4GQPH

Structure based design of sub-nanomolar affinity anti-methamphetamine single chain antibodies.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
229
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCTYFDSDDYAMEYWGQGTSVTVSGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Anti-METH scFv
publication title Affinity improvement of a therapeutic antibody to methamphetamine and amphetamine through structure-based antibody engineering.
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 229
sequence length 240
ec nomenclature
pdb deposition date 2012-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gqpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gqpH01
1D9KD 4OT1L 3RU8H 1XGTB 4DKFH 1JRHI 2H41A 3MOBL 1NC4B 4GQ9L 4KI1A 4R26H 2NY5L 3ORJA 4C4KT 2ICEB 3FQTB 1T21A 4OKVB 2QSQA 5EUKB 2PXYD 2QSCL 1KYOJ 1U9KA 4PRIA 3ARFC 4R97B 4O2EA 5CJOL 4NO5A 2VDRL 4PY8I 2DI7A 1U8QB 3B9DA 1NDGA 3C5JA 3NCYS 1JRHL 4PRAB 5E6IB 4CDHA 3GSQA 2FH6A 4Z5RA 4QHKI 2QL1A 4YDKL 4S2SA 2DYPD 3VG0H 3G6AA 1FYTA 5DEGB 4MQSB 5TE6L 3QDGD 1ZEAH 2VQ1B 5EDXA 4LDOB 1KCSL 4WUKL 4CU8A 5E7FA 5ESQA 5CKAA 2FJGA 3KPSD 4HC1H 4QCIA 1RIVH 5DO2D 3Q1SH 5DTFA 3EJYC 5LQBH 3ARWA 4IDJL 3VWJB 5H8DA 4Z7UE 3O3DB 1JPGA 2ARJQ 3U1SL 1QEWA 4XPAL 4B53A 1UKTA 4AT6A 1KC5L 3AMLA 4RDQG 3MLUH 2UZIL 5KVGH 4M43H 4YR6A 5EZJB 4JCLA 3VXTB 4UU9A 3M8OH 3LQMA 1XF2A 2ENSA 5JLZA 4OV5B 1L7IH 4BFIA 4RBPK 2NYYC 3O6MH 1S7VB 5F21B 1Z9LA 1INDH 1JP5A 1X4YA 4UOW0 5GGVY 3KLAB 4L9LC 4J4PC 5D1ZC 4JVWA 5HYIA 2E7MA 4OD2B 1X5KA 2OSLA 5ID0A 1CICD 2NX5E 1MCPL 4M48L 4D8PA 1X5FA 4DZBB 1MI5D 1NFIB 1NSNH 3HNSL 4XVUC 5KZCD 2OJEA 3IDIB 3NFNA 3HNVH 4E9LA 1YUHB 5MHSD 3OG4B 1SJHB 4M8VA 3JWOH 4X99B 4RMWA 5LVEA 4JFDE 3LDBB 1KCVL 3STBA 1NMCC 2VLRB 3BRGC 2MQ0A 1J1OH 4KU1A 5B38G 4TOYL 3QCUL 2YD3A 4PREB 2CXGA 3LVEA 3GSNL 4HIEA 3QUYA 3PQYD 5CEZD 1AKJD 4HBQA 1PW3A 3T4AA 4Y5VC 4OTXL 2ARWA 4YH6A 4HIHB 4KVCL 4PV9B 4UDUA 1DEEB 5K9OB 1FRGL 2IH3B 2UV3A 2GCYA 3MV9B 2A6JB 1H3XA 2CKNA 3TH2T 3BPNB 1QRNB 2ZKHL 3BKMH 1X5YA 3D2UB 2LU3A 5FO7B 4X9IA 3QUXA 1I3GL 1URLA 3DVGB 4L5FH 4WFGD 5IR1B 3ZYOA 1I7ZB 5EIVA 5B4MD 3PWLA 5I17A 3Q6GL 1H3WM 3CFCH 4NQDE 4PG9B 2QQKL 2F8VA 3QEQD 4LSUH 4DGYH 1JGVH 5DHVH 2WMPA 4M7JL 5I30H 4M7ZB 5BVJB 3FCTB 4FFWC 4K71C 2HVJA 2FEDD 1KJ3L 5HHOD 5EULV 3L5IA 1P4BL 4RRPG 3QRGH 3NA4A 2X6MA 4NN5B 3V0WH 3CC5B 4QYOB 3W9DA 3O3BA 5C0BA 4P0DA 4AH2A 1SQ2N 3BPOC 2YPLE 4CMHC 1MI5A 3O2DA 1BVLB 3H6JA 3HC4H 4PRBA 5EBWA 5EBMB 4CAGA 3KPMB 1YC7A 5C9JA 4E0RB 1QBAA 1QR1B 3GB7B 2ESVE 4ZPTA 4HWZB 1CS6A 4JREC 4J1UA 3O45B 2JE8A 3C8KB 4FQCH 1OARL 4YHOL 2APTA 4L3CA 1H3PH 3C8DA 3CPLA 3VXQA 1AKJA 1CFNA 1IAMA 4ODHL 4NPYA 3SGDH 1Q9OB 1MCRA 1NMAL 1XT5A 1D5ZA 2WV3A 1XZ0B 1LP9A 3M17A 5I8EA 2HVKB 1HXYA 4Z78A 3E8UH 1A6WH 4OI9A 4U1GC 4WHTB 4F7CA 1CE6A 4GKZA 4N68A 1Z9MA 1BP3B 4L4VA 5I8OL 3S37X 1WWCA 5E4EB 1AHWC 4H0HB 3FQNB 2VLLB 4P4RB 4NM4H 2C1PA 1FZOA 2OZ4L 2CLVA 1TZHA 3IXAB 3MV7B 1HI6B 4LLMB 4LSQH 4WHYH 2MSPA 4N0CD 2NY1C 2UZXB 4LRIC 2VLJD 1OY3B 1TCRA 5DGQA 3QA3A 4RCAA 3QEQA 5LGHH 1QHOA 2WUCH 3D0VB 1A14L 4F33A 4IS6B 4Y8DC 3ROLA 2NY3B 5FUZL 4UBDD 4YHZH 4GKSA 3CFKB 1DANT 1E6OL 5IFHL 4EJ1C 1CLOL 3GFUA 3BP4A 4MXWL 4LMQE 4LIQE 1OGAD 2CUIA 3MRPB 4PBXA 1OAUH 4OZFB 4QTIH 3SE8L 5JQ6L 5I1JL 1NEUA 2E9BA 3B9EA 4PJ5D 3GNMH 3DX6B 5C0AD 3CK0L 1MCCA 3U36B 3IAPA 1VHPA 4R7DA 1T21B 3FQRB 1PFCA 1TENA 4PRIB 2V9TA 3MO1B 3GO1H 1HDMB 3LIZH 4NO5B 3MLSL 3C5JB 1NDGB 1O7SA 4FQIL 3GSQB 2CDGA 4Z5RB 3QG6B 3F6LA 5FM4A 2BRQA 2R39A 4LCIL 1I8IA 3F7PC 4S2SB 3GMNA 3MX0A 3MQIA 1FYTB 1GGIH 3MLXL 3TZVC 4Y4FC 5MEOA 2R1XB 2VO5A 4XCFL 5BVPL 5IUSA 2HFGL 3NCJH 2QLVB 2UYLA 4ZO6A 2FJGB 3DX9A 4QCIB 3FQUB 3LCYA 3VGAB 5INCA 5DTFB 5LBSH 3KAAA 1JWUB 3RA7L 3LKNA 5CIPH 1JPGB 2WINA 5C07E 3RHWF 1MCWW 2B5IC 1S7TA 5E0QA 4TVPH 5JUEL 1FNSL 1QSEB 4MVBD 7FABH 3OAUL 5AG8A 4ZXBD 4YR6B 3FFCA 1IGYB 3VI4F 2IBBA 4UU9B 4JG1H 1GGCH 4XMKL 1IQWL 4L8BA 2YC1A 4RAVB 4BFIB 3HS0A 1AFVL 3RHWK 4J3UA 2UUDK 1H3TA 2BNQA 1EEYA 1S7XA 5IBUG 4KUCF 4C56B 3LRHA 5ID0B 1A7RH 3T1FA 1MCOH 2KDGA 1MWAA 4D8PB 2R0KL 1KV3A 1CBVL 2A1WL 4HCRA 2OJEB 4LCCC 5EBLB 3UJTL 5CBAA 3NFNB 5C7XL 4XGZA 5F1IA 3LRSA 3B83A 4J3TA 1ZK9A 2V6HA 2LE9A 3A6CL 3MBEA 3RPIA 2I5YL 5J3HD 4ZAKB 4MYWB 2BX5A 2B1HL 5CP3H 5DMIL 2EC8A 4XNUH 4APQD 4HIEB 2EYTB 1F2QA 5DXWA 4LLAA 4NNXB 1OWWA 4TUJB 3T4AB 5I1GL 1DQLH 4O02H 3VGEA 4EI5D 1IGIL 4G8EB 4LNRA 1WK0A 1IGCL 5IMOA 1IC7H 3VE0A 4UDUB 4YHYB 3PP4H 1KEGH 3C8HA 1F5WA 1P1ZB 4JFFE 4UTBH 4IRJB 4L8DA 4P2QA 2OM5A 2I25N 1T89A 5LJYH 4MGXA 4HSQA 4GSDL 5D71H 1R5WA 3VXUD 5JA8B 5KTEH 3QUXB 3QHZH 4WO4A 3SDYL 4TULL 5IB2B 4PJAE 5LGKA 3PWLB 5I17B 2VH5L 5EC2A 3V8OA 1PY4A 2NY7H 4MCZA 1UJ3A 1W0YT 2BSED 2H26A 2FCBA 3C6LC 2F53B 4ZXBA 3BYTA 3QT2A 5DJDA 5F7MC 4NQCB 2HVJB 3V7AE 3A6BH 2Z4QA 1P4LA 1PJ9A 4OQTA 3SDCD 1BM3L 2L7UA 4MA3A 3ESUF 3C5SA 2CK2A 3R0MA 1WWWX 2H2PC 5HHQB 1D3CA 4Y16C 5C0NC 4DZ8A 4NOFA 3UAJC 3W9DB 3O3BB 3QUZA 5IEHB 4FXGB 5C0BB 1AR2A 4AH2B 1UXSB 4YK4C 3OKDA 3SDDB 4PJ9A 4PRBB 2JTDA 2W9DL 3ULUH 4D2NA 5D7JD 1YYLH 4D3CL 1RIHL 2W0FA 2BSSA 4KGJA 4J1UB 4WEMB 4ZTOH 4JGMA 4NQTA 2DBLL 5FA4A 5FYKU 4BSVA 1MPAH 4JRXD 3UTZA 1KPVB 2ZUQC 1YEHH 3LN9A 4APQA 4L3CB 1X5GA 2NZ9C 1K8IA 3CPLB 1WEJL 3EOTL 4MJIB 1MY5A 4EI5A 2YD7A 2AP2A 2KBGA 1D5ZB 1MVFA 1YNKH 1QUNA 2IPUK 2APXA 5D2LE 1LP9B 2EDWA 5I8EB 1VENA 1HXYB 4Z78B 1X6NA 3RGVA 5ALCH 3K8KA 5J6HA 4OLZH 1Z3GL 1J05B 4TSCH 1HYRC 1WZLA 1IAII 2UWEE 3RIAF 1I1AA 5KSBA 4JM2B 4PLOB 3JWOC 5DT1H 5JA9A 3BDBA 2UUDH 3JV6A 4TTGA 2CLVB 2PYFB 1U36A 1T0MA 1FJ1B 2XKNA 4JFQB 4OZFH 3RIAK 2OX5A 1KB9K 5GJTL 3R06A 1B9ZA 1ONQA 1AQKH 3LS5H 5GRZA 5TPWL 3QR2A 3DGGA 4S1RH 1CL7I 4PJIE 4F33B 1BX2A 3ROLB 1RUKH 2FNBA 5EORH 4GKSB 4HPOH 1NLBL 4HS6B 4OGZA 3BP4B 4QTHA 4GAFB 5HHMD 4PJ7E 1CL7L 5DQDL 2OJZL 3FO9A 2ZOKB 1J0ZA 4FFVD 1IAIH 1FG9C 5J1SC 4EDWL 1IFHH 1I8MA 3OKEA 1LP9F 3ZYJA 1IILE 4R7DB 2PNDA 3QH3A 4AMKL 3RVXD 5B8CC 3UJJL 3OKLA 1AGEB 4IIQC 4KTEL 3T04D 1R0AH 4JM2F 4MCYB 3HG1E 1MFBH 2CDGB 3RDTD 3H42H 4JRXA 3BXNA 3LMJH 4OFVA 2DKSA 3IS0X 4OF8A 2BOBA 4X98B 4KK5C 1I8IB 5A2JH 1U8LA 2YN3A 4HQQL 5HDQH 2ZJSL 1WICA 3QQ4B 1XR8A 2OR9L 4GKOA 2FO4A 5BV7H 2VDKL 1LE5A 4PGJA 3VXRD 4RMSA 3DX9B 4NZJA 5INCB 1CXLA 2A6IA 3GHBL 1KGCE 4OKDA 4LASL 2VN7A 2GY5A 2R56L 4W4OC 2WINB 1S7TB 4Q6IC 3BP6A 3VFUA 4NZUH 4DN3L 4P59L 4XT1C 4IOIB 4WRLA 3NZHL 1IGML 4U31A 1MJJA 3C60A 3LS4H 4OIIL 1VFBA 3UZEA 1Q9KB 2VE6B 2YC1B 4L8BB 2P48B 3QG7H 3CDFA 4H1LA 3LEYH 1PQZA 5DVKA 5T33H 1HHHA 5EZOH 5EH1A 5DMKA 2NLJA 1EEYB 1L7TH 4OD1H 3O6FA 5KSUA 5CSBA 1PLGH 4PGZA 1CR9L 5ILTL 1F6FB 2GT9A 2UVFA 1DQML 2OK0H 3S35X 4HJJH 5F1IB 2M2DA 4WI6A 2EDEA 2IPTH 3RZCB 3O6KL 4XAWL 4HPYL 3MBEB 2AKRA 3T65B 3RPIB 4MXVE 4RSVA 4E42A 4UB0L 2M8XA 2BFVL 1IZKA 3MJ6A 4GMTH 3HMWH 2ZG1A 3T2PA 1BGXH 3NIDE 4JRYD 3ETBF 2FX8H 4R97C 4Z7VB 2H32A 4LEXL 5D72L 3ULVF 3MRQA 4LNRB 2GJZA 4WY7H 1C12A 3UDWC 2LTQB 2F15A 5C0JA 4KRNA 3ARGD 5TF0A 4LSRH 1G1CA 4KHTL 4L8DB 1FSKB 2VSCA 1A7OL 4P2QB 4JFOA 4GW4A 4NC1E 2QEJA 2XNAA 5E99H 3TWCH 5DYOA 5I8KL 5L6YH 4U1JB 3QIUA 4UQ3A 1BREA 2ORBH 2P4AB 5FYLH 5EC2B 2PW2B 5AEAA 4MCZB 1T6VN 4O58L 4PLNC 1UJ3B 4HZAA 2EDHA 5B22A 2H26B 3DX7B 3O2DH 1DBBH 3QDAA 5CD5C 2HLAA 3HHRB 43C9A 2Z4QB 5EU6A 1O7VA 1YN6A 3MLYH 4X6DA 5FKAA 3C5SB 2X4TA 1R3LB 4I0PC 5DSCA 1S78D 4DZ8B 2AQ3A 4U7MA 2HFFA 3SKJH 5CJQH 3QUZB 5DRWA 5CEZH 3PWPA 4Z7VF 5DJ6B 5E56A 3WFEH 3OKDB 4OIAA 1VADB 4PJ9B 1TCMA 3KVQA 3W0WD 5EU5B 4UT9H 1RURL 1EMTH 2BSSB 2ZCKH 5FA4B 2ZCHL 4BSVB 1U8OA 1JIBA 5T3XE 3LDBC 4I1NB 1F58L 3ZKND 1I1YB 4PJGE 1TVBB 5BS0D 4YGAB 1F4XH 4YHKH 5CEYA 1XGQA 3KPRE 3SJVD 2W92A 4Z8FL 1FORH 4OGXH 3RGVB 3HZKA 3FO0H 5J6HB 1G6RL 1PKQA 4PLJD 4KTDL 5JOPD 4WWKC 2APVA 4JPKH 3N9GH 1I1AB 4JDZA 1PG7W 5DZLA 1E28A 1T66D 4F9LA 4F7PA 4I3RH 5HD8C 5FF6A 5J6GA 2X09A 4JQXA 3REWB 4QOKE 4NSKA 3V5HA 2EXWD 3TO2A 4I13B 5FYJE 5AYUL 5C0DA 1OTSD 2BHZA 2ICWA 3R06B 5DQ9A 1ONQB 5KVMC 3MC0A 3CSYA 3DGGB 4LK4A 3CUPA 4G6AC 1E4JA 3T8XA 1BX2B 2DD8L 3WS3B 2YRZA 4NO0A 5DJYB 4JFPB 1WIPA 1E4WL 1T03H 4WUUB 3WKMH 2R29H 3G08A 3GSRB 1T0NB 4N0UB 2AEPL 4BKLA 2NQCA 1RVFL 2CIKA 5C3TA 3FO9B 2J8UE 4NKOB 1AD9A 3TO4B 3QDJB 5C6WH 3EO9L 1TNNA 1HHGA 1R3IL 2JIXD 5HXMA 5CAYB 1UYWH 2AABL 3WD5L 3LEXA 3OKEB 3QH3B 3GBNL 4BH8A 4J8RA 5IIEA 3WE6A 5D6CA 5MENA 4BZ1L 4OCMC 3GK8L 5JHLL 3CX5K 5T3ZL 1G0XA 1RIUH 3BXNB 1N2RA 3QUML 4JPIB 5LXGH 2I9TA 1NUNB 2BOBB 3CLFL 1U8LB 1TITA 1FLRH 2QTEA 5IFAH 2HT4C 4FS0A 4XNQB 2X70A 4WW2A 3V4UH 4JHBA 1LE5B 2FGWH 2ZUVA 2XKUA 4PB0L 1BQHB 5D9SA 5FO9A 1J5OH 3ULUC 3VW3H 3G5YA 5E5MB 2A6IB 2ZOLA 2HP4A 3GI8L 1CG9B 3GRWA 4IMKC 4GBXA 1DLHA 3P11H 1UACH 3U7YL 1N64H 1J0JA 2VITB 4F80A 3VFUB 4KKAC 1MWAH 3RI5F 3AREA 4M7KH 3MRIA 2VR5A 4Y19A 1RJYA 1MJJB 1WBZA 2WP3T 4JKPL 4NHCH 4HCRH 4P2RE 1VFBB 1MELA 1IKNC 3MLVH 2WBWB 3QFJB 3L3HA 4OZGE 4P46D 4AEEA 3ZKMD 4ZUVA 2FSEA 2EH7H 1HHHB 4W6YB 5IF0A 3DMMD 1LO4L 2NLJB 4YDLB 5KSUB 1FVCB 4N0RA 1HILB 1VKXA 3K46A 3EKCA 2D7OA 3WFHA 3H0TB 3VGDA 2F54A 3B9AA 1A7NH 2BSTA 2BP3A 2GT9B 25C8H 4PG2A 2VZVA 2NY3C 4O2FA 3VRLF 2Y25A 4KMTH 5GGVL 3WLWC 3K2UL 4JB9L 5I9QB 3P0YH 5A2LH 1UEYA 2EYRA 1QRKA 2JIXA 1HHIA 3EZ8A 5BRZD 2AKRB 3AS2A 1EERB 1JK8A 3STZA 3S4SA 2HFEA 3G6JF 4CN1A 1EEQA 2VDNL 5KANG 1CDCA 2X4PA 4NFDA 2H3NB 4F7MA 3MXVH 1ZTXH 2H32B 1F3DJ 2GJZB 4I0CC 5FO8A 1C12B 2IMNA 1HKLL 2YPKA 3C2AH 4WV1A 4M4PA 3WNOA 4XMLL 3R8QA 3TBWA 4S1SL 2CKBA 1DDHA 2FATL 5I73B 3QDHA 1ORQA 3I02B 4GW4B 4JKWA 2GITB 2OL3L 4LSDA 4I8DA 3WKNA 5DYOB 4OQTH 4QWWD 4S10A 3T3MF 1HK6A 3QIUB 3T0EB 4Z7WA 1ITCA 3VGAC 1IBGL 1HNFA 2W65B 3L6FA 4P23D 5IBTL 4DKAA 1BAFL 3GMMA 5DD1H 4LCWE 1RZFH 4WU7A 3GBLA 4OSUL 3RNKA 3SKUD 5E95B 2VB5A 4XI5D 3VGBA 2AJ3B 1D6VH 2CRMA 4P46A 3ZTJG 2HLAB 3BD5A 4POZC 1CDJA 43C9B 1F8TL 5EU6B 5BV7C 1YN6B 1H8SA 4P5TA 4X6DB 5FKAB 3VXNA 2X4TB 3PXJA 1OT2A 4TSBH 1KOAA 1EEUA 2HFFB 3OGOE 5DRWB 1S5IL 1YEFH 1B0RA 4JHAH 3MODL 5FGCB 4P9HL 3IKCA 1WFTA 1DLFH 1JNNL 3IXTB 3CIQA 2AGJL 4QF1A 4Z0BL 4X7FC 4ZS6D 4NKMA 5D8JL 2H9GB 1A2YA 3ARDB 4R96A 4L29A 3JBG7 3N85H 2JB5H 2EIDA 2FBJL 5DURD 1AD0B 1OTUC 3G6DL 2V5RA 2P24A 5JHDB 4NZTH 2GY7B 5D93B 4YXKH 1CI5A 5E8EB 5IVXA 3MUZ1 3QEGH 4R4BB 4JDTH 3QUYC 5CEYB 5I1KL 4LNVA 1XGQB 2IH1A 2RCSH 5ITBH 1NMBL 1PD6A 3QXTA 3HZKB 1PKQB 5B38A 3ARBA 4X7CC 5HHVH 2GAZA 1T1XA 4K94L 4ZS7H 1JPSL 4TSAH 15C8L 4F7PB 4KKCD 5DHXB 3CCHA 5J6GB 3PUCA 2AK4D 3FOMA 4BSWA 5E8NA 1VGEH 1XR9A 4MWFA 4NSKB 4QEGA 1WBYA 3V5HB 2ZG2A 3QUXC 3TO2B 2VLKE 5C0DB 4QRTB 2ICWB 4Y1AA 2CRZA 4AK1A 1XEDA 5BXFA 3CSYB 4QRRA 2Y1VA 2P5EE 5E9DE 3T8XB 2BY3A 5I8CA 4K8RD 1JPFA 5F96L 4BJLA 1E27A 1WIOA 1M4KA 3HC0B 1INEH 2EIZB 1OVZA 3G08B 4KJQD 4BKLB 3S96B 1P6FA 2P49B 2QHRH 2CIKB 5CWSA 3MSPA 1BQLL 4GRWE 3QQ9C 4FTVD 4WEUD 1CICC 3DROA 3CZJA 3LEXB 4R7NA 5CINH 1M05B 2XQYK 5IHZB 4BH8B 3PNWA 3H9SA 4RRPA 4J8RB 4NWUH 2H2SD 3SQBA 5IIEB 3WE6B 4X8JB 1AXSB 5D6CB 2DJSA 2VL5A 5MENB 4DKFL 4PJCE 1MFEH 4M3JA 4Z95H 4HS3A 3RX7A 3VMNA 2R15A 5C08B 3ILQD 2X70B 4WW2B 4H1LH 3U2SA 2DM2A 2XTJB 4MA8H 3P9LA 5D9SB 5FO9B 1TVHA 3KXFE 4HZLA 1MAJA 2DS4A 3VG0L 1DLHB 3VA2C 1AI1L 1ZEAL 2XZQL 3I84A 4ZNEE 3AREB 1YJDL 2AK4A 3MRIB 4I2XE 4HUXA 4Y19B 1RIVL 1RJYB 3OB0K 2QR0A 3Q1SL 4MJ4A 4ODBD 1RHHA 5M94B 3BIBX 4HFUH 3ZKSD 5DJZB 3WFBH 3B6SA 4ZUVB 2FSEB 2ADJA 5KN5A 3RPKA 2KQMA 4O5LH 2NY2D 5IF0B 4PRPE 3CSPA 5KVGL 1A7QH 5E8PA 1DUYA 1EVTC 2HTLD 4JR9L 4PUBH 1YEJL 3N1GC 5IFJA 3SDXA 2XWJA 2BSTB 1H8NA 5EU7C 1F42A 2XXCB 2VXTL 5DMGD 4L1HA 5D1XD 5F7DA 5IESH 4L1DA 2H32H 2I07A 3HB3D 4LAQL 5DA4A 2VWEC 1LO2H 2EYRB 4PGBA 2ZSWA 2R4RL 1VB9A 4FTVA 1BFTA 4WW2F 1T6WA 3JTSB 5HTSA 2IAMD 2HFEB 1RFDH 2LAGB 4U0QB 4KXZI 1QYGH 5L8LB 3BZ4B 2X4SA 1U6AH 2RR3A 1RZGA 4W4NA 4CVWA 4F7MB 2OMBA 1GPOH 2P8MA 4P49A 4MD4B 4N8VB 5FO8B 1LO3L 4WV1B 3QWRA 5SWZB 1S9YB 1SBSL 1PG7L 1YPZA 3RJQB 3AXLB 3TBWB 1DDHB 1HH9A 3Q0HA 1MLCB 5GISL 5IVZA 3AMKA 1ORQB 1SHMA 2ATPA 2DQJL 4FQLH 1LEKB 4Z7WB 3AB0B 2Z91B 1UCBH 3MGTA 3DO3A 1PYWA 3GMMB 4Z7QF 3PWNA 4ZFOA 4WU7B 4XP9H 4FXLA 4XPHH 4CBPA 2BNUA 5B39G 3UTTD 5CD3A 5E1HB 3RNKB 1CYGA 1A02N 1BD2E 3LV3A 5I74C 3RWIA 2DQDH 3FTGA 4PP1D 5KW9H 4V1DA 3DRQA 5C3LD 1RJZA 3ZTNL 4YHMH 4I9WE 4L5FL 1AO7D 1N6VA 1HIMH 5D6DC 1MRDH 2IBZX 1IC1A 1HQ4B 2P8LA 4JO4H 4P5TB 3CFCL 4IRZH 1NAML 3VXNB 1BFVL 5DZNA 5TDOA 3LKRB 1F4HA 1YMME 1I7UA 4DGYL 2D0HA 2M26A 1GGBL 3WSQL 1YNTA 3H3PL 2YR3A 5I30L 4XNMB 2VMFA 1FFPA 3GJFA 1XF4A 1NL0H 3IKCB 3QNZA 1NBYA 3RWDB 3FL7A 2W9EH 4QF1B 2MNUA 1R3HA 3IF1B 3MV8E 3QRGL 1QLFB 2YRPA 1A2YB 4LU5L 5SV3A 4R96B 1MNUL 4L29B 5J0BA 4UIMA 5DJXA 2FB4L 5J89A 4F2MA 1MUJA 2P24B 2BVQB 3EYQC 4YDIL 1AJ7L 4XNXH 3SGEH 4PV8A 1I4FA 3LN5A 3MUJA 5FA3B 1RZJH 3ZE2E 1OTTD 3CFJA 3TFKD 4ZO7A 5IVXB 2EE6A 3VXMA 4OCYL 3CXHK 3HUJA 4URTB 2IH1B 1FNHA 3GI9H 5C0FA 5TQ2H 3WUWG 3QSKB 1A4KA 4FHBD 3ARBB 3GSUB 4WHCA 2AXHA 2AV7B 1A1NA 3OXSA 4KKLD 3PHOB 1KB5B 1V05A 4HG4J 1U92A 1FSKC 3S5LG 1KCRL 4LGRB 1T89C 5E8NB 1DQDH 5C09A 1A6WL 1FL6A 2BOCB 4WO4C 3ZSTA 4Y1AB 1J18A 1UB6B 5BXFB 5I1HH 4QRRB 4X7DC 1UJ3C 1FNEA 3EDJA 3LSOA 1JPFB 4ZXBC 4LSQL 4OFPA 4BYHA 4S0TD 1E27B 3RVVD 3UX9B 4P2CG 2VDPH 4U6XA 1F4WL 4LLWA 3OBAA 1Z6JT 4FQXB 4BZ2H 5CWSB 5LGHL 2FDBP 3V6FB 3VFOA 5MP6H 2DQGH 5GJSH 1WFNA 1JTPA 2Q3AA 1CFSA 3KJ6H 3NCEB 2HKFL 2XA3A 3QJHA 3DROB 4X6EA 2F8OA 1CXHA 4R7NB 3QUZC 2E5EA 4YE4L 3O4OB 5ISZD 4D9LH 3PNWB 4UT6H 4WCYL 3H9SB 4H8WL 2BDNH 1OAUL 1SY6A 3HAEB 4I18A 4ZOEA 2F8XC 4KJWD 3RKDC 1FZMA 1ROWA 2IFGA 3GRWH 4PRHE 1DFBH 4G6MH 2K9UA 3CMOH 1P7QB 4NQUA 1N7ML 4HXBH 4FABL 5KSAD 1IKFL 5E00A 1LNUA 2W38A 2XA8L 1UWEH 1SMAA 4APQC 3LIZL 4LLUA 4L3EE 3BDYL 4ODUA 5F8QC 1A9BB 4OF3A 4CU6A 1DN2A 5E6ZA 4EI5C 1TVHB 3NAAH 3VI4E 1NGPH 3QDMB 4JFEA 5HGHB 3MLZL 1HINL 3WNPA 3A0OA 4Y4KD 4S1QL 1QSFA 1I1AC 3AGVA 4HUXB 4KAQH 5TE4H 4K2UL 4K3HA 2QR0B 1P6AB 2DRUA 1RHHB 3IRPX 5SX4I 1MEXH 1DJSA 3NIFF 3B6SB 3OL2A 4OFDA 2ADJB 5KN5B 1TNMA 4TVPL 3BWAB 1WAAE 4RFOH 3UTSA 3MXWL 1NCWH 3G5VB 4AL8H 3PV7A 4X4YA 5J11C 1GGCL 4TN9A 3UC0H 1KJ2A 2EDOA 4RISL 2W0PA 2LVEA 1A3LH 3AVEA 4KJPC 5TE7L 5J13B 1DBAH 2R1WA 3GM8A 4PRDA 1UEMA 3WXVL 2VC2H 4PGBB 2ADGA 2ZSWB 2OI9B 4YHNB 1VCAA 2N1KA 1EUUA 3NACH 1QSEE 2CKBH 1ORSB 3P4NA 4MD5B 5IB5A 3D3VD 5I1EH 2X4SB 5JQHC 4YHIB 1EXUA 3GUTA 4LBEB 1BECA 2J88H 2P8MB 5E7BA 3IGAA 1HOCA 1P4IL 1R3KA 2ED9A 1IC5H 4KI5F 5D1QA 4I0KA 4HMEA 1YPZB 2YSSA 2DWEB 2JF1A 4XNUL 1A0QH 1HH9B 2BRRL 3VA6A 4RGNE 1VEPA 1ADQL 4OCLC 4XX1E 1DQLL 2ATPB 1G6VK 1I7RA 2I27N 1KEGL 2CQVA 4UTBL 4Y4KA 1D9KB 1PYWB 2X89D 3T3PF 2DJ4A 3X12A 2D03L 1M7DA 1OQXA 2BNUB 4HHAB 5EFIB 4AG4H 4V1DB 5L2KD 3CXDL 1NCDL 2FJHB 5DFVD 2PXYB 4QXGH 1C5DA 4DAGH 3H2WA 4H5SB 3C60C 4XNYH 1HHJA 4GW5A 3BGFB 2P8LB 2PR4H 5FM8A 1BOGA 4G8GE 2CR3A 2J8OA 2AJSL 3I6LE 2Z31D 5TDOB 3HCVA 1I7UB 3IDXH 2DYPB 4XXCA 1MJ7H 1UT9A 3FT2A 4PTUA 4Z7UA 2E7HA 3O6FC 4TRPH 3QDGB 3MLWH 4MNQD 1KTRL 3V6ZA 4KZDL 3GJFB 1KYOK 1NBYB 4Q2ZB 1KIQB 5I19L 1R3HB 3DVFA 4RGMC 4NQED 4UIMB 5DJXB 5GRJH 4OUUB 2DIJA 1XIWD 3W11D 2VZ3A 4FFVC 4ZUUA 3VJ6B 1J0YA 4F2MB 3F7RA 3MV01 4PRNB 2F53E 1I4FB 3D3VA 1B0GA 3K4ZA 3N06B 3O4LB 2NX5A 5IM7B 3VXMB 3HUJB 1B2WL 4ZTOL 5C0FB 1I9IH 1A4KB 4WI2A 4HW6A 3RDTC 4U1HA 3TNMB 2DBJA 4XB8A 2B2XL 4JFDA 4AIZA 1A1NB 3KS0H 1BBJA 4M3KB 4CDGC 4PJFA 5KBNC 3MRBA 2XQBH 2RJMA 1S5HA 3TV3L 4MLIA 1U92B 4NN7C 5GGSY 3QQ3B 2EECA 1OW0A 5HSFA 2GJJA 5KZCB 5C09B 2Y9RT 5FHBL 4TSCL 4OLXL 2X89A 2Y7QB 5DRXA 1M6OA 5DT1L 1A6ZB 3GSVA 4OLWL 1FNEB 4TPRL 3BH8B 1S7SA 5D7LD 4XPGL 1CN4A 2CDFB 2EE9A 2O5XL 4Q58C 4Z6AT 1NKOA 2YMXH 3ECBA 2FIKA 4HLZG 4LLWB 3WL9A 4PJDE 1NGXB 3GJFK 3LS5L 1LDPH 3Q48A 2GK0A 4ZD3H 5ADOH 3VFOB 4KKBC 3VFPA 4NUJA 4PS4L 4MDJA 4MNQA 3HUJF 2A6KA 1CFSB 4YHPA 1TQBC 4X6EB 1RJLB 3VI3F 4OAWB 3MYJB 2ZCLH 1LE9A 3OB8A 5A2KH 2LV4A 2O61A 3IT8D 4GW1A 3MR9B 2NW3A 1Z9OA 1GCFA 3K80A 4GAJH 3IU4H 1KF9B 2XZZA 3TBSA 3S34H 3GMPA 4OB5H 4XWGL 4X9HA 1JVKA 1R0AL 2CXKA 2AXFA 2X1WL 2YPLA 4YFDB 2D7QA 3O0RL 1HEZB 2RHEA 1RZ8A 4ALAH 4ZUSA 5BJTB 1NCCH 3KLSA 3LRGA 1CE1H 2ZP0T 5HI3D 3WNNA 5KVFL 4JFEB 2ESVA 1J1PH 4KTYA 1MVUA 4M02A 1K85A 1QSFB 5KVDH 5FUOL 3IJHA 5TF1L 3HI1A 1Y6NR 4WGWB 3MJ8A 1MQKL 4WFFE 1RZJC 1MCQA 2I60H 2YD1A 3B3IA 4FXKA 1KNOA 2W1NA 2WWMC 4JQXC 3DYPA 4OJFH 1SM3L 2DQTH 5DQJA 1MCKA 3O8XA 2C4FT 1IM3A 5C0CE 4NZUL 1MCDA 3GMRB 1IAKA 3P9WB 3UTSB 3QXVA 5IGXL 4JGUA 4Q74A 5AZEL 1FIEA 2BVPA 3LS4L 5F88A 3MRJB 1UENA 1JBJA 4QLRA 1VESA 2YBRA 1L7TL 5K9KA 1I9JL 4PRDB 2ADGB 2BVOB 1S78C 3WFCL 4X83A 3EFFA 4XBGB 5FKPA 1HSBB 5CILH 3P4NB 1I1CA 4MQXD 5FOBA 1MY7A 3LH2H 5IB5B 3LKOA 2C3WA 1P7KA 4M00A 1JNJA 4K7PY 3TM6A 3TVMD 4CVXA 3VWKD 5C86A 2R2BA 1HOCB 1WF5A 2VXQH 4R4FH 3TEUA 2C3VB 5D1QB 2R69L 1W0VB 4L4TD 4LQFH 2YSSB 1MCHA 5ACZA 5I1CL 1R5VA 1U8IA 3NA9H 5T3ZE 1MRCH 4NJAH 3DGCR 1T83A 3IJSA 4QKXB 4Y89A 4Q9QH 4WW2C 1XH3A 2MJWA 2HJLB 2XTJC 2MHAA 4V2BA 5DLMH 4KZEH 3TJEH 4PLJC 4ZODA 3DO7A 3X12B 1KEMH 4GBXC 1M7DB 3O81A 4HKXA 4CRPA 1KN4H 1T66C 3GJFH 5E70A 1YNLL 2XICA 5KVEH 5E99L 1YEIH 2XZCH 3AREC 1FAIL 1XGYH 3QBTB 5K33A 5BOZG 5J7CC 4ISVA 1WZKA 1HHJB 12E8L 2V2XB 4GW5B 2YS4A 3R0NA 1QFUL 4WENB 3EDKA 4X7SH 1OTSC 1W72A 3D39E 3HCVB 3O2DL 2R9HD 3DBXA 3ZE1E 1DBBL 2WK2A 3DVNA 3FT2B 4PTUB 4Z7UB 3MGOA 5C07A 1D6EB 3LHPH 5F7WC 5HBBA 2QSTA 2HT3D 2MFNA 3UBXB 4N5ED 5JW5A 4PG2C 1LWRA 1T2XA 2HWZL 1MHPL 4AQOA 5HYFA 5JOFB 2SEBB 4F58H 1Z9SA 3L1OH 3VRJB 4JFZH 1ES0B 1JHLH 2QADB 4ZUUB 5I1IH 5CEZL 1KJVA 5EN2A 2VISB 1MREL 3WO3B 1LEIA 1B0GB 3MRLA 2GKIA 2NX5B 5BMFL 4M5ZH 5E8DL 1EBAA 4UT9L 1A6UL 3WNLA 1EMTL 4LOUD 4UILH 8CGTA 4U1HB 4YEEA 5E08H 2FIRT 1G0YR 3L3KA 3PGFH 4WV1C 4JFDB 5SX5K 2D3VA 4AIZB 1BBJB 5HHXH 3JUZA 3MCLH 4I3SH 1GGUA 3PWVA 4GAGH 1RJCA 4PJEE 2MPAH 4WFHD 4NT6B 4E41D 1T1ZA 4N8CL 5T1LD 1JGLH 3KGRA 2XWBA 5DC4B 3BSZH 4JO3H 4KQ3H 4NC0B 3CVHA 2PYED 5DRXB 1M6OB 3TNNB 1MIMH 2XXMB 3PGCB 1KULA 3PWJA 5EIIA 4NM8H 3SE3A 4C59B 1NCAH 4FZEH 4BELD 1NJ9A 4P46C 3ARFD 3WL9B 4P3CL 3OKNB 4Y5YA 2D31A 2GK0B 3NGBB 4PJAA 1GSMA 1CFTA 4P5TC 1Z0NA 3GZKA 3VFPB 3VG9B 4NUJB 4MDJB 4YHPB 2R1YA 5DI8B 4NQDB 1EAPA 1SEBA 3IFLH 1K2DB 1EGJA 3NFPA 1PGRB 2QHLA 5FDWA 4JM4H 1CXFA 4GW1B 1TJIL 2F5BL 1G7PA 5CGMA 5FFLA 3TBSB 3VXSE 1A9EB 1UYWL 1U58A 5E03A 3O9WD 1WCQA 5CLTA 1GAFH 2LU4A 1QKZL 4JKMA 2F5AL 3RKPA 4I5BA 3ARYA 3QJFA 2AXFB 1IT9L 2YPLB 4WUUE 5E5UB 1XGPA 4ZUSB 2NYYD 2GIYA 3I50H 4M5YH 1C1EH 1T5WB 2ESVB 1FLTX 4JANB 5GS1A 4J4PD 3ARBC 5D1ZD 2NY0D 2B4CH 2WQ8A 1KJ2H 4ZFGH 3IJHB 5D7SL 3HI1B 4OZFG 3WBDA 1WT5A 2EKSA 3CU7A 3CDCA 3VW3L 4LRNL 1YEGH 4FXKB 1KNOB 1DR9A 4XVUD 3E6FA 4PD4K 1W2KT 3O8XB 1IM3B 1DL7H 5D2LA 1ZS8A 1MWAL 4M6MH 1IAKB 4YBHA 3ZT6A 3B5GA 2UWEA 3C09C 1OOAA 3SBWA 4NHCL 3ZYZA 3KNBA 5GS0H 5F88B 1EO7A 3MLVL 4XI5C 4B7LA 2UY6A 1YEDB 3G6JE 4G6KH 2AJVH 1RK0B 1ZLSH 1P84J 5K9KB 3TA3A 2AEIT 1JZ6A 1XGUB 1A7NL 3EFFB 4YXHH 1FBIH 2NNAB 2KL6A 25C8L 4IJ3C 4WDIA 3H9HA 3HMXA 3U48A 4KMTL 4PJIA 3HR5A 3UBXI 4U1NA 3LKOB 2Y07L 1N0XH 2NCMA 4DQOH 5SX5H 2ADIB 5GSRA 4JO1L 4X7TB 5KSVA 4CVXB 4XPBL 5FYJU 3U30B 4PJ7A 4NNPH 1PSKL 5ADPL 3VFNA 3PJSB 3IJSB 1ZTXL 2X7LA 3C9NA 1D5BA 5CZXC 1J9CT 1XH3B 3WS6A 5LG1A 1WWAX 4FFWD 1Y18A 5HHMB 3C2AL 1T1YA 3I75A 4W6WB 3X13A 1G7HA 2C3HA 4Y7MA 3DO7B 5IW1B 3QULB 4L4JA 4ERSH 5MEPB 1VFUA 2B1AL 4GO6B 2PN5A 2Y36L 3LKPA 3GM0A 4OQTL 2MCPL 4ISVB 3O6LH 1FCGA 4OF0A 1NANH 2GJ6D 1MJ8H 2FECI 4WIQA 2FR4B 2FJFA 1TPXB 2O93L 1RZFL 5DJ8A 1G7LB 4DUWA 2FWOA 3DVNB 3CAFA 1ACYL 1LILA 5C07B 3PP3K 3TBYB 3KJ4B 4YPGB 2FECL 5HVFB 3BOVA 3BEVA 3S36H 1A3QA 2PW1B 3T4YA 3T0EE 4TSBL 2IPUG 4KJYA 4KRMB 3M45A 5JW3H 3QFDA 2OI9C 5EN2B 2AJZB 4JHAL 2PTTA 4OGYH 3U0PB 1KTKE 3D25A 3WIHL 1LEIB 4XXDB 3L3OA 1PEWA 4M4RA 4WFEE 1JWMA 3FMGH 2WBKA 5F3BA 1T5XB 2BXYA 5ETUB 1CGTA 1ZLWK 2AK1H 3TH4T 2NY4B 5C2BL 2BY2A 1NPUA 4NZTL 2ZSVB 4HLJA 4X9FA 1UB5A 4UT7H 3JWDH 1U3HA 2VAJA 4O9HL 1OP9A 3C5ZD 3R8BB 3WXWH 2XRAH 3IRZA 1DP0A 4FQHA 4OGAC 5ITBL 1IGTA 5DWUH 1EBPA 1EJ6A 1CU4H 4EI6B 3E3QC 4BFGA 5HHVL 1EZVX 4TSAL 1N5AA 2XN9E 1CF8H 4Y2DD 3TN0D 1MRFL 3WN5B 4KK6D 2BNRD 5EU4A 1Q9WA 1FNGA 1G9ML 1IQDA 3K81A 2ZPKH 4JFFB 4OZIE 3SOBH 5EIIB 5DVMA 5C2UB 5TFSH 3QIWD 3X11B 1KCKA 1KN2L 4ZUWB 1MCNA 1AGDA 3TCLA 5F89A 2ZWLT 3QP3A 2GFBB 4LFHD 2MQCA 3RY5A 4Y5YB 1HYSC 2D31B 2NY2C 5E1AB 5B39A 4PJAB 4DK6A 1ND0A 1CFTB 4EOWL 5K59E 1I75A 3ARGB 1KXQE 3OGCA 1EAPB 1JTOA 3TZVD 1INEL 1GHFL 4U49A 3JTTA 1P9MA 5EUOE 2BY0A 1EPFA 5L0QB 2X40A 1RZKH 4WWID 5F7EH 1G7PB 2HFTA 3KYOA 1J0HA 4FZ8H 5J8OA 1ZVSA 3FQXA 3NZ8A 4MS8D 1U58B 2Z93B 4U1IA 5CINL 4FFZL 3U83A 1RU9H 4NYLA 4J3VA 4RNRA 3ZDXE 1J0IA 4NWUL 4M62L 5CJBA 3VFWA 4JO2H 2C5DC 4H25A 4L8SB 4LMQI 3WIIH 2RQ8A 5GRWA 1QLEL 1S3KL 4Z95L 4NGHH 3U4BH 4UNVA 4MNGE 5CS7A 4DEPB 4U7KA 2KUTA 3C5ZA 5IHUL 4HV8B 4AYFA 1IGFL 2B20A 4XAKD 2KZ1B 4NDMA 3PV6A 4OLYL 4PJGA 2PO6A 4XVTL 3E6FB 2DLFH 4PJHE 5SWSA 3KPRA 4HIIB 5D2LB 3TN0A 1OPGL 2BNRA 1OQOA 4ELMA 3BAEH 2UWEB 5JR1H 1QBLL 3S5LA 5D5MF 3KNBB 2OQJB 1K6QL 3UCRA 5C08E 4OCXL 5GGTA 3WFBL 4LPVA 4K55A 4YWGH 4X80H 4AEHL 3TIDA 3B2VH 3KYKL 4LIQH 5AZ2L 3TA3B 3VDAA 1KLGA 2GTZB 1QTYT 3NTCH 4WDIB 1P53A 3H9HB 3BGMA 1A3RL 5JW4M 4PJIB 4NQVA 4U1NB 3PIQA 3BP5B 5CJ8A 2DQFA 4HWEH 3OKOA 1LO2L 1JPTL 4ODWB 2CLZA 4R8WH 5GSRB 4I18C 5KSVB 3BISA 2WBJA 1LK3L 2DWDA 1YYML 4PJ7B 1LQSR 5KG9A 1TQCC 3VFNB 1U6AL 3F7YA 2W60A 3C6LD 4RAUA 4RGOH 2B7DT 5D2LF 2X7LB 4DKDC 5F9AC 3GDBA 1D5BB 1DBKH 1DZBA 3IVKA 3MUHL 5DK3A 1T1YB 1W72H 4X5XA 5KJRH 1G7HB 4NBZB 1ODAA 3KLHC 3HG1B 3QISA 5GHWH 1A6VH 5BO1L 3W5MA 5IMKB 4Y16D 5C0ND 2XKSA 5DC0A 4ONFH 1NGQH 1DBJH 3KPLA 1FFRA 3L7FA 5FCUH 3RWEA 4FQLL 5I76A 2Q6WA 1L6ZA 1UCBL 4YFEA 1FV1A 1I1FA 3MBXL 5T1DL 4XPHL 3MNVA 4PJIF 3O11B 2J3SA 1MFDH 2DQDL 5C6TH 5CZKA 5H37H 3BI9X 3IDYC 2EZ0D 3EFDH 4FQQA 5F72S 1N0LA 1QBMH 4RIRB 1HIML 4TVPE 3VGHA 3B9KD 3RVVC 3BEVB 2NZ9D 4PJ7F 5D70H 4XZUA 4PPTA 1FAKT 5FGBA 2WZPD 5J12B 4YPJA 4KJYB 3MROA 1WC7A 2G2RB 4OZGA 3QFDB 3HC3L 1NGZA 5DK2B 1BBDL 4U7SA 2EKJA 5E2WH 1B90A 2VLMD 1QNZH 2A83A 2PTTB 4ONGH 3DXAD 3EOAA 2WUBH 3QUKA 2IQAA 3FONB 1JWMB 2R0LH 4P9ML 2Y6SD 3BKCH 4GJTB 5F3BB 4Z0XA 3IDNA 5SWQA 1EJOL 5GS0C 1MLBA 3CVHH 4I48A 4JHZA 1BJMA 4CMMB 3PDOA 3DMMB 3KPNB 2YEZB 3VDCA 1G7JB 5F9JB 3RAJH 4K3JL 3A67L 3FFDA 5KSAC 5D7KE 1U3HB 1JNLH 3M1BA 1EFQA 2K7PA 5D1QC 3C08L 2FD6L 1FIGH 4FQHB 1WZ1H 4G42A 5C0EA 5TQ2L 1IGTB 4JAMA 3GMOA 2LVCA 5GIRB 4A6YL 4XVJH 4N1HB 1DVFA 1N5AB 1UJTA 1UH3A 1HWHB 3HZYB 3K7UA 3D9AL 4Y4KC 3ZTJH 3I6KA 5EU4B 1Q9WB 1FNGB 2CJUL 4PIRF 3SCMA 1JWSB 1DQDL 1EGJH 1CD1A 3L3DA 3STLB 4K3GA 5GRVK 1AGDB 4J3SA 1X5XA 5EOTA 3TCLB 4G9FE 4DVRH 3WDJA 3BZEA 3GSWB 2RB8A 2XYCA 1QFWI 1V7MH 4QRPD 2O5ZH 1ZT7A 3R1GH 4OCWL 3QWOA 4U1SA 3KYMB 5IKCA 3B9KA 4K9EH 1Q8MA 4CNIA 5HVHB 2EC9T 2VDQL 2HRPH 2VDPL 4U05A 2VDMH 1QFWL 1WJ3A 4U3XA 3QI9A 1HNGA 4BZ2L 2AJUH 1ZHBA 4G5ZH 3OKMB 1KBGL 5GJSL 3KYOB 3F58H 5HYJE 1ZVSB 1G7MA 3FQXB 3KJ6L 3NZ8B 4MXVF 3RWJA 3DXAA 4UTAH 2X9XA 4U1IB 2QADC 4YGVA 1JGDA 1Q94A 2HMID 5AWNH 2GW5A 2ICES 3NIDF 3HE7A 3F8UB 2PF6A 3VFWB 2XV6B 2RAMA 4G6ML 4P4KA 3CMOL 4Q0XH 4H25B 2BVEA 4R0LC 2IBGA 1T0PB 5DJCA 1CDHA 5L2JB 1N6QH 2OR8A 2QKIA 3OJVC 4X6BA 3V95A 1UWEL 3MLTA 3ROOA 5HI5D 2CUMA 3KPQA 2B0SL 1ZLVK 1EK3A 2YRLA 3PV6B 4PJGB 2XWTA 2Q76B 2PO6B 1OW0C 2E9WA 1DQQA 4FNLL 2GSGA 4ZOCA 2VRAA 3KPRB 1EVUA 2V9RA 1H0DA 1LVEA 2IAND 1UM6H 4UINH 3GSNA 1YZZA 1FO0L 2NXYB 4JHWH 4KAQL 3HMXH 4RMUA 1KSRA 3JWDC 3FO2A 5DFVC 5GGQH 4M1CD 2OBGA 1NC4D 1VACB 4NZRH 3TC9A 3QXDA 1DN0A 1OLLA 1FFNA 4ZPVA 5IQ9A 4QRPA 1U3ZA 4RFOL 1TJGH 5EOQL 4QOKB 1I1RA 1NCWL 1RMFL 4AL8L 4MAUL 2DMBA 5DFWH 1BQHG 5E6ID 3UC0L 5J56B 4YX2H 2VZSA 5EO9A 3RUGA 1A3LL 2P5EA 4NQVB 3NVQA 3PIQB 3U46B 5C8JA 3AU1A 1DBAL 4LPUA 4JQIL 2VC2L 2CLZB 5GRVL 4UUJA 4HT1H 1I9RH 2NY6C 2WBJB 4G7YH 1XIWC 2DWDB 1OP5K 5ACMA 4PJGF 4YO0A 1KTLB 2J8UB 4MB4A 4DTGH 3OR7B 4B7IA 2VZTA 3MV11 5L8JB 3F7YB 4RAUB 4K7PL 4NNYA 3T3PE 2EDJA 2D7MA 3GSXB 2YUZA 3WJLA 3X14A 1R6VA 1WITA 3NABL 3GJEA 3CLEL 4PP2A 1BF8A 4XMPH 4X5XB 2XZAL 3DI2B 1RZKC 5HPMA 4A2LA 1A0QL 1J8HE 5L9DL 4PJCA 3MZGB 3LEVL 2P8PA 4YAQA 1T2QH 3SQOL 3KPLB 3L7FB 3RWEB 5BZWA 5I76B 4JZNA 1TZGH 1LO0L 3D69A 2Q6WB 5GXBB 3PF2A 3UO1H 3OPZL 4H0IA 1LMKA 2MTPA 1BF2A 1FV1B 3I6GA 2IANA 2DTSA 4BQCA 2DTML 3FB6B 4NO2A 3MNVB 4NJ9H 2OS7A 2HRLA 3O8XC 2KH2B 3V52L 5I18H 2N56A 4AG4L 1RUPH 3T0WA 4HK0A 4FQQB 3VH8B 5AG9A 2CDEB 3VFGH 1NC4A 1BHGA 4ZNEA 2VLRD 4KY1H 2ICEA 4I2XA 4OKVA 4XZUB 2J8UF 4P2RB 2IPKB 3MROB 3QZWG 3BQUA 4OZGB 3J7HA 3GKWH 3ME0A 1SBBA 3KWWB 4PRAA 3WIFB 1NGZB 3ARQA 4K07A 4TRPL 2V5MA 1ZANL 3LKQB 2A83B 4PRPA 2DQIH 2OZ4A 1XCTB 5HJ3A 3EOAB 3QUKB 2IQAB 1OSPL 3PXHA 4M1GH 4XH2A 5DJ2B 1BZ7B 3MV9D 3T0BA 1KELL 4Q9CA 3BX7C 4XNZB 4CU7A 5CMAB 5CLWA 1ED3B 5A43C 1QRND 4YUEH 3AS0A 3RTQB 4I48B 3IYLW 3D2UD 2V2WB 5ITFB 4N1CA 3TBTA 1KXVC 3VWJA 3MA9H 2DQCL 3FFDB 4XPFH 3O3DA 4KRPB 5LCVH 4Y0GA 2PUQT 5JIPA 2WANA 3M1BB 4K3EL 1BJ8A 3ALWA 3MPCA 4UV4L 4G42B 3MA7B 3EO1A 3KPSE 4JAMB 1T83C 1CLZH 3VXTA 4OV5A 1QZ1A 4J3XA 1W0WB 2Q8AL 4LVHB 1DVFB 5CCKH 4DGIH 4RMRA 2X1OA 1C5CH 1M7XA 3FT4B 3I6KB 3K74B 4OD2A 4EDXA 3SCMB 3L3DB 2XQYG 4DZBA 3X3GH 3ZHDA 4K7FA 5EOTB 1NFIA 5DRZA 4H26A 3BZEB 3VI3E 3IDIA 1EV2E 5EZLA 1GH7A 1YUHA 3EDFA 2EO1A 4YBLC 3QCTL 3V0VA 1ZT7B 4XHJD 5C0RL 1SJHA 2DDQH 3RVUD 3QWOB 1F6AA 4U1SB 1FP5A 4LCWB 3RX5A 5J06A 1UWXK 1JF6A 1L9NA 1BD2A 1MI5E 3KJ4C 1VPOL 4PREA 4HUMB 4DN4H 4LVNC 3KPTA 5E2VL 1LDPL 5MHSE 2XY1A 5ADOL 1HSAA 2DICA 4Q9BA 3Q5TA 4JG0L 1UQSB 5JPNB 3ULUD 1G7MB 3BMWA 3RWJB 4Y88A 4R2GB 1A6TB 2BJMH 4HIHA 4HUWA 4OZ4A 5GRUH 4YGVB 3V4PH 4YC2B 2ZCLL 5K9OA 4P2OA 1Q94B 1YMMA 1J1XH 2EO9A 3ARUA 1IC4H 3MV9A 4GLRI 5T3XH 1S7WA 4KKAD 1NFKA 4QRUA 4YDJA 3PQYE 3HE7B 5CEZE 3SE9H 1FGNL 2UY7A 4P4KB 4GAJL 3DV6A 2YKLH 3S34L 4LSPL 5DJCB 3MV7D 2QKIB 4F9PA 4KKNA 5IR1A 2JJSA 2P5WD 4D9QD 3EHBD 4N5UA 3MLTB 4L4VE 5F7LB 1KLFA 2A9NL 3KPQB 5GGTH 1ZGLM 4FQ2L 5MEQB 1EFXA 4D9RD 3GBML 1SYVB 1NCCL 1RQ5A 3T0DA 2NY3D 4WFGE 4FP8H 1N5YL 3WLWD 3BH9B 2GSGB 4K8RL 1LGVA 5FYJH 4U1KA 3GSNB 1ZWIA 1UA6H 3QEQE 1FC2D 1U8NA 2MCG1 3CC5A 1FE8L 5T1KA 3FO2B 5IB3B 2DQTL 3SE3C 3QXDB 1JZ3A 3KPMA 3Q6FA 1DN0B 1FFNB 2VWEE 4ZPVB 1SEQH 5HHOE 5I71C 4PRID 4E0RA 2XI9A 2VYRE 2VLKB 2X05A 3EOBB 2R9HC 2NXZB 3O45A 4AEFA 5ERWA 5EO9B 3C8KA 2P5EB 5E9DB 1FYTD 4G6JH 3AU1B 3BGAA 3S35H 2CSPA 4OM0L 3D48R 2N7BA 1Q38A 1Q9OA 4UUJB 5F6HJ 2X1PA 2HVKA 4NN6B 4WHTA 4NRZA 4YO0B 4DFIA 1K8DA 1L0XA 4LHUG 2CGRH 4MZ2A 3UYRL 1RULH 4GRWB 3C6SA 4J3WA 1YEKH 4JJHA 4NNYB 3FQNA 5ELIA 2PCPB 5HYSA 3SDAA 4MAYB 2C7UB 5GGRA 2X10A 4LOUC 1BIIA 3IXAA 3MV7A 4LLMA 1HI6A 4ZFOL 1KCUH 1Q72L 4POZD 2DI9A 3P0GB 5HPMB 3BJ91 4PRHA 5GZOC 4G3YH 1KCLA 2QQLL 4PJCB 5DZOA 4HGMA 3RL2B 5GS1C 4YAQB 2IFFL 3D0VA 1ZKAA 3OZ9H 1B4JH 5BZWB 3WFZA 4JZNB 1FC1A 1DUZB 1MAMH 3D69B 1WT5C 3FRUA 1B3JA 3L5JA 3B8SA 4KZEL 4L3EA 3TGXA 2E7LA 3I6GB 2VLJE 3QAZB 2IF7A 3KXFB 4NO2B 3MRPA 2BNQE 5HGGS 1YEIL 1E6JL 1H5BB 1OTUD 4PB9L 5FHAH 4HK0B 4N8VG 5F7YC 3DX6A 3SBWC 3U36A 2AI0H 4I2XB 1K5NA 4ZAKD 3TYGL 3FQRA 1OGAE 3MO1A 3QUYD 3HRPA 1HDMA 4GRWF 3BQUB 5B21A 5JOEA 3QQNA 3OG6B 4WHDA 4PJ5E 3TA3C 3D85A 3DVIA 3QG6A 4PRPB 5IG7A 5C0AE 3M07A 5HJ3B 3PWUA 3LQAH 4NP4H 3BO8B 4XH2B 4YFLF 1TZIA 3D0LB 2R1XA 4U6HA 4IRJD 4W6XB 4N0FB 3FAWA 1A5FH 4PJCF 4GQ9H 1LDSA 3QEHA 2FX7H 2NY5H 3FQUA 4MA1B 3QUXD 4M93C 2BMKA 1JWUA 4UNUA 5DF0A 3TBTB 2QSCH 1BJ1H 1UWGL 2OYPA 3O9WC 5CJOH 2VDRH 5A2FA 3BD4A 1F45A 5K9QI 2D0FA 3L5HA 2GTWB 1UH4A 1JRHH 3EYVA 1QSEA 1CD0A 3U0WL 3OWEA 3EO1B 1ZA3B 2Y06H 1IGYA 4YDKH 2V7NB 3MMEB 6FABL 4NQCD 4RAVA 1YA5A 4I3GA 4PYHA 1UKSA 5IJVA 1KCSH 3P3YA 1GOHA 2VL4A 5HHXL 3T09A 3SO5A 1E4XI 2NY0C 1WFOA 5CFHA 3QQ9D 5FYLD 4FG6C 4C56A 4EDXB 4IDJH 1JGLL 3EBAA 3N1FC 1FNAA 3V79C 3U1SH 4HUUA 5C0BD 4XPAH 4K7FB 2OCFD 3SDDD 5DRZB 4H26B 5F7UA 1KC5H 5EBLA 3AAZB 1E4XL 1MIML 5CUSH 2PTUA 2UZIH 5EZLB 5E2UL 1GOFA 1OAKL 3V0VB 3T0VA 4HK3J 4RMQA 1F6AB 3TT3H 5D96B 3RP1A 5C1MB 1NCAL 4FZEL 4X4XB 3SO3C 5EZIL 3EUUA 1BD2B 4ZAKA 5JPMB 2EYTA 1P2CB 4NNXA 3DNKA 1AGFA 4TUJA 1HSAB 5DD0L 4MJID 1MCPH 4M48H 4GG8B 4G8EA 3VGFA 2VDOL 4YHLH 4HUWB 4OZ4B 3RY4A 3HNSH 3V4VL 2E9JA 4P2OB 1YMMB 1P1ZA 1S7WB 4IRJA 4L4VD 4PJBE 4QHMA 4QRUB 4YDJB 4JM2D 4JM4L 1U41A 4EQ3A 1KCVH 1J11A 4ZFZB 4LKCA 3ZL4L 5TDNA 3DV6B 3MV8B 3QCUH 5IB2A 2X4OA 3GSNH 1X5JA 1J88A 1ZSDB 3PL6A 4U33A 5KSBE 1K9TA 1U3HC 4OTXH 1MSPA 3OAZK 5D2NE 2F53A 4NHUA 4KVCH 1U8PA 2YOCA 3VXUE 1EFXB 1G9EA 4PYGA 4NQCA 1C5BH 1FRGH 2HN7B 4YFLI 1C1EL 3GMQA 5KOVC 4S0SD 2ZKHH 4U1KB 3EGSA 2JJTA 3HAEG 4C4KO 5HHQA 1ZWIB 4XVSH 1U8NB 1I3GH 1X5ZA 4EBQH 4HLZH 5T1KB 3BZDA 1YEGL 2YUXA 5IEHA 4FXGA 2HH0L 1RV6X 1UXSA 3Q6GH 4XBEL 3SDDA 1BWWA 2QQKH 6CGTA 3Q6FB 4TTDD 2AW2A 4NC1C 5EOCL 4KQ4L 1FFQA 3L5WA 3EO0B 4M7JH 4GRWH 2Q3ZA 5ERWB 4Z9KB 3VCLB 3MRNA 2CMRL 3U0TA 1P4BH 1CIDA 1KPVA 3DHJA 1ZE3C 5HVHC 2AJVL 2ED8A 1ZLSL 1P9MC 4MJIA 4GUPA 2NW2B 3DUUA 3GIZL 2WIMA 4YXHL 1S7UA 4PJDA 2FX9L 5I6XB 3ZE2F 4J12A 4NRZB 1J05A 4JRXE 4XBPB 1K8DB 1OHQA 4XCYB 4RZCA 4RBPH 3C6SB 1MCSA 4JM2A 2BY1A 5D7LB 1OWRM 4BFEA 5HYSB 3SDAB 5GGRB 1BPVA 3WDHA 1BIIB 1OARH 3FFCD 4YHOH 2PYFA 5J9PB 2D7PA 3P77B 1FJ1A 4NNPL 1ZHLB 4J23A 4CKVX 4JFQA 4PRHB 1KT2A 2AEQH 5J1TC 2YPVH 3C5ZC 5DUMH 2BNQD 3UYPA 3HI6L 3EYUL 4JFHD 2IWGA 4EZMA 4CW1A 3FRUB 4JVPA 2A77L 4JLRA 3JZ7A 4L3EB 4HS6A 4RA0C 4TUKL 2PO6C 1FPTL 5T5NF 4YDVB 3ULSA 1VFMA 4ERSL 4C54A 4J2XA 2E8ZA 4Y2DC 1N59A 2OZ4H 4JPVL 2ZOKA 3TN0C 3MNZB 3TJHC 4KK6C 3EYQD 2NXYC 1K4CB 1OAXH 3MBED 3QIWC 1D5MA 4M7LL 2E27H 2HTKD 1K5NB 2IEPA 1T7WA 5HHME 1AGEA 3HE6A 3LZFL 5ENWA 1DQTA 5FUZH 4MCYA 1F4AA 4YXLH 1E6OH 5IFHH 3GMLB 4L9LA 5C0CA 3D85B 1CLOH 4GS7C 3Q5YA 1QLRB 4MXWH 5IG7B 3LAFA 4X98A 4CVUA 3PWUB 3S36L 4NKIL 5JXEA 1TZIB 4U6HB 4XRCA 5IOPB 3SE8H 5JQ6H 3QQ4A 5I1JH 1Q1JL 4G8FA 2ITDB 4P2QD 3QEHB 1A8JH 1SYSA 3OAZH 3K1DA 1I3UA 2BMKB 4Y4HA 1RK1B 4WO4D 2WBJC 4MS8C 4NOBA 2IQ9H 1NBVH 3MLSH 1RUQL 1RUAL 5DUBA 3EYVB 3JV5A 4FQIH 2R0ZL 4IOIA 5DEFA 3VXRE 4LCIH 2XACC 1Q9KA 2VE6A 5D4QA 4F57H 4UT7L 2Q86A 4MHHI 5IJVB 4QT5A 4HH8A 4NKQB 1RZ7L 3CFBB 5TH2B 1BQUA 2FBOJ 3RA7H 2F58L 3QUZD 4HUUB 4RGNB 5ESVA 3DJ9A 3QUMA 4JY5L 4PJ9D 1FNSH 5H35B 1T7ZA 1WAAF 4XTRC 2VABA 3OAUH 3RKDD 5AD0A 4XMKH 1IQWH 3RZCA 5HDBE 4HS8H 4PFEA 1EHNA 4KUZL 1QFHA 3S88L 1AFVH 3MLRH 3T65A 35C8L 4MA7H 3BRFA 2R0WL 2JCCF 1AGFB 1U91A 5TQ0H 4LSTH 4Z7VA 2R0KH 1X4ZA 5C70A 4HIJA 4G8GB 4MMZC 2CK0H 4CUCA 4F7EB 1AGCB 3RX8A 5JMOC 2A1WH 1DQJB 4JY6B 1T1WA 3RGVD 3UJTH 3D39A 5C7XH 5FEBA 1JV5B 4LPXA 1GVIA 4QHMB 1I1AD 3V5DA 5F7EL 2L7JA 5D7IF 3A6CH 4JRYE 4LKCB 5TDNB 1KTDA 3CMGA 5E24E 4U1JA 5DMIH 2X4OB 3MREA 1JMXA 3PL6B 5E8OA 1RU9L 2PW2A 1X4XA 4C57C 5I1GH 3I3EA 1IGIH 4UIKL 3DX7A 4NHUB 1U8PB 5C0GA 1WGOA 2VR4A 3LQAC 32C2A 5D5ME 1QVOA 4KJPD 2CIIA 3GMQB 4NGHL 2KPNA 3RJDA 3JVGA 2F19L 1J0KA 3EGSB 4GSDH 3CFDA 4LVHC 1R3LA 3ZLQC 3AC0A 4LCYA 3FRPA 1TTGA 3Q3GA 3SDYH 5CZVL 3CX5J 3MRHA 4LPTA 4ZYKB 3TO4D 1AHWA 2ERJB 5HVGB 2VH5H 5DJ6A 2DLFL 1VADA 1FG2A 5EU5A 3L5WB 5F6IB 2YWZA 5AYQA 2EZ0C 3MRNB 4YWGL 1BM3H 3U0TB 3B9KC 1QA9B 4OFIA 1I1YA 1TVBA 5T1LB 2H1PL 2V7HA 3NPSC 1D5XA 3QXAB 3W0WE 5FGSA 3QRFM 4GUPB 3U79A 5I0DA 3QI9C 4EEEA 4NCDA 5DJAB 3DUUB 2JJVA 2DIAA 1Z2KA 1FVDA 1S7UB 4QRQB 4PJDB 4B5EA 2W9DH 2BXZA 1CD8A 4R2GC 3DSFL 4UDTA 4RZCB 2BVYA 1JUFB 4HWEL 1RIHH 3IFPB 5BS0E 5EO1A 2Y6SC 4R8WL 2CPCA 2DBLH 3S7GA 4KK9D 2A2QT 2ENYA 1GXEA 4CADA 2VZOA 3ARFB 3QO1B 3SJVE 4ONOA 4P4KC 4XP4L 3C60D 4JPWL 3REWA 3QFJD 3EOTH 2HA1A 1KT2B 2ZUWA 5JOPE 5EO0A 5DD5H 3IFNL 3WFDL 5BW7A 4Q9RL 1PX3A 4IOSD 1C8PA 3WMSA 3O6FD 1Z3GH 4OBSA 3WS3A 5ESAA 4CW1B 3QPQC 1W72L 4JLRB 5DJYA 4CJ1A 4JFPA 2A9MH 4WUUA 2AERT 3GSRA 1ZHNA 5GHWL 1T0NA 3ULSB 3UTPD 4N0UA 1N59B 3HI5L 1DBJL 5L7XL 1JHTB 4NKOA 1CZ8H 3TO4A 1XF1A 3QDJA 5ID1B 5TGBA 1CVRA 1D5MB 2YD8A 9CGTA 4PJDF 3KDMA 1G6RB 4YQXL 4FQ1H 5TPWH 3HNTH 3LPWA 2CLRA 3HE6B 5ENWB 4ETQA 4R4ND 1H9VA 1TFHA 3NFSL 3EFDL 1NLBH 4L9LB 1OAYH 5C0CB 2HLFD 4JPIA 2YWYA 4WEBL 1RUML 1CL7H 2OJZH 4XRCB 1R24B 1RPQA 3MRGB 4XNQA 4G8FB 1QSZA 1AH1A 4O00A 4EDWH 4LP4A 1BQHA 3G6JA 1SYSB 5E2WL 3I85A 1QNZL 2DM7A 4Y4HB 5E5MA 3B5HA 5FCSH 3I9GL 3QIUD 3UJJH 1CG9A 8FABB 1M1SA 4KTEH 2R0LL 1GC1L 3BKCL 2VITA 4ZDHA 5DUBB 2HMIC 1NMCB 5I75C 3T2QA 3UPAA 3RWGA 3CVHL 5I1LA 4HX1A 1CGSH 1Q0YL 4KROB 5DEFB 1EHLL 4JZOB 4DOHE 3EYOA 5IW6B 4DW2H 3ZYIA 1C08B 4HQQH 4OI8A 3QFJA 3G5XB 4QXTA 2ZJSH 4BUHA 2Q86B 1CGVA 1JNLL 4QT5B 3UBXG 4QHLA 2VDKH 1F11A 4LLYB 5EU6D 1FIGL 4G43A 2N4IA 5HI5C 1KFAL 2AJYL 4KKBD 1FVCA 3CJJA 1HILA 3V6OA 4U0RC 2I9LB 3H0TA 3BN3B 3GHBH 5FYKD 2R56H 1T20A 4P3WA 3DOSA 3PWPD 3O41B 5ESVB 1A6PA 3QUMB 3P0VH 4XVJL 1P84K 4DN3H 1WBXA 2VABB 2X41A 3NZHH 1IGMH 4NO3B 4QRSB 3S37L 5AD0B 3ARDD 3CSGA 3JV0A 5BZDA 4Z76A 4ZUTA 4U6YB 4ODSL 4M1CC 3KHQA 1JCKA 4AY0A 4K71B 5E6YA 1CR9H 2O5ZL 1U91B 2H3NA 2J4WL 5ILTH 4HIJB 5CKGA 5ICYA 5BRZE 5E6IC 5EU3B 1T1WB 3D39B 4MX7B 1YY9D 3E1F1 3O6KH 4DUXA 3V5DB 3JUYA 4X4ME 4HPYH 4XAWH 3QZWA 4G5ZL 3MZTA 4LAJH 1U3JA 1BEYL 3I02A 2VUYA 1ZVHA 2GITA 1GIGL 4M9PA 4R90L 1KTDB 2WWMD 2BFVH 3T0EA 3MREB 5E8OB 1T7YA 1EAJA 5CSZA 5AWNL 1JZ7A 2W65A 1AE6L 1HH6A 2CR6A 3VWJC 1S7RB 3WNKA 4X6FB 4MJ6B 3E6HB 2DL2A 4Q0XL 5C0GB 5I1DA 1CK0H 2ZUUA 32C2B 5I1AA 1QVOB 2AJ3A 2KQNA 1N6QL 4HWBA 2CIIB 4NO0D 1F00I 4KHTH 2J6EA 4XPTL 1A7OH 3QPXL 4XP1L 4U1GB 3CFDB 4LCYB 3MLPA 3Q3GB 5I8KH 3VFVA 3MRHB 1AHWB 2Q1EA 1JYVA 1YY8A 4RMVA 4N90D 3I3DA 4X0KA 4N9GA 1TTFA 4O58H 4LQ1A 4PJEB 4QXUL 4S1DC 4I4WA 3IXTA 3U6RA 3WHXA 1FG2B 1UM6L 3T2NH 3U9PL 3ZE1F 2H9GA 4XC3H 3ARDA 4K3DL 3FAXA 2NY1B 2VQTA 1X5LA 3HMXL 1UM4H 4HAFA 4ORGA 1DANU 5A40E 5MEND 1AD0A 2OL3B 5GGQL 2DMKA 5JHDA 5D96C 2ADFH 1X7QB 4HFWB 4HIXH 2MQ3A 5GGRY 5E8EA 1TJGL 2V7HB 3MRDB 1D5XB 1CLYL 2G60L 4R4BA 2ICWJ 1FVDB 2XTJD 4JFXA 2YK1H 1IEBB 4UDTB 2YA2A 1UG9A 4GBXD 4J6RH 2M1KA 4CL7A 1RURH 3INUL 5EO1B 4KDTA 1NAMA 2ZCHH 4LSSL 3ARED 1DEDA 1I9RL 4G7YL 4CADB 3BPNC 3P73B 3ARZA 4Y19D 1F58H 4HXAL 4DTGL 4EQ2A 4F9PC 4QRTA 1L9MA 1CFVL 3W82A 2JJSC 3LD8B 4PJEF 5EO0B 3VXSB 4R6UA 4UV7L 2OP4L 2JK5B 4Z8FH 3ES6B 4Y4FB 1J86A 1K4DA 4PJ8A 2CH8A 2AK4E 4KTDH 5ESAB 1E4KA 3AFLA 2FHBA 2F54D 2A73A 1Q0XL 3HC0A 4M7ZC 2EIZA 1ZHNB 1RAMA 1MJUL 3S96A 3BPCB 3O2WL 4U3HA 3HPJA 1F4YL 5ANME 4NN5C 5TGBB 3UO1L 4YEFA 1OAQL 5AYUH 2R8SL 3SDXE 2QV2A 4XC1L 3O2VL 3KDMB 4Q97A 1M05A 5IHZA 3MUY1 5DEZA 4NJ9L 2CLRB 2IBZY 5I18L 1P5UA 2DD8H 3CH1A 4ETQB 4OCSL 4X8JA 4DK3A 1AXSA 4PJHA 4XHJC 1E4WH 4FTVE 2AJXL 4G80A 3RVUC 3VFGL 3SKMA 2AEPH 1V3KA 3ULVH 1RVFH 5SWZD 2AEWA 3FN9A 5C08A 4FQPA 5IB1A 3BD3A 4HUNB 1WFUA 3EO9H 3GKWL 1R3IH 1GL4B 5F7FA 3G6JB 3MACL 3DPBA 4X5LA 2DQIL 1OT1A 1F3JB 1MIEL 3MJ9L 1MOEA 1JYNA 4YIQB 4M1GL 3CNKA 1CT8B 1T22A 4ZDHB 1FDLH 5B3JF 2X1XR 3RWGB 3GK8H 5I1LB 4HX1B 4L8CB 5E4EC 3QUMH 2DF3A 3CLFH 3MGAA 3EYOB 3QEUB 3SDAC 2DLGA 3GKZA 3MA9L 4QXTB 5DJZA 4LHUA 1CWVA 5GRYA 1JZ2A 1XAUA 4GMSH 4QHLB 1F11B 2R2HA 3EHBC 4PB0H 3UDWA 4G43B 4P5TD 5CP7A 4N0YL 4OCRH 3RI5K 2XIDA 2L4OA 3IKKA 3BKYH 3GI8H 3FOLA 3FJTA 1T20B 3NH7L 3U7YH 4F8QA 3V9FA 5JIIA 5IHBA 1BFSA 4GRLA 1WBXB 5H37G 1IVLA 1RZIA 3MYZA 2AXGB 2E7LC 1DBML 3CXHJ 3RBGA 4DKEL 3TLRA 4JKPH 5K93A 4JFYA 2VAAB 3K4AA 1CTNA 2O5YL 1N6UA 5BZDB 4IRSA 3JTSA 4Z76B 4ZUTB 5J1AA 4RX4A 4ZTPL 1LO4H 3BZ4A 4OFYA 3QO0B 2VR9A 1T3FA 3KR3L 4PGCA 2DDQL 4MD4A 1MFCH 4N8VA 5ICYB 1HHKB 1MHCB 5GGVH 3K2UH 5SWZA 1S9YA 3ARBD 4IHOB 4OF5A 3AXLA 4YK4B 1MLCA 3QZWB 4MLSA 3BUYB 5DGRA 4P99A 4E5XA 1FL5B 5IW3A 3GEWB 3KHOA 2BJML 4ODXA 5GRUL 3LOWA 2VDNH 1LEKA 1REIA 3ISWA 4JEGB 2Z91A 4LLDA 1FNLA 1J1XL 2ID5A 5CSZB 2R4SL 2ICCA 1HH6B 3L3IA 1W8NA 4Y1AD 1JPST 3FO1A 2HKHH 4QRRD 5I1DB 1HKLH 1MQ8A 2E8YA 1TXKA 5I1AB 4HJ0C 4EN3A 2VDLL 4XMLH 2E6QA 1GZQA 4S1SH 1HQ4A 4G9DA 3RVTC 4P3DB 5GGTL 3LKRA 4FQXD 3UTTE 4WWKA 5GZNC 2NTFB 3VFVB 3P4OA 3OHXB 3V7AG 3DURA 4XNMA 1IBGH 1YY8B 1MCEA 2EH8H 5IBTH 1AO7E 4X0KB 4N9GB 1BAFH 3L5XH 1G84A 3H9ZA 4I4WB 3U6RB 3WHXB 4OSUH 3RWDA 1YQVH 1ZT4B 5IBLD 3IF1A 1NBQA 1QLFA 3H9SD 1AC6A 4M1DL 5I15L 2EEDA 4NUGL 4ORGB 1ADQA 4DCQB 2XN9B 3MJ7B 3SKNB 1F8TH 3MUGB 2BVQA 4LHJB 1F6LL 3DUSA 4U6TA 3VXPB 2BC4B 5FA3A 3GHEH 1SEQL 4OZIB 4BK5A 4ZAKC 4XP5H 4WTWA 1JF1A 3OXRA 1S5IH 5CZXD 3L95A 1D5IL 5T1MA 1JZ8A 4HKZA 2J8HA 3MODH 4P9HH 4JFXB 1JNNH 4GRMA 4Z0BH 3WHE1 3GSUA 3MRKB 3QDMD 2QJDA 4YHYC 2GHWB 2FLBT 3S35L 2AV7A 1ZT1A 5H94A 5C9KA 4HKBA 3PHOA 1KB5A 4IRJC 1NAMB 4ZNCD 3G6DH 5B8CB 5EUOB 4IIQB 4KI5D 4ZO9A 2BOCA 1NAKH 4HK3N 1RULL 1XMWA 1YEKL 5HYJA 1L0QA 3PL6C 5I1KH 1UB6A 3VD7A 1QFWM 3SGJA 4BM7A 1NCBL 1NMBH 3FT3A 1ZGLB 3W2DL 3R4DA 1J12A 1K4DB 2XT1B 4PJ8B 4BK4A 4NWTH 2A73B 4LARH 4K94H 1JPSH 15C8H 3FHAA 4G3YL 5DUPL 3BE1L 5DVOA 3P30H 2V2TB 3TPKA 4FQXA 3REVA 3ARPA 3HPJB 4OZIF 3V6FA 4MNGB 2JJTC 1MAML 4IM8A 1U2CA 3UPRA 5DR5L 2ERJC 5AUMA 4WI8A 1AQDB 4H88L 1INQA 2DQHH 3SDDC 4U3CA 5K59F 3HAEA 3CH1B 2J7LA 1NEZB 3QIBA 5F96H 3RU8L 4D0DA 4PJHB 1P7QA 4G80B 3DTXB 2PETA 4HKJA 4R26L 1ZV5A 5EUOF 1ETZB 3QCVH 3SKMB 3TIEB 3QWRD 5ALBH 5ISZE 5I16A 1U0QA 2GSIB 4OGAD 1T4KB 1BQLH 5IB1B 1A9BA 3VRIB 3PDDA 4BUGA 2Q8BH 4LKXB 2EE3A 5IMMB 2QBWA 3LQAL 3QDMA 4NP4L 3SY0A 1G7IA 2EDYA 5HGHA 4O51A 3ZDXF 1T22B 1A5FL 4AEIH 4JM2C 1PEZA 2FX7L 4HC1L 1G9NH 4V1DD 3GSOB 5LQBL 4YBQC 1ULVA 4LHUB 5JORB 4GG6F 4U6VH 3DIFB 1HYSD 2R2HB 5CP7B 3BWAA 3MLUL 1JYXA 3N1QC 4M43L 2Y06L 1UZ8A 3G5VA 1JGUH 3FOLB 1RD6A 3M8OL 1JZ4A 1L7IL 1AI1H 1EO8H 4MDIA 4NQSA 3O6ML 4PJHF 2XZQH 3N50A 3TCXA 1CQKA 1VGKA 3UP1A 4GRLB 1INDL 1YJDH 2O26U 2CUHA 1JHKH 1RZIB 2FZ3B 1KIPB 4BZYA 4JFYB 4YHNA 1J8HA 1OAZH 4IRSB 1B4RA 5J1AB 1ORSA 5DMJB 2CD0A 1NSNL 4LLVA 4MD5A 2OXHA 3RWCB 5CUSL 3HNVL 3O4LD 4YHIA 1T3FB 3VXMD 4LBEA 3QNYA 4JR9H 1YEJH 4TTDC 4IOFD 4PGCB 3JWOL 3HE6C 2A38A 3TT3L 4GFTB 2VXTH 1B0WA 5IQ7H 3WUZA 4X6CB 4I0PB 1J1OL 1NC2A 2D9CA 4LAQH 1IM9B 3S3JA 5KS9B 2DWEA 3D3VE 1F13A 5CIPB 5LWYH 2R4RH 5JXEC 3RBSA 4HWBH 4E5XB 3RFZC 4WTXA 2J6EH 4YHLL 4ODXB 1CXKA 4YZFE 5C09D 5HY9B 2FYYA 5JMRA 4LLDB 1BMGA 4Y4HC 4PJXE 1D9KA 3L3IB 1YDPB 5FYKH 4J7RA 3FO1B 3CVIH 4PJFE 3BKML 4HHAA 4LLQA 5EFIA 4OV6F 2JB6B 3RWFB 3ULVC 1LO3H 4KXZH 2FJHA 3WJJA 4KROC 1SBSH 1PG7H 2PXYA 4EN3B 5FECA 4ONHB 1A7PH 4H5SA 1GZQB 4EXKA 5GISH 4G9DB 2EDBA 4WW1A 3DX8A 4NZDA 3QB7C 2UZYB 5DK0A 2DQJH 1ZA6A 4LSUL 1UZ6E 4WWKB 3P4OB 1JGVL 1MH5B 2DYPA 3RNQB 5L2KE 4M03A 1C5BL 4O4YH 3DURB 1SJEA 3QDGA 2BSRA 2FHCA 2LFGA 4Q2ZA 4X6CF 1KIQA 3KPSA 5IT2H 5KS9F 4XVSL 3ZTNH 3V0WL 4EBQL 4OUUA 4JCMA 3VJ6A 3RZCC 4MNQE 3FN0H 5DDHA 4G6FB 1VDGA 3DUSB 4PRNA 3HC4L 1NAMH 3MBEC 1BFVH 3O4LA 1WTLA 1RSFA 4KGLA 2HTKC 5IM7A 1GGBH 2D4FA 3HRZA 3WSQH 3ZE0F 1JF1B 3D18B 4NQEE 3H3PH 3OXRB 5T1MB 3L95B 4G9FB 4HKZB 2XTLA 3SGDI 3NCBB 1U8HB 1NBZA 1HN1A 2MOVA 4FQCL 3OB0H 4GRMB 3KLHD 3PABA 3TNMA 5J4MA 2Q7NA 1H3PL 4JFED 4LU5H 1WQVT 2LTQC 1MNUH 1CICA 3K2MC 1ZT1B 5H94B 4HKBB 5MI0B 1QSFD 2FB4H 4OD3H 4KRLB 4WGVB 3QQ3A 4YDIH 1AJ7H 4RWHA 1QQDB 3E8UL 3RVWD 3T77A 4MSWB 2VZUA 3LN4A 1AP2A 1KIRA 2Y7QA 4OCYH 4HF5H 5HYJB 3DETC 1A6ZA 3KYNA 3FT3B 4NM4L 4FRWA 3UTSD 4ODTH 3BH8A 5F9OH 3PQYA 1U8JA 2CDFA 4QGYA 2AEQL 4JRWA 3BT2H 2X5PA 3S9DB 1NGXA 1R5IB 3JVGC 2YPVL 2X4UA 2HJFA 1WCBA 2WUCL 5DUML 3REVB 1KCRH 4TNWF 3VFMB 4HBCH 5D7LE 3B43A 4YHZL 3UPRB 4HDIB 2J2ZA 3MJGX 1RJLA 2X4QA 3OTTA 3MYJA 3EDDA 3PDGA 1NGYB 4OAWA 5AUMB 1U8MA 1INQB 5GS0D 4PJ9C 2VSDA 4QTIL 1JGEA 1H3GA 5F7KC 3MR9A 3QIBB 3IDJA 4D0DB 2OLDA 2P5WB 3QYCA 4TNWK 3GNML 1OAXL 1F4WH 4HKJB 3MTRA 2E27L 5D1QD 5I16B 3WV0A 3GO1L 3OMZA 3P9MB 3RWHB 2HKFH 4FQJH 4YXLL 1HEZA 3L9RB 5A3ID 2WNGA 4YE4H 2Q20A 5HHOA 5BJTA 4WCYH 4H8WH 1GGIL 3SY0B 1G7IB 3RGVC 4O51B 3SE4A 3NCJL 2DLEA 2BHUA 1N7MH 3ULUF 4FABH 1FNFA 4NQXA 3ZMRA 1IKFH 2COQA 5LBSL 4EVNA 3VH8G 4AM0A 2XA8H 1CXIA 5F7NC 4O2EB 2IQ9L 1NBVL 4XCCH 5EOCJ 3MRCA 3BDYH 1VERA 4P9HC 7FABL 3GMRA 3LD8C 1UZ8B 4JDVA 5BW7C 4JG1L 3G6AB 5DC9B 4MDIB 3MRJA 4NQSB 3MLZH 2A0LD 1HINH 4F57L 5DFTA 3LPGA 4S1QH 1VGKB 2DOCA 5CHNA 1SVZA 5ESQB 4U1LA 2WWKO 3CZFA 4K2UH 1BZ9A 4RFEA 5JZ7D 2BVOA 1A7RL 2AVGA 2JCCE 1J8HB 4JZJA 1MCOL 2AV1A 4XBGA 2QADD 4M6OH 1KPUA 1HSBA 1QEWB 3TO4C 4W81A 4UAOB 2MWCA 4LLVB 4AT6B 3T08A 1CLCA 3MXWH 3DUHA 2NX5D 5D6DA 5E94A 5SX4H 1XF2B 3QNYB 5JLZB 4K94C 4RISH 5BV7B 3AS3A 4HS8L 5JIKA 5D7IE 5IK3A 2VLJA 3MLRL 5IVOA 5TE7H 3ELAT 2C3VA 1NC2B 2OXGA 4MA7L 1W0VA 1MAKA 3WXVH 2OSLB 1GJIA 4JFDD 4HAGA 5TQ0L 4O02L 4OLVH 4LSTL 2R2EA 3NIGE 2CK0L 1IC7L 2HJLA 1OGAA 2D9QB 4RMTA 3PP4L 2FYYB 4XCEA 1BLNA 4KPHH 4L4TE 4TQEH 1OD7A 3O3EA 3OF6D 4PJ5A 1S7QA 1PDKA 5C0AA 5D71L 4LLQB 1P4IH 3DECA 2DL9A 3P4MA 4KK9C 5KTEL 3QHZL 4MZ3A 4QNPF 5FECB 5FUCE 3QUYB 2V2XA 4Z7OE 3HTLX 2BRRH 3D87B 2NY7L 4WTZA 4WW1B 1ADQH 4OZHE 3DX8B 2EYSA 5DK0B 1M71A 1ZA6B 1T80A 4YDLC 5DRNA 5HYEA 1D6EA 1KG0A 3V6OC 1SJEB 2GCYB 3S3PA 3IS1X 2BSRB 1WVZA 1ZAGA 1FFOA 4NQDD 2D03H 3A6BL 3UBXA 5KAQF 3THMH 2JJUA 3KPSB 1FH5H 1TTUA 5K9QG 1G9NC 3CXDH 5JOFA 1NCDH 2SEBA 3VRJA 1DTUA 1ES0A 2NY6D 3B9VA 3VD5A 5I9QC 5F9DC 1AXTH 1OCWH 4ENED 5DJ0A 5DDHB 2VISA 1KB5H 2AJSH 4DVBA 3ULUL 1TDQA 5F93C 5IVNA 1EH9A 1YYLL 3IAQA 3HRZB 3MOQA 1TVDA 1X3DA 2YPLD 2YUVA 4KZDH 1XCQA 4R4NC 4LL9A 1S9KC 1NBZB 1YJDC 1MPAL 5I19H 2BVTA 3PABB 2HLFC 1YEHL 5F6HI 1OP3K 4PD4J 3BRDA 2ESVD 1CICB 2G5BA 4ESKA 3BN9D 3WDIA 4NT6A 1MI5B 1YNKL 4OF7A 5I73C 5EBWB 5ALCL 3T77B 4OLZL 4I77H 5JNYA 3BPLB 1L4IA 3OF6A 3LN4B 1AP2B 1KIRB 5C9JB 1DSFH 3QIUC 3T0EC 4GAYA 3IJYA 4ZPTB 3TNNA 3O8XD 1B2WH 5F9WB 2HYMA 3KYNB 5DA0B 4AJ0A 3PGCA 4WFHE 4E41E 2OR7A 5GS3A 4PJBA 1S8DA 4HJGA 1AC0A 3PQY