3FFCE

Crystal structure of cf34 tcr in complex with hla-b8/flr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
MGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSFTWTSGGATDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The shaping of T cell receptor recognition by self-tolerance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
total genus 57
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE02
2IF7A 4WFHD 1MCPH 3QIWD 1MHCA 1YYML 4NKOA 3DPBA 3ZL4H 4W6YB 2GTZA 1NAKL 5MERB 3P4OA 2F74B 4M7ZC 4XNZC 3AREB 3C5JB 1RJLA 4ONGL 4OLUH 4U4BA 3LRSB 1WVZA 3ARGB 3VA6A 1MI5B 1RULH 3MMEB 4XNZB 2GJ6D 4OF5A 2X4SA 3HC3H 3MUGA 2Q8AL 2H6PB 5ENWA 4TPRL 2IANA 2UZIL 4IJ3B 5B8CC 4P49A 4RBPK 3U48A 4WJ5A 3P0VL 2F58H 4TQEL 2X1PA 1W72A 3V7AG 1FVDA 2ZJSH 5GJSL 1FNEA 2XFXB 1L7IH 4PLJD 5ICZB 4YNYA 3OKEB 4M6AA 5LBSH 2V2XB 4CNIA 4QY8B 1LO3H 2B1AL 3FOLA 1HILA 4RAVA 4ZFFA 1KCRL 4P2QE 5H94A 3ZHKA 2VXUL 2DS4A 2BJMH 2ZZUT 1T0MA 3HUJA 3O2VL 2A6KA 4JRYE 1DP0A 3RDTA 1YY8B 4RFNC 5GS1A 1WLHA 3E2HC 4CDHA 2IAND 1C1EL 1RAMA 1EEYA 3C5ZB 4UT7H 3MJ8B 2E7BA 5T1KB 1IGJA 1ROWA 3MLVL 3GIVA 5HJ3B 1BZ9A 3QHTC 4KU1A 2JLLA 2P5WA 5F7UA 5DJ8A 2MCPH 1Q8MA 5ID0B 1PFCA 2HRPL 2LU3A 4TNWF 5C0BA 1CLZL 4C56D 5I1IH 4F80A 3FO1A 2ICCA 3UJIH 1A0QL 4NKOB 4OLZL 4CJ0A 4PIRF 4BZYA 1UH3A 3L3IA 3LN9A 4JRYB 4BQCA 1JFQH 5HI3D 2AV7A 1DBKL 4XAWL 3BZFB 3H9SD 2ZPKL 3LEXB 3L1OH 1WAAA 4P2QB 3BAEH 1W2KT 1BOGB 2BNRA 3D2UA 3DV4B 3J8F7 4BQ9A 2DKUA 4J3SA 4FMFA 2AJYH 4PS4H 4PGEB 4HBCH 1FFPA 1R3JB 5FKPB 3QDGA 4JHWL 3X3FL 4CW1A 1G1CA 4OSUH 5EIIB 3SGJC 5C0NC 1HIML 1HXYA 1KCLA 3HE7B 4HCRH 1G84A 1HINH 3RNKB 4M5YL 3WIHA 4NC2B 1NBZB 2O61A 4WI2A 4C56A 1PJ9A 3U79A 4B7LA 1KYOK 4KKCD 3V2AR 1I3UA 1J1OH 1DQJB 3T65B 5C09D 4HJGB 4TUKL 1GRWA 4P2CG 3Q1SH 1MOEA 3Q3GB 2VMFA 3V6ZA 3BPLC 3R06A 3IFNH 3DVIA 4NQED 5DUBA 3QFJA 2ZOLB 3AY4C 4NT6A 1TDQA 4CVZB 3B5HA 4LLMB 3RNKA 4JFXB 1MRCH 2EH7H 2PYEE 4HPYH 5TQ0H 5JTWA 3E2HB 2PR4L 5DT1H 4JAMB 4I0PC 3QUXD 2HTKD 5KZCD 3KYKH 3IS0X 1M7IA 3EJZD 3UO1H 4C83B 3OTTA 5CLTA 2VQ1B 4PJ7E 2O5ZH 5CP3A 5DHVA 3BIKA 5C0JB 4P46D 3GFUA 1V3LA 4OI7A 3UDWC 2VAAA 4D9QE 5IM7B 1KIUA 3T4AB 4K3EH 1SJHA 3D0VA 4NBXB 4ALAL 2PXYD 4POZC 2X9WA 3RVXC 2DJUA 1KG0B 1A22B 4JQXC 4XVUD 1HHIB 2IGFL 3JV6B 2ERJB 1FAIL 4UQ2A 1FO0L 1D3CA 2Z9TA 2W60A 2VDLL 3IAGC 3A67L 2ARWA 3VXMA 1RZFH 4X6FA 4XI5C 3BPCB 3K3QA 2GKIA 3VFVA 4YC2B 4TNWK 3IF1A 3MLVH 4P23A 1EO5A 1KUMA 4CJ1A 1KG0A 3ZL4L 1INDH 1FZKA 4WTXA 1H3WM 3DX7A 3EJYC 2NY4D 1BVKB 3CDFA 1YN7A 2PXYA 3QG7H 5GRVK 4UZGA 1X6LA 1CICB 4NQDD 2A83A 1GC1H 2O5XL 4M7KH 2PTVA 1YDPA 3HZKA 4PBWD 3LQAL 4U1MA 2G60H 3KPSB 4KJPD 5TDNA 1IE5A 3BAEL 3CK0L 4XVJL 3T0DA 5E8NB 3BZ4B 2P5EA 3FN3A 1AHWB 3UTSB 4I0PB 5CZVH 1XH3B 3WDJA 3N85H 5FYJU 4KPHL 1KJMB 4NUJA 1QPPA 1MLCB 5HGHA 3U0WH 4X9BA 3U30C 2AQ1A 3ZHLA 4G6JL 4S10A 3KPOA 1A1OA 3P9LA 2ZUTA 4C54A 4JO3L 35C8H 1LD9B 1H3PL 4R6UA 2DQDL 5CSBA 3KHQA 5FF6B 4E0RA 4X5XA 1VGKA 4HXBL 5TF1L 2P5ED 2ED7A 1I8LC 2H2SD 4G6ML 1WFOA 3RU8L 3BSZH 4O02H 1NAMA 1NL0H 4U0RB 3LN4B 2OK0L 2VSDA 3MRRB 3QCVH 1MWAL 4HGKC 4G8GE 5DURD 3BP6B 4HWEH 3PL6A 1TJGH 4NO0D 1W72B 2YHGA 1UKQA 4XMLH 3FB6B 1U92B 5HHXL 3MLUL 5J12B 5HY9A 3OR6B 1KSRA 2DLFL 4XHJC 5DQ9A 5C09B 4PRNA 5DD6A 4XB7A 5GGVL 3GKWL 2FYYB 2QQKH 3I75B 2DWDA 3PQYE 4GW4B 1YN7B 4N8VA 4WW2B 2C3XA 5DUMH 3VXRA 1GXEA 1S5HB 1ZANL 4M6NL 3QUMH 5IT2L 2YEZB 4ONFH 2UZXB 3ZTJG 4I2XA 2VL5B 3MV8B 4HK0A 3LB6C 2DDQH 1J1PL 3N1FC 4RDQG 4O2FA 4Z7WE 4QYOB 4G43B 2ATKA 1D5BA 4XBGA 3HPJB 4YO0B 5IW1B 4O5LL 3UC0L 3WE6B 3MLPA 1B0RA 1R3HA 1FO0H 3UBXG 1ADQL 1SBBA 4LCWB 3N1GC 3BEVB 3O6MH 3TCLA 1T21B 1J1OL 5FA4B 2DMCA 4KKBC 2Y36L 4ORZC 1LK3H 3VGAC 2VIRA 3BPLB 5F7NC 1G7LA 1FG9C 3MZGB 5B39A 3RKDD 1QO3A 4MMZC 3TA3A 2Z93B 4NM8H 5FUZH 1R0AH 1CXFA 3OR7A 3NFSL 3SGDH 4PJCF 4GW4A 5A2LH 1P1ZB 4NQEB 3I6GA 4TSCL 5IOPB 4HWBH 1I75A 4P57B 3Q6GH 4U1KB 5TQ0L 2BDNH 3PWJB 1FZMB 5C3TA 2DQEH 4U6VH 1J8KA 3CSYB 3VRLF 4LDEB 1AR2A 3MACL 3KPQB 1GPOH 4GRWF 4Y4FB 5GS0L 1Z0NA 3K0WA 3ZDYF 1TVDA 2PTUA 5SX4H 5EU5A 4ZD3L 1Q9OA 4JO1L 5GGSY 4U0RC 1KJVB 1NUDA 4NP4L 3L5XH 4PRBA 5DSCB 2WIIB 2CKBL 2DBLL 1QYGL 3RY6A 1WK0A 4OB5L 3WN5C 5ETUB 4MQXD 3L3OA 1A02N 3MLSL 5BMFH 4BK5A 4AEIL 5IB3B 4MMXC 2X4UA 4XRCB 3DX9A 1RUAH 2DQCL 5C1MB 1IM3A 1RZGB 2VLLB 2DQGH 1FZMA 2F5AL 3NAAL 4NRYB 1A6AA 3NCYS 4KDWA 2VOTA 1G0XA 1TJHL 4HDIB 1XEDA 4OQTH 3LKSB 3BP5A 3CC5B 4S1SH 4UNUA 3M1BA 1KB9J 4F2MA 3V52L 3LRHA 4RISL 2VDQH 4S2SA 4Z7UF 5KS9E 5C8JB 3B43A 2D7PA 1OL0A 3KPMB 2R4SL 5ALCL 1T04B 3I6LE 3LMJH 4LLQA 2DQTL 5BZDA 5DZLA 1KPUA 3EFFA 5IF0A 1IAIH 4GLRH 5DC0A 3QG7L 5TF0A 4IDJH 4QHMB 5IB4B 4XP4H 5F21B 4GKOA 4JFEA 4F58L 4M7KL 3TA3C 4LK4A 5DJXA 5C2UB 4WI3A 4GRWH 5KW9H 1ZVSA 4JFDB 4PJFE 1OGTB 3QO1B 1J05B 4NHCL 2XZQH 3GSWA 2W9EH 4PG9A 5EZIH 3DIFB 1YPZB 5BVJB 4LKXA 1IAKA 2VE6A 3F7YB 2OMNA 3D69B 3VCLA 3MV7B 4GRWE 1X5KA 1B2WL 3FRPG 3VWKB 1RQ5A 4QNPF 1J1PH 5EZLB 4O58H 3T0ED 3ZKMC 4KZEL 5DD6B 1W8OA 4JKMA 4LLWB 4PJ7F 1DQDH 1F3JB 1GGIH 1UCTA 2HT3C 5IQ9A 4DN4L 1JGUH 5C6WH 1TETH 3ULSA 3ROOA 2QKIA 3CH8A 5SWZB 2NLJB 1KC5H 4BFIB 1IEAA 3NA4A 3F7PC 4D94A 4U1IB 4TVPL 2GITA 3RY6C 4FQHB 4L3EB 2AK4B 3OAUH 3NFSH 3SDAD 1QFPA 3FT3A 1S7XB 2Q8BH 3P30L 3BIKB 3D25B 4O02L 1IZKA 1G7LB 5FGSA 4M7LT 2NX5D 4D9RD 4KTYA 3HMWL 4NRZA 5L8LB 2ICWI 1R3LA 1N26A 2FGWL 4XMPL 1N6QL 3TBVA 3VRIB 5M94B 1TVBA 3H9HB 3V95A 4KTDH 1U42A 4NDMA 5L2KE 4MAYC 3MUGB 3UBXI 1UQSB 2ATPA 4EDXA 1B3JA 3G6JF 4APQB 1KCKA 4UILH 5LWYH 1GYAA 3SE8H 4M02A 3OJDA 3QCTH 2H1PL 3QQ3B 2VL5A 4I2XB 5B38A 1Q9OB 4XZUA 3L5XL 3W81A 1TQBC 4LGPB 4PJHE 3D0LB 5IWLC 3HNTH 1JMXA 3VD7A 4H5SB 1K4CA 3MROA 4LARH 3LEYL 3BH9B 3UTTA 3WEXB 1ZSDB 4LU5L 4BSVB 2BVUA 3P73B 1O7VA 3PHQA 4U05A 4LPTA 2XTJE 3HB3D 4EEEA 1Z5LB 4R90L 1JZ7A 4PJ9C 3DROA 3TIEB 5DUPH 2FJHA 3FL7A 5GIRA 4MVBD 3PHOA 2WLZA 4P2RE 4QXWA 1HSAB 4LAQH 1F4XH 4P4KA 5A16A 2CR3A 3ISWA 4HW6A 3PABA 3VWJA 5E70A 5FUZL 2G75A 2YPLD 5KSVB 1R0AL 1BM3H 3TYGH 3WO4C 1NUFA 1F6FB 4JLRA 1EX0A 5DS8A 5D2NB 4Q9RL 2VZ1A 3VMOA 1U8JA 3SDYH 1UA6L 2BSRB 1NBVL 4DN3L 1LO4H 1V7MH 1QTYT 3CFKB 4LSTH 5GGSA 2DTML 3GMMA 4G43A 1DFBH 1IFHH 1PW3A 2XWBB 2ZCHH 3NZ8B 5HGHB 2XZQL 4G9DA 5GS0H 4PREA 4U6YB 1IILE 3MRNB 5EU6A 1H3VA 4W4OA 3FJTA 4I18C 1NCCH 4EDXB 1MUJA 3Q5TA 1JV5A 3DURB 2JKXA 3HB3C 4XNQB 3QH3B 1A6UL 1T0PB 5EC1B 1G7IB 4XXCA 4ZS7L 3TVMB 4EN3B 5IB5A 5I17B 2AI0L 1T1YA 2VNCA 1JHTB 1T7YA 3X14A 4MDIB 4FQ2H 3G6JA 4C58B 3TV3H 4UI2A 2PXYC 3PGFL 4K9EL 1OTUD 1MJJA 4PTUB 4L5FH 2XQYK 1VFMA 4GQ9H 3LN4A 1LE9A 2AEPL 2XZCH 4ODWB 4QNPE 1FZOA 5DJ0B 5LVEA 3SE3A 4ODUA 3UBXB 5A1AA 2VDRL 4NO2B 3FTGB 4PREB 1I3GL 3UXFA 1JRHI 3L3HB 4NKIH 3GBNH 4KK9C 3QIBC 5C0AD 3JV4A 5TGBA 4X4YB 5E2UH 4YDKH 2HRPH 3GSNH 4HAGA 3C2AH 4LNRA 1RULL 4WUUE 2VC2H 2HG5A 1I1RA 3BUYB 1A3RL 4R8WH 3VWJC 4O2FB 1IAMA 4MXWL 1AGFA 1EVTC 3RTQA 1PKQA 3LN5A 5J6HA 4YPGB 1IT9H 4N0FB 3C6LA 3WV0A 4Z76A 2BVOA 1NC4B 4BM7A 4WVRA 1J05A 3S3JA 3QDGB 2ZKHL 1ZE3C 1L7TH 1W0WB 2BSSA 1BGXL 4R4ND 2IBZX 5C9KA 5EBWB 1T0NB 5DI8B 5I8KH 1LO3L 2B1AH 4EDWH 4JY4B 3KGRA 5KAQG 5HHMD 1GIGL 1ZSDA 4F15C 5KVFH 5D96B 3VFGH 5BZDB 4UT6L 4P4RB 3R8BB 4UTAL 4KDVA 4LCCA 4FP8L 4Z0BH 3QEHA 1ZT1B 4YPGA 4ZTPH 4HIEA 3CVHB 4RMVA 4ZUUA 5GGRB 3HS0A 3JWNC 3ZDXF 5C08B 3E6FA 3VGHA 1S9XA 5EA0L 5ISZA 3RUGF 1KIRA 1JHKH 3L7FA 4F7MA 1NFDF 3EZJB 1TQCC 3H42H 3S98A 1CL7I 4U1NB 3EFDL 1KN4H 5EO9A 3MCG1 2IQ9H 4HJJL 15C8L 4U1LA 5DWUH 2DM3A 4PJXA 4HUUA 1LO4L 1V7ML 2HKFL 4H0HB 4GG8B 4JDZA 4LSTL 3VXME 1UYWL 5IQ7H 3T3MF 5DO2C 1PG7X 2RR3A 1A7PL 5C0FB 1ULVA 5D72L 4PJCE 4KVCH 5AEAA 2NW2A 1DQTA 5D5ME 1MNUL 2I60L 2NY3B 4K7PH 2FNBA 4BZ1L 4AY0A 3V5DB 1CDBA 1EAPA 5EORH 5D7IA 4LDOB 5JUEL 3LQZA 3U4AA 4JN2B 3ZKQD 3DMMC 4U1JA 2Y5TA 4C57C 1MRDL 3LS4H 3ME0A 3LY6A 1WZ1H 2ZNXA 3B5TA 2GJZB 4MXVF 5IW6A 3QDMD 3FRUA 2FJGA 1UWEH 1ITBB 3DURA 2FIRT 4QRQB 4XWOC 3LH2H 4Y4HA 4FXKA 4NQXB 4AM0A 4CVZA 3LRSA 4H20H 5CWSA 4OLVL 4KI5E 1H5BA 5SWSD 3DIFA 1IGCH 3D85A 2FD6H 1EHLH 1UB6A 5CS7A 4JFFD 4KI5F 3WJJA 3DXAD 2EE2A 4KROB 3BKML 3X13A 2C7UB 3GI9H 4YDKL 5GS0C 2V2WA 4X4YA 1XCTB 2X4OA 2HT4C 4P46A 5LGJA 2X10A 4DN3H 3JWDL 4JFZL 4HCRA 4FA8A 5T33L 3WFHB 2OI9B 5H94B 1FVCB 3HRZA 2EDOA 5FHBH 3H8NA 4X6DE 1R6VA 3P4MB 2VUOA 1CT8A 4YHPA 2DKSA 2JIXD 1Q94B 2V5MA 4JFFA 1CLCA 2R0ZL 2ARJB 3B9KC 1QLFA 3LKOA 5IHUL 4E42A 1B90A 4DZBB 5D7IB 1G7IA 4R97C 3U1SH 1VACA 1T3FB 4XPFH 5AYUH 2Q76A 3IU3A 2AABL 3JZ7A 4LFHG 4K2UH 3TYFB 4DCQA 3BKCH 3EGSB 4HXAL 4FQ1L 1AO7D 3VFOA 1J18A 1CVSC 1L0XA 3NMEA 1BWWA 5D7LD 3AMLA 3TBYB 4KJQD 3QEQD 1R5WB 1MHPH 5D8JL 3VXOA 4LNRB 4YFLF 3EFDH 3IJHB 5HGAB 4PP2A 5EFIA 3PXJA 4CUCA 4AL8L 3BISA 2BVEA 2AXJA 4NO5B 2A6KB 2QQNH 3HAEG 3L5WB 2BCKB 2D7MA 3QUYA 2JELH 3R1GH 4MQ7B 4JFDD 5I8EB 5HYEA 1J8HB 3D9AH 4PJIF 3B9KA 1N2RB 4XPAL 1ETZB 3B9VA 3GGWA 3UJTL 2F54E 4G42B 4BZ1H 3X11B 3DXAE 4PLOB 3QEQA 3VFPB 1ES0B 2QSQA 4WTZG 3WSQL 3S5LA 3D5OF 4Q6IC 4YHOH 1C5CH 5IB5B 4EN3A 4G7YL 5I18L 1WTGT 2CIKA 4ELKB 1G7MB 2VISA 1AXTL 4F7EA 4H26B 1H3GA 2IFFL 1OPGH 3ZYIA 4DGVL 5I15H 1CK0H 4Y19E 5IFHH 1U8IA 2W91A 35C8L 5LJYH 1TZHA 2I9LB 5T1MA 1KTRL 1E4XH 3D39A 3CAFA 1NLBL 3CFKA 3RKDC 4Z78A 1EHLL 5F70A 4MJ2A 1Q72L 4NO0A 4OI9A 4GBXA 4KJWC 3GJEA 3SE9L 5DZNA 4MLSA 1S7TA 5FHAH 2I26N 1ZEAH 3BP6A 2GEEA 4L29A 1FNFA 2ADJB 1TCRB 1J0ZA 2YXFA 3D0VB 4M6MH 4WY7H 5DVMA 5T33H 3CC5A 4F2MB 1FVEA 4GKNA 9CGTA 1NCWL 4JFQB 2XG4A 4IDLA 3T3ME 1XF3B 5FHBL 1S9YB 3K80A 1G7HA 2X40A 1NEUA 4IRJB 2FEDD 4R7DB 5D6DA 1WC7B 4R26H 1KYOJ 3HI5L 1MCSA 2YWYA 1QP1A 1HH9A 1F8TL 1YEKH 4JAMA 2BHZA 3OX8A 5I6XB 4IJ3C 4CU6A 4H1LA 1CD1B 5HHQB 3QFDA 3WMSA 4JPIA 4FXKB 3EAKA 5IEHA 4P2OC 4F9LA 3UPCA 5C9JA 1FL6A 3BO8B 3MFFB 4JZJC 3VXQB 4FXGB 5HGDA 2HKHH 4PJDE 1DEDA 2WW8A 3SO3B 1VPOH 2D0HA 3CNKA 5D1XD 5I1KH 5IJKA 1YYMH 1JNNL 1CFVL 4JY6A 4YE4L 1VFOA 4L8SB 3PWLA 3SKUD 1EEQA 4NQDE 2HFGL 4FQXA 2FO4B 4EVNB 5ID1A 1XF5B 2H9GA 3AGVA 3QUXC 5J1AA 2WQ8A 1CDIA 4EI5D 4JKLA 3PGDB 3N9GH 3SDCB 1TVHA 1KEML 5D7LB 1IAII 3BMVA 4Y16D 3WFHA 3QB7C 3BN9D 3UZVB 4JM2C 1FZKB 2R0KH 2PTTA 3OWEA 4XAWH 2DQUL 3Q48A 3OKLA 1LDSA 2X4PA 4KMTL 3QUZB 4ZXBB 1XF5A 3IKCB 4XCNA 2NCMA 3QIUD 3BZFA 4KRMB 4N68A 3C8KA 1AY1H 1T1XB 4ISVA 2R29L 3EOAA 2R2BA 3L3IB 2D3VA 4NRXB 1PLGH 1A7QH 2LAAA 3OB0K 5DHYB 2G2RA 3OJMB 3RGVB 3TO4B 5C07E 1N3NA 1QYGH 3D0LA 12E8L 5EZLA 1V3JA 5JOEA 1E4WH 2HJFA 5HHME 1NC2A 4G80B 1ORQB 2BNRD 4XZUB 2IFFH 5INDB 2HJLB 5C0RL 2H26A 4H8WH 3KWWA 1LE5A 4U1HB 5CEZH 4OFIA 5F1NA 1KPRA 4CADA 2R0WL 3T4AA 2G2RB 2AXFB 1AGDB 3GI8H 1OCWL 1DVFA 1IQDA 2XKSA 1NCDH 5T1LB 1S7RA 3C5ZA 1KLFA 2CJUH 2Q7YA 4YLQT 1U92A 3AREC 3SKMA 3MRIA 4NYLB 2A6DA 2VDQL 4OF7A 5EULV 4JN2A 1T1YB 1JL8A 3LZFL 4JPVH 2WM0A 1I7ZA 5J06A 4HWZA 1D6VL 4LVOC 3ARBA 3P11H 1Z9LA 2L4OA 4KK6C 1FC1A 3DHMA 4M6ML 1KFAL 2ZG2A 2CDGA 3UJIL 1Q0YL 1PZ5B 1JHLH 4XB8A 1KCSL 2WIMA 4LOUD 4P99A 3QAZB 2PO6C 3PP3K 4LVNC 2NY2D 3DUSB 4U31A 2BC4A 1KJ2B 5GGSB 2F53D 2G9HA 3BEVA 1B2WH 4HPOL 2O5YL 1S9VA 4UAOC 4ZDHA 5EPMA 1YEKL 2PKDA 1PZ5A 2R1YA 2DD8L 4OAWB 5E8PA 1QLEH 3SN6N 1INEL 1F3DH 2HVKA 1CDYA 4ACPA 3T09A 5C0CE 1QBAA 5C0AB 1MJ8L 4PGBA 1J8HD 3CD4A 3RWJA 4M1CC 3DROB 1RPQA 2FLBT 3QI9C 1JPSH 2WLYA 3ZT6A 3RGVC 5EO1A 2JB6B 5IROC 3J7HA 1NGWA 2IPKB 3VXSA 5CKGA 3DX8A 2GAZA 1AGEB 1P4LB 1CFTA 1EHNA 4JKWA 4NQCB 5SWSB 4D0CB 2VDPH 1UWGL 3G5YA 4R7NA 1NBQA 5F9AC 4QRUA 1EH9A 3B9KB 1BEYL 5GRWA 3SCMC 1Z9OA 4AT6B 3JV0A 4TUOB 4YBLC 4KK5D 3MRQA 2F15A 1M4KA 1D6EB 1ZHBA 4ZO7A 5BRZB 3L6FA 3AM8C 4I0KA 1DJSA 2OMBA 1I9IH 3C08H 4JDTL 2BSRA 1VENA 1RK1A 3AXLA 5HHMB 3QCTL 3FN9A 2R29H 1G6RL 4O51B 4X7TB 1S7UA 4ETQB 1T66C 1A7QL 4ZS6D 4N0CD 4WHYG 1X5ZA 4OZFH 4QXUH 5J11B 1KCUL 2XTJD 4FG6C 1ZHBB 2X4PB 3QG6B 1F8TH 1V3MA 1ZA3B 5C07D 3S35L 4AQOA 1T4KA 4ORGB 4HQQL 5GS0D 1CE6B 1FC2D 2FJFA 4YHLH 1AHWA 1CCZA 2FYYA 4L5FL 1WIPA 3P0YH 2OS7A 1A7RL 3VWJD 5HPMB 2GCYA 4R90H 5JHDA 1OB1B 4F9PA 5DMGD 2CQVA 2LVCA 3EOBB 3BP4A 3ARWA 5EBLA 4MDIA 3MXVH 4ELMB 4MS8C 4WJ5B 2HJKA 1CFVH 3SHSA 5E7BA 3VI3F 1F02I 2IADB 3KLAB 4G6MH 1RJZA 4B5EA 2ADFH 1ETZA 5C0GB 3VI4E 3IT8D 1WT5C 4OM0L 1FFOB 2A9NH 5A40E 3S3SA 5EN2A 1QNZH 3O0RL 5EU6D 1FSKB 2XYCA 3IDXH 1LGVA 2NNAB 2XWBA 4Y4KB 4OLWH 3GMOA 3SCMD 1Z9SA 4PJAB 4HLZG 4AIXA 4UOW0 2ZCHL 3PWUA 4OGYL 4JG1L 2B2XH 1F58L 5E8DH 1YEFH 3TP4A 1X3DA 1N0LA 2R2BB 4DKDC 3QUML 2IANE 5MEPA 2D03H 3TBYA 3D25A 4MA3B 4M43H 3V5HB 2PN5A 3LQAC 1AI1H 4LLUB 1JP5A 1Y6NR 1R3KA 2CRZA 4PB0H 4ONHA 5L7XH 1IC7L 3IDMA 3UTSA 1UVQB 3GMQB 3ARGC 3KPMA 4MD0B 4NQCE 3RVWC 1S5HA 3DV6A 3U0WL 3CZFB 3V0VA 2MSPA 2EEBA 3BDYH 3VGEA 5LG1A 2G5BB 4QRQA 4YDIH 2X7LA 3GIZH 4WW2C 1CR9H 4PJGE 1MJ8H 2Z8RA 4G8FA 5ACMA 1QSFB 2FDBP 1KPVB 4P2RA 5D1ZD 1D9KC 5E6IB 1J12A 1OCWH 4MSWB 1AJ7H 1T2QH 2HYMA 5F1IB 4JRYA 1R5VB 2VLLA 1IKFH 2XPGB 2Z91A 3C60C 5TF1H 4JJ5B 1PYWA 2XN9A 4AEFA 4NC0B 3F7VA 5KBNC 3V4UL 4JREC 1AXSB 3B5GA 4JPKL 4KRPD 5GGQL 4GG6E 4OFYD 4MD5A 1WZLA 1PSKL 3QQ3A 4OCYH 3GSNL 3PWPE 4Q2ZA 1NMCC 3TA3D 4CKVX 2HKFH 2ZUQC 4P46B 5BRZD 5E2VH 1TZGH 3FN0H 4RQQA 3C08L 4HC1A 1DANU 5C0BE 2YKLH 1IMHC 1QQDB 3LSOB 2G9HB 5D1ZA 2VKWA 3NCFB 5EU3A 2BFVH 4JZOA 2OTUB 5D93B 4M6NH 2ZSVA 3D6GA 4XNYH 3QJHB 1DQLL 4HPOH 4S0SD 1NANH 3LS4L 3EOYG 2XZZA 1T03L 3T8XB 5HD8D 1LK2A 4XPBL 1JPTH 5L8KB 3MCKA 4ODWA 4Z5RB 3NTCL 5ILTL 4XHJD 1FYHB 5D7JA 1KB9K 3VFGL 5FDWA 1T1WB 2FO4A 2DJSA 2EDNA 4YR6B 5TE7L 1TQCB 3RVWD 1MCQA 3BMWA 1XR9B 2JJUA 1BFOB 1CD0A 1I85C 5DR5H 5IMOB 5K9KA 3OKNB 1U8KA 4JPWL 5E6YA 5ITFB 1PDKA 1C5BH 2Y1VA 3MOAL 1Q38A 4MA1B 4NM8L 1XZ0B 3JUYA 4LLYB 4R3SB 1CXIA 1IQWL 2B4CL 2E7HA 5ISZE 4N0FA 1NKRA 5C0FA 1FNSL 2OQJB 3MRNA 5SX5K 3W11C 3IETB 1CTOA 1IL1A 3C6SB 4HS3A 4XCFH 5F8RC 4ZSOB 1IEBB 5C70A 4N8VB 2BX5A 1H9VA 4N9GB 3BPCA 4GRLD 3QIBA 5HJ3A 5DJXB 2VXSL 1OGAD 4PY7A 4YC2C 1GAFL 3WS6C 2QEJA 3KPLB 1UZ6F 3PHSA 5KJRH 4YHPB 5I1DA 3L3KA 3CXHK 3EYQC 4LPYA 5TE4L 3MRKB 4R4FL 1A64A 4YXKL 4KGLA 2NXYC 4I3SL 4P4KB 3E8UH 2R0ZH 4Y4FD 4UNVA 5EIIA 4HS8L 4HV8A 3MNVA 3RA7H 4DW2L 3TNMA 1EBAA 4PGJA 4ODXB 3KYNA 4LSUH 5SWSA 2I9TA 2DWEB 1WIUA 5HD8C 4YNYB 3RVVC 4LLUA 4KV5F 3RWEB 1CR9L 2VLKB 3V79C 1S7VA 4LMQE 1CLYH 1PQZA 5EBMA 4J23A 2CXGA 1R24B 3DXAA 1KJ2H 1MCCA 1QRNB 4KUZH 4RDQF 1M6OA 2FX9L 2IAMA 5JXEC 5DJDA 1MREH 2BSSB 5H35B 3LIZL 4Z8FH 1ED3A 3U0PB 2IPUK 2EDHA 3T0AA 1FNHA 3EW3B 1R5WA 2V17L 5HSFA 2NNAA 1QD0A 5ANME 1NSNH 3QXAA 4V1DD 5DDHB 1RZJC 1XH3A 3HMWH 1MPAL 2OTWB 4UOW1 3VE0A 1K8IB 4IRSC 1FFOA 3O0RH 5EU5B 1CQYA 1NLDL 3OV6A 3O45A 2EXWC 3CX2A 3V6ZB 3DNKA 4G3YH 4PRPD 1TVBB 3H9HA 5JW4N 4UB0L 3S4SA 1T5WA 3OAYK 2NXYD 1M6OB 1MJ7L 3D9AL 1SYVB 4RX4D 4LRIA 4LP4A 2ARJA 1S7VB 1FYTE 5ICXA 1L6ZA 1U8NB 3FCTB 3OKDA 1TXKA 4KAQH 4KHXL 3DYPA 2WWKO 4U1GB 3M45A 1YEJH 4I4WB 3N1QC 2AEQH 4QHUA 5JHDB 1L7IL 4HUVA 3NPSC 4PRHD 3WFBL 5LBSL 4OQTA 3UX9B 5EOQL 3S96B 4PB0L 4N9OB 3BH8A 1Q0XH 5E5MB 4XWGL 3ESUF 2ZSVB 4AK1A 3QWOB 2DM4A 4WUUD 1F6AB 5CJBA 5E8EB 1BX2B 4LLDA 3QDHA 1A4JB 4YBLB 4P2YA 3W0WB 2YMXL 4BSVA 3VXMB 4RX4A 5EU4B 5FYLH 4KV5E 4GG6A 1W0VB 4MA8H 1GOHA 5CJOH 2X4RB 1WBXA 3EKCA 4LOUC 1ORSA 4OZFB 3B9EA 3ARGA 1OQXA 5I75C 4IRJD 5DJ8B 4MX7B 1H3UA 1GZQB 1FNSH 3F7YA 3QUMA 3OXRB 3B6SA 4WU7B 3L9RA 4KKNA 1XIWD 3G5VA 5BV7B 1JYVA 4PJCA 5C0CD 3NGBB 2W59A 1XZ0A 1B6UA 2IAMB 1NAML 1HI6A 2YPLA 4Y1AA 1NANI 1DQQB 4KTDL 1KIPB 2BY0A 2F54B 3K8KA 4L3ED 3TBVB 2VXQL 3S5LB 3QI9A 3G6AA 4MCYA 1WEJL 2LAGB 4RZCA 3EO0A 2LABA 1V05A 5J89A 3VG0L 4NN6B 1GOGA 4R4FH 1QZ1A 5GISH 1UM6L 1ZTXL 2NY1C 4PJGB 3WSQH 1QG3A 3ZYOA 1FYTB 4RIRB 3RWCA 3IDMB 4DVRL 1JYWA 2ZUQB 4GXUN 2J5LC 4LARL 4MQSB 3JWOH 4YAQA 3D39D 3KVQA 4MJ5A 4K3HA 4YDVA 3NTCH 5ILTH 2V2WB 2ORBL 5SWZA 4Y1AD 3T0EB 5JOPD 2QR0A 4W6WB 4MXQD 4HG4K 1MQ8A 2IBGA 2IANB 3QXDB 4PJAA 2BC4B 3FONB 4WUUB 2OI9C 4X7SH 1E4XL 5F7MC 3TN0D 2YPKA 5T1KD 3SQOL 2V17H 2HN7B 2B8OT 4ZUUB 3MLRL 3QQNA 3TF7C 3S37X 1QRNE 1YPZA 1Y18A 5IR1A 3QEHB 3ULUF 2VLKE 1X5GA 2Y7QA 4WUKH 2NY7L 4DZBA 5C0JA 5KVDH 1CGWA 5FGBA 4IEFB 4HK3N 4WY7L 1A6VH 3EOBA 3QDJE 3UYRL 4DGIH 5DK0A 1ONQA 3CU1A 3ARDD 2J8HA 1JBJA 2YPLB 5K59F 1A14H 2DICA 4NFDA 5GRUH 1YEJL 1FYTD 4KRPB 5AAMA 5M95B 1LP9E 2NW3A 3SOBH 5ID0A 2K3TA 3ULVL 2BMKB 3BD3A 4ZYKA 2AI0H 1QKZL 2Z35A 1SVCP 3H0TB 4O2CA 3K74B 4Y19A 1RURH 2Z92A 3DLQR 4X7FC 3AXLB 1EERB 3ARPA 5I9QB 5EC2A 4Z78B 3MGOB 1A6TA 5J3HD 4O2EB 3NA9H 1MRFH 5GRXG 3VFUB 5FYLL 3JV4B 4JLRB 2YRPA 3G5ZB 2R1XA 5CJOL 1MREL 4JG0H 2BXZA 1XGYH 4Y8DC 3DJ9A 3PABB 1BZQK 2VE6B 4KXZI 4R4BB 3UBXA 4MLIA 1KB5H 3KXFD 2MPAH 3FQNA 4RAVB 4PBXA 2CO7B 4NZUL 5I8CA 4PGEA 4OZFG 2VLMD 1HCVA 3DGCR 4QY8A 5AD0A 5DMKA 5CP3H 4BUHA 4Y19D 4XMLL 1QSFA 1JPGB 3N50A 3MOBL 2GY7B 4HT1L 5F93C 4E5XB 5D5MB 3KLDA 5EBWA 1TZIB 2OR9H 1CD9B 1FHGA 3QH3A 4PRDA 4RMWA 3MUHL 3KHOA 1T7VA 4K7PL 4NQEA 1MY5A 4WU5A 3N0PB 1FH5L 3A6CH 4LLMA 1MFBL 5C0CB 5DRWB 4ODHL 4PFEA 3U7YH 1UB5B 2R1YB 3TH3T 3O9WA 4MA1C 1Q9KB 4QOKD 4V1DE 5GRJH 3H3PL 4UU9A 2D7QA 3GM0A 4P5TA 1CGSL 3ZDZE 1E4WL 2X4TA 5I74C 2XTJC 3SBWA 4NWTH 3E3QC 5EO0A 4TVPD 5C0BD 5DD5L 3TCLB 2DF3A 1N5YH 1A4JA 2C3WA 4NSKB 1RK1B 1BQSA 4JGJA 3OXSA 5C08E 1B0RB 3PWPB 4YXHH 5L2KB 5D70H 2VSCA 2MQ0A 5AUMA 1JN6B 1G7HB 2NYYD 2ZCKL 4XBGB 4X7CC 3ILPA 3H9SA 4Q9QL 3RGVD 4BSWB 1L9NA 1AR1C 4RFEB 3ARBB 3O3BA 4DFHA 3BGAA 2BSED 4WU5B 1U3HA 1AD0A 3KNBA 2VDPL 3MUY1 4RAUB 3B2VH 5DQJB 4XCYA 4JDVA 2ICEB 1NL0L 3G5YB 5DK2B 2VRAA 5DQ9B 5KVMC 4KFZC 3VFRA 3SGEH 3MRMB 1HI6B 3ZLQC 2E27H 3IXTA 3HC0A 1NMCB 3FO1B 4TQEH 5C3LD 1JZ2A 1UZ8B 4BH7B 3SY0B 3U9UB 4JM2B 4PJ8A 4Y5YB 4RGNC 3V6BR 2ICWA 2ITCA 1SBSL 2O5YH 3GSWB 3V5HA 4F3FA 1YQ2A 3O81A 1T21A 4C59B 4HEME 4EUPH 4PJAE 3S35H 4HS6A 1D5MA 5T3XD 1INEH 2P24A 4GH7B 5AYUL 1AQDA 3QXWA 2X1XR 4LSRL 1DUYA 3LH2L 2KZWA 4U7SA 4ZAKB 1ZLUK 2QV2A 5B22A 2Z35B 3S97C 2NZ9C 5IVXA 1YNTA 4Y88A 5DMIL 4NBZB 3I85A 2VKXA 3AS2A 4ZAKC 4I0PA 3O3EA 1LMKA 5D71L 1GGYA 2R56L 2HT4D 4HWZB 1DZBA 3KLAA 1I1AB 3C2SA 3C60D 5D7LE 1IAIL 5HY9B 3PV6B 4Y4FC 1HZHH 3ZTNH 1P7QD 3F12B 1JHTA 3LV3A 3LB6D 4XCYB 3V5DA 3RIFF 1JRHL 1DVFB 2P8PA 4TVSa 3RVVD 1DBKH 1ZMYA 2CDFB 4RMRA 4QCIA 1UZ6E 2P8LB 1FNLA 3P0VH 4GRLC 5IVOA 3QUZC 4ZXBC 3QUYD 3OJDB 5T3ZD 5ACLA 3HMXH 1F2QA 2AJSL 5F9JA 3WLBA 2GQHA 4OLEA 3MV7A 2CRIA 3U7YL 1J10A 4YHOL 1CZ8L 3T2QA 3H3PH 3HZYB 1T2JA 5BV7H 1OSZB 5EH1A 5JHDD 1JGLH 1CGSH 4OIBA 2EDXA 1QKZH 1EPFA 1FO0B 3SKOB 3PL6D 1BJ8A 1A7NH 4QXGH 2E9JA 4P2RB 4J12A 4P57A 3AMKA 3MR9A 4U1KA 2V9TA 2V6HA 2Q86B 2X7LB 4IMKC 2HWZL 3TWCH 5DXWA 1EA9C 2DI8A 3QJFB 3CFBB 1BQHA 3LKPA 5GIRB 1Q9LA 3ZE1E 1CF8L 2DB8A 4S1SL 5BS0E 4RGOH 2D9CA 4OCXL 3JV5A 5HDOA 4NZUH 4K71C 1G0DA 2EH7L 5KS9A 1XGQA 2ZSWA 5KZCB 3CSGA 2DKMA 2X4OB 3HE7C 2QJDA 3QUZD 4ZXBD 4Q6IB 2RB8A 1UEYA 3RWIB 4OIIL 4MNGE 4M8QA 5F7DA 4CADB 1X5FA 1HK6A 2Y07H 5F6HJ 1CVRA 3H7BA 4IOFD 5E95B 4QYOA 3X12A 5JA9A 3L5HA 4Y5VC 5C2BL 5LWYL 3OGOE 1CWVA 2H3NA 1F58H 4BZ2H 1F90L 3HPLB 3QWRA 3SY0A 3DRTA 4LKCA 4OZHA 4Y4HB 5CILH 1FFNB 4JKPH 5HYSG 4HG4J 1I9JH 4ODHH 3HC0B 3IXAB 3RUGE 5I1EH 4NBYB 3C8KB 3MGTA 5E6IA 2WINB 4OF8A 3TJHC 3ALWA 5FFLA 4NZJA 3QUZA 4ZXBA 2BNQE 4LSSH 2DQFA 4NQUA 5E2WH 3PWJA 1E28A 1C5DB 2JJWA 1WT5A 1NBZA 1A2YA 3MLWH 3SJVA 3QQ9D 5FYKH 5E8OB 4G9FA 43C9B 5FGCE 3RWFA 4OFYA 1JNNH 4XPTH 1FORL 6FABH 1KV3A 2JIXB 2X1OA 2R56H 1BVLA 3HE6A 2RFXB 1J8HE 5IVXB 1YY9C 1UXSA 2DOCA 5BZWA 2J7LA 1MRCL 4RSVA 4GMTL 1WTLA 3V6FB 3SDDA 1QQDA 5IMLA 2CIIB 1NGQH 1T22A 1QFWH 2VZUA 3BDXA 1HCFX 1Z2KA 4W4NA 4GRWB 1FIEA 3QIUC 4JQVA 5IW1A 2OJEA 4YX2H 1UADC 1B0GA 3DYMA 4K3DL 1RU9H 1CFNA 2AKRB 1WUNT 3BKJL 5FIEA 4EI5A 5C07B 2QSTA 3EYSH 4ESKA 4IIQA 2E7LC 1FGVH 1KB5B 3F65A 1UZ8A 3CXDL 4X6CA 5D7JD 3TZVC 1OAKL 1CZ8H 4R96A 4XX1E 2XI9A 3VDCA 5IEKB 2RBLA 1R5VA 4ALAH 2HT2C 4OF3A 3RA7L 4DW2H 1J87A 5I0ZA 5CUSL 5D7IE 4FQ2L 1JGVL 2A77H 2WP3O 3WIFA 1QUNA 2XY2A 5AZ2L 1VGEH 2ICEA 4LLQB 3S37L 2D2OA 4BELD 2J1KA 3KNBB 2VDKL 1P6AB 2XWTB 5C0DA 5DMIH 5C0IA 2B1HL 3ULVC 2CJUL 4P2QA 3UTPD 5FF6A 2CK0L 5LGHH 4E0RB 2EDYA 3CFDB 2AV7B 3RU8H 4PJDB 4JQXA 1OGAA 3O3DB 3LCYA 4I1NB 4XRCA 4OCRH 4C56E 4PJEB 3C5ZD 4OZGF 3IGAB 3GHEL 4J7RA 5A3IC 3WFDL 1NEZB 4Z6AT 1GZQA 1A9BA 4R8WL 1IC4L 4U6XB 1U8PB 5E4IA 1NEZG 3QXAB 1E4KA 1IFHL 2V9RA 2DQUH 4BH7A 3BXNA 4L4VD 3IFPA 4XVJH 3WHE1 1ZANH 1I1AC 1J0KA 5I73C 1CLOH 2VTFA 2CIIA 1OAQH 1BFOA 2HJKB 5EOQH 4NRZB 4P5KA 4X6DA 5EBMB 2HH0H 4NZRH 3NH7L 1JWSB 1X4YA 5E5MA 4PV9A 4PJ7B 4G7VH 5GGTA 1E6OL 5KAQF 3MCLL 1HXMA 3MLWL 5K9OB 1FVCA 3EBAA 3C8DA 4GG6F 4JR9H 1EFXD 1UT9A 5IFAH 4ZOBA 2PYEB 5IBTH 1P7KB 4L3AA 1XFPA 4A2MA 5ESVA 4KDTA 1HH6A 2NZIA 4EUPB 2YZ8A 4HJJH 5EC2B 2EO9A 1Q1JL 3T0EA 2MFNA 1T6WA 4HFUL 5DWUL 5FYLE 4K71B 4Y19B 4DQOH 4P3WA 1QFWL 2A6JB 5I76A 1MIEH 3GSUB 3GSRB 5IK3B 4Q97A 4TNVF 2I9LA 1ZVHA 3WD5L 3MRQB 2Y07L 1I1FB 3IDNB 5MEND 1QSZA 1U36A 2V5SA 1YEIH 1C08A 1AXSA 4JO4L 3UTPE 3T77A 3WDHA 3C8HA 4GS7B 2CUMA 3RIAF 3L7EB 1P4IH 5JUEH 1Z5LA 1MAMH 4HUKB 5IT2H 1MRDH 2FZ3A 4XT1C 3K46A 5T1LA 1D9KA 3ZTJH 1AGDA 4JDVB 2A77L 3MRDA 5FK9B 4I18A 1A7BA 1YJDC 1NAMB 4KKCC 5GS3A 1XF2B 1BVKA 4LIQH 1GGTA 4MNGA 5E9DA 3IDGA 5EU7E 5I1JL 1OWRM 3E0GA 1ACYH 4L1DA 5D6DC 1IGCL 4YIQA 3KPLA 3JVGC 5ANMA 2X70B 1YNLL 4HUUB 5EU3B 1OP5H 2EC9T 1CICC 4S1QL 1G6VK 1H8SA 4NSKA 4KK5C 4MD4A 3SDDB 3GSNB 4F15B 4M3KB 4YHML 5KVEL 4A2LA 1BEYH 4DWHA 1MAJA 1MLCA 5AYQA 2DIAA 1NGQL 5H8DA 3VFOB 5SX5H 1S7XA 5LQBH 1DN0B 4U6VL 5KVGL 3HHRB 4MD5B 2Y25A 2JK5A 5IJKC 1TLKA 1JF6A 4LQFH 4M1GL 1LE9B 4KTEH 5GGTH 4Y89A 1XR8B 5ICZA 1A6WH 1JF1B 1KACB 2AJXH 5D5MA 3DV4A 4QKXB 3S4SG 1QLFB 1OTTC 5EORL 5J7CC 3SCMA 2E6QA 4OD1L 1S7TB 1TIUA 4GJTB 3QRGL 4AMKH 3KJ4C 3ARUA 4RMQA 5DD0L 3RZCD 5AAWA 1U95B 2A83B 4WV1C 1WCBB 3NH7H 5CUSH 1XGPB 4G7VL 3BDYL 3U46B 1A5FL 2ESVD 3B8YA 3GIZL 3KLSA 2JTDA 3TA3B 1PKQB 3LN5B 3CVHH 5LCVL 4DKAA 2NY0C 3JWOC 1TCMA 4HGWA 5FM5O 4UT7L 1AGFB 1ZLUH 4GG8A 3UCRA 4OLVH 4M4PA 1W0YT 4RNRB 3DI3B 3IDYB 3IGAA 5IBTL 4X0KB 5DHYA 3WN5A 3PP4H 4JFHE 4LLVB 3T65A 5HPOA 1VCAA 2Q8BL 1AP2A 1S7QB 3O8XB 4Z7UA 5ESVB 4U6HA 4L4TA 5F1KC 4HIJB 4ONGH 3TBTB 1YYLL 2AQ2A 4OCRL 1A4KA 2FGWH 4XMPH 4APQD 1N6QH 3CCHB 4GAYB 4NHUB 5BJTB 1FYTA 4NO2A 1ZS8B 4Y5XC 2ED8A 1JMZA 3NGBC 2NYYC 1BP3B 3DRQB 5DRZB 3IXTB 3TH4T 3SO3C 2IH3B 1PX3A 2I27N 2BCKA 2AP2A 5ISZD 3MXWH 4LF3A 4N0UA 3CUPA 2VR9A 3CLEH 4PB9L 2VAJA 4UUJB 1BJMA 3ZKSD 1AGCB 5M7QA 2NY6B 4WTWA 2XTJB 2YC1B 2F19H 5F7HA 3HN3A 1JF1A 3L3GB 5C92A 3OXRA 4O9HL 4XP1L 1GGIL 1F11B 2E5EA 3EO9H 3P9MA 4GSDL 3GZKA 1TETL 1MCEA 3CMGA 2PW2B 1RURL 4QRPB 1GZPA 5D70L 1B9ZA 3VD5A 3EHBD 3KXFA 2ZCKH 5FUCE 4FQIL 4QRSB 4LVHC 4FQ1H 1HH9B 1CDCA 1YNLH 4F33B 1H15B 1HH6B 3KPQA 2CDEA 4D0BA 4FFYL 1MFCH 4QRTA 3G5XB 3RL2A 5FOJA 5KN5B 5GGQH 4ZUWA 2Y06H 4UV4L 5B21A 3VWJB 2UY7A 1W8NA 1CGYA 3FAXA 3PWVA 3WIIL 4GUPA 4OF6A 3UO1L 3NBNA 2ADJA 1WV7T 2YD9A 3FHAA 2UUDK 4KTEL 1FV1B 5GGTL 3WNPA 3WXWL 1BOGA 3D2UB 1A6WL 1P4LA 3UTQB 2BFVL 5EBLB 5FB8A 3HZKB 1P4IL 5D1ZB 3P73A 3BRFA 3VXUD 1L6XA 2IEPA 5ICYA 4P9HL 2AJYL 1DQLH 4YK4B 1VKXA 3SKNA 3QEQE 4X6EB 3UTTB 2LFGA 4I0CC 5SWZE 1JV5B 4UIMB 5ESAB 1LO2L 2EECA 4WI6A 1FLRH 2A1WH 2IJ0C 1DBAH 5GPRA 1QSEE 4EI5B 3QFJD 5FM4A 1U3HD 1YNKH 3MREB 1RHFA 3FAWA 1KJ2L 3INUH 3TT3L 1KXVC 3MRCA 2B39A 2JJSA 4UDUA 4N8CH 4X6FB 1QRNA 2D9QB 4KZDH 1DLFL 4LFHD 4NO3A 4JRWA 5EZJB 1XCQA 1UM5H 3STZB 4GLRI 4L8CB 2G75B 5I8OL 5KSVA 4G42A 3NVQA 2N4IA 1KTKE 3SDYL 3FQXA 1D5XB 2P1YA 3GBML 5JO5A 4MNQA 4CVWA 3QDMA 3BQUA 2J6EA 4N1EA 1D5IH 1FFQA 5I1CL 5D7KE 2WWMC 3KPRE 1FL3B 2H32A 3NOIA 2R0KL 3H9YA 5DFTA 2H9GB 1ZLVK 4J1UA 1C7TA 3D3VE 1OAXH 3S8WA 4M1GH 3G5XA 4NKQB 1NGWB 3RL2B 3S36L 4ZMAT 4XNXH 4EXPX 2NY1D 2ZKHH 1QFOA 1OAYL 5CINL 1P5UA 1NDMB 5HYJD 3D85D 1BBJA 3MRJA 3O8XC 5EC1A 4HEPG 3TVMA 1JVKA 1MI5E 1RVFL 4GAJL 2H6PA 1MUJB 3ES6A 1JGLL 1IM9A 3OMZA 4OZGB 4YIQB 5B3JF 5J1SC 3DRTB 4OZHB 3TFKC 1NBYB 2NQCA 4JPIB 1K4DB 1U8HA 3ALXA 3UJJL 1U8PA 4G6JH 1WZKA 2IGFH 3P9MB 4ZDHB 5ABDE 3HFMH 1OLZA 3H9SE 1KTDA 5D2NE 5IMOA 3BVNA 2FCBA 2ICES 5I0DA 4GW5B 3ZE0E 1HHJB 2XICA 4PRHB 3UAJC 5DD3H 1TFHA 4PJHA 3MGAA 4AH2A 1XGRA 1UJTA 4PLKC 1XGQB 2ZSWB 2OP4H 2RFXA 3TVMD 2EIEA 1XF3A 2KH2B 1CS6A 5HPMA 1MWAH 3BKYH 4PY8I 3ARDB 1Q9LB 4I13B 1NAMH 3VXUB 4PV8B 1UYWH 3SJVE 4Z76B 5TFSH 2R4RL 2YSSA 2O5XH 4NQEE 2YD7A 1FGNH 4U1IA 4QTHB 3QHFH 4UB0H 1T2XA 5DJZA 2GJ6B 2GFBB 3C09C 2NY5L 2I60H 1AQDB 1U2CA 4O2EA 4PJHB 4BZ2L 2C7UA 3TT1H 1DQQA 3FHQA 3SKOA 1KLUB 3IJSB 4WCYH 3HMXL 1SHMA 2I25N 4F7CB 3A6BH 4H88H 4X6CB 1PLGL 4NPYA 3JV6A 4FXGA 4LAJH 1KGCD 1D6EA 5FOBA 4HD9A 5HYQB 12E8H 1PZUB 5MENE 2ORBH 4WFED 3U83A 4Z7WB 1VFAA 5E1HB 1ZVSB 4JFDA 4LNVA 5ESAA 1B4JL 5EU4A 4NJAL 2HLAB 5JLZA 1BFVL 5D2LA 4ZTPL 2BOCA 4Q74A 2GAZB 5AZEL 4U3XA 2Y4SA 3VGAB 3PXHA 4B50A 4LPWA 1J11A 1NUNB 1UXSB 2VLRB 4HWBA 1FQ9C 3HKFA 1LO0H 1OB1A 3HUJB 4ODVH 1BVLB 3NFPB 5DVNA 3IAPA 3TH2T 2X89D 5C8JA 4QRPD 4TSCH 1MSPA 3BSZL 2IH1B 4K3GA 4NWUL 5H2BB 4MD0A 4Z5RA 3TNNA 4F8QA 1P7HL 2FRGP 4DUVA 1YUHA 3GDBA 4JANB 4NQTA 4TPRH 4KMLB 1JN6A 3QFJB 1FN4A 1XGRB 2HFEB 3MLXL 5DJ2B 3BN9C 5C2BH 4X7TA 4DKEH 1SVZA 4HJGA 4Z18A 2WUCH 3I9GL 5FGRA 3R0NA 1L4IA 3DO3A 4QXUL 1C7SA 3L3HA 2DBLH 4ZG1A 4KVNL 4URTB 3RAJH 1GZPB 2X89A 5SV4A 2NY2B 1JWMA 4QHLA 5CFHA 4RIRA 3RWCB 3GSXA 1FLRL 4O5LH 3U9UA 3MA7A 4CW1B 3V4VH 2VABB 4J3VA 5T1DL 3P77A 1MLBB 1VA9A 5DFVD 4AG4H 3KPSA 3IFLL 1OTSD 4HIIA 2NXZC 3U7WL 1KN2H 3W5MA 1I9RL 5BS0A 4M61B 4PUBH 5KS9B 2F54A 5BVPH 1A3QA 5DMJB 3QYCA 2OL3A 2OXGA 3FB7B 1KPUB 5HI4C 3SDCD 3FQTA 1SJXA 1P1ZA 1YEHL 5DRZA 2R4SH 1OLLA 3L9RB 4BQ8A 5I8OH 4IRSB 2H26B 2SEBA 3LKSA 3Q6GL 3S7GA 5FCUL 5DA0B 2AJUH 3MR9B 5CMAA 3CU7A 3GSRA 5IK3A 4RFNB 3TN0C 4HUXB 1IC4H 3TBSB 2W38A 2V2TB 4NO0B 3SE3C 1FO0A 5HYJE 1IGTA 5D7SH 1IC5H 5CBEB 4OFDA 3PWUB 5IP4A 3H0TA 3NCYP 5E8EA 5F3HA 3VD4A 1JZ5A 2XT1B 2D03L 3A6BL 3TJEH 3BEWA 5E0QA 1G6RB 3PGCA 4AZ8A 2NY3C 5E5RB 4FQXD 1HINL 3EUUA 2QSCH 4QCIB 4PG2C 3FOLB 2VDNL 5B8CB 3O2VH 1CDGA 2GITB 4P0DA 1CG9A 3DX8B 4X6BB 5B3NA 1ZT7A 1KBGL 2OJZH 4FQXC 5MP6L 2NLJA 5EZOL 2RQ8A 3NABL 4TUJB 4OBSA 5H37H 2FHFA 2F53A 1FV1A 4DKFL 2DMBA 5E99L 1I7TB 3D3VA 2GT9A 5IG7A 3QIUA 2EO1A 2IH3A 2APXA 3FO0H 1ND0B 3HI1A 4DVBB 5I66A 3WHXA 4WFHE 2B4CC 1G1YA 3H9SB 2Z31A 1SM3H 5INDA 1IAIM 4I3RH 1QR1B 4L4VA 1KENH 5DUBB 4ZS6C 1IAKB 1UQSA 2ATPB 5CEZE 3WFDH 2J8UF 5FA4A 3AC0A 3WD5H 2FB4H 3NCCB 4KH2A 4CVXB 5IKCB 4OZHE 3CDYA 3LSOA 5HI5D 1DBMH 2W0LA 4CMHC 1AH1A 3WCYA 4TYUA 1MFEH 5F6IB 4XMKL 1F13A 3QUXA 4HUXA 2GFBA 1JTOA 1NGXB 4WDIB 2JCCE 2NTSP 3PQYB 4R26L 4RCAA 1LVEA 3HRPA 2BMKA 2BNQA 2BK8A 4F37F 3O11A 3CLFH 4AT6A 1NGPL 2AJZA 3VMPA 2FWOA 2Z31D 3VGGA 5F7LB 1T80A 4W6XB 3V4PH 1FJ1B 2XPGA 4NQCA 1U8OB 5JDJA 1OD9A 3BE1L 3L3KB 4LIQL 3AS1A 1G7JA 3PHQB 3VG9C 4XAKD 32C2B 1B4JH 4Z77B 5FAAA 5AD0B 1X5JA 2VB5A 4TVPH 4HIIB 1A6ZA 4FFWD 4Q9QH 3O6FD 1KULA 1W0WA 2DQJH 3DMMA 4M93B 3AROA 3THMH 4UAOB 4WNQA 3RVTD 5E7FA 1T1ZB 4NM4L 3O11B 4TSAL 3MFFA 1OGAE 3BO8A 5E5UB 2J88L 1JNHB 5C07A 1F00I 4LPUA 3PQYA 4NQSA 5IBLC 4X5XB 5FECB 4IMKA 5FO7B 4HIJA 4ODSH 3TBTA 1KJVA 1QFUH 4QTIH 4MA3A 1RZIB 4Z7UB 5KVGH 1KCVL 3MBXL 3CXHJ 4CAGA 3W0WA 3GSNA 3V6OA 3FN0L 3QNXB 2EYRA 2VH5H 3CK0H 5FO8A 2FEEI 3K7UA 5BW7C 2X9XA 3M17A 4OGXL 4QHNB 5TDOB 4WEMB 4YXKH 1U8LA 4CGTA 1X5AA 4OZ4B 5CZXD 2DIBA 3VRJB 4B53A 5I30L 4HS8H 4HDIA 5CEZD 4JKKA 4I4WA 1HQRB 4ZNCD 4F57H 4XHQA 4N0RA 3Q2CA 1JK8A 1MCNA 4KXZH 3QXUA 3QQ9C 2NTFA 3LPGA 1KT2A 2GY5A 2AEPH 2XZCL 1J0IA 3GI8L 4POZD 4RGND 5ITBH 3PDOB 3NN8A 4PUBL 5IB1B 4HJ0C 3HE7D 1GOFA 4I5BB 5DEGA 4YE4H 3PP4L 4MAYA 3W9EA 3BP7B 3SDXE 4S1QH 5I1LA 5T5FL 1CE1H 3UTSD 1J7VR 2E9WA 1J9CT 4P2OA 2VXTL 4F9LC 1U9KA 1MFAL 1AO7B 3C2AL 4OGAD 5H37G 1A6TB 1W0VA 4LCUB 1DCLA 4IM8A 3RWIA 1LEIB 4NNPH 3CFDA 5DVLA 2VUYA 1JZ8A 1HHIA 4FFVC 5K59E 1EAJA 4G8FB 5D1XC 3QNZA 3MXWL 4FMKA 5E9DB 3RI5F 4BA8A 1XF4A 3GJFB 4MNQB 5EUKA 2EE3A 4P59L 1OWWA 1AKJA 2EYSB 4XP6L 4I18B 4OD1H 4JQVC 1IBGH 1BIIB 1CDJA 1Q0XL 4EDWL 2Q86A 4YHYC 5FYKE 3VXRD 3G9VA 1MJJB 5E9DE 5DRNB 3O6ML 2Q87A 3TFKD 4UV7L 5EBGA 4FQLH 4X4XA 3T0BA 1XF1A 5IB3A 4YDLC 5I6XC 1S3KH 1H5BB 1K8IA 1M7XA 3QNYB 4R0LC 2HAZA 4XVSL 2P47B 1JTTA 3I6KA 2E8ZA 4NQXA 5JXED 1BOYA 4HX1A 5HDQL 1EXUA 4G9FD 2VISB 2YPKB 3C5JA 4Z7NE 5CD3B 1S9WA 3MRFA 3LKRB 2KQMA 3BHBA 4I3RL 3HE6D 1VEMA 5KSAC 4KQ3L 3TBWB 4HKZB 1KFAH 4X4XB 4X98A 4JRXA 1XR9A 5IMMB 3RUGA 4HZLB 3PL6B 2DN7A 4DAGL 3GO1H 4EBQH 4YEFA 3BJLA 3W9DA 4X99B 2WBKA 3BZDA 5DZOA 1U3YA 2DWEA 5DTFB 5C08D 2ZG1A 3ZE2E 5D7IF 4GUPB 2VZ3A 3TCXA 3VG0H 1RHHA 4HFWB 1Y0LA 1HSAA 3O3EB 1ZTXH 1U58B 1D5XA 5JO5B 3ARBC 2V2XA 3PF2A 1RZ8A 4L29B 4OCSH 1FNEB 2XFXA 4MJIB 3DSFL 4D0DA 2VIRB 4HHAB 4MVBC 5FYLD 4FS0A 3QZWA 4JRXB 4OD3H 1KXTB 2CLVB 4NJ9H 4MWFA 4JM4H 1IGMH 2JCCF 2IWGA 4Q7DA 4U1SB 4QGTA 5F7EH 4YHIB 4X7SL 4FQIH 2KPNA 1S78C 1XGTB 3QPXH 2VLJA 4F7MB 3B6SB 1HNGA 5FECA 3KXFE 4OZIF 4ZUTA 4Z7UE 5KS9F 4Y5XA 2FD6L 4H25A 4NKMA 3T2PA 2GJJA 5KSBE 3BP7A 2P5WB 1B0GB 5MERA 5IUSA 4HUWA 2DWDB 3MNZA 3GIVB 5TJWK 3TVMC 1RZKL 5EOTB 1OGAB 3EZ8A 5JQ6L 4P2QD 4PJIE 5K9KB 4NN7C 3MJ8A 1PQZB 1TPXB 1ZGLM 5BOPA 4DGIL 1FNAA 2XRAL 2Y5TB 2AV1A 2WMPA 4RGMC 3MUJA 5D72H 1OAXL 1EMTL 1T1WA 4N8PA 3WNLA 4E41A 8FABB 2R2EA 1WEJH 4N0UE 1L0QA 4JFED 1XAUA 2VQTA 5E8OA 3NZHL 3K81A 5HTSA 5TDOA 2WV3A 2ZUVA 1RI8A 2HG5B 3BGFB 5C0ND 1UXWB 3E6HA 1K2DB 4D0BB 3UJJH 3O6KL 1RUAL 3QIBB 2LVEA 3I2CH 5F88B 1KC5L 1ZK9A 3EYUL 4M00A 4KWUA 3BN3B 4GRLA 1JUFA 1YNKL 4KJYA 5DQDL 3WLWD 3S36X 4F7TB 1RUPH 2L7JA 5KTEH 3INUL 4Q9BA 3TT3H 1S3KL 1ZA6A 1Q9KA 3DGGA 4L4TE 1MHPL 1FL5A 3MRLA 1UENA 4YK4C 1P5VA 1BD2B 1MCPL 4CU7A 3DETC 3TYFA 3FT2A 3MRHA 4DCQB 2CSPA 5JMRA 4M93C 4MJ4A 4LBEA 1JTPA 5T5FH 2DQIL 4MCZB 1RJZB 1EFXA 3MJ7A 4ZFGH 4E5XA 2AAVA 5L6YL 5TFSL 4P3DB 3DETD 4K23H 4UT9H 2H8PB 4XVTH 4QHMA 4JM2D 4QOKE 5IB4A 1UJ3A 5I1CH 3P4MA 1EAPB 1AXIB 4MNQE 1IQDB 4XPAH 4ZO6A 3L1OL 2OZ4H 3K4AA 4XC3H 4JFXA 5EUKB 3ULVE 3ZE0F 2XV6B 5GJSH 1BREA 1N0XH 3QHZH 1QO3B 4R2GD 1CLOL 1I1FA 3IDNA 3ROLB 4ONHB 3OKOA 2Y5EA 1OAQL 5DJAA 4BFIA 3FT4A 4M6OH 4AENB 1T5XA 1HHHB 5IGXL 4RFOH 5I1DB 1LP9A 3GSOB 2AJVL 4LL9A 2X4RA 2EDDA 1JPST 4QXTB 1DQDL 2IFGA 1BAFH 1DQML 25C8L 4DK3A 1RZGA 1D5MB 2FBJL 1IGJB 1KELH 2CRYA 1LNUA 2QADB 3AU1B 5I15L 1CK0L 3L3DB 5ESQA 2CLZA 4YXHL 1IGML 4C56B 1MCWW 5DJAB 3Q1SL 1CFBA 3C09B 1U8IB 2PW1A 5LKNA 4RWYH 4LAQL 2R39A 3PHOB 4K7PX 1KJ3L 2AK1L 2QHLA 2W65A 4UINH 3MC0A 3VDAA 4JHBA 4XP5L 4W68A 5E9DD 3TYGL 3QCUL 3ETBF 3FQTB 1ERNA 1DDHB 4XP9L 3VFWB 3NFNB 3ARDC 4WENB 3ABZA 3IDJA 1LO5A 3P30H 4ZNEE 2YD1A 4MB4A 1FRGH 3NIGE 3SGKA 3VFRB 3CFCL 1U91A 4TUJA 1V7NL 3LKQA 4BJLA 5F89A 1E4XI 4U1JB 3F6IA 1JK8B 3R1GL 4FN0A 4PGBB 2F8XC 4HT1H 1EMTH 3S9DB 4R0LA 2RIKA 2IBZY 4QWWC 1BQHB 1JFQL 4N5ED 4IRZH 5B38B 2P44B 4OGZA 3KLHD 5DDHA 3BQUC 1NCCL 3GKZA 2FLRT 4L9LA 4GAGH 3O41A 3NZ8A 1SBSH 2ADIA 4ZPVA 3RZWA 1RUML 1ZGLP 4LASL 3ARVA 1JYXA 5GRJL 4OFKA 2HFTA 1PG7H 4RMSA 2RJMA 4HIHB 4S1DC 2YD3A 4ZUVA 4NOFA 1ZAGA 4HS6B 5JW3L 2KL6A 5DRXB 4PJDA 2PYEA 3JXAA 2EDJA 4Z7OF 4F3FB 5LCVH 4JM4L 3RWEA 5IFHL 1KJMA 4MZ2A 4NUJB 1AE6L 4JFPB 4HLZH 5DUPL 4MB5A 1EVUA 1OHQA 3KJ4B 3U4BH 4N0CC 3GJFH 2WUBL 3QP3A 5CEYB 4IIQC 4OUUA 3RGHA 3MV11 1HEZB 3GBNL 5E24E 4XBPB 5JR1H 4FTVB 5E56A 5F6HI 2IQAB 5J1TC 1PGRB 4EOWH 3S88L 3EJJX 4NN5B 3ZTNL 3N9GL 4WEUD 4XPGH 1YDPB 5LXGH 5HHNA 1O5DT 2VR5A 1BF8A 3RKPA 2H2PC 1CBVH 4MB3A 1MVUB 4U33A 5C0AA 1N64H 3T0VA 3ARFD 3MRRA 3G5VB 3U30B 5IESL 1ZLVH 2EYTB 2YOCA 1A3LL 4GAYA 4NHUA 2BVPA 4DKEL 1ZGLA 1JGDA 5ADOH 4IHOA 2V5RA 4IBLT 4WDIA 2ZOKB 5DC9B 3C87A 1N6VA 2AJVH 3OXSB 4Z7VB 4X6CE 5BS0D 1KELL 4UQ2B 4PJ5A 4GSDH 4FQCH 1X4ZA 4Y0GA 2F54D 1QSFD 1OP3K 5C0EA 2GJ6A 1CFSA 4UT6H 1JGDB 2DLEA 3TN0B 4Z0BL 2Z31C 2EDBA 4UIKH 4EUPG 2JB5L 3F5WA 3CVHL 1MCRA 2YMXH 4UMGA 2EDWA 4ODUB 1RY7B 1KXQE 1KN2L 2D4FA 4FZ8L 2XQYG 3H6JA 3HI1B 5F1SA 4LIQE 1OVZA 1Z6JT 3SJVB 3QDGD 1IGYA 3EIFA 4D2NA 3O9WD 4QOKA 2EZ0C 1T7ZA 1TZIA 4X99A 5DHVB 2DQFB 1OAZL 1GGBH 4P5TD 4NYLA 5EO1B 4J4PA 3MV9D 3QCVL 2X4QA 4ZFGL 3DX9B 4QRRA 3BVNB 2FX7H 4PGCB 2FATH 4PJ5D 1LHZA 2GCYB 1DDHA 2IG2H 4I77L 3VFWA 2EZ0D 4DZ8B 2VXQH 1I7RA 4PGDB 3HLAB 1NCTA 3RDTD 4WWKA 2UUDH 3QEUB 2PO6B 4BSWA 3MMEA 2FEDC 5D5MF 5ERWA 4JN1L 4XMKH 4PGZA 3QFDB 5T5NG 5A2KH 4Z7VE 3O8XD 4IS6A 3BEWB 3N1PC 4MA7L 5L2JB 5SX4I 1RK0A 1JUFB 3GBLA 3PWPA 4JKPL 3OKKA 3RDTC 4LASH 1IKNC 5ESQB 2O93L 1A1OB 3P9LB 3N85L 4M7LH 4BQBA 1HSBA 4F8TA 3RVUC 3DUSA 1NDGA 5DJCB 3SE4A 4KPHH 3EHBC 3KR3H 5DK3A 4OCMC 4O9HH 4XP1H 3GSOA 1GIGH 1DBAL 4L9LB 4PRPB 1MQKL 4P5MB 4LPXA 5E4EB 1HYRC 4K7FA 1OW0C 4KJWD 1CU4H 2X44D 2F5BL 5D1ZC 3RWFB 5CJQH 3VXSE 2DBJA 5F7KC 1D5ZB 1K5NB 1WBZA 4OCWH 5JZ7D 2Z93A 3NABH 3NCMA 4LCYB 2Z8VC 2R2EB 1NCDL 1UVQA 3GMQA 4GMSH 6FABL 5E99H 2BY3A 3IYLW 3PGDA 4HXBH 4BYHA 1A6AB 1N4XH 2VITA 4FTVE 3ROOB 4QHKI 5D6CB 5HHOE 1MHEB 1DUZB 3LZFH 5JLZB 1QRND 3NFNA 2EDFA 2NY7H 1K4CB 3MROB 2HLFD 4M7JL 3FQNB 4BUGA 3VH8B 1WFNA 3HZYA 1NC4A 3HPLA 3KYMA 3MNWA 3TPUB 4OGAC 2BVQB 5D7JC 3L5JA 3FMGL 1I9IL 4L9DA 1ZHNA 1X4XA 1JWMB 2V5TA 5ADPH 2C1PA 3N06B 5FDYA 4ZUTB 4Q9CA 1H8OA 2AKRA 4GAFB 3UAJD 3GJFK 1CD1A 1SJEB 2QQKL 1FGVL 4PGDA 1F90H 2AEWA 5DO2D 1HDMB 2GI7A 5I1HL 4GAGL 1UKSA 4NQCD 4P9HH 3HZMA 4WO4A 4JFEB 5MEQA 2QR0B 1WBYB 1BX2A 4LLDB 4WV1B 3ZSTA 1I7UB 4XH2A 3JWOL 1RJCA 4OLYH 1UWEL 3CH1A 1FFRA 2Z4QA 1VGEL 2JIXA 3ARTA 4JCLA 1VADA 3IS1X 3MJGX 1SJHB 2J6EH 4U2ZA 4CMMA 2VLRE 3ARED 3HAEA 5FYKL 5B3JE 1HKFA 3T8XA 2L0DA 5DD3L 1JPSL 2XKUA 3LDBC 3VI4F 4PJ8D 3OKDB 1GSMA 3PWNB 4XPTL 3SBWC 5K9QG 1DLFH 1GGCH 3K2UL 1QACA 1J88A 2XTLA 1J0YA 4JGMA 2VLKD 2EXYC 4U1LB 3STLB 3O2DH 1M1SA 4XNQA 5I19L 5MENB 3VXQA 3LHPH 5GRVL 5MHSE 1WWBX 4RRPA 5BXFB 5JOPE 1MI5A 3DWTA 3HC3L 2LTQC 4O00A 4BQ6A 2J2ZA 3RBSA 4H1LH 5E94B 5T3XH 5J0BA 4WWKB 2HFFB 2Y6SC 2BZDA 1ORQA 3ES6B 2VJXA 5EZIL 3EYQD 4GRLB 4KJYB 2EDTA 2EEAA 3KPNA 4QRPE 1S7SB 2C3VA 3RL1A 3QUKA 4JHWH 4L8DB 1NKOA 3SOBL 2PUQT 5GJTL 3VU2A 1MH5A 1KNOB 4RRPG 3OAZK 3C60A 3CPLB 1YA5A 2UYLB 1YMHA 3ZKND 1QEWB 4HQQH 4F57L 3BZEA 4F37K 5DEFA 1YJDL 2F53E 5KSBF 3V0VB 5AZ2H 1JCKA 1RIUL 3FQXB 4HFWA 1MIMH 3MV9B 3TIEA 5HDBF 4QHUB 3QA3A 3VXNA 4HBQA 5L88L 3MJ9L 3CPLA 5HVHB 4GW1B 4NO3B 1XCTA 5ICXB 5KSAB 3MV7D 1QBLL 2VDOH 2EEDA 4GXVH 3X13B 3L95B 3RL1B 1OARL 4Q0XL 2XQBL 3IJHA 5JW5A 4HFUH 4HUWB 1PSKH 2PCPA 5EOCL 2MJWA 2VXTH 3AB0C 5CD3A 3NIDE 3C6SA 4HS3B 3HR6A 3TZVD 4OZGE 3GHEH 4ERSL 4YQXH 4F58H 1NQBA 2CLRA 2UVFA 2NPLX 2QL1A 5GRZA 5DYOB 4OKVA 2C3HA 4LCCC 4JN1H 3VH8G 3VJ6A 1RMFL 4ELKA 4R2GB 2F9BT 2NY6C 3CFJA 2J5LB 3AAZB 3QXTA 1MHCB 3MLZH 2BSTA 3A6CL 3UPRB 3EJYD 5FKAB 2GW5A 2YPLE 2UWEB 3KAAA 4XP6H 1YY8A 4BFBD 3WYRA 1S9YA 4G7YH 5I18H 3QDJB 1CDUA 4P2RD 1CXEA 3IJYB 4Z7NF 1LO5B 1BBDL 2AJ3B 3O6FB 4KKAD 5DMGC 1N8ZA 3WFCH 4LHQB 3IU4H 1KTLB 2VL4A 3IFLH 3REWB 4Y2OA 3OJVC 5HHOA 5HHVH 5D93C 1OF2A 2UV3A 1BFVH 2HKHL 1A6PA 3PUCA 5BV7C 3LD8C 3MODL 3ET9F 2LV4A 5SWQA 3Q3GA 4JO2L 3KPSD 3OJ2C 5KSBB 4LLVA 3MX0A 5JDSA 1SMAA 4L9LC 5GXBB 2ZG3A 3BGMA 1YPZF 2J3SA 1RZJL 2ADIB 3NCJL 5D1XA 3KXFB 5GSVA 1PY9A 1WICA 5C6TL 3RWHB 5HVWA 3VWKA 3T0EE 2AJUL 2PW2A 1IL1B 3O4LA 4FRWA 3UTTE 4WW1A 3V5KA 1X5YA 5FM8A 5TDPB 1FFPB 5DVKA 3SJVD 1DL7L 4F7EB 2WANA 5FM5M 4JRXE 1O7SA 3DUUB 1D9KB 5E6IC 3NN8B 4HKXA 1AR1D 1U91B 1I8MB 5DHVH 4ODTH 4FHBD 5L9DH 2FZ3B 4I3SH 3E8UL 1IGFL 5DJ6A 2W0FB 1J1XH 2LU7A 1T0NA 5DI8A 4YR6A 3WEXA 5DD1H 4FTVA 1BQHG 1XR8A 1PAMA 2NY0D 4EXKA 2P4AB 4JQIH 2PO6D 1AD0B 3TV3L 4WW1B 5J6HB 1AFVL 1TPXC 1OTUC 4B7IA 3O4LD 2A6IA 3O4OB 4AG4L 5INCA 5HI4D 3DGGB 1JYNA 4NT6B 2J12B 4MNHA 2A6JA 5E00A 5I76B 2M2DA 4CRPA 2C4FU 1G9NH 2VQUA 1UJ3C 5I1KL 3WUZA 4HC1H 4A6YH 2QSVA 4ZUVB 4OIAA 3SO5A 1INDL 4RGNB 4ZUSA 3OZ9L 3AFLA 5TH2B 2DL9A 1NSNL 5JW4Q 1XMWA 2Q3ZA 4PJHF 3X17A 2QTEA 3L7FB 4E41D 1OF2B 1NCBL 1UA6H 2BRRL 1EUUA 5DRWA 5E2JA 3Q5YA 4K07A 4NUGL 3WHXB 1YN6B 4D8PB 3HCVA 4PJIA 3VW3H 3JUZA 4NGHH 4NZTH 5JIIA 1C12A 1X7QB 3GSQA 4Y16B 4WIQA 2C5DC 1JPFA 1QBMH 4U2YA 3RNQB 3RWDB 3VG9B 3MRGA 3EYOB 4P9ML 2QKIB 1N0XL 1YEDA 5MHSD 4DOHB 5JHDE 1EEUA 5JORB 4NNXB 5TE4H 3UTZB 3WXVL 3WNNA 4S11A 2K1MA 2C4FT 3DUUA 2A0LC 3Q6FB 2DM2A 1D7FA 5EIVA 3K8LA 4Y2DC 4U1HA 3T4YB 4XBEH 3ZKXC 1B0WA 3HUJF 2BNQD 2V7NB 4QXGL 1A8JH 5CEZL 4JO3H 3KYOB 2Y36H 4LSQL 3IF1B 4K3JL 3MYZA 3BI9X 4MD4B 2YK1H 4BH8B 1LNUB 1JHKL 1K8DA 2V2TA 1EHAA 3B3IA 3O3AB 5SWQB 1PKQE 1YQVL 4WI5A 5E00B 2VDOL 4GXVL 5F3BB 5T1LD 1IC1A 4MQXC 3WIHH 5GS1B 4Q0XH 2XQBH 2A6IB 1N59A 3HS0B 4W4OC 1BQUA 1NFDA 1RZ8B 3DMMD 5D4QA 4AM0B 2DQEL 5J4MA 4WHTB 4M3JA 3T3PF 1OW0A 4NQVA 3VXRB 4KI5C 4PJ9B 1WF5A 3MRDB 3BP5B 1P7QB 4JJ5A 2IPTL 3IDIB 1WCBA 3PQYD 4Z7QE 1YMHB 1JHLL 2OBGA 3BPNC 3QI9B 1RMFH 3TC9A 3OG6B 1IT9L 4XC3L 5CBAA 5FKAA 2QADD 3DHJA 3GHBL 4L8DA 4PJBB 3MLZL 4JY6B 3K8MA 4M1DL 3TBWA 2Y7QB 1KCUH 1X7QA 3FZUC 4BSJA 3MJ9A 3SKJH 3FO2A 1S9KC 1GJIA 1OTTD 4WI8A 3MRFB 3OB8A 2EDLA 5T3ZL 1NGPH 3HCVB 5I8KL 2XWJB 3BRDA 1JGVH 2NX5A 3TO4C 4HX1B 2XZAH 2DQCH 5E08H 1T83C 4ORGA 2VN4A 4YDJB 2DYPB 4LSSL 4EQ3A 1I1CA 2ZUSA 3QEGH 4U3CA 3KJ6L 3ARFC 1IM9B 3IU3B 4OZGA 5MEPB 4FOMA 2QHRL 5MENA 1M7DB 2PYFB 4UBDD 1T3FA 4N8CL 4LVNB 2MNUA 4HC1L 4RBPH 4F7PB 3OKKB 2YUWA 2CK0H 2E3VA 5LGHL 5KSAA 3OG4B 4U1NA 5BZWB 1LEGA 1MCOH 1JWUB 3H42L 4R4NC 4J3UA 3CDGB 4HWBL 4OFPA 2HP4A 3P3YA 1EDQA 1WWAX 2MHAB 2BOBB 5IVXE 2X09A 3MNVB 1XF2A 1VADB 5KVDL 5DGRA 4ZPTA 3WIIH 3HG1A 1JF5A 4NGHL 4NZTL 2OM5A 5JHLH 4ZQKB 4RZCB 5GGUA 2W0FA 1DL7H 2F58L 5E2TL 1KIQA 4KROC 1U8MB 1I8MA 3G08B 1DE4A 5ENWB 4H1LG 4PPTA 2YN3A 3MNZB 3VE0B 4PJ9A 1D5BB 4KQ4L 2JCCB 3MREA 1ZKAA 5K9JH 3DX7B 4Y8AA 3D18A 2ARJQ 1PG7L 4KK8C 2O26U 5BMFL 3EDEA 2Y72A 3TN0A 5BO1L 3ZDZF 2MQCA 5JW3H 4G8EB 4NNYB 4UV7H 5DEGB 3SDXA 4K2UL 2GTZB 5JW5B 4F7CA 3BKCL 1C1EH 1AE6H 4K3JH 2IMMA 4Z95L 3U36A 2P7TB 3G08A 4G6FB 1T1XA 3SEPA 3K4ZA 2WP3T 4WWKC 4K55A 1LDPL 3FB6A 1KJ2A 4XVSH 2VZOA 1CFQB 3L6FB 3IKCA 4AENA 5E1AB 4NC1C 2M8XA 5C7XL 3EFFB 5IF0B 2ADFL 3OGCB 3LMJL 5B39G 1WWCA 1FPTL 3ARFA 4OM0H 4S2SB 2APTA 4PV8A 1QSFE 1CIUA 4OV5A 5DJ0A 4IDJL 2AGJH 3W2DL 1RV6X 4OZ4A 1MVUA 3MFGB 4XGZB 2AJ3A 4JM2F 1AD9B 3NFPA 1U93B 4M9OA 3ZKNC 1D5IL 3L5WA 1XIWB 1RIVL 4UTBH 3M17B 4NNPL 2HLFC 3QDME 5J9PB 4X80H 3VW3L 1YEIL 4HZLA 1QR4A 2GTWA 1C8PA 1LD9A 2H1PH 4GKZB 1QBML 3RWJB 2XNAA 4KK8D 3VD9A 1UKTA 3JTSA 1SYSA 1X44A 5HYSA 1H3XA 5EUOA 4JRXD 5EO9B 3VXTB 1IRAY 1T89C 4W70A 1S7WA 3HNTL 2JJTA 5HGGS 4JVPA 4EI6A 4M7LL 2ITDB 2VXVL 3NCBB 4YFLI 3EGSA 5C08A 2KUTA 3CMOH 3CZJA 4PJEE 1ZHNB 4NWTL 4G9DB 4B0MM 3MSPA 5GQBA 1FCGA 5IB1A 1UGNA 3WLWC 3BZ4A 4PD4J 2XN9B 4M8QB 4G6AD 1HOCB 3OB0H 4Y5YC 3V6FA 4TUKH 3OQ3B 5F1OB 1K2DA 4HK3J 4J4PD 1K9TA 5GS2H 3CUPB 4IRSD 3O41B 2WWMD 3RX5A 3PNWB 4G8IA 2J8OA 1BM3L 3KYNB 1DEEA 4YEEA 3GSVA 3HAEB 3MLYH 5FHAL 1OAZH 1GGBL 4WHTA 3C6LC 3QJFA 1JGEB 1WISA 4ETYA 1M71A 3D2UD 2BNRB 5DJ6B 2PNDA 5F9OH 3A0OA 5K93A 3EOTH 2B0SH 4YBQD 4DAGH 4EBQL 3FQUA 3PWLB 4Y16C 4BK4A 4PY7B 3SDXF 5KJRL 3BH9A 2AXGB 3FQRA 1I8IB 1RSFA 5TQ2L 3D85B 3CJJA 3VD3A 1EUTA 5L8JB 3BWAA 3HI5H 4NQSB 4ZTOL 4LQ1A 4KQ4H 1CGTA 2V7NA 5CWSB 3HMXA 2CXKA 1JZ4A 4OCSL 5KSUA 2JCCA 4H26A 5D9SA 1XGTA 5EN2B 2OR8A 5F7DB 2EC9U 3FQRB 3I2CL 3OX8B 1SEBB 5DD5H 2JE8A 3RIFK 3LVEA 2D0FA 5HVGB 4YPJA 4Y4FA 5JXAH 5HYSB 3SDCC 4ISVB 1RUPL 1KF9B 2X4QB 5D6CA 2Q20A 3V9FA 4Y1AE 5DR5L 4OCWL 5D2LE 3ZO0A 1JPFB 4G5ZL 4XNUH 3LQZB 5BVPL 4Z9KB 2FWOB 5JA8B 4RAUA 4XAKE 2H32B 1LO0L 1N2RA 3MUZ1 1MCOL 4L1HA 3VXUA 3HUJE 4GT7A 1FPTH 1MWAB 2E9BA 3QISA 4E41E 5C0AE 2R23B 1DN0A 4U6YA 1FNGA 2FH6A 4ONOA 4J3XA 1E28B 2FX8L 5B39B 1WWWX 2NX5E 3DYOA 3RUGB 4K94L 1P69B 1IM3B 1Z0MA 2CDEB 4WHYH 5AWNL 1F3JA 1GAFH 4S1RH 4X9IA 1HQ4A 1A1MB 1CYGA 1HWHB 4P5TB 1MCWM 5EU7C 5K33A 1UCBH 2VXVH 7FABH 2CD0A 5HI3C 3VXMD 4MNGB 3G04A 5K9JL 3GM8A 3AREA 5A3ID 5HDLA 3W82A 5E8NA 5EUOB 4M8VA 4PR5A 2M26A 2XA8L 4QRRB 5B4MC 1NPUA 3GMPA 4JFOB 2LTQB 1F5WA 4JB9H 1E6JH 1CLYL 4QWWD 3PJSA 5MP6H 5CZKA 4EKXA 1Q94A 4JFFB 5BS0B 2VLKA 2GUOA 4I9WD 1I1AA 3U7WH 1G9NC 3VFPA 4HKXB 5L88H 4MJ6A 4TTGA 2DLIA 2YPVL 1NMBH 2BXYA 3HG1B 1P7QA 3HNSL 1GGCL 4EN3D 4KK9D 1C08B 1QPXA 1A21A 2DQIH 3NIGF 3MRBB 2I07A 4XNMB 4UQ3B 4PRHE 1R3KB 1GVIA 4JFPA 5C0EB 2R1XB 1XCQB 1K6QH 5I16A 2AW2A 3BESR 1F3RB 5AUMB 4Z7VA 1TITA 5J11C 3QRFM 4G3YL 2FB4L 2OXHA 4ZFOA 1F4HA 1ODAA 4JFYA 4OM1H 4R2GC 2Z92B 2YWZA 5HGAA 1BIHA 5JMOC 2C9AA 1R5IB 3VXPB 2HVJA 3LQMA 3VXOB 1WJ3A 2NY2C 3FFDB 1IC5L 2H45A 7CGTA 4ONFL 4ZTOH 4BFGA 4QRPA 3X3GH 1YUHB 3ZE2F 5IGXH 1CD8A 1S7WB 4P23C 3OHXA 4OZIB 4NC1E 5MI0C 2OL3B 1GHFH 4CNIB 3L5IA 1RIHH 4PTUA 5TE6L 1I7TA 3D3VB 3FB8A 1I3RA 4G9FE 4AIZA 1U8QB 3LKOB 5IMKA 4TRPH 1T7WA 1RIUH 3P9WB 3MA9L 3KDMB 1MIML 2ZNWA 4PR5B 5DJYB 4G5ZH 4XNUL 4DKFH 3OHXB 4KKLD 4OZIA 4XCCL 2E9IA 5J6GB 2MWCA 3FQWA 4FNLH 5CSZB 2X5PA 5IBUB 2FL5B 3GI9L 4G6KL 1FIGL 2IQ9L 1Y6KR 3P2TA 3DBXA 1I1YB 4QRTB 4X5WB 2Z8SA 4JFZH 4PP2B 2Q8AH 3TO4A 2ESVB 3HZMB 2P24B 4WO4B 4YQXL 5EO0B 2AXHA 4K3DH 1IKNA 3EOAB 1T6VN 6CGTA 5CZXC 2ENSA 1HHHA 3NIFE 5GGVH 3GKWH 1M05B 1YMMD 3FFCD 5ADOL 1G6RH 4UQ3A 3MV8A 2N1KA 4HK0B 3GMNA 1RVFH 2A38A 2A73B 1YMMB 3FFCB 2DIJA 2IH1A 2EYTA 2APFA 1IAOA 1QFHA 5IHUH 4CBPA 1WZ1L 2Q6WA 5HHOD 3OF6D 1CIDA 1YEGL 2NY3D 3HZVA 3UTZA 3K2MC 3LEXA 4DTGH 4NRYA 4M4RA 32C2A 1A7RH 5E2WL