2DL2A

Killer immunoglobulin receptor 2dl2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
197
structure length
197
Chain Sequence
AHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (MHC CLASS I NK CELL RECEPTOR PRECURSOR (P58 NATURAL
publication title Crystal structure of the HLA-Cw3 allotype-specific killer cell inhibitory receptor KIR2DL2
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dl2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dl2A01
2DIAA 3F7YA 4P59L 1HYRC 4HIEB 1WEJH 5AUMA 1O0VA 4F15C 5CGYC 1ED3A 3T2NH 4IMLA 3AREC 3QWOB 3P4NA 3KJ6L 3HZVB 5BOZG 2ICCA 5F7KC 1IGJB 2XG4A 2RCSH 4JZOA 3WBDA 3PWJA 4EI5A 3GSUB 4JFXB 1A2YB 1A22B 1TNNA 3OAZK 4WFFD 5LXGL 1QR1B 3ARGC 5CEZD 3QCUL 3RVVD 5DA0B 1Z0MA 2OJEA 3T2PA 1VADB 3U9PH 3ARZA 1BM3L 1S78D 1SYVA 3HE7B 1CL7L 5DC9B 3ZTNL 2VOTA 2I9TA 4S0SD 5FGCE 1HIML 5LVEA 4RAVB 5GGRA 3RUGB 5DHYA 3RBSA 2XWTB 5FXCH 1XF2B 1AY1H 3F12A 1R3IH 3FN0L 1W0WB 4K3JH 2LTQB 2Y9RT 4O02H 4OFKA 1EHAA 32C2A 1NKOA 2IQ9L 4OQ1A 4TSAH 3ROLA 3ULVH 1F4WL 1SJVA 5D71L 5F9JA 4S1QH 4H1LA 5GRJH 4TNWK 2CMRL 1D5ZB 1KCUL 2IALB 3QEHA 5ICXA 4J3VA 2MFNA 4F7EB 4MXWL 5A2IH 4OLYL 1UM5L 2O5YH 4B0MM 3ZYOA 4XGZB 4BELD 4D2NA 3VFPB 1ZGLP 1HQ4B 1ZEAH 2D4FA 4LPCA 2WBKA 3SDCA 1N4XH 3PG2A 3O0RH 4AK1A 3ZLQC 3UJTH 2GCYA 4MMZC 5CJ8A 2PW1A 3IJHB 2QL1A 4KUCD 3TGXA 2Y6SD 2EKJA 1NLDH 3OKNA 3RVUD 5C9KA 4ELMB 3CDFA 2D03L 2DI8A 1U92A 4U0RC 4G6JL 3MV8E 1F6FB 5C0IA 5KANI 3HC3H 1MJ8L 1LK2B 1K6QH 3JTSB 4QHNA 1E4XH 4HPOL 4FXGA 2NXYD 3ZKMC 1OAQL 1NMAH 1B4JL 3CSYB 1MWAH 5IIEB 1AQKL 1MY7A 3MBXH 2WBJC 1U0QA 4OCXL 4HLJA 3MLUH 1U8HB 4GBXC 4QOKE 2Q6WA 3P9LA 5FM5M 1MFDL 3C60B 2DBJA 4Y5YB 5T5FL 2JF1A 2X2YA 4AL8H 4LRIC 1J1PL 4U3XA 3TYGL 4YAQB 1IRAY 3FFCD 2DQHL 5GRZA 1RSFA 4FQLL 1JF1A 3VI4F 4CU8A 1OPGL 2DKSA 2FX7H 5IV2A 1CFBA 1MHCB 3PQYD 1MJ7H 3AXLA 1D5BB 3VXSD 4X6BA 3RGVC 1DQTA 4OCMC 3X14A 4L9LC 4P2QA 2NZIA 4KFZC 4YDVA 1JK8A 1D5MA 4XNZB 1BJ1J 3H3PL 4ZODA 1TJGH 4NGHH 2NCMA 4UNTA 2P8LA 5K9OA 3QDGE 4MA8H 5I66A 3S37L 2X4QA 1MH5B 3GRWL 5CJXA 4P5MA 1RURH 4U1KB 5E6IC 4LARL 3QNZB 4ODUB 3WHE1 4X6EA 3MV8A 1CS6A 1JGVL 3NFSL 4NKMA 4V1DB 1YJDC 1I7TA 2X40A 3WEXA 1E4WL 1LD9B 1X5YA 3RWHA 1BEYH 2O5XH 3DRTA 5FHAL 3MRPA 1BBDH 1IGTB 4MCYB 1WISA 5BZWB 3BDXA 5DI8B 1DQQA 4KV5E 1CYGA 1JP5A 3ETBF 5IJVB 1VGKA 4XPFL 1J9CT 1RJLA 4QXGL 3FO9A 3G5VB 3NN8B 2EE2A 1I3RB 4KKNA 4Y16B 1CLZH 2YD1A 3WCYA 3RGHA 4NRZA 5DYOB 1SM3L 4YC2C 3T8XB 4QOKA 4QY8A 4E41E 3PGFH 3OZ9L 4UOW0 2EDRA 1QLFB 1KENH 3P73A 3SKJL 1CXFA 5TF0A 2G2RB 2VLLA 2G75B 1OTUD 1VEPA 4XAKE 4JHZA 3ULUE 5E94B 3GJEA 1JE6A 1FC1A 1XGUB 4QRPB 4HUUA 1FCCA 4AT6B 3VD7A 2ICWB 3L3HB 3M17B 2R2EB 3EDKA 1G9NC 1EERB 2I27N 5GRWA 1GH7A 2ATPA 1U8MA 5HI4C 1IC4H 3O2DL 5LCVL 1FFQA 1QFOA 4LNRB 5E00B 3OB0K 3KVQA 4FNLH 2DQEH 1NCCH 1DE4A 2X89A 4FFVD 2J8UF 2ICES 3LKPB 1TDQA 2DQUH 3MNVA 1LO3H 1OTSD 1B90A 4KHTH 1JZ5A 3BIAX 4HFWB 5EZJA 5CEYA 2R2BB 3OKEA 3RQ3A 3NPZB 1QLRB 2YBRA 3TO2A 1HH6B 4R3SB 2GSIB 4R9HA 4KTEL 1P6AB 2C9AA 3N85H 4TRPH 2HP4A 2ESVD 4NFBA 1NCDL 4DKFH 2ZUXA 5IHLB 4S1DC 4FQCH 4R8WL 1JNLL 3V5HB 5BZDA 4MGXA 5C0CD 2NQCA 2XA8L 2H2PD 3NCYS 5KTEH 1JRHL 4OZHB 4OIIH 2NYYD 1DEEB 3MV9D 4JZNB 4NT6B 2X4TA 3QAZB 2DQDL 3VFOA 3VWJB 1FAIL 4M7ZB 3I02A 5I1EH 3C08L 3IYLW 4Y1AB 1F58H 3I9GL 3DETC 2J8UA 5DRXB 3BUTA 5IFAH 5ICYB 1S7VA 4YFLF 3QWQB 2JJUA 4NPYB 4XTRD 4YHYB 4ZNEE 1F3DJ 4KKAC 4NC1E 1U6AH 1N5YH 1KPRB 2NZ9C 4RGND 2BDNH 4A6YA 2BXYA 3RFZC 1AH1A 1MCIA 3MFFB 3CDCA 4Q9RH 3V5KB 4NN5B 4R6UA 1NCTA 5DJXB 2Q86B 5IR1B 2FB4H 43C9A 1LEIA 2VLRB 5AZ2L 4AM0A 1IQDA 5EOQH 5IEHA 2R0ZL 5EDXA 3PWUA 5C70A 4LCIL 5DMIL 4U2ZA 4PB0H 3UMTA 4G8FA 5DK0B 4LVHB 5FF6B 3O9WD 3WFZA 1V3JA 2A9ML 2X4OA 2GSGA 2WP3T 2NR6D 4HLZG 4X5XB 1N6QH 1JF6A 4GG8B 5T1DL 3CAFA 4C58B 3IT8D 5I15L 5JOFA 5IG7B 4I18A 3A6CH 4JGMA 4UIKL 1FFNA 5F93C 3D0LB 4YBLB 4Q9BA 2QHRH 2YA2A 3LZFH 4LRIA 1XCQA 4PRDA 2CUIA 5SWZD 4BSVA 1AXTL 5I9QB 3MUY1 4OFIA 1I8IA 4TUOB 1KGCE 3RRQA 4UINH 5BRZB 3IDJA 1CE1L 3MLXH 3P3YA 4OLUH 5ENWA 2EH7L 3QFDA 3LEYH 4KJYB 1ZGLM 3BISA 4ZNEA 1XH3B 4HT1L 3HB3C 3VFSB 3GI8L 3DMMA 5T1KA 3KWWA 3I50H 3WSQL 4HJJH 3JUZA 4LLUA 2NY1C 4QHKI 5I2IB 5HYJB 2PXYB 1YN7A 3MJ9L 3BZFB 4AIXA 3M1BA 4HIHB 4C57C 4ZYKA 2PTTB 4IOIA 4PJDB 5C6TL 1R5VA 5DD5H 4KK5C 2D7QA 4PB9H 1QQDB 2VQUA 1UWGH 4ZFZA 4Y4KA 1OAUH 3GMQB 2I07A 1Z9MA 4YK4B 3TPKA 4RAUA 3QIUB 1U8QA 1TETL 3VMPA 2XZCH 2J6EA 5F9AC 1BFOB 3MRDA 1YMMB 3RWFB 4M6AA 2FO4B 1A6TB 4LLVA 3VGGA 1LK3L 2F9BT 2XIDA 3MGOA 3O6MH 1L7TL 3B9KA 4Y19B 2P8PB 5ACLA 3HRPA 2CPCA 1EEZB 4WHDA 1NJ9A 4GAFB 2Q7YA 4WDIA 3CFDB 4X5WB 4TULH 2LVCA 1YMHA 3P9MB 5D72L 3LPWA 3CX5K 4KZEL 1WUNT 3QXUA 5I8CA 4OZIB 5IJKC 4FXLA 2R0WH 1T66C 2EDWA 5DEGB 5HHXH 5JORA 3B9VA 5L8LB 3MREA 4YBHA 4HDIA 3T09A 4IDLA 4XBEH 1CFNA 3PWNA 4J3OC 4HWBH 4PRHA 4ZUSA 4HXAH 3QA3A 5HVHC 4XCYB 5DF0A 2WBWB 1XGRA 3VJ6B 2Z4QB 4MAUL 4ZO7A 2Y36H 4OF7A 3U30B 4JFFE 4X7EC 4PTTA 4E42A 1PZ5B 5BOPA 1YEDB 2VLJD 2PYEB 4YFEA 1S9XB 4U1IB 3BGMA 1RZKL 1F4XL 1GGCL 4J4PC 2ZJSH 1TVBB 5J9PB 3KPSE 1ZLSL 5EBWB 2LAGB 4G7YH 5F7MC 4QTIH 4S0TD 1QZ1A 3FQWB 3OKKB 4LPVA 4KI5F 4YBQD 5LG1A 5ANMB 4P2CG 4WEMB 4OCYL 1WF5A 3T1WA 3FB8B 4OM0L 4WFEE 3BAEH 4QHLA 4Y5XA 1JNJA 4G9DB 1LWRA 1CG9B 3KJ6H 3CFEB 4PJIE 4QYOB 4GS7B 4WFGD 2H32A 5LXGH 4OUUB 4X99B 3NGBB 5IB1B 3BYTA 3ZDYE 3QCUH 2R1XB 1KJVA 5E9DB 1RZ8B 4KJPC 4UI2A 5AG8A 2FX8L 3NCMA 3JWDL 4LDEB 3OJVC 4JFFA 2VLMD 5KSAC 4JY6A 1AGDA 4JPKL 4YZFE 1CL7H 3ZTNH 3OJDB 3MRKB 3I75A 4PRIB 5CBAA 3GZKA 4N0FB 1IM3B 4NO0A 5JQ6L 5FK9B 1G7PA 3FN0H 2QADB 5FIEA 4JM4L 4LKCB 1B0RB 1T83C 2QSVA 1BZQK 2GJZB 4CVXA 2IQ9H 2BNQB 3QUXA 4HKBB 5GGUB 1MFBH 1F4WH 3ARED 5D71H 4ZUUA 2B4CC 1FYTD 4QRSB 1ZHLA 3MRBA 3ZKXB 2CMRH 1BJ8A 4JFOB 1KCUH 2VR5A 3FMGH 1OGTB 3MV7A 1UZ6F 3BP5B 3DBXA 4MXWH 3X12A 4OLYH 1UM5H 4LIQH 4YO0A 2ED7A 1T22A 2ADIA 3EZJB 1AR2A 1K9TA 3GI9L 3HC0B 4GQPH 4Q6IB 1MAJA 1FZKA 1M71B 3MJGX 3TBVA 2BNRE 4JFYA 1J18A 2CIKA 1RUKL 5L0QB 1M4KA 3R0NA 1CZ8L 2K7QA 5EU6D 4J3UA 2D03H 2GITB 4LCCB 3QJFB 1C5BL 5C0JB 4WTZA 4G6JH 3RIFK 2HVKB 3BZEB 1WVZA 5ABDE 1WITA 4QRQB 4G8GA 1MJ8H 1MCFA 3MRHA 1LO5A 4HPOH 5F71A 5EN2B 1MCWM 1OAQH 1B4JH 3BOVA 5K59F 2P24B 3TJHD 1AQKH 5DJ8B 3LH2L 3PP3K 4F7TB 4JG0L 2B20A 4XPTH 4OCXH 2X70A 3LSOA 3JWNC 4RFOL 5A43C 1NC2B 3MRIB 1BFVL 1MFDH 3ECBB 5T5FH 3DLQR 3V4PL 2F74B 2XICA 3X11B 3KYMB 5FEBA 3NIGF 2WNGA 4JO1L 4YPJA 4PJFB 5AAMA 3TYGH 1MJUL 1T2QL 3JXAA 3P0VL 1AKJB 1YEHH 4KC3B 1QSFA 3VXOB 3QSKB 1PGRB 4FQLH 4ZFGL 3EYFB 3HE6B 2DM2A 1OPGH 3C6LA 1F97A 1OAYL 2VLKD 4I2XB 4O2FA 1F8TL 4OD3L 3HZKA 4BKLB 3WNMA 4OD2B 4TVSa 3QFJB 1U91B 2DYPB 4DEPB 1VEMA 4ETQB 3LEXA 3WFDL 1KJMA 3KPPA 2E9BA 5DZLA 5KG9B 5D7LD 4LHUA 2OZ4L 3J8F7 2IH1A 3BT2L 1I1AB 2JELL 4FQQB 5DRNB 5E56A 2LAAA 5EC2B 3S37H 1T4KB 3D85A 3Q6FA 4OLEA 3GRWH 1MI5A 5EPMA 2WBJD 1MHHB 2UY6A 3LQAL 2MNUA 4D9QD 5EZLA 12E8L 5IB5B 2CKBA 4GBXD 1JGVH 1ND0A 3NFSH 4M6OL 4WU7B 2A6JB 1E4WH 1YYML 5A1AA 5FHAH 2RAMA 1N59B 2E7BA 5B38A 1G7JA 2HFGH 4A2LA 1RJYB 2VITB 3PHOA 4XPFH 5TDOA 4QXGH 2P48B 3HUJB 2VAAA 3BKCL 4JZJA 1CDCA 3RGVD 4J4PA 1S3KH 2F5BL 2DQTL 5KN5B 3OZ9H 1OW0C 3UROR 2QR0A 3D0VA 4PJBB 1ZHBA 4GRLC 3H3BC 3U0TA 3SKJH 5J4MA 4H5SA 4P4KC 1YDPB 1CFTB 4P3CL 1SQ2N 1X5JA 4WHYG 1I8KA 3C5ZC 4M43H 1TENA 4HX1A 2MHAA 5E6ID 1MVUA 2BRQA 4NBYB 5JA8B 5CEZL 1CFVL 2OR7A 4NKDB 4HK0B 3IS0X 3REWA 1AGEB 2YEZA 4RRPA 1XFPA 3PGDA 4M3JA 4NCDA 1EEQA 3O2DH 5LCVH 1NBZA 5HBBA 1ZVYA 2WW8A 1LO2L 3QO0A 5IEKB 1SJHA 1RHFA 5ETUA 1J86A 4MDJB 1MF2H 1KN2H 3PF2A 1X6LA 4JN2B 4Y5VC 5GZNC 1TIUA 2HJKB 4NZTH 5ESAA 2VDKL 2WIIB 2BCKB 5KZCD 5F6IC 3DYPA 4KTEH 3VFVA 4HIJB 5ID1A 3U2SA 5L2KD 1T83A 5CLTA 1BVKB 2A74B 5I17B 1NCDH 4CU7A 3F7VA 2A6KB 2VZ1A 2VMFA 4R8WH 1JNLH 2IBGA 3O4LE 1XGQA 5FM8A 1PLGL 5I71B 2ZG1A 2XA8H 2GTZB 1JRHH 2KBGA 5E8NB 5I76A 4IEFB 2DQDH 1FAIH 3BPNB 1HHIA 3C08H 3VWKB 3I9GH 5J13C 4OT1L 4NFCA 1GRWA 5CJOL 1PFCA 1EGJA 3PGCB 4WTWA 2VN4A 2YPKA 4OQTL 1KTKE 3MUHL 2AERT 2OM5A 3VXPB 4BH7B 4XCEB 1T03L 3RKDC 5IB2A 1TTGA 3SOBH 3KJ4C 2Y5TB 2PYFA 2UUDK 1OGAE 1RUML 2E7HA 5TDNA 4PR5B 5EO9B 2IQAB 3B6SB 4N0YH 2R0ZH 4KMQA 4JFED 2VWEE 5H2BB 3ARDC 4LCIH 5DMIH 2HN7A 4MD4A 4P46C 3FL7A 1LNUB 2A9MH 3VXME 2HJLB 2HRLA 1M6OA 4IRJC 1TMCB 3FONB 5T1DH 4FQPA 3KS0J 1D7FA 4LQ1A 5EBLA 3BH9B 2YRZA 2MPAL 3DETD 2OS7A 4WW2C 4BJLA 1ZA3A 3LAFA 4UIMB 4UIKH 1SJXA 4HGMA 1EV2E 3PJSB 4KKAD 5I1DB 1TCRB 3IXAB 1ZLWK 1ORSB 1FNEA 2NZ9D 5I6XB 1GXEA 5KVGL 1AXTH 2P45B 3W9EA 3DI2B 2EYSB 4W6XB 4ZTPL 3BD3A 4JFQA 4K3HA 1CE1H 4WUKL 3RWIA 2A73A 3I3DA 2EH7H 5D1ZC 1CN4A 1OD9A 4RWHA 4V2BA 1U3YA 4WGVB 2VJXA 3SCMC 4UOW1 2RHEA 3OKDB 1IGCL 4NC0B 4HT1H 2CIIA 3GI8H 4N0UA 4CUCA 3N06B 3MRJB 4OAWA 3PWPE 4MSWA 3WSQH 3BE1L 4QT5A 3MJ9H 3FFCB 1Y0LB 3MJ8B 4YHKH 1BF8A 3G04A 1EMTL 1A1OB 1EAPB 1FG9C 5C6TH 2XTJC 1BVLA 3PQYB 4B41A 5TH2A 5I73C 5DJZA 3VXSB 2IANA 4KKBC 3P77A 1GC1C 2IH3A 2EKSB 3NCEB 1TETH 1R3HB 1J8HB 1KTDB 2BVEA 4QHUA 4GW4B 1I8MA 5E4EC 3RWDA 4OF8A 1OARL 4QWWD 4JRYE 1P5VA 1LK3H 5I0DA 4HCRL 4L29A 3QDJE 1L7TH 1KJ2A 1ZHKA 5E2TL 3LRSA 1G84A 3GSOB 5I16A 5D72H 3C5ZA 2W0FB 4MB5A 4JDVA 2NY1D 1ZS8A 4KZEH 1EO8H 1A6ZB 3UBXA 4AY0A 3TFKC 4HIIA 2C5DC 5FYLE 5HJ3A 3V79C 4HMDA 4KQ4H 5FKPB 4RWYL 1R5WA 3IFOA 5I1CL 1CU4L 4MJ5B 2AK1L 4ZUTA 4KTDL 4KK5D 4HKXB 2JB6A 4BSJA 1UEYA 2V5YA 3QXAB 5E24E 4Q9QL 2FZ3B 1NUDA 2IPKB 2W9DL 5KVMC 3D2UA 3TT3L 3WNPA 4MAUH 3L3IA 2ZUUA 1F00I 1Q1JL 1YEIL 3TVMD 4FFWD 4XP4L 3SKNA 1F6AB 2BNUB 3F8UB 4XRCA 4CVUA 3WE6B 1G7IA 3HR5B 2ITCA 3S5LG 1A47A 1HILA 1IEAB 1YC8A 3ULSB 1RJZB 3ARFC 3FRPG 1T20A 1RZKH 1F4XH 1GGCH 2FH6A 1EBAA 5IESL 5F72S 4EN3A 3Q48A 3DOSA 3TA3C 2AV7A 2OTPA 1H5BA 5JPMA 1HWHB 5MEOB 1P7KB 1T66D 1AGBA 3WJLA 1MCWW 2X42A 1T6VN 3L3KB 3KGRA 5EC1B 4JRYA 1I1CA 2WWMD 3FO2B 4X4ME 1E4KC 4MJIE 4OCYH 5ELIA 4D9RE 5CIPA 3G5XB 5C08A 3F5WA 4OM0H 1OP3K 3BPLC 3ZDXE 2EE9A 1ZWIA 4Q74A 1QBBA 5GQBA 4PG9B 4ZQKB 5J12B 1P69B 2XWBA 3BEVA 2DMKA 4P3DA 4WY7H 2V9QA 3QT2A 4GKSB 1ONQB 2BK8A 5IVNA 1P6FA 5DQJB 3FT2A 1HSBA 1R24A 1JZ2A 1G6RL 1VFBB 1KUMA 2ESVB 4XNQB 4GSDL 1U41A 1KSRA 5ISZD 3T0EE 2FX8H 5AZEL 1R3JB 2A0LC 5H37G 1B0GA 4R4ND 3JWDH 4UDUA 1EZVX 4UTBL 1D9KC 4JPKH 2ITDA 3WLBB 5C0CB 3L3DA 4G9FD 3JSSA 3G9AB 4JPVL 3U9UB 1YN6A 5JQ6H 1XGTB 4KJQD 3MV9B 5F7NC 3HPJA 5D6CA 4JM4H 4WNQB 2P7TB 1UXSB 1SBSL 2NY3D 1OB1B 5GRXG 4I0PC 4P46A 4WV1A 3GSQA 1AGFB 4W68A 2DIBA 4IRJA 5LGHL 1VESA 3FQRB 4RGNB 4NQCA 2RB8A 3X3GL 2IAMA 2YPLB 4NO3B 4RIRB 4V2CB 4X4MA 3IFLH 4MJIA 4RBPH 3QH3A 2FCBA 3THMH 4KJPD 3NIFE 1JMZA 4RMTA 3L6FB 1WGOA 3MFGB 1IM9A 2NY7L 4MJ4A 4KWUA 4F9PA 5MERA 4KRPD 5KSAD 1G6RB 3O9WB 3OKLA 4YDLB 4L4VD 3VFWA 1U58A 3KYOB 3EO0A 1J5OL 5D1ZA 3E2HB 1QSED 3SCMA 1RUKH 3GMPA 1CZ8H 1T89A 1C5BH 5IMMB 3QPXL 5C07E 3T0EA 1CQYA 1VKXB 5HHPA 4LDLB 5JO5A 1ZGLA 3EJYC 5DJDA 4G3YL 3ULUC 5SWZB 3SDXE 4JKKA 1JGLL 4TPRL 5DS8A 4KMLB 2FHFA 2VDQL 1ACYH 3LPGA 3G6JE 3LH2H 3IKKA 5MHSE 5HHNA 3WMSA 4JG0H 3F58L 4W70A 2FECL 1DBAL 2DI7A 4U1HA 3MCLL 4RFOH 2AW2A 5EOCL 1BFVH 3MO1B 3ULVF 1LGVA 3CUPA 3V4PH 1U8LB 1FVEB 5DMKA 4Z7QE 3BFOA 4LOUC 1VACA 4JO1H 3NACL 1G1YA 3TIDA 5KSBE 3OAYK 4JDZA 3IRPX 2V9TA 4ZFGH 4HV8B 3NFPB 4R0LC 1OAYH 1YC7A 1F8TH 3H2WA 4OD3H 2UVFA 4PJ8C 3H9ZA 1SYSA 1QTYT 4ISVA 3O3BA 4OF3A 3WFDH 4ZFOA 3MOBL 2O93L 2V2TB 5IOPB 3OKMB 2OZ4H 4U1LA 1Y18B 4MZ3A 3BT2H 4X6FA 4DZ8A 2JELH 3GM8A 5D5MF 3IB4A 3GSRA 5GIRB 3N1FC 1K4CA 3TCXA 4DGIH 3O6LH 4M7JL 1DUYA 3OXSB 4OI8A 12E8H 4G43B 4GMSL 1YQ2A 4Q9CA 4NQDE 2HKHL 1HHKB 1O5DT 4M6OH 1WJ3A 1MRCL 3KPOB 1YYMH 5E0QA 4U2YA 1T0MB 4Z5RA 4QTHA 2XY2A 3HFML 3KDMB 4AH2B 4TSBL 1S9WA 1EH9A 3RIAF 2RGSA 1U9KA 5JW4M 4LQFL 3CX5J 3BKCH 3ARFA 1J05A 1VGEL 2D9QB 3RX8A 4GRMB 1NFIB 2J8HA 2EEDA 5DQ9A 2DQTH 5K9QG 4WCYH 5F88B 3T3MF 3MRNB 4UILL 4HKZB 1HHJA 4RMVA 5D4QA 3NZHL 1UVQB 3BIKB 3QULB 5HDQH 1IC5H 3VXTB 3BGFB 1PZUB 4XP1L 3H6JA 3ILQD 3LKRB 1MCHA 3VRIA 3U7WH 3WS6C 2OQJA 5D5MA 4ERSL 4K3DL 4OZ4B 3DX7B 5B21A 5F8QC 1JF1B 5CEZH 4C56D 3INUH 1CFVH 2VLJB 1WTLA 4XVSL 1GGIL 4PJ7E 3DTXB 2Z92A 3AXLB 4M7LT 3BEWB 1FIGH 2OMBA 3S96A 4WRLA 5D7IF 3TC9A 3NTCL 3FTGB 4HUKB 4ZSOE 3I6LD 1V05A 3TF7C 3BQUA 4AEIL 1ITBB 1S7RB 5K33A 4WUUD 3RL1B 3ARBA 5C0FB 2HTLC 1A6WL 1LO2H 4PJ7F 1MWAA 3QIWA 4KGLA 5LGJB 4GKZB 4RISL 2F5AL 5JXED 3UTZB 5DZOA 1TVHA 4GRLD 4WI3A 1BGXL 4NKMB 3GHEL 4P4KD 2J4WH 2WWKO 3CFBB 4PLKC 1D9KA 4XPGL 4RZCB 5EFIA 2GAZB 1I7TB 3O11B 2I25N 5D2LB 1OTTC 3CMGA 4HLZH 5HGHA 3HR6A 3RZCC 3MRPB 4OFDA 3OX8A 4O2CB 1KV3A 2VDKH 3OXRA 4ZOEA 4QHKJ 4XI5C 2JLLA 1S9VB 1RU9L 3U4BL 4IOSD 2DLEA 1U8NA 3DXAE 1EZVY 5GJSL 1WQVT 1FBIL 2DQIL 2R2HB 1A14L 2OR8A 3FQNA 3D3VA 4HMEA 1RK0A 2IBBA 4U1NA 2JCCF 2R29L 1AGCB 2WZPD 5D7IA 3MJ7A 4MHHG 3PP3H 4XHJC 1PLGH 2XNAA 1Z9SA 1DDHA 2BHZA 4JY4A 4M8QB 4HUVA 4K94C 2W65B 3W0WE 5TE6L 4X7FC 1NGXA 5L6YL 3WNLA 4R7NA 4G80A 4PJ7A 5C0AE 4OT1H 5I8KL 2VL4A 4QRRE 4NQEA 2EO9A 1B6DA 2H26B 5GZND 4F15B 4L1HA 4OQTH 5A2LH 5DD3H 3TPUB 2HH0L 2DL9A 2ATPB 2XWJA 3AREB 5BS0E 4DOHB 3WIFB 1T03H 1YY8B 1FYTB 4PGCB 4D0DB 1EEYB 1YNKL 2E7LC 3LCYA 2P5ED 4KVCH 2IGFL 3QEQE 3E6HB 4WIQA 2ZKHL 4L3EA 5DDHA 4HIXL 3VXNB 2YA1A 2Y4SA 3ARGB 4ONHA 3Q2CA 1BWMA 3O6FA 3BW9A 2XI9A 3C5SB 5DUPH 1MCCA 2JCCA 4NSKB 1MCQA 4ACPA 5TE4L 3GMRB 5HDLA 2R15A 3S6CA 3TP4A 2XXCB 3SDDA 4UBDC 1FLRL 5T1LD 4MNQA 4GG6E 2VH5L 1DZBA 2VDOH 5EO1A 1OL0A 3DXAA 1S7UB 2MPAH 3V5DA 3S37X 2BSTA 5E1AB 4RSVA 2GJ6A 4PRNB 5EU6B 2E9IA 5D6DC 3UTSA 3O2WL 3O2VH 3Q3GB 1UYWL 3BO8A 1MLBB 4P4RA 3H7BB 5KVGH 4NNYA 2E7MA 3P4OB 3RKDD 1VHPA 4ZTPH 3RWEB 1OWWA 3V6OE 3K1KC 1C08B 5B3JF 3QRFM 4WUKH 3GKZA 2ZG2A 1V7ML 3MUZ1 4JFDA 5LAXB 3MRCA 1JPGA 3I02B 4IM8A 1IGCH 3ARDD 3A6OA 1N0XL 4N1EA 1PQZA 1UWXH 4H25B 1CGSL 2YD5A 5JTWA 2ZOLA 2QLVB 5IVXF 1BOGA 1BHGA 2P1YA 3SY0A 3PHQA 5SV4A 3BE1H 2F53D 3QEQA 4L8SB 3DO7B 1BQHG 2LTQC 3S35L 2Q3AA 1X44A 1EMTH 3KPNA 2VLKB 4U0RB 2BVTA 1LEIB 2M1KA 4AM0B 3KHOA 4Q58C 4CW1A 4YDJA 5D7LB 2B0SH 2H3NA 3UC0L 5KBNC 4L8DA 4GG6A 2EDTA 2X4OB 43CAA 2XT1B 4MCZA 4PLJC 1PEWA 4I3GA 1OARH 2P5WE 5D1XA 4B7LA 2WBJB 1YJDL 1CWVA 5IQ9A 4HCRH 2APVA 5F3HA 5E2TH 2J7LA 4GBXB 3V0AC 2FEEL 5HYSG 3MC0A 4K3EL 4JVPA 5INDB 4M6ML 3H8NA 3BWAA 1TNMA 3SJVA 5IVXA 4HD9A 4LLDB 1A9BB 3MNWA 3GBLA 3BWUC 2DKMA 3K8KA 1P84K 3GIZL 4RWYH 4HEME 5H94A 5I1CH 1CU4H 2JIXA 1KIRA 3BJ91 1KIPB 2XTJD 5ENWB 2AK1H 1N5AB 3D39E 5DHVB 3RGVB 3KPRA 3LS5L 4Q9QH 1WZ1L 3GGWA 3S5LB 5A2JH 1U8PA 4BFIB 5JHDD 2W9DH 4LBEB 4GMTL 4L9LB 2CLZA 2GYSA 2Y7QB 4UDTB 4GW1B 1DBKH 1Q1JH 2VXQL 1X5GA 4PYHA 5T1KB 1KPVB 5BCAA 1IGYB 4LSQL 5FOBA 2DJ4A 4YQXL 1FN4B 2Z31C 1NUFA 4M1CC 5E6IB 3QHTC 4ZO6A 4NRYB 2HFFB 4ALAL 4NNPL 4RX4A 2E7CA 4Y88A 1SMAA 2EDJA 4L4TE 4D8PA 1FNGB 1I1FB 1T2JA 5IWLC 2YUXA 5IESH 1NEZG 2OLDA 3ELAT 5B3NA 4GKOA 3RZCA 2UUDH 3TFKD 4PG2C 5T3XD 3VFRB 3IKCA 3GIVB 1SEBB 2P5WA 1OF2A 4YDIH 4JHWL 2EC9U 4UUJA 1MFAL 4JRXA 4YC2B 2X1XR 3AS0A 1FGVL 5E5MA 4OCRL 1TQCC 3MGOB 1H3PL 1WT5A 4PJAF 3U4EB 1X9QA 1YQVL 2FLBT 3L9RB 1G9MH 5DEZA 3QXTA 2XG5A 3ALPA 2PNDA 4NKIL 1D5XA 4LPTA 4NQVA 1BREA 5J6GA 3ZSTA 2DQFB 1ETZA 1T3FA 4N9GB 5DRWB 1A3RH 5KZCB 3MRFA 2DJSA 5L2KB 2A83B 1G6RH 4F7PA 1DVFC 4OLXL 1RIVL 3LN5B 4GSDH 4R90L 5F1NB 3TA3D 1I7ZA 4TYUA 1ZT1A 5EU3A 4M93B 1F2QA 1M05B 3RTQC 1HOCB 4UTBH 1R5IB 2C1OA 2Y72A 4Z7UB 2Y5EA 3LQZB 1ZA6A 3FO0L 1OD7A 4JAMB 1FFOA 2CO7B 3IU3B 2CLVA 3IDGA 4X0KA 1RJCA 4L4TA 1SBSH 4XP9L 5FCUL 2R1WA 4DN3L 4FQIL 4LSUL 4HPYL 3MCG1 5FAAA 5LGHH 1EJ6A 5SWSD 3RUGF 1CGXA 3P9WB 2FGWL 2YD6A 3X3GH 4B53A 1CLOL 3IDMB 4QOKD 1H8SA 1SBBA 2H9GA 3ISWA 2OYPA 3ZE0E 3FCTA 4Z95L 4HIEA 2RQ8A 2A0LD 1Q0YL 1AQDB 4NM4L 3T0VA 3QWOA 2HFEA 2NY7H 4HWBA 4JFEB 2ADGB 3HZVA 4XC1L 3PWVB 3RL2B 2W07A 2ZG3A 2GY5A 5JW4R 3GSUA 1T21B 1FH5L 1RULL 2J1KA 1A2YA 1J5OH 3LMJL 1QR1A 2DLTA 1ZANL 5FO7B 4IBLT 1NAML 1OAZH 1PYWB 3QCTH 4XMKH 5DFWH 2OXGA 3UTPD 3CXDL 4I0PD 5FB8B 2A38A 3QPXH 2ENYA 3QDGD 4LHQB 4U31A 1VADA 5CZKA 4WI9A 3RY6C 4ZXBD 3OF6A 4HJGA 1CDBA 4XWOC 2FD6L 4G7VL 4RAVA 3RUGA 3TZVC 1JGLH 1HCFX 4TPRH 2F19L 2XWTA 1XF2A 1RHHB 3ZE1E 4EBQL 4JPIB 3SGEI 4ELMF 1AGDB 2MOVA 1W0WA 5CSGA 2VDQH 3UTQB 1JZ7A 1MCDA 2HLAB 1H0DB 4HS3B 1YNLL 4ORGB 3SGJC 3PUCA 3F58H 4GXUN 4I1NB 4LIQE 1L6XA 2DB8A 1DBAH 2NLJB 4U6VL 5HGDB 3MCLH 5EOCH 4NUJA 4P48A 4JJ5B 3ZHLA 3T0AA 3ORJA 2IALA 4WHYH 3ZE1F 1UCBL 2R8SH 3NACH 4WENB 2WK2A 4F7EA 3TO4D 3S9DB 4M7ZC 1N7ML 4E41D 5GRYA 4ZAKC 4XGZA 5FGBA 5KSVB 2D0HA 2IWGA 1GIGL 3VFPA 1HQ4A 1KTLB 5EORL 1UKQA 4OFYA 4PBVC 3ILPB 1VFAB 1NAMB 3ZT7A 5E8OB 3MOBH 3EJYD 4PTUB 1LEKB 4XAKD 3ULUD 2Q1EA 3IJHA 1DBBL 2BSRB 4OB5H 4RCAA 5JPNB 3QCVL 5CJQL 1FZKB 1OP3H 3BKYL 1REIA 1UB6B 4NN5C 4ELMA 2X1QA 4M7JH 2CIKB 3W9DB 3MYJA 4GLRH 2NY5C 1KLUB 4GMSH 2GTWA 1LK2A 3JTSA 2HKHH 1OAKL 4FABH 1MRCH 1KC5L 5K9JL 4LOUD 3HFMH 3BKML 4J2XA 3CSYA 4N1CA 2NY1B 5IIEA 2AJXH 4TSBH 3TLRA 1MUJB 3RAJL 1NDGB 4PJHE 4KJWD 1CGVA 4DKDC 4LQFH 1ZT7B 1U8HA 3O8XD 4PJ8D 1VGEH 5IWLA 1LDSA 1R6VA 3C60A 4Y5YA 2EXYC 1PX3A 2X4RB 4UILH 4Z7OF 5I9QC 4YAQA 4XP1H 2GK0B 1CGYA 3U46B 3RPKA 2D3VA 3TVMB 4ERSH 4K3DH 1IEBB 3MLWL 1MHCA 5CZXC 4CNIB 4QRPE 4CN1A 5CP3H 4OLWL 2PF6A 4XVSH 5LJYH 1GGIH 1LO4L 4NHUB 3SPVB 5FKAB 4QGTA 3QI9C 3NTCH 1M7DB 3B83A 2BOBB 4AEIH 3BP6B 1MH5A 5E7FA 4PJXB 4U1KA 4K07A 3UO1H 1UQSB 3QNZA 4RA3A 4U6XB 2VN7A 1RY7B 2YD8A 4G5ZL 1CDHA 4V1DA 4XMPL 5EPMB 5C09D 4RISH 1QEWB 1AP2B 2F5AH 1LD9A 4AG4L 3QWRA 1GHFL 1BGXH 1IGTA 3GHEH 4MCYA 3P0GB 5BZWA 3DX8B 4YK4C 2DLFL 4XPGH 5DI8A 3KPMA 5IJVA 2ED8A 4NKQB 4GH7B 1Z2KA 1FDLH 8FABB 3G5VA 3NN8A 4Y16A 1I3RA 1KXTB 4E5XB 5DYOA 2ZNWA 1RU9H 3U4BH 3T8XA 4H88H 3SDYL 2AVGA 1IQWH 2BVQB 3V7AG 1QLFA 2EDYA 1FBIH 4KXZI 3LN4B 4NRXB 2JJTC 2DDQL 2G2RA 3T77A 2G75A 1JWMB 2PO6D 5ISZB 1T7WA 2HAZA 5E94A 2OTUB 1XGUA 2HTLD 3UTOA 3ZE2F 4QRPA 1BZ9B 3U7YL 3WIIL 4AT6A 4G9FB 2ICWA 3GRWA 2XZZA 3ES6B 3L3HA 5L6YH 3M17A 4KAQL 6CGTA 5IVZB 2R2EA 5I8KH 4TNWF 1CCZA 1TLKA 2B4CL 4GXVL 1M7IB 1KGCD 4PLKD 5BVPL 5IHZB 1HEZB 2NY3B 4OZHF 4LNRA 4NWTL 5E00A 3K80A 1K8IA 3U30C 1MFEL 2HH0H 3RNKB 3CZFB 4LSRL 3QNXB 3PGDB 1A3QA 5E08L 4PJGB 2JTDA 2YSSB 1YNKH 2O61B 1F90L 2GUOB 5CLWA 3LKPA 2IGFH 3S88L 2ZKHH 4Y8AA 1C5DB 4HIXH 4W6YB 4BUHA 3LY6A 2YD3A 1UJ3C 4HFWA 1MIML 5KVEL 4PGEA 3RY6A 2R2BA 2Q3ZA 1BX2B 3NOIA 2C4FT 4XHJD 1QLRA 3LPFA 4KRPB 4M61A 5TE4H 1HH6A 4R3SA 5KSAB 2GSIA 4LHJB 3X3FL 2EDKA 2AK4D 3EDEA 1JHLL 4DKAA 4NJ9L 4MAYC 2VH5H 4L4VB 5CJ5A 1K2DB 2EH8L 5DR5L 1QSEB 5EZOL 1FZJB 2EDOA 3HHRB 3HCVA 1YZZA 5EUOB 3V5HA 3O2WH 4Y4FD 1UYWH 2Y07L 3TEUA 3JV4B 3D25B 4OZHA 5CEXB 1DEEA 3MRQB 4JZNA 4NT6A 4ENEC 5BRZE 3VWJA 3O2DA 4ELKB 1IC7L 2P49B 1IFHL 3IJSB 3L3OB 4OZGB 4Y1AA 5DRXA 4APQC 1BZ7B 1PX4A 5ICYA 1V7MH 5MEQB 1PBYA 1JHTB 4NPYA 3NGBC 1G0XA 1JYXA 3WFCH 1KPRA 1BQHB 2XZAL 1HI6B 5DC0A 1N0XH 5F21B 3MX0A 2PR4L 4KI1A 1CGSH 3MFFA 4ZOCA 3V5KA 3GSNL 4UBDD 5BW7A 3Q1SL 5DJXA 5IR1A 4GRWB 3N1PC 1I3VA 2VLRA 5DHVH 4OKVB 3BSZL 4PJDE 1QUNA 4U6HB 3G5YB 1IAII 1NFKA 4MDIB 4JO2L 5DK0A 5FF6A 1UCTA 4ZOBA 1K5NB 4X5XA 1FIEA 4GG8A 4I9WE 3B2VL 1LP9B 3D48R 5HYSB 3ZKXC 3UC0H 3C2SA 4JANB 5IG7A 1YECL 4PJDF 2WLYA 4HWZB 3C09C 1PG7X 2AJYL 3ESVF 3KPSD 3D0LA 1BJMA 1YJDH 4Y19E 2BERA 1KB5L 3U82B 3IAGC 5F7UA 2F54D 4ZS6C 1FVDB 5E8DL 2NY2D 4TUOA 4MXVF 3FB6A 4M6MH 5BRZA 5FDWB 4P5TC 2JKXA 4P2OC 2EC8A 2BSSB 5ERWB 4PY7B 1QVOB 5TFSL 4WFED 3GSNB 2FYYB 1QPPA 1KACB 2VZOA 4JRWA 4KJYA 4WI6A 5AAWA 1F02I 1XH3A 4BQ9A 1Z5LB 4DFIA 1FE8L 3VFSA 1RZIB 1INEL 2XN9E 3K74B 4K23L 4RA0C 4W4OC 4WO4C 3LS5H 1WZ1H 3P0YL 4M4RA 5H37H 4OZIF 4GMTH 1JI1A 5I2IA 1BFSA 1EXUB 2PN5A 5HYJA 2PXYA 1NEZB 2VXQH 1MLCB 4X5LA 3BZFA 1DJSA 4EOWH 3B9DA 3CPLB 2HT2C 4PLJD 4HIHA 4LSQH 4YQXH 4CDHA 2PTTA 4FG6C 3WYRA 3SDAD 2PYEE 4PJDA 3MRRB 1JV5B 4PREB 4F7MB 5EU7E 1KEGL 1JTTA 1RVFH 4LSVL 1QQDA 4ALAH 2FLRT 4NNPH 4DCQB 4C56B 1BF2A 3GMQA 1E4XI 1WFNA 1N3NB 4NO2B 3L5JA 4LAQL 3QIUA 1KB5B 1LE5B 4FFYL 2IANB 1BFOA 3NCFB 4ODSL 1YMMA 3RWFA 2FO4A 1A6TA 2BMKB 4PJCB 4TOYL 4UV7L 3WNOA 4JHWH 5ANME 4WUUB 3IF1A 4Y19A 2P8PA 4MVBC 1EEZA 3RVWC 3CFDA 4X5WA 1MFAH 3RNQB 4DEPC 4G6ML 4ZDHB 4R97C 3P9MA 1FGVH 4OCRH 1A7QL 1H3PH 4MD0B 2NW2B 4UTAL 1YQVH 2DI9A 4GRLB 5IGXL 1PJ9A 4UT6L 4OZIA 2M2DA 1FYHB 4LPXA 4P4KB 1I1AC 2WQ8A 4CAGA 1PG7W 5DEGA 3Q5OA 2Z31D 3CDYA 3HKFA 4HIIB 5DD1H 3MJ9A 1BECA 4DW2H 1P7QD 4HZLB 4C59B 5E9DE 2FSEB 5C0RL 4OLXH 1RIVH 4XCYA 2AJVL 4ODXB 2BNRD 3VJ6A 2Z4QA 4Z9KB 1C12B 2APTA 3QDME 3LKSB 3QDAA 5TPWL 4LFHD 2FHBA 1PZ5A 4PRIE 3VGDA 1YEDA 3MRGB 2PYEA 3EOAB 3AUVA 2C3XA 2ZUVA 1S9XA 4U1IA 4YXKL 3DJ9A 3EDDA 5DJ6B 1LE9B 1N64H 5J9PA 5EBWA 4XP9H 4DN3H 4FQIH 5ALCH 4LSUH 1KFAL 2LU7A 4HPYH 3T0XA 3U1SL 4Y5VB 3FQWA 3OKKA 1Q9OB 1A6AB 1A6UL 3GSXB 2CK2A 1LHZA 1R3KB 1IAKB 3GSVB 2FGWH 3BKJH 4D3CH 5ANMA 5HHOE 4JM2D 2FRGP 5F6IB 1CLOH 3LN9A 2CKNA 3HTLX 5HHMD 3FB8A 4JFPB 2P5EB 3PE9A 1DVFD 4Z95H 4KKLD 4EQ3A 4LCUB 4MB3A 3LQAC 2X5PA 4G9DA 1NH6A 2PKDA 1KULA 1CG9A 2MQCA 1Q0YH 4NM4H 5C08B 5HDBE 1WFTA 3RTQD 3CFEA 9CGTA 4XC1H 2KPNA 5F7FA 3KAAA 2X1PA 4KGJA 4XPHL 3I3BA 5SX5H 2VC2L 3QXDB 1FH5H 1RULH 4QYOA 5C0GB 3U0PB 1JZ8A 1NFDB 4OTXL 1ZANH 4OUUA 4X99A 1X7QA 5T1LB 1NANI 1K85A 5FUCE 5IB1A 1NAMH 2VXSH 3B9EA 2R1XA 5E9DA 5J13B 1RZ8A 5JLZB 3C9NB 1ODAA 3IFPB 3CXDH 3BVNB 1Z0NA 3EYSL 2JB5L 4DUVA 1P9MC 3OJDA 3MRKA 4PRIA 4YLQT 2BVOA 2FD6H 4G7VH 4N0FA 1IM3A 5HYQB 5FK9A 2L0DA 1QRKA 2F19H 3A67L 4JY5L 4EBQH 2B2XL 3KJ4B 4LKCA 1B0RA 2VE6B 2AV1B 3JBG7 4IHOB 2GJZA 1B3JA 1YYLL 2BNQA 1YNLH 2MSPA 5D6CB 4HKBA 4HS8H 5GGUA 3PDOB 4U6VH 1DBJL 4F57H 4QRSA 3ARDB 1XR9B 5E95B 5FYJE 3R8BB 1EEUA 1N0LA 4PJFE 4JFOA 4OIAA 4PRAB 4GQ9L 2IBZX 1OSPL 3WV0A 1S78C 4BK4A 1JFQL 3V0WL 5I1IH 1N7MH 5FUZL 2F53B 4WW2B 1GIGH 3QFJE 1IZJA 4TUKL 5TQ0L 3HC0A 5KS9E 3DVGB 2QTEA 1GC1L 4OM1L 4UQ2B 4Q6IA 4PJFF 1MQ8A 3NCCB 3TBWB 4XNXL 4NP4L 3TZVD 1S5HB 4HC1L 4WFHE 5E6YA 1DBBH 5ITFB 3QCVH 5CJQH 3BKYH 1CIUA 2GITA 4LCCA 3UEZA 3QP3A 5C0JA 4W4OA 1A7RL 3BZEA 3SCMB 2GY7B 1RMFL 2R4SL 4QCIB 1OAKH 1KC5H 5EN2A 5K9JH 4Q2ZB 5T3XL 5D2NB 4PRPE 1UA6L 3BKMH 2D31B 1IT9L 4YHNB 1T0PB 2AQ1A 2P24A 2LU3A 2XOTA 4MWFB 5DJ8A 4ZAKD 4I5BA 4F7TA 4EUPG 3JVGC 3UAJC 1X5ZA 3F7PC 3C8DA 1OM3L 3RJDA 1NC2A 3MRIA 3RWCB 2XTJB 1CF8L 4PJBE 2VDNL 25C8L 5I73B 2F74A 3X11A 3KYMA 4NQSB 1AO7E 3UYRL 5I6XC 1V5JA 1P84J 5C2UB 4PJFA 1HQRB 2NX5E 5JHDB 2VERN 3VXOA 1JL8A 5GS3A 3HUJF 3HE6A 1X5FA 2NXYC 5MP6L 2X6MA 3MLVH 4I2XA 3MLWH 4X8JB 4BKLA 5E4EB 3EDJA 3VGAB 3QFJA 1U91A 1NCAL 2DYPA 4OLWH 2ERJC 5KG9A 3O4LD 1LO4H 3HRZB 4JFHE 4XCFH 5DMYA 4Z7VE 4K55A 4X6DB 1I1AA 1ZV5A 2MWCA 4FQQA 4L9DA 3RWGB 5DRNA 5I30L 1JTOA 5EC2A 5FGCB 1T4KA 2V7HB 4FTVE 5JDSA 1MHHA 4LMQE 5DVNA 2UZYB 4X6FB 3DV4B 3DHMA 5IB5A 3OQ3B 2I24N 3T0WA 3HS0B 2Y25A 4G5ZH 4XMPH 4WU7A 3QHFL 2A6JA 4FP8L 2EXYD 4AG4H 1DL7H 1NSNH 2AXHA 2ICEB 1HN1A 5J7CC 2AQ2A 1GHFH 3SE8L 1N59A 2C7UA 5F1IB 1RV6X 5I1KL 1X5IA 2JK5B 4BUGA 1JNHB 1JUFB 1A4JB 5TQ2L 1A0QL 1S7XB 1RJYA 3R8QA 2VITA 4EXPX 1OGAD 4LSDA 2EDDA 3ME0A 3HUJA 4DGYH 1HXMB 5CZXD 2H6PB 4JREC 3SDYH 5KN5A 4WFFE 1KNOB 5HYIA 4Y2DC 3H9SE 3HI1B 5FO8B 3VXMD 3QB7C 3QI9D 1WLHA 1YDPA 2GT9B 1CFTA 1E6JL 3B3IB 2DDQH 2XQYK 3TA3B 2OZ4A 2HVJB 4MA3B 1GZQB 3L3GB 4NFDA 2D7TL 2CLRB 5F6HJ 1HDMB 5FYKH 3U7YH 3WIIH 4JQVA 4GOSA 1AC0A 4NKDA 4HK0A 4KAQH 1AGEA 5MEND 3C6SB 4LPWA 4YHOL 4OBRA 5D93B 1R3LA 2B4CH 5GHWL 4FQ2H 4OGYH 3BPLB 1JGUL 1SEQH 4LFHG 1FO0L 3RU8L 1DN0A 2LQRA 1D5IL 2OCFD 3JV0A 1MFEH 4L4JA 4LSRH 1G7HB 5SWSB 5J56B 2ZNXA 2VDML 3BJLA 5IEKA 5E08H 1OTUC 2W9LA 2NMSA 1F90H 4NQTA 4MDJA 4LNVA 3TNMB 5JW5B 3S88H 2E9JA 1HNFA 3QUYC 4OSUL 4RDQG 4ZPVB 4Z7NE 4JN2A 3PWPD 1MIMH 5KVEH 5E8PB 1A3LL 4JKPL 1TVHB 5CKAA 4D9LL 4NM8L 2CRIA 3WS3B 4N8VG 4GRWH 3BH8B 3GMNA 2WIIA 3P30L 4KY1L 2WP3O 3SKOB 4UZGA 3HI6H 2GFBB 1JHLH 4NJ9H 1WBYB 1AI1L 3BMVA 4R2GD 4BSWB 4Z7NF 4K8RC 5I17A 5GS1C 4FFVC 2EH8H 3FQTB 5DR5H 2R69L 3QYCA 5BVJB 4LSPL 4EN3D 2RFXB 2A6KA 4IDJL 1OTSC 3ULUL 1JPST 2HYMA 4I0PB 3IRZA 1A64A 2Y07H 3QDGB 2GTZA 3D3VB 5E8NA 4K7PL 3SKUD 5I0ZA 3V52L 5GJTL 5IB3B 4QXTB 1FO0B 4KUCF 4LSTL 1IC7H 1IFHH 3QDJD 1P2CA 2WUCL 4JY4B 5KJRL 3KNBB 3PGCA 1FSKC 2IBZY 3WFBL 2XZAH 1KXVC 3VXPA 1E0OB 4BH7A 4TNVF 4XCEA 5DJAB 2PR4H 1BD2D 2BZDA 4KK8C 2AGJL 3GSNH 3Q1SH 5D7SL 2Y5TA 1SJEB 4MAYD 1JF5A 3AFLA 4DKEL 2ZUWA 1XIWD 4PR5A 5EO9A 2B5IC 4ODTH 2IQAA 3B6SA 3SE9L 3BSZH 4E41B 5TGBB 5H2BA 3F6IA 5IW1B 3EYOB 3P4MB 1UM4L 2A6DB 3VH8G 4JO2H 4RMRA 1LNUA 4L5FL 4NC2B 2HJLA 3FONA 3HG1E 4ENED 1J8HE 4JQIL 3B2VH 1WBXA 3SBWA 3QDHA 3BH9A 3RI5F 4APQD 1YECH 1I9RL 4UIMA 1KTRL 2AJYH 4U6YB 3PJSA 4RAHA 1TCRA 3CD4A 3IXAA 5F96L 1KB5H 5ACMA 1ORSA 1YEJL 2G5BB 3DUHA 4WTXA 3V4UL 2GJ6B 2O26U 1INDH 5CD3B 2EYSA 5E8DH 1CBVL 1JGEB 3R06B 5GSRB 4OQTA 1JZ4A 1Q9KB 4M5YL 2NR6C 1AJ7H 1QNZL 3E2HC 5TFSH 2CXGA 3VFMB 3VI3E 2YD4A 5D8JL 4R0LB 3OKDA 2AJ3B 3S8WA 1FE8H 1CDUA 3O8XB 1INEH 4PJ8B 1P7HL 5M94B 3MRJA 4Z78B 3P0YH 3SKMB 2NY4D 3WKMH 3FFCA 2ZOLB 1Y0LA 2XV6B 5IP4A 3MJ8A 3PABB 1KB9K 2GW5A 1RUPH 3E0GA 1A1OA 1EAPA 4PJEE 2Y23A 3PQYA 1T1YB 1YPZE 4LSVH 3VXSA 5MEPB 4ZS6D 4N0RA 1BIIB 4XH2B 3LV3B 2UZXB 4LAQH 2EKSA 3CU1A 1NC4D 4OLZL 1R3HA 1KTDA 4FFYH 4P5TD 4JG1L 4ODSH 4P2OD 2YMXH 4GW4A 4YDJB 5CHNB 3Q0HA 4UV7H 1RZ7L 2P4AB 3PIQB 5IFHL 4AYFA 1T5XB 4WO4D 3UDWA 2JE8A 1FNFA 4QNPF 3GSOA 3FN9A 5C09B 1A7QH 2W0FA 5C6WH 1R0AL 3Q5TA 4UTAH 5SV3A 3T4YB 3GM0A 4XNYL 5IGXH 4UT6H 1FNSL 4O4YL 5HGGS 2HT2D 5FKPA 4FFZH 4ORZC 1WZKA 4FG6D 1ZAGA 3EIFA 3IETB 4MJ5A 1B9ZA 5FYKU 5CBEB 4HKXA 4LGPB 4K2UL 4LASL 4KDTA 3QXAA 5CIPH 2FZ3A 1DQDL 4PGDB 2IPKA 3CZJA 5F44A 4JE4B 1I4FB 2AJVH 2D4DA 2HTKC 3ARXA 5DD6B 5JW4N 2WANA 5CSBA 1X5AA 1ZXQA 1F6AA 2BNUA 2ICWI 4K94L 4YE4L 4BA8A 2PO6B 1N2RB 4OGAC 3RX5A 2V5TA 4Z77B 3L5WB 1FVCB 5JOPE 2GKIA 1S7QB 1IEAA 2DWDB 4MVBD 5C07D 4F7CB 2IJ0C 3ULSA 1RJZA 5J6HB 4YXKH 1OY3B 3RVWD 3VXUE 3UTTE 2VSDA 4DUXA 1FGNH 4HCRA 1NGZB 1M7XA 2EIDA 4Y7MA 5F70A 5EIIB 5FO9B 3KHQA 5MEOA 5D1QC 4D8PB 2YRPA 4P5KB 3BZDA 2C3WA 3ALWA 1A6UH 3L3KA 5EC1A 1JPSL 5CJBA 3RZCB 2YPLE 3KXFE 2VAJA 1WAAF 3FO2A 3MR9B 4JKMA 4YXHL 3AGVA 1NBYB 3G5XA 1GOGA 1HYSC 3FHAA 4MYWB 5E5RB 1MREL 3S35X 3BGAA 1CFQB 4OGXL 1QLEL 4XPHH 4GKSA 2VC2H 4IJ3C 3AY4A 1JHKL 3LD8C 3M8OL 5DQJA 2AK4B 3AM8C 4OTXH 1VFBA 4XNQA 2ESVA 2GK2A 3GO1L 4YHPA 1R3JA 2EYTB 4XPAL 1KCLA 4XT1C 1TZGL 2ID5A 2V5MA 3K0WA 3EYSH 2JB5H 1UENA 5B39G 2APXA 4Y4FB 5JMOC 3WLBA 1J8KA 5C0CA 1QHOA 1XF4B 5I1HH 1EPFA 3EUUA 3U9UA 1XGTA 3U0WL 3MV9A 5SWQB 2OTWB 1UFUA 3A67H 5D7JC 2C1OB 2B2XH 1WAAA 2VB5A 4WNQA 1BQSA 4NQDD 2P7TA 4ODBD 1ZA6B 3MJ6A 4K7FB 1OB1A 2VR9A 3LIZL 3QO1B 2CLVB 1AGFA 2LE9A 1F3JB 2Z8SA 1DBJH 4NWUL 3L5XL 3QRGL 3FQRA 5KOVC 4JGUA 4PJAB 4NO3A 4RIRA 2ZCHL 4GQ9H 2D0FA 1OSPH 3T3PE 4HWEL 5C0BD 1JFQH 3V0WH 2N56A 2L7UA 1LMKA 5FUZH 2WMPA 4OCSL 5GGTL 5HHQA 1ORQB 5D7KD 5HDOA 3L6FA 1IGFL 1P4LB 4TUKH 5I8EB 5TQ0H 1G6RA 1GC1H 2NY6D 4OM1H 1Q72L 1JRHI 5C3TA 3O9WA 3FAXA 3RY4A 5AYUH 4XNXH 3T3PF 4OF0A 2HFEB 3GB7B 3KYOA 4NP4H 4HC1H 5FM4A 1CT8B 1X4YA 2CDFB 2QQKL 3SGKA 3VRLF 3C8HA 3JV5A 4P2RD 3F7RA 1A7RH 5IMMA 3VFUB 3KPSB 1VKXA 4EUPB 2AABL 2H8PB 1K3IA 1RMFH 4MQ7B 5SWZA 2F54B 2EDXA 2YZ1A 5T3XH 2NY2B 1YY9C 1UA6H 1KIQB 1CXLA 2K9UA 1I8LC 1IT9H 3LB6C 1JGDB 1EVTC 4HJGB 4HF5L 5DEFB 1NGYB 1TZHB 4HQQL 2IADB 4OIBA 1DFBL 4XVTL 1P5UA 2EYRB 4LAJH 1OM3H 1CD1B 1CF8H 3MO1A 2VDNH 25C8H 3SQOL 1U8LA 1FVEA 3UYRH 5C0DB 4YWGL 5M7QA 2ARJQ 4PJIB 4NUJB 1VA9A 1ZMYA 4HV8A 3NFPA 2NW3B 2XKUA 5MP6H 4YHML 5DD0L 5ID0A 1DLHB 5MI0B 3FOLB 4FZ8L 3UXFA 3SDAB 3TJHC 1NCAH 1IC1A 2V2TA 5IOPA 5IM7B 3OKMA 2E8ZA 3NAAH 3MOAL 3VE0B 2KQMA 1Y18A 3MLZL 3VFGL 4P2QE 5I30H 4MLSA 5CGTA 3W0WD 5GIRA 3UPCA 4LF3B 5C0AD 1MHEA 3GMMB 2IPTL 4L8SC 4QRRD 3UAJD 3OXSA 5GRVK 4G43A 2BY1A 3TBYB 5CINH 5DGRA 4JHBA 4I48A 1HHKA 4DZBB 3QHFH 4FP8H 1WBZB 3KPOA 5CS7A 3MYJB 1OCWL 1T0MA 5BS0D 1UJTA 3SE8H 3KDMA 1L7IL 1NBQA 2AJSL 2GTWB 4AH2A 5I1KH 4CGTA 5TQ2H 5A40E 4Z18A 4FRWA 1KT2B 3WJJC 2FJFB 2Q8AL 3P40A 2Z31B 5IK3B 4GRMA 1NFIA 3VI4E 1LO0L 1CK0H 5F88A 3MRNA 4HKZA 1JYWA 3EDFA 1P7QB 1UVQA 3BIKA 3DHJA 3QULA 3VXTA 5D2LF 4KK6D 3U6RB 2XY1A 3LKRA 2BNRB 1CICD 1HKLL 1WCBB 1AE6H 4OZ4A 2VLME 3DX7A 5GGVY 3BIBX 2D7TH 2VLJA 3DTXA 5T1MB 3IVKB 5F7LB 3U4AA 3BEWA 4FZEH 3CFIC 5LQBL 3FTGA 3WIHL 5GHWH 1TQCB 3S36L 1JGUH 3BZ4B 1FO0H 3RU8H 1S7RA 1D5IH 1I9IL 3BX7C 4HGWB 2ZCKL 5GGSB 3RL1A 1DCLA 1IGMH 5C0FA 2FWOB 2VDMH 1OSZB 4N8VB 1EUUA 3I85A 5LGJA 4GKZA 2H1PL 4AIZB 3UTZA 4Y2DD 1FL5B 4M48L 4OSUH 5HD8D 5HHMB 2AXFB 1EAJA 4U1MB 1CVSC 3D6GA 4F8TA 3CFBA 1DVFB 1FNHA 1T1ZB 3BP7B 4RZCA 2GAZA 3O11A 2BXZA 1A3LH 1KELL 5D2LA 1G0YR 3EHBC 2DN7A 4D9LH 4NM8H 4O2CA 2VDPL 3RTQB 3P30H 3JV6B 4KY1H 2R39A 3KPMB 1S9VA 4MQSB 4P0DA 3N9GL 1PSKL 3DVNB 1AI1H 2R2HA 1QD0A 5ESVB 1OQOA 4F58L 2R69H 2X4PB 5EU6E 4LSPH 3MA7B 5CP3A 3T1FB 4IDJH 4YFDB 2Z8VC 1AGCA 5FA4B 3ULUH 4ETYA 2D7MA 1FAKT 4M8QA 4K7PH 3T77B 3V52H 5GJTH 1H9VA 2W65A 4CKVX 3LKOB 4LSTH 4U7MA 3V6ZB 5J1TC 2KZWA 2I5YL 2WUCH 3QEGL 3QUYD 4PJ9D 4HK3N 3EGSB 3WD5L 3S4SG 2H26A 2ARWA 2J8UE 3R1GL 1I7UB 3WFBH 5IUSA 3B5HA 3TPUA 4KVNL 3CLEL 4M93C 3AREA 3AU1B 4Z7WF 3WIFA 1YY8A 1FYTA 1EO5A 3VH8B 4PGCA 4D0DA 1EEYA 2AGJH 5D7SH 4EKXA 4OCWL 4DQOL 1K8IB 3E6HA 3D39D 5K93A 3TCLB 4DKEH 1FCGA 4K8RD 3VXNA 3EO1B 3RA7H 5IHBA 3ARGA 4I77H 5IQ7L 1MRFL 3SE9H 2VLKE 2A2QT 3C5SA 5EWIH 4I8DA 4NSKA 4BYHA 4L5FH 5GRVL 3CFJB 4X9GA 3GMRA 4PGEB 1I9EA 4JQIH 1CR9L 3ROOB 1OP5H 1S7UA 3TV3L 3TZVB 1L0QA 4M61B 5E1AA 2OK0L 2YXFA 5KSUA 1I3UA 2NY5L 3STBA 4PRNA 5EU6A 5GS0C 5I74C 3OMZA 3Q3GA 1YEJH 2Z93B 4N8CL 3ZO0A 1MLBA 3V4UH 3H7BA 3GMLB 4L8BB 3MBED 3HCVB 1S7TB 3P4OA 4U1JA 2YC1B 3RWEA 1Z9OA 4KK8D 1NEUA 2MCPH 1C08A 4M5YH 1U3ZA 1QNZH 2PUQT 3MCKB 5LAXA 4CN6A 3UP1A 3CSGA 1B2WL 1MHPL 1YEEL 3FKUS 3GMOB 4ZAKB 4F3FB 2B1AL 5D8JH 1DQLL 3PXJA 4MMXC 4POZC 4H25A 5EA0L 2F15A 3DURB 1RUQL 3FB7B 3WDJA 1BQUA 3HNVL 3F6LA 1T5WB 2UWEF 1BQLL 4L8SA 4YEEA 3DO7A 3GNML 2VISB 1UGNA 1QBAA 2VLKA 1UT9A 4LLAA 1B6UA 3REVB 1MCSA 4HGKC 5H35B 2X4SB 3HE7D 4PJ5D 1CGTA 3OF6D 3MQIA 5D7LA 3O4LB 4KDWA 4MA1B 1T80A 4OLZH 3WJJA 4ZUVA 4EVNB 1MCEA 3MTRA 4LLMB 2WBJA 3VD5A 5C6PB 1RZ7H 4WW1B 3G9VA 3NBNA 4Z76B 5IFHH 3CSBA 4GBXA 4JO3L 3IAQA 5INDA 3VA6A 4EIZC 4C55A 1R0AH 4JHAL 5IMOA 3IU4L 4K71C 1KCVH 4M62H 5BQ7B 4XNYH 3KPLB 4O4YH 4LLDA 1A9BA 4XZUB 3FB6B 1G7LB 1D3CA 5EG6C 2BY3A 1J1XH 1KIPA 1OGAB 1N5AA 3GHBL 4K2UH 4LASH 5DHVA 3RGVA 4QWWC 5EO0B 3S5LA 4BFIA 4L9LA 4LBEA 3RDTC 5ADOL 2XZQH 2Y7QA 4G8EB 3FRPA 4N90D 3S3PA 1E28B 4UDTA 4GW1A 3HN3A 3VXMB 3O45B 3TN0C 4PRHE 4PFEA 3QI9B 5FHBL 1KPVA 1QRNB 4K94H 1IGYA 4OCLC 4M8VA 4YE4H 1A7PL 1FN4A 4X9IA 2N7BA 4Z7UE 5DZNA 1NGPL 5E6IA 2VQTA 3DYMA 2HFFA 4NRYA 2XA3A 2EXWC 4CVWA 1FNGA 1I1FA 3ZDZF 4Q0XL 3G08A 3N0PB 4LMQI 2X1WL 3MRLB 2J12B 5MENB 4HULB 4Z7UF 3VFRA 4RBPK 4U1GC 2V9RA 3QQ3B 3GIVA 1QYGL 1SEBA 1L9NA 4MZ2A 3TVMC 2X44D 4FFWC 1CDJA 3EZ8A 2WINB 4YR6B 5HI3C 4ONGL 1FL6B 4LLYB 4BH8B 5DK2B 5IMLB 3U4EA 3SGDI 2BVYA 3IF1B 2HTKD 1X5XA 1MREH 3L9RA 2CQVA 1ZOXA 3EW3B 3PWPB 1GZPB 4OGAD 2DQFA 4OGXH 1JCKA 5CD5D 2OI9B 3CCHB 1QLEH 4P99A 1I85C 2EO1A 4N9GA 5DRWA 2X9XA 5B39B 3MLSL 1JHKH 3M8OH 5L2KA 2A83A 4XVJL 1I1YA 1JNNL 5F1NA 3LN5A 1NBVL 2VXVL 4R2GB 2WWMC 3GO1H 5TE7L 4JB9L 3FQUB 4PV9B 4XPAH 4DAGL 1M05A 5D1QD 3EBAA 3F65A 3H9YA 5J3HD 4M02A 1HOCA 2J3SA 1R5IA 1DP0A 4HAFA 4Z7UA 1F4YL 3LQZA 1DQJB 4AZ8A 5HGBB 5IBUG 4JAMA 3U0WH 4F2MB 4FS0A 3IU3A 5DFTA 2IMNA 3U36B 2ZOKB 2CO6B 3LKQB 4EUPH 3QDJB 1HYSD 4YNYB 4EDWL 1F45A 4KI5E 1QFHA 3PL6C 3LIZH 3F7QA 1UJ3B 2C3VB 4NWUH 3T65B 3I3EA 3L5XH 2O5ZL 1MAMH 4MNHB 1KN4L 2ZSWB 4Y89A 4WGWB 4R4NC 2ZCHH 1BD2B 3IDMA 4O5LH 4HWEH 1Y6NR 2DF3A 2DTML 4DVBA 3SE4C 4MAYB 2R4RH 1K4DB 4OCSH 5GGTH 4KJQC 1XIWB 3MV7E 2E3VA 2VKWA 1AQDA 2OP4L 4KH2A 4JFEA 4PD4K 2ADGA 3RL2A 4HJ0C 3PWVA 1VFMA 4LVOC 4P59H 4PP1C 2NY3C 1Q72H 4WU5B 1T21A 1CLYL 3IJYB 4MB4A 5E03A 5FO7A 5D7JD 3CU7A 4P23C 3ZT5A 2QQKH 1QPXA 1W0VB 1LVEA 3G6AA 5T33L 1PYWA 4APQB 3GJFA 5FB8A 4E0RB 3QZWG 2ATKB 1RUAL 1X7QB 1JZ6A 3BUYB 3LHPL 4XBPB 1PEZA 4XC3L 3VXRD 4KRPC 4G8GE 2QSCL 1RHHA 4JPIA 1BM3H 3KG5A 3VU2A 4HF5H 1CGWA 2BVOB 4LU5L 1S5IL 1HIMH 3UTQA 3GBML 3WHE0 2HLAA 1H0DA 4HS3A 4ORGA 4XVTH 1DFBH 3ZHKA 1UZ8B 4XHQA 4GW5B 2NLJA 5HGDA 1UZ6E 4PP2A 1JYVA 5EIVA 1TFHA 4X4ZA 4JJ5A 3SQOH 4HUMB 2RCSL 4YWGH 1PVHA 2V17L 5B22A 4M7KL 4UNVA 4X4YB 2NY4B 3VD4A 5T5NG 1D6VL 5KSVA 2A9NL 4YHMH 2UYLB 1GCFA 5DD0H 1P4IL 1QSFE 4QRUB 1KTLA 3CH8A 2CGRL 3C09B 4FZ8H 4FQXD 4JQXC 4Q97A 3ZKQD 3ILPA 1VFAA 1NAMA 2CXKA 3BHBA 5E8OA 5C8JB 1IAIL 4PTUA 3U9PL 3MOAH 1LEKA 1KB9J 3LS4L 1KIUA 2HT4D 4QF1B 1YY9D 3MLZH 3VFGH 2BSRA 5JPNA 3CXHK 3LB6D 1NC4B 1UB6A 5IBTL 4P5TB 1NDMB 1MCOL 3GBNL 4M1GL 3H9HB 4P2OB 3W9DA 2IPTH 3MUGB 5B8CC 3TIEB 3LDBB 1MI5E 1KLUA 4TSAL 5K59E 2P42B 4NCC2 1BLNA 4WO4B 2I26N 1OCWH 1VERA 3O41B 4PJXF 4NKOB 1L7IH 2AJSH 3QQ4B 4X8XA 1MUJA 1NDGA 5F7YC 4BZYA 3NIGE 3BPOC 1ZT7A 2O5YL 4U05A 2Q8AH 4OZFG 4KRNA 3JTTB 5C3LD 1LO0H 4I5BB 2X4RA 4YHIB 3X13B 4MQXC 1I75A 1XGPB 3TBTB 4HG4K 3O0RL 4NYLB 1IE5A 5GPRA 3MLYL 4L3CB 2GK0A 3UJTL 3U46A 5F97E 4R26L 3TVMA 1J1PH 3C87A 1IEBA 2X9YA 4NDMB 2QSQA 4LPYA 4CNIA 4G42B 4JPWL 1UB5B 2DQHH 4G9FE 5DJ0B 4TNVK 4JCMA 3BESR 5A16A 4XB8A 3STLB 4NHUA 3SPVA 5C07B 5FKAA 3DO3A 2QHLA 3HC3L 1WC7B 3QPQC 5LQBH 4R97B 1M7DA 4PRBB 4NQXB 3VFTA 3S36H 4Z8FL 2BOBA 3BP6A 3ZTJG 3SDXB 4PJXA 3H3PH 5IJKA 1UQSA 1I9IH 4FQHB 2ZCKH 1MCRA 4OV5B 3MRMB 4U6XA 4IRSC 3ILQC 3CVHL 3G6JB 2FJGB 1KLFA 2QKIB 5AD0B 3BDYL 5JDSB 3AMLA 4LARH 1Z9LA 3VCLB 5F1SA 1QEWA 1AP2A 1KXQE 1J0IA 3MUJA 1U3HC 3RI5K 3DX8A 1TITA 4HSQA 1KELH 4PJGF 2CK0L 8FABA 3K46A 5E4IA 4CN4A 3CFKA 5KSBB 4MD5B 2C7UB 2VDPH 4HFUL 4E5XA 1ADQL 2VABB 2Y06L 4N5UA 1CD8A 1MJ7L 3N9GH 2BVQA 1PSKH 2NNAB 1X5HA 4HUXB 2CRZA 2VXTL 4FQ1L 3V4VL 2XKNB 1JBJA 3LN4A 4NRXA 1X5LA 4F58H 5FYKE 5BV7C 1SM3H 2EE3A 5AEAA 4I9WD 1JWMA 5JXEC 5ISZA 3S4SB 1JYNA 5EUKB 1OLZA 5LGKA 5F7DB 2OTUA 3T04D 4B50A 1RURL 4YIQB 1BZ9A 4OJFL 4OZGE 1FHGA 1SVCP 4G9FA 3SE4A 3ES6A 5INCB 3DNKA 4JN1L 5IVZA 2I5YH 1UWXK 4BFGA 1HK6A 3QEGH 1FLTX 5EUOF 3CVHB 2MKWA 3WD5H 4NQDB 1M7IA 3SE3C 5IHZA 1HEZA 4UV4L 2NPLX 4YX2L 1CQKA 3EHBD 3RNKA 4KVNH 3CLEH 3CZFA 1R3LB 4BQCA 1YA5A 3QNXA 2E6JA 2WQRA 4OZGF 4PJGA 2YSSA 3ZL4L 2CD0A 2FBJL 1LEGA 4NNXB 1DN0B 1BP3B 2O61A 2GUOA 1PG7L 4DQOH 1ITCA 4POYA 1C5DA 2XN9D 5C0BB 5ESQB 5IQ7H 1MRFH 4QXWA 2X41A 3IGAB 1BX2A 4HS6B 1BAFL 3G5ZB 4WEUD 5KSAA 2NY6B 3DARA 5C9JB 1W8NA 3QIBC 1XF5B 4OFVA 4GRWF 1CR9H 2QJDA 4L4VA 3JWOC 1TZIB 3TV3H 2ICWJ 1K2DA 3GMNB 1QSEA 3QEUB 1FZJA 3U7AA 2NY5H 1U3JA 5EUOA 4O00A 4P2RB 3TT1L 2VIRB 4FA8A 4N8CH 3JV4A 3D25A 2KH2B 2IEPA 1LP9F 5CEXA 4ZSOB 4EDXB 3MRQA 4ZMAT 4ELKA 3L3OA 3IJSA 4OZGA 1OHQA 2C3GA 1BZ7A 5MEQA 1Q9WA 3IXTB 4KTYA 1JHTA 3SGEH 3ZYIA 1B2WH 3QUKB 1MHPH 1YEEH 1P2CB 4X7TA 2B1AH 4AJ0A 1DQLH 1QBLL 1BQHA 2HG5B 3IDIB 1HI6A 3HMXL 3J7HA 5BXFB 5HSFA 4NZUL 5EA0H 2L4OA 1RUQH 1OQXA 4N0UE 3HNVH 5F1OB 2PETA 1BQLH 3DYOA 4M9OA 4OKVA 2DWEB 5GS0D 1CDYA 4U6HA 5E70A 4DKFL 3G5YA 1U36A 3FAWA 3QDMD 4MDIA 1YNTB 1BPVA 5AZ2H 1K5NA 1FNLA 1VDGA 4NO5B 3V95A 1IGIL 4B5EA 2X4NB 1LP9A 5F9WB 4H0IA 5HYSA 2IANE 4J3XA 4JANA 2DQCL 5IFJB 3W0WB 4EI5C 4HWZA 1WBXB 5C0AB 1WWWX 4WUUE 1DANU 5I15H 4QRRB 5TF1L 3QISA 4XPBL 4POZD 1FVDA 4X80L 4LKXB 2EICA 3TESA 3O81A 3WLWC 2QV2A 5ITBL 4FXKB 4PY8I 1Q94B 3IU4H 5FDWA 5BS0B 5HHOD 4PJCF 6FABL 2IFFL 2BSSA 5J89A 2EIBA 2NTSP 5ERWA 4PY7A 1QVOA 3GSNA 2FYYA 2NXYB 1Z5LA 2FL5B 3GHBH 1RZIA 4NZRL 3L3JB 5L8JB 4N8PA 3I2CL 2ERJB 5ADOH 1JI2A 5E8EB 5E2WL 1EXUA 1N6QL 3JUYA 1NEZA 1MLCA 1MCKA 5D2NC 4IS6B 3CPLA 5FHBH 1H15B 1SVZA 1A7PH 1CICB 5JW3L 3MRRA 1JV5A 5KAQG 4K7PX 4PREA 5DK3A 4F7MA 4GLRI 2R0KL 3VRJB 2BHYA 4DCQA 4C56A 2OXHA 2GEEA 4NO2A 1N3NA 3QBTB 4OF5A 3EFFB 1P4BL 1CD0A 1KB5A 1LE5A 1IL1B 2VR4A 3IDYC 2BMKA 4PJCA 1QYGH 4I4WB 2LFGA 2WSKA 4WUUA 4PS4L 4RMWA 4KZDL 2EZ0D 3EOBB 3VGAC 1Q8MA 1U93B 4ONGH 1PKOA 2G9HB 3RNQA 4IMKC 1AXSA 4ZDHA 4JREB 5FYJD 1OW0A 3RDTD 5JXEA 4MD0A 1A1NB 1WWCA 1BIHA 2NW2A 4M00A 4Y2DB 4GRLA 4JVUA 5C08E 3TN0D 1AKJD 4P4KA 1A6PA 2BVPB 1AIFB 2ZSVB 4K8RL 3MLSH 2EXWD 4HZLA 3ARPA 5IBUB 1H3TA 2FSEA 1UWEL 4XVJH 1JNNH 2HT3D 1NBVH 2VXVH 4ODXA 5SX4H 4K3GA 5TE7H 1C12A 4JB9H 4R96A 3LKSA 4DAGH 4WFHD 5ICZB 3DUSB 4ODVL 1CTNA 3MRGA 1F4YH 1NFDF 3EOAA 3FB5B 4DK6A 1GAFL 4O51B 5HI3D 5L2JA 1URLA 4NZDA 5DJ6A 1LE9A 2R1YA 3D18B 4OBSA 4EDWH 3TM6A 3QUYB 2DQGL 4PJ9B 4PRPD 1J11A 5LKNA 4Y5VA 5DUBA 2PTUA 1ZLSH 2O5ZH 1Q9OA 4LDOB 1KN4H 1A6AA 3T0BA 5CP7B 1RZJC 2CDGB 4DVRL 3GSXA 4QHMB 1R3KA 1IAKA 3GSVA 2FR4B 4P57B 1IKNC 4M9PA 4NQCE 2MTPA 4JFPA 2DTMH 5T3ZD 2P5EA 3D39B 3OR7B 4LCUA 1AO7D 5GS1B 2VQ1B 2NX5D 1GGUA 2OP4H 5D93C 4GAYB 4BFBD 5KANG 3QZWB 3TJEL 4X7SL 3QXDA 4G6AD 5I8OL 1CLYH 5C0GA 2VDRL 3U0PA 1NFDA 4K9EC 5T1LA 4WW2F 2C4XA 3QG7L 4JFHD 5JLZA 3C9NA 3IFPA 4ZTOL 3PL6D 1RUAH 1FSKB 3BVNA 5I1LB 5L8KB 1RZGB 4G7YL 4FTVD 3LHPH 4YHPB 1F11B 2NXZC 1LILA 3MBEB 4XC3H 5HYQA 3MNZB 2DLGA 2QSCH 3MA9L 1N6UA 5I75B 1A4KB 2VE6A 4LU5H 2AV1A 4IHOA 1S5IH 4WI5A 3GBMH 2B5IB 2E6QA 4U4BA 3I6KB 3PDOA 2XTJE 3D9AL 5DJCA 3QUZD 4HJ0D 1H3VA 3ARDA 4PP1D 1XR9A 4TTGA 4X83A 3MXVL 5JHDE 4TVPE 4PRAA 5IHUL 2V17H 4EZMA 4M7KH 1J0KA 4ZXBC 3MLTB 4P23D 1D6VH 2F53A 3H9SD 2A9NH 4WW2A 3HAEG 3KLHC 1P4IH 5DTFB 1H3XA 1TJIL 2CGRH 3MXWL 3MGAA 3DVGA 1RIUL 4UQ2A 2HMIC 3MROB 1IAIH 5HHQB 3TBWA 4BK5A 3LS4H 3GI9H 4X6DE 1U2HA 4PJ5B 1S5HA 3VWKD 1KCKA 5ITFA 1VSCA 5IBTH 5T3XE 5CMAB 1MCOH 3GBNH 4M1GH 3OTTA 4LCWD 4YFLI 3TO4C 2WLZA 4OV6F 1VEOA 3WXWL 4OZFB 4QCIA 4X6DF 1MFBL 5FA3B 3K2UL 1BJ1H 4Q2ZA 2BX5A 3V7AE 5D2NA 2LV4A 2D31A 4YHNA 3FMGL 2R23B 2APWA 4MWFA 3ULVE 2X7LB 2YD9A 1HHGA 1IBGL 2BOCB 3RZWA 4LIQL 1BBJB 1JJUA 3IDNB 2V5SA 35C8L 3WDIA 2VKXA 2WIMA 3RWCA 2VL5B 3EOYG 4NQSA 3G6DL 5GS2D 4K7PY 3LKNB 5DJYB 1WIPA 1HQRA 5JHDA 3MLYH 4X4XB 1W0YT 1J0YA 5FECB 2E8YA 2DLIA 4KROC 4R26H 5IW6B 2YD7A 1C5CL 2V6HA 4X8JA 1MJUH 1T2QH 1FQ9C 3P0VH 4HC1A 4JPWH 1UH4A 4IMKA 5D5ME 3ZT6A 3NCBB 4DN4L 4KJWC 4UT7L 1B0WA 3HRZA 2FEEI 1T04B 1XT5A 3O8XC 4CVZB 5ID0B 2F8XC 1VPOL 4IIQB 4X6DA 1AFVL 3RWGA 1T2XA 2VDLL 4NOFA 5DT1L 2V7HA 4Z8FH 4I0CC 1XMWA 1KG0B 4HH8A 1EIBA 5SWSE 3DV4A 1PKQB 1GGTA 3CVHH 1BFTA 3HS0A 4I18C 4XPTL 3BDYH 1MHEB 1Y6KR 3LQAH 1G7QB 4U49A 2ICEA 4HHAB 4MQXD 4UT9L 2Q76B 5E5UB 2DJUA 2Z0BA 5F1IA 4ZUWB 1ULVA 2JK5A 4I48B 1JPFB 1JNHA 1JUFA 1A4JA 1QFWL 1UKSA 1S7XA 2CDEB 3T3ME 1YEHL 2CK0H 5CILL 1A1MB 1HXMA 4HFUH 4WWKD 2H6PA 3JZ7A 3C5JB 1ADQH 2AEQL 1E27B 5E2JA 2Y06H 2IMMA 1NPUA 3WL9B 3FT3A 4WWID 3W5MA 1KNOA 2VXTH 4FQ1H 3V4VH 3HI1A 5FO8A 4RNRB 3QPQD 1V7NL 3HG1D 2GT9A 3B3IA 1HHHB 3P4LA 4NC1C 2F5BH 1T0NB 5EB9A 3UTPE 1J8HD 3DMMC 3TA3A 1ZVHA 2HVJA 1JWUB 4JVWA 3D3VE 4MA3A 5D1QB 5L88L 1GZQA 3L3GA 4P3CH 4IRSD 5D7IE 1IKNA 2Q20A 4DJMA 3WHXB 2CLRA 4PBWD 1HDMA 4QEGA 5DLML 4PV8A 5H8DA 8CGTA 4OJFH 5DVOA 1U8IB 5ACZB 4JN1H 3ZZ1A 1E4KA 3C6SA 1P1ZB 1U3HD 3O3DB 4Y4KC 4UV4H 7FABL 4NQEE 2H41A 4YX2H 2HFGL 1G7HA 5SWSA 1TJHL 4LLQA 3PP4L 3EYUL 2PO6C 5CSZB 3LEVL 2XFXB 3ZL4H 5I1AB 2FBJH 5J1SC 3UZQA 4PJHB 4IJ3B 1PG7H 4RFEB 4HK3J 3TNMA 5JW5A 3LD8B 4UAOC 1S3KL 5IW3A 4ZPVA 1K3ZA 3B9KC 4HBCL 3RHWF 3DUUB 4L3EE 1CTOA 4F8QA 4YEFA 5E8PA 1F3DH 1D6EB 1J1OL 3LOWA 5F1KC 1BAFH 4KV5F 2B1HL 1FNAA 4M43L 4C83B 3WS3A 3BH8A 3ZKSD 3SKOA 2P46B 3V7MA 2DOCA 3VFNA 2JCCE 2GFBA 2VXUL 1WBYA 5HY9B 4PD4J 4BSWA 3FQTA 5BVJA 5D7JB 2B39A 2ORBL 4MNQE 2RFXA 1NANH 1J0ZA 4A2MA 4BZ2L 3OGOE 1NCBL 2ED9A 2VYRE 3TT1H 4I0PA 2GJ6E 1HXYB 3QDGA 2D2OA 3UTSE 3ULUF 1UXWB 4ZXBA 5IB3A 3KPQA 4QXTA 4AEEA 1FO0A 3NA9L 1AD9B 3VXRB 2Z8WC 2P47B 1UC6A 3KNBA 3DROB 2X4UB 2YZ8A 1MF2L 3KLAB 1CXKA 1KN2L 2YS4A 4JFDE 1S8DB 5A3IC 1GSMA 2VZSA 1QBLH 1MNUL 2FEDC 5CJOH 1TTFA 3HMXH 1EFXD 4TUJB 3WUZA 4NZTL 5DJAA 4NZUH 1BWWA 3AS3A 4ONOA 4KMTL 4Y4FC 3QIBD 4C4KT 3IDXL 4HXBL 1SJEA 3BD4A 2J2ZA 1Z3GL 3TO4A 4NIKB 4E41A 4YHLL 5TGBA 5IW1A 3EYOA 3P4MA 2A6DA 2XRAL 1RUMH 1EVUA 4S2SB 4FQXB 3WO4B 4Y5XC 5DFVD 4DTGL 1IGIH 3CC5B 3D69B 3IS1X 1U8OB 4CMMB 5EOTB 4JLRB 2KDGA 1L4IA 3UZVB 5JOPD 4Y4HD 3S36X 4GXUM 2DQCH 3VXUD 4LGRB 3W11C 1G1CA 3UTTD 2XXMB 3O6KL 3RKPA 4U6YA 3SN6N 5K9QI 5B3JE 1N8ZB 3RVTC 3DX6B 3EJZC 2G5BA 3CXHJ 3EYVB 5TF1H 5HI5C 5KSUB 3FFDB 4XPBH 5DJ2B 3RBGA 1X5KA 4X80H 5CD3A 5C09E 2NTFB 1W8OA 1JGEA 1ZTXL 3R06A 5GSRA 3DGGB 4UNUA 5EH1A 2YPLD 5ITBH 2C1PB 3KXFD 1Q9KA 2C3HA 3SOBL 3STZB 6FABH 4RMQA 2IFFH 2Q7NA 5FGSA 4U1JB 3SJVE 4Z7WB 3VFMA 5IVXE 4XMLL 4LLWB 4KI5C 4R0LA 5DVLA 3V8CA 2AJ3A 4N0YL 5GGVL 3O8XA 4DGVL 4PJ8A 4RFNC 4NZRH 3B2UC 1QSZA 3I2CH 4Z78A 3OR6B 4JO4L 3QUXC 3SKMA 2Z91B 3GJFK 3KPRE 5E2WH 3VDAA 3L5HA 3S98A 2NY2C 4RQQA 2F8OA 4EI5D 3PABA 5JW3H 2YK1L 4HG4J 4JJHA 5HHVL 1T1YA 3QNYB 2R0KH 4EQ2A 5MEPA 1BIIA 2X09A 3DX9B 4HAGA 4XH2A 5JA9A 3LV3A 3WLWD 4UMGA 1P4BH 3HLAB 4MXQC 2KKQA 5D96C 5CHNA 4XAWL 4HEPG 5F6HI 5F89B 3FT4B 4ZUVB 3EKCA 3PIQA 4PS4H 4P3WA 1T5XA 5BO1L 4KZDH 5C0EB 4YPGB 4FQJL 5MI0C 5LBSL 3SDAC 1QSVA 5C09A 5SX5K 3O4OC 3WUWG 4O2EB 4J8RB 3NFNB 4JRXE 3T4YA 4MHHI 3E1F1 3WNNA 1GYAA 5IMOB 1V3MA 3WS6A 3IETA 4M7LL 1QO3B 1HKFA 4YHKL 5CBEA 1J0JA 4K8RH 4NHCL 2AK4E 3IFNL 2UWEB 3L7FB 1S9KC 5AWNL 4PGDA 1UWEH 5F7WC 1I4FA 4KTDH 1YEGL 5DD6A 5I18L 3HNSL 3SDCD 1MCNA 5FOJA 2PO6A 1N2RA 3TT3H 4ODVH 4Z77A 4LVNC 1YEIH 1KEML 3L5WA 4XP4H 2A6IB 1FVCA