3ARDC

Ternary crystal structure of the mouse nkt tcr-cd1d-3'deoxy-alpha-galactosylceramide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
204
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
molecule keywords Antigen-presenting glycoprotein CD1d1
source organism Mus musculus
molecule tags Immune system
total genus 39
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ardC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ardC02
2D31B 3QDAA 2WQ8A 5I2IB 2UZXB 3ZMRA 3H3PL 3ULUL 1WFTA 2X70A 4AG4H 1OD7A 3OJ2C 2PO6A 4LRNL 3DRTA 3L3JA 5CJOH 1UZ8B 4PJFA 4WV1C 4AT6A 4DKDC 3TO4D 1UCBH 2DKSA 3KLAB 2B1AH 3UZVB 4HLJA 4FQ1H 4J4PA 3FB8A 4HJGA 4M61B 4NFCA 1YNTB 2J4WL 4WTWA 4IIQB 5E8NA 5E56A 3BP6B 1YMMA 4G6FD 4X6CA 4UQ3B 3RNKB 1KCVL 4XCCH 4KK8D 3F58H 3HNVH 4P46A 3TT3H 2OQJB 3V52L 2DDQL 5JQ6L 4DTGH 4WGWB 5DSCB 1PAMA 3VXRA 4QRRE 4RFNC 1R24B 3K8MA 5EH1A 4V2CB 5EOQH 5T1DL 2HT3D 5C3LD 1G84A 1EJ6A 3G04B 4XCNA 1XF5A 4H20H 2Y06H 1K8IB 2C4XA 4JKLA 2C1PB 2VLRB 2DWDA 3CFDB 3RGHA 3GNMH 4M6MH 1NGPH 5DQDL 4XX1E 5ECJE 5JA9A 3MRFA 3N85L 3Q6FA 1MCPH 1V3KA 2H41A 5A2JH 5DQJA 5A2LH 1MAKA 2MMXA 3BT2H 2D3VA 1A2YA 2JCCE 3VRLE 3KPSD 1Q9OB 3MRPB 1VADB 1ZHKB 1JGUL 3DRQA 3VFGL 3MA9L 4PS4L 4MLIA 3TJHC 1AXIB 4JRXA 3Q5TA 4M7JL 4XCYA 3H9SA 4HS3A 1IBGH 4NZDA 4JDZB 1S9VB 1CF8H 1I7ZB 1SYVB 1N5AA 3DUUA 1FYTA 4OFVA 6CGTA 2XI9A 5C86A 3MLZL 3PF2A 4QLRA 1B9ZA 4PJIB 3TA3D 1WIUA 2DM3A 3GSNH 4XHQA 5B22A 2ERJB 1ZHBB 3ILPA 5IB4A 1DQLH 1QBMH 1CICA 1FFQA 4E41E 4EN3C 3KJ6L 2CDFA 3K2UL 1EEZA 3DYOA 1INDL 5GISL 4NDMB 1BVZA 4Z5RB 2R2CA 4WI9A 5GS0L 5J57B 1KEGH 4TUJA 1C5BL 5C07B 3UCRA 3G5XB 3MNWB 4G8GB 3JTSB 1FV1A 4ONHB 1RHFA 1CDBA 4WI3A 3VXTA 2VLJA 4OB5H 3TO2A 2GT9A 4MJ5B 1FLRL 1KLGA 1JHTA 5HSFA 5D2NB 1FZKA 5DT1L 2X1WL 1KSRA 1G7MB 3G6JA 3BISA 2ITDB 1IKFH 4G3YH 5D2LE 2B4CH 2GTWA 1N7MH 2J3SA 3ROOB 3BGFB 4HUUA 4OUUA 2EYTB 2CK0L 5IJVA 1CFVH 3WIFA 3ES6A 3TBWA 1J10A 3JV5A 4YIQB 5C2BH 2P5WE 5C0GA 3D3VA 1L0YA 3QIUB 3H6JA 1G7IB 4J1UB 2XN9B 2PF6A 5LBSL 5IQ9B 3REVB 2XY1A 3S6CA 1F58L 4LARH 2B0SL 5SWQB 4TVPD 4P2QE 2GJZB 15C8H 5L9DH 1F45A 2A9ML 3RNQA 3S88H 3SCMC 4O2FB 4BH7B 1JZ2A 4G9FE 3RZCA 3BQUC 2XA8H 4HH9A 4W70A 5MEOA 2R2HA 1ZAGA 5GSVB 5SWSD 3F7VA 4LLMB 3MLSL 4Z7UF 1QLRB 2H6PA 3TT1H 4OZFG 4NKDB 4APQB 1V3LA 3KPNA 4IJ3C 3SQBA 4NNPL 5JMOC 1JYWA 3HG1D 5SWZA 4IRSD 4WI8A 5DMIL 3S98A 1RMFH 2HT2D 2VXUH 3IFNH 2EDRA 4O02L 2VXQL 5TFSH 3TN0D 5ETUA 2VXVH 5FO9B 4Z7OE 3JWDC 4JO3H 4YDJB 4LCYA 2JELH 4KC3B 4NQEE 2FEDC 2W60B 3HC3L 3AC0A 2ZZUT 3OG4B 4QO1A 5EU4A 4MA1C 1L4IA 3IFLH 4LMQE 3BN3B 4CJ0A 4F2MB 5CSBA 1MQKL 2BHYA 1A6UH 2JJTC 2CO6B 4BSJA 1MF2H 3RAJH 5I73C 3F62A 4GXUM 3D18A 1MLBA 4EQ3A 3DV6A 4NO2A 3VXUA 1EEYB 2BDNH 2VDRH 2G60L 1X5KA 3FB5B 2ADIA 1GZQA 1I4FA 4JKKA 4XP9L 1EGJH 4NO0D 4UUJA 5MEQA 5D1QC 1RZJC 3OKYA 2KPNA 1OGAD 1JMXA 3BZFB 4UDTB 4WEBL 3JV4A 1BD2E 2BOCA 3H7LA 4X4XA 5JR1H 2DQEH 5CKGA 3FFCD 2P44B 1VKXB 1BEYL 4MCYA 2LVEA 5JIKA 5BXFA 3L3KB 2IALA 3AU1A 4EKXA 2IJ0C 1LNUB 3TO4A 3U0TA 3BKML 1BBJB 1N0XL 4F58L 1FSKB 1M6OA 1KG0B 4YDIH 4FABH 4XB7A 1J1XH 1JZ7A 4UINH 4BKLA 1G9EA 3VXOB 4PREA 1MHPH 4ZAKD 3DETD 4MA3B 1GGCL 5DJ0B 4NQCB 2DJ4A 2X41A 1MRFH 4IHOB 5DQ9B 4Z7UB 1OM3L 4DN3H 5A2KH 4HK0A 5FDWB 4OCRH 4XC3L 5ACMA 5E00B 3BIKA 3Q1SH 4RBPH 3RVXD 5F7EH 4NZUH 4UIKH 5JZ7D 1RVFH 2OLDA 3JVGC 1QLEL 3EJZD 3DARA 2XTLA 4Q58C 3O3UN 3SGKC 4X9FA 5IFJB 3M1BA 4OLUH 1TETH 3PQYE 5B21A 5I19H 3O3EA 4LSQH 3B8SA 4WDIA 3UBXA 2F74B 1X5FA 1WBZB 1G9NH 1H3PH 3VWKC 5BOZG 3O9WA 5BO1L 3GUTA 3KPSA 5IG7B 4KFZC 5KN5A 5E0QA 2QHRH 4JJ5B 4NFDA 4O2EA 1YN7B 3VFSA 2WINA 4U1JB 1TMCB 3LKOB 3CVHH 4Y0GA 2MPAH 3EIFA 4KI5E 4X0KB 3VD5A 1I85A 1LP9A 4DUWA 2NR6D 4AG4L 3ZE1E 5CJOL 1QSED 3GJFB 1UCBL 3GMPB 1FNEA 4FS0A 5E6YA 1UGNA 1L7TH 4FQ1L 1CIDA 3TA3A 5EUOA 1GSMA 4HT1H 1JNLH 2Y72A 3KPOA 4PV9A 3QFDA 3TGXA 5I0DA 4U0RC 3QNXB 3ARYA 3F58L 3HNVL 8FABB 4ZFZA 3TT3L 4PJXF 3W2DH 5CEZH 1CD8A 1JGDB 2Y36H 3BP4B 3QIWB 4DTGL 4M5YH 2JIXA 1YC8A 3W82A 3R8QA 1FG2A 2FR4B 1F3JB 2L7JA 2AQ2A 3RWCB 5EOQL 3X3GL 4GQ9H 3V6ZA 3JUYA 4H20L 3MNZB 1K3ZA 32C2A 1J9CT 2Y06L 1DBKH 4XNMB 1QBLH 1VEOA 1KNOA 4P57A 3MO1A 4L9DA 5I66B 3GNML 4M6ML 4W4OA 3KG5A 3PWPD 3QDJB 1MCPL 1BP3B 3O2DH 4N8VA 4TSCH 3NOIA 5DFWH 4H1LA 3NFPA 4JKMA 1SY6H 3DURB 3BT2L 3KLHC 4R8WH 2HFEA 4YHNA 5D96B 3NZHH 5GRWA 1HHGB 5C70A 5GSRA 4J8RA 2XT1B 4U1MA 4MS8D 2H26B 4WFHD 5DRZA 4KTDH 4R2GB 2DJUA 2V9QA 3AXLA 1KPUA 3MXWH 5L7XH 1IBGL 4LAJH 1UENA 4LCCC 2Y5EA 4JFHD 1CF8L 4ZNEA 5T1KB 4HHAA 2XKSA 4U1GB 3C5JB 5I17B 3LSOA 5SX5K 4IMKC 2PTTA 5SWSA 3RVUC 1W0WB 1WBXB 5HYJB 3DROA 3DI3B 4IRSA 3BKCH 4I3GA 1DQLL 1WZLA 4OZGF 4CVZB 1QBML 4JQXC 1ZT7B 4XXDA 3VJ6B 1JF6A 4GFTB 3T8XA 3MX0A 3QUYB 4K3JH 5DHVA 4RMRA 2X4TB 3VGAC 1KEGL 3L7EB 3PWJB 1OCWL 3NPSC 4MA8H 5I1AA 4OM0H 5BZDA 1A7OH 1KJ2B 5I8CB 4LCUB 4R7DA 2ICEB 2RFXB 2EDTA 3OKKA 4Z7WF 2EYSA 4OB5L 1FZJA 4M93B 4X8JA 2ESVE 3F6IA 4GW5A 1ES0B 3EOTH 1EPFA 5DC0A 2P8MB 1A4JB 3PXHA 4M7KH 2HTKC 3G08B 3KHQA 1NBYA 1G0DA 4NO0A 1GGBH 2B4CL 2HYMA 4ZFGH 1N7ML 2WBJB 2W65B 1MNUH 1R3JA 1KGCD 1KJ2H 1OGAA 1CFVL 5C2BL 2X7LB 3H7BA 3GMMA 4PJ9B 2Q76B 1C16B 1XGTB 1KYOK 4QEGA 5IVXA 5L8KB 43CAB 5FUCE 2PO6C 3O3AB 3FFCA 4WFGE 5D72H 4LARL 2IFFL 4ODSH 15C8L 5L9DL 1WC7A 3DO7A 3S88L 3D25B 2XA8L 2ZKHH 1B6UA 3VGBA 4P46C 1ZLWH 4WO4C 4ZAKA 2NY3D 3TT1L 2DB8A 4QTIH 1S9WA 4OQTH 3S36H 5AZEH 3O81A 3L6FA 4WTZA 4CN6A 3GI9L 3TM6A 4TUOB 1RMFL 2VXUL 4M1GH 3IFNL 5ESAB 5I1KH 4XAKD 2A6JB 4K7FA 2E7LA 5TFSL 5TE4H 4RFNB 1A6WH 5CMAB 3SEPA 2VXVL 5I1IH 1KB5B 3CVIH 3ZHDA 3HUJA 4JO3L 4OZGB 4PGDB 3BGMB 2JELL 4HGWB 5HHPB 1VCAA 1FFOA 1FHGA 4R96B 3OAZH 3IFLL 4J6RH 2FX7H 3REWB 2BVUA 2VMFA 5C9JB 2EE2A 4ZSOE 4A6YA 5C0EB 1A6UL 1MF2L 3K8KA 3RAJL 1X5LA 3OMZA 4TSBH 3GSUB 1I75A 1WTLA 2JJSA 4D0DB 1FVCB 2YUWA 2XACC 4JKWA 5MHSE 2BDNL 3F7PC 3T0ED 2VDRL 4Z7WB 1AIFB 2G75A 5HGAA 2CD0A 1A7NH 4HUNB 4XXCA 1C1EH 4P2OD 2VB5A 1EGJL 3LV3B 3RY6A 2BP3A 1NCWH 5HHNB 2WM0A 4OZHA 2BY0A 1LO4H 2RR3A 2E7MA 5J11C 5GGTH 5CD5C 3VFPA 4JANA 3FO1A 3BYYA 2N7AA 5JR1L 4PRNB 1O5DT 1G7QB 4HD9A 5H2BB 3BD5A 1R6VA 5KANI 5L2KE 3UAJC 4X9HA 2AJSH 5JIHA 4ZG1A 2EE9A 5ANMB 1AXSB 3VXSD 4PJ5E 1LVEA 5DF0A 1OARH 3TJEH 4YDIL 4FABL 1KCKA 1Z3GH 2YR3A 2Q3ZA 4UINL 1FJ1B 1CICC 1MHPL 1IGFH 1I9JH 1U8IB 1BM3H 1G7HA 4M00A 3TIEA 4F7MB 2V7HA 3TVMB 3MJ9H 1MRFL 5HY9A 2YUVA 3GBMH 4HWZA 1YEGH 2YS4A 5C3TA 2XKNA 2QTEA 4DN3L 5C0NC 2NXYC 2BNRA 4OFYD 4OCRL 3G9VA 3ECBA 5ID0A 4M1CD 4K7PY 5F7EL 4NZUL 4UIKL 1RVFL 5IW6A 1I1RA 5F72S 4HLZH 3UX9B 1JCKA 2BRQA 1B0GB 3BH8A 3PGCB 5JOFB 1ZVYA 2APVA 2DRUA 3CPLA 4ODUA 3UMTA 3RUGE 5EC1B 2XIDA 3RWJB 3OB8A 4HGMA 1UJ3A 2F53E 3HPJB 4DEPC 4OLUL 1TETL 3WLBB 3PWPA 4GUPA 4X7DC 4WW1B 5I19L 5EB9A 5T1MB 4LSQL 3RWIA 3NA9H 3WD5H 1H3PL 4RGNE 4PBVC 3GRWH 1FFPB 3RY5A 2OJEA 2QHRL 2NY0C 3RL1A 1M7IA 3QDHA 1QO3A 1CLYL 3CVHL 4FG6C 4GRLD 5C0DA 5I74B 2MPAL 1YY9C 3RZCC 3B4NA 1NCCH 4HWNA 1S5IH 3BQUB 3C6SA 1G1YA 5E8OA 2X6MA 5J06A 1JNHB 2QSTA 1RJYA 3LH2H 1V7NH 1L7TL 4JO1H 4U7MA 1LMKA 5E8PB 4S0TD 4HT1L 1JNLL 3QWOB 1QYGH 4MSWA 2O61A 1VACA 4M8QA 2XKUA 2E8YA 4KK6D 1PKQE 3SDCB 3WXWH 3RIFF 2VAAB 1CXHA 1FG9C 5F88A 2ITCA 3W2DL 3CFKB 5CEZL 3IDJB 2Y36L 3OV6A 4M5YL 1WIPA 2F54B 3PV7A 1J1PL 4X80H 3DGGA 4XH2B 3ZKMD 4BUHA 4GG6E 4MA1B 4GBXC 4POUB 4YEEA 4M1DH 4PRDB 3RGVB 1A7RL 4GQ9L 4YR6A 5AYUH 4JKPH 4KDVA 3FCTA 1MREH 1V5JA 4JLRA 2B7DT 1DBKL 1QBLL 4MQ7A 1IEBA 3UO1H 2H2SD 5DA0B 4Q9QH 4HAGA 3VG0H 1EAPA 3CH1B 3V95A 1U2CA 4U49A 5IIEB 3UTSB 3O2DL 1DE4A 4TSCL 2VXSH 4UNVA 4J3WA 2VLME 1A02N 1SY6L 3VFVB 1VFMA 4R8WL 2ZNWA 3VDAA 3NZHL 4CL7A 1Q94B 2HA1A 3IFOA 3NZ8B 4MNQD 4DFIA 1AD0A 1ODAA 4KTDL 5FEBA 2CUIA 1TJGL 3MXWL 5L7XL 1B90A 2ED7A 2AS5M 2XWTB 4Z7QE 1TITA 3D0VA 3BN9C 3UTTB 4MNGE 2RAMA 4MD5A 2YZ1A 4GKZA 2NX5D 4ZOBA 4PRHA 4E5XA 1LEIB 1TZHA 5E4IA 4BFBD 2DLIA 3LKSB 5EBWB 3VA6A 1D5XB 5F7WC 1PY4A 3PIQA 1SVZA 3BKCL 1IAMA 4G8EA 3UBXI 2L4OA 1I9IH 3ZL4H 1P6AB 1JWMA 1YQ2A 4LVNB 5GJTH 3CLFH 4K3JL 1JTTA 2E7CA 2XA3A 5FCSH 5ISZD 3QFJB 3IJHB 5CIPB 3DHMA 3VFUB 1YEEH 1AKJA 1FBIH 1OL0A 4ALAH 4MA8L 1PY9A 3TPUB 2GSIA 4OM0L 1HDMB 1A7OL 5T3ZD 1BVKB 4GKSA 4CU6A 2VIRA 3VI3F 4OCSL 4Q6IA 3VI4F 4RBPK 5CEZE 4NCC2 3EOTL 4QRPB 3E6HA 5I8OH 1PQZA 3F6LA 4XNUH 3TEUA 5BOPA 3T0EA 2EE3A 3X13B 4M7KL 5E9DD 5ICZB 3NIFE 3O9WC 4ZUUA 5CIPH 4UZGA 1H5BA 4HJ0D 4P2OA 1FZMB 3V2AR 4OV5A 1GGBL 4ZFGL 1MNUL 3PV6B 4NM8H 1KJ2L 5GRZA 3RDTB 4XCEB 4YDVA 4ELKA 1UVQB 5J8OA 1U8NB 2Z31A 3TBVB 2IAMB 5IMLA 4E42A 1CN4A 3ARQA 3WJLA 1EX0A 1KENH 5E6ID 4JAMA 5D72L 3KXFD 2AXFB 3TYFA 5MERA 2H32H 4ODSL 1XCTB 1PZ5A 2AJ3A 1QEWB 3TA3C 3VG9B 4EDXA 3HC0A 2V2TA 2ZKHL 5IT2H 1JYXA 3NN8A 4U6TA 4U6XA 4K9EH 4PLJC 5DRWA 4X5WA 1IGTB 4U0RB 1A21A 4QTIL 3FJTA 3H0TB 3CSYA 5TE6H 5TGBB 4OQTL 3S36L 5AZEL 3IVKA 4HK3N 4PJGB 5SX4I 1VENA 2VQ1B 3S35H 4YHMH 3OR6A 3D39A 3K2MC 3BFOA 1ZLUH 4M1GL 3JV6A 1G6RB 3KYKH 1T1WA 5I1KL 3P73A 1BQHG 4X5XB 4HLZG 5TE4L 4NC1C 2VRAA 1A6WL 4L8CB 1KT2A 5I1IL 3CVIL 4Y16C 4EI5C 1L9MA 4GAYA 5D7IF 2CMRH 2N7BA 3WO4C 2WANA 4NHUA 5A40E 2IPTH 5C6TH 4PJEF 2GJJA 5IFAH 2FBOJ 5DJ8B 4J6RL 5AEAA 2FX7L 1OTSD 4KGJA 1UM4H 5J7CC 1ZA3B 1QQDA 5H94A 2BXYA 5DR5H 4W4OC 5IW1B 3T3PE 2BVPB 1DLFH 4WRLA 4YBQD 3JWOC 5J6GB 5K9KB 4TSBL 1G6RH 1H8SA 3GMOB 2J8UE 4MJIB 3BZEB 1KJMB 1A7NL 2GTZB 2NY2C 1X6NA 2JB5H 3LDBC 1C1EL 2C3VA 3G5VA 4PJ8B 1N59A 1S7RA 4PJFF 4DGYH 5KS9E 2XV6B 3T2OA 1NCWL 3KYNA 5EBMB 3QZWB 4K3GA 3O3BA 3GEWB 1LO4L 4JGJA 2ICCA 1BZ9A 2XPGB 3OKEA 5GGTL 1KTRL 4RGMC 4L3EB 4X6CF 2BOBB 4PJBA 4GG8A 3P0YH 4GRLA 2ID5A 3CU1A 3TFKD 4RQQB 1KIPB 3LRSB 1RI8A 3HRZA 3L3IA 4NQTA 2AJSL 3LQAC 2LE9A 4Z0XA 1DUYB 2EICA 3L5HA 3DUSB 1OARL 3TJEL 1RZGB 3QQNA 4IRSC 3WHE1 1X7QB 4O5LH 1DQJB 1Z3GL 5IMKA 3FOMA 4WI5A 1I9JL 1IGFL 3OXRB 1YDPA 3MYJB 4FZEH 4P5TD 5CHNA 1BM3L 2NMSA 2DMKA 2VZ3A 1MVUA 3UTZB 4O00A 3MJ9L 4M7ZB 4N0UE 3GBML 1YEGL 1S78D 4F7TA 5DYOA 1DEEA 2F8XC 4KPHH 2LTQC 3O8XD 3AS2A 2KL6A 2IANE 5E7BA 2FO1A 1FNFA 3QYCA 4UNUA 1S8DB 2VLLA 3EOAB 3OG6B 4RWHA 1WWCA 3T4YB 1TCMA 1RK0B 1G7LB 2GY5A 5D7IB 3SDXE 2QBWA 4HKZA 1WFOA 3DVNA 3K4AA 2PW2A 3NA9L 3SE8H 3H9HA 2BY2A 3WD5L 4L9LA 4FZ8L 4N0FA 5GJSL 3GRWL 1IGIL 3QULA 5C0BB 2F8VA 2X1XR 2I9TA 2Q6WA 2GITA 2X70B 2VL4A 2PO6B 5F7DA 4RGOH 1BOGA 3DRTB 5D6CA 4FTVE 1IAIH 4PJFB 3TH2T 5DD6A 1CD9B 4KRNA 5ENWA 5F6HI 4FQXB 1IFHH 3TWCH 1X5ZA 3FB8B 4ZOEA 1NCCL 1S5IL 5E8NB 3W0WE 3I6KA 5HDLA 4P23D 3R8BB 4R9HA 4E41D 3LH2L 1V7NL 4ZAKC 4JO1L 3T3MF 3CDFA 4JM4H 4WUKH 5FM5O 3V7AE 1IMHC 1QYGL 4XPHH 2DQIH 3B3IA 4PJDA 2E7LC 3VXRB 4BFIA 1UH4A 1ZLWK 3WXWL 3RA7H 3RVXC 3V7MA 4CMMA 3G6JF 5JZ7C 1XF5B 2ZCLH 1G9MC 4X80L 4JPVH 3B9KC 3VD7A 1VPOH 3ZYOA 4M1DL 2EYRB 2HKHH 4MMXC 5JO5A 3FQTA 3VFNA 1U9KA 1EFXD 3IS1X 3MRFB 5AYUL 3GFUA 4JKPL 2JJSC 3Q6FB 1MREL 5DURB 5A16B 3KYMA 3WDIA 3UO1L 1JF1A 4Q9QL 2P5WD 1KCSH 1A2YB 3OAZK 3VG0L 3S97C 3MQIA 5J0BA 3STZA 3DRQB 4KROD 2VXSL 1HWGB 4P2QD 2DQJH 1DZBA 2OZ4A 1Q38A 4XCYB 3H9SB 4HS3B 1QR4A 4CDHA 4G9FD 1N5AB 2NR6C 1FYTB 5IFHH 5E6IA 1X5HA 4NKIH 3KXFA 5BJTA 4OF5A 1J5OH 2BNQB 3M45A 3MLVH 4TNVK 3O6MH 4LSSH 1CR9L 4FFWD 3ILPB 4C54A 5IB4B 4JREC 4P2CG 4I3SL 5EZOH 1CICB 1FGVH 3GM8A 4Q0XH 2CDFB 5HHOE 1MPAH 5C0AA 4JFDA 2QQLH 4NQED 5HD8D 4TUJB 3CAFA 1I9IL 3ZL4L 4WFFE 2NXYB 4PG2C 1DP0A 4DGIL 4GRWE 1FV1B 2ICWJ 1CTOA 5GJTL 1MHCA 4ODVL 2VLJB 3FZUC 3TO2B 4CN1A 5GS0D 4Y19E 1YEEL 1FBIL 1Q72H 4Y4KD 1FZKB 4ALAL 1T22A 3E2HC 3MV7A 3G6JB 4L4TA 1UJ3C 1U3JA 1MJ8H 4JM2D 5EZLB 2GTWB 4PJ7E 4DEPB 1FL3B 3O6LH 5I8OL 3A67H 4OUUB 5IJVB 4RAHA 4RSVA 3AY4C 3ES6B 4P4KD 5DDHA 3WIFB 3ULVH 1BD2D 5L0QC 5JW4Q 1D7FA 3P30H 4AH2A 5C0GB 3D3VB 1P7QD 2X4NB 1UQSA 3UPRA 3VMPA 2NY0B 2ZOKA 4NM8L 5JPMA 4DZ8B 1MFBH 3T77B 3LEVH 3RNQB 3ARGB 1QTYT 5FV1L 3RZCB 4HH9B 1KENL 5MEOB 2IGFH 4AIXA 2EIZA 4JN1H 3F7VB 1DANT 1BF8A 3KPNB 3VDCA 5IT2L 2UWEB 4PD4J 1QNZH 4K2UH 4K9EL 4F57H 1S7QA 3W9DA 2ZPKH 3EDDA 4QRRA 5TE6L 1ED3A 5ETUB 4ZTPH 3S35L 3SJVA 5E1AA 4LCYB 4YHML 1RULL 2M2DA 1U3HB 3KPRE 1K6QH 5I1DB 5EU4B 2V5RA 3KYKL 1AXTH 5HYQA 4AJ0A 3VXNB 3IDMA 3PQYD 1HQRA 2ZCHH 2CMRL 4JQIH 5EN2A 1MLBB 1VFUA 3DV6B 4NWTH 2IPTL 5C6TL 4NO2B 3RRQA 5IFAL 1NUGA 3LB6C 5CEXA 5B4MC 2JCCA 2ADIB 1A7QH 1MI5D 1UM4L 1I4FB 5DR5L 3NIGF 1FO0H 1DLFL 5JHDE 3B9DA 2YPLA 5MEQB 2QQKH 3RL2A 1G6RL 4JZJA 3CD4A 4YK4C 3WKMH 4GQPH 5C08E 4EZMA 1LP9F 3KPMA 1FNLA 3BMVA 3WN5A 2WUBH 4PLNC 2VUOA 2JB5L 3U36A 3JV4B 4JFEE 2BOCB 1A7BA 1DQQB 4KI5D 3R06A 3OGOE 1CE6A 2D7OA 4DGYL 4LQ1A 5AWNH 4X4XB 2J8HA 4P9MH 4OGYH 3B2UD 5EUOF 5TQ2H 2YK1H 2IALB 3TO4B 3U0TB 1UM6H 5DMGD 3P0YL 4KQ3H 5M7QA 1PG7H 2JKXA 1T7YA 1M6OB 4C4KO 5DXWA 2WSKA 4BKLB 4G6FB 4P23A 3IXAB 4PREB 4E41A 5BS0E 4LF3A 3KYOA 4LLAA 1I1AC 4FNLH 4CUCA 3Q6GH 3P77A 1NLBH 2KUTA 4XNYH 4O5LL 1VGKA 4F7CA 4D0CB 1D9KD 2AK4E 4DGVH 3E0GA 1FL5A 1R3KA 4L4VE 1EO8H 4YPJA 4FZEL 4HK0B 3BIKB 3X12B 5DFVC 4MQTB 2R0WH 1ZHLA 1NC4A 2V17H 1K8DA 4I4WB 1RURH 3NCCB 4KPHL 4XP5H 4OFIA 4B0MM 3SKJH 1RZKH 3EYOA 3M1BB 5D2LA 3QI9A 2Z93A 3O3EB 2R56H 2YSSA 3KLSA 1UKQA 3UBXB 2RCSH 3NFSH 4MAYC 3GUTB 4P2OC 2V7NA 2VWEC 3KPSB 3ZYJA 5KN5B 3IDGB 4M02A 1WISA 4BJLA 2Q1EA 2VQTA 2MQCA 5F8QC 3VFSB 2WINB 2ADJA 2V5TA 5DC9B 3SE8L 2Z31C 5BCAA 5D9SA 1U8LA 1A1NB 3NIDE 4LHJB 5CWSB 3WJLC 1LP9B 1ZOXA 1CK0H 5KZCD 4HH8A 5DD5H 2JE8A 1CDHA 3BP5A 4RGOL 1OOAA 4OCNC 1IAIL 1Q0YH 3R1GH 4RCAA 3O6FD 1V3MA 5HHVH 1R5IA 4RAUB 5FECB 1IFHL 3TWCL 3TA3B 1VEMA 1DN2A 3PNWB 5EUOB 4U6HA 1VGEH 4LRIC 3T0DA 1I7UB 3KPOB 4PV9B 4HSQA 3K7UA 3QFDB 4ZYKA 3K3QA 2VABA 5DEFA 1UXWB 5CJ8A 1F4WH 1B4JH 4LDEB 4Y1AE 4ZFZB 4GH7B 2JK5A 4JM4L 4LDLB 4WUKL 2Y4SA 2QQQA 4XPHL 2DQIL 3MLXH 1RZ8B 4X7TA 1KXQE 1FG2B 2XNAA 1NFDA 3MA7A 4M1CC 5DJYA 3RA7L 2ESVD 5CGYD 2ZCLL 32C2B 1T7ZA 1N6VA 1KNOB 4JPVL 4HUVB 3OZ9H 1N6QH 4P57B 3MO1B 1ZLUK 1VPOL 5DRXB 2HKHL 5KANG 2KQNA 5E8EB 1UH3A 4AM0A 1AFVH 1RAMA 4U3HA 5KVGH 4X7EC 4H1LB 3NFPB 5LAXA 2W9DH 3AVEA 4WHTB 5IVXF 3ELAT 3SKNA 2DMCA 1KCSL 1BD2A 2HFEB 4YHNB 5D7SH 2QKIA 4QTHB 3EFDH 4K94C 5J1AA 3FQXA 1KEMH 4J8RB 5GSRB 3V0WH 2FYYA 4WFGD 5CINH 1LEKA 3GMQA 2OXGA 2DQJL 1Z9LA 5T1LA 4RGMB 1KPUB 4GRLC 3ARVA 1DVFA 4ZO8A 2NY6D 5IEKB 5IOPA 4H1LH 4HHAB 3BMWA 5IFHL 3MV8E 3UPCA 3LSOB 4Q9CA 3BZDA 4NKIL 2PTTB 1JZ8A 5SWSB 3MLVL 1FFNB 4JFPA 3SGDI 2LAGB 3O6ML 4LSSL 1BHGA 3DROB 2FZ3B 3HG1B 4IRSB 43C9A 3HUJF 2Y07L 1YNKH 4KK6C 2I25N 2XG4A 3C8KA 1FGVL 4XXDB 5EZOL 4BSWA 3LEXA 3SOBL 4Q0XL 4LIQH 4X4MA 1MPAL 1M7XA 5DHVB 4I18A 3TN0B 3DXAA 2QQLL 2E27H 1T3FA 1YN6A 3LOWA 4HMCA 3T1WA 2ZNXA 5BZDB 1PYWA 3EO9H 4XWOD 3UROR 3OKKB 3BUTA 2EYSB 5GPRA 4X8JB 5IESH 1WWBX 2EDOA 3PQYA 4L5FH 4BYHA 5MHSD 1Q72L 4OLYH 2F19H 5GGSY 2H2SC 2OTUA 5T5NF 5DHVH 4JQVA 4QRQB 4OZHF 4YGVA 1MJ8L 3TIDB 1NBYB 4I5BA 4NO0B 3H8NA 3RTQD 5CKAA 3O6LL 5IQ7H 3A67L 1I1YB 1R3JB 1RUQH 4HUMB 1OGAB 3ULVL 3FFDA 1NDMA 3WFCH 1FC1A 3P30L 3H7BB 2DF3A 1IEHA 5DD1L 2RB8A 4W6XB 4UTBH 5L2KD 4JRYE 3FFCB 4RMSA 1J12A 3MJ8A 3MTRA 1MFBL 1WC7B 3DO7B 4PJ5D 5JHLH 2IQAA 4Z0BH 4GXUN 4C58B 5DJ6A 3QPXH 2IGFL 4S10A 4KRPD 5FYLE 3P0GB 3D2UA 2UYLB 4JN1L 1F11A 4ZAKB 3ARFD 2HTLD 1T7WA 1QNZL 3AAZA 1XCQB 1I3RA 4K2UL 3TF7C 1D9KA 4U1NA 3MRNB 5DJXA 1DN0B 4OD3H 2ZPKL 1CQYA 2XWJA 4MXQC 4K7FB 4QHUA 1AR1C 4ZTPL 4K8RD 1K6QL 4HIXH 2F5BH 3A6OA 1AXTL 4NWUH 5LGHH 4OIAA 4A6YB 1O7VA 5D5ME 3ZYZA 1S7XB 1T0PB 3WUZA 3L5XH 4LOUC 5DUML 1TENA 2ZCHL 4JQIL 3MRJB 4NWTL 1CT8A 5HGAB 3FN9A 2E5EA 1LGVA 4RGND 1A7QL 5I6XB 3ALXA 2DWEA 2Q7YA 1YECH 1T6WA 1FO0L 2D0FA 2QQKL 1OAQH 4RFEA 1L0QA 3WKML 2BY3A 4OAWA 1BVLA 4U1SA 5JDSB 4MQXD 3VFPB 4JANB 3UBXG 4PJCA 1ZA6A 5AWNL 4I48B 3WLWC 3WNPA 2O26U 4PP1D 2ZG3A 4P9ML 4OGYL 5E6IC 4HWUA 3ETBF 5TQ2L 2YK1L 1QSEB 1MCCA 5HDBF 1UM6L 4KQ3L 4H0HB 4DFHA 1PG7L 3MUGA 4YBLB 5D93C 1EBPA 3QO0A 4PGBA 1ZGLB 1HILB 1UZ6F 1OVZA 1A5FH 3RIAK 5KAQG 3QDME 2X4PA 2MTPA 4R4BA 5E99H 1G7HB 3TIEB 4BFGA 2V7HB 4QHKI 1SBSH 3Q6GL 4XHJD 1EZVY 2PYEE 1NLBL 1R3HA 1TVDA 4OT1H 4XNYL 5HI5D 5HY9B 1IT9H 4HWZB 2K9UA 2XKNB 3RVWD 3RHWF 2BNRB 1EO8L 3VD9A 3ECBB 3BOVA 1T04A 5ID0B 4HZLA 4LSTH 4YJZL 5H8DA 1RUKH 2CUHA 2ESVA 5DUPH 5IW6B 2R0WL 3ZE2E 1RFDH 2V17L 1U95A 3BH8B 2YWYA 5I71B 3I75B 1PD6A 1RURL 3CPLB 3N9GH 4M61A 4ODUB 4XP5L 4I13B 2UV3A 1YNTA 3SKJL 1YPZE 3S34H 1RZKL 1UJ3B 1AC6A 5AUMB 1MHEA 4YBQC 3PWPB 4GUPB 2LVCA 3MBXL 2VLMD 2R56L 3RWIB 3EO0B 4J3SA 3ZSTA 2NXZD 2RCSL 3NFSL 3WIHA 3LKNB 4F37K 1OTUD 5DSCA 5FFLA 2OJEB 1BFOA 5TF1H 2DTSA 1J0YA 2YN5A 3B9AA 2QQNH 1U8QA 3T08A 5E4EC 1P7HL 1M7IB 1SJXA 5DFTA 1QO3B 1IAOA 2YEZB 4H1LG 4LEXH 4CW1A 5CJBA 5FO8A 3G04A 3C87A 5C0DB 1NKOA 3FL7A 4OLWH 4K71C 2DI7A 3PP3H 1AE6H 1CK0L 3TFKC 5HDOA 1GXEA 5E8OB 4OCYH 4BZ2H 1Q0YL 3R1GL 4XAWH 1RJYB 5HHVL 3T09A 3VU2A 3W11D 3OAYH 1MCWW 2CSPA 1VGEL 2M8XA 4MSWB 2O61B 1U8KA 2Q3AA 3E8UH 1VACB 2NLJA 4M4PA 1ZHKA 4KGLA 5F1NA 1F4WL 1B4JL 3GSNA 1P4LB 2R2BB 2EDJA 2ITCB 3VGEA 1NAMA 1K9TA 3VXMA 3MLXL 5CZXC 3TCLB 3DGGB 4HWBH 1II4E 3FQWA 4LSUH 4ZS7H 1SYVA 1QG3A 4N0CD 2WWKO 5CEZD 2PXYC 2I60H 3FCTB 4WU5A 2WLYA 4PJIA 4MQ7B 5ABDE 1IEBB 3OZ9L 2IF7A 1N6QL 3J8F7 3ZTNH 1EAPB 4PFEA 1AFVL 1AY1H 1CDUA 4JZJC 3RTQA 5KVGL 1DE4B 4IBLT 3DUHA 3G5YA 2YD1A 2W9DL 4NDMA 4ONFL 2G5BB 2OK0H 5IBUB 4E0RB 5D7SL 2ZUXA 3EFDL 2ZCKH 3EGSB 3G5XA 1KEML 3BX7C 3V0WL 3IFOB 1I1CA 2X9YA 1NMCC 3JTSA 5CINL 1JGLH 2MQ3A 2D7QA 2FJGA 4MJ5A 3NCFB 2EDHA 5D2NA 1F90H 1WFNA 2CDEA 3ULUC 3C8DA 3SE3A 3D0VB 2DJSA 4G6KH 4FMKA 5C0JA 4MD5B 1JZ6A 2NY4D 3MV9D 4GKZB 5IV2B 3V5HB 4PRHB 1PLGH 1S7WB 2ITDA 4E5XB 1TZHB 2HJKB 2NY3B 4M8VA 2OJZH 4HKJB 3PIQB 5L88H 3WYRA 2EH8H 4CGTA 1CU4H 3AM8A 4YIQA 4G8EB 3H42H 4QWWC 1YNKL 1MCJA 2OI9C 5D7LE 3CXHJ 4J1UA 2C5DC 5DVKA 1J0HA 4LIQL 1IAKA 2KZWA 5IQ9A 1MRDH 3C09B 3CSBA 4JDVA 2E27L 5SWQA 4OI7A 5B39B 4WTZG 1QFUH 1S3KH 4XRCA 3HZVA 2GSIB 4O2FA 4BH7A 3RUGA 5HDQH 3EO9L 1S7SB 2E9BA 4GKSB 2VIRB 4DCQA 3TESA 2F53A 4Q6IB 3CSGA 1H3GA 3QI9C 5IESL 1WQVT 4L5FL 3E6HB 4G80A 4CN4A 4OLYL 2F19L 1WF5A 3MGAA 4WI2A 3T0EB 2EEDA 4ZUUB 2Q8AH 2EIBA 1H5BB 1L6XA 4P2OB 4BK5A 1EHNA 2BVOB 4HS6B 5A43C 4OV5B 1F3DJ 3BXNA 5DVOA 5IQ7L 3JZ7A 4PJBF 3O4OC 3KYAA 4KROC 1RUQL 1KTDA 1YQVH 1JWUB 4HWEH 1F42A 3WFCL 4YDVB 4WHCA 4YDJA 1HK6A 2CLZB 4ELKB 2Z31B 5DC4B 4ZNCD 1MH5A 5J1TC 5IMLB 2DLHA 4E42B 4PRPE 4NSKA 3FN0H 2NZIA 4LMQI 3DI2B 5T5NG 5ADPH 5MERB 3TYFB 4KRMB 1UYWH 3LCYA 1PZ5B 4IRJD 2QJDA 4G6JL 3I9GL 3VXSB 5JHLL 4J23A 4EDXB 4Z0BL 2V2TB 1EEYA 2FWOA 4DVRH 3TYGH 3O3DA 3NN8B 3QPXL 4FFWC 4U6XB 4KXZI 3MBED 4OLEA 1N4XH 5DRWB 2QSVA 1PKQA 2V6HA 5JW4R 2BNUA 1N26A 4LPUA 3C2AH 4P3WA 3CSYB 4N8PA 4PY8J 2AJXH 4WHDA 4AIZA 3OR6B 1UC6A 1J8HE 3W81A 1FH5H 4OD3L 4X6BB 2P7TA 4GG6A 3P73B 2IAND 3OKMB 4OKVA 2ZP0T 3DIFB 4N0YH 5GS0C 3IU3A 4GAYB 1LE9A 2EIDA 3VXPA 5LCVH 1AGFB 4NHUB 4NM4H 5M94B 4HIHA 1N0LA 4HIXL 4OBRA 3DNKA 2F5BL 3PHQA 4NWUL 5CZKA 3CX5K 1QQDB 5H94B 2HG5A 2AW2A 3DTXA 3L5XL 3BJLA 1MCKA 3PJSA 4MA3A 3BAEH 4QRSA 5IVOA 1BQLH 2A6KB 2C3VB 4IHOA 5DQ9A 3G5VB 3BP7A 1N59B 1S7RB 1NCBH 1YECL 2EXYC 4KDTA 3WL9A 1WT5A 3KYNB 1OAQL 2A0LD 4PGCA 1ZT1B 3O3BB 4FTVD 1DVFC 5D1XD 3EJYD 4GG8B 4GRLB 1U6AH 4MB3A 4P4RA 3W0WD 2JTDA 3FHAA 5FF6B 2WLZA 4MNGA 5JXED 3HRZB 1C8PA 3MUY1 4KMLB 5IB5A 5IFJA 3CVHA 1NEZG 4HIEA 4XMLH 4PJDF 3DJ9A 2FNBA 4KTEH 5F96H 4OJFH 2CDGA 5IMOB 2F74A 3MLUH 1A5FL 5IMKB 5IG7A 1U2HA 1YDPB 5CHNB 5E99L 1MVUB 4H8WH 1SBSL 4I18C 3VFRA 3KS0J 1YN7A 2H9GA 4OT1L 3TLRA 2EECA 2XZCH 1IT9L 2ED8A 3LKOA 3QAZB 4PJXE 2GIYA 5DYOB 4UT7H 1GZPB 2P5EE 4OF3A 3OKLB 1ITBB 1XFPA 2HT4D 1RUKL 3BSZL 5HGHB 5DUPL 1OP5H 5CEYA 2VLLB 1MELA 3GMPA 5CSGA 1RFDL 5BRZE 1C12B 3FOLB 3LHPH 4QHNA 3BKYH 3I3EA 4JQVC 4HW6A 3N9GL 4RMTA 1NDGA 1DBBH 4JFOA 1FZOA 3S34L 4KJWD 4X4YA 4PLKD 4HKZB 3DVNB 1BWMA 3GM0A 1BMGA 4NBYB 4NOFA 5JA8B 5F9OH 3FT4A 3T1FB 3FB6A 3H9HB 2VISA 2Z91A 3SE4A 4L9LB 5L2JA 3SGDH 4N0FB 3QIWA 5EPMA 3KLDA 3QULB 5F7YC 5TF1L 2I9TB 2Q6WB 4NC2B 1JGEA 2GITB 4JZNA 1A6AB 2QQNL 2FR4A 4PTUA 5F7DB 1BOGB 2P47B 3IS0X 1F3JA 2AXHA 5D6CB 3VFWA 4LEXL 3L3OA 5DD6B 3TBTA 5DMGC 1UKSA 5IBUG 4OLWL 5TPWH 4I9WE 4G7YH 1AE6L 3ZE0E 4NN7B 4OCYL 4B53A 3RI5K 3ARED 4XAWL 1CDGA 3SO3B 3IB4A 5HHOD 3ARUA 1BPVA 3U6RA 1U42A 3QDJA 4OM1H 4GXVH 5DJCA 4KK5D 1A22B 2EC9U 2GQHA 1GCFA 4NO5A 1HHGA 4PJDB 3WV0A 3HR5B 3OKNA 4JPIB 1I8LC 4I3RH 2VTFA 2Z8VC 5ISZB 4Y19D 2N4IA 3MUJA 1NBVH 4HWBL 2FIKA 4LSUL 4ZS7L 3ZDZE 3FQTB 4YWGH 3L5WA 5GZNC 2QSCH 2I60L 2NYYD 1W0WA 1WBXA 4PJAE 3KYMB 5B39G 4ENED 2XZQH 5HYJA 1CVRA 5GIRB 1E6JH 4KMTH 3ZTNL 4A2LA 1AY1L 3BGAA 4R7NA 3SY0B 5F3BA 1QFHA 3V6OC 1WV7T 3PWNB 4CVZA 3STZB 3VJ6A 1AP2A 1GJIA 1JPGA 2OK0L 2J88H 5DJ2A 5I1CL 3P9WB 4ZDHA 3L7EA 2ZCKL 3WCYA 2ZUQC 2VZSA 3EO1A 2DQDL 4R3SA 1I8MA 1KJ2A 1JGLL 1PEZA 5E6IB 4L8SA 3KXFB 5H35A 4U3XA 3N1MC 3MRLA 2OYPA 1F90L 3NMEA 3T4AA 2WWKT 4Y5VA 2P8MA 5HYEA 4G6KL 4POZD 5D93B 5GQBA 1YEIH 4IOIB 1PLGL 4F15C 4R26L 4OI8A 3DV4B 3FT3A 3L9RA 1HYRC 3GMLA 2EDNA 4ZS6D 2E7HA 3HN3A 5C0AB 2OJZL 5L88L 4N0UA 1AGBA 2FX9H 4D2NA 1MAJA 1I8IB 3H42L 2X7LA 3KPRD 3GO1H 4MB5A 3TPKA 2ICES 4RZCA 2Q76A 1MHHB 4I8DA 1FVEA 5I76B 1C16A 2Q7NA 4ZO6A 1IC7H 1MHCB 4OQTA 1D5MA 1MRDL 4RNRA 3BEVA 5CUSH 2JCCF 3VRLF 1YEJH 5DEGA 4JVPA 5CGYC 4LLUB 1QFUL 1S3KL 1T22B 3V4VH 1BQSA 5HDQL 1JPTH 3SDXA 5F9DC 3FKUS 4XB8A 1EHAA 3IXTB 4XI5D 5JHDD 4Y4HD 4Y4FD 3B9EA 3BESR 5ILTH 3T2PA 3BE1H 5C08D 3AS1A 3WNMA 3GSQA 4NIKB 5DDHB 4OD1H 4JFED 4I0CC 2Q8AL 1KYOJ 3RJDA 1WAAA 2V2XA 1DBMH 1UQSB 4U05A 3LEYH 2ZOKB 4M7LT 2EDKA 2A6JA 3ULUF 1YQVL 3MLTA 4HWEL 4FTVA 1JV5A 1A3LH 1JL8A 5CMAA 3VMNA 5JPMB 1F8TH 4XVUC 2VKWA 4OZGA 4PGDA 4HGWA 2HLFC 4EBQH 5D1XA 1NMAH 3P11H 3KWWB 3W0WA 4MVBD 1P5VA 3FN0L 3AGVA 5JXEA 5ADPL 3HR6A 2VZUA 1UYWL 5GGTA 5BS0D 1P4IH 2EIZB 5CGTA 5D1ZD 1XR8A 1RU9H 3ULSA 1OAZH 3GSUA 4LNVA 2DQGH 1BLNA 2VDQH 4G6AD 1AIFA 3TYGL 4AY0A 3I84A 2A1WH 3PP3K 5KTEH 2FEEL 4AQOA 1KV3A 4L4VD 3W9DB 1N4XL 3LV3A 4JG0H 4QRRB 4P5TB 3C2AL 4RX4D 1P4BL 1ED3B 2AJXL 2RBLA 5FM5M 4JY6A 5E1AB 3OAYK 4ZFOA 1IGJB 1IM9D 1FH5L 5D2LF 1XF3A 4GW4B 4HFUH 5HYQB 3O8XB 2CIIA 3WO3B 5DJZA 4N0YL 3IDMB 2VYRE 1BFSA 5LCVL 1R0AH 2ZUUA 5EN2B 1Y0LB 4NM4L 4YO0A 4AIOA 4HX1B 2A9NL 2FDBP 1U58A 3IDNA 2ERJC 5CEXB 3V79C 2JCCB 4G8IB 4ONGH 3QJHA 2HH0H 1FJ1A 3L95A 1BQHA 3RTQC 1QFWI 3RL2B 4PUBH 4JZJB 5FGBC 3K4DA 5C0CE 3BAEL 5E03A 3KPMB 1KFAH 3WN5B 2YOCA 3U36B 2AEPH 4CADA 3R06B 1NCBL 1P1ZB 2APXA 1CE6B 2B4CC 4I0KA 4JPKH 2UY6A 3QWRA 1JZ3A 3OJVC 1CQKA 1CD1A 4N5UA 2A77H 1FL6B 5D2NC 4NQVA 4ZO9A 3GRWA 1T20A 1U6AL 3SE3C 4LLDA 1KLUA 4QT5A 3PGCA 1HYSD 1RJCA 1ZXQA 5EC1A 4P23B 2Y23A 5FKPB 1H8OA 3AREA 3TBSB 4E41B 1ZT4A 4LF3B 1AO7E 3CH8A 3KYOB 1CCZA 4WW1A 4Y1AD 4JFXB 3P77B 1RV6X 4KTEL 3AM8C 1VGKB 2Y6SD 4OJFL 5F96L 2E9IA 3MLUL 1NFDF 3QIUC 1R3KB 2FH8A 5F7NC 4NCC1 4H8WL 1J05A 4X6EA 2XZCL 3WEXA 1AQDB 2Y1VA 3U30B 3S36X 5GGRB 4Y19A 4FHBD 5CSZB 1ZEAH 1OP9A 1K8DB 2AAVA 4LLQB 4X83A 4UT7L 2EXWC 2CQVA 1MCLA 1CFNA 4NFBA 1OAKL 1RIHH 3EYOB 5D2LB 1JNHA 2Z93B 1EFXB 1XGUA 3ZDYE 5DO2C 3LHPL 1UACH 3BKYL 4BQ6A 4FQQA 1TTGA 4RGNC 1DBBL 2P5WB 4NRZA 2V7NB 3DX6A 4P5KA 5B3JE 5F9OL 3SDCA 4HG4K 4LP5A 4KROB 2QL1A 2WBKA 1DCLA 3FQNA 4YHLH 4P2QB 6FABH 1MEXH 4MQXC 4TQEH 5D9SB 1U8LB 4G9FB 5GRVK 2F54A 5FUZH 4XH2A 3MV8D 4CVXA 1EO5A 1F6AA 4PYHA 1JI2A 5IHZA 1R5VB 3L3DA 5JXAH 1R5IB 4RDQG 2HWZH 5TPWL 4XTRD 1IZJA 5IWLC 4G7YL 1BGXH 5BMFH 3RWDA 4LCWE 3PHOB 4WTXA 2HRPH 1DBJH 4AENA 5I1JH 3D1MC 3QXTA 4ZYKB 2VABB 5DEFB 4P5MA 2AQ1A 1K2DA 2DIAA 4I2XE 4HV8A 4LK4A 1IRAY 4OM1L 4GXVL 2JK5B 5HI5C 4NQEB 4B7LA 3BKJH 2FRGP 2APWA 4C56E 1UT9A 4NT6B 4X7TB 4LU5L 1U91A 5EU3A 3O11A 4NN5B 4BH8A 3MA7B 4I3RL 5DJYB 1WUNT 3DMMD 3QEQE 5DA4A 4QXGH 3UP1A 4Y4KB 1B6DA 1FSKC 1NBVL 4K3DH 4U2YA 2XWTA 4ORGB 2GFBA 3UTTA 4YWGL 4JM2B 5JHDA 2OR8A 4Y4HA 4Y5YB 2QSCL 2E6JA 1Z0MA 1LEIA 4HC1H 4KI5F 4D9QE 5C08A 4KRLB 2OL3H 3FTGB 5LAXB 3MR9B 2XZQL 4LFHD 3SKNB 3ALPA 1E6JL 4P4KB 4KMTL 1MVFA 1BD2B 2CR3A 1CI5A 2YD6A 2QKIB 5FUOH 1P7QB 1WT5C 3PWVA 5J1AB 3FQXB 4JRYD 2B1HH 3B2VH 4BZ1H 1LEKB 2Z92A 3GMQB 4JO4H 1KF9B 2FHFA 1G9NC 1GRWA 3S5LA 5T1LB 5CIPA 1OSPL 2FCBA 3ZO0A 2CGRH 5IOPB 4P2RE 4Z76B 2BCKA 5FYLD 1BVKA 1GAFH 1WIOA 5FA3A 3S37X 3N1FC 4JFPB 2FHCA 1AQKH 4QRPA 5D1ZA 3UZEA 5EC2A 2GEEA 3BDXA 3HA0A 1G7PB 3TZVD 1ZVSB 43C9B 2AK4A 2NY5H 1YEIL 2Q87A 2H32A 4L4VA 5F7MC 3C8KB 4BSWB 3S9DB 2BJMH 4OIIH 4RX4A 1QSVA 3BW9B 2FX9L 5GRYA 3OKOA 3UDWA 2OSLB 2VE6A 1T3FB 3C5ZD 3VA2C 1YN6B 3GO1L 1U8NA 1IM9A 1X5GA 3TBVA 3B8YA 1PKOA 4HKXA 3R0MA 2IAMA 3CCHB 1PYWB 1HSBA 1IC7L 3MACH 3TNMA 4MNQE 5CUSL 4A2MA 1YEJL 3PQYB 1XCTA 5GRJH 1OQOA 5F6IC 3V4VL 4IOFC 2OTUB 2R9HC 3WFHA 1L6ZA 1RSFA 1JPTL 4YGVB 5GGSB 5ALCH 4JCLA 4PJEE 4I5BB 2NW2B 2KQMA 2NX5E 5ILTL 3BE1L 4XX1G 1IGTA 1OP5K 2UY7A 5TGBA 3EDEA 3FFDB 1NDMB 4OD1L 4PJGA 3U46A 3HFMH 3IAGC 1YMHA 2VDPH 3QIWC 1DBML 2MFNA 4ODXB 3DVGB 3UJTH 3ZKND 2BERA 3OPZH 1BZQK 2A73B 1G6RA 3LEYL 4X5XA 4URTB 5EU6E 5IB2B 1HXYB 1A3LL 3RKDD 3MJ8B 1N2RB 4L8CA 1F8TL 5I0ZA 3RVVC 1KPVA 4EBQL 1NMBH 2IQAB 3P11L 4OLZH 3V8CA 4ONOA 4PY7A 4NHCH 4LGPB 1YMME 4X6CE 3QDMD 1P4IL 4JHZA 3QQ9D 2DI8A 1DFBH 1KIQA 1RU9L 1OAZL 2NPLX 2DQGL 4ZXBD 2PYED 2VDQL 2GK2A 4J7RA 4MJIA 3NCYP 5GGUB 2A1WL 3AAZB 5KTEL 1TJIH 3CMOH 4X7FC 1D9KB 4U1NB 5D96C 5DJXB 5E9DE 4JG0L 1AI1H 2XWJB 3ALWA 2P8PA 2X4OA 4YUEH 5FOBA 1S7UA 4LKXA 4R2GC 4N5ED 2O93L 3CJJA 1T21A 4L3EA 2BOBA 3U0WH 1UB6A 1TQBC 2RIKA 3UTPE 4JVWA 4KKAD 4GS7C 4NKMA 4U1GC 2WP3O 4HFUL 3D0LA 1TVBA 3GK8H 2R8SH 5ELIA 2BSTA 5AG9A 5E2TH 5HI4C 1R0AL 2DMBA 4C57C 1A14H 1NLDH 1CT8B 1MUJA 1O0VA 2E6PA 1FDLH 1OT2A 1RZGA 1I9RH 4ONGL 2HH0L 1DQJA 3C60A 1E4JA 3ESVF 1XH3A 5GZOC 4O9HH 3M07A 3OXRA 3QUYC 1TZIA 3BPNB 1KFAL 3UTZA 4U1SB 1PFCA 2F5AH 4JRXE 3F7YA 2AEPL 2R1YA 2F8OA 1ZA6B 2AJZA 4H26B 4JPKL 4X7CC 2I9LB 2R0LH 4JGUA 2ZUQB 4J3XA 5KZCB 3MV8A 4I0PD 2NY1D 4L8SC 5DJAB 4B5EA 2A77L 4M93C 1SJEA 4TUKH 3O6FB 3EOAA 4LHUD 2P46B 3T4YA 3MUGB 3NAAH 5KSVA 1GPOH 3QO0B 2HFGH 4KY1H 3QO1A 4JFQA 4HF5L 5CBEA 3LQMA 2X4PB 2H3NA 4R4BB 2WBJC 3QG7H 5EWIH 4OZIE 4J2XA 3MCKA 4RIRA 1R3HB 2QR0A 4PJ9C 2VJXA 3D48R 5EZJA 5BVJA 1S9XA 3T3ME 1WICA 5C0BA 3VFTA 4PJIF 4MA7H 1T04B 4HZLB 3MSPA 4QRUA 2ESVB 3S35X 1ZEAL 5CLTA 1U95B 1IC1A 2XWBB 5BZWA 3TH4T 4FQXA 4DKFH 5FIEA 4DKEH 4KKLD 2IEPA 2F15A 4WI7A 1RIHL 2DBJA 1UCTA 1ZV5A 4KMQA 1MHEB 5F97E 2X4SA 3OR7A 4FA8A 1UACL 2W92A 2NTSP 1VESA 3P4OB 3P4NA 3D3VE 4FQPA 1BFOB 2A0LC 4JRYA 2X10A 4R90H 1HHKA 1U8QB 1CG9A 2OM5A 1E6OH 4YHLL 1IAOB 6FABL 1MEXL 4FXKB 5SV4A 1RIUH 3T65A 4CW1B 5FO8B 3DX9A 4TQEL 4HUKB 2HVKA 5D1XC 3EJYC 3QEGH 3EHBC 5FUZL 1JZ5A 5EORH 5J3HC 2X89D 3WIHH 2EYRA 1M7DB 1RJLA 4NQCD 1OHQA 5JXAL 4V2BA 2DBLH 2HWZL 4YC2B 2YA2A 1BGXL 5SWZE 3HE6D 5A16A 5BMFL 3NACH 3OGCA 2HRPL 5DGQA 3MLYH 1DBJL 2VDKH 1DBAH 5FYKE 5I1JL 1U8KB 3ZHKA 2NLJB 3AMKA 5IF0B 3V5DA 5D7LD 5HYIA 5F1NB 4OD2A 3GSNB 5J13B 3QDGE 3RUGF 2WWMC 1KACB 1A9EA 1Y6NR 1NAMB 1FRGH 3VXMB 3BKJL 4XPGH 3C5ZA 5HGDA 1FE8L 4JB9L 5JDJA 2EE6A 3FQWB 1SYSA 3WSQH 4JY4A 4G6MH 5F9JA 2HT4C 4LLWA 3NGBC 2IBGA 1LDPH 3MMEA 9CGTA 4QXGL 2BNQA 4WU5B 5F7LB 3VXUE 4X9IA 4K3DL 4YXLH 4EOWH 3HAEH 4R0LA 5I30L 3ORJA 3RPIA 3ARBD 5DGRA 4M6OH 1X5YA 3RBGA 5A2IH 1NAMH 4KJWC 2DTMH 5EO9A 3RTQB 3QQ3A 1TDQA 2VLKE 2XTJC 1T1YA 4HC1L 3TVMC 4F33A 2OL3L 3G5YB 1RZFH 1MFNA 2X09A 2FIRT 3IAPA 4CAGA 1FNSH 5FUOL 4M43H 2E6QA 4PRPD 1AGEA 3PWUA 3QXVA 4N8CH 2B1HL 3B2VL 1E0OB 5C1MB 1A3RH 4S1DD 5L2KB 5FK9B 4UBDC 4BZ1L 4JO4L 5IVNA 4DAGH 2FJGB 3MCLH 4V1DE 1HCFX 2CDEB 3NCYS 4PJ5B 2VN4A 2CGRL 5C0JB 2VUYA 1GAFL 4KRPB 3NTCH 5F89A 3AREC 4LP4A 4MNHA 5EZLA 1FL3A 1AQKL 5HJ3A 3ARFB 5FGCE 5HHME 4ZXBA 4GG6F 2PYEA 5B8CA 1J8HD 2NY5L 1R3IH 1N6UA 2X4NA 4Q2ZA 2YD7A 1U41A 5D7JD 2BJML 1T80A 4WFEE 4OIIL 1IAKB 3VCLA 2VL5A 2BVQB 3CXDL 1QFWH 4JDVB 1XIWD 4DZ8A 4ODTH 3BD3A 5FAAA 5I74C 1CS6A 2EKJA 3T77A 1R5WA 5KJRH 4XRCB 3ARGA 3HZVB 1IC5H 1E4WL 3OWEA 3RUGB 4OF0A 4DCQB 3MACL 1BJ8A 1KPRB 2F53B 3EOBA 3VGFA 4WI6A 3IDUA 5F70A 5IP4A 1EVUA 4G80B 3VH8A 4RMUA 5ACLA 1YNLH 2UWEA 1BQUA 4RGNB 5ALCL 3GIVA 4K8RH 3SPVA 4Y2DD 3BXNB 4FFYH 3SDCC 3WHE0 1JTPA 1KTDB 1HINL 4Z7QF 4UDUA 3HFML 3EYUH 4GO6B 2VDPL 2YKLH 3B83A 4O4YH 1FO0A 3UJTL 1MH5B 1U3HA 5FHAH 5I1DA 4S1SL 1F00I 4NSKB 1A3QA 1DR9A 1CFTA 4MWFA 4I0PA 3G6DH 3CFJB 3RGVC 3VXNA 1GGIH 3MOAL 4X6FB 1IJ9A 3QRGH 3RFZC 1NMBL 4RMWA 4YZFF 4OLZL 5FXCH 2FWOB 4NHCL 3O3DB 4JHBA 1A4KA 3S96A 1PKQB 1DFBL 2BNUB 1KULA 5CS7A 4TNWK 4KAQH 4AIZB 4OSUH 2OMBA 1NGXA 1TJIL 3CMOL 1DQDH 1DQQA 1WITA 5DHYA 2P7TB 1AI1L 2A74A 1GC1H 1NC2D 2P5ED 2R1WB 4PJHE 4QYOA 4GG6B 1PX4A 2R2EA 4YUEL 4OKVB 4LSDA 1W2KT 4NC1E 2ORBH 5EIIA 3IU3B 2R0ZH 3NIFF 1LE9B 4H88L 1HN1A 5E95B 5BRZD 3VXPB 1CXEA 4HIHB 3U0WL 3WJJA 1JBJA 3PHQB 2FLRT 2HLAA 3RWHA 2HG5B 3GK8L 3S7GA 2R8SL 3DTXB 1UB5B 3IXAA 5E2TL 5I1GH 5EDXA 2H45A 2BXZA 3PJSB 4U3CA 1A14L 1NLDL 4QRSB 5E24E 1FDLL 1I9RL 2NXZB 4D0CA 3BP7B 1CL7H 1AHWA 3TNNA 4O9HL 3WL9B 1RZIA 1JN6A 4LVNC 4PGCB 4KUCD 5BW7A 2EC9T 3LS4H 5KOVC 3Q3GA 5EULV 5J89A 3X12A 1B0WA 2EO9A 4I9WD 4WNQB 4JFFE 2XYCA 1QRNE 2R0LL 5C09E 4ZNEE 4P4RB 3HI6H 4I4WA 4MNGB 1HKLH 1XGRA 2X89A 1VFAA 1CZ8H 5IB5B 2WP3T 3CVHB 4TUKL 2Y7QA 2EZ0C 4HIEB 5D1ZC 3MYZA 4K23L 4WI4A 2N56A 5I9QB 1CGSH 3NAAL 3U2SB 3R4DA 3HE6A 1GPOL 2CDGB 2IG2H 4M6AA 4KY1L 2ZJSH 1MI5E 1QPXA 4K3HA 3IDGA 3K8LA 5D7LA 5EWIL 3FO9A 5IHBA 3VFRB 5TDPA 3RDTC 2H9GB 3RJQB 5TDOA 3JSSA 4WENB 4P3CH 4K9EC 3ZKXB 1F2XK 2GY7B 1H15A 4U1KA 1VERA 2GKIA 1LD9A 1A1NA 2IAMC 5CWSA 1YJDH 3T0AA 3SDDD 4MA7L 1OTTC 3HAEG 5CEYB 2B1AL 3F8UB 3ZHLA 3WS3A 5F6IB 3CFBA 3VG9C 4QHNB 4RAUA 1NSNH 4HPOH 4DKFL 5FECA 4DKEL 4G9DA 3PNWA 1NDGB 4JFOB 3OJDA 4AEFA 1FZOB 1I7UA 3RY4A 3U79A 4X4YB 2ILLA 4XCCL 3PHSA 1UXWA 5C8JB 1KJVA 3TJHD 5JQHC 3FT4B 4NUJA 2XQBH 5T3XE 3FB6B 3WMSA 2VISB 1D5BA 2Z91B 4EVNA 5L2JB 2WIMA 5EPMB 3MRHA 4GOSA 2PETA 4WW2A 4PRPA 5IVXE 1RZ8A 1JGEB 4JZNB 4R90L 5ICXA 1T6VN 4PTUB 4Y7MA 1JWSB 1E6OL 4OCWH 3G9AB 4OFKA 3VFWB 1RIUL 5F1KC 3L3OB 3VD4A 3TBTB 3UTQA 2AERT 2CLRB 3QEGL 2ATKA 4KHXH 1T66D 2XG5A 5EORL 2R39A 4KJQD 4HUVA 1D5ZB 5FM8A 3WIHL 5DRXA 1ETZA 2C3HA 4MJ2A 1NGPL 1JNJA 2NY4B 5E8EA 2JJUA 4EN3D 2GYSA 3U6RB 2DBLL 3EDJA 3MUHL 4MLSA 1J7VR 3NACL 4WHTA 5DJCB 2Y6SC 4CNIA 1KTLB 1PG7X 3IAQA 3MLYL 2VDKL 1DBAL 2HVJA 4PJ8C 1GIGH 3ARWA 7CGTA 4QTHA 2MHAA 4Z7NE 4NO5B 5CP3H 1NGQH 2QHLA 3OKNB 5D7JA 3HLAB 1CTNA 4PRAA 3HUJE 1EJOH 1EIBA 2DM2A 4HCRA 3SDXF 1FRGL 4XPGL 1C5CH 1IM3B 4OLVH 3GJEA 1TQBB 2FIKB 5IEKA 4QHLA 3WSQL 4GS7B 4F9PA 4G6ML 4QRTA 1ZK9A 1FLTX 4JN2A 3L5WB 2PCPA 1LWRA 4LEOB 1LDPL 3MFGB 1WAAF 1U8PA 1FFNA 1ACZA 5GRUH 1UWGH 4YXLL 2J8UB 4EOWL 3GSNL 2FZ3A 3MRDA 1W0YT 3HG1A 2NCMA 4Z7VE 4M6OL 3B5HA 3C60C 1NAML 4R7NB 5F3BB 3GSVA 5KS9B 4Y2DA 2DTML 1IAII 3HMXA 1JMZA 1H9VA 2X4RA 4OZHE 5ADOH 4OCXH 1AP2B 1FCCA 5DZNA 5IMMA 1WEJH 4M7ZC 1RZFL 1JUFB 1JPGB 3TN0A 5DJ2B 1FNSL 4ZDHB 4M43L 3HB3C 5ID1A 3H9YA 4TNVF 3SCMD 4NPYA 4ZQKA 4N8CL 3N1QC 3EO1B 4JPWH 5EOCH 4R3SB 1I8MB 4NYLB 3FQRA 4L8SB 2CH8A 4DAGL 3GSWA 3MCLL 2DOCA 5H35B 3MRLB 3T4AB 3WFBH 4IRJB 4GRMA 4Y5VB 5INCA 4QRQA 5GS2D 3NTCL 4RWYH 3TIDA 2D2OA 3LN9A 3MBEB 1IKFL 5F7HA 3FT3B 3UPAA 3L9RB 4G3YL 2P43B 3GMLB 1I1YA 2OBGA 5HGGS 2D03H 1W72A 4N0UB 3SKMA 1AGBB 2J6EA 1IARB 3EDFA 2FEDD 1R3IL 3KJ4C 2BNRE 5F9WC 4RZCB 1NH6A 4FFVD 1A6ZB 1FVEB 1NC2A 2P5EA 2IANB 1EERB 1D5MB 4RNRB 4P49A 3BEVB 1U3YA 1G7JB 4LSVH 1QFWL 1TQCB 5DEGB 4ODTL 5BRZA 4GAGH 4FQXC 5KJRL 4J4PC 1IC5L 2YXMA 4RAVA 3SDXB 3EZJB 3T2QA 3INUH 5D1QD 2UYLA 4TYUA 1Z5LA 3HPLB 1HXMA 5FM4A 5C0CD 1IGYA 1FAKT 3GSQB 4UAOB 2GJ6E 4P59H 5SV3A 1EUTA 4FQHB 1YNLL 1ZVHA 4JFYA 4EUPH 4PRIE 1JHKH 2W38A 5FO7A 1HSAA 2V2XB 1XCQA 4K8RL 3MRNA 1DN0A 1IC4H 4FFYL 1E28B 3MGOA 1YA5A 3IFPA 4HXAH 3MLTB 4FTVB 1JV5B 2ZSVB 4PR5A 3RX5A 3EYUL 5MENE 1EEQA 2YKLL 4W81A 4O4YL 5D1XB 2NNAA 5FHAL 3CLEH 3EYVA 3W0WB 4NZTH 3JTTA 1PSKH 3AS0A 3VGGA 1JHLH 1GGIL 1S7XA 3MJ7A 5FYJH 1AO7D 3QRGL 1XR8B 3ULSB 3MRJA 1GOHA 5T5FH 3S4SG 4GRWF 1BLNB 5HDBE 3HE7D 4GLRI 1ZLVH 1VB9A 1VFBA 2CIKA 4KAQL 4JY6B 2G9HA 4OSUL 5JDSA 4ZFOB 1CGYA 1Q9LA 1DQDL 5JORA 3K74B 1D6EB 1GC1L 5F3HA 2BSRA 4I48A 1J0JA 1XF3B 2DQEL 3SDDA 2CIIB 2ORBL 3AMLA 3HZMA 5DJZB 5ESQA 2R0ZL 4CDGC 5KSBE 5I8EA 1QSEA 3NGBB 4YX2H 5EU7C 1F02I 4YO0B 1A9BB 1U58B 4QNPE 4R0LC 3IDNB 4P3DB 3VWKD 5FHBH 5DK3A 1ORQB 1GL4B 1IE5A 3QJHB 1J1XL 2ENYA 1HILA 1ZGLA 4H25A 3L95B 5I1GL 1BQHB 3QHZH 1N64H 3Q48A 1KB9J 2XTJB 3X14A 5FB8A 2GK0A 1EDQA 1GGUA 3QWQB 1IQDA 3GIZH 4CADB 1CL7L 3G5ZA 2WMPA 3KNBA 3K81A 3LS4L 4FQLH 5AD0B 3ULVC 2X1PA 1CD1B 5K93A 3PDGA 3Q1SL 3SN6N 2FJFA 4NQVB 4M62H 3RU8H 1T20B 2A6IB 3LN5A 1BBDH 4LLDB 1KLUB 1ZANH 4QT5B 4LCWD 3HI6L 4NQDE 3I75A 2DQCH 4M3JA 1HKLL 5C9KA 4PRHE 1MCEA 1B0RA 1CZ8L 2EDWA 5AUMA 5IW3A 1V3JA 3QUMH 3MRKB 3AREB 3QQ9C 1ZT4B 3U7WH 4EN3A 4N1EA 2P8LB 2EDBA 4ZXBC 5B8CC 3EO0A 1HWHB 2Z8SA 2IG2L 1G9NL 2ZJSL 4C56D 3LKNA 4C59B 2X2YA 3BH9A 3NCEB 4GRWB 5CFHA 4UQ2A 3O2WH 1J05B 1KXVC 1LO2H 3QEQD 4X6EB 4N5EC 1NEZA 4MDJA 4P3CL 3WEXB 2YEZA 4Y19B 3IGAA 4N9GB 3ARGC 4D0BB 1YJDL 4WUUE 2FATH 5CD3A 5F9AC 1CFNB 5DK2B 4K55A 1J18A 1IL1B 4PJ7B 5IJKA 2IBZY 1F3DH 1U93A 1WFUA 1XGUB 4D9QD 5KG9B 4GRWH 2BFVH 1NSNL 4HPOL 4HWBA 4FQQB 2VO5A 3DWTA 4XBGA 4XP1H 3U9UB 4C83A 4NRZB 3GHBH 2W0PA 2UVFA 3QJFA 4ZPTA 1J0KA 3DX6B 4P5KB 1FAIH 1P4LA 2R2BA 3FQNB 4MD4A 4KK9C 3KPLA 3U9PH 1U3HC 1EH9A 4MX7B 4XVJH 3QUKB 2VSCA 4LLYA 4P2RD 2EDFA 3TCLA 3EYQD 2BX5A 4CVXB 4XPTH 2NY1C 3FQUA 1F6AB 4OCWL 1XR9A 5K9QI 3HKFA 3RVUD 5IHZB 1NUFA 1QSFE 2W9LA 4M4RA 3L3DB 3OHXA 4KHXL 2FECI 2DDQH 3RWDB 1L7IH 1L0XA 1SJHA 4AENB 4X9GA 4P5MB 1K2DB 4HV8B 3MOQA 4E9LA 1JYVA 3SBWA 1G1CA 5C2UB 4B41A 1WZMA 4FRWA 1MRCH 3D39E 4KV5E 2G5BA 3LPGA 3SGJA 4E0RA 3KPRB 1GIGL 5F71A 1XGPA 3EGSA 1NGQL 2D9QB 5D70H 1BJMA 1U91B 3QP3A 5EU3B 4AYFA 1U8MA 4NRYA 3O11B 2C7UA 4BH8B 2JJTA 2C3WA 1EJOL 5T33H 3UC0H 3TO4C 3GKZA 1C5CL 1Z2KA 4OLVL 3WJJC 2APBA 1DTUA 4XPBH 4MJ6A 4ZPVA 4KKLC 2GFBB 1QRKA 3ZZ1A 2CLVA 5IV2A 4PJGF 5JHDB 4Y4HB 4U1LA 3V5HA 1S7WA 1I1FA 4KK8C 4LSRH 3QG6A 4EUPG 4NOBA 3NIDF 5GRUL 5C08B 2HJKA 4KWUA 3C5SA 4HMEA 4HKJA 1X6LA 4JFEB 1RZKC 3FO2A 1AHWC 3DX7B 3PWVB 2J2ZA 2PO6D 5BW7C 2C3GA 2B39A 5ADOL 3FO0H 4OCXL 5EU6D 2ADFH 1WEJL 2Z92B 5E1HB 3S5LB 2HT3C 4PJBE 5B39A 4K7PX 4JPWL 5EOCL 1INQA 3D85D 1YMMD 2P24A 2BCKB 1S7SA 5D71H 2V2WA 4P46D 5FA3B 4WO4D 1S9YA 5BS0B 5INDA 1AO7A 3WFBL 5D1ZB 1INDH 4WVRA 4RRPG 5EC2B 3HE6C 2I27N 3QH3A 3K80A 2AK4B 3HE7A 4NKOA 2H32B 4L4VB 4N9OB 2BVOA 4HS6A 2D03L 1Y6MR 1I8KA 1JWUA 1NJ9B 3OKOB 4H5SA 3JVGA 2VE6B 2C1OA 2CLZA 1CWVA 2FD6H 1IM9B 3UTPD 3V7AG 3E1F1 4HKXB 1I85C 1CFQA 1HSBB 3TNMB 3U4BH 4HJJH 4LSVL 5C6PB 2DL2A 3Q5OA 2UZYB 3ZDXE 1WWAX 4GAGL 2R15A 1IILE 3VXSA 3BEWA 4QXTB 3WFHB 3VWKA 4N1CA 4YQXH 4OKDA 3INUL 3MV9E 3ZTJH 2YD5A 3O4LE 1F58H 2Q86B 4JRXD 2OXHA 4P59L 5CD5D 3U46B 3WFDH 1JHKL 1YMHB 3QNZA 3P4LA 4WW2C 3QXDA 4X6BA 1IC4L 4OFYA 1JRHI 3UAJD 2PR4H 4OF6A 1RD6A 2YPVH 4HXAL 4QCIB 3OKMA 3ARXA 3DIFA 1HZHH 1X5JA 2WIIA 1UM5H 4JCMA 5EUKB 1KPVB 5I75B 1AGFA 5EOTB 3A6CH 1GH7A 3CLEL 3JV0A 5IHLB 4LCWA 4PY7B 3VWJD 4NZTL 1PSKL 1JHLL 5FYJL 5HPOA 2EEBA 2FHBA 2YZ8A 4I2XA 1KIQB 3OKDB 4Y1AB 5T5FL 1T89A 3D6GA 4LPYA 4G5ZH 1TTUA 4Q7DA 5C0ND 2A6KA 2NXYD 3UJJH 4NN6C 4PJDE 4C56A 2ZSWA 3MUZ1 3EZ8A 3ZKQD 3O41A 3SDAD 2P8PB 2X4OB 1ZT1A 5FOBB 1S7UB 4LKXB 5KVDH 5E94A 2R1XA 3QEQA 4OF8A 2DQFB 5CZVH 1JPST 1T21B 3CX5J 2B5IC 4LKCA 1UB6B 1IQWH 1M05A 4R4ND 4FN0A 4NKMB 4ZMAT 5FF6A 3D0LB 1TVBB 2COQA 4WHYH 2BSTB 2PUQT 4DN4H 3MJ6A 4YX2L 3IYLW 4MGXA 3BHBB 3RWGA 1D6VH 1MUJB 1T7XA 4QGYA 1IZKA 3D3VD 5FHBL 1Z9MA 5HYFA 5IMOA 4KKNA 4ZFOL 1CDJA 3C60B 4L3AA 4Y5XA 1XH3B 5GGVY 5L6YH 2HT2C 3QHZL 5AZ2H 3DSNA 1TLKA 2Z35B 4FFZH 1TZIB 1JPSH 1U3ZA 5ESVA 5FGSA 3TN0C 4KKBD 1BX2B 3GIZL 3F7YB 4O2CA 1CXKA 3BVNB 2R1YB 1PX3A 1YY9D 3NH7H 1P2CA 2AJZB 3CFEA 3CFCH 1K5NA 2VITA 1MCOH 1JGVH 1GZPA 3MV8B 4FQLL 3BIAX 3OKLA 3N50A 2YWZA 5HGHA 3RIAF 1SJEB 5IB1A 1CFSA 2DQTH 4WEMB 5J9PB 4M62L 1WLHA 3RU8L 4OFPA 2OCFD 1BBDL 5SWZD 1C12A 1ZANL 3FOLA 2Z8RA 4P9HH 5KSVB 2DQCL 1ROWA 3BWAA 4OZFH 5FYKD 5EA0H 3E6FB 3QO1B 1YYLH 4JFQB 2BZDA 5CBEB 3QUML 1FIEA 2H3NB 3U7WL 1FVDA 3QDGD 4JFDE 3MCKB 3SKOB 4RIRB 4QOKE 2QR0B 3T1FA 2Z9TA 2EKSA 4HUWA 3PXJA 5FYJE 5EZJB 3KJ4B 5F9WB 4F3FA 1S9XB 5BVJB 4GBXD 3FB7A 3VFTB 1P6FA 3BZ4A 1A6AA 5ITFA 4MNQA 2BK8A 3K0WA 1LO2L 4F8TA 4QRUB 1HCVA 3DMMB 3VXUD 5E8DH 4ETQA 4N1HB 3MV7E 5BZWB 3ZSSA 2YA0A 4POYA 2FATL 4M9PA 4L4TE 4M48H 3F7QA 2YHGA 5HYSA 2A83A 4F37F 1EK3A 2NX5A 2X4SB 3OR7B 2VLKD 3DETC 3VE0A 2BFVL 5E6ZA 5DVLA 1HHJB 1DDHB 4XP1L 5BV7B 2QEJA 1OQXA 3P4NB 4P2YA 1BIIB 3GHBL 3SQOH 3SE9H 3ULVF 5IB3A 3G6AA 4JRYB 1A1MA 3HR5A 1ITCA 1HHKB 1FAIL 4JPIA 4FXGA 1CG9B 5EU6A 2Z4QA 3T0WA 4CBPA 3U48A 2VR5A 4V1DD 3T65B 5ISZA 3ARZA 1AGDB 3DX9B 3U9PL 2HVKB 4X99A 1CYGA 2DLFH 1TZGH 4XVJL 3EJZC 3JUZA 4YHIA 3BN9D 4Z9KB 4PB9H 5C7XH 1WSST 3D85A 4XPTL 5BV7H 2M1KA 5TQ0H 4HEPG 4YFLI 1RJLB 4Y88A 4WO4A 5HHMD 3S5LG 1IVLA 3I6GA 4MZ2A 3OGCB 4XXCC 3TP4A 5I6XC 1L7IL 1T0MB 2B2XH 5GIRA 3TZVB 4EXPX 5E9DA 3MRCA 3SY0A 3V5DB 3BPLC 3RY6C 3MRIA 3ZE2F 3PWNA 5HHQA 4WFED 5FDYA 1HI6A 3OF6D 4OD2B 4FQ2H 1P7KB 3SJVE 3X3GH 5FYLH 1MRCL 1CBVH 1A9EB 1YPZF 3VXQA 5HGDB 3C5ZB 3HZYA 5D70L 4L4JA 3SDDC 1SYSB 4O58H 5DMKA 5IR1B 5JNYA 1JE6A 4JY4B 5D5MB 1ZLVK 1QOKA 5F9JB 1P69B 4XZUA 4LLWB 3UC0L 5T33L 2UWEF 4JFZH 3PDOA 3MMEB 1PBYA 3RWEA 1MJUH 4XPBL 3WFEH 5EIVA 2EIEA 4YBLC 4R0LB 2FO4B 3O9WD 3ZTJG 3RPIB 3MNVA 5J6HA 5F93C 5HBBA 12E8H 2YPLE 4IOIA 4RISH 4LSRL 3DV4A 1FPTH 5EO9B 3QQ3B 5HVGB 1T1YB 4F33B 2AI0H 3CNKA 2W0LA 5F6HJ 5F1OB 1XF4A 4S0SD 1I8IA 3HCVA 4HFWA 5L8JB 1AGEB 4NNXA 1ZTXH 3BPOB 3PWUB 3NPZB 2I07A 5K59E 1MHHA 5I76A 3BWUC 3FO0L 1B3JA 2NQCA 2ADFL 2DL9A 2HKFH 3CLFL 4IMLB 4GLRH 1JVKA 5LXGH 4ETYA 3QEHA 3ULUE 4LLUA 3IDIA 5I71C 1T66C 4KJQC 3VWJA 5D71L 4PLJD 5LGJB 1MWAB 3IXTA 5F89B 3QDMB 4MNHB 5IKCA 2AEQH 2D9CA 4GW1A 4TPRH 3ARTA 5HJ3B 4OZIA 2YRLA 4Z78A 4XNUL 4ZXBB 4ZUSA 2PYEB 4R6UA 5B8CB 1B2WH 2JIXD 4MQSB 2XFXA 4X6DE 1OCWH 4Q2ZB 3F65A 3VCLB 3SDAA 2VL5B 2W07A 4Y16D 4EI5D 4MS8C 3CXHK 3VW3H 1MWAH 3FONA 2D0GA 1TNMA 2FD6L 3P40A 3S3JA 4WHYG 1R5WB 3KWWA 1YPZB 3U4BL 4RA3A 3EOBB 2DM7A 4HJJL 5IJKC 4TTDD 3ET9F 1Q1JH 3O6KH 1YEFH 3LKRA 1UWXH 4PBWD 3VH8B 4HIJA 1NANI 1N3NB 2J12B 1AJ7H 2NY2D 4LGRB 3NCJH 4YQXL 3GIVB 3SPVB 1QHOA 2OS7A 2R23B 1OF2A 3CX2A 4P5TA 4MHHI 3UZQA 1AD9A 4UDUB 5FCUH 2EDQA 2IFFH 2HP4A 3WFDL 3H2WA 1U92A 4JFFD 1IGJA 1QRND 1FO0B 5C09D 2BMKB 3LVEA 4U31A 1NUNB 1CFTB 2PR4L 2YPVL 4MWFB 3QUXD 4GW4A 4I0PB 2N1KA 2E3VA 3O8XA 4ACPA 1HZHL 2NY1B 2IPKA 4DOHE 1UM5L 2VZOA 5C92A 5J56B 4S2SA 5C0IB 1Y0LA 4NZRH 3A6CL 4HX1A 4LHUB 3GI9H 2I24N 4G8IA 4L29A 1A4KB 2WK2A 3L5IA 3S96B 1D5IH 2ARJQ 3RPKA 1I7RA 2IH3B 1LQSR 5I16A 3SBWC 3QDGA 5E5MB 4PGEB 4K3EH 5KAQF 4G5ZL 3SGJC 1NGXB 3UJJL 4FFVC 5DHYB 1P1ZA 1TTFA 2A74B 1EA9C 4QYOB 4GBXA 2R2EB 1NFDE 2GI7A 4YPGB 1Q9WA 1UFUA 5KVDL 5EIIB 3O0RH 1DQMH 2X05A 5CZVL 1FL6A 3NA4A 2ZUWA 1IQWL 3BD4A 4AEIH 2A2QT 2X40A 1QLFA 2HLAB 3RWHB 1ND0B 3IRZA 1P84J 5EO1A 5FKPA 2FGWH 4DN4L 3TBSA 1DJSA 2VLKA 2NY3C 4X4ZA 4WW2F 5T3XD 4UILH 1D6VL 1KCUH 3BPCB 2ED9A 4JFXA 1YY8A 4WJ5A 5C0FB 1QFPA 4N90E 1AHWB 3TNNB 5L6YL 3PDDA 5AZ2L 3WIIH 1RZIB 1OLZA 1JN6B 1J87A 1HNFA 2G5RA 3OSKA 4FFZL 3DX8A 1JPSL 1BJ1H 1TIUA 3H3KA 3Q3GB 3C09C 3MGTA 5GGRY 4V1DA 1AQDA 3VRIB 3GMNA 5GGRA 3NH7L 4LFHG 5CSZA 3CFCL 2FEEI 1MCOL 1JGVL 4LLQA 1DUZA 1WBYA 2L7UA 1EV2E 1XGRB 2ADGA 1VFAB 4Q6IC 4WWKD 2Y7QB 3MXVH 2DQTL 1EFXA 4LQFH 3V6FB 4P9HL 2F58H 2IQ9H 3AUVA 3HE6B 3NABH 3T0EC 5EA0L 3HE7C 4U6YB 5DHXB 1YYLL 1H5BC 2P5WA 1OSZA 1J88A 5D7LB 5JW4M 4EIGB 4HQQH 4X4ME 3FO9B 1EMTH 5TDPB 3OF6A 2EEAA 5TDOB 3DXAE 3AS3A 3MZGB 4P2QA 4U1KB 4KQ4H 1H15B 1LD9B 5E2JA 3B9KD 1DANU 4G9FA 4UIMA 4LAQH 5FYKU 4LNRB 2AK1H 2H8PA 4U1HA 3CSPA 4PIRF 3IETA 5E8DL 1R5VA 2YD4A 2X9WA 3WS3B 3CFBB 3EYFA 4G9DB 3RZWA 4M48L 4HDIA 3PHOA 3OJDB 3TBYA 3ARBB 4BK4A 3LKQA 2YUXA 4HG4J 1S5HB 1F13A 1KJVB 1U8OA 4NUJB 1U8JB 4TTGA 2DQUH 2Y5TA 1CLYH 1D5BB 4EVNB 3CUPB 3SQOL 3SE9L 4MD0A 3PUCA 3MRHB 4NQEA 4WW2B 4PRPB 4NT6A 3H9ZA 4HC1A 5ICXB 5GS3A 2JJVA 2OL3A 1NUDA 2MKWA 2OTWA 4OTXH 3QHTC 1AR2A 3RI5F 1A6TA 3UTQB 2ATKB 2DLFL 1TZGL 4Y4KA 1XF1A 1TCRA 4N68A 4PB9L 5C7XL 5BV7L 4ORGA 4UT9H 5GS1A 1ETZB 5TQ0L 4L1HA 4JM2A 4Y5YA 1DL7H 2AQ3A 1T89C 2EDLA 2V5YA 1WZ1H 3FTGA 4OLXH 1ZLSH 3MR9A 3GJFH 3ILQD 4CNIB 4LL9A 2B2XL 1J8HB 4P4KA 4PRBB 2BNRD 2HVJB 3SHSA 1J1PH 2MHAB 4NN6B 1P7QA 2CUMA 4PJHA 2K1MA 4Z18A 1M71A 5D7JB 4QXUH 3FZUD 4FQ2L 4PRAB 1A7RH 1KN2H 4Y16A 4EI5A 5FYLL 1CBVL 4B50A 1XIWB 4G42A 3GJEB 2B5IB 3IJSA 3ESUF 4NQUA 4NQXA 4H8WC 4QHLB 4O58L 4Z76A 4QRTB 5JOEA 4JN2B 4XMPH 2PCPB 2QSQA 2MWCA 4JFZL 1JRHH 2KKQA 1J5OL 3DBXB 1U8PB 1MJUL 2GJ6D 3DSFH 3WFEL 4D9LH 2W9EH 4PRID 3MRDB 5GRXG 4KUCF 1G7PA 1MCSA 4HCRH 4GAFB 1ZVSA 4Y5XC 12E8L 4ELME 3GSVB 3V6OE 4RISL 4Y2DB 3T2NH 1FPTL 2X4RB 5HGBB 2AI0L 5IMMB 1KC5H 3ZE0F 4U33A 1TJGH 3VH8G 5MEND 3BW9A 3QAZC 4PJCE 2GW5A 2OSLA 1OAXH 2D7NA 5ID1B 4JFFA 2C4FU 4NPYB 1QRNA 2E9JA 1ZTXL 4ZQKB 3GB7A 5C09A 3EYQC 3ZKMC 3CCHA 1X3DA 3MROA 4DWHA 3QXUA 5LWYH 3FQRB 3QUXA 2HKFL 2NW3B 2O5XH 4KDWA 3GSWB 5LXGL 1X5IA 5A2FA 3HMXH 2V5SA 4GRMB 35C8H 3JXAA 1FP5A 5INCB 1QKZH 5GGSA 2KZ1B 4Q97A 1MI5A 4GMSH 4RA0C 3QUZD