2DL2A

Killer immunoglobulin receptor 2dl2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
197
structure length
197
Chain Sequence
AHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MHC CLASS I NK CELL RECEPTOR PRECURSOR (P58 NATURAL
publication title Crystal structure of the HLA-Cw3 allotype-specific killer cell inhibitory receptor KIR2DL2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dl2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dl2A01
1NCDH 4YHYC 4OV5A 1JK8A 2D9QB 4FQXD 3VMPA 3QNZB 4ZOAA 4S1RH 4M7JL 4MQ7B 5FGSA 2VC2L 5I1CH 5B4MC 2CDFB 3BP6B 3I9GH 4X7DC 5CGTA 4XMLL 5MEND 2NNAB 1BPVA 1BBJB 4ZPVA 1GOFA 1S9VA 1AGBB 3IFNH 3TYFA 1IM9D 4DOHB 3G6JB 4DZ8B 1OGAE 4PY7B 1FNEB 3PV6A 1BVKA 3Q48A 4P3CH 1MIEL 3IFOA 5J1AA 2HLAB 3SN6N 1Z5LA 3QDME 5I2IB 1PX4A 4IOSD 3QG6B 4XXDA 5EA0H 4QXUL 2FJHA 1QR4A 1OD7A 4XWGH 4ZYKA 5IKCA 3QDGB 2FHBA 2HAZA 3SKMB 3KXFD 1QFUH 5AAWA 3HS0B 3IJYA 5ANME 2H6PB 4PLNC 3NFPB 3Q6GL 4QXGL 1DBJL 1YECL 2X2YA 3C2AL 1G0YR 3P11L 2OL3B 2GTZA 3LEVL 4NJ9H 1MCBA 4N0YH 1NCAH 1T5XA 3BHBA 1J8KA 3WDHA 5CJXA 4ZNCD 2QADC 5KS9B 3MCG1 4ENEC 5ESVB 1S9KC 4WIQA 5DUBA 3RIFK 1A7PH 5SWSA 5DVKA 1I8IB 1UZ6E 4HWBA 2XTJC 1YEJL 4LOUD 1OAXH 1F6AB 3KPSD 2H2SD 3KS0H 4ONGH 5JOFA 2AJ3B 4KY1H 3SOBL 5IB1B 2EZ0D 3DWTA 4KKCD 1J0JA 1KUMA 4JY6A 3P4LA 4YDJB 5ETUA 4NQDB 4GXUN 5BJTB 3UTPE 4ZDHA 3TCXA 2OJEA 1FYTD 4GFTB 4ZPVB 4JKLA 2OP4L 4M62H 2VLJE 1FLTX 1WZMA 5A16A 3IB4A 4OCRH 3GIZH 2PUQT 4EI6B 2BFVL 2HFEA 4Y4FB 4F7CA 1JNNL 4FXKA 3SO3C 3FCTA 4JKWA 4ONFH 1WQVT 2ZPKH 3NGBB 4KU1A 5BQ7A 2AV7A 4Q6IA 4FQIL 3S3SA 1CL7L 4OKVB 5DJCB 4F33A 1WUNT 3KYOA 5C0DA 1W0VB 4G8FA 4IHOB 1B90A 1VHPA 3ZTJG 2Q3AA 4X4XA 4WTZA 3M8OL 1OAYH 3V5DA 5SWZB 4ZYKB 1HIML 1MCKA 4N0FA 3CD4A 2N4IA 3OAUL 1U8QB 5IKCB 2B20A 4I3GA 4OLWL 4MDJB 3U30C 2J12B 2NY4D 4HULB 3FN9A 3A0OA 4EDWL 5CSGA 4Z18A 4M43L 1WTLA 5IB4A 4LSVH 2GTZB 4HD9A 3WHE1 2J5LC 3MJ7B 3TVMB 2IMMA 1GGTA 4APQC 5AG8A 1A7RH 1SY6A 3MLSH 5IIEB 3O4LB 2WUCL 3E6HB 5IWLA 2GJ6E 2X4QA 4EN3D 4UV7H 2A6IA 3LMJL 1XF4A 3GSRA 3VXOA 1OAKH 4UUJA 1A3QA 2A6JB 3LV3A 1KG0A 4K9EL 4MHHI 1F8TH 1P6FA 3QDJA 4AIZA 2G60L 3ROOB 1GC1C 1EX0A 2DDQH 4YHKL 2BVYA 2NY1B 1CL7I 2H32B 3QH3A 1VFBA 5D5MF 4HEPG 2OR7A 2D4FA 5I18L 4HKXB 4JY6B 4CAGA 4PJEA 1F11A 4XGZA 4OF7A 2C4FT 1A6AB 4NNYA 1CFNB 4PD4K 1AFVL 3HPJB 1B6DA 3W11C 3MROA 1H3TA 3GJFK 5FKPA 3SDXE 1ZHBA 3H9SA 1G7PA 1IQWL 1EERB 1VACB 4KJPD 1Q1JH 4F7CB 3SDCC 4F8QA 1F45A 4UIKH 1U3JA 2A9NL 3OJVC 3MJ9A 3UJTL 2EYTB 5INDA 3T0AA 1T7ZA 3GMNB 3RVVD 5IB2A 4F33B 1EHXA 2FL5A 4LPUA 3E3QE 5C0DB 4KVCH 5CIPA 5DJ0A 1S78D 2E6QA 2Y36L 2A77L 1IGCL 3J7HA 4X4XB 3BUYB 1KEML 4P4KB 3UEZA 4PRDB 1FYHB 2WWMD 5EORH 4N0CC 5MEOA 5J1SC 5C0ND 1D6EB 5M7QA 1JF1A 4J1UB 4H88L 1IFHH 1VKXB 5JDSA 5FK9B 1OY3B 3B2UC 4M48H 1S7RA 3EJZD 3BWUC 3TBTA 4K3DL 4OI8A 5CLWA 4P2RB 2CR6A 5E8OB 5TPWL 4D0BB 5EOQH 1BFOB 4AEIL 1FGVH 1KG0B 4N9OB 4RMTA 3MGAA 4AIZB 2DL9A 2Q8AL 5IM7B 5A2FA 3K8MA 3LSOB 3RDTC 2DQIH 3PJSA 5FECA 1EZVY 3JWDH 2AK4E 1WV7T 5AUMA 3VXUA 4NM8L 1NUGA 4JFED 2H3NA 1KN4L 2J4WH 4CUCA 3QEGH 2VR4A 1F11B 1A14L 2IF7A 4XGZB 1BWMA 5KJRL 3PG2A 1EO5A 4I18C 1N8ZA 3CFBA 1MRCH 3KPOB 1D5MA 5C7XH 3T1FA 3S88L 4Y16C 5FKPB 3LQZB 2DM2A 1I7ZB 3EYVA 1UJ3B 4MA7L 5TFSL 1HDMA 1ZE3C 5DVNA 2PO6D 2ZUVA 3UTTE 5I1LA 3MFFB 4XCYB 2VLRB 4YK4B 4Z78B 2NTFA 5INDB 4Z7OF 5EOCL 3WFZA 1BQLH 5IB2B 4U6YB 4HK3N 5CIPB 5DJ0B 5M95B 4AM0A 1A4KA 2VR5A 5DJ2B 3IJHB 5EU6D 1QBML 5D1QC 2HG5B 3TA3C 5FHBL 5I73B 4KFZC 1YNLH 3W39B 3EOAB 2GT9A 3EO1B 1KCSL 4LLYB 4E9LA 2D7OA 4UTAH 5EZLB 5JDSB 4JPKL 3IDGA 1MY5A 1AGEB 2E7MA 5FGBC 2OQJA 4X7FC 4WNQB 2VZSA 5IOPA 5L2KD 1KOAA 2A1WH 4OZHE 3RKDC 1YNTA 1QBLH 3NCJL 4M3JA 4OGYL 1X6NA 1TQCC 2DWDA 3F8UB 4FQ2H 1AQDA 4PYGA 3MRPB 3CDCA 3KPRD 2R1WA 5DDHB 5K93A 1TIUA 1GZPB 3ARBB 2DLTA 3GSWA 3BN3B 2Y5TA 3VWJB 1I9IH 1F6LL 3WNOA 2OJZH 2AJYL 4AL8H 1FO0H 5AUMB 1GSMA 2Z31A 3U7YH 3L3IB 3TN0B 2H3NB 3FN0L 1P7QD 3PWLA 2NY6D 5C09D 1U3ZA 1OD9A 4TSBL 2Z8WC 3MLZH 3J8F7 3NIGE 1G9NC 4Z7WE 3CC5A 4PRNA 1SYVB 1CT8B 4YQXH 3CPLA 4HWZB 2KZ1B 4ZQKA 1SEQH 2AVGA 4R90L 4YX2L 3T1FB 3QEUA 3TPUB 1I85C 3MRCA 4X6BB 4Y5YC 3BKYH 2PW2A 1A02N 3R06A 1X5IA 2OSLA 1MCLA 3ELAT 4RISL 1CFVL 4QHLB 5C07B 2WQRA 2LE9A 2EE9A 5CJBA 1IT9H 1TZGL 2QLVB 5CP7A 3LQAC 3ARDC 4UV4L 4Y1AA 4OLZL 1E4WL 3MCKB 2VXQL 3NIDF 1EBAA 1H8OA 1P4BL 3BP5A 5CAYB 4PR5B 5D7LA 4NJAL 4K94H 2PTVA 3O0RH 4P4RB 4PD4J 1KIQB 2P1YA 1OAQH 4XAKD 3WBDA 1YPZF 2JCCB 2WQ8A 2BY2A 2JJSC 4WI5A 4XP1H 1NC2A 1J9CT 1MIMH 1Y18A 1ZVSA 2VDNL 5DD0H 2QSCL 2PW1A 3V6FA 1YNTB 3F12B 3CFCL 4YHIA 3T09A 5HDBF 3P30L 4Y19E 6FABL 1NGPH 4OBSA 2GK0A 4BQ6A 5GGSA 2R1WB 3BZ4A 5FM4A 1V3KA 3L3HA 3ZE1F 3KVQA 3U7AA 4KUCD 5TE4L 5D7JD 2CK0H 5HYJD 3BP4A 3RVUC 1BVLA 2F5AH 2ZOLB 3MGTB 3PWLB 1K4DA 4CVZB 2EDKA 3I2CL 4OFYD 2DQFB 3IU3A 5F7HA 3VXSE 1R3LB 2VAJA 5HI5D 3PIQB 4XCNB 4XI5C 4BM7A 4KHTL 3W9DA 4NM4L 1QP1A 5SWSD 5FYKU 2D7MA 5I1EL 1CK0H 3MRCB 3VFSB 1ZVHA 3R0NA 5EU4A 3B3IA 3OSKA 1YEHL 3E8UH 2JKXA 5D6CA 4XNYL 2UWEE 1YYLH 5GRVK 5TQ0L 4L4VE 1WCQA 1UWGL 1EAPA 1VESA 2XIDA 4LLDB 4J3VA 4X80H 3MUGA 4RAVA 5JW4Q 5CUSH 3O3UN 3NACL 1WSST 1BECA 1CFBA 1YUHA 2X4UA 3S98A 4L1DA 5DUPH 4R8WL 4IBLT 5E5RB 4L4TE 4LK4A 3P9LA 3GHBL 4Q0XL 1T83A 3KGRA 3BQUC 1NC2B 2NY5C 3T3PE 3QJFB 3DROB 3DBXA 5HY9B 2PW1B 4YHIB 3UYRL 2ENSA 1Q94A 3QCTL 4P23A 5T3ZD 5GGSB 4JO1H 3BFOA 1CG9B 4IDJL 3ROLA 3MRHB 3JV5A 1BFVL 5F7EL 25C8H 4LSSH 2BXYA 4W4OA 3U4AA 3QXUA 4N8VA 5HHMB 1VEPA 3OX8B 4N0UE 4RFOL 2RCSH 3MJ6A 3WFEH 4OAWB 1U3YA 3MFGB 3MODL 3OKLB 2WUBL 1W0WA 1QYGH 1MREH 1IGIL 2AS5M 3SDDB 5FGRA 3DSNA 3LEYH 5EBWA 2HFTA 3DSFH 4PJXB 5MERA 4JY5L 4L4JA 1CF8H 1BOGB 4BZ2L 3RAJL 4PJCB 5T5FL 4S1QL 1TVHA 4MXWH 4O02L 3U79A 4XMPH 1OWRM 3QDJD 3CAFA 3HB3D 3PHOA 4OF3A 5DJAA 1D9KC 4NHCH 2IALB 4WI4A 5EU4B 5IBLC 1NGYA 1YJDL 1G7HA 3B3IB 3L3OB 1NGZB 3L3JB 4DGVL 5D6CB 4M7LH 4NOBA 4U1HA 4Y2DA 3F7RA 5ADPH 5F70A 1LNUB 1KFAH 2OLDA 4YHML 1A1MA 5GGVL 4XPFH 5GXBB 3U4EA 3OZ9L 3TWCH 5K9QG 2FH6A 2DM4A 1QFPA 4KHXH 4M6ML 4JG1H 4KJYA 1IL1A 2FIRT 3C6LA 1IAIL 4W6WB 1LEGA 5HYSA 1LE5B 3QO0A 4UDUA 5FFLA 3H9SD 2CO7B 3OAYK 3P9LB 3C9NB 3N9GL 4OUUB 3CFJB 1OL0A 4GBXA 4HUXA 5A2JH 1HQRA 5MI0B 2V17H 1RJLA 2HJKB 4PY8I 4Y89A 1G7IA 4KRNA 4AMKH 1VEMA 3NA9L 1Q94B 4XAWH 5HDOA 5ILTH 4P23B 1Y6KR 3WIIH 4IMKA 1IBGH 1FBIL 2P47B 5HHQA 2OK0L 4MJIE 4HUUA 3Q6FA 4ZSOB 3WLWD 2BVUA 4JFQA 1QO3B 2P5WA 3AY4A 3QRGH 2J88H 3MGOB 1GPOL 2IPUK 2EICA 4P2QA 4Y4KC 3TIDB 1FL3A 5CJOH 4ZAKA 5FYKD 4HIEA 5TE7H 4YWGH 1U8HB 1CE6B 2P42B 1PG7W 4JFOA 4PGCB 1WWWX 1CDIA 3MA9H 1FO0B 4MLIA 1IAII 1OTUC 5GJSL 3VFRA 3I3BA 2A73A 3PWPE 5I71C 4X6DA 3WIFB 4JZJB 1ZOXA 3LZFL 5BZDA 5ICXA 3TCLA 2F74B 3BD5A 3U9UA 1MLCA 1P6AB 5HGBB 2FB4H 1DQJA 1ODAA 1XZ0A 1I1RA 3H0TA 1MRFL 4K7PH 1NGYB 3RQ3A 3LD8C 4ETQA 2UUDH 1FPTH 3U48A 1UB5A 3HA0A 3T0WA 2AJUL 3AXLA 4ELMB 3VXUD 4PIRF 3W82A 4G3YH 5L0QB 4R7DB 4RIRA 4CW1B 1I8KB 1PEWA 4FTVB 1MSPA 2FRGP 2YPVL 5F72S 4BKLA 2VDQH 3GSNL 2ARJQ 4ODSL 5EOCJ 1GIGL 4LSQL 5HYSB 1KTLA 3QXDA 3BKJL 1KYOK 3QO0B 5IROC 2ZUWA 2E27H 4JLRB 1WCBA 4LCIL 2BSTA 3E3QC 2R2HB 2DOCA 2BVOB 4XPAH 1PW3A 2VUYA 3FQUB 4JQIL 2YKLL 2VB5A 3QWOA 2OR9H 3OF6A 1I3RB 2HTLC 5HHQB 1JZ3A 4R4BA 2VL5B 1A6PA 5DMJB 3Q6FB 1W8NA 2JB6A 4XC3L 4NWUH 3Q3GA 1MCEA 1U8MB 2NMSA 5LXGL 4ODVL 2B1HH 4J12A 1S7UB 3IJSA 5CEYA 4U33A 2Q7YB 1EO8L 3VFWA 2VLKE 2Y7QB 3BMWA 3ULVH 3W5MA 3MV8A 3WJLC 4GXVH 2YPKA 4GSDH 5CILH 2A73B 4WEBL 1HCVA 4NO2A 1N6UA 4OLYH 4RAUA 4F8TA 4HFUL 1XFPA 3U9UB 2NY3C 2WNGA 3F7YA 3D3VE 4X98B 1JZ6A 4LVHB 1T1ZB 1Q72L 4HQQL 4LCWE 1UM6H 4HXAL 4M7ZC 1HSAB 3K1DA 4K3HA 3OHXB 5EUOB 1EEZA 4ZS6C 1XGQB 3V7MA 2IANB 2JIXA 2Z31D 5L88L 2CLRB 4G6JH 1TJGH 3QQ4A 4PS4L 2X4SA 5DJDB 2K3TA 2ED7A 3QI9D 3SKJL 3RTQB 3DRTB 4FQCH 1KTLB 4I5BA 3VXNA 1YY9C 1SYSA 2HTKD 3QXDB 1XT5A 4ZUTB 1Q0YH 1F4XH 3VRIA 4E41A 2BSTB 5HJ3B 4KTEL 5CEXB 4HIXL 4H20H 3G08B 1I8MA 1I4FB 2ZUTA 2FWOB 3QWOB 4PJHE 4IS6B 4KV5F 4UDTA 1Z3GL 4RQQB 1JWUA 2CJUL 3LRGA 4X99A 3W0WB 2K7PA 5D7SH 3K1KC 3X14B 3JWOL 3O8XB 3HR5B 3Q3GB 1INEL 5CP3A 4MXVE 4QRPE 2VYRE 3BGFC 4M3KB 5ESQA 5GSVB 1PY4A 1BIIB 4Y1AD 3PL6C 4G7VH 1QSEA 1T3FB 5CEYB 4OT1H 4L5FL 1LK2A 5B39A 1MAJA 4K7PX 5D7LD 2MSPA 3LHPL 4HJJL 1TLKA 4C56E 2BRQA 2MPAH 3L7EA 4JFZH 3REVA 4PBWD 4GLRI 3BPOC 4BQ9A 3HC0A 3MRBB 5HVGB 1J1PH 4R2GC 4K8RD 5FM5O 3MLYH 4XNZB 3V0AC 1T2XA 1QSZA 1BBDL 4UQ2B 3IFLH 3L3DB 2XZCH 4DVBB 1VFOA 1MFAL 1WVZA 5CGMA 2AW2A 5LGJB 4LF3B 1HHGB 1KC5H 4S0TD 1D6VL 1LK3L 4YDLB 2R1XA 2X4NA 4HUWA 1S7WB 3CXDH 5EBLB 4ELKB 5C0AA 5KVMC 4OZIB 3T1WA 3L7FA 1UWXK 4UIMA 3MREB 2ADIB 3HE6B 4MYWB 3H3PL 3AVEA 3JTSB 2OTPA 2AJSH 1LDPH 4IRSC 5FOBA 2OL3L 1OTSD 4WTXA 4PJDE 5I1HL 5E0QA 1JN6A 2IH1B 1F2QA 3FFCE 5GGRA 5D71L 2EXYD 5IHUH 5E00B 2DYPA 3B6SA 4HKZA 1JWUB 4U1MA 4X99B 3C87A 3WFBH 1RIUL 3QPQC 5ISZB 3AM8C 3BXNB 3U6RA 4PLKC 1CDBA 2V7NB 1NMAL 3GMQB 4NZTH 1EXUA 5ESQB 1LEIA 2LTQB 4PRBA 4HJ0C 4G6KL 1EHLH 1FDLL 4S1DC 1MPAL 1IMHC 1LK2B 3UTQB 5DMIL 3WUWA 3FN3A 1NDMB 4QTIL 4Q9RH 2F54B 3M1BB 5D7IB 2APBA 3MUHL 4XP9L 1KYOJ 5FDWA 1NBQA 3G5XA 1NGXA 3QIWA 3CZJA 3SJVD 1L7IH 2CIIA 3FOMA 3P0YL 4U4BA 5FO8B 2DQEH 4QRQA 2W0FB 3ULUD 2HJLA 1QRNE 3AREC 1BX2A 2MHAB 3ZKQD 4F7TB 4R0LB 2R1XB 2X4NB 3UJJH 5JHDA 2B8OT 2FATH 2VNCA 3PWVA 5D1XB 4Y4HA 5EOTB 1CGSL 2VE6A 3FRUA 5IVZB 1NSNL 1KV3A 2A83B 4JFHD 4DVRL 2PTUA 3BT2L 3P9WB 4EVNA 4HZAA 1RV6X 4L3AA 2XNAA 4Q2ZB 2DQDL 1R5WB 4PTUB 5FOBB 1BD2A 2R4RL 1O5DT 2YPLE 3GHEL 3VGAB 4DUVA 1LVEA 3BH8A 4YDKL 5CCKH 3QHTC 5F88A 5C0CA 3D87B 4WFGD 5FUOL 1PEZA 4MJ5B 3CFKA 3ARYA 3DV6B 2RAMA 2VXTH 2BX5A 1G7LB 4NN5B 1K3ZA 4Y2DD 4HWBL 2J6EH 4U6TA 4UOW0 1N2RA 3S3PA 2P7TB 2X40A 4UOW1 1TVBB 1RJYA 1I8LC 3N1PC 1C7TA 3N0PB 3PDGA 2C3HA 4LVOC 5C0BA 5KVFL 3AFLA 1AXIB 2IBZY 4ZD3L 5LGHH 1K4CA 3CLEL 3C6LD 3GSXB 5I75B 2MCPL 5DEGA 4DFIA 1JGUH 3BYTA 1WLHA 2VDML 2R56H 4GBXD 1U95B 1OSZA 3RA7L 5E5MB 5FDWB 1OP3H 4U1IA 3DTXB 3CSBA 3QIWB 5HHOE 4JFDE 4X5LA 1N6VA 1KN2H 5DRWA 1Q9WB 4NNPH 1N64L 3OMZA 4JPWL 2W91A 1GXEA 2VXVL 4H0HB 1Y0LA 1TETL 5ITFB 3OR7A 3QUXA 2UVFA 3WFDH 5E2UH 2HJLB 4L3EA 1UXSA 1B0RB 2P5WD 5GS0H 1JP5A 3DX9A 4JG0L 5I1JH 3LPGA 3IDMB 4CN4A 4ZNEA 3MA7A 4P2QD 1N26A 4GRLC 1JGDB 2OZ4H 4M6NL 4JPVH 4ZAKD 4U1GB 2PYEB 3V8CA 5D2LF 2W0KA 2VE6B 5F7DA 5BV7C 1GC1H 1N4XH 2A6DB 4RGOL 1QHPA 1S3KH 1MHPH 4KMTL 3ZTNH 4POZD 2AABH 1OCWH 2LAGB 3GMOA 1OGTA 4DAGH 4DN4L 3T0DA 4GUPB 2RIKA 1I9RL 1Z0MA 1EEYA 2CR3A 3RGVC 2Z9TA 2IPKA 2A38A 1PY9A 3AGVA 1F58H 5IMKA 1HILA 4MJ2A 1K8DB 3LKNB 4KROB 4U05A 5HGAB 5C0CB 4M6OL 3U7WL 5HI3C 2DBJA 1I75A 5J4MA 1QR1B 1JI1A 4QWWD 5CHNA 1DQLH 2ZKHH 1J88A 1DUZB 3C60C 1AD9B 3EDJA 5D5ME 2PTTA 2KH2B 1HHKB 3SPVB 5ID0B 3B9KC 3GBNH 4RFEB 3DRQB 5GISH 1ADQA 3GSVA 3TO2B 4F80A 5KN5A 4K55A 3HMWL 3T2OA 2QTEA 1F02I 2VXUH 3NCBB 3RIAK 5E4EC 1PKQA 4XT1C 1ONQB 3UCRA 4NBYB 5GGUB 5ITBL 2YD5A 4HXBH 1IC4H 2ZUUA 4JKMA 4WO4C 3H3KA 3MCLL 3ARFD 4G8EA 1NCDL 4JHBA 5E9DA 5I74B 4YXHL 5I1CL 1AI1H 5I0ZA 3BD4A 3I6LD 1AO7A 2YZ8A 3WDJA 3U0PA 4U0RB 3UPRA 4JRYD 3QUXB 1CN4A 1AR1C 3UAJD 4PJ7B 1HXYB 5FM8A 3MJ9L 2XN9B 1JGEA 5AZ2H 1XR8B 3IFNL 4KGLA 1MVUB 5KOMC 2DIJA 3VD4A 1EV2E 4MSWA 4PJ9C 4LAQH 1RMFH 1MQ8A 3UBXG 4LSUH 4AIXA 4O4YL 1IZKA 2G5RA 1CGYA 3L3GA 4M9OA 3MV8D 4WHTA 4NKDB 4ZUWA 3MBXH 3FJTA 4L3CA 4MNQE 4TUKH 2MOVA 2Z0BA 3RVXC 2W0LA 4GKNA 4KPHL 4OF0A 1ZT1B 4AEHH 2EH7L 4MZ3A 1BJ8A 4F9LA 1YY8A 2Y06H 4JGJA 3RVWD 1QFUL 3NCYS 3QFJE 5DS8B 4HC1H 3Q0HA 1LMKA 4YHYB 4MWFA 4KDVA 1J8HA 1N59A 2JIXD 1NCAL 4LLVA 4WI7A 4RWHA 3OJMB 5D7IF 2ICWB 3UX9B 1A7PL 3G04A 4WFHD 4YDIH 3DUUA 5IMLA 3WS3B 3NTCL 1INDL 1OAXL 1XGUA 4H25A 4KY1L 3TESA 2OS7A 4NYLB 2BJML 1ZV5A 3IU4H 1N5YL 4AYFA 4E41D 3RRQA 3O9WB 5AWNL 1MCQA 1HH6A 3DUSA 3QDGE 4P99A 1NH6A 4GG6F 1VGKB 3U0PB 1PYWB 1IAKB 4Z7OE 2ITDA 5EUKB 2RGSA 2X1WL 1MUJA 4IRJC 4OCRL 3I3DA 5D7KE 4H5SA 5GHWH 2ADGA 2X4RA 3O3AB 1H0DB 5KS9E 1QSED 5I19H 1WGOA 4MSWB 4ONFL 4APQA 4N9GA 1S7TA 4PUBH 5L8JB 3VCLA 3VI4F 5DMKB 9CGTA 2LAAA 3CUPA 3FO2A 4HGWB 1CXHA 3L3GB 1OQXA 3V4UH 3S6CA 4F7PB 4ZUWB 3HR6A 4P3WA 5F7FA 3K4DA 2XTJB 4NBXB 5DD6B 3BAEL 4M02A 3P73A 4W81A 1UQSB 2WIIA 2G75B 5F71A 4QKXB 4UTBL 2PN5A 5F1SA 3QCVH 2NPLX 3GIVB 4G5ZH 2WMPA 3B5GA 2GK2A 4C58B 3WO4B 3VDBA 3S4SG 3S37H 4LSVL 4LAJH 1ETZB 3VXQB 5C9JA 1J8HB 3MRIA 1FFNA 2Q6WB 4WW2B 2VN4A 1P1ZA 3V6BR 2XPGA 4UV7L 4J3TA 3VRLF 5C0AD 3PGDB 4HS8H 3UC0L 1IC5H 4MZ2A 1LILA 3STBA 4DFHA 1XF3B 3SO3B 1F8TL 4XMKH 5JHLL 2O5XH 1RUMH 1QBAA 5CMAB 3F6IA 1IC7L 2DDQL 3ZZ1A 3S4SB 2P43B 4P5KA 2Q86A 5F7UA 3QG7H 4AEFA 2HH0L 2IAMC 2XKUA 4PLOB 1JYVA 1ZHLA 5SWZE 3U46A 2OTWB 3D85B 4XBGB 1BEYL 2X70A 3LS5L 2YUZA 5J6GB 2YN3A 2DYPD 4FQHB 1XIWC 5D1ZB 5KBNC 3U30B 3FO0H 1T7VA 4HMCA 1P7HL 3CCHA 1II4E 3RZCA 2DICA 3FB5B 4PP1C 5JO5B 1RURH 1Q1JL 3G5YB 3RY6C 1PZ5B 3O4LE 4LVNC 2YOCA 1HINH 4UIKL 4N9GB 1GJIA 3NIDE 3PNWA 4KQ4H 4D9QD 1DQMH 3JV4B 2IH3A 4KWUA 2IG2L 5JW4M 3V95A 1CQKA 4JJ5A 4HZLA 4HG4J 2FD6H 3NFNA 1YPZE 3PV7A 5DD5H 4ZTOH 1X7QA 3KYNA 2DQGL 5I8OH 3H8NA 4WU5A 2VDRH 3HMXH 2J8UB 2WIIB 5IEHA 4YGVB 3FB6A 3V0VA 2FX7H 5EORL 5EPMA 5HDBE 1P84K 4MAYC 5EZJB 4LLUB 2ENYA 4WUUB 1IM3A 4MD4A 4WI8A 3I6GA 3K74B 3EO9H 4BQBA 1FP5A 3HHRB 5C0FB 1LO3L 4OCXH 4ZFOB 4I18A 4PJ5E 3ZE1E 1R3HA 5JHDD 4BUHA 1KLGA 1WZKA 2XPGB 4G8GA 1UGNA 3RJDA 4Y4HD 4Y16A 5C0IB 4WV1C 1MJ7H 2AXFB 4XPGH 2Y25A 4EOWH 4KKBC 1M7XA 1FGVL 1WJ3A 2QR0B 5EO1A 1AXSA 2D31B 3BDYH 2V2WB 3SDCB 3IGAB 4PJ7F 2OXGA 2OBGA 3JWDL 1BD2D 4NQSB 1NBYB 3DXAB 2HLFC 1K5NB 2BSSB 4JRWA 4NRYA 2CKBA 2J4WL 5DJ8B 1A6TB 1M7IB 1ZA3B 3L95A 3HUJA 1ROWA 3GEWB 3HG1A 2NX5A 5D1QA 4GT7A 3TA3A 3U0TA 4XVUC 1ZGLA 3IXTB 4QLRA 1HNGA 1F3DH 3INUH 1YJDC 1GAFL 4D0DB 2NY5H 4HFWA 3EHBC 5C7XL 1IGFH 1WBZA 1DEEB 1UKQA 1C5DB 1MQKH 4G9FB 5I9QB 5C0BD 2GAZB 1L0YA 5F7KC 5FGBA 2DS4A 1TDQA 2DLHA 2VLMD 3EW3B 3TFKC 4P2RE 2BMKB 4EZMA 3BH9A 4PJGA 3JVGC 1AQKH 1BQLL 4JJ5B 4NDMB 3JSSA 4L8SC 4PTTA 1T66C 5EFIB 1Z9LA 3PWJA 1X7QB 4PRPB 3MRDA 4PJBB 3D25A 3NIFF 1TTFA 5DTFA 4WU5B 3RDTB 3WFCL 3DHMA 3LB6D 1YNLL 4BQ8A 3O6LL 4XCCH 2XKNB 4H1LH 1UB6A 4Z95H 2EKJA 1UZ8A 4UTAL 4MD4B 2P24A 4L3ED 3HNVH 1TNMA 4Z76A 3A6CH 5IFJA 1N0LA 1MRDH 5F44A 5C6PB 1X5YA 5CSBA 4YHOH 5GRUL 3ULUL 2A1WL 2CSPA 4LGPB 4N90D 1KJVA 1JWSA 2HT4C 4FQ2L 2VLRE 4QCIB 3UPCA 5BRZB 1JZ4A 2AGJL 1I85A 4PRIA 3FL7A 5FF6A 1BLNB 4Y5YA 3HNTH 5CS7A 4EIZC 1I9IL 1FFOA 2OJZL 2LV4A 5CJQH 5J11C 2NYYD 2X1QA 3U7YL 4GMTH 4M1GH 4X6CF 2CKBB 1L0XA 3L95B 5FO7B 3ARDA 2V2XA 3U0TB 2I5YH 3TA3B 4D8PA 1KT2B 1JPFA 2YD7A 1XF5A 2LU4A 2P8LA 4YQXL 3EBAA 2FJFB 1UYWH 3RNKA 5T1MB 5F1NA 1RIHH 4Z5RA 4S2SA 2JJSA 4KRMB 5GSRA 1MJUH 5HDQL 5DK3A 3BKYL 5IB3A 2BCKB 4P46B 4U6HA 2VZUA 1AJ7H 2QSVA 2MKLC 4PJGB 3OR6A 5F96L 1QQDA 4F58L 2E7BA 1TQCB 3MNZA 4WFED 3SO5A 4WY7H 4DUXA 1KCRL 4OZFH 3UPAA 3SGDH 4DKFL 3T0EB 3ESUF 1IT9L 5E9DD 4WW2F 4YHLL 2C3WA 2APWA 3BD3A 3MXWH 5FKAB 2YA1A 4BUGA 1AO7D 2ARJB 1SBSH 3DHJA 4K3JH 3X11A 5CEZD 2BVTA 4CGTA 1OAQL 2BOCA 4IJ3B 1CFTA 3OKMA 4XP1L 5E1AB 1MIML 2Z91A 4AT6B 4B5EA 3H9HB 2QADD 4I3RL 2FCBA 4LKCA 1WWAX 1NC4D 1DBKH 2XQBH 4HIJA 5DK0B 1T0MA 4Y5YB 2XTJD 4WHYH 4KKNA 4MNGB 2XZAL 1KEGH 3I02B 3PP4L 2CK0L 3BKML 5EIIA 1FG2A 4I2XA 1MCJA 2EDFA 2F5AL 2BSED 4NQVB 5DR5H 3GKWH 1DQDH 1JL8A 5AYQA 4LCYA 1P84J 3KS0J 5C3TA 3ARDB 3TC9A 1U3HC 3HZYA 4YHNA 4F7EA 1JPFB 3FQNB 5E03A 2VIRA 1OGAA 2OR8A 3VFPA 3MRKA 4MD5A 5DT1L 2Q3ZA 4RBPH 3K8LA 2JCCE 5ALBH 4LBEA 3ARSA 5GGVY 2ZUXA 3QDMA 5KSAC 2Q1EA 2G2RB 1CK0L 4U2ZA 3RP1A 2NW2A 2J8UF 3G9AB 3X17A 3IVKB 5JR1L 5GSRB 3BQUA 1ORQA 5CD5D 2ADJA 32C2A 4O5LH 4PJ8C 3MUZ1 1WFTA 1JRHH 2B7DT 4OTXH 1YYLL 3DMMC 5JZ7C 1RVFH 5J9PB 1D7FA 5ANMA 1L0QA 2EKSA 4LHUA 5CGYC 3WL9B 1S9YB 2GW5A 1KLUA 1YEGL 2P5EB 4X80L 1HYSC 3MACH 1CE1H 1X5LA 3BPLC 1MFCH 1CI5A 4LQFL 3TYGH 5H35B 2E3VA 2PF6A 3F7VA 1IGTA 4KZEL 1ZANH 3VXRE 5DUPL 3P4MA 4CDHA 3TT3H 1A3LL 5H2BB 3GRWH 1CFTB 5F9JA 4JFYB 1PVHA 4P9HL 43CAA 5BS0B 4DGIH 4PJEF 3EZJB 4APQD 3OQ3B 1CTOA 3QXVA 4YAQA 3S35H 2XICA 5E2JA 3MOBH 5BVPH 4HIJB 2J7LA 4LSRL 3VXTB 1G7JA 2WBWB 5JUEH 2WBJC 4LSSL 3VFOA 1MH5B 1D9KA 1VFAA 4R26L 5J3HD 5C86A 4HGMA 2AV1B 5DZLA 2OTUB 4HBCH 3CVHA 4TQEH 2DMBA 2EC8A 1FVDA 5I16A 2VLJA 3KLAA 1QYGL 2YA0A 4MS8C 3HZYB 1AHWC 2R0WH 3LKQA 3DX8A 4G6FB 3FT2A 5KVDH 3ZT6A 3NAAH 4U6XA 3QNYB 4LBEB 3S97C 4LIQE 4PJBF 2XG4A 5T1KA 1T4KB 2IFFH 5IQ9B 4KUZH 1HHHB 4ODUB 4P49A 1H3VA 4NHCL 4F57H 4LNRB 4M7LL 1XAUA 4QRTA 5ADPL 2FO4B 4TPRH 4J4PC 4NQXA 1KFAL 5ANMB 5H37H 4H1LG 5HHME 3OKKA 3TWCL 2QKIB 2W1NA 4KHXL 4JG1L 4KV5E 4BSWA 4Y4KA 3ZL4L 3A6OA 4N0CD 4N8VG 1OPGH 3K2MC 3KAAA 2GJ6A 2OCFD 3G5VA 3RZCD 3WFHB 1PSKH 3SE3C 3B2UD 4NT6A 1QLFB 1Q9KB 3I50H 3MRJA 3X12A 4C54A 4H1LB 4IRZL 4KDWA 4FQQB 5BZWA 5EH1A 1P4IL 3BRGC 1E4JA 4JDVA 1MY7A 4PJCE 5DURD 4WW1A 5ILTL 1SJEA 1NLBH 1T2QL 2DIBA 1GL4B 5IMMA 1KJ2H 3P4OA 1D9KB 2NW3B 1HH9B 3IF1A 3QRGL 4PJFB 4MMZC 4WWID 3U1SH 1J18A 5TE7L 3BDXA 4YWGL 4LGRB 4Y4FC 4GKZA 3SDXA 2NR6C 1KACB 5MEQA 1NGQL 2DLGA 5A2IH 2C1OA 3MA9L 1UA6L 3ABZA 3NGBC 5E8NA 4O2FA 5HHNB 5EDXA 4ZUSA 3NOIA 4U6XB 4G8GD 4BH7B 3WO3B 1NCCL 3T4AA 3BPNB 4Y16D 5IROA 1QNZH 1KPVA 5CINH 4LL9A 2WW8A 3V79C 4L29A 4YH6A 4OZFG 5I8CA 5J6HB 2FSEB 4X5WB 1KPRA 4G8IA 4H8WH 1LDSA 4HSQA 1MF2L 1KJMB 4ZSOE 1H5BA 4J23A 2R23B 3RWGA 1T1WA 4NO3A 4NQXB 3TO4C 1FLRL 3EYOA 2Y6SD 4G3YL 4GAGH 4OGXL 3OKKB 3S35X 3VWKA 1FZJA 2GSGA 1UM4H 3TVMC 1ND0A 2VDQL 3MRGB 3HG1D 5D1QD 2NX5D 4MD0A 4OZFB 2ATPB 2YSSB 3CFEA 5I6XB 3O6FA 1WZLA 3G5VB 2IEPA 3ZHDA 2ICEB 4HH9B 3WJLA 2KZWA 4NT6B 5ADOL 3MV9D 1S7XA 4XPBH 4XPAL 1F3JA 4FQ1H 5EC1B 2EC9U 2FLBT 2OR9L 4FFWC 4WHYG 3UYOD 2GKIA 5I71B 3SQBA 1WAAF 3RKDD 3UZVB 3NPZB 3WSQH 1SJEB 5C8JA 2D3VA 4JKPH 3MR9A 5AYUH 4ZG1A 3ZDXF 3ARPA 1DSFH 3IF1B 4K2UH 1C5BL 3ILPA 1MFBH 4NC2B 3L1OH 1MHCB 4FTVE 3SGEH 4NGHH 1NAKL 1KPUA 4UQ3B 1WEJL 3ULVL 4KTYA 2C1OB 4LMQI 4LLAA 1CLYH 4GSDL 3RFZC 4QRUB 5CILL 4OZ4A 3FAXA 3OGCA 1P4LA 4I3SH 3EJYD 4OLYL 4Q58C 4I4WB 2I60H 2HVJA 1HWHB 1LO4H 4GAJL 1TZIB 5GGTA 4PRID 4PG9A 3O3EB 4UOJA 5DYOB 4B41A 1UWEH 1AGDB 1X5JA 5SV4A 1Q0XH 5DQJA 5HI4D 5IBUB 4ESKA 1RK1B 4G6JL 2H45A 4Q9CA 2IFGA 1MHHA 3MRMA 4MNHA 2AI0L 2CUMA 1DE4B 1JCKA 3SCMC 4PGBA 1PJ9A 4FQCL 5DFVC 5D8JH 4C4KO 1RQ5A 2I27N 4TNWK 1BZ9B 4QHNA 5DUMH 1F4XL 4LLMA 3HAEA 1UEMA 2BRRH 3PHQA 5KVGH 5FCSH 4H20L 3TBVB 1I1AC 1F3JB 3KLSA 4F37K 1P2CA 1E27B 4P59H 4QF1B 4X9HA 4YPGB 8FABB 3BSZH 5DEFA 4V1DB 2AK4B 2NY3B 3LRSB 1HQ4A 3MR9B 2R8SH 4KRPD 1RZFH 3D9AL 2IANE 1XF2A 5T3XH 5CJ5A 5BV7H 4M7ZB 1A3RH 4Z7WA 2H26B 4JO3L 4OT1L 3AUVA 3GJFA 5D9SA 1KJ2A 3RVUD 2UUDK 4XBPA 4KZDH 5JORB 5GJTH 1INQA 4JFZL 3RX7A 4UT9L 3VD9A 3TT1H 4UBDC 3UTTB 3VD3A 2VZ3A 4C83A 4XI5D 1RHFA 1J1PL 4DZBA 2BOBA 1YEDB 3QJHB 1SEBA 4IRSA 3P4NA 5D2LE 3MLYL 3VI3F 4X8JB 4H26A 5DMYA 1HCFX 3IFLL 2XZCL 1G7QA 5IJKA 4F3FA 1Z9OA 2EEAA 3B8SA 5IVXB 2EXWC 1WF5A 3W0WE 2SEBA 1GGUA 2JK5A 3E2HC 3RBSA 1KC5L 3GM8A 4UI2A 1AGCB 1RUKL 3QHFL 4HH8A 1V8HA 1P5VA 5GS1C 4X83A 2YC1B 4QEGA 5IHLB 5TH2B 3OKDB 2AK1H 1PLGH 3HZMA 3PL6B 3ZHLA 2PR4H 2YWYA 1OGAD 1RIVH 2N1KA 4OZHB 2R0KH 4KK6D 5LGKA 3EO0A 1LDPL 2GHWB 4L9DA 4Y19A 2VISB 3QDMD 4PJFF 1EHNA 3ARBC 4PV9B 4OQ1A 4IMLB 4JHWL 3VWJC 3BQUD 1N3NA 5ENWA 1J87A 2ZG1A 5IHUL 3OPZH 1HSBA 4NFCA 4O58H 3EFFA 2EYRA 3WKMH 4PRHB 3MLWH 2C3XA 2LABA 3TN0C 2EH8H 1DUYB 1J1XL 2BY1A 1E6JH 5EO0A 1HQ4B 3DVNB 4YDVB 5IG7B 4LHUD 2HT3C 3OXSA 1CDCA 4NZTL 5E08H 1XF2B 2NY0D 3AREA 3Q5YA 3VXSA 3EDDA 1EHLL 3OJDA 3CH8A 3LKRB 1KJ2B 2DM7A 4LP5A 5HVWA 2W07A 4XBPB 1NFKA 4U1SB 1P5UA 3STZB 1A7OH 2VDLL 1NAMA 4Q9RL 2AJVH 2Z35A 1DBAH 1QEWA 3ZT5A 4ZFFB 4ODWA 2NXYD 1JTOA 1D3CA 2BOBB 1U92A 3GI8H 5E6ZA 3O41B 5KZCD 2R1YA 4U7MA 2UWEA 1TTUA 1U8KB 1GGBH 1SJHA 4XP5L 1V3LA 3KYMA 3VGHA 5ICZA 5J0BA 1CYGA 5DSCA 3LRHA 4QGTA 2HRLA 4CVUA 2ZCLH 5IBLD 2X4TA 3BZEA 3CK0H 5ISZE 3NH7L 3UTPD 4JHAL 1J0IA 1BF2A 3QUYB 1RZ7H 1DBBH 2YEZB 1X44A 2VLJD 4Y8AA 5BW7C 4U7SA 3A6BL 3HZMB 5JLZB 4M8QA 4JZOB 5LAXB 4OCLC 4R7NA 2F54E 5D7IE 4HKJB 5T1KD 4NQEA 3D18B 3STLB 3WUWG 4J3SA 5I15H 1HSBB 3EYSL 2DWEB 5C9KA 3HC4H 4U1KA 4N0UA 4KJWC 1E0OB 1ZSDB 2R0ZH 3SQOH 1U8LB 1A9EB 2FX8H 4QXWA 3DVFA 1DVFB 5HGHA 4OM0H 3BW9B 5E2TH 4WDIA 4X6EB 4HMDA 1CGTA 4R9HA 1JYXA 4CMMB 5DHYB 5LGHL 3WHXA 5GGQH 4Y4KD 1YNKH 2NY2B 3X3FH 1YEEH 5ALCL 4GG6E 2VTFA 5HGDB 1JGUL 3BE1H 2GJ6D 2L7JA 3THMH 1M71A 2R56L 5C1MB 4ALAL 5INCB 2P8MA 12E8H 1FNSH 1MELA 1OTUD 2M2DA 4LRNH 4YE4H 4N1HB 4LMQE 4OLVH 1KN2L 3PWUB 3FRPA 3IDUA 3WIHA 1KNOB 1N5AA 2VAAA 3VI4E 3RGVA 1L9MA 1HHJB 4L4VB 5HBBA 3KYMB 3TPKA 5E6IB 3VRJA 2BDNL 5E5UB 4X7SH 3FTGA 1FVEA 1H3PH 5I1JL 2D9CA 4NKIH 4JPVL 4IM8A 3C60A 3GBMH 1RZ8A 3BGMB 1BM3L 1GC1L 1N4XL 4L4TB 3B9KA 1CICD 2GY7B 1ES0A 2HFFB 4LVOB 5KSVA 1S3KL 4M8QB 5FUZH 3ZTNL 3UTZA 5TE6H 2DTSA 4NNXB 3SE8L 2CLZB 1A2YA 4EDXB 1NMCC 4Z7UF 4LARH 3DGCR 3RL1A 4HUKB 3VRLE 4ZFOL 3MJ8B 1JUFB 4MJIA 3B9AA 4WO4A 4JGUA 1AGFB 1JHTB 3ES6B 4LSDA 1EFXA 4YBHA 4KK8C 4N0UB 2W65A 5HYEA 2ZKHL 3MLRH 3VXMB 3EFDH 3JWDC 3VWKD 2HMIC 3SDDC 2W9DH 4HJGA 1IGMH 4XXCC 3VH8A 4LKXB 5D70L 1OP5H 4GRLB 4G80B 2FYYB 4PJ9A 2VERN 3PWPA 2VXUL 3O6FD 5LBSH 1NCWH 4PPTA 1R3KB 3QUKA 5BV7B 5IVXF 4OCYH 1IC4L 4FOMA 3MRRB 4LFHD 4UT7H 1C1EL 2DQJH 1F2XK 2ZJSH 5DO2C 5JMRA 2R2EB 1JYNA 5HVHB 1AI1L 3BPCB 2V2TA 3VE0B 3V52L 3EGSB 4QTHB 4Y5XA 3EOBB 1DL7H 3LN9A 3IKCA 2QHLA 4TVPH 5K59F 5KTEL 1MLBA 5AZ2L 1NUDA 1A4JA 3HPLB 2IQ9L 2ZCKH 3LIZL 2BNQB 4ZS6D 5C0RL 3QZWA 3C60B 4LAQL 5AD0B 1I1YA 2EEDA 1RZ8B 5T1DL 4WU7B 1CD1B 5IW1A 5JW5B 5MI0C 3B9KB 1A7NH 3HZVB 5KANG 5B21A 3UTZB 4QYOB 4Q7DA 3WV0A 5E8EA 3WCYA 2APXA 2XV6B 3C8DA 1NL0L 4PJAB 4AY0A 2YXFA 2WIMA 5E4EB 1WITA 3O3DA 4XCEB 1OTTC 4WVRA 1RULL 4WO4B 4HC1L 5TDOA 1FNLA 4DKEL 1EFXB 3EYFA 4RMSA 2VITB 4PJ7E 5GZND 2XWTA 4BH8A 2VLKA 4S0SD 2XN9E 1U93A 4LLWA 3S36L 5FDYA 4FP8H 2FX9L 2I9LA 5JW4N 4IRJA 2E6PA 4YDIL 4HEME 1OM3H 3KLHC 3BJ91 2HT2C 3QA3A 1RU9H 5DHVA 1QA9A 3VFMB 4EI5C 1NEZA 4JPIA 1G7MA 4G43A 4JZJC 1TXKA 2CKBL 3KPRE 4ZPTA 2GTWA 3B43A 4EUPH 3BZFA 2CIKA 5F97E 5IB5A 1PQZA 3D3VA 1XGTB 4R4ND 4E5XB 1KIPA 2DQCH 1XCTA 5ESAA 3R0MA 4LCWA 4YXKL 4R2GD 3RUGF 3QXAA 1A8JH 2HKFH 5IEKB 2GITB 1MLBB 4ONOA 4JJHA 5GHWL 1WC7B 4EBQL 1V3JA 3ORJA 3NIFE 1YMMA 4PUBL 3TBWA 3LS4L 1CLCA 4NKOB 4YPJA 4QXTA 3V4UL 1K85A 2D4DA 4K94C 2O61A 1U42A 2FIKA 4PJHA 4UINH 4ORGB 1K9TA 3SGKC 1IEHA 3BN9C 3PDOB 4BELD 5JNYA 1H3GA 1SBBA 4HPOH 4IRSD 3VA2C 1AD0B 1X9QA 2RB8A 2UYLA 5FYJH 1S7VB 4BSVA 2IAMA 4XWOC 4MA3B 5I76A 2YBRB 1Q9OA 3GSOA 3GMRA 4QRPA 3IKKA 1YN6A 3K4AA 3EYFB 5A2LH 3S37L 1XIWA 1R24A 2XWTB 4BH8B 4FFVC 3OB8A 3LOWA 4CMHB 2VKWA 4HS8L 1JNLH 2C1PA 4X6CE 4C56A 2WZPD 1C16B 1S5HB 2ICWJ 3V4VL 1IAOA 1NEZB 3RY6A 1NUFA 4HJ0D 3KYKH 4BZ1L 4XMKL 5GIRB 2ERJC 3UJIH 3TIEA 5C6TH 2GYSA 3HI1B 3KWWA 4L8BB 4Y19D 3IDNB 3QG7L 5EZOH 1NUNB 5T33H 3D3VB 3RU8H 5HYJE 3TV3H 1J10A 2FJGB 2DQUH 3FB7B 3MBEB 1T04B 5A3IC 4G42A 1IGJB 1NFDB 3FO0L 3GFUA 5K9JH 3RTQC 1BMGA 4F2MB 4Y2OA 2VZTA 1EDQA 3QAZC 3ARED 3OKOB 2V9TA 4FABH 2XQYK 4QHUB 3VXSD 2ESVB 4JQXA 1HINL 1ZT4A 2G9HA 3A67H 3K2UH 4FQXC 1OOAA 1DQML 2C9AA 5ERWB 1U58A 1LO0H 4OGAC 3OTTA 4WV1A 4M61B 4XZUB 1I7UA 2QSTA 5GS2D 1F5WA 2FD6L 5IFAH 3MNWB 1ZWIB 4JB9H 4MCZB 1ZLWH 5DD5L 1EMTH 4HUMB 5FYLH 2BC4A 2GUOA 3VFUA 3VU2A 4ZTOL 5BXFB 5I8OL 1RZJH 1P9MC 3VFGH 1IKNC 2VDRL 4OV6F 1W0YT 2FX7L 3O8XC 4JFPA 4O2CB 1FORL 2VDOH 2IADA 2IAMB 1CU4L 4FFYL 1ZAGA 2ZCHH 1ZLSL 1YN6B 1MWAH 1JHKL 3ZKND 1T21A 3TNMB 5E99H 4OCXL 3P77B 4XPHH 1XIWB 5GRJL 5KSBF 2ICES 3IS0X 4ZFZA 2RBLA 1U8NA 1IJ9A 1PFCA 1E28B 2C1PB 1R0AH 1MJ7L 2CDEA 4EOWL 4Z7VA 4OLUH 3FO9A 5T3ZE 3BDYL 5CSZB 1RZKC 4LVNB 5B38A 1LE9A 7FABH 2AJZB 3P9MA 3OKEB 3FQTA 2PETA 5LG1A 3JVGA 4JZNA 1OHQA 3Q1SH 3C5SB 4W6YB 4NQED 3T3MF 4JO4H 1OVZA 4QRRB 4L8SA 2BVPB 1JPTH 1JPGA 4XVJH 1QRNA 2J8UE 3H6JA 1JGVL 4RDQG 1YYML 2XFXA 3L9RB 4Q9QH 4WUUE 2Z4QA 4MAYB 2NY5L 3JV6B 5JPNA 1M05A 2BVEA 2JLLA 2XRAH 4O00A 1MQKL 4POYA 4RGNB 1MCPH 3HE6C 2UZIL 2PXYB 3IDIB 3M45A 4FXGB 4G7YH 4YGAB 5ID1B 4K07A 2XA3A 2G9HB 5I1DA 5FHAL 1V7ML 4NHUA 3MNVB 3MXVL 1AQKL 3QEQB 5C2BH 4PJDB 4G6MH 2YPLA 2I07B 5DRZA 3LEXB 3FFCB 4QY8A 3T0BA 1MFDH 1U8OB 4PJEE 2X05A 4FZEH 3RGVD 1VB9A 2FBJH 4IOIB 4XCCL 4Z6AT 3AU1B 3GUTB 2APFA 1B4JL 3ALXA 4Z95L 2D03H 1L6ZA 2LTQC 4LSTH 5DJZA 3BIBX 1HKLL 1CXIA 4JGMA 1W72H 4ZTPH 2CK2A 1MRDL 2ZZUT 3U0WH 1NEUA 3FQWA 3I3EA 4G9FE 2F53E 5HYQA 4EUPG 4CU7A 2F19H 3GJEA 4NC1E 3B9KD 3IRZA 2KDGA 3ARGB 2J3SA 1QHOA 3CVHL 4HV8B 3O11B 4OZGA 4Z8FL 1C7SA 3HNTL 5IHZB 5K9KA 2X10A 3F58H 1BVZA 4JFDA 4WWKB 3RJQB 3W9EA 3SE4C 2I9TB 4JZNB 3AAZB 1LD9A 2JJTC 2M8XA 1K6QH 4HHAA 4N5UA 4GMTL 4M1GL 3VJ6A 4L9LB 1GYAA 1UCBH 4PRPE 4MJID 4PJBE 3SGJA 3O45A 4NKQB 3PGFH 1QRNB 3VFTA 4EUPB 1C8PA 4EN3C 2DJUA 4R0LC 4GAYA 2I5YL 3D39B 2E9IA 5IJVA 3W2DL 4P3DA 3FOLB 4FQLH 5D1XC 4E42A 1P69B 1I3GL 3QO1B 1AR1D 1UYWL 5BMFH 5IMOB 4NSKA 4HCRH 4NPYB 2N56A 3QIUB 2FHFA 4P2CG 5D2NE 4YFEA 3MV01 2JB5L 3CMGA 4GW4A 4PJ9D 1AJ7L 3V2AR 3PWPD 1KJ3H 2AXGB 5HHVH 2MMXA 1FIEA 1UVQB 5BRZE 5CWSB 2Q20A 4WY7L 3PXJA 3VDAA 4PYHA 3D2UA 2VDPH 4I0CC 3V5HA 3KPLA 1CFQB 4NN5C 3CVIH 1BJ1H 3MXWL 1MJJB 1XH3B 4XRCA 3WE6B 2N7AA 2HYMA 2I25N 1DANU 3D69A 4KJPC 3AS3A 5J11B 4OSUL 1SBSL 5D5MA 1T5WB 4PRAA 5KSUA 5I1GH 1UXWB 3QQ3A 1FNHA 1U3HA 5B22A 2YK1L 2DTML 4N0RA 4IEFB 3MLUH 5JA9A 2MJWA 1QLRA 1S78C 2ZUSA 1A5FH 4WJ5B 1EGJA 3VXPB 4GRMA 4XVTH 4ODHH 1FFQA 3QSKB 3I6KA 5IGXH 1DBKL 3MUJA 1U9KA 5KSAA 2XQBL 2LU3A 2WWMC 3GGWA 4OB5H 5BOZG 5I30H 5DD1L 5C0NC 1URLA 3SKNB 1NFDF 1MCOH 5HHOB 4OD3H 4NZRH 1KEGL 4ZXBA 4PJ8A 2E6JA 4GAFB 4AZ8A 4DN3H 4X5XB 4G6AD 3T0EE 2Y07H 1G9MH 3DMMA 3SGDI 1WWCA 1J0KA 5MEPB 5DR5L 3GKWL 1DQDL 3T2QA 5E1HB 1XGPA 3C2SA 4AENB 1RZGB 4OIBA 3ALPA 5KVEL 4QT5B 1FL6A 3V5KB 2MQ0A 5DJYB 3KPMA 2VLKD 3BO8A 2FHCA 4BFIA 2EDXA 1IEBA 4TTGA 5ALBL 3MMEB 5C0GA 1HXMA 4V2BA 4IRJD 3VD7A 4P57B 3RWCA 3UDWC 4O51A 4MNQA 1EVUA 5AZEL 5TDPB 3NZ8A 4F7MB 1T20A 1KCUH 3RWDB 1ZHKA 1RUQL 4CU6A 1JRHL 3AMKA 4OD2A 3V6ZA 4NO0B 3QFJA 4LU5H 4X4MA 2F5BH 4U1LB 3QNZA 4FNLH 4MNGE 4MQ7A 4TSAH 2B5IB 1NBVH 3S96B 2CDFA 4LCWD 3MACL 1CE1L 3BP6A 1MFCL 2NNAA 1BBJA 1WAAE 4X7TB 1JWMB 1AGBA 4ZMAT 5KSUB 4XTRC 4YHZH 4AEEA 5DQ9B 4D94A 4DZ8A 1CFSA 5L6YH 3ZDXE 4PY7A 1FNEA 1RFDL 1IZJA 1YMMD 2HLAA 5FCUL 4KQ3H 1MWAB 5I2IA 2DBLL 3DYMA 3QG6A 5GZOD 4IIQC 4NP4H 2DI8A 3WJJC 5JUEL 1D5XB 1C5CH 3R4DA 5I74C 4RMWA 4U7KA 3FT3B 3QDGA 1JRHI 3SKMA 2R2BB 1A6VH 5DA0B 2D7TL 2YMXH 5TGBB 3HS0A 5I8KL 3RPKA 2H6PA 2X1PA 4Y1AE 4TQEL 4Z0XB 3DMMB 1JPSL 4J4PA 1R5VB 3B9DA 2EO1A 4NQCD 3B2VH 2P5EE 3F6LA 4FZ8H 4LDEB 2OL3A 5F89A 4Y5VC 5D7LE 4QRPD 5EN2B 5CZXC 4K7PY 4RDQF 3BPLB 2R0WL 3KR3H 5KS9A 5F9OL 5ESVA 5TDNA 4GH7B 1MNUH 4MQTB 4RWYH 3NAAL 2XXMB 1I8IA 2DJ4A 5SWQB 4C56D 3T77B 1QFWL 4PP1D 5BS0E 2IFFL 1F6AA 2GEEA 3HC3H 1FCGA 3FMGH 4KUZL 5DXWA 2AJ3A 4V2CB 5ICYB 4XP6H 1X5GA 5IB1A 4F57L 3V6ZB 4KJQC 3QFJB 1BREA 4TPRL 5EZIH 4PGEB 2WBJB 3QCUL 4CU8A 4YDJA 3BIKB 4XMLH 4NQDA 5BJTA 5JOEA 1IC1A 4KAQH 3V7AE 4K3EL 1OPGL 1C12B 4EI6A 4Y4FA 4FXLA 2FZ3B 3Q5OA 3FQXA 5FV1L 4HPYL 4J8RB 1CFSB 5IT2L 1AHWB 2ZSVB 1VGEL 3HRZB 4OKVA 5DJCA 4ZOBA 1J0YA 1QFWI 1W72B 3O9WC 1G6VK 1W0VA 1NLBL 4JN1L 4KKBD 4IHOA 4RBPK 3EDEA 1KJ2L 5SWZA 5T1LD 1U8QA 5DRXB 1FJ1B 4QXGH 4MDJA 1YECH 2NXZB 3C2AH 3CH1B 3P11H 2A0LC 1KXTB 3HZKB 3RNQB 4P2OB 3TO4A 3VI3E 3QIBB 4AQOA 5F89B 1RAMA 1S7QB 1YDPB 1T22B 3G6AB 3MJ7A 3TVMA 5IQ7L 2GCYA 3GZKA 5IIEA 3O4LA 5HYFA 3E6HA 3T65A 5TDNB 1YEJH 3H42L 1F4WL 2H1PL 1QNZL 3N85H 2A6JA 5CINL 3SJVE 1M7DB 4J7RA 1T80A 4EIGB 5D7JC 4TULH 3DETD 3ROOA 2HKHL 1YPZA 2JJUA 1F3DJ 2H32A 3TFKD 5DZOA 2Z8VC 1LO5B 3MRQB 5DI8B 5HI5C 2CD0A 4HKXA 3WO4C 1YEKL 3BWAB 4GAGL 1T66D 1NCNA 4PJFE 1UC6A 1A6AA 3RHWF 1CFNA 3HPJA 4NO5B 1A47A 2OP4H 1OWWA 4WW2C 2VLLB 1S9XB 2BFVH 4MA8L 4P2YA 1BZQK 2C7UB 4PJ5A 1JNNH 4EKXA 1VACA 2FO1A 2FDBP 3FQXB 4W68A 3X3GL 1A1OB 2VABB 1A6ZB 1TQBC 4FQ1L 2EYTA 1NGWB 2E8YA 3GMNA 3LKOB 2JELL 1JHLH 4WFGE 3WEXB 3NA4A 4JKPL 2YPLD 1HIMH 3OAUH 1ACZA 1ZK9A 5AYUL 3BUYA 4P4KA 1J12A 4YBQC 3C5ZB 4PRDA 1SJVA 5D1ZC 1NAML 3R8BB 4M43H 1D6EA 3FT4B 4P48A 3RPIB 1CDYA 4J1UA 4HUVA 1VKXA 2HA1A 4NGHL 5FK9A 3TO4B 1X5KA 2IWGA 3WHE0 3WNMA 4P5TD 2WUCH 2GSIB 4AG4H 2GCYB 1MCWM 1CLYL 2DM3A 3KHOA 5K33A 5FB8B 2CH8A 3T65B 5GS0C 5JA8B 4P2RA 1OT2A 3KPTA 1FG9C 4ODTL 4K9EH 5E8OA 4D0BA 4NZUL 1BFOA 1QSVA 1JE6A 2I60L 2X7LB 4YHPB 1KENH 5BO1L 1H15B 1I1AA 5IM7A 1YPZB 3LSOA 5EU3B 4JM4L 5I18H 4JFDD 1G1YA 1Q0XL 3VG0L 2IBGA 5E2WH 1MCNA 4HIIB 2PYFB 4LCCC 4PB0L 2VUOA 5HSFA 1AFVH 3GMMA 5ELIA 2EECA 1QZ1A 1CLZH 4HWUA 2W9EL 3KPOA 4YXLL 3HI6H 1IQWH 4PJ5B 3SGEI 2AP2A 1B3JA 1X4ZA 4QOKB 3LQZA 3HRPA 2EDRA 1I7ZA 1UJ3A 4MX7A 2OI9B 1CBVH 2A9NH 3MFFA 1CLOL 3UJTH 5KVGL 4XCYA 2VLRA 4JY4B 3T8XB 4TNVK 4Z78A 1EUUA 4P59L 4YJZL 4U6YA 2Y36H 3BSZL 2GFBB 1KEMH 3U2SB 3FO1B 1F90L 5DJ2A 5F1IB 3IJHA 3D2UD 2R8SL 2YD9A 1RZFL 1V5JA 2HG5A 2XWJA 5MP6H 3NPSB 4QHMA 5T3XL 4LIQH 5BV7L 3W39A 2FLRT 1C08B 3EOAA 1A3RL 1MCFA 3EO1A 4LLYA 2ZG2A 4HUVB 5EZLA 1F42A 3ILQD 4XNMB 5I9QC 4KZDL 3BX7C 5KW9L 4NRXA 1AGEA 4NC1C 3WIHL 3TT1L 1UG9A 4OJFH 4WNQA 3SCMB 3VGFA 1U3HD 1J05B 5E8DH 3NCEB 3GBLA 3WLWC 1QFOA 4GKOA 3N50A 5SV3A 1UJTA 4JFFB 5DC9B 2Q8AH 3MRPA 5KSAD 5DDHA 1GZPA 1I1AB 3ARBA 2HFGL 4HS3B 4JRYE 1KF9B 3VWJA 3HAEG 4V1DE 4OUOA 1KN4H 4TUOB 4ZXBD 5JMOC 1VEOA 4M5ZL 4PJ8D 1A14H 3L3IA 3TN0A 1AY1L 1HHIA 4Z7UE 4FQPA 5J12C 2V9RA 3GMMB 4NUGL 2UVEA 1X6LA 2W60B 3PGCA 5D2NC 1SYVA 1CT8A 2AK1L 4HWZA 1MEXL 1DDHB 1G0XA 2PR4L 3C09B 1BQHG 2CXGA 2A74B 3TPUA 4MX7B 5C08D 1F6FB 2EDDA 4X6BA 1JMXA 5JPMA 2DAVA 1NJ9A 4MNQD 2DKMA 2B0SH 4G9DB 5HD8D 3WKML 3L5HA 3MLWL 3LQMA 4QHLA 3K3QA 1QBMH 4M7KL 5C07A 1E6JL 2AXHA 1BQHB 5IVXE 1TZHB 2BNRB 5DVLA 1BQSA 1R5IB 2XWJB 5E08L 3MCKA 4QHMB 3E2HB 4JPKH 1RJZA 3MV7B 4PR5A 3NFSL 1CZ8H 4P4RA 3QEHA 1KIQA 4TYUA 3ZT7A 4RMVA 2WLZA 4NRXB 3SE9L 2JCCA 1A7OL 5GS1B 2MQ3A 5BW7A 4OGYH 5K59E 4MS8D 4P46C 5GRVL 1D5BB 3WXWH 3F12A 3ZKSD 3GI8L 2IC2A 3BEVA 3S34H 1TCRB 4ZUVB 3T0EC 4FMKA 2AJYH 2WV3A 4PGZA 3CDGB 1SMOA 2BNUB 4PRHE 3DURA 3QDGD 1JNJA 3CK0L 2ZOLA 3MGTA 4AJ0A 1HHIB 4TSBH 3CU1A 3R1GH 4TOYL 4TN9A 3UZQA 4J4PD 4CVZA 3VXRA 2DQFA 1RZ7L 1DBBL 4IJ3C 5DVOA 4MHHG 5I1IL 2RHEA 2Y5EA 3PGCB 1R3LA 4R90H 4HK0A 4PGDA 3PIQA 4XCNA 3KJ6L 3HKFA 1JPST 4KKAC 1OF2B 4I0KA 2B4CC 4OM1H 5AAMA 3QQ9D 4NKMB 3VFSA 2ZNWA 5JPMB 1NJ9B 4RISH 2DQHH 3VMNA 1CFVH 3WLBA 5FA3B 1PG7L 2YS4A 4KXZI 1TZGH 3QI9C 5E56A 5F1KC 1UACH 2BVQB 4UV4H 4OLZH 1E4WH 4BSJA 2VXQH 3HI5L 4LLDA 2AEWA 2HTKC 4UAOC 3I75B 4OM0L 5E2TL 4NQDD 5C0AE 4YFLI 3VMOA 1RJZB 1YNKL 3BYYA 3BI9X 1YEEL 3QEHB 3SDAB 3RUGE 3KHQA 1V3MA 2GJZB 5E6YA 4Y4FD 3KYAA 2NR6D 3THML 1CS6A 3CFCH 1YC8A 2ED8A 3QJFA 3P30H 4YFDB 6FABH 1OSPH 3DROA 5DD3L 4X0KA 5HY9A 3VD5A 4EEEA 12E8L 4HWEL 3F5WB 3EYUL 4W70A 4LRNL 2VZOA 1BHGA 1T89C 4OIAA 3BEVB 3CX5J 3D1MC 1CG9A 1D5ZA 3PUCA 3MRHA 4OBRA 3MO1B 4Q9BA 2CRYA 3CZFB 3RIFF 5SWZD 3OX8A 1GZQA 1WBXB 5D4QA 3DURB 5F7YC 1YN7B 2AXJA 1E4KA 4OAWA 5IK3B 4UNVA 3QWRA 1LHZA 4NKIL 4ERSL 4LASL 3OKLA 3VXRB 5EWIH 4RSVA 3SDDA 2WAHA 4HK0B 4K8RC 4PGDB 5E7BA 3TVMD 4JM2B 3JUYA 4XXCA 4PJXA 3O4LD 3WS6C 1BOGA 1WIPA 4PJCA 4NWTL 5F6HI 3JZ7A 1YEHH 4BJLA 4XNYH 2IALA 3WLBB 3BOVA 1KBGH 1RI8A 1NGZA 3L3OA 3L3JA 2NY1D 2PCPB 5TQ0H 2VWEE 1XGYL 3KNBB 1UWGH 1L4IA 4RRPA 1OAUL 1LNUA 4LCUA 3MLRL 4YO0A 4KI1A 3EFDL 3DO7A 2ED9A 3FRPG 3B4NA 4PREB 3GDBA 2W9DL 4M4RA 1IGML 4R8WH 3MV11 2R29L 3GHBH 3VGGA 1SVZA 1LE5A 2Q7NA 2VQ1B 5I66B 5LBSL 3C9NA 2EXYC 4OUUA 3CFJA 2MCG1 4GS7B 2VRAA 5LKNA 5GRXG 4X4ZA 2HJKA 1BD2E 4X0KB 3DX6B 3RL2B 2DQJL 1EA9C 2ZJSL 4IDJH 4UB0H 2X4OB 1BFVH 1NMCB 3EDKA 4Y88A 1D5ZB 4ZSOA 3C6SA 4RFOH 4UT6L 2GQHA 2AQ3A 1QO3A 4U49A 4YBLC 1DL7L 4P4KD 4TVPL 4WENB 3MGOA 1GZQB 1UM5L 1Z9MA 1ZT7A 3MODH 3TIDA 1UKTA 1DLHB 3VXME 2ITCB 3V4PL 2ZCKL 1U8HA 1CE6A 3SEPA 4RX4A 1MCIA 1RZKH 1BIHA 4PGCA 5E2VH 4X7CC 2P46B 4OIIL 1FO0A 5FEBA 2D0HA 5F8RC 1S9WB 4JY5H 2CLVA 2EO9A 4BZ2H 4NRZA 1X5HA 5T5FH 4L8DB 3WIFA 4JZJA 4P2RD 4S1QH 5T3XE 1T0NB 4NZDA 4O02H 5KSBE 4X4YA 3MSPA 2F74A 2CMRL 5D96B 5HGBA 2EDEA 1MFEL 2XKSA 1T1YB 4ODXB 1KGCD 4R96B 4RMUA 4ELMA 5C71A 1W8OA 4LCUB 1U2CA 3L5JA 4Y0GA 4YO0B 4D2NA 1ZLUH 4R7DA 1QSFB 4CW1A 1I8KA 4FTVA 3DO7B 3B9EA 4FP8L 3T3ME 3CMOH 2XYCA 2BNQE 1RU9L 2G5BB 4A6YH 3N9GH 3BPNC 4JLRA 1LO2L 5J56B 5EG6C 2ARWA 2R2HA 1I9EA 2BVOA 3VFNB 2VLRD 3CDYA 3FQUA 1GRWA 4XC1H 4I0PB 4PJAE 2OK0H 1I3RA 3L6FB 3H7BB 3SGKA 3QHZH 2VL5A 4HKBA 3EJJX 3LH2L 1AP2B 2HKFL 1IQDB 3C6SB 1A0QH 4CNIB 1GPOH 1U8MA 3GSUB 4UNUA 4GG8B 1B2WH 1ZT7B 1S7UA 1FH5L 2EXWD 2Q7YA 3ARVA 2D7NA 5I6XC 4MQSB 4GBXC 1A22B 2Y7QA 2CKNA 3SY0B 3U9PL 1MAKA 35C8H 5FXCH 1LP9B 3CFIC 1AR2A 4LEXL 4EI5B 1SJXA 2CLVB 4IMKC 4NRZB 3T0XA 4UINL 2Q87A 4X4YB 4KKLC 1G6RH 4HBQA 3AY4C 2ATKB 3QBTB 1OP5K 4HPOL 3QUMH 4JQVA 1NANH 4X98A 1T1ZA 3OWEA 5EO9B 5IFHL 2AJUH 3ARBD 3MUY1 4ZAKC 1O0VA 5J89A 3IDJB 3VWJD 1HSAA 5EUOA 3OHXA 1XGQA 2O93L 2IANA 5I17A 5CEZE 3RZWA 1DFBL 2CLRA 3TN0D 4X8XA 3GSNH 5DJDA 3CSGA 1GIGH 2WP3T 3E6FB 5B3JF 2HT3D 3RTQA 3DRTA 1GVIA 3TZVC 2FR4B 1MAMH 3T4YA 3BP7A 1J7VR 4ZUTA 3UJIL 3V0WL 3BVNB 5C6TL 5HJ3A 2YKLH 3EOTH 5CEXA 1WT5C 3G08A 5D2LA 1I4FA 5EZOL 5T33L 4QWWC 2FWOA 2JTDA 2BZDA 3RU8L 4IS6A 3KG5A 3C5JA 4RQQA 3EYQC 2DQUL 1V7NH 3TLRA 3W0WA 3E0GA 1P9MA 2DF3A 1IKNA 4HKBB 1IAMA 3X14A 5C07D 2EIZB 4I9WE 3O8XA 3HR5A 1T1XB 3VGBA 4JM2F 1TCMA 1YEFL 2H2PC 4JANB 5CKGA 5LVEA 1MI5B 5GSVA 1BIIA 1T3FA 1FZMB 4X7EC 2V5SA 3DI2B 2H8PA 3ARFC 3ECBB 3K2UL 3MLTA 3ARRA 4GW5B 2IPUG 3HE7B 4I77L 1LO0L 2ORBH 2VH5H 4OD1L 4TRPL 3MRBA 3KPPA 1RZIA 4JB9L 1EMTL 5FYLL 4ONHB 4ZODA 3UAJC 4FQJL 2DJSA 4MGXA 1RZJL 2ERJB 4HLJA 3ZMRA 3N1MC 3QUZB 4UQ2A 3D5OF 3L3DA 4JRXE 4UU9A 4DVBA 2XA8L 3QWQB 4P5MB 2ZCHL 1EGJL 3O6MH 5LGJA 4LF3A 1HHGA 4PS4H 2ZOKB 5I17B 1H3UA 1NFDE 3O4OB 5KOVC 1S7WA 3TNNB 2WWKO 4KJWD 5EBLA 3SKJH 4ELKA 4OCWL 4GLRH 4OZIA 3M17B 1R0AL 2ESVE 1MCCA 3QAZB 3MREA 2ADIA 4OLUL 3HE6A 3T4YB 3BP7B 3RVWC 3JTSA 5DGQA 4XNQB 1CGVA 4KTEH 5CBAB 2C3VB 3OKNA 7FABL 4FQXB 3CU7A 5H94A 5D2LB 2IH1A 2COQA 1Z3GH 2XTLA 4O9HL 4JO4L 1JPTL 5E00A 4XVJL 3C5JB 4QRSA 5MENB 3GMPB 1MCDA 3VFVB 5IBTH 5CJ8A 1I1FB 4Q9QL 2ADFL 3AS0A 5ISZA 3FONB 4TUJB 4HUNB 3HTLX 1IM9B 1DQQA 3AS1A 3BXNA 5F6HJ 2V7NA 3QYCA 3GMQA 4JN2B 1IRAY 3EDFA 4J3OC 4M5YL 4U6VL 4G7YL 43C9B 3QQNA 1ZEAL 4X6FB 3UTQA 1S7SB 2H8PB 3MLTB 5DJ6B 4E0RB 3CX2A 1NDMA 2F54A 3IETB 3M1BA 5D7IA 4CBPA 1A7QL 1T6VN 3KPPB 1NC2D 4DCQB 1RZIB 3F62A 4I48B 4ZS7H 3KXFB 4HWNA 1MFDL 3DGGB 3RY5A 5I1AB 4MMXC 4M1CD 1MFAH 1ED3B 5FO8A 4QRRE 2JJTA 2W0FA 4UU9B 4Z0BH 2FBJL 1Y6NR 3CFDB 4JR9L 3PQYE 2D03L 4LSTL 5HHMD 4DQOH 2MHAA 3ZKXC 4F7TA 4ZTPL 4R0LA 1I7TB 1W72L 3QUMA 3RWEB 3U0WL 3QWRD 3IAPA 5D1XA 5EOTA 1NDGB 5F93C 5IVZA 2Z93B 2A83A 3KPSB 4RGNE 1IEAB 3H3PH 5EU7E 2F19L 3SDDD 1UADC 4OGZA 4TVPE 5DC4B 4Q2ZA 3X13B 3OKNB 1R5WA 3QEQE 4PTUA 4O2EA 3VW3L 5D71H 5H94B 3F7PC 4A6YB 1K6QL 2FEDC 3NABH 3IFPB 4MJ5A 1QOKA 3DV6A 4QRSB 1FYTB 3FFDB 3SKOB 1G7LA 5DO2D 5GPRA 4C57C 2P4AB 1JI2A 1LP9F 4HF5L 4Q6YA 4TTDC 3QUYC 1ZLWK 4J6RL 4H8WC 2P7TA 2OX5A 3QNXB 3U83A 1DQQB 5JIKA 1TVBA 4JE4B 1HEZA 2XT1B 5BMFL 2Y1VA 1KCVL 3ARQA 4RFNC 5DMIH 5I8EB 3GSXA 1ZS8B 4EXKA 2ILLA 4QTIH 1X4XA 5IVNA 4XP9H 4YC2B 1KJ3L 4M8VA 3S5LG 5HHVL 1U95A 5E5MA 4HGKC 5FA4B 1U8IB 3P0YH 2DMCA 3DTXA 3GO1H 2NY4B 5HHPB 1Q9WA 3CVIL 4P23D 3TJEL 5ITFA 3PABB 1DVFC 4KI5D 1B0RA 3IDXL 1LEKB 4JAMB 3AB0B 1T03H 3D39E 1G6RB 2EYSB 1HI6B 2KBGA 3IDMA 4EN3B 3QUMB 1JGDA 2NY2C 1CGSH 1LQSR 3N1QC 2PYEA 4GMSL 3MV9E 5HYIA 5F9AC 4RX4D 4GG6B 1A5FL 3ETBF 2A6DA 2Y23A 4ODHL 2O5YL 3GB7A 1F4YH 5IGXL 5DMGD 2DQDH 3KLHD 3NN8B 4PJIB 2HT2D 4DJMA 3UDWA 4OB5L 2R4RH 3GSNB 3GHEH 3LKPA 5F3HB 3LN5B 2VWEC 1MCOL 4GUPA 4O2EB 4OD3L 4XP4H 2AEQL 1LWRA 5FUOH 3LKSB 2Y07L 4JDTH 5E6IC 1K8DA 3LKNA 4HDIB 5HGAA 4HIHB 4R4FH 3UO1L 5IR1B 4HWBH 1QR1A 1FN4A 5L2JB 3FQRB 1DUZA 1FZOB 1S8DB 4F9PC 1AD9A 1I9JH 5JXAH 1HHKA 3SPVA 5ID0A 4ZD3H 4FTVD 1HEZB 2WM0A 1YC7A 3CLEH 4RFEA 2QL1A 5ACZB 3DRQA 4JFXB 1KTKE 3TBYB 3WN5B 4QNPF 5F7NC 5FYJE 5JOPD 3TO2A 2WSKA 2YUXA 3AS2A 1BOYA 3I85A 4NUJB 2H41A 1DP0A 2L7UA 2KUTA 1F4HA 1ONQA 3AROA 2IGFL 4UILH 5C92A 5GGUA 4DWHA 4LU5L 4RGMB 3ESVF 2F5BL 5L7XH 1FFRA 3WJJA 1N64H 4JPWH 2H9GB 4TSAL 2VXVH 1TETH 1GCFA 1WZ1L 4RZCA 4HX1B 3BN9D 4TSCH 1TJIH 4PJ7A 1HXYA 3CXHK 5T3ZH 2XN9A 1AIFA 1GHFL 1L7TL 1CGXA 1XR8A 4YHZL 1MVUA 4DTGL 3F65A 3EUUA 4RGOH 1JZ7A 1EJOH 3KPRA 4KQ3L 1FAKT 2OM5A 2YUVA 1CXLA 3GB7B 4NKDA 4DN4H 3LB6C 1YZZA 3CLFH 2X09A 2OYPA 1ZT1A 5HVHC 5IW6B 3LKPB 4JFEB 5C0EB 1SY6H 1KLFA 4KK9C 1KTRL 1A6VL 5DS8A 5FO9A 3UBXA 4FZ8L 1FN4B 1TVDA 4HAGA 2IAND 2WLYA 3AMLA 4FMFA 1FVCB 5FYLE 4JREC 1EFQA 2PO6B 2ICWA 2P48B 1MNUL 2XZQL 3JTTA 4RWYL 1AH1A 3HMWH 4PB9H 4OF5A 3RTQD 3WS3A 2X89A 2NYYC 3HC3L 3FMGL 1RUPH 4HG4K 5ITBH 3DYPA 4NYLA 3ULSB 4XP6L 1U8PB 3MCLH 2L4OA 4OKDA 5EU6B 2WBKA 2P44B 3O9WA 4OGAD 4XH2B 4IIQB 4YXHH 5EZIL 1NBZB 3L3KB 5K9OA 4S1RL 3OF6D 3DNKA 3P0VH 4I2XE 4GW1B 3RKPA 3IXAB 1VGKA 4RZCB 1PYWA 4Z7VF 3I9GL 3W0WD 1IAKA 3MJ9H 4NBZB 2EDYA 4KAQL 5EUKA 3O8XD 1AIFB 4JHZA 5L2KB 5CIPH 4X6CA 4Y5VB 1H0DA 3O3AA 4O4YH 3PWNB 5HPMA 4P3CL 5DMKA 4CJ0A 4HGWA 3KPRB 5FYKH 1YEIH 4F7PA 3M07A 4KPHH 2O26U 5EA0L 2EH7H 5DD6A 1ZHNB 1PD6A 5D7JA 3BISA 5F3BB 5HYJA 4XWGL 3ZDYF 1UQSA 1P7QB 2G75A 2NY6B 5C09B 5C70A 15C8H 3GIVA 4OFYA 5FO9B 2QQNH 3UBXB 4OI9A 1JVKA 1ZKAA 4MA1C 4NJ9L 1ETZA 2DI7A 3VXQA 4N0YL 3WNKA 2VN7A 2Q6WA 2Y72A 2Q76B 4WW2A 3RVTC 2EDOA 5I0DA 3PGDA 3JTTB 1BF8A 5E4IA 3NTCH 1INDH 3N85L 4CADB 2ZUYA 1XF3A 2J6EA 4F9LC 2BJMH 5B3NA 1ORSB 3SDYH 3HE6D 4TULL 1N0XH 1ZGLP 4ONGL 1N5YH 5CMAA 3BESR 3S4SA 5EIVA 4OV5B 5AWNH 1JK8B 2EDWA 4R6UA 5BVJA 1TFHA 5K9OB 2OTWA 3D85A 4XBGA 2EDTA 5J6GA 4FQHA 4HS6A 3MLVH 4TVSa 1S9VB 5D1ZA 2V6HA 4OZGF 4CMHC 1FRGH 5ISZD 4M62L 3TYFB 3FB5A 4PJIF 3GIZL 4OLXH 7CGTA 5CD5C 5JO5A 3PV6B 3B8YA 3G5YA 1BVKB 4X6CB 1PZ5A 2D0GA 3IFOB 5J1AB 4QHKI 2ZPKL 1Z5LB 5HPMB 4I8DA 3RI5F 3JV4A 1DLFH 4XXDB 1JHLL 2FJHB 1CGUA 3BAEH 2F54D 2OZ4A 4OFVA 3MLPA 3QXWA 5HGGS 5D7JB 5C3LD 1JGLH 5HYJB 1OAYL 3MBEC 4UTBH 3UTOA 1MCWW 2ZWLT 3IJYB 2J8UA 4YGVA 4C55A 2EIEA 5EZJA 4LLUA 4WUUA 4LCCA 2DIAA 3JWNC 1T5XB 3BHBB 4C4KT 2C3GA 3ZE0F 5C0FA 1Z6JT 1J0ZA 3CXHJ 4AG4L 4ZFOA 2B4CH 5DUBB 1A7RL 3UC0H 2A6KA 3MLSL 1GGCH 4IOFD 5SWSB 3DPBA 5F7LB 1EJ6A 1WK0A 5D1XD 5C0IA 1HOCA 1OAKL 2AXFA 1QFHA 5JHLH 5J3HC 5JOFB 2QR0A 1IC7H 2D31A 1KENL 2V2WA 3SDCA 2E7CA 1MCSA 4LP4A 1TQBB 3IGAA 3FZUC 2HH0H 3CDFA 4NQSA 1NBYA 4R97B 3DXAA 1K5NA 2BSSA 4JEGB 1BEYH 3WXVH 3BGAA 5E2WL 5BVJB 3LS5H 4JVUA 5DJ8A 2I24N 3C08H 3UXFA 2EDHA 5ETUB 4GRWF 4ZDHB 1M6OA 1A6TA 1M7IA 1ZA3A 2OJEB 3MOQA 4HS6B 4LPVA 1CLZL 2LFGA 1KCKA 3IXTA 5A16B 1FSKB 4WTZG 3HI6L 4D0DA 2HFEB 3U82B 1HYRC 4P9MH 4FXKB 1DEEA 3FCTB 1C5DA 3L5WA 4G9FA 2F53A 1CBVL 2GAZA 5BQ7B 2AV7B 4Q6IB 1BJ1J 2IG2H 2MTPA 2BMKA 2WP3O 3KYOB 4C59B 2P45B 4G8FB 4LRIC 2DQGH 2KPNA 4KVCL 4NDMA 3V5DB 5IESH 4N0FB 5EFIA 4PRPA 1RSFA 4PJBA 3QIWD 3RDTA 3PF2A 3ULVD 5MP6L 4MXQC 3RZCC 4LIQL 1OLZA 2XKNA 4K8RH 3LN4A 5IB4B 1IFHL 4LCCB 1LO3H 4RGNC 4M48L 2PXYC 5EU7C 3UTSE 2X4QB 3ET9F 1CXKA 4HC1A 2A6IB 4OJFL 4BFEA 5D2NA 2A6KB 1XF4B 3GSRB 3VXOB 5E8DL 4UUJB 4QOKE 2PYED 1QACA 3LV3B 4BFGA 1HOCB 3PHSA 3QDJB 5EOQL 4QCIA 5BRZA 4LLQA 1ZXQA 1BLNA 3QH3B 1VFBB 2O5ZH 2DQIL 4AQ1B 1GGIH 2R4SH 1KSRA 3G6JF 4PJEB 4M9PA 4LSPH 4NNYB 4KROD 5C0CD 3QEGL 3L5XH 1ZTXH 3TM6A 3FHAA 3HLAA 1M6OB 1OQOA 3MROB 4NC0B 5FO7A 2MKWA 1GAFH 4PP2A 4RAHA 4DKDC 1KT2A 2YD1A 1BQUA 1MRCL 1ZHBB 3H9SB 1G7PB 2FJFA 5T1MA 5TF0A 3L5WB 2F53B 3ARGC 4JKKA 4XTRD 1MJ8H 2VQTA 5D93B 5GRWA 2BCKA 4P46A 2FL5B 4WWKC 4NN7B 2B0SL 2Y6SC 4JFFE 4XHJC 2HP4A 2ZNXA 4L9LC 1D5IH 2QSQA 5KS9F 3T0EA 3WFCH 1M1SA 3O6LH 5MEOB 5FKAA 1JF1B 3ISWA 2J8OA 3QUXD 4YR6A 1W2KT 2ARJA 3LN4B 1CZ8L 1S7RB 4XCFH 2XN9D 5J12B 3QIUC 4LPCA 3TBTB 5GRUH 3ULUH 3K8KA 5TQ2H 5E1AA 5F9WB 5SX5H 5F6IB 5D2NB 4AT6A 5CZXD 2CXKA 3H9HA 2VZVA 3WXWL 1QBLL 1QD0A 2P49B 2AGJH 4PG2C 3S34L 3CSYA 4LLQB 5DK0A 3PJSB 2RQ8A 5FECB 1G1CA 3QDHA 4MNGA 3VXUB 1XF1A 3I02A 3ZDZF 3DYOA 4AL8L 1FO0L 3U4BH 2F8OA 3QI9A 2BNRE 4KJQD 1WAAA 3W81A 3R1GL 4NQVA 1N8ZB 3HLAB 4GQPH 3RIAF 3CFBB 3EJYC 3MLZL 4PP2B 1D5MB 4OFIA 5B4MD 3GNMH 3V6OE 5MHSE 3FQNA 2D2OA 3MV7E 1SEQL 3EYVB 5DQDH 1HDMB 5K9QI 4WGWB 4XBEH 1T7WA 5I1LB 4KUCF 2CRZA 4UZGA 5HDQH 4OM1L 2G2RA 3IVKA 2NTFB 4JO2H 2X89D 5F96H 5HI4C 4F58H 2DQHL 4MB3A 1KCRH 5EIQA 1ZMYA 4AM0B 4DKFH 1A4KB 1T89A 2EE2A 2XOTA 3ZO0A 5J9PA 1UACL 4YHLH 3O9WD 3WL9A 1S9YA 5IVOA 3IYLW 3KDMA 2Q8BH 2P5EA 2GT9B 4U31A 4ZFGH 5H35A 3IDGB 4YR6B 2GIYA 4K94L 3O0RL 2Y4SA 2A0LD 2OQJB 2ZG3A 3HMXA 2BXZA 5H2BA 5IOPB 4JFYA 4HT1H 3PP3H 4I3RH 1NMBH 5BS0A 1OSPL 5DD0L 5CD3A 2DWDB 1AQDB 1PX3A 4ENED 3WS6A 4KRPC 1NGPL 4NN6C 1TPXB 1J0HA 1DN2A 3CSYB 3D6GA 3O2VH 3GSWB 3VXTA 2Y5TB 2XZAH 2VZ1A 2B5IC 1OP9A 3PP4H 4MVBC 4CN1A 1MH5A 1QTYT 3BKMH 2Z31B 4QHKJ 3S9DB 3SBWC 1IKFH 2AV1A 1A6UH 2OTUA 3QI9B 1RZJC 4WFFD 3CC5B 4PRNB 5EWIL 1OW0C 3CPLB 4ZQKB 1MCRA 3BUTA 4UAOB 5DT1H 1J8HD 3QEUB 2JF1A 5F9DC 3QNYA 3PXHA 1CDGA 1FC2D 5JR1H 1T4KA 2PW2B 3R06B 4B7IA 2OSLB 5IQ9A 1HHHA 2VDKH 4ODUA 5B3JE 4OI7A 2DB8A 2D7QA 1KBGL 4LNRA 2I26N 3E8UL 1TITA 5CP7B 1NKRA