3FFCE

Crystal structure of cf34 tcr in complex with hla-b8/flr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
MGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSFTWTSGGATDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title The shaping of T cell receptor recognition by self-tolerance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE02
3MZTA 3RDTC 2DN7A 1JFQH 5DJAB 4K8RL 4WU5B 5B4MC 4LSPH 3KWWA 5FIEA 3ARFB 3D3VB 3O0RH 3ZDXF 2AEIT 5IK3B 2NXYC 2R23B 5EBMA 4WTWA 1JRHL 1F4HA 1I8LC 2HJLA 5FUOL 3C08H 4F9LA 4MA8H 1H9VA 1Q72H 1XZ0B 1QKZL 1BJ1J 4MA3B 5TGBB 4Z5RA 3SHSA 5CZKA 1XGQA 1JF1A 5D7JA 3BDYH 3IFNH 4ZDHA 2DJUA 4LCCC 1ITCA 3SGDI 4JFQB 3SKUD 3PQYB 4KKBD 5D1QA 5IGXH 3BP4B 1HH6B 3PE9A 1J7VR 4DUWA 4H1LB 3LD8C 5C0AD 3NIGF 2X1QA 4WI9A 4L8BA 3AS0A 5F9DC 3QHFL 3CLFL 5TDNB 1P5VA 1F4YH 1IQDA 3MRIA 3DLQR 5IMKB 3QUYB 1A6AB 1S7SA 5ESVA 1T3FA 5MEPA 2WBWB 3FRPG 3BEWB 1S7RA 3BQUC 5GGQH 1JZ8A 1UQSB 1LE9B 4BFIA 4FN0A 4NZTL 4TTGA 2NYYD 1DDHB 2V5RA 4X80H 4UOW1 3ILPB 4MJIB 4HFWB 2EH8L 3G6AA 1RURH 1XF5B 2EC9T 5E2TL 1BLNA 3K2UL 4CJ1A 3U4BL 2JJTA 2DQCH 3ARED 5E08H 4I2XE 2RGSA 2O5XL 5I1GL 2E6PA 4PTTB 1U8LB 4JFED 3I6GB 2YRLA 1E4KC 4Z7OE 1F4XH 3FO0H 1EGJH 4PJFA 4GKNB 3IF1A 3FT3B 2EDTA 5AG8A 4U7MA 2OTWB 2HMID 3BFOA 5GGTH 1AXSA 3HE7C 3LOWA 4YBHA 3UTOA 4O2FA 3DGGB 4PJ9D 1J11A 3GKWL 3OHXB 3IFPA 2SEBB 3ARGA 4FP8H 1N3NA 1MCJA 1CFTB 3I3DA 2X40A 1I8IB 1U3JA 1JMXA 3DO3A 3FMGH 5LBSH 3S96A 2RBLA 1Q9KB 5DRNB 5DSCA 1HXMB 5T1DL 3ZSTA 1EHNA 5SX5H 3SCMC 3OR7B 1OSPH 1R3IL 2NW2B 1IAIH 1X4XA 2NCMA 2IWGA 2YK1L 1FH5H 4I5BB 4R8WH 3T2PA 3G5VA 4Z7UB 1JHLH 5ICYA 2G9HB 3NA4A 4IBLT 5I1AB 4RX4A 5IHUL 3D2UB 1S7TA 2FD6L 1UACH 1T83A 5HHNB 1JUFA 3CGTA 4NNYB 1FPTH 1HQRB 2VERN 5C9JA 2YA1A 1P7QA 1SJXA 1EX0A 2HT3D 1VGEH 4JJHA 2YPLE 3CPLA 5I73C 4OTXH 3NFNA 1JTPA 1KB9K 4LL9A 3IVKA 5CGMA 4HHAB 4S1SL 1FYTD 4PJ5B 1P1ZB 5I8EA 4LPVA 5F1NB 3QCTH 4X6BA 4HK3N 4HS6B 3OKDB 5B8CC 4X7FC 2CK0H 5KVFL 3ARTA 3WL9A 3SKOB 3NCJH 1RIHH 2YD8A 2E6JA 2X41A 1IGFL 1P4IL 3KXFB 1R3HB 1I3UA 1JWSA 3PWLB 5E9DE 1Q94B 1IL1B 2VDOH 1H8NA 4NO2B 1NBYA 3DX8B 2P46B 4X83A 1U8QA 1IBGL 4MAYD 3NABL 3WYRA 5IEHB 4PJFF 1A1NB 3S3JA 1BJ8A 2XICA 5CCKH 2XKNA 1RPQA 3JXAA 4JRYB 4YXHL 1UM4H 1YNLH 2B7DT 4KQ3H 5J3HD 1A5FH 3IAPA 5HYSG 4GW4A 4UMGA 5JPMB 3W2DL 1X5LA 5HYQB 2C4FT 3IDGB 4I2XA 3MODH 3HZYA 1FGVH 4ZNEA 1DLHB 1KIUA 5DJ8A 1YECL 3PHQA 2IC2A 4KK9C 4M4RA 1A6ZA 3V6BR 4EUPA 3NVQA 1ZLSH 2WMPA 2JF1A 3CFEA 1UKSA 2Q76B 4XBEH 4EI6A 3TBWB 1PY4A 4WI2A 5J13B 4XPAL 3V7AG 5HVWA 2XZCL 1H15B 4CVZB 4LPTA 4P2RA 1N4XH 1Y6NR 1I7RB 4JB9L 5T3XH 2GJ6B 1MQ8A 2YWZA 4NQDA 4WCYH 4HIIB 4LKXB 5JIKA 4M1CD 2R69L 4JDVA 1XEDA 4XI5D 3M1BA 3MCLH 4FQLH 1G9NL 2W9DH 4E41A 5JUEL 5DR5H 3F7YA 4YEEA 2H9GB 2H8PB 1JHKL 1XT5A 2DKMA 3BSZL 3IJYA 3MV7D 4FZEL 4CRPA 4W68A 1IAKA 4NKDB 2F53B 3KYNB 2ESVB 3GJFK 1EZVY 2FX8H 3MC0A 5J1TC 5EFIA 1LP9A 4JQVA 4NQSB 4P2QA 5F9WB 2B1AL 4WWKB 3TBVB 3TPKA 2IAMC 3KR3L 4GKOA 4UUJB 5DURD 4BZ1H 5JXEC 5DJ0B 3OKLB 3PXJA 2CDGA 4X5XA 1JZ5A 4CVUA 1IKFH 3TLRA 4RFOL 5HD8C 4M5ZL 3VW3H 1C16B 4HKJA 5E1AA 2XFXB 5FF6A 1B9ZA 3KPQB 3QG6A 2ZUTA 1OP9A 1XF3A 3VFVB 4GAYB 5HYJE 1D5ZA 3HG1E 1OD9A 4PFEA 3KPRB 4I18C 4MJ2A 2X09A 3EDDA 1MVUB 4HMEA 2R2BB 5HDOA 4GRLD 3REWA 3RGVB 1RULH 5CINH 4ACPA 3D0LA 3GMRB 2H2SD 4J23A 5FGRA 4PY8I 3T65B 3RWFB 3HPLA 2YZ1A 1RMFH 2OXHA 1AHWA 5E6YA 1CF8L 2Q7NA 1ZAGA 1I1AD 3U6RA 1EHXA 2CR6A 3CZFB 4P2YA 5LG1A 3LQMA 2F8VA 3GMNA 5I1HL 1E4XL 1VACB 3P9WB 4PLJD 4WI6A 5IFAH 5I76A 1MJJB 4FQPA 2CMRL 4IRSB 1E4XI 4NNPL 5E9DA 5I8KL 1H5BB 4QHLA 3MRLA 4MNGB 4Q7DA 5CD5C 5JW4R 5D96C 4KH2A 2A6KB 4Z7OF 5ALCH 4ZUTA 3PGCA 5JA9A 5BRZD 4PJCE 1IVLA 4FHBD 3T4YB 5F7EH 5DZOA 5GGVY 1ZHNA 4TUKH 4G80B 3FB7A 4AEEA 3ARBA 3KJ4C 3VGAB 5D2LE 1KN4L 4JFPB 4HJGB 1NKRA 3MOAL 1MHCA 4K8RH 2GTWB 2VO5A 4P57B 1BD2E 4YHYB 4N0UA 1BFTA 5FUOH 3MPCA 4AQOA 5C71A 4KPHL 1TVBB 5IEKA 4KROD 1QKZH 3S34L 4FTVA 5DRZB 5IVZB 2RAMA 4U1JB 4C57C 1WK0A 3OF6D 2E7MA 1UB6B 1PYWB 1LP9F 4HG4K 1YQVH 5B3JF 1MCPL 1RZGB 3D5OF 1ND0A 2EE3A 4V1DE 1KF9B 3LEYL 1VHPA 1WCBA 5C2BL 3VMOA 1B6DA 1WIPA 3RY5A 3QHFH 3CLFH 4GUPA 4HS3A 4LGRB 3I02B 3RZCD 1UG9A 1PEZA 4JM2B 3ARRA 3FQUA 2A9NL 3KS0J 4I9WD 5AWNL 4M7LL 1LE5B 5IW6B 1KPRA 4C56B 3GI9L 4OZHE 4ERSL 3CDFA 1MAML 4Y4KA 2Q20A 3QPQD 4U3CA 3NBNA 3RTQB 4NZTH 3EUUA 2HRPL 4WWID 5DD0L 5HHXL 5ISZE 4ZYKB 1B2WL 5FOBA 2EH8H 4JFOA 3TWCL 5E2TH 3K2UH 1G0YR 4K07A 4XWGL 3U4BH 4X6FA 2JTDA 3V6FB 3NPZB 3HUJB 3QDAA 5HYJA 3MJ7A 2O5XH 5I1GH 5EULV 3BPCA 2EEBA 2WUBH 4PJ7E 1MAJA 2VKWA 1L0QA 4K3DL 3U4EB 2XY2A 1ZHKB 1P7KA 4JG0L 3Q3GA 4ONHA 5E8OA 5F9OL 4YHNB 2OL3B 3BP5B 3KLDA 1NCNA 3CUPB 3UAJC 3QDJB 3GKWH 5DUPL 3EW3B 5T33H 4NRYB 4APQB 5F7UA 1CLCA 3UXFA 5DWUL 2FLBT 4H5SB 1JZ6A 5JLZB 4PJCA 1V3JA 4OF6A 4OUOA 1PG7W 2JJSC 2D2OA 3L3GB 1F5WA 1C8PA 5T1DH 5L2KB 2ZCHL 4QOKD 4EUPG 3EYVB 4PJBA 4N90E 1FORL 5IV2A 1R3IH 5F3HB 5D2LA 4Z77B 3OAZK 1KJMB 2IADB 4KRLB 3BGAA 5GZOD 2HVJA 2YK1H 1NMBL 1N59B 4O2EB 1TFHA 4JFDE 3FT2A 1X5IA 1RJYA 2IEPA 4NO3B 5FYKU 5ICXB 3QIWB 3ARDA 4NDMA 5KG9A 5IHUH 2J5LB 2FD6H 3SGEI 4GO6B 1X4YA 3D85B 1J86A 2VIRB 1I1YB 4DVRL 2JB6B 5GISL 3QI9B 4DKAA 4YH6A 4HKXB 3MYJB 3FONB 4X6CE 1QRNE 1DBBL 1JZ2A 5A43C 3ZZ1A 3BZFA 4H0IA 1WF5A 1UENA 3FFCE 3QUKB 5HHMB 2IPKB 4HLZG 5SWSD 2ICWJ 1CBVL 4N8VG 1DQJA 4NZRL 4G8FA 5I18L 2VUOA 1RUAL 4S1SH 1ZLUH 1IGIL 1I8MA 4OV5B 2Y07L 4JEGB 1OGAA 4XNZC 5BW7A 4OCRL 5KVFH 5IMLB 4EN3A 4D9RD 5TPWL 2PTVA 2WUCL 3O3EA 4S0SD 1XH3B 1IGFH 5GSRA 2VQ1A 1ORQA 5DGRA 5GRZA 5CJ5A 1MAKA 4JN2B 4OZHA 3H42L 1IBGH 3MRJB 1O7SA 3NABH 1R3JB 1DQML 4FXGB 1X7QA 5F7KC 5IHZA 3P0GB 4UINL 5ISZA 4UQ2B 4DQOH 1SY6L 4YXHH 2DLFL 1U0QA 2LAAA 4HGWA 1ZHLB 3IXAA 3DMMC 3W2DH 1TQCC 1U42A 2E7LC 2ICWI 2G60L 3PWPE 1YECH 2VZ1A 3TVMD 4PJ7A 3HPJA 5CKAA 3RDTA 4BKLB 2UUDH 4PJCF 5TE6L 2W07A 3T0VA 4XMLL 3BISA 4BA8A 4F15C 1L6ZA 5CBEA 5I71B 4HIJA 3NACL 3PWUB 5D1ZB 1QFWL 4XPAH 4LRIC 4PJBF 2DQFA 3MGOA 1I8LA 5D2LF 5E5MA 2FYYB 3FHQA 4GQPH 5DJZA 3H9HB 3BHBB 3VWKD 2IH3A 3OX8A 3T8XB 5F88B 4EKXA 3K81A 3D0VA 3MLSL 3HCVB 2R69H 3PJSA 4EQ3A 1G9NH 3MV8D 4N9GB 4X9HA 4OBSA 5C0CD 3PUCA 5JUEH 3TH3T 3N9GL 3MNVB 3JTTA 4X4XA 1JHKH 3BSZH 4GW1A 4FZEH 5C09D 1MFNA 2X70A 1KJ2B 4PGJA 5DJDA 3NCEB 5EBLB 4JFDA 4GAGH 2AK4B 2B1AH 3MJ6A 4UT6L 2VLJB 4X99A 4FZ8L 3KR3H 3IGAB 5CIPA 2KL6A 1I3VA 3H7BB 4OGZA 1CTNA 5I17A 4HF5L 2NPLX 1GL4B 2CIKB 4LVOB 5I19L 4RFOH 1TVHA 1RZ7L 1TZIB 3L3IA 1XIWD 3FL7A 2CKBL 3BQUA 4GT7A 4YHKL 1MI5E 2Y5TB 1MCBA 3QUZB 2ZJSL 4LP4A 3MV9D 3NCMA 2D4FA 3VXSE 4X6CA 2V7HA 1WZMA 4RGND 3QEUA 2HFEA 5HYSB 4G6FD 5I9QB 5DJCB 4P3WA 3MR9A 2DWDB 4OZHF 1RZKC 3P73B 4KI5C 2X10A 5BMFL 5EBWA 5INCA 4QRSB 3C5ZC 5ANME 5BS0E 2E7HA 3HS0B 1CF8H 4JZNB 3QDGE 3JTSA 8FABB 3CCHB 5F7FA 4QHNB 1FZMA 1E4KA 1T1WA 3PP3H 3GMOB 4NHUA 5I1HH 2NTFB 2V2TB 3O3AB 5J6HB 2CMRH 5EORL 2OR8A 4NNPH 3QXAA 1A4KA 3U46B 5I8KH 4NQEE 1OP3H 3ZKMD 5CP7A 2EDEA 4O51A 3QEQB 1T03L 4MMZC 5JORA 4ZQKA 3STZA 3HE7A 1BBDL 3BJLA 2BVTA 1AGCA 3C2AL 1MJ7H 5HVHC 3KWWB 5FCUL 1RIUL 4IOFC 1KN4H 4NUJA 3MLXL 3P11L 5EBMB 5FKAA 2HJLB 5L6YH 3MOAH 4R2GD 3P77B 3PWPA 3SCMA 4Z5RB 2EO9A 1XGQB 1JF1B 2AQ3A 2DIBA 5FB8A 5JPNA 4KPHH 4ZDHB 4W4NA 3U7AA 4TNWK 3WFEL 3S34H 3LKPA 5DHVH 1NC2A 1LEGA 2WNGA 3E3QC 4FFYL 5D1QB 1V8HA 5C3LD 2HLFC 1D9KD 4LCWD 5HPOA 1MCPH 3KG5A 4L8BB 3WUZA 4OM0L 2D0GA 3LEYH 3QEGL 1IQDB 3MRIB 2NY4C 2QJDA 3QDMD 3PWJA 1S7SB 3WKNA 4QHUA 5ESVB 1MWAH 1T3FB 1K4DA 4X7EC 4X6CF 5MEPB 3QULA 4PIRF 1S7RB 3VXOA 2EYRA 2Z92B 2NTSP 2A9NH 5B8CA 4CW1A 4BFIB 4RAUA 5AWNH 3GI8H 3GI9H 3IFOA 4ERSH 4WHDA 1MAMH 2VJXA 1CQYA 2X4TA 3G6AB 4U1LA 1BLNB 3ZDYE 2CLZA 5TJWK 4A6YL 2R56H 3LH2H 2HRPH 5DD0H 5HHXH 1B2WH 1MI5A 1FP5A 3TWCH 1KCVL 1ZK9A 4MD0A 4XWGH 3IS1X 5IVXE 5FYKD 4PRHD 3BH9B 1AO7D 4PJFB 3O3DA 4XCCL 2CXKA 2FBJL 3IF1B 1A7OL 4PB0L 1AY1L 1QHOA 5F8RC 5ANMA 5BS0A 2EIDA 4JG0H 4GJTB 1JGEA 2H41A 5F9OH 3RI5F 1UZ8A 5FYLD 1IMHC 1QQDA 2VLKA 3FQXB 3QDGA 1AXSB 5CEXB 4O2FB 1KCLA 1RI8A 2MMXA 4NUGL 2CRYA 3IFPB 3ARGB 4BQ6A 4WWKD 1N3NB 5AYUL 3OPZL 3ZKXB 3NCYS 3LKSA 5MEQA 1RAMA 4XHQA 1EO7A 1SM3L 2G2RA 2XTJD 5DUPH 3S96B 1BM3H 2EDJA 3DOSA 2EXYC 3VRJA 1AXTH 5DSCB 1YJDC 4NCDA 2DAVA 5SWZA 4OD3L 3ZE1E 4PJHE 4MHHG 5GQBA 4JGUA 4KRPD 3G5VB 2VQTA 2ZCHH 4WVRA 1DL7L 5ICYB 3THMH 1FORH 4JO2L 5AUMB 2W1NA 1NMBH 2PXYD 2IBZY 3P4LA 1S7TB 2B0SL 1AR2A 3MLPA 5DTFA 1JUFB 5IIEA 4TQEL 2R8SH 5D1XB 5C9JB 3LKOA 1P7QB 2AEPL 4HEPG 1GC1L 1MCKA 3C09C 4JE4B 4DVRH 4FMFA 5C0JA 5GISH 3P3YA 3VG9B 4Y8AA 3GIVA 2IAMA 3RKDD 4ZFFA 5JXEA 1FCCA 5FGCE 1E6OH 3IVKB 4Y4FD 5EZIL 4KKBC 5I8EB 1UWXH 2FWOA 1CBVH 2HYMA 2DIAA 4NZRH 5I18H 1RUAH 2NY0B 3OG4B 2Y07H 3WL9B 1LD9A 4NRXA 4I18A 1RQ5A 4OCRH 4M93B 3BZ4A 3D69A 3DSNA 5CFHA 1JWSB 3LHPL 5EH1A 5TPWH 2WUCH 1NBYB 1T22A 3V0AC 1UB5A 4L5FL 3DVNA 3HAEA 1U8QB 2NLJA 5K9QI 1HSAA 2B20A 3MXVL 2EYTB 2DD8L 2BMKA 5HPMA 3AY4C 5FO7A 3C5SB 2XKNB 4BUHA 5ABDE 2NY5L 3WLWC 3H42H 5CJQL 2BJML 2K3TA 1DQMH 1UH4A 2C3HA 2GSIA 2NYYC 4GW4B 4I2XB 1QSZA 3RL1A 1SY6H 1D7FA 5K9JL 2DLFH 5DJ8B 2QADD 2A6JA 3PHQB 3AREC 1A6ZB 4EUPB 3BX7C 1A1OA 4KQ4L 1FO0L 1J87A 4OCLC 5D2NC 5IVXA 3LKQA 2G60H 1JGLH 1OD7A 3CZJA 3CFEB 4EI6B 5C07D 3PV7A 3T09A 1FAIL 3MUZ1 3TPUA 4S10A 1WWAX 5TE6H 5T3ZD 4XMLH 3VXME 1JGUL 1FNSL 1HCFX 3LRHA 3BMWA 3JV6A 4P2RB 1J88A 2DQDL 1QFWH 1V05A 4NQDB 1MH5A 4JDVB 1L9NA 3ILQD 4HWEL 4JFZL 3M1BB 5F97E 1G1CA 2IPTL 4PJ9C 4E41B 4NN5C 3V95A 3F7YB 3IJYB 2FNBA 3DYPA 1IAKB 2C4XA 1AI1L 3N9GH 2C5DC 1DVFD 2GTZA 1U41A 5DVOA 5EFIB 4P2QB 5F21B 1MCLA 1BQLL 3LCYA 2OI9B 5DUML 2CDGB 5CAYB 4RBPH 4X5XB 2ZKHH 3UTQA 2RJMA 3OKOA 4NWUL 4FZ8H 3IAQA 4DGVL 4R9HA 4HKJB 1MLBA 1TTUA 3UCRA 5E1AB 2DJSA 3TN0D 2WINA 3QG6B 1XF3B 1RZ7H 1D5ZB 4M7LT 2CKBH 4YHKH 5LWYH 1WAAE 2ZJSH 1NPUA 2OBGA 1G0DA 2ENSA 3REWB 3OKMA 3DTXA 3D0LB 4HMCA 4MNQD 2L0DA 5F9JA 3VFRA 1F42A 1AHWB 3RNQA 4UT7L 5BMFH 3S37X 3U6RB 5DT1L 3DRQA 3RVVD 2B39A 2PCPA 5JW4Q 3ZDYF 3GMNB 4DCQB 2QL1A 1ZGLM 5HHOD 4C4KT 2I07A 1KCRL 5I76B 1AIFA 4U6XB 2N7BA 5E9DB 3L3DB 4QHLB 5DVLA 4JJ5A 1DBJL 5F89A 4X6DE 4ZUTB 3PGCB 3DVGB 1QO3A 5EORH 4U2YA 3MUGB 4LQFH 2OK0L 1ZHNB 1K3ZA 3Q2CA 3P4OA 3FB7B 4MAYC 1EZVX 3IKCA 1EIBA 1X44A 3ARBB 4HK0A 3T0DA 4MNHA 3QT2A 3P30L 4NPYA 1OP5H 3ZYJA 1BBDH 2VXQL 1MHCB 2H45A 3C2AH 5J3HC 3ULVL 1RIUH 2ICEA 4N0UB 3MLXH 3P11H 2HJKA 4KK6D 2K1MA 4JRXE 2HFGL 4PJGA 3BPNC 1IM3A 5DD5H 1N7ML 4HV8A 4FTVB 1P84J 3MLWH 3U48A 1PQZA 4CMMA 2YN3A 1CDHA 1NH6A 2E6QA 2R1WA 4RAHA 1CGYA 3WFEH 4PY7A 2BHYA 5E8EA 3FKUS 3VXRD 3DECA 4ZO8A 1ND0B 2G5BA 4JPIA 1WCBB 3O9WB 3K8LA 1NUFA 1KLUA 2XWJA 4D0CA 4M1CC 4OM0H 4GUPB 4XI5C 4HS3B 3QEGH 3N06B 5IB3A 4YJZL 3N85L 3FQWA 2F54D 4KI5E 2VDNL 1QRKA 1OCWL 2YS4A 1V7ML 1PZUB 2ZUQC 5I1EL 1N6QL 2NXZD 4F8QA 1FV1A 1GHFL 4Y4KB 3JV4A 2PF6A 4L3ED 1J8HD 5A16A 5E6ZA 1HHKA 3WFHA 3WO4C 3LRSB 5FOBB 1JPGA 4JFOB 2Q3AA 1EFQA 2A74A 5FM5O 1F58H 4X6FB 4A6YH 5ADOL 2ADJA 4HJJL 5HYJB 3HG1B 3MJ7B 3BJ91 5L0QC 3U82B 1WFNA 1WAAA 3DHMA 5JHDE 3BPCB 3ROLA 3VH8A 1KCVH 2BSTA 5JIPA 1BOYA 2FJFA 3JBG7 1RZKL 1P7KB 4XCCH 3FO2A 3Q3GB 4ONHB 5E8OB 2FBJH 4RGMC 1VFMA 2DQHL 1A7OH 3H9SD 2HVKA 4JPWL 4PB0H 4YDLC 3DMMA 3C6SA 1RUML 3TM6A 4PRIE 4Z7WE 3ZL4H 2E7LA 3HAEG 2P47B 3MRNB 1I1AC 3WS6C 2X05A 1D5MA 2KH2B 4NUGH 1IAIM 4PLJC 3OPZH 4PJGF 4X6DA 4BQ8A 1IC4H 4PJCB 4LRIA 2YR3A 1SM3H 3UTSE 4E9LA 1FE8L 4NKIL 5INDA 4OUUA 2NY2B 5AEAA 4KHXL 1RJZA 1HHHA 3DYMA 3FAWA 3HZVB 4PJBB 1ZVYA 5KSUA 5SX4I 4DJMA 5IV2B 1OTUD 5D2LB 2UUDK 2HVJB 2X1OA 4H0GA 4HWNA 5HYFA 1CDBA 3FT2B 1RJYB 1DL7H 2O61A 5JHLL 4JO2H 3EJYD 3ARDB 4NDMB 4ELKB 5KG9B 3SDCD 4HJ0D 1FNLA 3EYFA 1H8SA 2YUZA 1LDSA 2B0SH 2WANA 3CMGA 1JNJA 5HGBA 4TQEH 1FL6A 5HDLA 4KROC 1FVDA 1K9TA 1GC1H 2XV6B 4YBLC 2R1YA 2AJVL 3CFKA 2VYRE 2X6MA 2FIKA 3BZFB 4HZLA 4Y1AD 5TE4H 5FYJL 1DQJB 4G8FB 2XQBL 4ZNCD 5EZIH 2AGJL 4S1QL 1DQTA 4RWYL 2APTA 2PTUA 3LS4H 3UJTL 2R4SH 4KDVA 5C0BE 4EN3B 3QUXC 4JFYA 3O3EB 1AGFA 5GSRB 2VQ1B 4Y19D 1ORQB 1S3KL 1WAAF 4HLJA 4IIQC 4Q58C 3RZCC 1MF2L 1OWRM 3G04A 1CIDA 1NSNL 1GOFA 3LHPH 3AS1A 5K9QG 3C5ZA 2X1XR 4LARL 4PYHA 4OZHB 1NDMA 4L5FH 5D7JD 5KSAD 3MXVH 1I9RL 4HPYL 1MFDL 4CMHC 1X7QB 2DD8H 5IHZB 2CKNA 5HGAB 3ZTJH 5ISZB 2EO1A 2NY5H 3QPQC 2BJMH 3WIIL 3WMSA 1FGNL 5EWIL 4HGWB 4PGZA 3GO1H 3MLZL 3IXAB 2HLAA 4Y16D 3GHBL 5K9JH 1FVEA 4UNVA 4XPHH 4JN1L 4PJ7B 1A7NL 3HPJB 4X6DF 3RDTB 1FO0H 3PP3K 5C70A 1JYNA 2PO6D 3VXPA 5CBEB 3DETD 1QPXA 4HIJB 3EDJA 1UWGL 1FAIH 1CGXA 3DROA 2WBJA 4R4FL 2NXYB 2DQFB 1OP3K 3MGOB 1H0DA 4H20L 4LIQL 2P42B 4Z7WA 4LNRA 5E5MB 1JGUH 1FNSH 4ISVA 1NCWL 5DJZB 3VFPA 2DQDH 5I15L 3F6IA 3U0PA 4JKPL 3OX8B 1NFIA 3FQTA 1CFBA 2XNAA 3D0VB 2IAND 3PJSB 4HWEH 2LE9A 4JFZH 2IPTH 1H3VA 3UTSA 4BQBA 3CVHL 1OB1A 1A1MB 4HKZA 5CSGA 3JTTB 4X4XB 1YJDL 3BIKA 3C8HA 4GW1B 4CKVX 3MNZA 4L4VD 3TT1L 4HAGA 5EU4A 3SO5A 2XOTA 3E0GA 2X70B 2DL9A 2QQNL 1AI1H 2WW8A 5JR1L 4JFDB 3UZVB 5C0AE 3V0WL 1XGYL 4M9OA 4OIIH 5ALBL 1BQLH 4K8RD 5GZOC 3K4ZA 1IRAY 2I9LA 4X99B 2M2DA 5B21A 5DUMH 5CIPB 5AAMA 2CLRA 1OPGL 5E03A 5I17B 3SDYL 1DUYB 1TVHB 3L3IB 4XNQA 4NWUH 4DGVH 5BZDA 4MSWB 3BQUB 4GBXD 4MB3A 1OAYH 3O45A 2FJHA 1J0YA 4X6CB 2V7HB 2NY1D 5JQ6L 3QEUB 1BIIA 4KI5F 4OZGA 2HFEB 1G9MC 3KLHD 3ARSA 3S88L 3U7WL 1J1PL 5CWSA 5KZCD 2P8PB 3BESR 3MR9B 4CU7A 2QTEA 5FUCE 1EH9A 3D9AL 5EBWB 3WNNA 5INCB 1XFPA 5DVKA 2ICWB 4WY7L 4WHTA 1IFHL 1KIPB 4UT7H 3JTSB 4PS4L 5DT1H 5C0BA 3HC4L 1FZMB 1KBGL 3C60B 4ZTPL 4ZAKD 1KCRH 5CUSH 4JFEE 3U4AA 1NLDL 4OIBA 1D3CA 3QXAB 1A4KB 2ZUVA 3SJVA 1EVUA 1U8MA 1DBJH 5F1KC 4PG9A 4BM7A 3I75A 1GPOL 1JPFA 5E8PA 4MDJA 3QCUL 1INDL 2RB8A 4HFUL 5JORB 4QTHA 4ZQKB 1P7QD 3STZB 3HE7B 3GEWB 2H32H 2OK0H 1TVDA 1Z3GL 3VH8G 1AGCB 3D48R 5DS8A 4Z7WF 5EUOE 3P30H 4JVUA 4NUJB 1VFUA 3B83A 5FKAB 4GRWE 2DLEA 4HUMB 2VXQH 5GXBB 4WW2B 2E7BA 4BQ9A 3ULVH 1P6FA 3PWPB 3CC5A 3SCMB 1UJ3C 4ZUUA 5FB8B 1HDMA 3ETBF 2YXFA 5JPNB 1KUMA 2KQNA 2HFGH 4OKDA 2Z4QB 1N7MH 4HQQL 2I24N 2J88L 3TVMC 1J8KA 3LKPB 1NC2B 1LEGB 3B9AA 2RCSL 3QYCA 3V6ZA 3U7YL 4UNTA 3LN5A 5JOEA 3DXAD 4LKCA 4PP2A 3G5XB 4JG1L 5F7HA 2XG5A 1G7QA 4P48A 1Q0YL 4ZFOL 4K2UL 1N5YH 4L8CA 3VWKC 1LHZA 4WDIA 5EIQA 2Q87A 5IMOA 3S5LA 2E9IA 2YN5A 3PWJB 4K55A 4ONGL 5I73B 3PIQA 4QHUB 1RUPL 4N0YL 4M3KB 4PLNC 1K4DB 5LGKA 3QULB 1GGIH 4OZGF 1QBLL 1S9WA 2EYRB 5B8CB 1FYTE 2VDNH 1DQDL 4CW1B 1NUNB 1OCWH 4IEFB 5I1IH 5C0AA 1V7MH 4RAUB 5I1EH 3GSNL 1N6QH 3OV6A 1CD8A 1GHFH 2X4TB 3VMPA 4U1LB 3BI9X 4L4TD 2CLZB 1S7QA 2FR4A 4ZODA 1UWXK 3NIDE 1JTTA 5JO5A 1MI5B 1CI5A 3VD7A 1MHPL 4MD0B 5E1HB 1IEAA 5ADOH 4HJJH 3OZ9L 1XIWC 4QXGL 5DFWH 2D7TL 3AY4A 4WGWB 2Z91A 3O3DB 3LY6A 1QFUL 4RDQG 4RGNC 4P4RA 1CGWA 2CR3A 3OL2A 5ANMB 5BS0B 3ARQA 1Y6MR 2NY7L 3ZTNL 1UZ8B 2DQHH 1QQDB 2VLKB 3AREA 3QDGB 4JPWH 4HUXA 1YEGL 3M8OL 5D2NA 4QNPE 2PUQT 4NJ9L 5MEQB 2BY2A 3LKSB 3IDMA 4JFEA 1P4LA 4XRCA 5DMGD 3L3OA 4K23L 1G7IB 1C12A 2G2RB 4HX1B 3OR6A 2Q1EA 2FEDC 3U1SL 3VRJB 4GXUM 5CHNA 3G5ZA 5A2KH 3TBTA 4M7ZC 3ZKMC 4HT1L 5GRJH 1FE8H 3KYKH 4QRPA 3X3GL 4CU6A 4XZUB 5D6DC 3E6HA 4KHXH 5EUOA 3DX9A 4ZFOA 4PLOB 1P7HL 4PJ9A 1NFDF 5F6HJ 1S7XB 4UQ3B 2FECL 5EDXA 3VRIA 3MA9H 5GRWA 5JHLH 4NFCA 5DTFB 4KKCD 3MBXL 4RFEA 5AG9A 4RNRA 1NGWA 5IIEB 1C08A 3LKOB 3MV7E 1N2RA 4R2GC 4OZIA 3TIDA 4OQTL 5C0JB 5D70L 3RI5K 1CVRA 3GIVB 2IAMB 4ZFFB 3RIAF 1M7IA 2AJVH 3QQ4A 3TT3L 1SQ2N 4F80A 5JMRA 5MERA 4ZXBB 2FWOB 3T04D 5FYJH 5IB2A 4OF5A 1D9KC 2JIXB 4IRJD 1LO2L 3BRFA 1LD9B 3BD4A 4NRXB 4YK4C 4I18B 1MCIA 4LPCA 4P23D 4HIHA 3UJTH 5FA4A 3BZ4B 5BO1L 3D69B 5C8JA 1BAFH 1GOHA 1R24A 5F6HI 1T22B 1UB5B 2DM4A 2GY7B 3DVNB 3HAEB 1U2CA 3CSGA 1S3KH 5LJYH 2NLJB 1HSAB 1FYTA 3TA3D 2R0KL 1NSNH 4PJ8D 2BMKB 5HPMB 5FO7B 4LARH 1KYOJ 2PW2A 5H2BA 1GJIA 2GSIB 1I9RH 2MQ3A 5AD0A 15C8L 1L4IA 2QKIA 5D96B 1MCOL 3WIIH 4YDIL 2EIZA 1FGNH 2A6JB 5EWIH 1MCQA 5IBTL 3MLZH 5B38A 4OI9A 1IZKA 1A1OB 5IVXB 3EFFB 3LKQB 3Q6FA 4LSDA 2FL5A 4MAYA 5BRZE 5EO1A 3KJ4B 4JN1H 3TPUB 1A7NH 3IFLH 3HI5L 3ARUA 4JREC 5HTSA 3SDAD 1P53A 1BEYL 3IJSA 5I66A 3JV6B 1UWGH 1HQ4A 1FNGB 4R4FH 5EUOF 1G6VK 1YYML 4LIQH 3O2DL 5DA0B 1K8IB 4GRWF 3V5DA 1MH5B 1WLHA 4IDJL 1NCWH 5LGHL 1OL0A 5I15H 2YKLL 4JKPH 5FO8A 1OP5K 5B22A 4OQTA 4XMKH 1J12A 3MRGB 1DANT 4OZIF 4JHAL 3D39D 4P9HL 4UIMB 3CVHH 2XTJC 4P46D 2GTZB 1NAKL 5D7IE 4PRPD 2CIIA 2DIJA 4OF7A 3N1MC 2ADGA 5GRYA 2QQNH 3AM8C 4KRPC 1A7BA 1RUQL 5CZXD 5C86A 5JR1H 1FHGA 1T0PB 3SGKA 4P2CG 4EI5C 3QG7L 3V0WH 2FZ3A 1XGYH 5ALBH 1GAFL 1U93A 1IGCL 3OKOB 2BVQA 1MLBB 3MV7A 1OPGH 2WINB 3SDYH 2GT9B 4C4KO 1A64A 4NC1C 4KTDL 1SEBA 1T04A 1FN4A 2QSQA 5LGJA 2KZ1B 2P45B 4I9WE 4KMLB 2Y72A 4NKOA 1DUZA 3OKMB 4LVEA 5FGCB 5FAAA 3S5LG 3DTXB 3S88H 1J1PH 3RKDC 5D8JL 2OR9L 5F9JB 4I13B 3VFRB 4G9FD 3RNQB 1PY9A 3VGGA 1S9VA 1T21A 3DRQB 4HW6A 1JPSL 2PCPB 4WY7H 3ESVF 1IFHH 4XP6L 1L6XA 1SBSL 3QXDA 4IM8A 4LLUA 3NIDF 1VFAA 2I07B 1HYSD 1JK8A 2AV1A 1AIFB 3R1GL 4DEPC 4PS4H 1B90A 2AK1L 2XWTA 3HC4H 4JJ5B 5DK0A 4KK8D 4M61A 1DEDA 5F89B 7FABL 3ARDD 4ZTPH 1A02N 1SHMA 3MBEC 4Y0GA 1NLDH 1QO3B 3U30B 4PJAE 4NFBA 1Z2KA 4KMQA 3P4OB 1GPOH 1SJHA 3QCUH 3IKCB 1INDH 3O2DA 4HK0B 2YA0A 1I1AA 4HFUH 2E3VA 4MNHB 1BZ7A 3VGDA 4NPYB 3R4DA 3WS6A 4BH7A 1RU9L 1Z3GH 4R7DA 3PV6B 2ICEB 5JOFA 3QJHA 2HJKB 3O6FB 2ZUWA 5TDPA 2E9WA 4K3EL 4OF0A 1XF1A 1Y0LA 4PJGB 2QADC 4G8GD 1IM3B 1OGAD 3H0TA 5BRZA 5KN5A 4HV8B 1A47A 3CMOL 1PQZB 2KQMA 4JKLA 4CMMB 5JNYA 4ELMF 1W72A 1S9KC 3BW9A 2E27L 4QOKE 1LILA 1I1FA 4OSUL 5EIVA 4HQQH 1NMAL 2R1WB 2J88H 2R2EA 2L7JA 4PY7B 5E8EB 2UV3A 1H8OA 1RZIA 2RCSH 3TYFA 5DI8A 3U7YH 1H3TA 2G5BB 1I3RA 2NY6D 4JPIB 4WI3A 2XWJB 2CQVA 3ILQC 4NT6A 4K2UH 4DN4L 1ETZA 1EUUA 1A7PL 4QRRE 5IB3B 3QIBC 3MUJA 4ONGH 5E5UB 5IQ7L 1RUPH 2ZPKL 3OF6A 1QP1A 3FQWB 1YMMD 4ZSOA 3FJTA 2C3XA 5J1SC 3V9FA 5SWSE 1DVFC 1QBLH 1T89C 1FV1B 1RK1A 2XN9D 2FHBA 3JV4B 5CZVL 2XTLA 2VUYA 4RQQA 1DQDH 2EE9A 4S1DC 5A16B 5IHBA 5MEND 5CJOL 5H35A 3GSNH 1HHKB 1KEML 2BNRA 3WFHB 5D7SL 3AXLA 1JPGB 4P4KD 5HDBE 2HRLA 43C9B 3TIEA 3BT2L 1ROWA 2A74B 3IDIA 4IIQA 3D3VE 3RZCA 5IFHH 4D9RE 3L5WA 2GJZA 3AC0A 2YUXA 5ID0A 1U8PA 4Q0XL 3ROLB 3VH8B 1MHPH 4LPWA 2BSTB 1G9ML 2GFBA 3OZ9H 5JMOC 2D7TH 1HXYA 3TNNA 1FQ9C 2FJFB 2CK2A 3UO1L 3W39A 1G7JB 3FO2B 4N68A 4OCWL 2DL2A 1QFUH 3CXHK 4OGAD 5DYOA 1T66C 3FN3A 2HVKB 4I3RL 4PGCA 3DMMB 1SJEA 3C6SB 1TQCB 1ZXQA 4FXLA 4V2CB 5F1IA 2NY7H 2VZ3A 3ZTNH 2Y23A 2VDQL 2CRMA 3SPVA 2ERJC 3RVVC 3LDBB 5DEFA 1YEGH 3CU7A 3M8OH 1D5MB 3C5JA 4NJ9H 4YHIA 4X6DB 4M3JA 1UWEL 4K23H 4PJAA 1Z0MA 3QIUD 4WHYG 2V9RA 3U1SH 4HWBL 4NNXA 5INDB 4OUUB 2ID5A 3BDBA 1RJZB 5B38G 1HHHB 2XRAL 2OMNA 5KSUB 1KTKE 1T5WA 3VI4E 4HT1H 4TRPL 3X3GH 1NGPH 2WIIA 35C8H 2O61B 1RD6A 1H3WM 2AEWA 4ZTOL 3ES6A 3ZT5A 3EYFB 4F37F 1VPOL 3MV8E 5HGBB 5C0CE 1QR1A 3A0OA 4R96A 5IWLC 1FL6B 4JRWA 4XNYH 1FVDB 3ZHDA 2P5ED 4QOKA 5C09E 5ERWA 2R1YB 1IAOB 2ZNXA 3CFKB 4OQTH 1S5IL 2O26U 5D70H 2FIKB 4HZLB 3JVGC 4IMKC 4U1MA 3RAJL 3TV3L 3TT3H 2EDQA 1CICD 4RRPG 4HSQA 4NO5A 3HE7D 4S2SA 4NO0D 5DA4A 1S7UA 4WTXA 3BPOC 3SE3C 5DC0A 2GIYA 1LO2H 3RU8L 4FABL 4JFYB 4HMDA 4LASL 4F3FB 3MV9E 2DM2A 1MNUL 1AGFB 2AVGA 1G6RL 4RGNE 1SMOA 2CRIA 3CNKA 3VGEA 5BO1H 3G04B 4NJAL 3HNSH 4D9QD 5SWSA 3C5ZB 2ZCLL 2FRGP 1NDMB 4U1KA 3U0TA 3N1PC 1G0XA 2R0KH 1AH1A 1G7HA 2NXZC 4XH2A 4XMPL 2HG5A 3QQ3A 2HLAB 4YHPA 3RL2A 15C8H 4OFIA 5M95B 1MCOH 4YDIH 3WDIA 1FVEB 3T1FA 5IBTH 3Q48A 1QFWM 4PJAF 3VXPB 2ZUUA 2CUMA 5CD3B 2QEJA 4AT6A 2WBJB 1F11A 5LVEA 4JY4B 1O0VA 4Z7WB 4LNRB 1BEYH 4P49A 3BXNA 3X3FL 3MJ8A 4C83A 3DRTA 4G7VL 4ISVB 1CDCA 2HAZA 3U0PB 1UJ3A 3EIFA 1Z5LB 1AC6A 1YYMH 4QXWA 1NFIB 3FQTB 3O2DH 2UYLA 2XNAB 4IDJH 5LGHH 1CU4L 3TVMA 2YKLH 3UJJH 5J89A 1JZ4A 3N1FC 3UTSB 1OB1B 5K9KB 4HKZB 3BIKB 4NGHH 3KVQA 5EU4B 4E0RA 4LVNC 4P9HH 4JM4L 2QQQA 5IF0A 1NAKH 3CDYA 4W6WB 4LCWE 1OTUC 3VWKA 4JVPA 4LFHD 3MV01 1A7RL 2NY4B 4U7SA 2I9LB 4WV1C 1RUQH 4XTRC 3B4NA 2CLRB 4WTZA 5DK2A 3QG7H 3MV8A 1G6RA 3EJYC 3QDME 4HG4J 3ZYIA 1IGCH 4XNQB 5C0CA 1YDPA 4P9MH 4HJ0C 5BZDB 2MKWA 2DQGL 4OJFH 2IH1A 3O45B 2FJHB 1LK2A 4OAWA 1BIIB 4OZGB 4B5EA 4UB0L 5TF0A 5CWSB 1DN2A 5HDQH 5M94B 1OWWA 4WHTB 5SWZD 2Y6SC 3F7PC 4QWWD 5C9KA 4POZD 1U3HB 1JPSH 4P3CL 5C0BB 1MELA 1XIWA 1GRWA 3GMLA 2RQ8A 1SBSH 3MV9A 2QLVB 3R1GH 5FYKE 3I50L 4QT5A 2AK1H 3SJVB 1U8MB 2GITA 4PRHE 7FABH 1AO7E 3MLTA 4PG9B 3I75B 5E8PB 1JPFB 4FQQA 4MDJB 4QTHB 4FS0A 1QSFA 3QSKB 2DI9A 4PPTA 5DS8B 2AW2A 5KSAC 5FYLE 2GUOA 2H26A 1Y18A 3K1DA 1ADQA 5TF1L 1RU9H 4QGTA 4WFED 2IGFL 5CILL 1ZVHA 3R8QA 4OI7A 3CC5B 2A2QT 1M7DA 2CJUL 4ZUUB 5KSBE 4DOHE 3ULUL 2XTJE 4J2XA 4K3EH 1HDMB 5F7YC 4Q9BA 3OXSA 1R0AL 4LLQA 5D6DA 4RFNC 5FYKL 4FQXC 2P7TA 4ONFL 3BP7A 4QYOA 3RA7L 3CMOH 2PO6C 3TP4A 3BIBX 2XIDA 3DETC 3V6ZB 4OSUH 1CE6A 5J1AA 1NMAH 4GXVL 1BQHG 1ZLWH 4LKCB 1QEWA 4PP2B 3VMNA 4X4ME 1NCCH 1G7QB 2IG2L 2ZUYA 1Z9SA 4RSVA 4L8CB 4WDIB 2DRUA 1R5IA 3RVXD 3S5LB 5IMOB 3W9DA 4NC1E 3U36A 3WDHA 2ZWLT 1YY9D 2VLMD 3PIQB 1MHEA 4DN4H 5IJVA 4S1RH 5KVDL 4QXUL 1A7PH 4I77L 4DGIL 5MHSE 1CL7L 5FEBA 1N8ZA 4ZG1A 5IQ7H 1S9WB 2ZPKH 4L1HA 2EDHA 4JHBA 2OS7A 1D9KA 4OGYL 4LCWA 2LV4A 1DQLL 5C0AB 1JV5A 2BNQD 5CZVH 1QTYT 3PHOA 4FQIL 5CJOH 1S7QB 2FR4B 1QA9A 1XMWA 2E9BA 1KEMH 5C0FA 5D7SH 3BYTA 5LQBL 2DMKA 2XACC 3BT2H 1MFEL 1IEAB 2F5BL 4GBXC 2VC2L 2Z91B 2XXMB 4Q0XH 4MA1C 2NY1C 1G9MH 4P4RB 1KIRA 3O6LL 4Z7VF 3RY4A 3KLHC 1ZTXL 2X4SA 4XB8A 3UO1H 4OCWH 4WU7A 3AREB 4I3RH 3BKYL 4HUXB 4XNUL 4OLZL 5D2NB 3RWDA 3IDMB 4JFEB 1P4LB 4XRCB 3L3OB 1C12B 1NANH 3OR6B 5C07E 4HKBB 4ZAKC 1AO7A 5CHNB 3G5ZB 3NFPA 3WKML 5ICZA 2WWMD 1UWEH 3TBTB 3HZMA 4UU9A 4LSVL 4JKKA 5T3ZE 4HWBH 4R0LC 1CFNA 3DV6A 5EUOB 2HN7A 3DX9B 1X5GA 3TO4C 4I0PC 4TRPH 4PJ9B 3QUML 3V2AR 4NN5B 4GRWB 1OY3B 4HZAA 3VRIB 1MCWW 4Y5XC 3EBAA 1OQXA 4BJLA 1I7ZA 2UVEA 2X1WL 4EVNA 4LSQL 4JHWL 4RFEB 5KSBA 1YC8A 4RNRB 3CFIC 4CADA 1NGWB 4ZTOH 4U4BA 1C08B 5CJ8A 4C54A 1DFBL 4M5YL 3T77A 1N2RB 2AJUL 4OZIB 1BQUA 1NC4D 4XP4L 5ADPL 1VPOH 3TIDB 3ELAT 5FYJU 3IDNB 3BWAA 3AM8A 4X7CC 2JJUA 3GM0A 2ZG2A 1M7IB 3QQ4B 4EI5A 1S5IH 5MERB 1L9MA 3LRGA 1MCEA 2WWKT 1F02I 3MRBA 2PXYA 3CD4A 4X4MA 3V8OA 4BFBD 1U8NA 5IB2B 3RAJH 4F8TA 3TV3H 5HY9A 4NC0B 2NQCA 4IHOA 1T7XA 4HBQA 4Q9QL 3WFCL 3UAJD 5KSVA 4Y88A 1VENA 1UM6L 4ZS6D 4HIHB 5DVNA 5FA4B 3IAGC 3RU8H 1R24B 4FABH 5DGQA 4LASH 4P99A 2X7LB 3BRDA 1MNUH 4TVPL 1G6RH 4G7YL 4QGYA 1FYTB 2HH0L 1XAUA 4MNQE 4XNMA 2JK5A 5DF0A 1GVIA 2AQ2A 1HKLH 5H2BB 3ZDZF 5KVEL 3HR6A 3N1GC 1TLKA 4M1DL 1YC7A 2DM7A 3ZKSD 3HNTL 5AD0B 1V5JA 2QKIB 3ULUF 4PJDE 1YUHA 5F3BA 4XMPH 2EIZB 4QRTA 3MBEA 1AFVL 5B38B 3RIAK 2VTFA 4HGKC 3FT4B 2FL5B 4MAYB 3VDCA 1UXSA 3Q6GL 4LLYA 4GMSL 3IKKA 4I48A 4JQXC 3DWTA 4OLYL 3SQOL 1FVCA 3IJSB 5I66B 5A2IH 2VXVL 1HQ4B 3A67L 4B41A 4G6JH 2BVPA 3BPNB 4KVNH 3V5DB 3EGSA 4G7VH 1NBQA 1BFOA 4LCUA 1FZOA 5FO8B 3EOAA 5KSBF 2VDPL 5C07A 3TZVD 1CU4H 2CUHA 2OP4L 2VNCA 4XNXL 1NAML 1BWMA 2LAGB 2D7NA 4KY1L 2B5IC 2CIIB 3QRFM 1S7WA 2ADGB 5GS0D 2LFGA 1D5BA 4G6KL 3WBDA 1IT9L 2FZ3B 1NCUA 1A7RH 1U93B 3ULVD 3M17A 4OZFH 3MV7B 4WIQA 1ZA3A 2VLRD 1AC0A 4R3SA 4KKCC 4YFLF 2ZUQB 4ODTL 3PDGA 5FFLA 1DVFA 1T89A 3MUY1 1SEBB 1T04B 1FN4B 5LGJB 2DQGH 2F54E 4L8DA 4NKOB 1DUZB 3R0MA 4GKZA 1UC6A 1X5JA 3CVIL 1CLOH 3BYYA 5DURB 3WO4B 4L3EE 1S9VB 1T21B 3PP4L 4I8DA 5C0DA 5L0QB 4LLUB 3ZDXE 1VFAB 1JK8B 2AV1B 4U1IA 4IRJC 2AKRA 4P3CH 1AKJD 4M61B 4F58H 4J1UB 4P23C 2BY3A 5LBSL 5L7XL 3L5HA 4D94A 4GRLB 1BREA 4RGMB 3I50H 3P0YL 4YDLB 4MNQA 3G6JE 2GK0B 1Z9MA 4OKVA 3J7HA 1IAIL 3H9SE 1I1AB 3TA3C 4OFDA 1BZ7B 4HXBL 4NRZB 1M05B 4PJ8C 5EOTA 3T2QA 3F12B 3MRRA 4BH7B 1NCDL 1DBAL 1YEKL 4R7DB 5HHOA 2EICA 4NSKA 3GMMA 1YEHH 4PJDA 5JOFB 3QJHB 1TITA 5TDPB 5TF1H 1WQVT 3NIGE 4LPUA 4YHOH 4OFPA 2IGFH 5EU5A 1Y0LB 2A6IA 2VLJE 5CILH 2OZ4L 1FPTL 5BRZB 4XCNA 4BFEA 1IZJA 5KN5B 3P9MB 2CJUH 1U36A 5J6GA 3G5YB 3ULUH 3NZ8A 3W9EA 2XQYK 1OF2A 5JNYB 1R0AH 1W72B 5F7NC 3BW9B 3MRHA 3EYOB 1I1FB 2R2EB 2VISA 4U49A 3RA7H 3QUYC 1N5AA 1RZIB 1CFSA 1QR4A 3TYFB 3SDAC 5DI8B 4RMWA 5EC2A 3TBSA 1LO4L 3TNMA 4GXVH 5EZOL 3FAXA 1IJ9A 1I3RB 5GGSY 3SEPA 3WJLC 1M6OA 4YHZL 2GSGA 4XXDB 5IWLA 1LEIA 3RKPA 2IG2H 1MJ8L 1FCGA 1P2CA 4KROB 2EDWA 2FH8A 4NT6B 3FFDA 4L1DA 1ETZB 5TQ2L 4YBLB 5IBUB 2XPGA 4K7PL 3RBGA 1EGJA 3RY6C 4WUUD 3JVGA 3T08A 4IMKA 2NR6D 4Y8DC 2VDOL 5IB4A 5KVDH 3LSOA 2VB5A 4QXUH 4C58B 3VXRA 1A3RL 4I77H 4Y1AE 4DGIH 1CL7H 1RK1B 5GGTA 5D5MA 5T3XE 1EK3A 3RUGF 4RQQB 1C5BL 5D71L 3FO1A 1HILA 1KT2A 4OGYH 3SE3A 1DQLH 1UM4L 4W70A 5H35B 4RWHA 4Z8FL 2BNRB 4XAWL 3AU1A 5CZXC 1A6TA 4IJ3C 4GW5A 4ORGA 3AXLB 1QVOA 5HGHA 3TIEB 2OR7A 3DX6A 1FGVL 4FQIH 4IIQB 3RZCB 3L5WB 3WD5L 2GJZB 4BFGA 3PG2A 1U8PB 4Y19E 4KC3B 5D6CA 2VZTA 2F54A 2NX5D 3IRPX 2F5BH 4AIOA 4P2OD 4XVJL 1HXYB 3TNNB 5D9SA 3W39B 3F58H 5ID1A 4D9LH 4L3EA 2YD4A 1J8HA 5DYOB 4IS6A 3O6LH 4PGCB 1SJEB 2J12B 5FYJD 4YO0A 5F1IB 4AEFA 4CVXA 3OB0H 4CBPA 1T7ZA 2JJVA 4LEXL 3SPVB 1FRGL 3BKYH 4PJDF 1XGTA 1ZKAA 5DEFB 4XNUH 4OLZH 2DDQL 4U0QB 1UEYA 1H3XA 3HHRB 3JWDC 3C5JB 2I26N 1UM5L 4PREA 1HYSC 4YHIB 1NCAL 2X9YA 3AB0C 2C3WA 1IGTA 4PJAB 3GRWL 4KK8C 1J05A 3G6JA 3MFGB 3LB6D 4NNXB 1UCBL 3IXTA 5BQ7A 4XAKE 3WKMH 4YAQA 4OCNC 3H9SA 4Z18A 2A73A 2H3NA 1CTOA 2ZSWA 4H26A 1T5WB 4LSVH 4M7JL 4KJQD 2WIIB 2EDLA 3FTGA 5F6IC 3BE1L 4O02L 5ELIA 1B0GA 3QUMH 1OM3L 3ES6B 2FHFA 2IANE 1CDYA 1P69B 1N26A 2Z8WC 1W8OA 2FEEI 3VFNA 1DBKL 4LHJB 1T2XA 4LSQH 4JHWH 4AYFA 1T7VA 1QR1B 4R96B 4F7CA 4S11A 1DFBH 4M5YH 4O4YL 4CUCA 2AJUH 4L4VE 5J0BA 4RISL 4QOKB 4XP4H 5ADPH 5ERWB 5C6PB 1TNNA 4NKMA 1KC5L 2EEDA 4WV1A 3TYGL 4JCLA 4U1MB 4TVSa 3ESUF 2PKDA 2ZG1A 5D5MF 5IBLD 2A9ML 3DX7A 4JQIL 3VFOA 3SDCA 2AXHA 4KMTH 1T0MA 4NO5B 1CDUA 5J56B 4S2SB 3FRUA 4OLEA 4G5ZL 1X5KA 1S7UB 2NY6C 4PRDA 4N8PA 4Q9QH 3WFCH 2VE6A 5E4EC 4JVWA 1NBZA 4LBEA 1K3IA 4L29A 5CEZL 4L4JA 5SWSB 1U2HA 1PX3A 1WICA 4N0FA 4TVPH 4G7YH 4U1KB 2HH0H 3MJGX 4F37K 1G7HB 2ITCA 1EJ6A 3DGCR 3NN8A 4XH2B 3H2WA 5KVEH 4UDUA 2HG5B 3QQ3B 4M1DH 3OJMB 4YHPB 4DGYL 3HNTH 3RL2B 2PR4H 5FHAL 3W11D 2FATL 4P4KC 1D5IL 4Y19A 5J11C 3SKMA 3T1FB 5I6XB 1AFVH 3B9VA 5HVGB 3B2VL 1QFOA 1JRHI 1RSFA 2O5ZL 3QISA 1J18A 3KPOA 4ZOCA 5KSAA 3G6JF 1MQKL 3QPXL 3O4LD 2JCCE 3Q6GH 1A8JH 4GMSH 2YD1A 2VITA 4AT6B 4E5XA 1XGRA 1F11B 4OLYH 1EHAA 3SQOH 4U6VL 1YQVL 3BXNB 4OGAC 2VXVH 3MJ8B 5EIIB 1FC2D 4C83B 3BH8A 1UJ3B 3A67H 4X98A 4Y16A 3S36H 2UYLB 3OJ2C 1EBPA 3ZT6A 4QTIL 4H88L 3OKNA 4FQXA 3TVMB 3S8WA 1HKFA 4YLQT 2C9AA 3EO1A 2OMBA 2VDPH 2PO6A 4GAJL 3RWGA 4E0RB 2OP4H 3QIUC 1EO5A 1L0YA 4XNXH 1NAMH 4DKDC 4YGVA 5IF0B 4KY1H 3VWKB 3WLWD 3EYSL 2DB8A 4QLRA 2IANA 4G6KH 3ZYZA 1IT9H 5DK2B 1HI6A 1ZLWK 3MV8B 1G6RB 5C92A 1BJMA 5C0CB 1YDPB 3B9DA 1W2KT 1MRDL 3S4SA 3QHZL 4L4VA 3VCLB 3QXTA 4ZNEE 1LK2B 4MMXC 3LZFL 5C09B 5K9OA 4OAWB 2WUBL 4ODTH 1D5XA 2UZIH 4XCEA 4BZ2H 5I1KL 1JGDB 3DI2B 3KYAA 1F2QA 3CDGA 1MIML 1I9JL 1SVZA 3AFLA 3CVIH 4IMLA 1W8NA 4L4TE 4QRPD 1CICC 4P2RE 4K9EC 2L7UA 3GJFB 3PP4H 3D6GA 1XIWB 3H9ZA 1DLFH 3KPLB 4GBXA 3GMLB 3S36X 4NQDE 5A2JH 3MV9B 3SGJC 1BD2D 4RGNB 5T33L 1GCFA 4RGOL 4OD2A 4QT5B 1MCRA 4G6FB 2GITB 3CH1A 4E41E 3MLTB 5EU3A 4Z6AT 5L7XH 4FQQB 2R2CA 4OV6F 5EU7E 4POUB 3P0YH 4KV5F 4XC1L 5GPRA 1QSFB 2Y06L 4MYWB 1GZPA 2AERT 3O41A 2GUOB 4M8QA 2H26B 1Y18B 2R0WL 3IT8D 4HXBH 3MRKA 1LP9E 4P2QE 1S7VA 1YNKL 1NCDH 1A14L 5B3JE 1DBAH 3QAZC 1CDIA 1YEKH 4Q74A 1Q9OA 1ZE3C 4ZAKA 1KJVB 5DHYB 1CCZA 4TNVF 1H3PL 4V1DD 4M7ZB 4BSWB 3L7EA 4AY0A 3QEHA 4CAGA 1VGKA 1UJTA 4LLQB 2OZ4H 4R0LA 4YZFF 1DEEA 3MACL 2JCCA 1FIEA 5D72L 3BP7B 4QYOB 1TQBC 2XZQH 1WFTA 4I0PA 3D18A 3MGTA 2MJWA 2EYSA 1CE6B 5J1AB 4Y5XA 5JW5A 1QEWB 1AR1C 4G8IB 4MWFA 1N64L 1ITBB 3NTCH 4R2GB 2YPVL 1LO4H 5EZOH 4NM4L 2DQJL 4YHZH 1R5IB 5DEGA 3W9DB 3U36B 2BOBA 3IDYC 1MJ8H 3V52H 3W0WA 1I8KA 3DURA 2CPCA 5IJVB 1JP5A 5TQ2H 4K7PH 3TJHD 2BVOA 2FCBA 3CIQA 4WFHD 1ZSDA 2W38A 4AEHL 1N8ZB 3KLAA 3OKYA 4NHCL 1QLFA 1VSCA 2ED7A 4XPFL 43CAA 4DUVA 3DXAA 1D9KB 4LCWB 1A3RH 1JV5B 1AXIB 4YK4B 2KKQA 5FCSH 3RX8A 3PHOB 1C5BH 2F15A 5D71H 4DQOL 4KVCL 1QA9B 5C0FB 4Z8FH 4XAWH 3QDMB 1P4BL 3ALWA 1R3KA 2W65A 1QHPA 1I85C 3I6LE 3V6OC 4OCXL 4DWHA 3VXNA 1EBAA 1WBZA 5DD6A 4LDLB 1MHHA 4N0UE 3WD5H 4LHQB 1PG7L 2XA3A 1A6VL 3HRZA 1FLRL 3WV0A 3F7VA 1V3MA 1KIRB 4XVJH 4FTVE 2X4SB 1NMCC 1TMCB 1BGXH 3VFSA 1QFHA 4G8EA 4WU7B 4L4TA 2XI9A 1B88A 2FIRT 3O8XD 3O6ML 1BMGA 1NKOA 3P2TA 4NBYB 2AJSL 4QWWC 4F33B 5DRWB 4POZC 3GSRA 3RWDB 4LEXH 1FRGH 4JQXA 2FX9L 3ZE2F 5JW3L 4U6TA 1FFQA 1WBYA 2DDQH 4JREB 1EEUA 4PRHB 2W0PA 1YEEL 4R97B 1AO7B 1UM5H 3ZKNC 3NFPB 4PY8J 2BOCA 5ICZB 1NCAH 3HZMB 3K1KC 2JCCF 4K7PX 4UU9B 2BRRL 3GRWH 4NQCA 5GGSA 2D7OA 1UCBH 4OT1L 3WFBL 1CFNB 3DV6B 4XVUD 2HN7B 1QRND 2IQ9H 4GAGL 4M7JH 5EU6A 1U3YA 3FFCD 1OTTC 3QFJD 3CX5K 2WWKO 3QJFA 3VFWA 1I7ZB 4KDWA 5L88L 3JV5A 3B5GA 3BE1H 4EVNB 4O02H 5KSBB 4DOHB 4CADB 2XTJB 1OM3H 4QHMA 4YIQB 1SYVA 3T77B 4Z0XA 3H7LA 1EFXD 1DBKH 1ODAA 3C6LD 1MIEH 2BSED 4YWGL 3D39E 3BWAB 1PSKL 4YNYA 4KRPB 4O4YH 2MTPA 1JYXA 3DBXA 2I27N 3MREA 5JIHA 4RISH 1WFOA 3C9NA 5LCVH 1KC5H 3EO0A 3MRBB 5TFSH 2PXYB 4UDTA 3STBA 6FABL 4YE4L 3TYGH 1U8NB 3C87A 1AQKL 2ADFL 4TTDC 5E7FA 1ZMYA 5HY9B 3UZQA 2A9MH 4JQIH 5BV7C 5E00A 1V7NL 4XVSL 5KSVB 1CGUA 2LVEA 2PETA 4G5ZH 4P5TD 1E28A 3BGFC 3NIFF 5KANI 3RVXC 5AAWA 3TC9A 4NQXA 1YY9C 3TFKD 2CSPA 4RMSA 3BMVA 1KGCD 1YMHA 2MFNA 5CEZH 5FUZL 4Y4FB 5E2UL 3SO3C 4XNMB 3S4SG 1MUJA 1XR8A 4G6ML 3SDDD 4G9FE 3X14A 2JK5B 5AZ2L 2APFA 1TETL 4IRJA 1MJ7L 2APWA 1LO0L 4PJBE 4JY5L 5DDHA 4O9HL 2LTQC 4P23A 2ZNWA 5F3BB 5D1ZC 5L6YL 4QRTB 2I9TA 5GRVL 4DGYH 1WBXA 5FHAH 2FATH 4EIGB 1F3DH 1D5IH 4MXVE 1UXSB 3TA3A 5FDWA 4I48B 3B2VH 3T3ME 4PJ8A 3Q5OA 2VXTH 2O5ZH 1GC1C 1DE4A 1JVKA 1FVCB 4ZUWA 1MQKH 3QPXH 4ALAH 2ITDA 4LPXA 2VAAA 2XKUA 2CUIA 5D93C 2BVPB 4U6VH 1MJUL 2QADB 3EGSB 3EFDL 1BFOB 4LCUB 5H37H 3IU3B 4DK3A 1FZOB 4LHUD 3JWDL 5J12C 3EOAB 4ZPVA 2J8UA 1PZ5A 4G8GE 1OGAE 4N8CH 2D0FA 5C07B 3QUXD 4WO4D 2BNRD 4QTIH 4H88H 1RZFL 3B8YA 3QUYA 1MWAL 2BXZA 4CGTA 1A6AA 1W0WA 4LAQH 3PABA 4GAJH 3SDAA 2JELL 1ERNA 4MLIA 1A3QA 2WWMC 1LWRA 1WIUA 4PGBA 5GSVA 4NP4L 1ZT7A 5C0IB 3BEWA 1S7WB 3LN9A 3WJLA 1PVHA 4M1GL 3GI8L 1D5BB 2VXSL 4Y2DD 3EYSH 2NY5C 5GHWL 3RY6A 1MOEA 2R56L 3M17B 3LH2L 4LQ1A 1J1OL 4N1CA 1ZA3B 1EVTC 4R3SB 1ZGLB 3D39A 2A6DB 5E0QA 4P46A 1DVFB 1MRDH 3QHZH 4JDZA 5DJ6B 4XPTH 4PRPA 1YMME 5DUBB 2JB5L 5KJRL 2MQ0A 3LZFH 1T4KA 4GKZB 1CT8A 2XN9E 2CDEA 2JJWA 3I9GL 3WFZA 1EEQA 5MENE 5I1KH 4KJYA 3VD5A 3FQRA 2DQEL 4WUKH 4M6NL 1MIMH 2YMXL 3ZT7A 1I9JH 5C0DB 3WXWL 2KBGA 2OTWA 4FA8A 1TJHL 3TN0B 2ICES 1EMTH 4U1IB 4G6AC 2AKRB 4FFVD 1M71A 1YQ2A 2BSSA 4ZS6C 4I1NB 5DHVA 1BM3L 5DJYA 1AXTL 5F7LB 4RGOH 1KTLA 4MNQB 2NY3D 3H8NA 5L2JA 4KZEL 3S6CA 3ZMRA 3OSKA 5HVFB 4OKVB 4G9FA 5DRNA 3GBLA 4GS7C 4CN4A 2R4RL 1VFBA 4XC1H 5EOTB 3GSOA 2ERJB 1W0YT 4KGJA 4MHHI 3THML 3VFUA 3IU4H 1FZJA 2Y06H 4Z7UA 5HHOB 2YUVA 4KKAC 4NSKB 3OJDA 4PJDB 2R0WH 5F9AC 4O5LL 4EBQL 3FB8A 1YNKH 4K71C 5GIRA 5I1AA 1A14H 3SQBA 5D1QC 3K80A 1MWAA 4ESKA 5EU5B 2A6IB 3QO0A 2J8UF 2YRPA 2OTUA 4L3CB 4XCNB 2R8SL 1H3PH 4PG2C 5J6GB 3NZ8B 3QA3A 3W9EB 4J3SA 1F6AB 1HQRA 2EDBA 3KDMA 3MRHB 5HHVL 3KHOA 1JPTL 3MACH 5D72H 1T7WA 2VISB 3BKJL 2F8XC 1N5AB 1E6OL 2DMCA 4N0RA 1CFSB 2HFFA 5EC2B 3TBSB 3TNMB 4EIZC 3FOLA 2GSGB 4M48L 1J0KA 1LEIB 1N64H 5F7MC 1OVZA 1P2CB 2YPVH 4G8GA 3UTTD 3FFDB 4NM4H 1KNOA 2DQJH 3LS5L 2XPGB 3QXVA 5IT2L 4U3HA 3QO1A 3KLSA 4HWUA 1IC1A 3TZVC 5IB4B 1LVEA 1R3HA 4WEBH 3LSOB 4LLMA 3VXRB 1FIGL 5DXWA 1PX4A 4MS8D 4AEHH 4NHCH 5D5MB 4XPFH 5IEHA 3FO1B 1KT2B 3BPOB 2BC4A 4ZUSA 5CSBA 5GS0C 3AU1B 1BHGA 4K3JL 4KXZH 4GW5B 4ORGB 5TH2A 4XP9L 1QVOB 3LKRA 5HGHB 4JO4L 2BDNL 2VABA 3DX6B 4KVCH 5HYQA 3IDGA 3M45A 5I2IA 1P4BH 3ULVC 5D6CB 3BUYA 1HZHL 2F54B 2BX5A 4OCXH 1YMMA 1JGLL 1IQWL 2HJFA 4D9QE 3GNML 4XPBL 2NXZB 3BEVA 1R5VA 2P43B 2XN9A 1PG7H 5D9SB 1A6VH 1FLRH 3TGXA 5SWQA 4YR6A 3TBWA 5ID1B 4L3EB 1HH9A 1J8HB 5MENA 3NMEA 4IS6B 5C08D 4KUCD 2P5WD 2ARWA 4YO0B 3S37L 4ODUA 4CN1A 3DSFL 4P4KA 4ODXA 4Y7MA 4CVXB 1FL3A 4Z7UF 4K9EL 1QFWI 4Z78A 5MP6L 1WZLA 4Z95L 4NIKB 4GLRH 2DBLL 4LKXA 3MNWA 4PJEE 3MLYL 3O6MH 2D7PA 4YC2C 3DI3B 1TCRA 2AJSH 5FECA 2NZ9D 4PREB 3X13A 1BP3B 4LCCA 3HC3L 3OTTA 4MXVF 2FX9H 2EDYA 5DC4B 5DQJA 5JW3H 1IGTB 3T3MF 1J05B 1T6WA 1YEEH 1YN6A 3G6JB 5F96L 2C7UA 3IXTB 1F8TL 5BQ7B 4YAQB 3BPLC 2GQHA 5I75C 3H9SB 2A73B 4RZCA 2H3NB 2ZSWB 4H26B 2VDLL 2F53A 2BRRH 2ESVA 5D1XC 4JFXB 4OT1H 2VL4A 5IW1A 3WFBH 5J57B 3C8KA 3FTGB 1FJ1A 4K94C 1B0GB 1YEDA 3E6FA 2ZKHL 2LABA 3OKLA 3VFNB 5L88H 2EZ0C 2V5TA 3QIUA 4LVNB 3V0VA 5C6WH 4JAMA 4TUOB 2VQUA 4CJ0A 2VDML 4XBGA 4F7CB 4H1LH 5LWYL 5F72S 4YWGH 2HTLD 5DVMA 4NKMB 1PSKH 3L3JA 2PYED 4EZMA 3SY0A 4LEOA 4WV1B 1PG7X 1XCTA 4MJ6A 4QF1A 4YXLL 3O4OC 3PDDA 1MLCA 3DX7B 1ZHBA 4I3SL 1SY6A 3VFOB 3SDCB 1U95A 6FABH 2VN4A 4YE4H 3B9EA 1T0MB 4PRBA 4HDIA 1QSFD 1AQKH 2ADFH 5D4QA 3FRUB 3V6OE 2EDDA 3MO1A 4PRDB 4DZ8A 3GMQA 4Y4HD 2VLKE 1KG0A 5KANG 3VXTA 1V7NH 2VE6B 4HAFA 4XVSH 1NBZB 1WWBX 4LBEB 2P5EA 3S97C 4L29B 3FO9A 4IDLA 2FEDD 4G43A 4ZMAT 5FDYA 4PB9L 4PR5A 4PD4K 4Y1AB 3ZKQD 2ZOLA 4PBWD 2QQKL 1QSVA 2NR6C 1T7YA 4N0FB 3WE6A 4LQFL 5E6ID 1NGYB 3LIZL 5FUZH 1CICA 4TYUA 2NW3A 4PJXA 1EEZA 5E2UH 1BFSA 2X4PA 2ITCB 2ZOKA 5SWZE 1R6VA 4G6MH 4GG6E 5AZ2H 4WHCA 4NO0A 3NN8B 3SGJA 1TETH 5D7LD 4UDUB 4MGXA 4JFPA 1OTSD 1LO0H 3H6JA 3WHE0 2DQTL 4JY5H 4O9HH 3KYMA 5K93A 4NN7C 5IVNA 5DMJB 5IM7A 2OL3L 4Y19B 2PYFA 5KW9L 3UBXI 5DD5L 4F57L 4XPGL 3BIAX 3FN9A 3EYUL 3KPOB 3MLWL 2D31A 3IDJA 5D7JB 5KSAB 2CH8A 2VITB 4P2OC 4E5XB 1U8KA 1MFAL 4HCRL 2J7LA 1Q8MA 3S35X 4U1JA 3MX0A 4OI8A 1UB6A 2WV3A 3LQZA 3BH8B 5ESQA 5SX5K 1R5WA 4WFEE 5DHXB 4GRMA 4PJEA 4Y16B 1RZGA 3RFZC 3RGHA 1MJUH 4RFNB 3EFDH 3OKNB 2CKBA 3JWDH 3EO1B 4YEFA 2NZIA 4ZD3H 2PO6B 3FHAA 1PEWA 3RWGB 1RZFH 1JE6A 4PRNA 1FNAA 1JWMA 1S8DA 3T3PE 3LB6C 2JELH 4QO1A 2XT1B 2R29H 5EZLA 4V2BA 4MLSA 4NP4H 4JDTL 3U0WL 4KJQC 4C56A 4M1GH 2IANB 1QSEA 2ZP0T 2VXSH 3K3QA 2C3GA 1T5XA 4ZYKA 5GHWH 4O58L 1F58L 2VLME 4NZDA 3GSQA 5JQHC 3S4SB 1J1OH 4MB5A 4UIKH 4BH8A 1YYLL 4L4VB 3ULUD 1VFOA 5K9OB 3V6FA 4MQ7A 3HUJA 3D87B 1D5XB 1F4WL 4KDTC 4WNQA 4XCEB 1RHHA 3WNKA 5A1AA 5KJRH 1Z9LA 2JB5H 4G3YL 1KJ3L 3CDGB 1MCNA 4PJXF 2BNQE 2GI7A 3I6KA 4IMLB 5GJTL 2V2WA 1ZHKA 3ALPA 3I9GH 5C0GA 1I85A 3OGOE 3UBXA 5IBLC 3UDWC 2Y7QA 3V6OA 3ZL4L 4NC2B 4WFFD 5BV7L 2DQEH 4M6NH 2WZPD 5C0ND 2YMXH 1HOCA 1GGBL 5EO9A 1CD1A 2XZAL 4GBXB 4G42A 3WXWH 4MA1B 2X4NA 1TJHH 5B39A 4BZYA 2ENYA 2AJ3A 2NY1B 2M26A 2ZG3A 1HHJA 4NBZB 3VGBA 1IC4L 4JRXD 4M6AA 5KZCB 5EU3B 5FO9A 4H8WC 4Z76A 2DI8A 1MFCL 4Y5VC 1U6AL 5DD1H 4KZEH 4OLXL 4GG6A 1GZPB 1K8DA 1SEQL 1AJ7L 3O41B 2R4RH 3ZHLA 4Z77A 2H2PD 1S7VB 2C1PA 4ENEC 4EI5D 1N59A 1Q9OB 4ZAKB 4PJEF 3E2HB 1MY7A 3CXHJ 3QNZA 2G5RA 4O5LH 4EBQH 3QEHB 5CGTA 3BZDA 3W11C 1VGKB 3FRPA 4Q6IC 3VXUD 1DEEB 2JCCB 3O9WC 5FKPA 3KPPA 3MGTB 3W82A 2EYSB 1HCVA 5HHVH 3F7QA 3CPLB 1JPTH 4Y5XB 5TE4L 3RBSA 3NFNB 4N0CD 3QWRD 5JW5B 3BKJH 2EXWD 2QSVA 4U2ZA 4UZGA 4MWFB 2BSRA 4JPKL 2WSKA 4A6YA 1MSPA 1KJ2L 4X6BB 3SE4C 1MCDA 3LS4L 4M48H 5DEGB 2R4SL 2BOBB 3EHBC 1W0VA 5LKNA 1I8KB 3DURB 4A2LA 4LAJH 1CD0A 4UNUA 3DO7A 2UWEA 2W60A 5FV1L 3LS5H 5HHPA 2BVOB 5IT2H 3MBED 1CWVA 3HUJF 3AROA 1ZSDB 1QYGL 3KLAB 1QLFB 2A1WH 3SDXE 2DTSA 43CAB 5IHLB 1IC5L 1YA5A 3DXAB 3L7FA 5ETUA 1FIGH 1A9EA 4TNVK 5GS2H 2X1PA 2BY0A 1I7UA 1UH3A 1PLGL 4K3JH 3GO1L 4PRID 2HT2C 1R3KB 2W65B 4XP9H 1PGRB 4OFYD 3VXNB 4JO4H 2BDNH 3HZYB 4FFZL 4Y89A 5DD6B 3EKCA 5FOJA 1MHHB 4DTGL 3T0AA 1L7IL 4N1EA 4XPHL 5IESL 1KLGA 3HRZB 2OJZL 1HZHH 5I8CA 3F7VB 4PJGE 1IQWH 2J3SA 2DLGA 4HH8A 1HINH 3GNMH 4XPBH 3NCCB 2BNQA 3P40A 3DHJA 5JXAL 3VFSB 1KCSL 5ENWA 1X5XA 3O3BA 4G8EB 5D1ZA 4GG6F 3WHXA 3AMKA 4L4TB 1OLLA 3S37H 4LRNH 3DSFH 2J8OA 2WP3T 5GGUA 2FYYA 4K9EH 2DWEA 3GSRB 5BVJA 1QLRA 5MP6H 4KK5D 4Z95H 2CLVA 2PNDA 2DBLH 1WBYB 3MLYH 2X9WA 4HIXL 3QIBD 2BOCB 4AZ8A 4AIXA 3HC3H 4N9GA 3GUTA 2BERA 4FG6D 4WI7A 3UZEA 3WLBA 4TVPD 5F96H 5GGSB 1F8TH 2E8ZA 4J4PD 1CG9A 2VDLH 1LP9B 5DEZA 4QCIA 4QEGA 4S1DD 4OIIL 2CDFA 1IARB 3QJFB 3VFWB 3RWJA 2B8OT 4N1HB 1SYVB 2Z93A 4Z0XB 2B5IB 5ILTL 4LPYA 4MZ2A 1OAYL 3GBNL 5FF6B 3VWJD 2UWEF 2VDMH 2W59A 4YNYB 3GSVA 1WITA 3DBXB 3MREB 1OAKL 3T3PF 3GM8A 5DJ2A 5DLML 2DYPD 4TSCL 3EO0B 1T66D 4YXLH 2GJJA 3QH3A 3HPLB 1CLYL 4I3SH 3ULVE 3X12A 2K7QA 3QP3A 1JF6A 5E00B 2XZZA 3EO9L 1NC4A 2VLRE 1FO0A 1E28B 2QHLA 5CUSL 3V79C 4GFTB 4NQXB 1I4FA 4XP5H 3U9UA 3MRLB 2F19L 3SDXA 3CFDA 1YMHB 2NTFA 1CQKA 3DV4A 3TJHC 4PB9H 2A83A 4KAQL 5E4IA 1PKQA 1XR8B 2QQKH 3X14B 3K4DA 5JDSA 3NAAL 3LIZH 4IRJB 3U2SA 5GS0L 1FAKT 4FNLL 5DDHB 4P23B 4U0RC 4LFHG 4XX1E 1PFCA 3TF7C 1RFDL 4CDGC 2I9TB 2DQTH 2R39A 2OJEA 1IGJA 1WBXB 3UBXG 2RR3A 2W0KA 2OL3H 3P77A 3UTPD 2JJSA 5KW9H 5FDWB 3TA3B 5IEKB 4BK5A 4PJ8B 3OKEA 4F57H 4XPGH 1BX2A 2BFVL 3CXDH 1DE4B 5B39G 3EYUH 3EDKA 3WCYA 4ZUWB 1FBIH 2ITDB 2VKXA 4NN6C 2VAAB 1MFAH 4HCRH 1JYVA 2V2XA 3VFTA 2IBBA 2YRZA 3G9AB 3JWOL 4PG2A 5HGGS 3O8XC 1N5YL 1EA9C 1I75A 4HEME 1FFNA 2J8UB 4ZPVB 1PZ5B 3VFMA 1QNZL 2BHUA 1T20A 5FK9A 1FFPA 2NMSA 5DC9B 1CE1L 1W0WB 3EAKA 4YFDB 3PABB 3KPSD 4KGLA 3SDAB 2KZWA 1GGIL 1HHIA 3FQUB 4PGBB 5GSVB 1ZT7B 3BOVA 4DKFL 5I1IL 2Z92A 3HE6D 3DYOA 1KPRB 4XVUC 4M4PA 4K94L 4LDEB 4JDTH 3U0WH 4WI4A 3RP1A 5C3TA 4R4NC 3TZVA 2IQAA 4K7FA 3JZ7A 3D39B 4P46B 4WUUE 1ZLUK 4O58H 4X9FA 3D25A 4JDZB 1YYLH 4PRPB 2P8MA 3C6LC 2ATKA 4X7SL 2H32A 1T4KB 3SDXF 3NPSC 1CT8B 2VAJA 1F4WH 3C60C 2CDEB 4IJ3B 1TTFA 3BH9A 4KJYB 3FQRB 3O2VL 4G3YH 2R9HD 2EKJA 1KJ3H 1BOGA 5DO2D 2DKSA 3JWNC 5GJTH 2AEQL 1JZ7A 1TPXC 2VLRA 5BV7H 3FQXA 4M43L 3F65A 1U8IA 4YDKL 5GZND 5CEXA 1GGBH 3MRMA 2XZAH 1DR9A 1M71B 1T2QL 1UYWL 2BSSB 3EZJB 2NX5E 5DHVB 4P5TC 5DJYB 4D0DA 1KTLB 1JBJA 2YD3A 3B2UC 5L2JB 1EDQA 2D9QB 4WW2C 1AD0A 1Q0XL 3TFKC 3QZWA 4G9FB 3E3QE 3QXWA 5GRJL 3KYKL 4P9HC 2FX7L 1VFBB 2B2XL 5FYJE 1MFCH 2WLYA 3GSOB 1U6AH 3V5HA 1TDQA 4MXWH 4DUXA 3SDDC 3VFUB 5DRXA 1FZJB 2P49B 4OLXH 3FN0L 1SEQH 1AJ7H 5CJXC 3OJDB 3WN5C 1X3DA 2BXYA 4XTRD 5EO0A 3FB8B 2FJGA 3AB0B 3MA9L 3UX9B 5GIRB 1AKJA 5AUMA 5IUSA 1F97A 1MWAB 2FGWH 3QO0B 1C5CH 4WEMB 5J4MA 2OTUB 3NH7H 2E9JA 5HYIA 4H0HB 3QA3B 3MROA 5D1XA 3KDMB 4R26L 4U1HA 4U3XA 5F6IB 3CFBA 3HB3D 4YDJA 4OZGE 2VSCA 2HFFB 5T1LD 5F1SA 5JOPE 1KB5L 1VADA 4HIEA 2Y6SD 3FOLB 4URTB 4JPKH 1I8MB 4X4YA 4G8GB 1OGAB 2APBA 4JFFD 4P59L 1KJ2H 1KNOB 4PUBL 3QO1B 1BAFL 4WO4C 1G7PA 1HE7A 4R4BA 2Y9RT 1FYHB 2YD7A 4LLMB 3CDCA 1JI1A 1A6PA 3SJVE 1QYGH 5IJKC 1X9QA 1IC5H 4LIQE 2NY6B 2BC4B 2EYTA 4ZUSB 3MRFA 5F93C 5T1KD 3C5SA 5TH2B 5E4EB 3ULVF 4OLWL 4TN9A 4Y2DC 3LKRB 4MZ3A 3ZTJG 2VABB 1PLGH 5I2IB 4WUUA 3V4UL 3BUYB 4KJWC 1VCAA 1YMMB 5T5NF 2HJFB 4FFZH 5F71A 4DTGH 1L7IH 4GG8A 2F8OA 4FQXD 3BEVB 1R5VB 4WJ5A 2XN9B 5HBBA 5IESH 3MRQA 3IFLL 2OJZH 5SWQB 4YR6B 3EOYG 1IM9D 1HH9B 5MENB 1JN6A 2HWZL 4YPJA 5FHBL 4U05A 3BD5A 1CYGA 4ODUB 4CVWA 5JXAH 2FLRT 4P4KB 1KCSH 4ODXB 1FL3B 1OT1A 3BKCL 1KIQA 5J11B 4Z78B 3MNWB 1NFDE 4JZJC 3AGVA 1IEHA 2IH3B 1TCRB 1KENL 1F90L 5FECB 2GW5A 2NX5A 3X13B 1R3LA 4LCCB 4NQVA 4P2OA 4FFVC 4XMKL 5DQJB 5EUKA 1YN6B 1JI2A 2C7UB 3O4LE 4HIXH 5CEZD 4H8WL 4N8VA 4UBDD 4RZCB 5DMIL 5GRVK 1KB5A 1XGPA 2NY3C 2VZUA 5EG6C 1AGDA 3LD8B 5IW1B 3C8KB 5DJDB 1FJ1B 3SKJL 3E6FB 1YEDB 1FZKA 5KAQF 2DBJA 1TXKA 3PL6D 1HEZA 1ACYL 3G08A 2V6HA 4LDOB 5E2JA 3QIUB 3V0VB 4JAMB 4ZXBC 5IKCA 4XBGB 3UC0L 1RJCA 3O6KH 1NCBL 1E6JL 5ILTH 5JDJA 1NGXA 3GBNH 3L1OL 4U1NA 5HJ3A 3L3JB 2YPLA 3SY0B 4LEOB 3IB4A 1J0ZA 3MSPA 1KPVA 1XCTB 1OAKH 4MJ6B 4QF1B 5F44A 3UYRL 1MLCB 3L3KA 5DLMH 5CBAA 1ZHBB 4TSCH 1U95B 4PRBB 4HDIB 5KBNC 3MO1B 2FO4A 1CLYH 2HKHH 4DZ8B 3GMQB 4DCQA 3JV0A 1KG0B 4KDTA 3VXTB 3EO9H 5I1JL 3OGCA 4PV9A 4JKWA 1LO3L 5D2NE 2P5EB 4D2NA 4EEEA 1T1WB 3FO9B 4U6XA 2RHEA 4G43B 4NHUB 3L3DA 4PR5B 1OAZL 1C5DA 5B3NA 2ZOLB 3BDXA 5GS3A 3WE6B 2F19H 3UDWA 3DVGA 5CP7B 3AAZA 3ZLQC 1CICB 2NW3B 4O51B 4PJXB 1EEZB 1KFAL 4KAQH 3MUGA 4MS8C 2X4PB 2ZOKB 3ARWA 5IFJA 2W0FA 3TO4D 4I0PD 2X4UA 2UVFA 3NAAH 4NO0B 4QRPE 5F7WC 5GS0H 4HH9A 2Q8AL 4FNLH 4GKSA 3KYMB 1HHGA 3WIFA 5IM7B 2PYFB 3MOQA 4ORZC 1BZ9A 2AP2A 3CVHA 3L5JA 1RFDH 1JRHH 1LNUA 4Y5VA 5L8LB 3B9KD 3MXWL 2YXMA 1U92A 4TULL 2GK2A 2D31B 3H3BC 3IDJB 1IE5A 4F7MA 4OZIE 1XF2A 3W0WD 1U8KB 4J7RA 2BFVH 3QCVL 3SGDH 5BXFA 5T5NG 3GSXA 3QAZB 3HZKA 1K4CA 3LQZB 3CFCL 3GGWA 1A6UL 5GS1C 2DOCA 5ESQB 2VSDA 1INQA 1R5WB 3QZWG 2YSSA 3OAYH 4GRMB 2IBGA 1NFDA 4PJEB 3U9PL 4Q6IA 5DD3L 2ZSVA 3JWOH 2CKBB 3O9WA 1TQBB 4UT9L 5J9PA 4OCMC 2Z31D 2VDRL 1QNZH 2NZ9C 4XX1G 3O4LA 4J12A 1EJOL 1F6LL 4PRNB 1CE1H 1PJ9A 1JWMB 1Z6JT 1S8DB 3MA7A 1UA6L 4B50A 2E8YA 5EZLB 2CO7B 2GHWB 3VXOB 4P5KA 3SE4A 1BJ1H 4AM0A 4DKFH 3IDYB 1QSEB 3IFOB 1PD6A 4K94H 3EYQD 4I4WA 1T5XB 3NOIA 3LRSA 5BOPA 5IFHL 3GSQB 4BH8B 5KAQG 4ETQA 2VLLA 4MQ7B 5DMYA 4WFHE 3HG1A 4KRMB 3NCBB 1JHTA 4MAUL 4WNQB 1RHHB 3VD9A 2EECA 4X7SH 2HTLC 2EDOA 4J3OC 3P9LA 3I6KB 4OB5L 2V2WB 4EDXA 3OMZA 5C0GB 4NQCD 3UBXB 2Y7QB 3U30C 2Q3ZA 3O2VH 1ZWIA 3MLRL 5IB5A 1JGEB 3F5WA 1QBML 1HOCB 3T0ED 5EO9B 1AQDA 2AEQH 3BUTA 1CD1B 4D8PA 1KV3A 3IDXL 4G42B 2BP3A 5EU6D 2X4NB 3MRNA 4MQSB 5B39B 4JO1L 4Q9CA 2AJ3B 2F58L 4M43H 1A6WL 3RWIA 4YDKH 4Y4HC 4LLAA 1HHJB 3P4NA 1T2QH 1NMCB 1UYWH 1NUDA 5FO9B