3ARDC

Ternary crystal structure of the mouse nkt tcr-cd1d-3'deoxy-alpha-galactosylceramide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
204
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ardC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ardC02
4ODSH 4CAGA 2B20A 3BPLC 2AJUL 5DMGD 3F7PC 4KK6D 3V6OE 5EO1A 4ELKA 1L4IA 4L5FL 5IMLA 3P0VL 3CGTA 1QKZH 4ELMB 4XNYH 2X10A 1OP3H 4N0FB 5DK0B 4DAGH 4HKXB 4WJ5B 4NFCA 1F02I 4ZFGH 3D9AH 5F9JB 1X9QA 3WO4B 3WFCH 1CFBA 3FHQA 5CSBA 1L6XA 4I4WA 5LWYL 4ODHL 3PGCA 3WO3B 1TZGH 5D8JL 1CICC 1J9CT 1VA9A 5HYJA 2HFTA 4Y5XC 3GNML 4YWGL 1RZKC 2FNBA 3HPLB 3HUJF 3OKDA 3R8QA 5CZVL 4EDWH 5HPMB 1NANI 4GQ9L 4Z7UB 1MRDH 4R8WL 1W0YT 2F54A 1IGFL 1SMOA 1WCBA 4QHNB 3U46A 4S11A 2VL4A 5DZLA 1T1ZB 1VGEH 3OR7A 3LS5H 4C56E 1FFRA 5TFSL 2XZAL 7FABL 1XR8A 5D7IF 3WNNA 2UYLA 3QFDA 3DECA 1OGAA 4F8TA 1NSNH 1DE4A 2W0LA 3GK8L 4IDLA 8FABA 4JCLA 5MERB 1GRWA 3C6LD 4FFYH 3SJVD 5TQ0H 2IADA 3HMXL 3DO7A 5DUML 5H8DA 4OAWB 2EDXA 4OGYH 4YDKH 3BGMA 2BNUA 4N8CH 3RPIA 4JM2C 4KKBC 3T3PF 4Q0XL 1R3IL 4XPFH 3U4EB 5D2LE 4YJZL 2YA1A 3MXWL 4KGLA 3RU8L 1YEKH 1H8SA 5E2JA 1PKQE 3CMGA 4UTBH 4P9MH 4OIIH 1UT9A 3TBVA 2FX8L 3C8DA 1SQ2N 3NAAL 1CXHA 4IHOB 1F4AA 4UNUA 5E9DD 1XIWB 3QUMB 5EU3A 1FNGB 5F1IA 3I2CL 4P3CL 4MMZC 4MXVE 5EO0A 1KCUL 4X0KA 4GAYB 3U7YH 2IBGA 3S96A 1DFBH 3K7UA 3Q3GA 1MFBL 4YX2L 1BAFH 3BGFC 2ZG1A 4NC2B 2R1XA 5EO1B 3MUHL 3ULSB 4ELKB 2PXYD 5T3XL 3RUGF 4P2CG 3KXFD 3BZ4A 2LAGB 3DGGB 2ITCA 3FT2A 4P0DA 4HGMA 3LVEA 1QG3A 5EOCH 1INDH 1D9KD 1YQ2A 4J6RH 5LQBL 4I4WB 2W9DH 3PGCB 4AENA 2YA2A 5ISZE 3AREA 3N1QC 3FQUB 3NCJL 4KGJA 4HUVA 5FECA 3MLZH 1NMBL 5BRZA 2P8LA 3OKDB 2UVFA 5CEZL 4NCC1 3STZA 2EE9A 2DTSA 4G9FE 5SWZA 4CMHB 3S5LB 2ITDB 4LAJH 3U46B 1SYVB 3ZE0E 3MRIB 5I1EH 4OD3L 1IGTA 1IQDA 2GI7A 3EBAA 3T08A 2FX9L 2UYLB 3QFDB 4K8RD 4G6KH 3TBSB 1OGAB 2G60L 1GGCL 1FQ9C 8FABB 3WFDL 3X13A 4KROD 1ONQA 3GRWH 3VXSD 1E28B 5DEFB 3QXTA 1OAUH 4LLDA 3SOBH 3DO7B 3TA3D 4TOYH 1BZ7B 3WIIL 4D3CH 1T89A 2BNUB 3GIZH 5ANMB 3RPIB 1JZ4A 3MNVA 2YA0A 4U6YB 2OTPA 3EOYG 4HMEA 4YBHA 3WKML 5CZXD 2Y25A 4QRRB 1ZTXH 5DTFA 3TZVD 5I71C 1Q72L 4KU1A 1KUMA 4NM8H 4PJ8B 3GKWH 3TBVB 4PP1D 4NKDB 5L8LB 1RHHA 1VFBA 4JFYB 5F1IB 1MFDL 5EU3B 3RDTC 4HJ0C 1J0ZA 3OL2A 4WTZA 3JWDC 1HOCA 4G3YL 5C07E 2O5ZH 1IGJA 1H3TA 3S96B 3DVGB 1NC4A 1OARL 3Q3GB 4OLYL 1DZBA 1NEZG 1TJGH 2BNQE 1IAKA 5IVOA 3J7HA 1ZLVK 2R1XB 5C09A 3EHBD 3CLEH 1LP9F 3CX2A 1CL7L 2P7TA 3BIBX 1S7SA 3FT2B 4XC1L 3JWNC 4QRTB 1XGUA 1P4LA 4U1GB 2W9EH 3D6GA 1TQBC 3L5IA 5CFHA 5ERWA 5SX4I 4AENB 1HNGA 3AREB 3IJYA 3V9FA 2J5LB 4LIQL 4RZCB 5IEHB 1YN6A 1AO7E 1YC7A 5BRZB 1M6OA 2LE9A 2CDEA 4HZLB 3KYKL 3DRTA 3U48A 2AI0H 3TO4A 2UWEA 4NWTH 1TMCB 3V2AR 2EDTA 3WIHA 3STZB 3BH9B 3GMRA 4JG0L 1JNHA 1GGYA 4XPTL 4JHAL 4NO2A 1AQDB 5SWZB 2Z92A 3DUHA 1J1OH 2ERJB 3RWDB 3SBWC 2I9TA 4XVUC 3HR5A 1NDMA 3NFSL 2FD6H 1YYML 3DV4A 15C8H 1P84J 2NY0C 4PS4H 3C60D 1RZKH 4MA3A 2W92A 4M7ZB 2HA1A 5A2LH 5CIPH 3X13B 1JHTA 1ONQB 2DLFH 4PJCE 3CDFA 3MLUH 5FFLA 1XF5B 1RZ8A 3VGAC 1KENL 3KPNA 4I8DA 5IHUH 2AEQH 3OAZK 4LLDB 4WGWB 3H0TB 4KZEL 2X70A 1DTUA 2KQMA 2R4RH 4JANA 4PJAA 1FZKA 2AEPH 3IFNH 2EDQA 4NO3B 3F12A 1I1AA 3O6FD 3GO1H 1T4KA 3HN3A 3B8YA 4OB5H 5EC1A 4X7CC 2Y72A 4G7YH 3IDXL 4UBDC 1AFVL 3B9KB 1KB9J 4H5SA 5DTFB 4UT7H 3O8XD 2DQTH 3HRZA 1YUHA 5CSZA 3QG7H 1SY6A 1RHHB 5EU7C 4QGYA 3HZYA 4Q9RL 1F11A 3P0YL 4Y16B 4KDWA 4ISVA 3QQ4B 1N7ML 2DJ4A 5DHXB 4OGAD 3NIFF 2QSCL 2W60B 1E27B 2Q6WB 3TN0D 1IAKB 3U0PA 2J6EL 5JLZA 2Q7NA 3ARGA 3C08H 4UV7H 4UU9A 5C09B 4AQOA 3RWIA 4UDTA 1JZ6A 1RULH 3VCLB 3P30H 4LPTA 2IWGA 4UTAH 3DHJA 2XTJD 1JN6A 4GG6F 3IXTA 2Y6SD 1KCVH 1XGUB 4TVPD 1GAFL 2G75A 5JO5B 5EO9A 1GIGL 1ORQB 2CDGB 5ERWB 1HWGB 4TSBH 4JPKH 4O02L 2DWEA 4YBQD 5GGSY 1JYWA 4MJ6A 5KW9H 3WD5L 5ADOL 3OB0H 1M6OB 3LQAC 5T5NF 3OKKB 3DRTB 4QYOB 5FO8B 4AIZA 5C0RL 4C83A 4IOIA 3T3MF 3TT3L 4L4VB 1AJ7H 4KI5F 3BH8B 3GMRB 2WANA 4MNQD 4X7TB 5GS3A 4EXKA 2Z8VC 4HKZA 4NO2B 4Y7MA 1QFUH 3MOAH 2X1QA 3BP6A 3TVMA 2I9TB 5FGRA 5D72L 1FZMA 1EAPA 3OV6A 1CLZL 1HHGA 3WNLA 3DV4B 1BVKA 2FHBA 1NLDH 3GHEL 5C71A 4MA3B 1BBDH 5J4MA 4K2UL 1DBKL 3CZJA 2BCKA 3R4DA 4IOFC 1JHTB 2ORBH 3CIQA 3KPNB 1RMFL 4KKCC 3QIBC 1CBVH 4ZD3H 4PJAB 3U9UB 3F12B 4NQDB 1I1AB 3ECBA 4NQCD 5BO1L 4MNGA 3QIWB 1T4KB 4OUUA 3MRFA 3T2PA 5EC1B 3WN5A 5LXGH 3B2UD 1ZT4A 4WO4A 4H5SB 4LSVH 1S5HA 5IVZB 1VPOL 3KYAA 5JIHA 3UEZA 1YUHB 2MKLC 2BVYA 2FJFB 1XMWA 2F74B 4DWHA 5CEXA 4N0CC 3VG0L 1F11B 5DJAA 3SJVE 3QSKB 4ISVB 2IH1A 1J0HA 2ZWLT 2X4QB 5MI0C 1BECA 4FP8H 3U0PB 5BS0D 1UCBL 3QH3A 5D7JB 3SDAB 2ZUWA 1MLBB 3ARGB 3SKMA 4KRNA 2CMRL 3F7YB 3ARTA 3MRMA 5ACMA 3RWIB 4UDTB 4XHJD 1CFVH 5HD8D 1KG0A 5CEYA 1WEJL 1QFOA 1ZHKA 4LP5A 1AGBA 1WC7A 3GMNB 2NY4D 1JN6B 3GSOA 3KWWA 1IZJA 4FQHB 2BNRA 1U0QA 4Y2DB 3IXTB 5ETUB 4DGIL 5CJQL 4ZMAT 1A0QL 1R3HA 2I07B 1W72B 2G75B 5E9DE 5GJSH 5EO9B 3O4OC 1QR1B 5BMFL 4L4TA 2NY5L 3B2VL 4ODXA 5I1GH 1KLGA 1JPTH 2LABA 2ATKA 4H8WC 3ALWA 4HHAB 2F8OA 4QEGA 2DWEB 4HULB 5HHPA 5T3ZL 4MJ6B 5F96L 4TUOA 5D70H 1KN2H 4FQ2L 3O3UN 5C2BL 3E6FA 1FAKT 2CLVA 4AIZB 3O3DA 4M43H 4C83B 3KXFE 4LCUA 2F58H 1QOKA 4ZSOE 1KJ3H 2E8ZA 1DBAH 2BSRA 3TVMB 3BP6B 3VFGL 3I50H 4R0LC 3EYFA 4L8SA 3U9PL 3JV4A 1HHGB 5IBUG 3EW3B 4M4RA 1BVKB 4LVOB 4OZHF 4Z7VE 4LCWA 3T4AA 4PJGE 1FJ1A 1I3VA 3CLFL 3MJ9L 1C8PA 2QQLL 3KS0H 4LHJB 4B7LA 5HYSA 1KLUA 4G8IA 5J0BA 4BFEA 1YPZF 3IDNB 4LU5H 5FYLL 2R0WH 1H3XA 2XWBA 3ECBB 4MNGB 4OUUB 3MRFB 4OLUL 1L0XA 3WN5B 1AHWB 5EU6D 3UPRA 1YEHH 2VXSH 1BFVH 2JIXD 4D0BA 4HWBL 4HUXA 1Z9MA 3KYOB 5IROC 1RJZA 4RGOL 1PSKL 3MZTA 4U1KB 3ZE2E 1NCAL 3UBXI 5EOQH 1NLBH 5DJAB 3BIKA 4Z76B 2X44D 4MAYD 4R90H 3QEGL 3QH3B 1B6UA 3SKMB 3KPSA 4RIRA 3RNKA 5JXAH 1KG0B 5CEYB 3GJFK 4KAQH 1WC7B 3VXPA 4OCYL 2BNRB 4JZJC 3D0VA 5HHNB 1EDQA 2OQJA 5IFAH 1R3HB 5C0BD 5MEND 2I60H 3TJHD 3V7AE 4ELMF 1DSFL 2VLKB 4L4TB 3E1F1 3X17A 1X5ZA 2ATKB 5EOTA 2NZIA 4XVJL 1E4WH 1KYOJ 1T2XA 1A9EA 2V7NB 2X6MA 4NNYA 4ERSH 5HHPB 3R0NA 4TUOB 3MLXH 2P5WB 1LK3H 4KTDL 3E6FB 1FFQA 5K9QG 2CLVB 3O3DB 2CDFA 4LCUB 1NCCH 2HVKB 1F58H 3QA3A 1ETZA 1LO0H 1FRGL 4L8SB 4LAQL 3ZYIA 2CLZA 3JV4B 2HT4D 5I1AA 1EHLL 1LO4H 4KTEH 4IRJA 4F15B 3C6SB 4PYGA 4RGNC 43C9A 4KUZH 2IPUK 2VLJD 2DQDL 2VMFA 5DQJA 3ARFA 3LQAH 3MA9L 1UM4L 3T4AB 2Y36L 4AT6A 1HYRC 1FJ1B 1FNEB 4M5YH 4X9HA 3ARQA 3P73A 2HT3D 2ZPKL 3CDGA 2CXKA 1KLUB 4G8IB 2WNGA 4BZ2L 4KQ3L 3HI6L 4UT6L 5T1DH 1DLHA 2XWBB 4HT1L 1YECL 2ESVD 1I8LA 1GZPA 4Z7OF 2DBJA 2VXVL 4JVWA 4JY4B 4L3AA 4PRNB 5JW4R 3UPRB 3GI8L 5F1NA 1ZOXA 5J6GB 4KK5D 4GRMA 3O6LL 3ARRA 4Y5YC 1PX3A 4LOUC 4JGMA 3V0VB 4BSJA 2BXYA 2EYTA 1N64L 4J4PD 5I1CH 1YDPA 1KIRB 4HIIB 2VDKH 4M4PA 5C0GA 4U6XB 1BFOA 3O6KL 2J8HA 2R4SH 2HFFA 1GGBL 4LNVA 3KPSB 1A6AB 2C1OA 3VMPA 3MRDA 4JFZH 5B38G 5J1TC 3QCTH 1RK1B 1FYTA 1UH2A 3CPLA 5DZNA 3OF6A 1EEYB 5FYJL 1CL7I 3VXPB 4NZRH 1PY9A 3D0VB 2APBA 4ZXBD 2DL9A 1OD7A 4KC3B 3O11A 4TULL 4Y89A 4CUCA 2AJSL 5EOTB 4LVHC 3KLAA 4NNYB 1OPGH 2R2HB 4XBEL 2B7DT 3QUXB 4G7VL 1J05A 3MJ8B 5MP6L 3QIUC 2IANA 1L7TL 2FZ3B 3VFOB 1KBGL 1NEZA 3L9RA 4U1MB 2CDFB 2VLRB 1RZFL 4HDIA 2IMNA 1A21A 4W68A 4NFBA 2Z91A 3JV0A 2DS4A 1U8JA 4ONHB 3P4NB 3MV7D 4TVPE 5I1AB 4XPBL 4J8RA 4IRJB 4S1SH 3MRRA 4HIXH 3HNTL 2E7LA 1JZ3A 4KRPD 1KTDA 3ARFB 3DI2B 1J1PH 3CMOL 4HUUA 1G7MB 1EGJL 3OKYA 2XWJA 1MWAL 4GRLD 3P73B 2X2YA 2WINA 5IOPB 1B4JL 4DEPC 2Z35A 3LB6C 1MJUL 1J18A 1VENA 4HWUA 1CXIA 4MNQE 1DLHB 4WV1A 3VXMA 4TUJA 1MJJA 1T6VN 4P2QD 3T1FA 1XGYL 1PEZA 4UQ2A 5DZOA 2XQYK 4TNWF 4P5KA 1N0LA 3NTCL 1IARB 3T65A 4CU6A 2OMBA 5F1NB 1DUZA 1S9WA 4OF0A 3ESUF 5F3HA 5L9DH 4GRMB 5I18L 4KJYA 3NACL 3EJZC 4R7DB 4DN4H 1Y18B 1CDUA 4UOW1 1IQWL 2EYTB 4XMLL 2YSSA 5ID1B 1WF5A 4W6YB 4N8PA 5C0GB 1P84K 3PV6A 1A14H 4NSKB 3GSWA 2D4FA 4NQCE 1SYSA 1MHCA 2C1OB 4XNUL 2H3NA 3MRDB 5DRWA 3MO1A 2YD6A 2D0HA 4FXKA 1FYTB 3CPLB 2YWYA 3TNMA 2EDRA 2R1YB 3GRWA 1DUYA 2ZP0T 1A7OL 2DIJA 1U41A 3WUWG 2NXYB 5FA3A 4PLJD 3O11B 3LKSA 3D25A 2R0ZH 3KLAB 1KB9K 1RUMH 1G7PA 1ACZA 2ADIA 3MNWA 1B6DA 1J05B 4OM0L 3SE3A 5BS0E 3VFWB 5D6DC 1I8IA 4TTDD 2IANB 2DIBA 5KBNC 5DGQA 1NEZB 3QUZA 2PO6A 4FFWD 1UWEL 4L5FH 4FFZL 3M8OL 3HG1D 4NDMB 3QYCA 2YS4A 3MFGB 1U8JB 3F6LA 4ZFOL 4I18B 3DIFA 2AS5M 3H9SA 4AIXA 1JGEA 4X4ZA 2DYPB 4PRHA 4OCMC 3MRRB 1KTDB 2X4RA 2VLLA 3VWJA 5D8JH 4BM7A 1KULA 5E6IC 3EYQC 2NX5B 3LQZA 3WS3A 2ATPA 2Z35B 5EIQA 1O7VA 1DJSA 3BX7C 3TT1L 5CZVH 5K9OA 4GQ9H 3M07A 4TUJB 5JQHC 4FQCL 4Y19A 3T1FB 1IGFH 4FQ1H 4UQ2B 4GW5A 2DM7A 4I0PC 3LIZL 3PDDA 4Q9QL 3ZT6A 1EIBA 5TFSH 5C0IA 1R0AL 1S9WB 2XZAH 7FABH 5KVEL 5HYJD 1JPFA 4OLEA 3BQUB 2FLBT 3QR2A 4X6BA 4D2NA 3GK8H 1G7LA 1PG7W 2YSSB 2JJVA 3ESVF 1DL7H 3HFML 1URLA 4JHWH 3PV6B 3HMXH 4YK4C 2F54D 5D1XA 5DUMH 2CSPA 3MBEA 1Z6JT 5TGBA 1SYSB 5DRWB 4Q0XH 1R3IH 2K9UA 3ZDXE 3MO1B 4JDVA 3QCUL 4RCAA 3MXWH 4ZPTB 4L1DA 5EU6E 3RU8H 3ZTNL 2XV6B 3ZKNC 1OGAD 5CIPA 5DO2C 1WZ1L 5E0QA 1DUYB 1R6VA 1T5XB 5D7KD 3PWLA 4NBXB 1GHFL 1NFIA 2P24A 43CAA 3ULVC 1QRNB 3SCMB 5FA3B 2FX8H 3F7QA 5KANG 5EDXA 5CBAA 4NNPL 3CSYA 4N0UB 3I2CH 4P3CH 3C2AL 2YD1A 1G7PB 2FRGP 3TNNA 1VGKA 1KCUH 3EZ8A 3MNWB 5JIKA 4LMQE 2AJZB 3ARDC 1I8IB 5D1ZD 5J11C 1MFBH 4YX2H 3FO9A 1BWWA 2NZ9C 3BPOB 2PO6B 3OAYH 4ZAKB 3WDJA 4BH7A 3RP1A 4LLYB 4U31A 1QFWI 3T8XB 4X80H 5I19L 1QVOA 4YHIB 1HN1A 2HVJA 2QSVA 5C0BE 1JGEB 3RVXC 4JM2A 4PRHB 4ZUSB 1U3HC 5I0ZA 2B1AL 1JHKL 5I6XB 5FUOH 5LQBH 1QRKA 5DK2A 2UVEA 2V2WA 2VLLB 1MLCA 3QI9A 4XPAH 3ROOB 1IFHL 2GCYB 5FB8A 4L8BA 1NMBH 5IR1B 4WFFD 5CJXA 2ATPB 4HV8A 5HHXL 3RVUD 5CEZH 5K9OB 3CFIC 1IKNC 4Y19B 3DUSB 5F9OL 2JF1A 1TNMA 4HSQA 3BPLB 4GW5B 3NA9H 4NZDA 5HBBA 4F8QA 5FOBA 2DI8A 4QRSA 5FHBH 4D9RD 3MV8A 2JE8A 2VLJE 2FX9H 4XCYA 1JPFB 3OTTA 4ZTPH 5I1JL 1ZVHA 4N1EA 3QXWA 4POZC 3RIFF 3MBXH 3WFDH 2OYPA 1YJDL 4YUEL 4B50A 3V5KB 2BRQA 3PHQB 5SWZD 1CICB 1J12A 4X6CE 5FCSH 5CCKL 3FB5A 5IG7A 3TH2T 4Y5XB 2CO7B 4EZMA 4NQXA 1HYSC 1A5FL 3WKMH 4PLOB 5E8DL 5HY9B 4XCCH 3PWLB 43CAB 5JMOC 4P2OC 3PE9A 5ILTL 5CBAB 3P3YA 2F9BT 1WGOA 1MFDH 4GRWE 4KKNA 1ZHBA 4EDXB 3TNNB 4G3YH 5DD5L 3RGVC 4E42A 2HFGL 4AY0A 5K9JL 3WKNA 1OARH 4OLYH 5FUCE 3CU7A 3ZE1F 4BH7B 1VSCA 3ARBC 5IMMA 1I7TA 3ELAT 5DEGA 5J13C 4XC1H 1V7MH 1ZANL 2NYYD 4R2GC 5E6ZA 2HVJB 1RD6A 5D4QA 4JM2B 1YYLL 2GK2A 5D6CA 3AMKA 5L7XL 2ILLA 1MLCB 1NC4D 1Q0XH 5GGTL 2EDYA 3SDDC 2CKBH 4LIQH 4PJHE 5DFVC 5C09D 3LN5A 1D5MA 5JIPA 1AGEB 1T0MA 1J0YA 2YD4A 5B4MC 1JVKA 4QLRA 1KYOK 4LDLB 4AYFA 4XC3L 3LOWA 4Y8AA 5KS9B 3E3QE 4JFPA 4JG0H 3T09A 5IGXL 4XPTH 4JHAH 3TC9A 2Q1EA 3VFSB 2IAMD 4XP6H 1KJ2L 3MV7E 4WFED 3BGFB 5FOBB 1TCRB 1C1EH 3UTSB 1HE7A 1P6FA 1YNTA 3NFSH 3TM6A 3MGOA 4PJFE 4LP4A 4ETYA 4TSAH 1A1OA 5IBUB 1T7VA 3BRDA 1H3UA 1A7RL 3I02A 5E99L 3I3DA 3PUCA 1C16A 3TO4D 5F44A 4MZ2A 1WCQA 4JR9L 4F37F 1IC1A 1M71A 1IEHA 3X3GL 2VWEE 1QYGL 5IG7B 3F5WA 2GQHA 1XF2A 5FKPA 2YD3A 4OZ4B 4HX1A 4NQXB 5C9KA 1MAKA 5CD3A 2ZUUA 3HKFA 3IDXH 5EZLA 1PLGL 1AFVH 2GJZA 4KVCL 4QHLA 3EDFA 4HIHA 3RL1B 4H88L 3BW9A 3EFDL 3SPVB 4BZ1L 3TBWA 2DKSA 3SBWA 2A83A 1JPSL 2XPGA 5CBEB 3NIDF 4Q9RH 2YUWA 1ZHBB 4RMUA 1F6LL 4R7NA 4Z7UE 3P0YH 1AGCA 5SX5H 4BFGA 1YA5A 4P4RB 1I1AD 2QSCH 3LN4B 4KI1A 2FLRT 2J6EH 3BN9C 2RGSA 3K1DA 4HLJA 1TPXC 4YXKH 3QQ9D 3ULVH 1D5ZA 2HWZL 3KDMA 4ZFZA 1I7TB 2W38A 3EZJB 3MLRL 5DEGB 5DR5L 5B38A 4XVSL 4RX4A 3BZEA 3MCKA 3OPZH 2DICA 4WI3A 4Y0GA 4PJEF 1GAFH 5D6CB 1R3JA 5BOPA 3X12B 1GIGH 5CGMA 3DWTA 4O02H 2X1WL 1RUAL 1X5HA 2P4AB 5BW7C 5I71B 3ARGD 3WD5H 1CG9A 3ZDYE 5ADOH 1TVBA 3LN5B 1D5MB 3QZWB 3I75A 1T0MB 4NBZB 3RDTB 5C0RH 4LQFH 4RA3A 1XEDA 3TT3H 2H2PD 4HIEA 3HG1E 1HI6A 1AGDA 4NOFA 2FH8A 3MUZ1 1MIML 3ZZ1A 5D7LA 3ISWA 1CLZH 4LGSB 5DJCA 1JE6A 1BLNB 2ZSVA 2EDEA 3DURA 1U93A 1C16B 2F8VA 2OXGA 2EH7L 3QG6A 1RMFH 5C0AB 6CGTA 1TQBB 3TVMD 3MFFB 1I7UB 3F5WB 1XF2B 5BO1H 3VE0A 4YZFE 5EPMA 1SJEB 2O5XL 3C5SA 3HMWL 4U6VL 4DUWA 3I9GL 5CD3B 4LSQL 1S7TB 1ZT7B 1IL1B 1IBGL 5HYJE 4XBGA 4HIHB 3BW9B 1VPOH 2ZUSA 1VFUA 3X11B 1CZ8L 2A83B 3INUL 4RMRA 5I8KL 2YD9A 1ZA6A 4R7NB 3VG0H 5A2IH 3DVNA 1AGCB 3EOBA 2F54E 5D5MB 1OD9A 3FOLA 3NZ8B 4ZO9A 4LNRB 1N6QL 3CFKB 3TH3T 4ZS7L 3R8BB 1TETL 3VGAB 4WO4D 3KDMB 1ITBB 1WEJH 4ZFZB 5B38B 1OGAE 3L3GB 1G9EA 5D7KE 2F19L 4LL9A 1EBPA 5CJQH 4ONOA 4QTHA 3IYLW 3MLVL 1R3JB 4HLZH 2NY5H 1U91B 3MV9A 4KHXL 1YMMA 1ZVSA 2XKUA 3VFPA 2VYRE 4LPUA 1KPVB 1EZVX 5F96H 4NRXA 2CIIB 3BP7B 5T3ZH 4UI2A 4FQ2H 3L3IA 5C2BH 5JOEA 1TVBB 2XNAA 3ARPA 4S1QL 3UTTA 4XXDA 4U1JA 1K4CA 3F7VB 4HQQH 2BNRD 1AGDB 1BFSA 5E7FA 4JGJA 1I8KA 2DD8H 3VFGH 1P7QA 5E5UB 2HG5A 1BD2D 3TLRA 5BV7L 3U9PH 4LARL 1MREH 1JFQL 5AG9A 3QWOA 2ZSVB 3BDBA 2XWTA 1WAAF 3DURB 1U93B 3CLFH 2XN9D 3MJ9H 1S7WA 4WFFE 2WM0A 1FFPB 2QQLH 3K46A 3EOAA 3QG6B 1JL8A 1ES0A 3P0GB 1TTFA 5FYLH 4I77L 3U6RA 3VWKC 1IAII 4U1IB 3VE0B 1AC0A 1OAXL 5EPMB 3UTOA 3VXQA 3IAQA 3PWVB 4OLUH 4J3WA 1N5AA 1G9MC 4LBEA 4D9RE 2WMPA 2OTWA 4LCWD 3EOTL 4QY8A 4G6JL 4FQXD 4HWBH 2NY2C 2D9CA 3GBML 3RWCB 4NJ9H 5BRZE 3QDGA 4JN2A 3GB7A 4RGOH 1PSKH 1LDPL 4OTXL 1NCAH 4GW1A 3MYZA 5SV4A 5KVGL 1ZA6B 3EO0A 3SQOL 3T0XA 4PBXA 2DQHL 2X1XR 3FOLB 5SWZE 3QEGH 3L3KB 5E4EC 2GIYA 4PJ5A 3H7LA 5EIIA 5FYKL 2HKHL 1B4RA 1Y6NR 1JBJA 2XKNB 2OL3L 3STLA 3D5OF 3ALPA 5EB9A 4OCYH 4PFEA 4MCZB 2HLFD 1NMCC 5MEOA 1WITA 4QTHB 4H1LH 1EVUA 5FUZL 4X5LA 2VXQL 2XG5A 1DSFH 3WUWB 3SE8L 3MV9B 1U8HA 2XY2A 1CD8A 1YMMB 1ZVSB 4XVJH 3VFPB 3ZKSD 5HHMB 2VERN 3KJ4C 4NQTA 5I17A 3KPSD 3L3IB 2XNAB 4KTDH 3RKDD 5HYIA 4Y5VC 3N1PC 4MD4A 2YHGA 1RU9L 4O51A 4U1JB 5T1KA 2VDOH 4HLZG 3SQBA 2C3XA 3QWRA 2I24N 1FRGH 4P48A 1I8KB 4NKOB 5MI0B 2BHUA 4PGCB 1P7QB 2HG5B 2DJUA 3L7FA 2WBJD 1EHLH 1U8QA 2IF7A 5EU5B 2W0KA 4Z7WA 5D1QD 2DQDH 5IJKA 2DLEA 4P9HC 5K9KB 3TPKA 1UM4H 2NXZD 2Y36H 2VDML 2XWTB 1YEEH 3LRHA 2OZ4L 5C09E 5GS0L 1S7WB 1A02N 3QUML 2ZPKH 3O4OB 3ETBF 5B3JE 4JPWH 4BZ2H 1ES0B 4LPYA 1E4JA 4UT6H 1CCZA 2F53A 4K7FA 3JV5A 3GSXA 1NGYA 1YECH 1P4IL 4HT1H 4IRJD 1UQSA 4LBEB 4WFEE 1EXUA 5C6PB 5JQ6H 2Y07L 3SDYL 3V0WL 3GI8H 3ZDZF 2HMIC 2Q7YA 4JREC 3SN6N 2R29L 1R5IA 3MQIA 3O6LH 3QDGB 4JN2B 4OI9A 4R0LB 1OGTA 1KXTB 4L8DB 4PLNC 4LKCB 4GW1B 2UWEE 2Y5TA 1NBYA 4YGVA 1QBAA 2R2BA 3QWQB 4F9LA 4FG6D 1AP2A 1GGBH 4G5ZL 3E0GA 4R97C 4U1NB 2JCCE 4PJ5B 2E7BA 3IDMA 5EIIB 3LKNA 3JTTB 2PUQT 2IPKA 2GY5A 5FYJH 3QJHB 4UIMA 2DLIA 4LEXL 3HMXA 2RIKA 4TULH 5CSGA 3HZKB 5B8CA 1S7VA 2HJLB 2AJSH 1L6ZA 2APTA 3PABB 3BZFB 2NY6C 4PJAE 2AJYL 1MHPL 4BFBD 1OTTD 5I17B 3QPQC 1Q8MA 4POYA 3VW3L 4Y5YA 5MP6H 1H3VA 4LF3B 4M7LL 1GL4B 1L7TH 4H1LG 3I3BA 4HIJA 1FYTD 1KBGH 4O51B 3OF6D 2AQ1A 5T1KB 3RVWD 3S35L 4UOW0 4N9OB 1IZKA 4D9QD 5KSBA 3IKCA 2ED7A 1TQCC 3L7FB 4JJHA 1U8QB 4XPBH 3F6IA 5F71A 3HNTH 4Z7WB 4K7PL 2GEEA 4XXCC 2DL2A 4MDJB 5E8NB 4JZJB 4BH8B 3U4AA 3LY6A 1MWAH 4EQ2A 3O3AA 3FB7A 4PJDA 1B4JH 4P5TA 2Q8AL 4NN5C 1YEGL 1YNKL 2F53B 4K7FB 1M4KA 3GSXB 3PGFL 4K07A 2QQNL 2F5AL 5ICXA 4G80A 1UQSB 1XGYH 4ZG1A 1EXUB 5L8JB 3NTCH 2ARJQ 3LSOA 2Q7YB 5CLTA 4U33A 5F7EL 1R5IB 5I18H 3NACH 1FDLL 4QGTA 1OGTB 1IQWH 5DI8A 4CNIB 4XMLH 5BZWA 4KY1L 1KXVC 2Y5TB 1MH5A 4OZIF 1ZHNA 4JJ5B 1Y6MR 4YGVB 5IBLD 5M94B 4RGNB 3VXMD 1V3JA 5JXEC 4Z8FL 1IT9L 2R2BB 2Z93A 3OKNB 4RISL 5F7MC 3I84A 1G9MH 4X6FB 1MCFA 4X4XA 2B4CL 3IDJA 4IDJL 4YR6A 4V1DA 1ACYL 3IDMB 3SDCA 4OD1H 3IFPA 1EHAA 3KPMA 5IF0B 5I15L 3ARUA 3JUZA 1IGMH 2Q87A 1U6AL 2IPKB 5JORA 1AIFA 1Z0NA 1CE6A 5C08A 1A7OH 4OUOA 1CGWA 3I6LD 1SVCP 1J11A 5BCAA 2EE2A 4QHUB 1X5IA 2N4IA 5FM8A 4XMPL 4O58L 4DZBA 1TTUA 1CDJA 1FCGA 2CR3A 1WVZA 4MNGE 3PQYA 4OM0H 4Y5YB 5FA4A 2LAAA 4GKNA 4GAFB 3MLTA 1IC5H 3FAXA 3OZ9L 4BQBA 1ED3A 4XZUA 1M7IB 4S2SA 1UXSA 3M8OH 5IIEA 3Q0HA 2PTUA 3VFTA 3LD8C 1N3NA 4PBVC 4PTTA 3BFOA 3V7MA 1INQA 4WWKC 5KSBB 3IKCB 4S1DC 1U8KA 4G9DA 4L29A 4DZ8B 4X8XA 5DD3L 5KS9F 1VCAA 2PTTA 3KLSA 3DX7A 1QLRA 1NAML 3K2MC 4NPYA 5IFHL 3RGHA 3E2HC 4TTGA 2VDPL 5BXFA 3F7RA 2FJHA 1RZJC 3QUZD 5HDBF 5CJ5A 2PO6D 4ZTOH 3VRJB 4Q6IA 3TT1H 4LVHB 2ZKHL 3WXWL 2BNRE 1I9EA 4FQCH 3K0WA 4FXGA 3H9SD 2GFBA 5DDHB 4G80B 2FIRT 4LSTH 5D6DA 5ICXB 1T04A 1F4XL 1JK8A 5FHAH 2V5YA 1IMHC 3LIZH 3WE6A 4Q9QH 3IDIB 4JZOB 3D2UA 4KJQD 1RUPL 3O2VL 3LSOB 2C26A 3VWJD 3VXUA 1R0AH 3OHXA 5KVEH 3O4LA 3LCYA 3FKUS 2CXGA 2BY1A 3OKLB 3RWEA 5GZND 3BXNB 1BQLL 2XN9E 2APWA 2OX5A 4XCFL 5DI8B 3QQ3B 2EXYD 5J1AA 2Z4QB 4YIQA 1WZMA 1NFDB 3HFMH 4Y19D 4G42A 1RJLB 1MSPA 3N0PB 4X4XB 1T1YA 3NZHH 4V1DB 1TZHB 5FGBA 4JQVC 3KPMB 3QCUH 2VZUA 4C58B 4DEPB 4KI5C 4LCWE 3ZTNH 5C6TL 1AIFB 2ZOLA 1WZ1H 4HF5L 4TQEH 5C08B 5CGYC 1GHFH 2H9GB 1CE1L 3KPOB 4FNLL 5A2JH 4RBPH 2FBOJ 4NNPH 4I0PA 5B39G 4MQTB 5CGTA 1XZ0B 3C2AH 4NQEA 4JE4B 5TH2A 1T5WA 5D1XD 3FONA 4DZBB 3MBED 4WEUD 2F5BL 1VHPA 3PQYB 1H5BC 2NW2A 5FA4B 3NIGF 2W1NA 4KJPC 1DLFL 3MLTB 5DD6A 4H0IA 1KNOB 1ED3B 4XZUB 4S2SB 4YNYA 3VFRA 1UXSB 3VFTB 1UCTA 4PTTB 3VI4F 5I19H 5TF0A 3SE4C 5IW6A 2ZUYA 1Z9LA 5T5FL 4UV4L 4XI5C 4PRPD 3VXRA 5I1DA 1JHKH 4HFWA 4ZDHA 1RZIA 2HKFL 1QLRB 4WDIB 4NPYB 2J6EA 4KMTL 4IJ3C 1YY9C 1EO8L 4X7FC 2FJHB 1IFHH 3KPSE 3V6ZA 2CK2A 4ZOAA 4J3VA 4PR5A 5L6YL 4NC1C 3GHBL 4DQOL 1WTGT 1NGWA 2ZSWA 2VB5A 1KCSL 4FXGB 4GAJL 5F9OH 1BBJB 1K6QL 4O2EB 3X3FL 2CKBB 4MLSA 3GMPA 4JAMA 3QI9D 3OHXB 1HHIA 1UZ6F 3PWNA 1SM3L 1W72L 1QZ1A 5H37H 2DMKA 3TIEA 5J1AB 2ED9A 1A4KA 3VD9A 5DUPL 3SY0A 4LSDA 4G42B 5EWIL 5E6IB 4DUXA 1WBZA 1T1YB 3DMMA 2VXTL 3PHOA 3V0AC 1G6VK 3MV8D 5IVXF 5D5MF 5ITBH 3NCCB 3AM8C 1A5FH 3H9YA 5E8DH 1NUFA 2ZOLB 5F7DA 4CRPA 1ZEAL 4EIGB 1OQXA 1JTTA 1JF5A 1OWWA 5ILTH 4CL7A 3DSNA 4I0PB 5FDWA 4U2YA 4NQEB 5TH2B 1NC2A 5DMYA 3U0TA 5E08H 2ADGB 5DD5H 2I9LA 1F3RB 1Q1JL 1I1RA 5I16B 5DD6B 5GGRA 1JZ2A 1U8PA 4YNYB 3IGAB 2FX7L 1AR1C 5EBLA 3FN3A 5CJOH 1RPQA 3BPNC 1HQ4B 4YK4B 1ZANH 2Y9RT 2DWDA 5IW6B 2X1PA 1WBXA 1NJ9B 4JDZA 4WNQA 4Q58C 4P46C 5J1SC 4V2BA 1YYLH 2IQ9L 3QFJD 3VXRB 4E41B 2EDKA 2XICA 4HFWB 4ZDHB 3MACL 4YEEA 1RZIB 3QEQA 3RA7H 5L7XH 1BF2A 4K9EL 4Q74A 1F3JB 5BV7C 1KB5B 5GGTH 1I8MA 4XB7A 4OKVA 4EN3A 4F58H 1EJOH 3V6ZB 5T1LA 2PYFB 3A6OA 4QNPE 1MAJA 3TF7C 1FYTE 3FQWA 1NGWB 4JFHD 4XC3H 4RBPK 4D9QE 4JFEA 2ZZUT 1S9YB 3IJSA 5J11B 4BQ8A 1KJ2H 4NWUH 3OR6A 3CSGA 4O4YL 5E8EA 1AE6L 4JAMB 2MQ0A 3ARBA 3U1SL 5TE4L 1V8HA 3SGKC 5F7HA 1A7RH 1HHIB 2IANE 2P5EA 3PWNB 5E99H 5EFIB 3MRHB 1U3HB 3MRGA 1R3KA 1A4KB 4HWZA 3S88L 4JR9H 1PAMA 3SY0B 4YBLC 3X3GH 4NRZA 1OWRM 1OB1B 1QYGH 3SDDA 4Z6AT 1UEMA 4U1LA 1RZGA 4NQVA 1F6AA 3MNZB 1BVZA 4PB0L 3K2UL 2KKQA 5H37G 1N2RA 1PLGH 4KVCH 5F7DB 4LCCC 3B5GA 3D85A 3MJ9A 4LCYA 2WV3A 3AUVA 3V6OC 1LEGA 3EFDH 4BZ1H 2AGJL 1JPSH 5FDWB 4DKDC 1K4DA 3VXME 5E5MB 4GKOA 3KAAA 3MUY1 4BQCA 5HGAA 4Z77B 1K8IA 1U58A 1FNHA 2NY1D 4HWBA 5GGRB 1BF8A 2J12B 1CQKA 4BA8A 1U8PB 5EBLB 2HWZH 1S7RA 3JZ7A 4RMQA 3MLRH 5DR5H 1G7HA 4XVSH 1IM9A 4ENED 5ESQB 2EIBA 1U2CA 4DCQA 4JDZB 4YHOL 4WNQB 3I6LE 5JW5A 5I1IH 1ZLWK 1QFWM 1RIUL 1DN0A 3QEQB 3RVVC 1MFAH 4PJBB 4WW2F 1RQ5A 2PCPA 4M8VA 1I8MB 4OKVB 4P2OB 4X9GA 4XCEA 1JHLL 1AXSA 4KZDL 3O9WC 3QUYC 3FQWB 3TP4A 1VACA 1GC1L 3WJJC 4Y4KC 3SO3C 5I1HH 1KEGL 3RGVB 4HKBA 3TBYA 4JFEB 5KSAC 5DJDA 3IJSB 1B0WA 1WZLA 3QNXA 3SDXB 3OR6B 1HQRA 3V79C 4UBDD 3ARBB 1W2KT 5KVDL 5J13B 1OTSD 1NUGA 1Z5LA 1I7RB 5AZ2L 2NTFB 3VRLE 5GGVH 4QRUA 3WHE1 3MRGB 1FG2A 2O61A 2EH7H 1LO5A 3DYMA 4NRZB 5HDOA 3SDDB 5BW7A 1A9BB 3H9SE 3C2SA 4MQXD 4U1LB 1S78D 1RZGB 1HNFA 2VQUA 4NQVB 4BUGA 2VDQL 5D7LD 1J88A 2O5XH 2W0FA 3HMWH 1P4BL 4OQTL 4U6VH 5JPMB 3RQ3A 4DVBA 3I9GH 5JZ7C 4GW4A 1N2RB 4LSQH 1IBGH 2DQUL 4WI5A 4YO0A 4LCYB 3D85B 5FK9B 4WI6A 5B21A 4L3ED 5LJYH 1KTRL 1LEGB 1S8DB 4IMLA 3TJEL 1CZ8H 5B22A 5HI5C 5I8KH 4BSWB 1K4DB 4K7PY 5HGGS 4ODSL 2W65A 2YK1L 1FL5A 4QXWA 5F3BA 4Y19E 5DS8A 5F7UA 1PEWA 3TFKC 2UY6A 5HGAB 1K8IB 4PRAB 3AS1A 1N6QH 1T66C 1JWUA 4ZS7H 1XGTA 4QF1A 5KG9A 1S7RB 3MJ7B 1G7HB 5T5NG 1IM9B 2R23B 3KGRA 2F19H 2WWKT 2R9HC 4OZGA 3MLVH 2E3VA 4QXTA 5F9AC 1DN0B 1U92A 1OT2A 5I73C 4FZ8L 1IVLA 5I1KL 4KHXH 3PL6C 2XA8L 4XCEB 4YHPB 1AXSB 3GM8A 3W81A 1MRDL 5C7XL 4S1QH 2DM4A 4KKCD 1BM3L 1DQJA 1VACB 4H1LB 3G5VA 1IC4L 5EIVA 3KPQA 3HE6D 3LS5L 1IILE 1MI5B 3GIVA 1CS6A 5DJDB 3UAJD 2OJZL 4JN1L 5BV7H 3MV9D 3IS0X 4PRPE 1NSNL 1VADA 1YMMD 4LARH 4FA8A 5HHMD 1JFQH 4XMKL 1II4E 3L5HA 1GOFA 1QSFD 4LLWA 1Z5LB 4JFFA 5ALCH 2GT9B 4XNZC 3KLHD 3UTTD 3CVHL 5HHVL 4IS6A 5FO9A 1FG2B 4YDKL 3T0EC 1LO5B 2NQCA 2EKSB 4IM8A 2QL1A 3HI1A 4WUUA 4I77H 1P7QD 1QO3B 4PV9A 3S3SA 1OAXH 1OW0C 3MR9A 2W0FB 3T4YB 4DVBB 3FQNA 1CXEA 4R4FL 4GW4B 4YH6A 1GYAA 2BRRL 4IIQC 2BVPA 4YO0B 3EOTH 1ZV5A 4P4KC 1AXTL 1EGJA 1MWAA 3GBMH 5E03A 5H2BA 4QO1A 2MMXA 1LDPH 1N0XL 4XNMA 3U7YL 5IW1B 5HTSA 3SQOH 3PF2A 1FL5B 2AVGA 3M1BA 3DVFA 5DS8B 3O2DL 1F45A 4X6DA 3H7BA 5D2NA 3MV8E 3FQXA 5FYKH 5DVNA 5EOCL 2HKHH 1A1NA 4I13B 4PLKD 3GMMB 2JK5A 2OL3H 1INDL 1IEAB 4Z78A 1UA6H 3QDGD 4RFEB 4PG2C 2W9DL 5FUZH 4QXTB 3SE8H 5E1AB 1MFNA 4EI5C 4TNVK 5B39A 3OKMA 4M1CC 4PRBA 2WQ8A 4PJ5D 2ARJB 2XYCA 2MPAL 2B39A 1DQJB 1RU9H 1GGTA 3G5VB 4M6ML 2RCSL 5DMIH 3WBDA 2RQ8A 3DSFH 5I1EL 5F6HI 1J8HA 3LKPA 3HUJA 3ILPA 4JY5L 4G6KL 1H8NA 1WISA 1NMAL 4F9PC 5I9QB 3LKQB 5ITFA 3OG6B 3W2DH 1X5AA 5HI3D 5FO7A 5T33L 2AABL 4J3SA 2VDMH 1OAUL 1REIA 2OZ4H 5FF6A 5GS0H 1DQLL 4TOYL 1PD6A 5FO9B 5T1KD 2A6IB 4P59L 5DJXB 2FECI 3BN3B 5D7IA 2FHFA 4ZFOA 3QWRD 4HBCL 4WUUB 4JFHE 2XFXB 3LEXA 4PV9B 2YPKA 4G6ML 1P4IH 3MR9B 1NFDF 1WV7T 4OQ1A 3ILQC 4POUB 4Y5VA 2EO1A 2VE6A 2Y07H 4DKEL 4N68A 4YEFA 4QTIL 3UMTA 2Y5EA 3CFDA 4NGHL 5H2BB 1HSBA 4GO6B 4XWOD 2X89A 3W11C 3F8UB 4MS8D 1K85A 3ZTJH 2X41A 5SWSA 1IGCL 3H3KA 2CUMA 3M1BB 1PQZA 4N0YL 4OCRH 2F53D 4WHYH 4FABL 4X6DB 3OXRB 4ZO8A 1LE9B 3H7BB 4G5ZH 5EZJA 5EORH 1S9XA 3VI3E 2O5YL 5DMGC 3FQTA 2R15A 3VWKB 1U8OA 2IBZY 3MREA 1FZOA 4LEXH 4KXZI 3RUGA 1JGUL 1UWXH 5DEZA 1EPFA 2E9IA 3OKMB 4FTVB 3P4OA 1AY1L 2AJYH 1MHPH 3B9EA 4PRBB 3VW3H 2ICEA 2HFEA 3NMEA 4L9LC 3OKEA 2OJEA 4M7LH 1EHNA 3IFOA 5F6IC 1GOHA 3WHXA 1MCWW 2NPLX 3EJJX 5DQ9A 3RTQA 2Q3ZA 4BUHA 2R2EA 3FO0L 4G6AC 5BVJA 1V7NH 1U8IA 1J8HB 5AYUL 3LKPB 3ILPB 3ZHKA 1RZKL 3PJSA 1FIEA 2ZCHL 1Q9KA 4PRIA 4D0CB 4PJ9A 5ITFB 2D7QA 3T2OA 1F8TH 3RY6C 2AEQL 3R1GL 4LOUD 1NMCB 4KJWD 1A2YA 5MEQA 4XCNB 3FRPG 2R4RL 2R69H 3FOMA 3IU4L 3MROB 2MJWA 4M6NH 4ZFOB 1YEGH 5LGJA 2VDRH 1YNKH 4HKJA 4X99A 2YPKB 3C6LC 3PGFH 2QQNH 2F5AH 1Q9WB 4LLQA 4Y5VB 1IAIM 3QG7L 2YWZA 4BKLB 3FFCD 3CC5A 3BESR 5T3XD 5F7EH 1BQHA 1HSBB 1MJ8L 1FDLH 3WL9B 5J56B 3AMLA 2CLRA 4P5TD 5SWSB 2OXHA 3WS6C 2QEJA 1CDGA 2CIKB 1PQZB 4Z8FH 1IT9H 4RISH 4ZOCA 1CF8L 1PFCA 3IETA 2B4CH 5EZJB 4UTAL 1A6TB 4IDJH 5CILL 1ACYH 5D7LE 1OP9A 4M5ZL 1S9XB 1RVFH 2LFGA 1HEZA 1U6AH 3VXOA 1F3DH 2A1WL 5CEZD 1UYWH 1U8OB 3U36B 1JRHH 3WLBB 1LEIB 3MREB 1BX2B 4WHYG 1QSEA 4TSBL 1Y6KR 5AUMA 4JLRA 3ZKXC 5CLWA 1LP9A 5KW9L 1UADC 4XMPH 2O93L 4O58H 5EN2B 1W8NA 4KDVA 1ND0A 3P4OB 2HFEB 3O3BA 3OKEB 1FNFA 3QRFM 3SDCD 4K9EC 1AJ7L 4DW2L 3S5LG 4BELD 4APQA 3IFOB 5A2FA 1CXKA 2V9TA 3OZ9H 3LB6D 4WWID 7CGTA 4FZEH 4M7JL 1HH6A 3ULVF 5DQ9B 2R2EB 3P77B 5C08D 4NKMA 3FMGH 5IQ9A 5IB4B 4PGDA 4HUKB 2FDBP 4R97B 5DD3H 1Q9KB 3QQNA 3SKNA 4PP2B 4PRIB 5DJYA 5E8OA 1NAMH 2GAZA 3HNSH 5IT2L 3JVGA 2HJFB 2VDPH 2UZIL 4CADB 3QXVA 3V95A 3FN0L 4PJIF 3FOMB 4K8RC 3EJYC 4WY7L 3CFBB 5C0CA 1TVHB 1MY5A 2MHAA 4PJ7B 1JNNL 4HG4J 2NY6B 5LGJB 4NT6A 4KROC 2X40A 4LSVL 1F4XH 4LLQB 4WVRA 1UWXK 3MV9E 5GGTA 2P47B 3IS1X 4KKAD 3TA3C 5ENWA 1G84A 1YMME 5DHVH 1JI1A 3O2VH 5HHME 3ZL4L 4H25A 3VGFA 2EE6A 4RQQA 3EFFB 5JNYB 5CZXC 1TQCB 3UTTE 1BQLH 2KZWA 3TZVC 2WBWB 4KUCD 1DVFA 4PP1C 1KJ2A 1IGIL 3QXAB 3G6JB 3IETB 1DR9A 1L9MA 4WHTA 4HJGB 4LPWA 3D2UD 3MV11 3VXUD 4EKXA 3JWDL 3OX8A 4EXPX 3O4LD 3PGDA 5C6TH 2EDFA 4HF5H 3PP3H 3EHBC 3W39A 1QSEB 4FNLH 3GEWB 3K8KA 5LAXB 2IH3A 3AC0A 1S7QB 1LP9B 5BOZG 3Q5OA 2MCPL 5HDQL 4P2RA 4FQQA 1KN2L 2YKLH 2OR9L 1U3JA 1ND0B 2F5BH 4GG6A 2J7LA 3O3BB 1J0IA 3TYGH 2F58L 4Q7DA 1KJ3L 4DGYL 1DLFH 4PJBF 4UAOC 2VZTA 1NBZA 2QKIA 1TZIA 5FOJA 2WBKA 3FTGA 1W0WA 3I50L 3KPPA 2GSIA 4HMCA 4KTYA 4K94C 4NKMB 4A2MA 5IQ9B 4LKXA 3V8OA 3QDGE 4PGDB 2BSTA 1FLTX 3WCYA 2D0FA 4KFZC 2IG2L 2C9AA 2W59A 4I0PD 3SKNB 4X7EC 4NQED 4MWFA 4MAUL 5E8OB 1NPUA 5F7NC 4X9FA 1FH5L 2HKFH 1ZK9A 5M95B 1EFQA 2GAZB 4I48A 2HT2D 4KMTH 5IW3A 3SDXF 1DEEB 1G9NC 1EO8H 4PJ5E 1A7QL 4LU5L 4QOKB 1CXFA 3P2TA 3C60C 1K8DA 1QQDB 5L6YH 3GHBH 4DQOH 3VDBA 3FT3A 1TJIL 4NT6B 4NYLA 4D0DB 1NGZB 1YEHL 4PJXB 3T1WA 4GAJH 3WXVL 4Q2ZB 4EUPH 3BJ91 3VXRD 3HI5H 1K6QH 4H0HB 2NNAA 2UUDK 3X3FH 5IHZA 5ENWB 2X05A 2ZG3A 3W9EA 3O6FC 2HYMA 4HAGA 2ICWJ 5HHOB 3LD8B 3LRSA 1X4ZA 3FN9A 1SM3H 5IB2B 1JMZA 1OHQA 3O8XC 5DUPH 5HVHC 2RFXA 5EWIH 3B6SB 1CR9L 4H26A 2XXMB 5E2WL 4Z7WE 4X4YA 1GGIH 1RIHH 4OGAC 4XTRD 5IFAL 2WAHA 3OX8B 3QUKB 3TN0C 2I60L 1ZEAH 4Z9KB 2F15A 3C8HA 4OFVA 2IH3B 5EC2A 4IOSD 4GBXA 2FJGA 4FQQB 1ODAA 2XTJC 5C0ND 2Y6SC 3F65A 3DMMD 2F53E 4GG6B 4UT9H 1Q1JH 5EBMA 4AEHH 4AJ0A 1NBZB 4YHKL 2GJ6A 1TZIB 4YBQC 3FTGB 3KPPB 2FX7H 1FP5A 3OGCA 4U6TA 3GJEA 3DTXA 5I0DA 4QRPB 3MYJA 1LO4L 4KTEL 3UPCA 2BSTB 2JLLA 3LQAL 3QULB 1MCOL 4MWFB 4RGNE 1NC2D 3MACH 3EGSA 3HLAA 2FYYA 4I48B 2C1PA 4K9EH 1OL0A 3SGJC 3FCTA 2H26A 4PV8A 4M7KL 2X1OA 4DFHA 4HBQA 4Z7QF 2Q86B 5DC9B 1QFPA 5DJ0B 4OZHA 3FT3B 4WCYH 2BSSA 3UJJH 3GSQA 2R56L 4NYLB 1XH3B 3GFUA 3K4AA 1S9VB 2HN7A 1DQQA 4AG4L 1B88A 2ZCLL 1YEFL 2NNAB 3QEQD 5IHZB 3C5JB 1OAZL 2LTQC 3ZKMD 4O4YH 4PD4J 1AE6H 1NH6A 3W9EB 25C8H 1YPZA 5DQDL 1M05B 3HA0A 4EN3D 1FORH 1XGQB 2YMXL 4K8RH 1QNZH 4Y2OA 5T1LD 3B2UC 4P46A 4NKIL 4EUPG 1WSST 4JPIB 1KEMH 4JFZL 5KSBE 1KC5H 1WFNA 3V52L 3QCTL 4JFED 3ORJA 4WFHD 4IJ3B 4GXVL 3RWGA 4NZRL 5T3ZD 2X4TA 1ZT1A 4GJTB 2NR6D 4PB0H 3ARBD 3K2UH 5D7SH 3D87B 3FB6A 4RNRA 2AXGB 3DUUA 5T3XE 3MRKA 4KK8D 5DHYB 2P5ED 4P2YA 4ZS6D 3WJLA 1OP5K 5KSVA 4XHJC 5HD8C 1EEUA 4HWNA 4PJDE 2LVCA 5EC2B 5EUKA 3OAUH 2PW1A 4U3HA 1AO7D 3C8KA 2ZJSL 4X9BA 4PY7B 1I3RB 5INDA 3NN8B 4MB5A 4ELMA 2XQBL 1T83C 4N0FA 2GJ6B 5D96B 3D85D 4H8WL 3GSNL 4JFXB 5D93B 1E0OB 4TVSa 5E6YA 4Y4FA 3FB8B 5CEZE 3W0WB 4YHOH 5FYLD 3MGAA 1RIUH 3BHBA 4FHBD 3EGSB 2BZDA 5GJTL 2FYYB 2AKRB 3B4NA 3S34L 4IMKA 3OKOA 3WFBL 3GSRB 3HPLA 3FCTB 2H26B 3NPSC 2V5SA 5HPMA 5SWQA 2OL3A 4KZDH 5A3ID 1I9JL 3DJ9A 4KMLB 2FL5A 1GC1H 5E00B 3V8CA 1IM9D 1ZKAA 1HCFX 3GSQB 5C08E 1KEGH 2BY3A 4OF8A 1T1ZA 1DBJL 5DYOA 2WWKO 4UB0H 5GIRB 4KHTL 2HN7B 1DQQB 1U95A 2J8UF 2JJTA 1LK2B 4X98A 1HKLL 1G9NH 1XR9A 4M9OA 1YPZB 5F7LB 3ZT5A 1W0VB 3CFCL 5KVDH 3BPNB 4HUWB 1P5UA 2HAZA 3NH7L 5AZ2H 5GS1A 1HZHL 4P46B 2NY3D 1A14L 2QQKL 3FRPA 1T80A 1UZ8B 2C3GA 5BV7B 3UDWC 4GG8B 3U4EA 3OB8A 3W5NA 3BN9D 2V7HA 4YAQB 4OQTH 4K3EL 4MAYC 3O9WA 3QUYA 2FO4B 3CJJA 2OZ4A 1JI2A 4IHOA 4RNRB 3D39B 1XIWA 1EMTL 1FNGA 5KSVB 1KIQA 4Y1AB 1QBLH 1RUML 3TJEH 1MFCL 5KSAA 2EXWD 1A6ZA 1DANU 2PW1B 4YHYC 4GAYA 5DJ6A 4NN7C 5K33A 3C8KB 4Z0BL 3AAZA 4JO1L 2EDWA 2YK1H 1SJVA 4KV5F 4M93C 4N1HB 3ULSA 4MJ5B 4HW6A 3TJHC 1HIML 3TV3H 5INDB 4KH2A 2X9YA 3DGGA 1FL3A 2GSGB 4WHCA 5ECJE 4DN3H 2BHZA 3JUYA 4LIQE 3QAZB 2VOTA 3DI3B 3VXUE 4M8QA 4MQSB 2CH8A 3V7AG 3T0AA 3O4LE 4Y4FB 4YBLB 2CUIA 1T03H 4OGZA 5HGDA 2X4OA 3GMLB 3S97C 3BHBB 3FQUA 5L2KA 4FZ8H 3G08A 5I1KH 5JHDA 3ET9F 3OKOB 5J3HD 4LCCB 1HHHA 3MOQA 2HT4C 4M6AA 2XA8H 1D7FA 5SWQB 32C2B 2OL3B 1WFUA 2LU3A 3TH4T 5C7XH 1X4YA 1CD1B 4RWYH 1BM3H 2FL5B 2WIIA 4FQ1L 3S5LA 1IC4H 4HD9A 2ITDA 5CZKA 4GH7B 5DYOB 1SYVA 3MRIA 2HT3C 1ZLVH 1U95B 3VFUA 2OJZH 4JN1H 4X98B 2D31A 1FAIL 4RAVB 3TBSA 4EVNB 4NQEE 1XR9B 2KPNA 4XMKH 3B43A 2ENSA 1DL7L 1E28A 2EDJA 3NA4A 4QHMA 2OCFD 2EC9U 5DEFA 5GHWL 5GS1B 1BWMA 2A0LD 1MQKL 4OF3A 5FYJD 4JHWL 3CVHH 3KPRA 5HHVH 1BZ7A 1AD0B 4KK5C 4CJ1A 5ANMA 3FAWA 3PL6A 4U6YA 4J4PC 1LO2L 1I1CA 4QRRA 3VXRE 2V9RA 2V7HB 4M1GL 3G6DL 4NBYB 1INEL 3MLYL 3O9WB 3QUYB 4R4FH 4PJ8A 2BRRH 4NKDA 4R4ND 1AXTH 4Y4KB 4HG4K 4JFFD 4JFYA 3SO3B 1KPUA 1KIQB 3LEVH 4LHQB 5KSAB 2AJ3A 1U36A 1A6ZB 4H20L 4WW1A 2Q3AA 5IB1A 5K59F 1N0XH 2WWMD 5DJ6B 3DVGA 3AAZB 2YXMA 3TWCH 2MQCA 1G7JA 4ZXBC 1LO3L 3O2DH 2VH5H 1FL3B 1O7SA 1PKQB 3OAZH 4X80L 5IFJA 4KPHH 1FGNL 1MCLA 4QRTA 4YFLI 3T0EA 4M8QB 5DJZB 4NZJA 4N8VG 4ETQB 2GUOB 4MXQD 4Z0XA 5FUOL 2N56A 5HGDB 2I5YL 2X4OB 4XPAL 3S3PA 5C07A 5B3NA 3LN9A 4RZCA 3E3QC 5L2KB 5IEHA 4GSDL 3G08B 5JHDB 4B0MM 3G5XB 3ULUF 1HHHB 5J12C 1YMHA 4HJJL 1SVZA 1KJMA 4HZLA 5HI4D 3BMVA 5LCVL 2MPAH 3BH9A 4KRPC 4YPJA 2APFA 1AQDA 2WIIB 4YDLC 2D2OA 4M6MH 3RWDA 3NA9L 2RCSH 5E94B 5FHBL 5DWUL 4LCIL 4GRLC 3VFUB 2D31B 3GGWA 4JY5H 4PJ7F 3T77B 4ZTPL 5ISZB 1NMAH 2VWEC 2DQEH 2FIKA 2Q8BL 3MXVL 3T2QA 3RHWK 3MBXL 4WU7A 1XF5A 4QHMB 5T33H 2AABH 5GQBA 1GSMA 2IMMA 5CD5D 4RFNB 5J57B 3H0TA 2CR6A 2IFFL 4HS3A 3KPRB 1DQLH 1JZ7A 4AEIL 4NO3A 4P59H 5I73B 2FEEL 4PY8J 4HBCH 3PL6B 4CVXA 1LVEA 1J8HD 3MRBB 1DANT 4I9WD 4G6MH 3B9KA 4XCCL 1NAMA 5AWNL 3RFZC 3QEQE 3G6JF 4DKEH 2OLDA 4MYWB 4QTIH 2DQCL 2E5EA 2OM5A 1KPUB 4NGHH 2EDHA 2EDOA 4PJCA 1SEQL 3DXAA 2AJ3B 2EH8L 5IB1B 4WW1B 4Y16A 1BJ1J 3QQ4A 1FLRL 4OCXL 4N90D 2W60A 1E27A 1IGCH 1MF2L 2M26A 2Q6WA 3LS4L 1G7JB 4YDIH 1U42A 2J3SA 3VGGA 2Z0BA 4HEPG 3B3IB 4N0YH 4PLJC 4JFEE 3MRPA 3I3EA 4LSSL 4WFHE 4FABH 5DHVA 3VCLA 2YUZA 3EDEA 4UNTA 4XNZB 1CN4A 1V7ML 5IFJB 5T3ZE 3BD4A 4XT1C 3T0EB 2R8SL 2O5YH 5GSVB 4Z0XB 4TTDC 1BQSA 1H3GA 5JO5A 4LK4A 2P5EE 2X89D 1ORQA 2CDGA 2SEBA 4FFWC 3SKJL 1I9RL 2CO6B 3D48R 5SWSD 1Q0XL 2QLVB 5DD0L 2CKBL 1JGUH 5C07B 3WLWD 1K3ZA 3DETD 4IIQB 1WQVT 2BNQB 1RAMA 3OKKA 1YMHB 1KJMB 4QYOA 1AY1H 3EKCA 5FO8A 1D5XB 5IV2B 4L4VA 3BH8A 4X7TA 4DOHB 4EEEA 3RVTD 4X8JB 3CZFA 4XP6L 2DTMH 3HPJA 2EC9T 1C1EL 3FO0H 2EE3A 3QBTB 4X6EA 5AYUH 5FYLE 2H2SC 3GGWB 5KSUA 4TSAL 5F1SA 4OI7A 2ZCHH 1U8LB 1Q38A 2X9XA 2FIKB 2YRPA 2JELL 4J7RA 4K55A 4PJXF 4XX1G 5GSRA 4WU7B 1I4FA 2YN3A 2RJMA 1X5YA 3R1GH 4ZYKA 4P49A 2EZ0D 3HB3D 4HS3B 3BVNA 4JKMA 4DVRL 3WFEL 3WFZA 2VITB 3IU4H 3U9UA 4NQDA 3RTQD 4Z7NE 4ZUTA 3ARZA 3QIWA 4W6XB 3UP1A 1MJ7L 3RI5K 2JJUA 4EI5B 4CVXB 1RJCA 3X14A 4WHDA 3EUUA 3QO0A 3RZCD 1NAMB 4PRID 4PJ9D 5IVZA 4X83A 1PY4A 1N26A 3E8UL 4UNVA 2FJFA 2F74A 5A1AA 1MJ8H 4PJCB 4WEBL 2K7QA 3DXAB 1MUJA 3QP3A 4ODVL 5DC0A 5EUOF 2X4QA 4PD4K 5D7JA 3SDAA 1KB5L 1MLBA 3RBGA 4M1DL 4EUPA 3RWJA 2QADD 3F7YA 3MRPB 3LQMA 4YXKL 3ULVL 1CF8H 5DHVB 3RY6A 4KRMB 1SJHA 1OQOA 2DMCA 3GMNA 5CILH 2CUHA 3KVQA 4M5ZH 4HPYL 4Y2DA 5E2VH 4FQHA 5ETUA 1W8OA 4CJ0A 3OPZL 5D1ZC 2UZYB 4Q6YA 2I07A 3MRCB 1W72A 1VFAB 4N5ED 3TCXA 1A3LL 35C8L 1HHJA 2A1WH 1A6UH 5EH1A 1QR1A 5C8JA 2SEBB 2DF3A 4HHAA 1C08B 3KG5A 4XP5L 2E8YA 1CGVA 1I9IL 1A7PH 4QT5B 3K74B 3UO1L 3ABZA 4LQFL 5L8KB 4DW2H 2IFGA 3MCLL 1T6WA 3CZFB 4ORGA 4M7JH 3HPJB 2OP4L 3NCYS 5AAMA 4WI4A 4X6EB 2CJUL 3O2WL 3C5ZA 2VAJA 5KSUB 3RVUC 3GJFH 3MRQB 3QRGH 1QTYT 5GSRB 5IWLA 1I4FB 6FABL 2VR5A 5IT2H 3N1GC 3QNYA 4ZYKB 2UZIH 4APQD 3CFJB 3BVNB 3FN0H 2HH0L 4UQ3A 2N7BA 3IDNA 1A47A 3GBLA 1F6FB 2J5LC 4WY7H 4ZUTB 4RWHA 5KANI 1JNNH 3X14B 1AHWA 2P49B 1KPRA 3GM0A 3QO0B 4OZGE 2E7CA 4OM1L 3Q5YA 4HUMB 1RFDL 3KYOA 1A7BA 5F6IB 4CDGC 1P7HL 1KTLA 1PJ9A 3O6ML 4GLRH 5TQ2H 3ZL4H 3HZVB 4U1KA 5HHQA 1RUKH 2GY7B 1MUJB 5FYJE 4Z76A 4B7IA 4KDTC 1V3LA 5DF0A 4OCLC 1GH7A 1U8NA 5C0CD 1IM3A 4WW2C 3VDCA 2Y7QB 4EUPB 1PG7X 3RWJB 1IGIH 4JFOA 2R0LL 1SJHB 3HC0B 4TNVF 1YY8B 2XZCL 4OGXL 4LLVB 5DC4B 1E4XL 1T89C 5HHNA 2DAVA 3JWDH 3V5DA 1R5VA 1PW3A 4JFFE 1QPXA 1HHJB 2VLKA 2DQIH 1C12A 3CSBA 5C8JB 4C57C 3VXSA 3NBNA 3C6LB 2V7NA 3Q6GH 4OKDA 2NYYC 4OD2B 2MCPH 1DVFD 4HEME 5HDQH 3TGXA 4WUUE 5EU4A 2P5WA 4U6HA 5E56A 3SGDH 2OR9H 1MCCA 3LV3A 1AKJD 5TF1L 2HVKA 4PJEA 1CDYA 4HUNB 4HQQL 4I0KA 4DGYH 3S37L 5LGHL 1CVSC 4OLZL 3BT2H 2DD8L 3VGBA 4ORGB 5JA8B 2JB6B 1XFPA 1JGVH 4RAHA 3C6SA 5E9DB 1MREL 3C5ZB 4J3TA 4OCWL 2IG2H 4F7PB 4P2RD 1I85C 4MAUH 1EAJA 1FNEA 1D6EB 1FH5H 4NZUH 3RY4A 2IAMC 4CDHA 2QR0A 4X6DE 1CYGA 3PWJB 3QNYB 4PUBL 4U0RC 1XF3A 5D2NE 2Y23A 5F89A 1A7QH 3TESA 4UQ3B 3VH8G 1ULVA 2X09A 4ZSOB 3T0WA 3ZKXB 1TJIH 3MZGB 1JZ5A 1CGXA 3VRIA 4JY4A 4PRNA 3TO4C 4MA1C 4U4BA 1KPRB 3WXVH 5J6GA 1VEPA 3LZFH 3JBG7 4Z7VB 4ZUWB 3Q6FB 2V9QA 4NJ9L 1HWHB 1KTLB 2VR9A 3V0VA 5HHQB 5DT1L 4HMDA 1KIRA 4HIIA 1ZE3C 4U6XA 5DLML 3HS0B 4K3HA 4LDOB 1RSFA 1U8NB 3MUJA 1IM3B 5ID0A 1YZZA 1ZAGA 4TRPL 3T0DA 3QDMA 1A6AA 1ZLUK 1XCTA 4JFOB 1J8HE 1RK1A 3HUJE 2FCBA 5GRXG 4I9WE 3VD5A 1CR9H 1EEYA 1X7QA 5I1LB 5E2WH 4GKZB 3OXSB 1CFQA 4PIRF 1EJ6A 2IPUG 3V5DB 1R5VB 1F90L 2QJDA 2WLZA 1C12B 4KROB 4LPXA 1NBQA 2XOTA 3VXSB 3QQ9C 4HK3J 2R2HA 4HH9B 3QUXA 4N90E 5D7IE 3TA3B 3QZWG 1ZLSL 1H9VA 5EU4B 3MJ8A 3JWOC 4U6HB 2IPTH 2FZ3A 3LV3B 3F58L 4NM4L 4OQTA 3QEUA 3VFOA 4U1MA 2VDOL 4LRIA 2VLRA 4DKAA 4MD0A 4PJEB 1QUNA 1K5NA 4TUKL 3TPUA 4KUCF 4YHKH 3TZVB 4CVUA 1OSPL 3MRLA 4ONHA 3ARGC 3P4NA 3UXFA 4NN6B 3T3PE 3QNZB 4OSUL 5SWSE 4GBXD 1CI5A 1MCOH 1YEEL 4G8FA 3L5WA 3DHMA 3CCHA 1G7MA 5CS7A 3TN0A 2QR0B 5I75C 5IOPA 1XF3B 1OAKL 5KVFH 5F89B 4M7KH 4JPWL 1I7ZB 1B0RA 1RY7B 2GJ6D 3ROLA 2OS7A 4OBSA 1I3GL 1DDHB 3EDDA 2GTWB 3VRIB 2R56H 5JQ6L 2E7HA 2BY2A 3LEYH 1WAAA 3TYFA 3RUGE 1PZ5B 4MJIA 4AG4H 5ELIA 2ZCLH 1YEFH 4UAOB 3ARSA 1OAZH 2IGFL 3TVMC 5GS2H 4R7DA 1LHZA 4ZFFA 1Y18A 5DQDH 5ID1A 2YMXH 4WI9A 1B9ZA 2NLJA 1CGTA 1ZXQA 2HTLD 3GKZA 4HCRL 4NKIH 4JVPA 5ID0B 4O5LH 4NSKA 2M8XA 1OAYL 1D3CA 3QDMB 1LDSA 1QBBA 1AC6A 4OLWH 1XCTB 3V52H 4CMMB 3A0OA 1GVIA 4GXVH 4NIKB 2A2QT 1X7QB 4PRIE 2R1YA 2XACC 5E70A 3C60B 1CFQB 5GRUL 1DN2A 2QV2A 5CKGA 4G43A 1B3JA 5D2LF 4FFVD 3CVHA 4M02A 1Z9SA 3WN5C 1LMKA 4X5XA 1KN4L 2PKDA 3IF1B 4WO4C 4NOBA 4WU5A 3VFWA 1F5WA 3IDUA 3O6FB 1P9MA 2ZJSH 3QEUB 3CNKA 1K9TA 2WP3T 4MXVF 1A22B 4MD0B 1K5NB 2BVUA 3MC0A 2XQBH 4NDMA 2XQYG 4OV6F 3TPUB 3MSPA 1S9KC 4RMVA 2A9NL 2LVEA 3MRLB 3O8XB 3GMQA 4I18A 4H8WH 2BERA 3GSNH 4RMSA 1A7NH 2VQ1A 2DYPA 1PG7H 2AV1B 4N8VB 3BKJL 1KT2A 4ONGL 1CQYA 4G8FB 3L5WB 3O2DA 2NX5A 3CCHB 5GJTH 1TCMA 3T0BA 3TN0B 4U1HB 3S34H 3WFBH 5BJTB 5BS0A 2VSDA 3U82B 1B0RB 4JKKA 3VGDA 2N1KA 1NL0L 2XI9A 3BP4B 3ROLB 1I9JH 2XTJB 4Y4FD 1MCPL 4QXUL 3W9DA 1BHGA 1IGYA 2ZG2A 1DBJH 3VD3A 4KHTH 3TYFB 4MJIB 1LP9E 2R2CA 3BQUA 1HKLH 3GSVB 1N59B 4ZFFB 1MOEA 3ZE0F 3CFCH 5FYKD 5DFWH 4OFDA 5BZDA 3NH7H 2NLJB 4P3DA 1HZHH 4FQXC 1G9ML 2QQKH 4YDVB 1CDHA 4MNQB 2PR4L 3BGAA 4L8CB 2ICWB 3OJDA 2A6JB 4GAGL 4W4OA 3WIHH 4XH2B 2GITA 4OD1L 3LPGA 4Z5RA 1T0NB 4OJFL 4TN9A 4ZPTA 1BOYA 1IGML 3WYRA 4DTGL 1C5CL 4K3EH 1T5XA 1JIBA 1QRNA 4G43B 3SCMA 5C3TA 3CVHB 1OM3H 1S5IL 3IJHA 4N0UA 1EMTH 4X5XB 5JDJA 1QEWA 1MFCH 4EI6A 2FWOB 5C0CE 1IJ9A 2LU4A 2LTQB 4YXLH 4LVEA 4Z0BH 2AJZA 4WU5B 2HLFC 4JO1H 3HE7A 4NQCB 1IC5L 3L6FA 1C5BH 4GMSL 4M6OH 3S4SG 2E7MA 5CAYB 4ZAKA 1HIMH 3G6AA 1V3MA 2AQ2A 2ZUTA 4LLYA 3T8XA 4N1CA 2EEBA 4YHIA 5GS0D 1A4JA 3GMQB 2V17L 1XIWD 2VQ1B 1DBML 3BEWB 4ZUSA 3UDWA 2Z8WC 4MHHG 3CH8A 2Z31C 1KT2B 3OMZA 3ROOA 4MAYA 4PGBB 2GCYA 4J3XA 5IR1A 2FEDD 5BS0B 4ZTOL 3IDYC 2WBJC 1F97A 1ZVYA 5D1QC 4R26H 3DUSA 2NXZC 3A67L 3NIFE 4LSTL 5FHAL 4P9HL 1OLLA 3W9DB 1IGYB 5MENA 2JTDA 2A9ML 1CXLA 4LPCA 4YFDB 3WV0A 2FR4B 1FAIH 5L2KD 4P2RE 5E2UL 2VSCA 3FT4A 2VQTA 3JTSB 5JHDD 3UJTL 1NGXA 2J8OA 3EYSL 4GG6E 1FNSL 1F4YL 5BZDB 1GPOL 4IRJC 4XRCA 1N5YL 5GHWH 1E6JL 4P3DB 3ME0A 3V5KA 1MQKH 3PHQA 1ZGLP 1CICA 4HH8A 4F7MB 2CKNA 3NZHL 4PJCF 3OJDB 4Y5XA 4JRYA 2GITB 2EDBA 2MNUA 4Z5RB 1X5GA 3NPSB 1LO2H 1CU4L 5HY9A 1T66D 4ONFL 5F9DC 4M1GH 3T3ME 3G6DH 4TQEL 4OZIA 1INEH 4KI5E 1WK0A 3MLYH 1PDKA 5I30H 2MFNA 4FG6C 1FSKC 1I8LC 3IJHB 2XZZA 5GRVK 1B0GB 3UYOD 3ULUL 3KPRD 4QHKI 1QEWB 2D7NA 4EDXA 4H20H 4EI6B 2IJ0C 3DX8B 1BEYL 4H0GA 3DRQA 5J7CC 3HE7B 1UKQA 5DA0B 3L6FB 1KACB 1T0PB 4ZQKA 5C0DA 2ESVA 1A6VL 1LO3H 3G6AB 1WWWX 4KKLD 4QRRD 2VISB 2RBLA 5EU6B 2JIXB 5ICYA 1H8OA 2ZUQC 4PJ8D 1MELA 2EECA 1FGNH 1A4JB 1OTTC 3HR6A 1CLYH 1KELL 4J4PA 5GGRY 3RVWC 2I5YH 5TDOB 2BVOA 4MAYB 2XRAL 4GSDH 2BSED 1ERNA 3OJ2C 2P45B 4HJJH 1AGEA 1BZQK 3QO1A 5C3LD 5LCVH 5TE6H 3L3OA 5KS9A 1ZGLB 4YHYB 2R0KL 4Y8DC 3P40A 4CBPA 4NN7B 2C4FU 2VKWA 1RHFA 3VFSA 1JYNA 4M93B 4KK9D 1MFEL 5MENB 1TCRA 4ALAL 3UTSA 5DWUH 4LCIH 4ZXBA 2J2ZA 2JJSC 1UM6L 3ARED 1CGSL 3FT4B 5BRZD 1NGXB 1P69B 4MD5A 4QKXB 3MXVH 2Q8BH 2HP4A 2DIAA 4ZOBA 4XRCB 1LWRA 5JW4M 4E0RB 2VUOA 4NO0A 3QXDB 5F7FA 1U2HA 4F7EA 3IU3A 2IFFH 3HRPA 2GJ6E 3RX8A 4AEIH 2HRLA 4OT1H 4YDJB 2HLAB 3CDCA 3B9VA 1T20A 2VAAB 2ZCKL 4JRYB 3VH8A 5I8EB 3GI9L 1NCTA 4OZ4A 5HYFA 3GJFA 4S0TD 5ITBL 1KXQE 5IBLC 3U0WH 1FIGH 4CW1A 1TNNA 4WV1C 5AWNH 4OZIB 3RL1A 2Z8SA 4XPHL 5JR1H 3SPVA 3L1OH 2DQCH 5CBEA 4JM4L 5AD0B 3G04B 4ZUVA 2XKSA 1SEQH 1F13A 2EH8H 1U8MA 3S37X 5E08L 1ROWA 4FOMA 1FLRH 2BY0A 4OZHE 3DRQB 1FC1A 4OCXH 4P4RA 5KTEL 1FN4B 1MF2H 3LN4A 3LS4H 1MCQA 4P2QA 2YEZB 2K7PA 3O45B 4ZQKB 3V4VL 5C0DB 1T2QL 2ESVB 1A3RL 1T21A 3B9KD 4LSSH 4M48L 3EYVB 5CJOL 5ABDE 2WUCL 5ICYB 3P9MA 3BP5A 4FMFA 5ALBL 1YPZE 2BDNL 2R8SH 3CAFA 3RA7L 3X12A 3RL2A 4Y16D 3SKJH 4GUPB 1I9RH 4MQ7A 2BVOB 1T3FA 1Y0LB 4G8EA 1WFTA 4UDUB 5DD0H 4F58L 1EJOL 3QJFB 3QZWA 3RDTA 3QO1B 2A73A 5LVEA 5H94B 4OFIA 3L3OB 3RWHA 3QPXL 3SE3C 4O2CB 3OWEA 4NWUL 3QUZC 4ZXBB 2PO6C 3IDGB 1MHEA 4FQPA 1RZJL 3MOBH 3S8WA 1UXWB 2NW3A 1BLNA 4MD5B 5GISH 2JELH 3NPZB 4BQ6A 4PJHB 3MLWH 4UMGA 2FSEA 4NO0B 4Z7VF 2WLYA 4L4VD 5C0AA 4ELME 4F7EB 3IU3B 4KJQC 1KCLA 4DVRH 3VWJC 3WFEH 4PJGF 1MNUL 2W07A 3MFFA 1I7UA 1T20B 3HNVL 3VH8B 5L2JA 3LPFA 3S36X 1MJ7H 1SJEA 5GZNC 3GJFB 5J12B 3MV7B 4U0QB 4MNHA 1S7TA 1ZT7A 1IL1A 2EXYC 4CW1B 4IRZL 3VA2C 4KRPB 1UKTA 3D18B 1I3UA 3X11A 3VD7A 1JF6A 3E8UH 5FYKE 4ZUVB 4GRLB 4HK0A 4WEBH 1U8MB 1O0VA 5IVXA 2MCG1 4MXWL 4NQDD 5D5MA 3OSKA 4ODVH 4MVBD 3CXHJ 3QIWD 5C0EA 5TPWL 3NZ8A 3ZE2F 2Y06H 4P2QB 4EOWH 4LNRA 3VFVB 1KB5H 3BPCA 4M1DH 3CFKA 1T21B 3SE9H 2VDLL 3P9MB 3BP5B 5D1XC 4U1SB 3L3GA 5TE7H 4HPYH 3MBEC 1CDIA 4XAKD 4J1UA 4QWWD 5HYSG 5I1IL 4G6AD 3HHRB 3K4DA 3RL2B 1A3LH 35C8H 4Z7OE 1MFAL 1U91A 4RGMC 4MQ7B 2C4FT 4JDTH 4XP5H 1T3FB 4G8EB 5D7JD 1KPVA 3SDAD 2CIIA 1I9IH 3BP7A 1A1MB 2X7LB 3UO1H 2A73B 4AIOA 5IMOB 5I1HL 4Y2DD 4XP1L 3RWHB 3F7VA 3E6HA 2KUTA 3MCLH 4MA7L 2G5BB 2AXJA 2OP4H 2AJXL 5F7WC 1YEIL 5JA9A 2CJUH 3O2WH 1MHEB 3RPKA 3A6BL 2NW3B 1WIUA 1X5KA 3OJMB 1R24A 4OZFH 4UIKH 2CRYA 5GGVL 6FABH 2FSEB 5D1ZA 1KJVB 1FFPA 1JWMB 1G7IB 2HH0H 3H3PH 3QI9C 3HG1B 5IP4A 2YXFA 4U1IA 2NY7L 5L2JB 4X9IA 1L9NA 5CJXC 3PWVA 4I2XA 4YPGB 5M7QA 1NCDL 3C5ZD 4MNHB 4O9HH 1JPGB 3RKPA 2VXUH 4OM1H 1G1CA 5L2KE 1RFDH 2KQNA 3RWCA 4Y4HC 5JHDE 5ICZA 3SGEH 5IQ7H 3O6MH 5DJ2A 4HK0B 5IMLB 4I3SL 2O26U 2NY0B 5IVXB 1D5BA 5HDLA 3UZQA 3L3KA 5C0EB 5I2IA 4CVWA 4AZ8A 3DARA 3BPCB 2AK4A 3DGCR 2D7PA 1E4KC 2OBGA 4JO3H 2R0LH 5HYEA 3QIBA 2XKNA 2G9HA 2XZCH 4OGXH 3RJDA 4MB3A 1E4XH 3QDAA 4MCZA 1EZVY 5HYJB 4J1UB 3WUWA 1BFTA 4KVNH 3KPRE 3MUGA 2F54B 5ANME 5HPOA 1WCBB 3NGBC 2C7UA 5F1KC 3H42L 5TF1H 2XZQL 1BJMA 2UY7A 3NCBB 4QRRE 3OR7B 4YHZL 2LU7A 4X7SL 3RHWF 3PDGA 1XR8B 4BSVA 5I76A 3S4SA 4NZTH 4KDTA 3S37H 3EJYD 5LGHH 3E6HB 4OLZH 5KZCB 2E27L 3GUTA 4NKOA 4PGCA 1DE4B 4CN4A 4WW2A 2CK0L 2VLKD 4L4TD 5EU5A 1OP3K 5EBWA 2L7JA 2IADB 4OCWH 5K9KA 3FZUD 2P5WD 3BGMB 1R24B 5ALCL 3KS0J 1X6NA 2YZ8A 4M3JA 5D1ZB 4PUBH 2YRZA 4ZOEA 4JQXC 3GSNA 3L3DA 3T0EE 5FDYA 1WIOA 1LILA 2RB8A 5D9SA 3CSPA 4I2XB 4OZFG 3PIQA 3FO2A 4X4MA 4OCNC 5EA0L 5EO0B 4X0KB 3CUPA 5CMAA 2GKIA 5ICZB 5F1OB 2VN7A 1LE5A 4R0LA 3HC4L 5DJ2B 4L8DA 4YQXH 1LEKA 4LKCA 5DT1H 4JB9L 4NUJA 1J86A 2A74A 3BZ4B 4NQUA 3QHTC 4DOHE 2ITCB 5DLMH 1D5BB 1Z2KA 3Q2CA 3RZWA 5I2IB 4YGAB 1I85A 2ICES 4TRPH 4U1NA 3BWAA 1EFXA 2AK4B 2HJKA 2IAMA 1VB9A 3JTTA 2H6PA 3QIBB 4DGVH 2G9HB 2PF6A 3HAEH 1UA6L 3QJHA 2BHYA 4HUVB 4DJMA 1CLOL 5FECB 4LRNL 5FEBA 4OBRA 2P8PA 1F90H 4L1HA 4LSUL 2P8LB 2NY1C 3PXHA 3O3EA 3S36H 3HZKA 2HJLA 2JJWA 2HTKD 3PABA 3BZFA 1JNJA 4NUGH 3MUGB 5AG8A 3QDMD 1ZLSH 4ENEC 4HZAA 5IROA 4LF3A 4OCSL 4YFEA 2C7UB 3F58H 4NM4H 4LPVA 2JCCA 2X9WA 5DD1L 1RURL 1IQDB 1IGTB 5I76B 4BSVB 3S4SB 5DMIL 4TUKH 3DSFL 3GUTB 4WW2B 4JPVL 1OSPH 2D4DA 1A64A 1CD9B 1V3KA 5HJ3A 2IC2A 1H15A 1DQML 3DXAE 1HKFA 4RDQF 5EBWB 3W2DL 4OSUH 3RI5F 3QUXD 3GBNL 1J1XL 3BDYL 4MDJA 5E8NA 4JZJA 4BH8A 4OFPA 1NKRA 1X3DA 3B5TA 3MNVB 4YXHH 3VMOA 3Q1SL 2VLRD 1CD0A 3N9GL 1QLFA 1OAKH 2WP3O 2WW8A 4WUKL 3GSNB 3L3DB 1OTSC 4AL8L 5CKAA 1I3GH 1UKSA 5D9SB 1MY7A 1VFBB 3PIQB 2E6PA 4J23A 3FO2B 1XCQA 2B1HL 1YEJL 3ARFD 3LPWA 1HOCB 3CUPB 5CMAB 1HINL 1IGJB 4IRSC 3MRNA 1NC4B 1ORSA 2IGFH 1LE5B 4JFQA 5EBGA 4MQXC 1LEKB 1S78C 2CRIA 3LKRA 3N50A 1CFTA 4I3GA 4CNIA 3KYNA 4NUJB 4JJ5A 1FVCA 4L4VE 3IRPX 2A74B 2P7TB 5GZOD 1S7SB 4NRYA 3OKNA 1NBVL 4CVZA 4OCRL 3N85L 4HCRH 4X6FA 1TTGA 1P53A 1OAYH 3VG9C 3ULUC 3BWAB 1EFXB 5EORL 2HJKB 1MVUA 2IAMB 2BJML 1HK6A 1P4LB 5IF0A 4JVUA 4U0RB 2H6PB 4MJID 1D6VL 3S7GA 2BOCA 3IJYB 5FM4A 5GRUH 1YN6B 3ZDXF 2P8PB 1WIPA 3MLSL 1L0QA 3O3EB 4QHUA 2CDEB 3UTZA 1UB6A 3TO4B 2UWEB 4MA1B 1KN4H 4G8GA 2DJSA 2D3VA 1MCKA 4U7SA 3ARWA 4NQDE 1JNHB 5JHLL 3K8LA 3HAEG 3MMEA 1EV2E 1N8ZA 3TO2A 2Z92B 4R96A 2FB4L 3HR5B 1JNLL 2JCCB 1NDMB 1C7SA 1M7IA 3I6GA 4MZ3A 5JW4Q 1GOGA 2NXYD 1EHXA 2A9NH 1V7NL 4XAKE 5KOVC 1FYHB 1TJHH 1UWGH 5HJ3B 4DZ8A 4XNQA 1H15B 1RZ8B 3EYUH 4NHCL 1NANH 3BKJH 1F8TL 1KFAL 2X70B 1IE5A 2DKUA 2A77L 4JANB 1J0KA 4ONGH 4XP4H 1FZKB 2IAND 3HE6C 4MCYA 3VXNA 3UAJC 2R69L 3BD3A 1QLFB 3SO5A 3VRJA 3QHZL 1KIPA 4M6NL 3HC3L 3TEUA 1MRFL 1YN7A 1GGUA 1NL0H 1UJ3C