3FFCE

Crystal structure of cf34 tcr in complex with hla-b8/flr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
MGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSFTWTSGGATDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title The shaping of T cell receptor recognition by self-tolerance.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE02
3EUUA 4OIIH 5C09D 2ED7A 3X12A 4N8VB 3MRNB 1YQVL 5D7KE 2C3WA 2P44B 3PQYE 4M1GH 2WM0A 1IAKB 4ODSH 3S36X 4KY1H 3L7EB 1RHHB 4XMLL 1G0YR 4JVWA 4RNRA 3LZFH 1OL0A 4UDUB 3RL2B 2F15A 3A6CH 4Z77B 4MJIB 3FHQA 5I1HH 3BRGC 2NW2B 3BKYH 5D96B 4ZD3H 3UJTL 3F7PC 4D9RD 5EIIA 3OJDA 3FFCB 1CGVA 4AZ8A 3FQWB 1G7JB 2QEJA 1HINH 1TQBB 4U1GC 4U33A 1F4XH 1ZA3A 2IQ9H 3ARGA 4Y4HB 1NL0L 1X6LA 1DTUA 4HLJA 2VOTA 4NWTL 1CR9L 2X4RA 1Y6NR 2FZ3A 2CDGB 3IETA 3TEUA 2AJXH 4EI5D 1BGXL 4P5TA 5MERA 3H3PH 4LPYA 3I50L 1JWSB 2ARJA 2FD6L 1NLBL 2BNQE 4LLUB 4G8GA 5KVDH 1FNHA 4KPHL 1K3IA 4WJ5A 3BRDA 2AI0H 3VWJB 3RZCB 2MCG1 5ICYA 5IW3A 1J8HB 5EO9A 1T2JA 2R2CA 2ATKB 4PJBE 4X5LA 1D5MA 1MCKA 2HKHL 4TNWK 3NIFF 1H8OA 3OV6A 1MQ8A 4KJPC 4HUUA 3G5VB 2NY6C 3RX5A 3HCVA 3TN0A 3KXFB 4M6OL 3QPQD 4BSJA 5T1DL 1W0VA 5TE6H 4R8WL 5E8PA 1FO0H 3LDBC 4P2CG 1GVIA 1TZIA 4YIQA 4X4MA 5B22A 1ONQA 4D0DB 3IJYB 1VCAA 1FN4A 5JPMA 1HSAA 4FFYL 1JHLH 4OFYD 1RUAH 2MPAH 4OLUH 3S36L 2HAZA 4Y7MA 5E2WH 4XBEL 1UCBL 2DBJA 1Z5LA 4PGBA 3O3EA 4X6DF 1MHPL 2C3VB 1ZHKB 4R90L 2F58L 4K23H 3P73B 1I9RL 4XX1E 5CP7B 2G75A 3DARA 4X83A 5E6IA 1PY9A 4M7ZB 1Z6JT 4NWUH 2R1XB 3OKMA 4BK4A 5A2FA 5GRJH 4UQ3B 1JYVA 5DTFB 3WFHB 3ULVF 4K71C 3DMMD 4PJAB 5D2NC 2HLAB 5CJBA 3REWA 4NQXA 2HVJB 3FT4A 4HPYL 1R0AL 4CL7A 3HUJE 5CGMA 5GJTL 4FRWA 4QWWD 5I30H 4FFVD 4WU5B 5FGCE 3EFDL 3D85D 3E6HA 1YQVH 4JQXA 1LDPL 3VXQA 3HE7B 3PXJA 2BVUA 4Y2DB 1EIBA 3MRPA 4XMLH 3WN5A 5HYQB 5I75C 3SJVB 4U6XB 1QBML 1LE9B 4Q6IC 1Z0NA 1C5DA 3RTQC 1YDPB 3TBTA 4XCNA 1JL8A 3AUVA 3L5WB 4O58L 4PRPB 3KDMA 4XMPL 4ZO7A 3QEQE 3O0RL 4UIKL 4CBPA 3UJTH 2FJHA 3Q6FA 3EFFB 3HZMB 1BZ9B 1CD8A 3IB4A 3GSXA 5GGSY 1ZLSL 5DFVD 3G5YB 4F7EB 4W70A 4WI4A 4FQQA 1VGEH 1T1ZA 3BHBA 3QA3A 4HKXB 1A1MB 1NL0H 1EXUA 5IWLC 3MLWL 2B1AL 3AS2A 4NWTH 5CIPH 1LEKB 1XEDA 2COQA 3RWJA 4A2LA 3CK0L 4JFDD 4PJ7F 4XPHL 3ALWA 5DA0B 2GTWB 4ZUSB 2X4TA 2D0FA 3BZ4B 1I9JH 4BM7A 5HPOA 4QYOA 3LQAL 3UDWC 4YHLH 2A6JB 1JJUA 1C5CH 4IIQA 4KDTC 4UIMB 3UJIL 1WGOA 4HCRL 2NYYC 4U0QB 1FO0A 3VXPB 3RIFK 2PTTB 3QDMD 4L4TA 2AK4D 4KPHH 1IGYA 4UU9B 1RZ8A 1G0DA 1ADQH 4Y19B 5L7XL 5B38G 5HHOB 1FFOA 1B0RA 4KMTH 3H7BB 4OQ1A 3LY6A 2W0FA 4ZYKA 5C0CE 5C0AE 4KC3B 3VGFA 3KYMB 3PABA 3BH9B 2HKHH 4U1GB 3QJHA 4RFNC 4M6ML 3D69A 5D9SB 3PDDA 4ACPA 3NA4A 3L3DA 5T3ZD 4YXLL 5DQJA 1ETZA 3T65B 4M6OH 5KSAC 5FUOL 3DVNB 3IKCB 5T1DH 4R8WH 4DZBB 5DHVB 5F7WC 4PJFB 3CCHB 2DYPA 5C0EA 3HNTL 4U2YA 4K94C 4JGMA 3MODL 4FFYH 3D0LB 3MX0A 3RWFB 2DS4A 2XPGA 4NCDA 1BBDH 3S36H 3UTZB 4X6FA 5I1LA 1EZVY 4OFIA 2BJML 4XBEH 5DC4B 1UCBH 3L3KB 4PGJA 1JE6A 1H8NA 1M1SA 3HMXL 1MHPH 4R90H 2F58H 5TPWL 5JXEC 4GOSA 1I9RH 1UFUA 1X4ZA 5SX4H 3S3JA 2OCFD 4G6AC 1LDSA 3EYFB 1J8KA 5JO5B 3MYJB 4OAWA 4NQDA 5J9PA 1DBML 3BIBX 3TZVC 4G9FD 2NY6B 1S9XB 3VGGA 3S34L 1YEKL 4UQ2B 4JFYA 1IC1A 1RIUL 1ZLVK 3LVEA 3MFFB 3WJJA 3UROR 2ZJSL 3LDBB 4HPYH 1R0AH 1AE6H 2EECA 5FUCC 5GJTH 1NGXB 1FZMA 3SDXF 5ISZE 2F53E 3UTOA 3VE0B 1HXMA 3FZUD 3EFDH 4J3VA 1OTUD 2YHGA 3FL7A 5K93A 2O5ZL 1LDPH 1MVFA 4P2OA 5I1AB 5I6XB 3CZFB 3FO2B 4L29B 1HH6A 5IBUG 3RI5K 5HHPB 4J8RA 4U1KA 5DJ8B 4TTDD 5A1AA 3VXNB 5CD3A 5CIPA 2W60B 2I9TB 4FQJL 2VN7A 1CFQA 4OV5A 5LGHH 1HKFA 4G3YH 2A6IA 5I1EL 3KYKL 4O58H 4K71B 3K7UA 4X4XB 1CTOA 4XMPH 3STLB 4UIKH 4JFHD 5F8QC 5BV7C 3EYVB 3D2UA 3K8LA 5GGTL 5B38B 5T1LA 2XY2A 4QGYA 1ZLSH 1T2QL 3VDBA 1FVEB 4C4KO 2W65B 5FDYA 4M48H 4JFPA 1ADQA 4O4YH 3CX2A 3P0VL 4QLRA 2B1AH 1JZ7A 1ZKAA 1NC4B 2ZOLA 5JTWA 1FORL 1RIVL 2D03H 2RFXB 1S7VA 3IXTB 4AL8L 5JW3L 3QISA 5I75B 3PGDB 2VLME 4OZFG 2BC4A 1I7ZA 3EJJX 3LQAH 4Q6IB 5IOPA 2UWEA 4G80A 1G9ML 3RTQB 4HCRH 4MAUL 1AXIB 4YNYB 1ZLVH 1CG9B 3T2NH 4BH8A 3LS4L 3LN4B 5L7XH 2ZCKH 4QRRA 4TUJA 3GDBA 4JVUA 3W11C 3BGFB 3MREA 2V5YA 1IAII 2KPNA 2OQJA 4M6MH 1BIIB 3HTLX 3SOBH 1S7SA 1U36A 5B8CA 4YXLH 3SE9H 4ETQB 1FV1B 4UT6L 2M2DA 4PV8A 1P2CA 5FUOH 4XP1L 2C4FU 4UILL 5AD0A 1KJ2L 1G84A 3BE1L 3MRQB 2P45B 4QOKB 3HNTH 3I3BA 1XCTB 1AD9B 3MODH 3BGAA 5CBAB 2YD5A 3MA9L 1CU4H 4HQQL 3C60D 5EO1B 3T0WA 3GSOA 3STZA 2BJMH 3ULUE 1IKFL 4KMQA 3T2QA 3V6OA 5DO2C 1DVFD 3NABL 3HMXH 3BQUD 3LPFA 2XWBA 1S3KL 5IBUB 5DS8B 4QRSB 1S9VA 4LSPL 4R0LA 1PVHA 5I19L 1YN6A 2IEPA 4ZNCD 5IVXA 5CWSB 3HC3L 4ODTH 2EKSB 4PRHE 1AQDA 1VFUA 1YY9D 1QLEL 4GUPA 4QTHB 1DBMH 4PG2C 2GJJA 4NRXB 2MWCA 1N5YL 1FYHB 1C1EH 1JTOA 1QLRA 4WDIB 3S34H 3C6LD 1YEKH 4HT1H 4K2UL 4U49A 3SGEH 1TMCB 1RIUH 5FYJD 1MCBA 5DRNA 2ZJSH 4I18C 5JHDE 1QHOA 1YC8A 2W07A 2FSEB 2A6DB 1K8IB 5KOVC 4KJWC 2WIIA 4N9OB 3AY4A 2BRRL 3GB7A 2G2RB 2O5ZH 3H9SB 1DEEB 4JY5L 2DTMH 3KLAB 2Y36L 3MV9D 5SV3A 5C0RL 3QQ3B 4JRYB 1U2CA 4HUWB 3VXME 4OZFB 4WUUB 4PY7B 3PQYA 2N4IA 1J0YA 4FQJH 1RAMA 5FV1L 3O6ML 1F3DJ 4HX1A 1SQ2N 4GLRI 1P6AB 5I1EH 3KYKH 3QDGE 5TDNB 3TZVB 2DJ4A 1DQJB 1I75A 1S8DB 1EFXA 2HH0L 1NKOA 5SWSE 3S5LG 1P84J 5GGTH 1KSRA 2D7TH 2A0LC 4HCRA 3OKDA 2ZUTA 4I1NB 5CEXA 1T2QH 4ELMA 1XF4B 3V4UL 1CIUA 2IAND 3T0BA 4NZJA 1I7TB 1FG2A 4XAKD 5FGSA 3P0VH 2QSQA 4GRWE 2GJ6B 1RJYB 3L3JB 3T3ME 5E56A 5FYKE 5I74B 4NSKA 5JZ7D 4LNRB 5JW3H 2F5BL 2NXYB 3RWHA 1HHHA 2VWEC 3BD5A 3PP4L 2XYCA 3W9DB 3QHTC 5ACMA 1G9MH 4K8RL 1LNUA 5J1AA 1OP9A 3SDDC 1XH3B 5GHWL 1DR9A 4U6TA 4HUKB 4PBXA 5BV7B 3LS4H 2APWA 2P5WE 4PV9A 4XP9H 3VW3L 1P7KA 2BNQA 2E7MA 43C9A 3O8XA 3T8XB 2E8YA 2JJTA 3GRWL 2HRLA 3GI8L 1EO7A 2MTPA 3HMXA 1P9MA 4NQEB 1OF2B 3OKNB 4BQBA 1QHPA 5L0QC 4UT6H 2DD8L 4PJBA 4YDKH 3WO3B 2A9NL 2R1WB 3HE6A 5F9JA 4NKMA 1R3HA 3BE1H 2FIKB 1HQ4B 1IC7L 5DVKA 1K2DB 3LEXA 4PGEA 3QIBD 5BCAA 5I17B 4L9LB 4Y16C 1EJOL 4HQQH 1A8JH 2H9GB 3KPRD 4MWFB 1U95A 5IW1A 5ICXB 1IKFH 4XC3L 3O81A 4ZTPH 1QA9A 5FK9A 3ZE2F 5MHSD 5ICZA 5DUBB 5GGVH 3NABH 1INQA 4YH6A 4GAYB 1FNEB 1U41A 3GZKA 2B0SL 4POYA 4U1LA 3HC3H 4ZO9A 4ZFFB 3DXAD 1QLEH 5KSBB 3NVQA 1N5YH 4GKZA 4LOUC 4H0IA 3QUZC 4WTWA 4K2UH 4CRPA 3HS0B 1OCWL 2NY4C 4QCIB 3S5LB 1RV6X 2CUIA 4HG4J 4RSVA 2WWMC 4HWZA 4L3CA 4Y4FB 2VLRE 4GSDL 5HI5D 2BRRH 1GZPA 2A73A 5GGTA 2V7HB 3C5ZC 3HUJA 3ULUL 2LAAA 3P0YL 5F9DC 5HPMB 1UWGL 2W9LA 4L3EE 1BIHA 2VR5A 4BFEA 2Y36H 1MCPL 5C0RH 5HGBA 4O2FA 1CXLA 2NY3D 2V2XA 1JCKA 5BS0E 1NFIB 3RP1A 4PP2A 4XCFL 2M26A 3O6MH 4YWGL 1KJVB 3SE3C 2X9WA 3QUML 1LP9E 2HH0H 3I2CL 3QXTA 4I77L 3X3FL 3QIUC 4KI1A 2PO6C 5KS9F 3D18B 4I18B 4XGZA 4JZJA 1U8LA 3QEQA 3DX6A 3V4UH 1BD2E 1QFUH 2GUOA 1OQOA 4RBPK 1RK1B 4PYGA 4RGND 4FQLL 4PJCF 3DIFA 1Q9OB 2GYSA 4E41B 4Q9RL 1E4KC 1MJJB 2F5BH 4X99A 5F93C 5EZJA 1J0HA 3P4NB 1HE7A 3FB8A 1D5IH 1QTYT 2P24B 3LN9A 1M71A 1MI5E 3BGMB 2ENYA 3MSPA 1BHGA 4KU1A 4R2GD 1F4HA 4Z0XB 4KRLB 3L3HA 4BUHA 1TZHB 1WV7T 3BXNB 5GHWH 3KHQA 5EIQA 1UM4L 5KVGL 4BH7A 1U8KA 4CADA 2NNAA 4Y1AB 5F1NA 2PCPA 4BK5A 3VFWB 5DHYB 2AK1H 3Q3GA 4MJID 3WUWA 4F9PC 3GRWH 1AO7D 2BNRD 3PHOA 4WI2A 5EN2B 3L5JA 4U31A 5AG8A 5FYKL 4NC1C 1KIRB 1ZWIA 2DD8H 1WIPA 5C0CA 3ZYZA 3TO2B 5C0AA 4K55A 2A9NH 3FQUB 4JO1L 3HNSL 4N0CD 2ICES 5CEZE 3GKWL 3VXOB 1IC7H 4Y4HD 1QFWL 4QHNA 4XTRD 1EJOH 2ITCA 2UY6A 3PHSA 4X80L 2JLLA 3SDDB 4HS8H 2R4RL 5GS0L 1S9YA 3BESR 2YUZA 4JO4L 2OP4L 5D2LB 4NQVA 2B0SH 2VL4A 3MXWH 4JY6A 4C56E 3R0MA 3RVWC 1N8ZA 2G5BB 5DRWB 2BNUB 4WY7L 4QRPE 2GTZA 4MJ6B 4OUUB 5GGRB 5IB2B 5E8DH 4HS3B 4WGVB 4LIQH 5L0QB 3HN3A 1J8HD 3MRGA 2DWDA 1OCWH 2JTDA 4PJ9A 4X0KB 1T7WA 5JDJA 3IU4L 5E8NA 4S11A 2R2BB 5C07A 5E24E 3V6FA 1UVQA 2IH3B 3BPLC 3MGTB 4R96B 4GSDH 4Y16B 3GMQB 9CGTA 5ID0B 3P0YH 3SGDI 3B9KA 5ISZA 1UM5L 2F53A 1BM3L 4U1NB 2YXFA 5CZXC 5B3JF 3PGCA 3HI5L 1INDL 1YMMB 3KPQB 4HIIA 5MEPA 3QEHA 1QNZH 3VFOA 4MD4B 1KJ2B 4AIZB 1OB1B 1MY5A 3S4SG 4E42B 3QUMH 4QXWA 4YFLF 2XV6B 1LO5B 3I2CH 5FKAB 3QUZB 1AKJB 3OG4B 4I77H 4FXGB 3D48R 5DQ9A 3F5WB 1KB5L 1Q94A 4L8DB 5IBLC 1TITA 4LSUL 3IFPB 3QQ9C 5IBTL 5KN5A 3V5KA 1HIML 5KANG 5SV4A 4OZGB 4PJGA 1Q72L 4FQLH 4TUOB 2BVPB 3C5ZB 5F70A 5DGQA 5E8EB 2EXWC 2WUCL 4Q9RH 1ULVA 3ARGD 4NN5B 5GS3A 4GQ9L 3VGAC 1XGQA 3GRWA 4ZDHB 3PWNA 2ATPB 5IF0A 1XF3B 3JTSA 1A6PA 1KELH 4PLNC 4X6CB 4OF7A 3VCLA 1VGKA 2QQKL 2OR7A 3TFKC 3HE7D 1EHAA 3MLXL 2X4PA 4DN3L 4Y2DD 3J7HA 1UM4H 2ENSA 1CFVL 1SJHA 3OZ9L 1HQRA 2OXHA 3DURA 1MLCA 4HMCA 4TNVK 2AP2A 4YE4H 1I1YB 5KVGH 1F6AA 2E7LA 5L8KB 3QIUB 2C4FT 3SO3C 4G8GD 2AGJL 1YEGL 3NGBB 2YA0A 3QXUA 3ESVF 3MNVB 3RGVA 4PRPD 3MBEA 2Q7YB 1VERA 4GRWH 5IV2B 4M03A 2NX5A 5D2NE 5FYKH 4ODHL 1U0QA 5I8CB 4DGIL 1ES0B 1S7WA 1ZLUH 1K85A 2GKIA 4JO1H 3HNSH 5A2IH 4GG6E 3GKWH 2IBGA 3DX9B 4QNPE 3SKOB 1QFWH 3SN6N 4IS6A 3TN0D 1QPPA 4HUNB 4XZUA 3L6FA 5KSUA 4KI5F 1RI8A 4X80H 1X7QA 1U42A 3DBXA 2R4RH 2R0LL 3W39A 1AP2A 4G8EA 4JO4H 2OP4H 3JWDL 5BQ7A 4Z7OE 2Z8RA 1FC2D 1A1OB 1UJ3C 3L9RB 4ZPVB 1PG7X 1GIGH 2P48B 4YX2H 3U4EB 4O51B 4J3UA 4WY7H 4HPOL 3S4SB 3E0GA 4NKDA 5E6ID 4XNMB 3QO0B 1R5WA 1JPST 1FNGB 3HLAA 2K7PA 3QUMA 3BWAA 4NYLB 2I5YL 2AXGA 3ZDXE 5JHDA 5IB5A 1EH9A 3PWVB 1UM5H 1BM3H 1MHEA 3MO1A 1XR8A 3T2PA 2DLTA 4ORGB 3HI5H 4F57H 5CJ8A 5HGDB 1YJDL 35C8L 4TSCL 3EO0B 1PZ5A 2XKNB 1BMGA 3OR7B 1WVZA 4N0FB 3O3UN 3VRIB 3VXMA 3MLZH 4K3EH 5ITFB 2WLYA 1S7RA 2OR9L 3PE9A 2VQ1B 4LDLB 1GAFH 3QXDB 3AGVA 1R5VA 3O3DA 1HILA 3MR9B 3ZDZF 1KB5H 5C6WH 2VERN 2H1PL 4AY0A 3QDGA 1CT8A 4M8QB 4LSUH 5HDOA 4P2RE 5IBTH 3H6JA 3EKCA 1HIMH 4JANA 1FNLA 5SWSA 4PJDE 5JNYB 3BPLB 3GMMB 4JRXA 3VI3F 4WCYH 3ZKQD 2PYEB 2EDLA 5DT1L 2DLGA 1VPOL 2JIXA 2WUCH 3LKSB 4G8IB 1OY3B 1EBAA 5HI3D 1AIFA 1WIUA 3JVGC 4OZIB 4LCWD 5E00A 4GFTB 3MJ8A 3RQ3A 5FB8B 2C1PA 3RVUC 4BQ8A 5IVZA 1ZGLB 3GUTB 2QQKH 1WCBA 3I6LE 4KTDL 3PDOA 4YQXH 3KHOA 1Q9LB 4DN3H 4YEEA 3NBNA 3FQRB 3E3QE 3IDUA 3T04D 1CFVH 3OZ9H 3KNBA 5DYOB 1T4KB 1TETL 3MTRA 5JOFB 3KYOB 4LCCC 2YWYA 5J6HA 3ZDYF 1A4JB 1PG7L 1DJSA 3WO4C 4L4TD 2FX7L 2AGJH 1YEGH 1U8IB 1RHHA 2YD2A 2J8UB 4XI5C 4LLYB 3L3IA 4OKDA 4RAVB 4W6XB 4ODHH 4KUZL 4LVNC 4NO3B 4R7DA 3BSZH 4DGIH 3LKOB 5EC1A 5DJ2A 1OPGL 3VGAB 4LLMA 4B41A 3KYAA 4UBDD 1EERB 3HI6H 3OKEA 3MACL 5CILL 4X98A 3CFBA 1PEWA 5EU3B 2DYPD 3ARXA 3GM8A 3U2SA 1DL7L 3QWQB 4V2BA 3VRJB 4K9EL 3WNOA 1CL7I 5FF6B 2P42B 2R0LH 3TO4A 3UTSA 5ACZB 1IL1A 4ONFL 2D31B 3MRHB 2EKJA 3OXRA 2QBWA 1CICA 1KEGH 1J05A 3CDYA 4FS0A 3SO3B 1Y18B 5HGHB 3ARBC 2RIKA 5E1HB 4PJEB 5TGBB 1KPUB 3B2UD 2J7LA 3QWRA 1QEWB 5I1DB 1RULH 3F6IA 3ZL4L 5TQ2H 2J8HA 3V6ZB 2NXZC 5HDLA 4X9IA 5CJQL 4J3OC 1ZT7A 3BN9C 4XNYH 5ESAB 5CEZH 2HWZH 3UP1A 1CS6A 4NQDD 4RISL 2H2SC 3CX5J 1ODAA 1BQHA 1RVFL 3UJJL 1IGJB 5DJXB 5T5NG 4NJ9L 4F2MB 2I5YH 4RRPG 4I3SL 5D72L 5IIEB 2X5PA 1KB5A 5HGAA 3RBGA 2EH7H 4URTB 2CJUL 3NIFE 1KYOJ 4M4RA 2JJVA 2VLRA 4BSWB 5DMKB 3MLTA 5D6CA 5F7NC 2DI7A 5GZND 3J8F7 2QSVA 2IPKA 4P2OD 1UJ3B 35C8H 2AJ3B 4L3EA 4NC2B 1JUFB 1U2HA 4KVNL 4U1HB 4EXKA 5I66A 3PP3K 4JZNA 1GOHA 5D7LE 1FAIL 1F4AA 5BS0A 4TPRL 4DCQB 4I9WE 2OR9H 1FL5B 4OCNC 5KBNC 4NQUA 2Y6SC 4LLWB 4P23A 1HDMA 3U30C 4WFFD 4M8VA 4ZUWB 2H1PH 2R2HB 2P5WB 4LSRL 3BH8B 4H88L 4GAFB 1FE8L 1NGYA 1LP9A 2FGWL 4X6DE 2KL6A 4X8JA 5IMMB 3CFDB 3D2UD 4MLIA 2GEEA 2MKWA 5INDA 4XVUC 4WV1C 4YHZL 2F19H 5T1LD 4X9HA 4HV8B 3KPNA 3RWDA 3QH3B 2FEEI 1VPOH 3ULVE 3CU7A 3DV6A 1TENA 2X41A 3GMRA 5HSFA 1PLGL 3QJFA 4U7SA 4FA8A 1IGIH 1LEGA 3KLDA 4NOFA 3CH1A 1T6WA 5KW9L 1HXYA 4H0HB 1TXKA 3AU1B 4KTDH 2C7UB 4NQTA 4D3CH 1MF2L 4JRYD 4YHKH 1MI5A 1TETH 4TSBL 4WFHD 4KI5C 3CLEL 3U82B 3K46A 1PG7H 4GRLD 2FX7H 5T1KA 5DUPH 4R97C 3B43A 1T20B 1X5AA 1S78C 4I2XB 3DROA 4ZOAA 4QRRD 3SQOH 3QI9B 3DJ9A 2WBJA 4JKLA 3BP7B 4OZ4B 5KSVB 4KXZI 1A0QL 3GSRB 5LAXB 1OPGH 3S97C 4ZAKA 1E27A 4ZUVA 1DDHA 2GHWB 5CHNB 2MHAA 5CILH 2DQJL 4FQCH 3PP3H 1LEIA 3QUXC 3NCJL 2CK0L 3U9UA 1IMHC 1JFQH 1B0GB 4JM2F 2G5RA 3SEPA 2FJFB 3OGCB 5IG7A 1DLHB 4YDIL 1DL7H 1MFAH 4K9EH 1T66C 5J56B 2NXYD 4KRMB 4LPTA 3BP6B 4X8XA 1P4IL 1G9NL 5T1MA 4LCCB 4ENED 4BELD 5BJTA 3ULSB 2FO1A 5IR1A 4HIJA 4PJ7E 3WO4B 4I0KA 1A7BA 2N7AA 4M3KB 1EK3A 1G7IA 4LSTL 1H15B 4OBSA 5BW7C 5GPRA 5T3XH 3IU3A 4CNIB 1L0QA 4EUPH 4IOIB 1CLOL 1NANI 2DWEB 2R9HD 4LVNB 5EOTA 4C56A 3NA9L 2PF6A 2HYMA 2P5EE 4RISH 2H6PB 2YD9A 4FXKB 5D6DC 4JDVA 1OTSC 4NDMB 4QRPA 1CVSC 2DQIH 3GJEB 3T0EC 3RUGF 4C57C 4GW4B 4NQED 4JG1H 5IGXL 1RVFH 3UJJH 2PUQT 1NDGB 2A6KA 3ARRA 5CBEA 3RWGB 2NLJB 4KVCL 5D72H 2WP3O 1BD2B 4ZUTB 4BFGA 2CIKA 5GSVA 3GMNB 1A1NA 1KLUB 1M05B 4Q97A 1LD9A 1SYVB 1GGCH 3EHBC 5GGQL 3WHXA 4PGDA 1NCUA 5E5UB 4KAQL 4KUCF 4OD3L 5E03A 2XN9B 3ARBB 5DD3L 4KVNH 4NJAL 2FR4B 5DJ0B 5D7KD 1FAIH 4H25A 3PQYD 2DQCL 4TPRH 4QF1A 2NXZB 1FDLL 2A1WL 4RMQA 3QFDA 3QNYB 3CUPA 4H88H 4LSRH 3G04B 3E1F1 1FE8H 1EFXD 3QNXA 1AC6A 4YHZH 1I7RA 2YBRA 4WEMB 1U93A 3EYFA 3MRFA 2BVQB 4PJIF 1QVOA 4S2SB 3SDAC 1Z9LA 3B5HA 4Y4FD 1PLGH 1S9XA 3VWKA 4AMKL 4IRJA 1A4KB 5C0BB 1W0WB 1T7XA 2GFBB 4ORZC 4MMZC 5LKNA 3SDXE 1BOGA 1F97A 2B8OT 4P2QB 4LGRB 4TSBH 4Y4KA 3HPLB 2EO1A 3CLEH 3IDIA 1WJ3A 3U30B 4ISVA 4PG9B 5I1AA 3RVVD 4FHBD 4NKQB 4DUVA 5TE7L 2JJSA 4LDOB 2KQMA 3QO1B 2VDLL 4XVTL 2BNQD 4WV1B 5D7IB 3W9EB 4HAFA 3KPPB 4PY8I 4XNUL 4APQB 2BSRB 1F3JB 4XCYA 1A47A 3O8XD 3ULVL 4OGXL 3ARTA 4GQPH 2MCPH 1DBKL 1DQQA 2AV7A 1WF5A 1YUHB 5D2NA 5D1XC 5CMAB 4F7PA 4EUPA 3AXLB 3KPMB 4JJ5A 3NCJH 4UB0L 1YYLL 2CK0H 4E41D 3L7FB 3TA3B 3NCMA 3UYRL 4GG6A 1L4IA 1TVBB 1G6RB 4RFOH 2ESVE 4TUKH 3EJYC 1FFRA 4RIRA 1LE5B 4KGJA 1P4IH 4CMHC 2VLLB 3H0TB 3WCYA 3MJGX 1T7ZA 3NAAL 2M1KA 3THML 2BOBA 2X4SB 4LSTH 1OARL 1HHGA 4R97B 3PGDA 2BOCA 4DJMA 2DIJA 2Q76A 2HFTA 1NCWL 4D8PB 2YK1L 1SMOA 2VLKB 3JTTA 3S35X 1S9WB 3WJLC 4U1SB 3P11L 3NA9H 4WI6A 4DVRL 5LXGL 3RVXD 4YHNB 2HLFC 3BP5B 2IQAA 3JUYA 4OM0L 1BJ1H 5AAMA 5IGXH 3ISWA 2ADIB 4FOMA 2HFGL 5IJVB 3QUXB 4KVCH 1V3MA 4NRZA 1Z9SA 2LAGB 3HZYB 5H94B 1V8HA 3W81A 3TYFB 1ZT1B 3CPLB 5JDSB 5I0DA 2XQYG 4P59L 1T3FB 5A2KH 1FV1A 5DJAB 3Q5YA 1IT9L 3ARWA 4LGPB 1CFTB 3Q1SL 5C0IA 4KAQH 3K2MC 4OD3H 3MRQA 4HH9A 4NJAH 3W0WE 1ZAGA 1I4FB 1PYWB 2YPKB 2AEQL 2ADJB 4GXUN 2YEZA 1FDLH 4HD9A 4KDTA 1IM9A 1T1WB 3DGGB 2A1WH 3HPJB 3IDNA 4PRBA 3N9GL 3T0EB 3GSNH 1CDHA 4NPYB 4XP5L 1I3RB 4LRNL 2CXKA 2EDJA 1N0LA 1T5WB 3MV7B 1NBQA 3QEQD 4F8QA 4P2RA 4J12A 1L0YA 3TM6A 2EXYD 2SEBB 3U9PL 5FM8A 4PJDA 2CDEB 2AJZA 3TPKA 3FB7A 4PTTB 1VKXB 2VXUL 5KSAA 2AJYL 5C0FB 1GOFA 5F6IC 4X6BB 3KPSE 3MXVH 1KCUL 4K07A 2CD0A 1LMKA 3LRHA 2BY2A 4CDGC 3ILPA 5GIRB 3HZKA 1DZBA 1CD0A 4POZD 1N5AB 4UAOC 5A16A 4RCAA 1N59A 4DUXA 3P77A 2WINB 2PXYA 5JA8B 3MPCA 5JXEA 1KPVB 1WFTA 4WW2C 3S35L 3RKDD 5LWYL 4OKVB 4TRPH 4XNUH 1YYML 2R1YA 3ULVH 4OGXH 3IJSB 2DI8A 1DBKH 5EA0L 5SX5K 4OD2B 2ICWA 3FOLB 1NCAL 4X9GA 3GIZL 3O45B 3SDAB 5JPNB 5C0CD 5C0AD 3ZLQC 5IP4A 3GSVB 1YYLH 3T0XA 3UYRH 1SVCP 3EYUH 3QIWA 4D0BA 1ZANL 5C0JB 1UWXH 5E2TL 3MRMB 4F15C 4J1UA 2HFFA 2PNDA 2PR4L 5DC0A 3NAAH 4X4YA 1OT2A 2XWJB 3THMH 4F7MA 3LKPA 1OARH 1Q0XH 4XNZC 4OFVA 5HY9A 2VDRL 4AG4L 5J3HC 1OVZA 3W9DA 2VZVA 4M93C 4G7VH 4KHXL 1KNOA 3LKNA 1AR1D 3HRZA 4YAQB 4DVRH 3MRDA 4LKCB 5F1OB 1XZ0B 2WNGA 4NZRL 5ANMB 5JOEA 5D1XB 4AENB 4LKXB 4LLVB 4OM0H 1NGPL 4F9LC 2R0ZL 2HFGH 1LK2B 1NQBA 3IVKA 4PJ9D 2CDFB 1LVEA 1OAYH 4L8BB 1UADC 2RJMA 3T8XA 2AJVH 4NUJB 3VXTB 4YGAB 4FG6C 3EYOB 1BVKB 3CC5A 1RZIB 4MDJB 3N50A 3GSNA 4P59H 3MQIA 5T5FL 4CMHB 5C92A 3HG1E 3NIGF 1XCQA 3K4ZA 3MRJB 1IT9H 1EEYA 4B7IA 1E6OL 3B9KD 3Q1SH 5ISZD 1MFBL 2F53D 3ZT5A 2F8VA 1CD1A 3ROOA 3H42L 4ZFOB 4NRYA 2QTEA 1FVCB 3RY6C 3AREA 4KTEL 2AEQH 2BVOB 1G7PB 5C0NC 1A9EA 5D5MB 2AV1B 3WIIL 4HK0A 5K9JL 2GAZB 1ZHBB 1WWCA 1KC5L 5D7LA 3N9GH 3ZE2E 5F8RC 3B5GA 3BZFA 4OIAA 7FABL 3LKRA 4XP5H 4LRNH 1FAKT 3M1BB 3X14B 4K8RD 2Z93B 2P8MB 2G60L 1T0PB 3QHZL 1OW0C 2FO4A 4X6DA 5DURB 4MNQE 4CVXA 4AYFA 4P9HL 3OHXB 2ORBL 3U9PH 3G6JB 4KROC 4FABL 2VXUH 2OTUA 2AJYH 5GGSB 1RFDL 2CLRA 2LE9A 1QO3A 3F7RA 1MFDL 3K0WA 3DSNA 1T0MB 5FO9B 4BQ9A 4MNHA 3WHE1 1QRKA 3CLFL 2W9DH 4TNWF 2VLMD 5IHLB 3C87A 5EFIB 4N5EC 1MRFL 1D9KC 1XIWC 5EBWB 2APTA 3S35H 5LWYH 2ZUYA 4ZG1A 2V2WB 2E9WA 5EA0H 5FFLA 4R4FL 1SYSB 1ZTXL 1NCAH 2X42A 4PG2A 4XPBH 3S98A 3GIZH 1UH2A 1A7PL 1QR1B 3V95A 2FDBP 2FBJL 4Z95H 1VFBA 3BUYA 4AM0B 5C9JA 4EQ3A 2VKWA 5F6IB 5KS9E 3OX8B 1K6QL 1R6VA 1XGTB 2ZOKA 2Z35B 3LAFA 1ZANH 1NC2A 2E7CA 5E2TH 4PJCE 5E94B 2Q8AL 4TTGA 2CLVB 4UV7L 4DUWA 4M5ZL 4HJ0C 4UAOB 4JFXA 1IGTA 4MJ4A 1MJJA 3HFML 3DO7A 4I3RL 1GXEA 4JFFB 2VDRH 4GMTH 5D8JH 1YEEL 1GZQB 3DLQR 2UY7A 4WW2B 3ZSSA 4L4VB 2L7JA 3T4YB 4L8SB 4PJ7A 3ULUD 4CMMB 3ABZA 1SJVA 4KHXH 2X1PA 1C8PA 5MEQA 4PY8J 4NP4L 4G42B 1JPFB 2AEIT 4NZRH 2B4CC 3OAUL 2I9LB 4P57B 5JQHC 1JZ8A 1NGPH 2G9HB 4PRHD 2R0ZH 1MWAB 5BRZB 3KGRA 2VLJE 4HIEB 2HT4D 2P5EA 2WBKA 3JBG7 4M1CC 2RQ8A 3VXRE 5AYUH 4GBXC 5F9OL 1OT1A 1TJHH 5KAQG 3ARVA 3DETD 3BD4A 4Z9KB 5T5FH 2VSDA 3BAEH 3U4AA 4EN3C 4F15B 4CW1A 2XZCL 5JHDD 3EGSB 1HI6A 3FN0L 5CGYC 1E0OB 4GW5A 1QFOA 3O11B 3I6KB 4XNZB 5K9KB 3VXOA 2CH8A 3OJVC 4KQ3H 5C08E 5EO0A 4M93B 1KJ3L 1XGUB 4G5ZH 2PYFB 2Q6WB 3WIIH 1KC5H 1Z9MA 3G6AB 4JEGB 3VXMD 4EI6B 3EJZD 4YJZL 4MD5A 4ODVL 7FABH 2VITA 1LO0L 2G60H 3QDGD 1P7QB 4PJ5B 4GG8B 4XP6L 3DRQB 4G7YL 5KG9A 4EKXA 1S5HA 4P9HH 3MV8A 2ORBH 1Z0MA 4YDLC 1MAML 5DRWA 1JK8A 2VXVH 5FO8A 4FABH 3RIFF 4XAWL 1N2RB 4LEOB 5IHBA 2JIXD 4QHMA 4YHIA 1MFDH 5ESQB 2ZUQC 1OGAE 5GXBB 3MRLA 2F74B 5FYKD 5J6GA 4OLYL 2V2TB 3P9MB 1LO2H 3Q0HA 2Y4SA 5I1JL 4OI7A 2OSLA 3SDXA 4DN4L 3CFEB 1PY4A 4KJQC 1KG0A 4FTVB 2FJGB 5F7DB 5B3JE 1YPZB 1MRFH 5DD0L 3HC4H 4KQ4L 2NTFB 5DI8A 3OR6B 1UB6B 5F3BB 5GS0D 1J88A 4FZ8L 4OGZA 3RFZC 2P5WD 1ZTXH 2WQRA 4KROB 2EIZA 3V5HB 1CDBA 4KK9C 2EO9A 1AKJA 2FBJH 3P30H 3AS0A 1NBZB 3QUYC 1ED3B 2EIEA 3O6KH 2X1WL 5DJYA 4U0RC 3U1SL 5BZDA 1K6QH 4LQFL 1II4E 4HXAL 4PJHB 5EBMB 2JB6B 3IF1B 3SGKC 4POUB 3PWPB 3KYNB 4OIBA 3S7GA 2AEPH 3D0VA 4UV7H 1U8QA 1ZHLA 2HFEB 4M5ZH 2ESVA 5DWUH 5I15H 3TO4D 4GKSB 3HFMH 1J1PH 4I3RH 5DJDB 1QYGL 2X10A 5FM5O 1YEEH 1D9KB 1CICD 2FL5A 4M02A 4ELMF 4EBQL 1GGYA 1XIWB 2YD6A 4AEFA 4P5KB 5JHLL 1YNLL 4NP4H 4PFEA 2DDQL 2Q7NA 3QWRD 4HEPG 3WKML 4LRIA 1T1YB 1TZGL 4LDEB 1I8IB 3WV0A 1EGJL 5EU7C 4XB7A 3WXVL 3QI9D 3CSYB 2PO6A 1G7HB 2DQTL 2XZZA 3CFJB 3QUKB 3TBVB 4LU5L 3NZ8A 5F9OH 4KH2A 4TQEL 4WTZA 3NFSL 3W82A 2BCKA 2R15A 3D3VE 3K1KC 5I8CA 4PR5B 1JYXA 1CDYA 1OD9A 1F3RB 4FQHB 4JQVA 3ORJA 3WD5L 3DV4B 1CD9B 2VLRD 3IDMB 1A9BA 2CIIB 1WWBX 1CLZL 7CGTA 5EU6E 1V7NL 1OM3L 4HS6B 5CD5D 3TGXA 1L6XA 4L3ED 4KI5E 2VXTL 2XG5A 2PTUA 2QR0B 4ZFGL 4K3HA 4XPAH 1J10A 2QADB 5BS0D 1P6FA 4ODVH 1WSST 4MCYB 5SWQB 1ZEAL 32C2A 3I85A 5FGRA 3UO1L 1D5BB 1L7IL 3LRGA 5CKGA 2DQDL 1LO0H 5IMLA 4G7YH 2OYPA 4F3FA 1DSFL 5J13C 2ADGA 4XAWH 1AGBB 2FHFA 3RVTD 4F7TB 1BD2D 1HHJB 4UOJA 4A6YL 5MENE 4LSVL 3C8KA 3PL6C 1QSZA 3ECBB 4XVSH 4YBHA 4OJFL 5ERWB 2ZCHH 4OLYH 3KPSA 1HOCA 4W4OA 5I1JH 1RZGA 1BECA 2R0KL 4JKKA 4DN4H 5EC2B 2XN9D 5JQ6L 3VFUB 3IGAB 1MI5D 2GJZA 5DD0H 4KZEL 2YRPA 1R3JA 3GMLA 5M7QA 5T1KD 4C55A 2L4OA 3X3GL 1T21A 4FZ8H 2DQEL 5H35A 4YDLB 2EIDA 4FP8L 4WENB 2WBJD 3FQTA 3TESA 2ZSVB 4GKOA 1EEZA 4YHOL 5D4QA 3QXDA 5FHBL 1BVLB 3TP4A 4PLKD 3JV6B 3ZHDA 4Z78B 1FIEA 3ZDZE 1IARB 1I9IL 3O4LE 3U1SH 4QY8A 3UTQA 5J06A 4YHML 1NGWA 2ZUQB 4HXAH 5DMGD 5CFHA 2I25N 1AGDB 1HWHB 4JREB 5BXFA 3VI3E 5FAAA 5CEZD 3IRZA 2XA8L 1LO3L 4AH2A 4OI8A 1NDMB 4ZFZB 4WI9A 4YBQD 3QDJB 4JPIA 5DRZA 4EI5C 4YDVB 4EBQH 4EQ2A 1JNJA 2IWGA 3MMEB 5MEOB 3VXSB 1YNLH 3U36A 2DDQH 4FNLL 3WKMH 2IMMA 4TOYL 1TZGH 3ARSA 1EGJH 1AGEB 2WP3T 3LEYH 5AYQA 3U4BL 3WXVH 4M7JL 3QUYB 3ZDYE 3N1MC 3ARDB 4APQD 4OF8A 1U8NA 2DQTH 4U0RB 1J86A 3I02B 4QRPD 1AXSB 4DKEL 1AGCB 3MUGA 4LU5H 3UX9B 4TQEH 3T77A 4PS4L 4AQ1B 4MHHI 3QPQC 3GHEL 1I1AA 3R06B 3TA3D 3CD4A 1S7TB 1U3ZA 3W5MA 5HVFB 4PJ8B 3FRPA 3HG1A 3GO1L 5GRVL 1CLZH 4YXHL 1V7NH 2QQLH 1FZJA 1CE1H 2X40A 4CVZA 3HAEG 1JPGA 3I84A 4C83B 1G7QB 3AVEA 1BREA 4QEGA 1EFQA 4N1EA 1ZEAH 3UO1H 1L7IH 4HIHA 2DBLL 1KTRL 2VLKD 1SJEA 2DQDH 3D39E 4IRSA 2P7TB 3PIQA 4MSWB 3TT3L 1IGCL 2H3NB 4PBVC 1UCTA 2H45A 3DMMC 1DSFH 1JV5A 2KKQA 3IDXL 4IJ3C 4Y5XC 4WI7A 5T33H 3WUZA 3QCUL 1WTLA 4MNQA 4JFOB 2FRGP 2AQ1A 4LSVH 5E1AA 1QACA 3EZJB 3C6SA 2IAMA 3LV3B 4IRZL 3VWKD 4CVWA 4QWWC 4OJFH 2X09A 4DZ8B 4IRJD 5CP3H 4FFVC 1IGJA 4U3CA 1H5BC 3IDGA 4U6YB 5CSBA 3GSWB 3CZJA 3FQNB 4WFGE 5L88L 2GCYB 2R0KH 4O9HL 4WW1B 4WU7A 5JQ6H 3X13B 5E9DE 4M3JA 4Y4KD 4LCYB 4AT6B 2Z31A 3BZEB 2D0GA 5IFHL 1NGQL 1F11A 2ZNXA 4U1IA 4Y5YA 3X3GH 1JUFA 3GSQA 4JLRB 5HYJE 5LGJA 2DQEH 3OGOE 4S1SH 4ZUUA 1VFAB 1QOKA 2HTKD 4ZSOE 3EYSL 5J13B 3SKNA 1QRNA 2ZNWA 3P4OB 2X1OA 3MCLH 4YHOH 5FHBH 2X1XR 1FCCA 1RIHL 3G5ZB 1MLBB 3BX7C 1UA6L 5DFVC 4YHMH 3PL6B 1NBYA 4PJXF 1NCTA 5C09B 1EGJA 1UJTA 4JHBA 4WHYH 1MIML 5KS9A 3PWLA 5L2KB 2ZUSA 3ETBF 1I1FA 4PTUA 3V4VH 1LO3H 2DM7A 2NR6D 1UXSA 4JFEE 4PJCA 3RWEA 2OLDA 3QQ4B 2BVTA 1VADB 4YHPA 4RQQA 4X9FA 4PJGF 3RDTA 1A6TB 4ZXBA 4XP4L 3L5XL 1PW3A 3HAEB 2ITDA 2YR3A 3TWCL 2EYRA 5EUOF 5I18L 5DRXB 2FHBA 3P4LA 1QSEE 1GPOL 4P2YA 1IZJA 3B9EA 3PV7A 3GGWA 2VXQH 3GJFH 3P0GB 3NCBB 4D94A 4DKEH 1RSFA 3NH7L 5IEKA 1MAJA 4PS4H 3SHSA 3FQXB 4ODXB 3MBXL 5F71A 4L8CA 1JF6A 1Q9KB 1XF1A 5L2JB 3VXRA 1YEFH 4EVNA 3GHEH 1X5HA 3VMPA 3LD8C 4E5XA 2A9ML 3MNWA 4WEBL 3ROLB 1NLDL 1XR9A 2CLZB 1ZS8B 1GC1L 4XRCA 4HW6A 4U6VL 1ORQB 1DLHA 4PGCA 1DP0A 5EOQL 3REVA 5GGVY 5C08A 5CP3A 5FM4A 1IM9D 1ZHNB 3B3IA 5CZVL 2E6JA 5BZWA 3QNZA 2WZPD 2CUMA 4P5MB 1SY6L 2VSCA 5F44A 3TT3H 4LP5A 2NY5C 5TDPB 4GKNA 1IGCH 4MQTB 2QSCL 5JIIA 5ESVA 2F8OA 3IDXH 4I4WB 4PB9L 4UUJB 3QEGL 2BHZA 3S37X 5CS7A 4P2RD 1MHHB 2F54E 2BERA 1IKNC 1OSZB 3G08A 3IFLL 1JHTB 3TCLA 4IRZH 3RUGE 3UTTE 4GW4A 2XKSA 4Z7WB 1PAMA 4YO0B 3FZUC 4MZ2A 3B9AA 4JVPA 5JR1L 4N0UE 4HFWB 1OTUC 2EDFA 3U7AA 4O2CB 5IMOA 5L88H 5TDOB 1ZK9A 3WNPA 1G9EA 1JPSH 3HC0A 1OGAA 1RUQH 1HEZB 3V5DA 4X6EB 5ILTL 4AQOA 2OI9B 4NQSB 4TTDC 5IFHH 3I6LD 4M43L 4BKLB 2DAVA 5IW6B 1ND0B 4P48A 2E9IA 1SM3L 2PXYD 4K3DL 1FGNL 1GHFL 1ZVYA 4JN2B 1KTDB 1KENL 1PG7W 3DMMB 1H8SA 4CVUA 3EYSH 4IJ3B 4OCYL 1C08A 1A6VL 2DLHA 3CFKB 2V7NB 1RIHH 4NC0B 5D70L 4NN6C 4NZTL 4FQXD 3N1PC 4Z7UF 1CWVA 2VLJB 2DM3A 1N3NA 5ITBL 1FLTX 1H5BB 1MIMH 3D85B 3ESUF 1CGUA 5F1KC 1CDIA 4GXVL 4PJIE 5IROA 5IFJA 3GJFA 2A2QT 1F90H 3GK8H 4YPGB 1S9KC 3QIWD 3I75A 1VFOA 3NOIA 3NFNA 4HUXA 3ARYA 2HN7A 3EDEA 2I60L 3T1FA 3BEVA 1W0WA 3SE8L 4A6YB 4EOWL 1QBBA 3U0TB 4XP4H 3SGEI 3L5XH 1FZKB 4E0RB 5LQBL 3TWCH 3O3AA 1YEDB 4WHTA 4HH8A 5DDHB 1GPOH 4NQCE 4RX4D 1YEIL 2ZUVA 4OGYL 3RRQA 3F12A 4PRNB 2R23A 1BZ7B 1U3HA 3NH7H 3T3PF 6FABL 3GHBH 3MBXH 3S37L 4AIXA 3BMWA 4ZQKB 4YFEA 2BSRA 4WI3A 4LSSL 1T03H 4MX7B 4JFDB 1CFSB 5ETUB 2A9MH 4WEBH 2R4SL 4MQ7B 3EOAA 5CMAA 3VG0H 1GC1H 3D3VA 4H5SB 2UZIH 4U1JB 1Y0LB 1CLYL 2BFVH 4B5EA 5GS1B 2VMFA 3BVNA 4LPWA 3C60C 3QDMB 2AK4B 3ARED 1DVFC 5EU6A 4XC1L 1T04A 3BQUC 2B5IC 4HKZB 4LF3A 2HG5A 5D7LD 3MCG1 1KBGL 1SY6H 3MRKB 1YY9C 4JAMB 4I9WD 2QSCH 1JZ6A 1G7LA 1RZKC 3CNKA 3BDYH 2DL2A 1FLRH 1BFOA 3IXAB 3C6LC 4NKIH 4WWKA 1JZ3A 3IJHB 2Z92A 4LSDA 3NZHL 4TNVF 1U8HB 1BBJA 4L1HA 2CMRH 2E5EA 3IFLH 1X6NA 4BZYA 1N6QL 2DM4A 3JZ7A 1MCWM 4OZHB 3VFTA 4HJGB 1PKQE 5JIKA 3WS3B 2IMNA 3ULVD 5MENA 4ZTOL 1U8OA 4OTXL 4QRQA 1T5XB 4PREA 4MQXD 5L6YH 4MMXC 4R3SA 4MCZA 4FQ1H 5JW4N 3WS6C 5K9OA 1A7OL 1O7VA 2Z9TA 2V6HA 4M43H 3BO8A 1MREL 2L7UA 3TCXA 5LBSL 2DIAA 5EU5B 1SM3H 2ICCA 3LQMA 3CVHL 1GHFH 3MRBA 1KENH 2R0WL 1H0DB 3QFJA 4ZPTA 2VL5B 4OCYH 1A6VH 2LV4A 2J4WL 5FO7B 2AEWA 2IH1A 4PJ5D 3NFPB 4NZTH 5D6DA 2BDNL 3TNMA 3JWOL 5IJKC 1ZVSA 2YD1A 1V5JA 3QP3A 1WZ1L 3MLVL 4MJ5A 5ITBH 4WWID 1ORSB 3O4LA 4XCEB 4DOHE 1QZ1A 4PD4K 4R7NB 1NAKL 5JZ7C 2NY7L 1H3PL 4P46A 2DKUA 1NC2D 1KTLB 2CDEA 4JB9H 1BP3B 4IMKC 5CCKL 2PTVA 2RCSL 2YZ1A 2CRYA 3SE8H 1IAIH 3KJ6L 5F96H 4EOWH 1I7UB 3MOQA 2XWTA 4OCRL 1RZJC 1NPUA 1PQZA 4P3WA 1R24A 3O9WB 5LQBH 1KCSL 4HUVA 1A2YA 2ZG3A 4XHJC 3FRUB 4PJAF 3V2AR 1YEIH 4U4BA 5IB1A 2NY0B 1U8JB 4OGYH 3PHQA 3WDJA 3QPXL 4Q9BA 4NN6B 1EA9C 4M4PA 2VIRA 3ME0A 3HI1B 2IBBA 5IM7B 1FJ1B 5I0ZA 1AY1H 1DN0B 5IEHB 3IFOA 2BXZA 2P5ED 1DE4A 4JPKL 4LSSH 2NY1D 25C8L 4P4KA 5BMFL 1SY6A 1B9ZA 4D0CA 4LAJH 4UINH 3V8CA 5F72S 3OKKB 5DK2B 4HDIA 3QIBC 4KRPC 4X5XA 4Y5VC 2EDKA 1CLYH 5DK3A 4Q2ZB 2DM2A 2IFFL 2BK8A 3E8UL 2EH8L 2AKRB 1JRHL 2PW1A 3DTXB 5FCUL 4XC1H 1OAQL 3FO1B 2Q86B 2GK0B 1CGSL 3CSGA 4OLVL 4AEEA 1GRWA 1DBAL 2ZPKL 5JORA 4G8FA 2BSTA 1KBGH 3R8BB 3FONB 1DQLL 3SGJC 2H26A 2XXCB 3A6OA 1C12A 3D39A 2H41A 5FDWB 4Z7VB 4WI8A 3HR5B 3A0OA 3B9DA 1W0YT 5I73C 4BZ2L 4XVJL 3EDKA 1N6QH 1MVUA 2VE6A 3ZE1F 5HI5C 1K4DA 4JHZA 4ZTOH 1WIOA 5IB3B 1P1ZA 5KANI 1QSFE 1M7DA 4MDJA 3MRRB 3H8NA 1DVFB 1AQKH 5E5MA 1CF8L 2B5IB 2DMKA 1A7OH 3NIGE 2NY3C 2ZP0T 4JZOA 5I8KH 1YN7B 4RAUB 3LSOB 4V1DE 5LBSH 3NPZB 5E9DA 1DN2A 1U9KA 3CVHH 2FWOB 5I76A 5JXAL 5IVOA 4G9DB 4K7PX 5E5RB 2Q3AA 3VA6A 1X5FA 2WK2A 3EOBA 3OF6A 4JFQB 1RK0B 2DOCA 5EU7E 3KPOB 3C6LB 5HYJA 3WJLA 2J4WH 1QR4A 5CAYB 1VHPA 3DUUB 4NM8L 3GSUA 1IM3A 1BAFL 4N0YL 2P8LB 2BDNH 3G9VA 4ZSOA 3JWOH 5DD6A 1FFNB 4PJFF 4QXTB 4OCXL 3MLVH 4RGNC 1I1CA 3H9YA 3G5XB 4HWBH 1NAKH 4NNYB 2NY7H 3TBSA 2Y9RT 4F7CB 5IFAH 5CUSL 4M61B 5JW5B 1A5FH 4GXUM 3MV9B 4CU7A 1ZA6B 5CCKH 5EU4B 2ESVD 3ZE0F 1I8KB 1JWUB 1MUJB 4K3JL 4R2GC 2DJSA 3MZTA 4JFEA 4I0PA 2YPLE 2YZ8A 4JO2L 2YC1A 1ROWA 2Z4QA 5GQBA 4LK4A 3WDHA 1WBZA 3MLPA 3C9NA 2ICEB 3MGOB 3QPXH 2I07A 2VDNH 1FYTE 1RHFA 3U0PA 2IANB 5C0GA 5HYFA 1QSEA 2EYSB 2CRIA 4JQIL 2PO6D 1OAUL 1FGVL 3WFDL 3X11B 3VGDA 1TNMA 4JPKH 2DQFB 1A6ZB 1TQCB 1YZZA 5BMFH 3PWUA 1JGLL 15C8L 3FO0L 4N0CC 3W2DL 1WBXA 2J12B 3CDGA 2XTJE 3A67L 4Y4HC 2X4QB 5LGKA 4XTRC 1JGDA 1T22A 5F1IA 3VFPA 4CGTA 4MD0A 4KKLD 4HC1L 3V0VB 4ODUB 3VH8G 2IFFH 3E8UH 2EH8H 3ARFA 1TVHA 5FCUH 5DMYA 1G7MB 5HHQB 1JF5A 5HBBA 4JM2A 3X17A 4JE4B 4OLVH 1EHXA 1DBAH 1I8MA 1WBYB 1BEYL 2IADB 3U79A 3W0WD 1JNHB 4JFFA 4MQSB 4MB5A 2HJFB 3PJSB 4QRTB 1QBAA 4R4BB 2OM5A 1KULA 1X5GA 5FM5M 3ARDD 2X7LB 5I8OL 1TDQA 1ZSDA 2YRZA 3CX5K 3CVHA 4YHYC 1HINL 3KPTA 1Q0YH 1F4XL 4BZ2H 5DLMH 4X5WB 3QIBB 4Y5VB 4CAGA 1FRGH 1IQWH 1N26A 2OL3L 5FKPB 3KPRB 4NIKB 2B7DT 3RUGA 3UTTA 4PRDA 3TIEB 4PJ8D 4LCUA 1XT5A 4N0UA 1CF8H 2Z91A 3MNZB 4NHCL 1BLNA 4O02L 3VDAA 1IEBB 4HWBA 5J11C 3TBWB 3DXAB 3WLBB 1AC0A 5JXAH 4PBWD 5I30L 2VABB 4LHUA 1QFWI 2EZ0D 3FTGA 4NM8H 4N0YH 1BAFH 3OPZH 4M7ZC 1UZ8A 4YDJB 1DANU 4ONHA 5DEFB 1JWMB 4XCCH 3V9FA 4NGHH 5I73B 3RWCA 1F58L 4OCXH 4F9LA 1S7UB 2GY7B 5SWZE 1X5XA 3TJHD 4XH2B 4BYHA 3UYPA 2YN3A 5EZLA 4U6HB 3ARGC 1MHCA 5CUSH 2AJUH 2D7NA 3F7VA 3ZYIA 2C3HA 2NY3B 4JRWA 4PJIA 2HJKB 1B4JL 4K3JH 1KJMB 1U8PB 5E2WL 1WT5A 3HE7C 3MROA 1JHKL 3VH8B 3KWWA 4Y2DC 1PKOA 3NN8A 3QWOB 4NNXB 3MA7A 2V2TA 1U58B 3ILQD 5L8JB 1R3KA 4I5BB 4XWOD 5J7CC 2XFXB 3MJ7B 4UNUA 4X7TA 4NWUL 2OJEA 1U91A 5GRJL 2DLFH 3VXUE 2A83A 4IEFB 4PPTA 3SKMB 3BEWB 1A6AB 4QXGL 4NQCA 2J3SA 5EZOH 1TFHA 4RGNB 3UAJC 1OAUH 5C8JA 1FGVH 2QKIA 3B6SA 4LNVA 3WFDH 4N8PA 1YMHB 3QQ9D 3RPKA 4FQPA 1IEAA 3F7QA 1JGLH 4MNGE 3FO0H 5GGUB 3W2DH 4DAGL 4IDJL 3A67H 3T0AA 3TN0C 1JN6B 3PG2A 2F54B 4H0GA 2EYTB 1AHWA 1I1AD 2CGRL 5L2KD 4HC1H 4R2GB 1Y6MR 4OFDA 5D1QA 5EBMA 3HG1D 3OSKA 1XAUA 1ZT4B 5ALBL 5I16A 3EO1B 2QLVB 4N90E 1BEYH 4LAQL 2VISA 2CUHA 4BFIA 4K7PH 3OXSB 3QZWB 1A3QA 4MAYD 1P4LB 1JYWA 1AO7B 3D25B 3ZT7A 4ELME 3RJDA 2BNRB 2GITB 5FGBC 4CJ1A 3DX8B 3O41B 5E6IC 1NFKA 4IRSD 2UYLA 4F8TA 4QHLB 5I8OH 5E8OB 3N1GC 2GT9A 2YUWA 1RJZA 1VGEL 1EVTC 1K8DA 1PSKL 4MNQD 3AM8A 2OL3H 4QHKJ 2QJDA 4M9PA 3RNKA 4KJYB 3ARQA 3FT3B 4XNQA 1NGZA 2IAMD 4PRIE 4DW2L 1DUYA 1VACB 1K4CA 1PKQA 1M7XA 1I9JL 1UH3A 1CK0L 4JQXC 4ELKB 3FFDB 4YHLL 4NHCH 1C5CL 4O02H 3B2VL 3PNWB 1NJ9A 4G43B 4KKCD 2C1OB 3ZYJA 4YFDB 3WN5C 4L5FL 3IDMA 2Z31D 1UC6A 1J12A 2CKBB 5I8EA 1FPTH 5IKCB 1ADQL 3DX7B 1SEBB 1MH5A 1K5NB 1UQSA 4HGWB 5INCB 5KTEH 2OTWA 1G1CA 2IG2L 4KMTL 3K81A 1MCHA 5CSZA 4YHYB 4Y8AA 4MCYA 1F58H 2DICA 1EAPA 1X3DA 3GFUA 3DRTA 1ZXQA 3CH8A 5IMKA 5FECA 2Y5TA 2IGFH 4MVBC 4U7KA 5AG9A 5EG6C 4GBXA 3LOWA 1MCOL 3MC0A 3N1FC 4IHOA 4M9OA 5FXCH 3X12B 5HI3C 5JLZA 4EN3A 4S0SD 3DSFH 1W72H 1HHJA 1B4JH 1BBDL 1CFBA 4J4PA 3PGFH 3D87B 5J11B 1B2WL 4J6RL 4KK8D 3O2VL 5FOBA 1JHKH 3HR6A 5I6XC 3SO5A 1F42A 4K7FA 4IIQC 5KSBF 5ID1A 4IMLA 4ZXBD 3RDTD 4UI2A 4HC1A 1WAAF 4NBXB 2NMSA 4NO2A 4QXGH 5EIIB 5JA9A 3BKML 1KIPA 4G6FD 2XACC 3OJDB 1RJLA 2H8PA 2EE9A 1F8TH 1AE6L 2V9TA 1ZA3B 3ARGB 4HSQA 4UDTA 4DAGH 4IDJH 1MPAL 4UBDC 4UTAL 2VLJD 5EZIH 2X4RB 4OF6A 2FZ3B 3BPNC 4HHAA 3VXRD 2CGRH 4EDXA 4NOBA 4RGMC 1CE6A 3IETB 3BKCL 1R3IL 3T08A 4P5TB 3EOYG 5MERB 2O61A 3ZTJH 1TJIH 3UBXA 4U05A 5ALBH 2ARJB 2OL3A 3H9ZA 4G8GB 4LAQH 3LN5B 4RMWA 5LGHL 4WJ5B 5C08D 4G3YL 1TCRA 2FH6A 5F7LB 3B2UC 4F33A 4DKAA 3NIDF 5ICYB 2VJXA 1OGTA 1UACL 5EO9B 2NY2B 3CXDL 1BQLL 1D5MB 4XI5D 3SDCA 2MQ0A 3AS3A 4OF3A 3OG6B 3BGFC 4M48L 4HUUB 3HCVB 1NAMH 3TN0B 4O4YL 3DHJA 5FYKU 1PSKH 1W0VB 3DYMA 5E8PB 5GSRA 5IT2H 4N9GA 1TZIB 4YIQB 4D2NA 3LIZL 1IEHA 1L6ZA 1ONQB 2D03L 1MCQA 3OKOA 2ARWA 1FN4B 4DW2H 1HSAB 5JPMB 2X9YA 1FL3A 2C4XA 8FABA 3MLRL 1R5IA 1CK0H 5HHVL 5GZNC 4P2OC 1OGAD 1KCLA 3B2VH 1QSFA 3S96A 1Z5LB 4PGBB 3O3EB 5D71L 4L5FH 3U0WH 4JKPH 3BRFA 2APFA 2P8PA 3T2NL 5ECJE 4ESKA 4EDWH 2G75B 5E6IB 1W72A 4V1DA 2ZCKL 3TBYA 3P40A 3OKMB 2IG2H 1JTTA 3GIVA 2X70A 1VENA 3REWB 2LFGA 3SOBL 4ZNEE 4Z5RA 4NQXB 3FT4B 3SE9L 3DOSA 5J0BA 3C2AL 1KIQA 2P7TA 4MSWA 3NACL 4YGVA 4WVRA 3WHE0 1MCDA 1MCOH 5AUMA 3VFRA 4MA3A 3E6HB 3LS5L 4XT1C 3Q5TA 1UZ6F 3V8OA 5IHUL 1JPTL 5B4MD 4Z76A 3VXQB 4XPGL 1CU4L 5D2LF 5DJ6A 5EUKA 1B2WH 4J6RH 1HKLL 3MRPB 3O2VH 3E6FA 3WN5B 3M17A 3OKLA 4JN1L 2MJWA 2VR9A 4W81A 5KVMC 4MHHG 5HGGS 3TBTB 4YR6A 4XCNB 4HK3N 2YPLA 4GRLC 4ODTL 1WC7A 3KDMB 3M45A 5H37H 1OTTD 1JGEA 2FJHB 2VZ3A 3Q6FB 1WUNT 4LLAA 3BKMH 1C1EL 1DFBL 1TPXC 3GSXB 4LEXL 5C07E 4HT1L 3TNNA 2E7BA 1U3HD 1FYTA 4PB0L 2BHYA 4FQQB 3BHBB 1T1ZB 4DGYL 1AGFA 3QA3B 5JUEL 3KPLA 2D9CA 1EXUB 1MPAH 4UTAH 5B8CC 4NO0A 3DUSA 4LCWB 1HH9A 3RWJB 3B8YA 2EEDA 3MRCA 5I74C 3BKCH 2X4UA 3L95A 2X4TB 1R3IH 1IQDA 1RUPL 5F88A 3U46B 2DTML 4PJXE 2NXYC 3D3VD 4QYOB 1NAMA 3ET9F 4IIQB 4ENEC 5CSGA 4C59B 2HVKA 1FO0B 2R39A 5HI4D 4L4TB 3V6OC 1IGYB 1MCIA 1RZ8B 5EU6D 3UCRA 3O9WD 1QLFA 3QQ4A 1UACH 4R0LC 4B7LA 1FFOB 2WUBL 3CMGA 2FHCA 4MB3A 1B0RB 3CXDH 3VGEA 1FFPA 1DCLA 2W0FB 2R9HC 1U8MA 1BQLH 4OZGF 2NY0D 4PJGE 4ZYKB 2D7TL 3PABB 1A7RL 1UXWA 3GMPA 3QJHB 1XF5A 5EBLA 3D69B 2FECL 1TTUA 3L3DB 5EUOE 5DQJB 1ETZB 1KT2A 4WWKD 3BPNB 3BD3A 3QXVA 4RGMB 2DYPB 3LIZH 4PP1D 4X6CF 5C0EB 5JOPE 4IOSD 3VD5A 3AY4C 2XPGB 5MEND 3MLRH 3SBWA 5HHVH 4L9LC 4X6FB 5I1LB 3RPIA 1DANT 5D71H 1NUGA 4EI5A 5L9DL 3WEXA 4OF5A 2R56L 4HKBA 4HZLA 4XP9L 3JV4A 2NX5E 1HHIA 4HULB 4OAWB 2IF7A 1WWAX 1HHKB 2IC2A 4D9LL 4NQDB 3VJ6A 5J9PB 5D7JA 3FT2B 3LQAC 4U7MA 5FCSH 1NFDB 4JFYB 1DQML 3C2AH 1NMBH 4YDKL 4LIQE 3NACH 1AD0A 1FZMB 3DVIA 4HZAA 3V7AE 1HXMB 4JDZA 5SWZA 3GMOA 2W0PA 2ICWI 3LS5H 4Y4FC 5IHUH 1JPTH 4XPGH 4P2OB 4P46D 5EULV 1HKLH 1HH6B 3L3GA 5DSCA 1I8LC 3FHAA 4ZTPL 4JN1H 4J8RB 5E2VH 4U1KB 3D6GA 3SCMA 5GGVL 2A38A 5CD3B 3TYGL 5CIPB 4FQ2H 4NT6A 5I2IA 1CFQB 3K80A 4OV5B 1HSBA 1F02I 2A6IB 3HHRB 1IAOA 2BMKA 4LP4A 5GGRY 3D2UB 3BOVA 1DFBH 2C9AA 5T1LB 4LEXH 3T4AA 4S0TD 4DFIA 4JPVH 3M07A 2CR3A 3O8XC 4P99A 3VXUA 4PB0H 3VU2A 1KXQE 4JFPB 4DGYH 3INUL 4PUBH 1AXTH 3QG6A 1MEXL 5JUEH 4Y5XA 3TPUA 2PKDA 4AIOA 4P4KD 5ADOH 2ZOLB 1S7VB 4MNGA 1CQYA 2R2EA 1RUPH 4Z7UE 5EPMA 2BC4B 3E2HC 3JWNC 1I7ZB 3F58L 5IOPB 2UWEB 4G80B 1JGUL 3QRGL 4I0CC 4GRLB 4BH8B 2NY5H 1A7QH 4CN6A 3HMWL 1P69B 1KLFA 1S5IL 2BSSA 4YBLC 2WUBH 4NBZB 4QRRB 1FVDA 4TUJB 1TPXB 1FL6A 4JRXE 3MREB 1A7RH 3SPVA 3RVXC 4HGKC 2HT3D 3WNKA 3TVMA 2OQJB 2H2PD 1S7SB 1QFUL 3D39D 1UKTA 5B8CB 5H2BA 4RWYH 2DIBA 4PV8B 1P2CB 1TJGL 4OZIF 5AD0B 3CXHJ 4QT5A 2VYRE 3WE6A 5IB4A 3T3PE 4OSUL 1D5ZA 1YNKH 1UEYA 1CFNB 1D5IL 1AI1L 4P4RA 3GSOB 3STZB 1GCFA 1M7IA 4PRIA 5IK3A 1E28A 3VFNA 2A74A 2XZAH 2XWBB 5L9DH 4DVBA 5D93C 1S9VB 4R0LB 2J8UF 2W91A 4U1JA 3SQBA 2R56H 1YN6B 2V9QA 5IVXB 2DTSA 1LK3H 1AQDB 5E9DD 2H32H 3PV6A 4D9LH 4GUPB 1SVZA 2AK1L 2X4NA 2NZ9D 3OF6D 4MJIE 3WXWH 1QLRB 2J5LB 5HYJD 5JW4Q 1DQMH 1G9MC 5DRNB 1N6UA 2EDRA 1KLGA 4I13B 4ZS7H 3FFCE 2EXYC 1F6FB 2WIIB 4LVHC 3BW9A 3T09A 3UTSE 1GSMA 3GB7B 1BX2A 3G6DH 2FYYA 2IBZY 1DUZA 5LCVL 4HS8L 3WFCH 3RA7L 1T1XB 4PJEF 3TYGH 3PQYB 2UZYB 5C71A 4HX1B 5DD1L 4JFED 3MXWL 4POZC 4I0PD 4XX1G 1M6OA 3ZYOA 1RQ5A 2XXMB 1EFXB 5TH2A 5IHZA 5E8DL 3RKDC 4LIQL 1MRDL 3OKDB 2L0DA 5CEXB 4PRAA 4ODWA 4ELMB 1S7XA 1EMTL 3K3QA 4YZFF 1QSED 3INUH 1XGPA 1FG2B 1MEXH 3P3YA 5DK0A 4G9FA 2E27L 4EIGB 2EE2A 2IALA 4NSKB 5CEYA 3KXFE 1D6EA 1XGRA 3RWHB 1HHHB 1S7QA 3C5JA 3AB0C 4NN5C 1QQDA 2Z8SA 3TIDA 3F58H 3FB6A 2WLZA 4NFCA 1ORSA 3O6FA 1ZGLM 4OCLC 1JGUH 4GW1A 3QRGH 1QNZL 1LNUB 1UB5A 1MOEA 2GSGA 1IC5H 4NHUA 3ARFD 3QEUA 4H8WL 3IDYC 3U7YL 3HMWH 2ED9A 4BUGA 3TT1L 2WBWB 1RZKH 1S5IH 4JM2D 1J1OL 3KS0J 4PV9B 5C0DA 1QG3A 1P7KB 4HKJA 2BNQB 1KPRA 4W4NA 5F89A 3OAYK 3O8XB 1AR1C 4PLOB 3BDBA 4QRUA 3VFSA 3NGBC 2W0LA 1FZOA 3CSBA 3BIKA 4PJAE 1T0NA 4PJBB 4QGTA 3CMOH 1KXTB 1TJGH 1BFSA 4LMQI 4RFEA 1TCMA 3HE6B 5F9JB 3MRIA 2H32A 1R3HB 4NKMB 3ZMRA 1Y6KR 3E2HB 2P4AB 1XF2A 3LEXB 4PGEB 3LKQA 3AMKA 4OSUH 4NKOA 2YUVA 4U1MA 3MUZ1 1AI1H 1KELL 2F54D 4JG0L 4XBGA 1JF1A 1U95B 5IW1B 4NUGH 2O5YL 4I48A 3B9KC 4JHAL 3RU8H 3UTTD 5DMJB 1QA9B 5FK9B 3ZHLA 5ICZB 2YSSA 3WYRA 1INQB 3QULA 4WNQB 4YBLB 5D1ZA 2ZSWA 5KZCD 3SJVE 4YE4L 3MUJA 4U1LB 1QFPA 3WUWG 4DEPC 1HNGA 4OGAD 4JFZL 4RMSA 4LFHD 2X05A 3PWJA 5BO1H 5F6HI 4GKZB 2DB8A 4N8CL 4PRPE 1CBVL 4KUCD 1D5XA 1CXFA 2AXFA 3BYTA 4K8RC 4TVPE 5T5NF 4HWZB 4L3CB 4WRLA 4ZNEA 2ADFH 5L8LB 1GZPB 2A73B 3FN3A 3HUJB 2MFNA 5IUSA 5LCVH 3CFIC 5FGCB 3OAYH 2WQ8A 3F7YA 3MOAL 3FO9A 5HGBB 4O2FB 2V2XB 5D93B 3RA7H 3ZE1E 3V79C 3UPRA 4PP2B 1HK6A 4NO5A 4RBPH 3C60A 5DD1H 1GIGL 2EIBA 4ZS6D 4YX2L 3BQUA 2E7LC 3LRSA 3N06B 4Y19E 2WIMA 1MRDH 5HHOE 1KB9J 4XGZB 1U8LB 3QEQB 3BFOA 3DX6B 5C6TL 3HA0A 1EMTH 5HJ3A 2DQUL 4G9DA 2GUOB 3TC9A 3WIFA 4LVHB 3H9HA 1CXHA 3DIFB 2E27H 2JCCA 4BSVA 5AWNL 4R9HA 4MS8D 5AAWA 5JMRA 4MGXA 4X99B 5JW4M 5EZJB 5DJCA 1GGBL 3FB8B 4PJFE 1F2XK 1X5ZA 3QSKB 1M71B 1FFQA 2XIDA 4F57L 5D1QD 1SBBA 3G5XA 3L3HB 5DEGA 4PJXA 1BJ1J 5E99L 4H8WH 3U7YH 3TT1H 4JGJA 1M4KA 4BH7B 4HFUL 1U8KB 1J1OH 3RWIA 4CADB 1P4BH 2NNAB 3MLZL 4K3EL 3VFVA 5F1NB 1LQSR 3ZE0E 3ULUC 2X4OA 2PCPB 3IS1X 4PLJD 1GAFL 2RBLA 3Q3GB 1EHLH 3WUWB 2NW3A 2VUOA 3N85H 3PHOB 2LU4A 1ZWIB 5HHNA 1ZV5A 2YD3A 2F9BT 5C0CB 3P9LA 5C0AB 4OLEA 3O3BA 4WCYL 2HT4C 4PD4J 5E2UL 3LMJL 3AB0B 4O2EA 5EUOA 1YEJH 2GSIA 3BPCA 4QHNB 5IJKA 4MA8L 2AAVA 3DETC 2KH2B 5AZ2L 5J8OA 3QXAA 2ITCB 4JG0H 1J5OH 2R29H 2O5YH 4JHAH 1S9YB 4DKDC 3IDYB 4YQXL 4P5TD 4KV5F 1HYSD 4NQVB 3VD9A 4OB5H 2VC2L 4JY6B 5D7IF 1MFCH 4JFZH 1N8ZB 1MQKL 2Q3ZA 2GTZB 3EJZC 4N8CH 1CBVH 5DZLA 1ZLWK 5T3XE 3U6RA 2NY2D 4H1LH 3MRGB 2DWDB 4WO4A 4PJ9B 3BSZL 5E8NB 5C07B 3V6FB 1UVQB 3HI6L 1AH1A 3V7AG 2CRZA 4S10A 5HHXH 5HYSA 2OXGA 1O7SA 2JB5L 3B9KB 5ISZB 2F53B 2DKMA 43CAA 3CVIL 3PGCB 3MOAH 4HIIB 5MEPB 3QEHB 4R4ND 3SY0A 1KEGL 3VFOB 5FA3A 2JK5A 4S1DD 5B39A 4J4PD 4DEPB 1J1XH 3H3KA 3OKYA 5DQDL 3FCTA 3DVGA 1R3LA 3BMVA 4IDLA 1U92A 1RULL 3KJ4C 5TQ2L 3C5SB 5DQ9B 3UXFA 2KDGA 2PW2A 4OQTL 2NCMA 4LLQA 4TVPL 5GS0C 4MB4A 4XNYL 5F3HA 5KN5B 5CEZL 5C6TH 2HWZL 5FA4A 3V5KB 4RMUA 2DQUH 4LBEA 5BVJA 3SGJA 1IVLA 5J12C 5ADPH 4U2ZA 2CO7B 1EAJA 5AWNH 4Q0XL 2CR6A 2O26U 1PGRB 3FN9A 1XGQB 1H3TA 1Q9WA 3PWNB 3WL9A 2EH7L 5IF0B 1GGBH 5DJZA 4OV6F 3JTSB 1U6AL 4QOKE 1INEL 3VCLB 3I3EA 1VGKB 1ZLWH 2N1KA 3VD3A 2XY1A 2Y7QA 4Z7UA 2X4PB 5CLTA 4OT1L 5E99H 1SJHB 1HQRB 3DURB 1MLCB 1CICC 1F6AB 3I6GA 4HFUH 1NEZA 3UPCA 3FOMA 3L3OA 4GAJL 3BP4A 4GRMA 4YUEL 2JELL 2GK2A 1B4RA 5HXMA 2D9QB 1C5BH 2W9EH 4XBPA 3MBEB 1PX4A 3OTTA 3IDJA 2NX5B 1AFVL 3ES6A 2F19L 3QI9C 1S7WB 3LQZA 3SDCD 3EO9L 4XXDA 4TSAL 5E2UH 3LMJH 3JV0A 3Q6GL 3HZVA 4P3DA 3K2UH 4IS6B 4MA8H 2EEAA 4LLDA 4XZUB 4UV4L 3L6FB 5KSUB 5CJXA 5E7BA 5AZ2H 4JKWA 4IOFD 5IQ9B 3RNQA 3FB5A 4H1LA 3UZVB 1X7QB 1IGIL 4KTYA 1RZFL 1AP2B 3H9SE 5GGUA 3OJMB 4G8EB 3UZEA 1X4XA 3UEZA 4D3CL 5BQ7B 4YHKL 2VC2H 4JRYE 4N8VA 5CD5C 4HK3J 3MRNA 1QSFD 2FEDD 4WUUE 1N0XL 3WSQL 1IAKA 1T89C 1MQKH 1MFNA 2VDKL 3L7EA 5DUPL 2EC9U 4NKDB 4UDUA 4PRHB 3SQOL 3RL2A 2MMXA 3ZKSD 1W2KT 1R5WB 4RMVA 4KDVA 4P49A 4Z77A 4MJIA 3HLAB 3QUMB 5FUCE 2NW2A 3BWAB 4GT7A 3ZHKA 4FQCL 2AXGB 5JHDB 5IB5B 2GJ6E 3FFCA 2GQHA 1WFNA 2JB5H 3FQWA 1JFQL 1PFCA 1G7JA 1ZOXA 3EYQD 1MHEB 3MO1B 1XR8B 3BJ91 1MFAL 3CVIH 4Y4HA 2F5AL 3U7WL 2QHLA 2CPCA 1A3LL 1PZ5B 2CDGA 2VAJA 2OTPA 4ZMAT 3U83A 3OMZA 4DKFL 5DQDH 2ZG2A 3U48A 3VXMB 4KKAD 5T3XL 1E4WL 2DQGL 1SMAA 3VGBA 1S7RB 3CGTA 3AAZB 1R5VB 3O3DB 1HILB 5TQ0H 4OQTH 1BQHG 4TVPH 4OCMC 1JWSA 3QDGB 1CT8B 4LLUA 1XMWA 1T2XA 4BQ6A 4JANB 5SWSB 3ARZA 3JWDC 3VWJA 2DQIL 3RZCA 3OAZK 1VEPA 2WBJC 4JG1L 2YXMA 2Q20A 5LG1A 3HB3C 1HCVA 1J8HA 1FYTD 4Q0XH 2JIXB 4PLKC 4JHWL 2ATKA 4MLSA 5DMGC 3ELAT 3ZKND 2C3XA 1AIFB 4GRWB 4NO0D 3I9GL 4ZO6A 2V5SA 5E00B 3MJ8B 1U6AH 1GGCL 3H3BC 2C1PB 1F4WL 3G5VA 1INEH 5IVZB 3KXFA 4JPWH 1X9QA 1MCCA 1WCBB 2XTJD 4XB8A 3PDOB 5FUZL 5D5MF 4OT1H 5K59F 3KNBB 4YBQC 4D0DA 3IJYA 5CJOL 1O5DT 3KJ4B 5J6HB 4GAJH 2J88L 4YUEH 2JELH 3MJ9L 2QQNH 2F8XC 5JIHA 3QXWA 3L3IB 5J12B 3BZDA 2C3VA 1ZHKA 5FOJA 1AFVH 5KSBE 3P73A 4R7DB 3TV3L 1YJDC 3RIAK 1KEMH 5CP7A 3G6JF 5EC1B 4APQC 1WAAE 5DJ2B 5DHVH 2R1XA 3EO9H 4LLMB 4TSAH 4UQ3A 3Q6GH 5DTFA 3WFHA 3OKEB 4PJAA 4WHDA 4UV4H 2HLAA 1UKSA 4X98B 3CFBB 3R0NA 2HVJA 3U2SB 4J23A 4KKBD 3TA3C 1RZFH 3UTSB 3TO4B 1BF8A 2WV3A 1DQDH 1IL1B 1CGYA 4LPVA 4OCWH 3OXRB 1CICB 3MUY1 1J05B 4WU5A 1HN1A 1L7TH 3OAZH 4OF0A 1N0XH 2NPLX 3HE7A 3WSQH 3KLHD 2VDKH 4Y2DA 5TE4H 5E08L 5HYQA 3VD4A 3SJVA 4U6XA 3SKJH 3UTPE 1LE9A 1ZT7B 4BFBD 2P46B 1IILE 1B6UA 1NCCL 1YDPA 2RHEA 3LN5A 5D7JD 2MCPL 3T1WA 1OLZA 1BQHB 3L5WA 4PRPA 3NIDE 4K94L 1CLCA 3EFFA 3HZMA 1BZ9A 1YEHL 1KB5B 5HGAB 4OQTA 3G5YA 4E41E 4F7EA 5MI0C 4RFOL 4TUKL 1CQKA 5SWZD 2VLRB 5BVPL 3MLTB 3VWKC 1ZE3C 5D6CB 4HKXA 4IRJC 3RKPA 1A1MA 2F5AH 4YFLI 3U7WH 2IPKB 5A3ID 1LEKA 4L3EB 1A3LH 4WW2F 1A02N 4HIXH 5C1MB 4TVSa 3RAJH 4DKFH 1JVKA 5I66B 2GTWA 2W92A 4JZNB 3SCMD 4ZUSA 5C2BL 3BZ4A 1E4WH 4Y4KC 2DQGH 5BS0B 3MYZA 4Z6AT 3WBDA 1IAIM 2X6MA 2A6JA 4P23B 1HDMB 4GAGL 4UIMA 5A40E 2BHUA 4K9EC 4Y1AE 3VXPA 2PTTA 1NGYB 1LP9B 4X7FC 4X8JB 2JJSC 4UU9A 2HTKC 5INDB 4LASH 5FGBA 3KG5A 4Y19A 2VNCA 3KPNB 3RWDB 5HHOA 4C58B 5B21A 3VXUD 3H7BA 3CIQA 4FMFA 4JHWH 4PYHA 3ZT6A 4LHQB 2FB4L 3KYMA 3DV6B 3BH9A 3GMRB 3I9GH 5HDBF 5D9SA 3QJFB 4RDQF 2VWEE 1KUMA 1F4WH 1LEGB 3T65A 5GISH 3CH1B 2Y5EA 4O00A 1HXYB 3DVNA 3IKCA 2ZZUT 4DZBA 5DHVA 5HVGB 1KFAL 5FUZH 4PJFA 3CCHA 2NR6C 5J4MA 3D1MC 5CJOH 1MI5B 1WZLA 5BV7L 3BDXA 1UZ6E 3D0LA 5EORL 3RWFA 4Q58C 3DVFA 2WAHA 5D2LE 2J88H 4HBQA 3RX7A 5T1KB 3UTZA 3MJ9H 2QHRL 2P43B 3V0AC 4KK6D 3L3KA 4DQOL 3DROB 1BQUA 4WTXA 3GSNL 4N90D 4KK5D 3MV8E 2WBJB 3TV3H 4HUMB 3GBML 3TVMD 5JO5A 4ZAKB 3MYJA 1E27B 4ZUVB 1DDHB 3Q5OA 2MHAB 3IAGC 1LEIB 4QHUB 4ZO8A 3U9UB 1WITA 4UQ2A 5IG7B 3MFFA 3MXVL 5DGRA 1NGXA 5T1MB 5ELIA 3VE0A 4F37K 4LCWA 3OWEA 1CR9H 5BJTB 1YPZF 5IR1B 4HIJB 1YMME 4PRID 1G7IB 4XHQA 1B3JA 3U46A 3IU3B 3MLUL 1BGXH 3CZFA 3FO2A 4L29A 5E08H 4ERSL 5HHPA 1ZGLP 1C7TA 5DJ8A 3I50H 5EOTB 3VXNA 4C56B 2W60A 2FD6H 1NLBH 2VXSL 4TRPL 2I9TA 2WWKO 1NCCH 4JDVB 4QRPB 4EUPG 5FIEA 4X4XA 4K94H 3STLA 2A6KB 5CBEB 4PJHF 1UH4A 3EYVA 4OZGE 1KN2L 1YEHH 2CIKB 5GSVB 5KAQF 2AABL 5B38A 1A1NB 3HE6D 1FVEA 2W65A 1LD9B 5EOCJ 2BY0A 3EYUL 5BVPH 1JI1A 1LGVA 3WHXB 4PGDB 4OZFH 4OLZL 1NC4A 4X6CE 2RFXA 3IXTA 5FYLE 1Q0XL 5C2BH 1KACB 4H25B 4QF1B 1LWRA 4Q6IA 5HHME 2FX9L 4G7VL 4AEHL 4GAGH 3QFDB 3RTQA 1DBJL 3CUPB 3E3QC 4YNYA 3MJ6A 1OP3K 1CG9A 2PXYC 3QNXB 1G9NC 5H8DA 1I7RB 3LN4A 2YBRB 1U93B 3VFMB 3MRFB 3AROA 3MJ9A 1F5WA 1OAYL 1HHKA 1QVOB 5MI0B 2AJVL 2FB4H 4FQXC 3FT2A 3VWKB 1BIIA 1NFDA 4IRJB 5IWLA 4ETQA 1KOAA 3LB6D 3BN3B 4N1HB 1BOGB 1KFAH 2EE3A 3QIWC 4QOKA 2DJUA 3O6FD 4Y4KB 1XCTA 5BV7H 1AD9A 3IDIB 3UDWA 5EORH 5CBAA 4ISVB 5EO1A 3B9VA 2QHRH 5J89A 1FCGA 2YKLL 1OLLA 4DQOH 1QBMH 2DN7A 5DS8A 4QRSA 4XCYB 1X5IA 3GBMH 4NC1E 5CWSA 1DQQB 2EKSA 2AV7B 3O4OC 3O0RH 5D2NB 4F7PB 2Y07L 4QTHA 4EUPB 4NRXA 4JJ5B 5F7UA 4WDIA 1NUFA 4GG6B 5HD8D 1V3KA 5K33A 2D2OA 4RIRB 2EC9T 4KFZC 2FSEA 2A6DA 2APBA 1K8IA 3MLWH 1OP3H 3CK0H 3RGHA 4XPHH 2G2RA 2BOBB 3H9SA 1DEEA 2W9DL 1HHGB 2BOCB 2Q76B 3KLAA 3MLUH 5D1ZD 3AREC 4ERSH 1I3GL 3QQ3A 1VFMA 4JRYA 4HUWA 4Z18A 3JTTB 3UJIH 4MXVF 4OZFA 4PY7A 4WUUA 1XGYL 4L8SC 2VXSH 4GRLA 3NPSC 2WW8A 2IQAB 1TTGA 5C3LD 1JGVL 4XPBL 5TDNA 2NZIA 3TZVA 1DQJA 4M00A 1S8DA 3AC0A 4NRZB 4Z95L 5D7SL 3DI2B 1KN2H 2AABH 5C7XL 2PYEE 1XF4A 2IBZX 4HLZH 1I7TA 2GJ6A 5C0IB 1KTKE 1RJYA 3L3JA 1Q8MA 4OLZH 3ULVC 4OZIE 4NFDA 4LNRA 4HH9B 4JJHA 4MQXC 4N68A 4GMTL 5D8JL 2YEZB 1CFNA 4FFWC 1IM9B 2VKXA 1WK0A 2FX9H 4W68A 4AEHH 1WFOA 3IDNB 1DBJH 4PRBB 4JO3L 1XH3A 5TPWH 1E4XL 3MLYL 4OLXL 4WFEE 2J8UE 2I26N 2GIYA 1EV2E 4UNVA 4G6JL 2B39A 4P2RB 1HCFX 1BVZA 1EHNA 5K9QI 4PJDB 4RFNB 5AYUL 2AJZB 2D7OA 3FB7B 5C07D 3DNKA 1TJHL 4NQEA 1OF2A 3QR2A 3OKNA 5KSAB 3BAEL 2CKNA 3MUHL 2R1WA 5FYLL 1B6DA