3FFCE

Crystal structure of cf34 tcr in complex with hla-b8/flr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
MGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSFTWTSGGATDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title The shaping of T cell receptor recognition by self-tolerance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE02
1OGTA 4I9WE 2NY3D 2CMRL 3EO0A 4YPJA 3KYKH 4JO1L 2IH1B 4QHNA 1IM3A 2X4PB 5J3HC 4DAGL 3HAEB 5HI3C 2EE3A 2VLKD 5E5RB 1RZJC 2VIRB 1TFHA 3W2DH 4RGOL 5C9JB 1OOAA 1BPVA 3MJ9H 3TWCH 5HVHC 2F5BL 2JELH 1DN0A 4IIQA 1OVZA 4BQCA 4Y2DB 5C2BH 3BKYH 2JJSC 4PGCB 4Y19A 3THMH 1VENA 4LFHG 1NUGA 3I50H 2FJGB 3EAKA 2J2ZA 1OTTC 5BQ7B 4O4YL 4NM4L 4HGWB 1EAPB 2R4RH 4NQVA 5HHPB 2H8PB 1QSED 2CDFA 1A22B 4HT1L 1C7SA 4Q6IB 3K3QA 5MEOB 1WC7B 4AEIH 5JW4Q 3FOMA 5IVXF 4JR9L 3TN0B 1CD1A 5DMGC 2E8ZA 1SBSH 2H26A 1K6QH 3V0WH 4XP5H 5I19L 1P5UA 2MHAB 1FFPB 1ZS8A 2E6JA 2R0KL 5FGCB 5CJ5A 3QG6B 1AI1L 5CJOH 5CLTA 4YR6B 4LCCC 1D9KB 3EYSL 2AV7B 3OGOE 1QBML 2OP4L 4PJFB 4G9FB 1RIHH 5IQ7H 4UB0H 1MY7A 5HD8C 4M6NH 5I1HH 4GAGL 2V9TA 1OP3H 4NSKA 4EXPX 3ROOA 4Y7MA 5HPMB 4I4WB 1S7TA 3P9MA 2D31B 4KTDL 3QEHB 3WSQL 4F58L 2EC8A 4OCLC 2D7TH 1BBDH 2QEJA 5DMGD 4WFGE 2OJZH 3D3VB 2ADIB 4BFBD 2IH1A 5HYJD 2DIJA 2X4PA 3KXFE 1AC0A 3HAEA 3O8XB 4QHUB 1FNFA 3MLWL 5E1HB 3TFKD 1AKJB 3WNMA 2VIRA 4IRSD 5C9JA 2DL2A 2FX8L 3VXUD 4FXLA 4PRHB 5D7LB 3CSBA 4WENB 1FAIL 4K3DH 1PVHA 3B9VA 1CFVH 4PGCA 4FFZL 2FJGA 4WV1C 4B53A 2CMRH 4KKNA 2VQ1B 4YBLB 3HRZB 4HGWA 1EAPA 5HHPA 4MWFA 2H8PA 3P9WB 1X5GA 3BGFC 3IDMA 4OD2B 4PJXF 4Q6IA 3BDYL 3U4AA 2F5BH 3TN0A 3IS0X 4PUBH 2BY3A 5DF0A 3KYNA 1KN2L 2MHAA 1FFPA 1N8ZB 3QG6A 4KZEL 1D9KA 3TBSB 2ADFL 3G08B 5IBTL 1FZOB 4PJFA 2YXMA 3CLFH 1G7IB 3DX8B 4PYGA 4Z9KB 1D6VL 2D7PA 3V4PH 4ZTPL 4JZJC 4LQ1A 5HPMA 4I4WA 1X9QA 3ULUH 4LOUD 3QEHA 4HF5H 5I19H 2B4CL 4KKLD 1QLFB 2R0KH 3B2VL 1BZ9B 4RGNB 3JWDC 3HC3H 3N85L 5CGYC 1RVFL 4JE4B 4OZIB 3D3VA 1QBMH 2ADIA 2PYEB 3MUY1 3EHBC 2VISB 2Y72A 3O8XA 4QHUA 5GZOC 1YNKH 4GAGH 4MNQD 4X7EC 1ED3A 1AKJA 4GLRH 4LLWB 2C4XA 5EWIH 3C2AL 5D7LA 4KTDH 3WL9B 4PB9L 5LG1A 3QHFH 1NUFA 4XPAH 3ZDXF 3MCLH 3MO1B 3PWNA 3T2QA 3ULUF 2DOCA 1MSPA 5IB1B 3VMOA 2W9DH 1G9NL 2W07A 3HNVL 2VQ1A 3LEXB 1P7QB 3HRZA 3VXMD 1VPOH 1FFRA 1WT5A 5B21A 1NGYB 5EBLB 4NT6B 4UT7H 2A9NL 4V1DE 3EHBD 4CKVX 3C6LD 3ZLQC 5F9DC 4Z6AT 2VZOA 3LQAC 1FAIH 2ICWJ 3ALWA 1MCWW 5E8EB 1N4XH 4GMTH 5EC1A 4BQ9A 1N8ZA 2GK2A 3N1PC 5ICXB 3TBSA 1RZFH 3G08A 1FZOA 3ARSA 3ZKND 4Y2OA 2CDGB 1DEEB 4PLKD 4UDTB 1G7IA 3DX8A 2V5MA 4XP6L 3O0RH 5FYKH 1S9WB 3HG1B 3CLEH 4J6RH 4DEPB 2A1WL 2R69L 1ONQB 2AEIT 4MQXC 5L8JB 2YPVH 4TSCL 3MACH 1QLFA 4BUHA 1A4KB 1BZ9A 1OL0A 4DKAA 3J8F7 3OPZH 5HHOE 4OZIA 5F7EL 2PYEA 1HKFA 1F4XL 2IF7A 2NZ9C 3QFJA 3UBXG 4ZTPH 4LLWA 4NKIH 3QQ4B 1MFDL 1MCWM 3SDDC 3SGJA 2B4CH 3WL9A 3B2VH 5DHVB 2VZVA 3MO1A 4ETYA 5IB1A 3UTTE 1DLFL 3N85H 3RP1A 4NC1E 4MQXD 3QH3A 1P7QA 2YPKA 2DQGL 2JE8A 4UT9H 4P49A 5IEKB 5TDOB 4R7DB 1NGYA 5EBLA 3DO3A 2YUXA 3CSGA 4U05A 1A6PA 3C2AH 5AZ2L 1G7JA 2ZOLB 5BRZE 4OQTA 2GI7A 2NZ9D 3IU4L 4R4NC 1HSAB 3KJ6L 2BOBA 5HHQB 2FD6H 5E8EA 1LO5A 3BQUD 1G9NH 3RWIB 5ICXA 5FUZH 3RWJB 2CDGA 4OBRA 1GPOH 1DEEA 3OWEA 4UDTA 5GGVY 1NCBL 4OZHB 1Q9WA 1S9WA 3HG1A 5FYKD 3TYFB 4L9LA 3RA7H 4NQXB 1X5JA 3LRHA 3TF7C 2NXZB 1ONQA 4BSWB 2EZ0C 1FV1B 4JPKL 5EORL 2JCCF 2CK0L 1I8KB 2CGRL 4HFUL 2DQDL 5F7LB 1A4KA 5C0AD 3F7VB 4LRIC 3SDYH 1IC1A 1MFCL 3B3IB 5E8OB 4XVTH 3MRHB 3D25A 3B9KD 1H5BA 4NRZB 3L5JA 4XP6H 5DGRA 1OCWH 4ZUUA 3M17B 3QQ4A 2R69H 5FYJH 4WWID 3S97C 4JFEB 4XVUD 4UOW1 4JPWH 3GI9L 5I1EL 5DHVA 2ATKB 1I1RA 5ACLA 4LMQE 3V4VH 3HZMB 1YEEH 3AY4A 5F7EH 1JF5A 2VL4A 3M45A 4PJ5D 5IEKA 3E6HB 5TDOA 4R7DA 1TPXC 1N59B 3IGAB 4TTDC 3A67L 4N8PA 3SKJL 5CP7B 43CAA 2NY1B 1WTGT 1HSAA 4HUUB 1EHXA 5HHQA 1HEZB 4FFVC 4ERSL 3L3JA 5EPMB 3MLTA 1OAZL 3X17A 5IMOB 5C08B 4M3KB 1X5HA 2Z93B 3C60A 1T4KB 4G6ML 4K8RC 2FEDD 1KB5L 3RWJA 3EJJX 1UG9A 4QYOB 1XIWC 2CJUL 3AXLB 2AXFA 5IK3B 5BV7L 1SEBB 4OZHA 4FTVD 3TYFA 2L0DA 4HIJB 3ABZA 4NQXA 5IW3A 4WHDA 5AWNL 3BO8A 3KJ6H 5L88H 3OKMB 3CFCL 1ULVA 4CU8A 1PG7X 2YC1B 1I8KA 3B5TA 3WIHA 3F7VA 4FFVD 3B3IA 5E8OA 1L7IH 3TCXA 1IM9B 2PW1A 4NRZA 2Y25A 1NCBH 3SE8H 3SCMB 4LLUA 4POUB 4K8RD 4ZOAA 1YPZF 2PTUA 5DMJB 4HUXB 4V1DB 4YHMH 2Z8VC 5B38G 4ONHB 3K0WA 5FYJD 4JFEA 5E4EC 2DQEH 5IW6B 1UEMA 1EJOH 2CGRH 4HFUH 1NJ9B 3HZMA 2AEWA 1FYTB 1RJCA 4ZXBB 3DRQB 4LAQL 3WS3B 3T2NH 5BO1L 1FCGA 4P0DA 3ILPA 3FHQA 5B3NA 5D72H 5JQHC 4HBQA 1CGXA 4G6AC 1N59A 3IGAA 1RUQL 4PJEF 2NTFB 3BN3B 3RHWK 4GW1B 1CFQB 1UEYA 4HUUA 5I1EH 1HEZA 3W5NA 1J1XH 5EPMA 4EQ2A 1RUAL 5IMOA 5C08A 1JN6B 2Z93A 2DIAA 1T4KA 2YWYA 3E2HB 3V79C 4HKBB 4EI5D 5HHOB 4QYOA 2KUTA 5IK3A 1MWAL 1NC4D 1SEBA 3O4OB 2VZUA 1O7SA 3A67H 4HIJA 1T20B 1CGSL 2MPAL 3SKJH 4XPFL 1OAYL 4WUKH 3SE3C 4JFXB 3OKMA 4PJGE 2YC1A 3F7YB 3ULSB 5BVJB 4OF0A 3UTTB 2RCSL 3WMSA 5FB8B 4R4FL 1BVKB 4S1SL 1IM9A 3O3EB 5F1IA 3SCMA 4FXGB 3RAJL 3PHQB 4XC3L 4O2CA 1WFTA 3C08L 4HUXA 2P42B 4NN6B 4S1QL 4XMLH 2VABB 4ONHA 5BRZB 4PR5B 4GRLB 4Q2ZA 1YEIL 3CFCH 3CVIH 1K5NB 5DJZA 5IW6A 5C3LD 4JKKA 4Y1AE 1JBJA 1E6OH 2FH8A 1FVDB 1NJ9A 2VDPL 1XCTB 1FYTA 3SGKC 4ZXBA 3DRQA 3WKML 3WS3A 4KKAC 4QWWC 1MIMH 1EK3A 1ES0B 4JVWA 4LVNB 5JDJA 3WXVH 3HE7C 2R29H 4GW4B 1EO8H 5MENE 3QO0B 3IT8D 2NTFA 3EW3B 2VXQL 5BMFL 1AE6H 3CVHH 1FJ1B 2Z31C 1CFQA 3ARDB 4M6OH 5D93B 5F1SA 4CRPA 1V7NL 5K9JH 1JN6A 4LPTA 2IBZX 4LAQH 3C5JB 5BO1H 5DZLA 1HINL 5ID0B 2DB8A 2X89A 4J3SA 1BF8A 1BM3L 2F5AH 5T1LB 3SE4A 4U0RC 1T20A 1P69B 2XWTB 5TQ0L 2EIEA 3HE7D 2AJYL 2AK4B 4JFXA 1EFXB 2AS5M 1LEGB 3ARXA 3L3HA 1M05B 3N1GC 3F7YA 2YPLE 4QXUH 4HIXH 4ODXB 3VJ6B 3ULSA 4X7TA 3EDEA 4G8GB 5BVJA 3UTTA 5JPNB 2R0LH 2Z31D 5IJKC 2VAAB 3OKKB 1BVKA 4J4PC 3LMJH 3O3EA 4M8QB 1MWAH 1TJIH 4AG4H 4KRPD 3QEGH 4FXGA 2L4OA 1N0XL 2L7UA 3PHQA 5IKCB 4ZUSB 3ARBC 4OCSL 1LO4L 1CGSH 4JFFB 3HMXL 1U3HC 1OAYH 2VABA 1HWHB 2FO4B 5BRZA 4PR5A 4GRLA 1DL7L 1K5NA 2R1YB 1CGVA 3CSYB 3GBML 4N5EC 4I18C 4P9HH 4CMHC 1IZJA 4JFHD 5ISZE 1FVDA 5EZIL 1XCTA 2RCSH 1O5DT 2V7NA 4KDWA 1UM4L 3BP4A 4N90E 3EYOB 4S1SH 1FE8L 1WICA 1FBIL 1ES0A 3E3QE 3RAJH 3S8WA 4GW4A 4RRPG 4XC3H 1J5OL 3QA3B 1EMTL 1R3JB 3QO0A 4S1QH 4BH7B 2I60H 3EGSB 1U8KA 4F57L 1YEIH 3VI4E 4K94C 2CPCA 4WI5A 1FJ1A 5DD3H 4F9PA 3ARDA 1JZ6A 3ARBD 2EH7H 4NZRL 2VDPH 1TJHH 5DMYA 1HQRB 1JGVL 4F7TB 3C5JA 4HHAB 1MREL 4G6KL 3RWFB 5FDYA 5LGKA 1NEZB 3FT2B 4OZFH 1DVFD 5T1LA 4YWGL 5H35B 3DXAD 4JFZH 4EIZC 1HE7A 2CKNA 3EDJA 3S34H 1J8HD 1RULL 4LIQE 2XWTA 4ZFZB 2J7LA 2AK4A 1EFXA 5CWSB 3FQNB 1LEGA 1FRGH 1M05A 1V7NH 4ODXA 3VJ6A 4UTAL 5DLMH 4G8GA 5JPNA 2IFFH 2Y7QB 2B39A 5ADPL 2VB5A 4DKDC 3QPQC 2BHYA 2VAAA 3OKKA 1BM3H 2GJZB 5IESH 4M8QA 1SY6L 1M7XA 1S7VB 4ODWB 1MFAL 2QKIB 1GOFA 4IM8A 5IKCA 2ESVE 2ED9A 1NMCB 3CMOH 1T5XB 3QIWD 4JFFA 4P2RB 1IE5A 2FO4A 2DJUA 4PJDA 4YAQA 2R1YA 3CSYA 5D5ME 2EE2A 5BCAA 5DURD 1BQHG 1KN4L 1A3LL 1NH6A 2VXVH 4R0LB 4U1LB 3EYOA 1CE1H 3VRLE 5DUPH 1TXKA 2F53E 3MUJA 2AJXL 3RWEB 1YN6B 3IJHB 5C2UB 1G9MC 4X6EB 3K2MC 4JFDD 4BH7A 1J1OL 1LVEA 3EYFB 1MF2H 5CD5C 2VDLL 2YKLH 2QQNL 3GBMH 1NLDL 5E7BA 3TIEB 2BVEA 2EC9U 4ZG1A 4EDWL 3AREC 4O58L 1X5KA 2ARJQ 1HQRA 1UM4H 4F7TA 2NY0C 4NZTL 2W91A 1WBYB 1X5LA 3AS0A 2PXYD 3RWFA 2KZWA 2CLVB 1NEZA 3FT2A 5HDOA 3LQZA 1B2WH 5H35A 1IQWL 4P5TB 4FP8L 4ZS6C 3KPQB 1XF2B 1YEFH 5INDB 2F8VA 3SDAD 3DMMC 3DECA 4ONGH 1FSKC 5CWSA 1NQBA 3FQNA 4Y1AB 5HYSG 3ZDYE 1JGVH 4FN0A 2Y7QA 1MREH 4JPVH 5KSUB 1RHFA 4G6KH 4XWGL 3RVTC 4A2LA 4NBZB 2PUQT 2BNRE 3ARED 3MJ7B 4GBXB 2GJZA 2YZ1A 3ARUA 5GJSH 1NMAL 4YWGH 1S7VA 2QKIA 2NY0D 2P5WE 5MENB 1T5XA 1Z2KA 4P2RA 3I6LD 5LQBL 2P46B 3ZSTA 4KFZC 1PLGL 3BKML 3QUYB 3VD3A 4LVOB 4LAJH 4ZS6D 3UBXB 4KVCL 3B4NA 5A2FA 4DN3L 5EO1A 4UTAH 4JG0L 2PYFA 3KHQA 3RGHA 4R0LA 2DLFL 4U1LA 4HQQL 1BOGA 1F58H 2EXWC 3BGAA 3IXAB 4FQJH 2X05A 3GMQB 1MFAH 4NOBA 3RWEA 5L9DL 1EEZB 4FQIL 3IJHA 4X6EA 3EYFA 4Y4KB 2OTWA 4OSUL 2V7HB 3EOTL 1FDLL 1MJUL 3PL6C 3C87A 2PETA 1NBVH 4ZSOE 1WBYA 2QQKL 4AEHL 2CLVA 2AJXH 4Y19D 4I3RL 1MCPL 1MFNA 1XF2A 3KPQA 1CL7L 2P8MB 1J1OH 5INDA 5JA8B 5HTSA 1A6AB 1MCSA 3QCUH 3MYZA 5J11C 1NLDH 5HDQH 3D39B 4G8EB 4Y1AA 4O58H 5IG7B 3ZYIA 1JJUA 5DHXB 4NZTH 5KSUA 3V6BR 2BC4A 3T4AB 2FSEB 2JB6A 3MJ7A 4JREC 1DQQB 2LVCA 1KUMA 3LH2L 5EOQL 1CI5A 1F3RB 1HHKB 5MENA 1GSMA 1FNSL 1H15B 3BZEB 3QIBB 1LE5B 3K2UH 2DD8L 3QUYA 3UBXA 4EBQH 4LEXL 2IPTH 1TVDA 3IDXL 5LCVH 5L8KB 1RJLB 1OSPL 3BSZL 4XWGH 3RVXD 1IILE 5KJRL 4M7LH 3IXAA 4NQSB 1NFDA 1T89A 3G5VB 3GMQA 1KJVB 1EEZA 2E7BA 3T0AA 5IGXH 5LQBH 3EBAA 3GSUB 1HKLL 4Y4KA 3SO3B 2YD9A 1QOKA 5E56A 4KVCH 5AUMB 4JKPH 3QCVH 3BYYA 3OSKA 1FZKA 3CX5J 5JQ6L 4JN1H 2DQFA 3GM0A 3JZ7A 1C12B 1IBGH 2F9BT 3CXHJ 2C9AA 4Y2DD 4M7KH 5J7CC 3FFDB 1IC7L 1T03L 2P8MA 2CUIA 1A6AA 2HT3D 4NZJA 3KYMB 3C9NA 3D39A 1AY1L 4G8EA 1BEYH 5D5MB 3RU8L 5IHLB 5F7NC 1MJUH 5IG7A 3O9WB 4AJ0A 2GTZB 3TN0D 3NTCH 5E0QA 1GGUA 1EXUB 2QQKH 4M9OA 3T4AA 2FSEA 4AEHH 5K9QG 3WJJA 3NIFF 5H8DA 4I3RH 2F53B 1DQQA 1MCLA 3O8XC 2WUCL 2P47B 1CL7H 1HHKA 3A6CH 1D9KD 5BMFH 2P5EE 5HHNB 4UT6L 1H15A 3BZEA 3QIBA 3LVEA 1LE5A 1D5IL 1Z9LA 4G9FD 1SJXA 1N6QL 1JMZA 1EGJA 2G5BB 3GGWB 4S0SD 1NLBH 1UACL 2F58L 4NFBA 5B38B 1AO7B 2E27L 1J18A 1RJLA 5K9OA 1LO2L 4N1EA 3V5HB 3L6FA 3RQ3A 4HGKC 4YBLC 4NQSA 5JW4M 2ZWLT 5EOQH 4CJ0A 3G5VA 3ZZ1A 1KJVA 1PW3A 1WT5C 2CRZA 4Z7NF 3GSUA 3D3VD 2IH3A 5F6HI 1QFWL 2DD8H 4KROB 3FN0H 3O8XD 4WI3A 5AUMA 2XKSA 2MWCA 1AKJD 1B9ZA 3GDBA 4ETQB 1KIRB 2CUHA 4AMKH 1ZVYA 5D7LD 1OPGH 2B5IC 4OCWH 5KW9H 1HHIB 3RPIB 2BNRB 3V6FB 3NACL 3V8CA 3RL1B 3P0YL 3FFDA 2OL3B 2P5WB 2Y6SD 4P57A 4KY1H 3FCTB 4AK1A 4PRIB 4OZIF 3AU1B 3CDFA 5DR5L 5EO0B 5D5MA 3MV8A 1JZ4A 1I3GL 1R3IL 3O9WA 3MBEB 1TCRB 2NY6B 3EOAB 1MFEL 4HWNA 3PF2A 1EXUA 3Q5TA 2B1HL 1DLHB 5EULV 2ZP0T 1R0AL 4KC3B 4NCDA 2F53A 4U1HB 5A1AA 4UQ3B 5HHNA 2FB4H 3JUZA 5HDBF 4H88L 3H3PL 3KLHC 2G5BA 3GGWA 3SGJC 4NKQB 3BT2L 4PY8I 5B38A 1AO7A 4GLRI 4M93C 3O3UN 5JPMB 1RZKC 4JO4L 3V5HA 3QNXB 4ZSOB 1HDMB 4HKZB 4HJ0C 3TJHD 4RGND 5A3IC 4Z95L 3QNYA 3HTLX 2PYED 4RAUB 4CU7A 5DD0L 3K4AA 3PP4H 4X9BA 5HYQB 3BMWA 1A1NB 2DQIL 3L3DB 3QP3A 1UACH 5M7QA 2DQHH 5FYKU 3NZHH 2Y23A 4ETQA 4J3XA 1KIRA 2BVPB 1LO2H 1W72B 1QR4A 3BP6B 3KLHD 3VDCA 5E08L 1CDYA 1F3JB 3BI9X 4NHUB 1HHIA 3RPIA 5CBAA 2BNRA 3V6FA 4QRPA 3RL1A 1EHAA 4EVNB 2XN9E 2OL3A 2XXCB 2P5WA 4L9LC 1P7QD 5H2BA 3NAAL 1R3KB 4X9FA 4PRIA 2IPUG 3AU1A 5A3ID 2QQLH 5IB5B 2IQAB 4L8SC 3MBEA 1CQKA 1BFTA 2J4WH 1TCRA 3EOAA 1KIUA 3AAZB 2EO9A 1EHLL 3D0VA 1DLHA 1DFBH 4J23A 2ICES 1H5BC 4F80A 1FFNB 4U1HA 4Y4FB 4UQ3A 3CPLB 1GGTA 4PLOB 5C07E 1JK8A 4YX2H 3ZE0E 2YD5A 3ES6B 4YK4B 3HG1D 1R3IH 5HYIA 4PRAB 4WTZG 3STZB 5JPMA 4O9HH 3QNXA 4ZSOA 4PJHE 5ABDE 1WTLA 1HDMA 4HKZA 4AYFA 4XPTL 3T8XB 3BP7B 1QEWB 5I1DA 1GCFA 2CK2A 4RAUA 3MODL 4R97C 5HYQA 1A1NA 1NMBL 4M1CC 2Q76B 3WFEH 3L3DA 4MVBC 4KVNL 4OT1H 3BT2H 4MGXA 1I3UA 1MCIA 2OTPA 2BVPA 4OZHF 4NQEE 1WCBA 4Z76B 1W72A 4JO4H 3BP6A 5E8DL 5CEXB 2LTQB 3C60C 1AFVL 2ICWB 5JHDE 4NHUA 1B90A 1Q1JL 3MROA 1V3KA 1WIPA 4EVNA 4G8FB 4Q9CA 4YXHH 5F8RC 4X4XB 5FDWB 5DD0H 1G0YR 1R3KA 4G8IB 4GQPH 4M03A 2V9RA 25C8H 5I1AA 3PE9A 2OXHA 3UROR 5IB5A 2IQAA 5CGTA 3WXWL 1QA9A 1D5BB 4E9LA 4N0CD 5EG6C 2EKJA 4LSDA 4M1CD 5L7XL 3AAZA 5C0BE 2FJFB 5FYJU 3RWGA 1OP5H 2APTA 1A6VH 1JVKA 2ATPB 2YUWA 2HKFL 1FFNA 5F7FA 4JRXB 5FGBA 3CPLA 3NAAH 4WFGD 5HPOA 2WMPA 4OBSA 3NCYP 3ES6A 5F1NB 2CH8A 3U9PL 4PRAA 2DMCA 3PGFL 3MGOA 3STZA 2NXZD 1EHLH 4PJIE 1II4E 1BQHB 3AM8A 4WUUB 4PJ7B 3Q48A 4JFOB 5FCSH 4W4OA 1SY6A 3WFBH 1LK2B 4Z7WE 4HPYL 5H94B 4R90H 5DQ9B 4LHUG 3T8XA 3BP7A 1QEWA 1MEXH 4D0DB 1AJ7L 2C4FU 3OAZK 4MX7B 1WISA 2NY2B 1FVEB 4RRPA 3FQXA 3P77B 5E70A 2Q76A 3F7PC 3SEPA 4C4KT 4CVZB 2NY1C 5IR1A 4PLNC 2ZUWA 4K9EC 1DQMH 1MJ8L 4YDLC 5FECB 2ITCB 4RFOL 3HA0A 3WEXB 4IOFD 4JFED 4QGYA 5CEXA 2FECL 4O5LL 1V8HA 2ICWA 4LU5H 3J7HA 3V0AC 1TDQA 4G8FA 2LAAA 2WW8A 3ULVC 1I9JL 4X4XA 5FDWA 4WCYH 1RUKL 4G8IA 1EFQA 4GKNA 4LSRL 1QFWM 2HT2C 4LKCA 8CGTA 2X1OA 4DTGL 4NRXA 1U8MB 1KXQE 1D5BA 4Z7OE 5E8DH 5KAQF 2ZPKL 2NY1D 2FJFA 3DX9B 3QAZB 1KYOK 5HYSB 2MCPL 3CDGB 2ATPA 1UFUA 4OFIA 5DMKB 5C08D 1L0YA 4KH2A 4JRXA 1J1PH 2VDKH 4ZO9A 3VGEA 4GAJL 1IFHL 2MKWA 2XKUA 2XZCL 4Q9QL 1OWWA 1Q0YH 3O6MH 3GMLB 4XP9L 4LPUA 1BQHA 4YDKL 4WUUA 4PJ7A 3HI6L 4JFOA 2HKFH 4MA7L 4QF1A 1IGIH 1LK2A 1AC6A 5H94A 1U41A 3RX5A 4U1JB 5DQ9A 4BZ1L 4D0DA 2KQNA 5HHVH 1IM9D 4MX7A 1IZKA 4PRDB 3NMEA 1FVEA 2X40A 5CZXC 3P77A 3SCMD 1IGCL 1ZA3B 4X99B 4CVZA 3U9PH 3QUKB 4L3CB 5FECA 4V1DD 3QDME 2ITCA 2BFVL 3WEXA 3ESUF 1JGDB 5MP6L 4FABL 2QV2A 5IFHH 3ZTJH 1EEUA 1FYTD 3SE4C 4ZXBD 1AJ7H 4UBDC 2A0LD 5C07B 4NKMA 5DO2D 1GIGH 1A2YB 1EZVY 1OLZA 1U8MA 3S35X 4RFOH 4I0PB 1T3FB 5CZXD 3H9SB 2ICCA 4RMQA 5E5MB 1JZ8A 2WV3A 3OAYH 4U49A 1HH6B 2HLAB 2H32A 3LZFH 5HYSA 2APWA 5D6DA 2BRQA 4LSTH 5DMKA 1I8LA 4WTWA 1QHOA 5F9OL 1J9CT 1PJ9A 1UCBH 1I1YB 1I9JH 5HHOD 2H6PB 1ZLWH 5GGSY 5T33H 2X89D 4LSRH 3KLSA 4GRLC 1CD8A 5DMIH 1OAXL 4ZO6A 1OP3K 3V9FA 3O6KL 4OUOA 4S2SB 3GI8H 2ZPKH 3AS3A 5GRVL 1FNGB 3GMLA 5JHDB 3HLAB 3MLZL 4RFEB 4PGDA 4LVNC 1GHFH 2HWZL 1C5DB 3UTTD 2BNUB 1DE4B 3HNTL 1A6UL 4GUPB 1KEGL 5E2VH 5GJTH 3RZCB 2PW2B 4PRDA 2XACC 3BWAB 1ZA3A 4X99A 5D93C 1NGXB 4ZO7A 3QUKA 1LDPL 4L3CA 2KL6A 3IDGB 5D7SL 5BRZD 4GRLD 4XP9H 1KLUA 4WGWB 1JGDA 1JYWA 1Q8MA 1YEKL 3MFGB 3BW9B 3ALXA 4MA7H 3TT3L 4U7MA 3WIFB 1DP0A 4BZ1H 1JI1A 1NGZB 5DFVD 2QSVA 1GC1L 3BYTA 3DVNB 2NLJB 4U6VL 1H3UA 1S9YB 4LFHD 5C07A 1ZEAH 4R2GB 2AKRA 5KN5B 1A2YA 3GJFH 1DBKH 4GSDL 4PV9B 1NGQL 1V7ML 4QOKB 2BFVH 1T3FA 4L1DA 2Y5TB 3H9SA 5E5MA 3ARDD 3G5XB 2HLAA 5I16B 4XWOC 4LNRB 2HLFD 4FABH 1I3RB 2R0ZL 4XTRC 1GRWA 3E6FA 4NWTH 1I1YA 3SO5A 3QQNA 2H6PA 5GHWH 1DQJB 4MXVF 1RMFL 5T1LD 1A21A 1CCZA 5C0GB 4LASH 4HBCL 4WU5B 2X9WA 1OGAE 4S2SA 2ILLA 5DK0A 1B0WA 4TSAH 2AK4D 1EFXD 4WEUD 4K07A 4WI9A 1YNLH 3RFZC 2X7LB 4WI4A 5ACMA 4G8GD 2BNUA 1F90L 1FNLA 1DE4A 1LMKA 4CJ1A 2ZUQB 4GUPA 1MCRA 3MLVL 2PW2A 4XTRD 3JSSA 4MMZC 3BWAA 3ISWA 4AL8H 5CJXA 1BIIB 2I9TB 4JFFD 5DJAB 4JN2A 3IDGA 4AM0A 2X10A 4ONOA 5GS1C 3SKNB 4C56B 1XF1A 2O5YH 2XQYG 2D7MA 3BW9A 3LCYA 4G43B 4PJAE 4AQ1B 1A1OB 2HWZH 5TQ2L 3T04D 3WIFA 4N0RA 2WZPD 3UTQB 2EE6A 5I75B 1NGZA 3HNTH 1A6UH 4NYLB 4ZOCA 2XA8L 3DVNA 2NLJA 5FFLA 5KTEH 1S9YA 3LKRB 5CD3B 1BGXH 5KN5A 1LDPH 1CDJA 4WW1A 4PV9A 2W60B 2UVFA 4KK6D 4QOKA 4CGTA 5D7SH 3OAUH 5F7KC 3O2WH 3G5XA 1RZ8B 4XXCA 4U7SA 5I16A 1BMGA 2VDQH 2VMFA 4LNRA 1HZHL 1I3RA 4G5ZL 1LEKB 1ACYH 2O5ZL 3MNZB 1ZGLP 4HW6A 3QUZB 3RBGA 1NMCC 5DD5L 2FGZA 4XAWH 4FMKA 1DQJA 1NC2B 4TVPH 4DVRL 5KSVB 3B43A 1S78C 1RI8A 5C0GA 1UA6H 4WU5A 3C2SA 4F7PB 1QFUL 4P2QE 1BD2E 3I85A 4N1HB 1MCJA 4R0LC 2Z8RA 3KYAA 2R0ZH 4ELME 2X7LA 3VG9B 4JCMA 1DQDL 3L1OL 2Q20A 3PUCA 1ZXQA 2G9HB 3ARWA 4Y5YB 4H1LH 2Q87A 1A4JB 1U8HA 2D7QA 5SWZB 4XVSL 1KOAA 4HBCH 2I9TA 4P2RD 5CZKA 2XRAH 5JXAH 5DJAA 3VXNB 2OJEB 3KPRB 3CZJA 4P23C 3DO7B 4KMTL 4LIQL 3T3PE 5FM5M 5CBEB 1S78D 3SKNA 4C56A 5C8JA 4DN4L 4G43A 1A1OA 5C0IB 3UTQA 1IKNA 4OKDA 2C3XA 4ZNEE 5F72S 4NYLA 5L6YL 1IAOB 1K8DB 4MD5B 1K3IA 3U83A 3LKRA 5CD3A 1IVLA 5EU6E 5I30L 2WQ8A 2W60A 3G9VA 2WP3T 3ARFB 4YDIH 1PSKL 2VLMD 2B1AH 1UH2A 1XT5A 3NH7L 1F4YL 2Y4SA 5FV1L 5TQ2H 4HJGB 3UZEA 1LEKA 1QBAA 3MNZA 3W5MA 4UNTA 1RIVL 3QUZA 3QNZB 5CP3H 5FUOL 4L8DA 2XA8H 1KCSH 4TULL 3F7RA 4TVPD 1NC2A 3VG0H 3UJJL 4OD3H 5KSVA 4OKVB 4P5TD 3KS0H 4TRPL 4F7PA 4KKCC 3P30L 1G6RL 3RX7A 3Q1SL 4Y1AD 1UKQA 4OTXL 5CS7A 4YHLL 5CSBA 4ODSH 3ZKQD 5TGBB 1T7XA 2G9HA 4GBXD 4Y5YA 1JYNA 2W59A 3MA9L 4NNYB 1A4JA 2GHWB 5SWZA 5E2JA 5DD1H 1UXWB 5MEND 2V5YA 4BQ8A 3KPRA 3DO7A 5GGRY 2XKNB 3QUYD 4YUEL 3SDXE 1EGJH 5CBEA 4NRYB 5TE4L 3OF6D 2VWEC 6CGTA 5E99L 5C0IA 1DQDH 3B83A 3L1OH 1IAOA 1K8DA 4MD5A 2FX9L 3TPUB 1T83A 4ZFFA 1V3MA 2UV3A 2DKSA 4NO5A 3CFIC 5TF1L 1CGUA 1T0PB 4Y4KD 5F9JB 3ARFA 4KMTH 4LIQH 2WUBL 1JHLL 2YK1H 5E2UH 2ZUYA 3AB0C 2WIIB 4OLVL 4QHLB 3QEUB 4K71C 3T09A 4DN4H 4HC1L 4HS8L 5EU4B 3RGVB 2CIIB 2V17H 4HCRH 3VI4F 1OWRM 4JANB 5BV7C 4FQ2L 1DDHB 5L6YH 3QNZA 5DHYB 3QIBC 3CH8A 5CJ8A 4OKVA 3CFBB 3QEQE 4P2OB 2DJ4A 5CJQH 5TH2A 5C7XH 1QO3B 4L1HA 1UB6A 3ETBF 3D39D 1F4YH 4PJAB 4WTZA 1WAAE 1XH3B 1KPRB 5LAXB 2N56A 2FX7L 3S6CA 2APVA 3FZUD 3LKNB 5FUOH 3ILQD 1KJ3H 1RURH 5TGBA 3SO3C 5SV3A 1KPVB 3WNPA 3B5HA 4LHUB 1A3RL 4JQVA 4TRPH 4WHYG 1NDGB 3QIBD 1CE6B 1G6RH 2P7TA 4MAYB 2XKNA 5JIPA 2Y06L 3T0EB 2Z4QB 3H2WA 4YHLH 1JGLH 1KXTB 4RDQG 5D5MF 2IALA 4UV4H 4PJ9B 5IB2B 1AGDB 1MCQA 4RWHA 3GKZA 3TPUA 4H0HB 43C9B 2EDJA 3O4LE 1WF5A 3H7LA 3KPLA 1EDQA 3VRLF 2DLTA 1UKSA 3CDYA 4V2CB 1YMME 5F9JA 4EN3B 3MCKB 3O9WC 4PG2A 4YUEH 5J6HA 4CMMB 2Q7NA 3N1MC 1YYLH 3QEUA 1EX0A 4M43L 5GS2H 4NJ9H 5E99H 5EU4A 2CIIA 4JDZB 1FH5H 4GXUM 4JANA 4GS7B 1DDHA 2RIKA 2H1PL 5BJTA 4JFPB 5DHYA 1MHEB 5C92A 2VLKE 4JVPA 1UWEL 2OL3H 3CFBA 1CTOA 4XGZB 3MV9A 4P2OA 2OZ4A 1CL7I 3HC4L 1QO3A 2WUBH 3BDXA 5KSAC 4HC1H 4HS8H 5E6IB 3MV8D 3O9WD 1XH3A 4DFHA 1KPRA 5LAXA 3LKNA 1IGTB 3MCG1 3ZDYF 1R5VB 4PJBB 1UB5B 2F53D 1KPVA 4JRWA 4TNVF 4LHUA 4XI5D 5EU6B 1YQVH 1NDGA 5DQDH 3IYLW 5GXBB 1DBML 4M7ZB 5JOFB 1CE6A 4ALAL 4MAYA 1ND0A 1AHWB 3I6GB 5BVPL 3T0EA 3LIZL 4MB4A 1Q72L 1I1AB 2F74B 1E4WL 3VA2C 1YEGL 1AO7D 3SN6N 1QSZA 4K3JH 5TE7L 3A6OA 3HR6A 5BZDB 4ONFH 1T7VA 1AXTH 1HHHA 1GVIA 1I1FB 4PJ9A 3ZYOA 5B8CB 1AGDA 2KQMA 4DUVA 4X5XB 43C9A 1A3RH 2YUVA 3WDJA 3W81A 1JGUL 3KYOA 2BDNH 4EN3A 3MCKA 1C5BH 4L3AA 4ENEC 1OAQL 4R26L 4KROD 5IFAL 1BJ1H 4HH9B 4CMMA 4HKXB 4IBLT 3OKLB 4HS6B 1NCDL 1W72H 4PREB 5HYJE 1K4DB 1MHEA 2BNRD 1U8NA 2EXYC 1HIML 1S7UB 1L4IA 4XGZA 1KGCE 2P5WD 3RL2B 2VDOH 3VXUE 1KLFA 4MS8C 2FNBA 5I2IB 4PRID 2Q7YB 4M43H 2LU4A 5E6IA 1QLEL 4L5FL 2GSIB 1DQLL 4HXAL 3RTQB 3MBED 1LK3L 1U58B 1Z3GH 2NY6D 4LDOB 4GKSB 1YUHB 3CNKA 4ZNEA 1IAIH 1IGTA 1WBXA 4K7PH 1Z9MA 1R5VA 2NX5E 4PJBA 4KJYB 1UB5A 4IJ3C 4YDJB 3ZHDA 3I9GL 2AQ1A 4XC1L 5D70H 4LSSL 2EXYD 2AV1B 3PG2A 1AHWA 4FZ8L 4IS6B 3D5OF 5CFHA 4F15B 5EZJB 4D94A 2F74A 2Q6WB 2YRLA 5I8KL 3DX6B 3VGGA 3PJSB 5BZDA 3HCVB 5I1JH 1I1FA 5IMLB 5B8CA 1VFMA 4F8TA 4X5XA 4ZOBA 4YFDB 1QKZL 2IAMB 2R23B 3K4DA 5JOEA 3U30B 1QFWI 5B3JF 5DJYB 5IW1B 4HH9A 4YHNB 4HKXA 1E4WH 5DEGB 5FHAL 1INDH 3OKLA 1HSBB 1U8LB 3Q6GL 4HS6A 4UAOB 5BS0E 1UZ6F 2WLZA 2DBJA 3TM6A 1MHPL 1T1ZB 2VH5H 3EFDL 5EU7C 3AS2A 1K4DA 3L9RB 4OZ4B 4RFNC 4MNQE 5LXGH 3BKCL 1NGPL 3RL2A 1RUPL 3GNML 2OK0L 1T2XA 5I1GL 1AD9B 4Z7UB 5I2IA 2GSIA 2QSCH 4LCIL 3RTQA 4I2XE 1U58A 1OP9A 4W4OC 4OM1L 2DS4A 3IVKB 3M07A 4GKSA 2R4SL 1YUHA 1YY8A 4XCYB 4QNPE 4KJYA 1MPAH 3VI3E 4YDJA 4U2YA 2DF3A 4Y4FD 5JIHA 2N4IA 1P4IL 2AV1A 5K59E 3W11C 1KCRL 5EZJA 2LTQC 4ZAKC 1DQLH 1VFAB 3TIDB 2Q6WA 3P11H 1R3HB 4I8DA 5D1ZB 3DX6A 3N1FC 1N5YL 3HCVA 4LVHC 3RY4A 5IMLA 3I2CL 4YE4L 5MERB 2GK0B 1GOGA 4K2UH 4LKXB 3S3PA 2IAMA 4LDLB 3I9GH 4XC1H 2R23A 3QWRA 5I6XB 5AYUH 3DV6A 1DUZA 2A83B 4FZ8H 1H8SA 5DJYA 5IW1A 4D9LL 3QXWA 1QSVA 4YHNA 1BLNA 4EUPH 5DEGA 2A6DA 2BY1A 2AJVH 5EZOH 3G6JB 1U8LA 1FIGL 3W11D 3NFPB 1T1ZA 2V2XB 3AMKA 2BSSB 1DTUA 4MXWH 4MSWB 1JPFB 4OZ4A 3I3BA 3RBSA 3MNWB 5GISH 5TFSH 4E41B 1JNNL 2OXGA 1XCQB 4PJ7F 4G80B 4IMKA 5J13C 1A7RL 1AD9A 1NKOA 3ARVA 4N0UA 3ARRA 4Z7UA 3UDWA 4Y5VA 3L7FB 4D9QD 3H42L 5FHAH 4KTEL 3ZKMC 3TT1L 3TJEH 5IVNA 5DS8A 3DPBA 1MHPH 2GSGA 3IVKA 3EFDH 2XZAL 5LGJA 2XI9A 4XCYA 4LCWB 5T1MA 5FEBA 4UINH 4QTIL 2NY2C 3SDCA 4TUKL 3TH2T 4JRXD 3GNMH 2OK0H 5DRNB 2APXA 2RHEA 5SV4A 3PGCB 3P4NB 3V2AR 3R8BB 1VFAA 3TIDA 3HNSL 1ZTXL 1R3HA 5D1ZA 4OM1H 1JYXA 1T7ZA 3SY0B 1JPTL 2C26A 3O6FC 4G7VL 5KVDL 1U3JA 4WUUD 5MERA 4RSVA 5LWYH 4LKXA 1CDCA 3DETC 1ZT7B 2A83A 3VFUB 2QADC 1NCAL 5EA0L 2NY2D 5T5FH 4IEFB 1KCRH 1X6NA 4EOWH 2OI9B 3U4BL 4L4TE 4HUWB 3STBA 5D6DC 1N5YH 3G6JA 1F00I 1I8LC 4OIIH 4WU7B 1KJ2L 5D2LE 3NFPA 3VH8G 2GTWA 2V2XA 4YIQB 2BSSA 3S3SA 3Q0HA 1JPFA 2NX5B 4JKLA 4H8WL 3MNWA 4E41A 1UH4A 1XCQA 4HUMB 4G80A 3K4ZA 3VXPB 2PCPB 4ODHL 3CFKB 3L7FA 1CFSB 2W9LA 5GS0L 1CK0L 1FIGH 4O00A 3TV3L 3GRWA 3BGMB 3PHOB 2AGJL 1YEJL 4LCWA 1FLTX 4PJ5E 1TVBA 1XGYL 4AIOA 1MRCL 1JNNH 4BJLA 3WN5A 4XMKL 2Q8BH 1C1EL 1IEBB 3BGFB 2BVUA 3H42H 4JHZA 5D1QC 3PGCA 3P4NA 1HI6B 3OG6B 3TT1H 2P24A 4UTBL 3SHSA 5C0RL 2R8SH 2V2WB 3ZE0F 4MAUL 3SY0A 2M2DA 5BS0B 2XZAH 1K2DA 3NA9H 1L9NA 5I0ZA 1AIFB 4N8VG 4FTVE 3B9DA 3VGBA 1ZGLB 3PWPB 4U1IB 1H3WM 1ZT7A 5IHZB 3VFUA 2R2HB 2JJVA 3CIQA 1J0HA 3QFDA 2B2XH 4JZJB 3FQRB 3OB8A 4MDJB 4I2XB 4U1MB 2YD4A 2NQCA 4YIQA 1MQKL 7FABL 5EOCJ 2FECI 4APQC 3MRBA 1NL0L 2X4TB 2NX5A 2IPKB 3GSXB 3DURB 4OGAC 1EBPA 3VRJB 3VXPA 3P0VH 3GKWH 2PCPA 3JWOH 1NCAH 4ZDHB 2EH8L 3CFKA 5C07D 2VXTH 2Y36L 1EUTA 4U1KB 3H7BB 1CFSA 4BQ6A 2PKDA 1S7XA 1MIEH 4I77H 4S11A 3D85B 3OG4B 3BGMA 3H9SD 2J3SA 3PHOA 3VFNB 4BSVB 2ID5A 1JYVA 3VFRA 3STLB 1AR2A 3QQ9D 1DQTA 5EFIB 4LMQI 5CJXC 5C0ND 3TBTB 3GUTB 3CCHB 1IEBA 2V5SA 5ITBL 1PZUB 3CXDH 5B39G 5GRUH 4DZBA 5GS0H 5IMMB 1HI6A 4CNIA 1CZ8L 2V2WA 1I9EA 1FG9C 1MJ7H 1T1WB 1AIFA 1XGYH 5JHDD 3VRIB 1GGBH 4YBQC 1C1EH 3B2UC 3DUUB 2FDBP 3PWPA 4U1IA 4U6XB 2BCKB 4LLQB 4MNGE 4X9IA 2FL5A 3RZCD 3TNNB 4X6CA 4UTBH 5EBMA 5C0RH 4XXCC 2GCYB 3FQRA 1FORH 4DGIH 4MDJA 4LP5A 3OKYA 3M8OH 2EDFA 4PJEE 3HI5L 4D3CL 2IPKA 3VMNA 3DURA 3PWVB 3O41B 1QBBA 3VRJA 4EDXB 1VACB 1OAUH 3KR3L 3S4SG 2AAVA 4ZDHA 3OGCA 3MREB 1VFBA 4AQOA 1EBAA 4LP4A 4R2GD 5T3XD 2P1YA 4U1KA 3IAGC 3H7BA 3PV6B 2C3HA 1FLRH 4QOKD 4ZFGL 1PEZA 4Q58C 2BVTA 3D85A 3SDDB 3VFNA 1MQKH 2EDQA 3ZYZA 4BSVA 7FABH 5T1DL 3DYOA 1IARB 3ZKSD 2IC2A 2DLIA 3FO1B 3STLA 4Z7OF 4YHYB 1IQDA 3QISA 5FIEA 4DQOL 1PY4A 5EFIA 3MRQB 3GUTA 3CCHA 1VFOA 4XRCB 5D7JB 4X9HA 4N0FB 3X3GH 5IMMA 1LQSR 3O2DL 4L4TB 4X6BB 2FBJH 1OY3B 4W6YB 4LSVL 3CSPA 5D2LB 4PB0H 1IKNC 1NBZB 1T1WA 1FO0B 1N5AB 3VRIA 5JIIA 3N1QC 4KXZH 3QHTC 1VDGA 3DUUA 4U6XA 4QHMA 2BCKA 4LLQA 1CGYA 4C58B 3TNNA 4XNUL 3FONB 4HS3B 5DRWB 4G6JL 3WFDL 3QXVA 2GITB 1OM3L 1ADQA 3U2SB 4JJ5B 5H37H 5C9KA 1F4WH 1F13A 2IMNA 4P2YA 4XP4L 1P6FA 4C56D 3QUZC 1QR1B 3PWVA 1XF3B 3O41A 5KANI 4KV5F 4EDXA 1VACA 5DJ6B 3MREA 3OJ2C 3OHXA 3WD5L 3PV6A 2E8YA 2YOCA 5GRJH 2F8OA 2VITB 3OR6B 3GMPB 3G6DH 4X98B 3X13B 3SDDA 2ITDB 2GKIA 2I26N 3PIQB 1OAKH 3FRUB 2DDQL 3V8OA 2EDHA 3FO1A 3BKJL 4MHHI 2E6QA 1A7BA 3QUZD 3MRQA 5C6TH 4IDJL 2HVKB 3VXRE 5D7JA 1NC2D 4N0FA 1PGRB 4KHTH 1EHNA 4O2EB 4L4TA 4X6BA 3MV7B 5D2LA 5ADOL 5T1DH 1NBZA 1RZGB 4U1GC 2PF6A 1W8NA 1N5AA 3MOBH 2WM0A 5FO9B 1TLKA 3UYOD 1T83C 5CUSH 5I1CH 1MAMH 4JLRB 5I1KH 1OT1A 4PTUA 1XIWB 2AJUL 4ZFOB 1Y0LB 2I25N 3VFMB 2FLBT 3FONA 4HS3A 35C8L 5SWZD 3D9AH 2BNQE 1TCMA 5CEZL 4JY4B 2GITA 4JJ5A 3VE0B 4YHKH 3KPRD 4LSVH 2PR4L 2NTSP 3UJIL 1QR1A 2J88H 4WWKC 2LFGA 3IDYC 4OB5L 1F4HA 5E1AB 3ARQA 1M4KA 1XF3A 5HGHB 3O3BB 5DJ6A 3GSQB 1OLLA 1RFDH 2JF1A 4HPOL 4OD1H 4NKOB 2HRLA 1LNUB 3DGGB 1J0JA 2VITA 3GMPA 3GSNB 3OR6A 3ARFD 4X98A 3X13A 1H3PH 2ITDA 4LLAA 1CICB 3RUGE 1OP5K 4F2MB 3FRUA 4CAGA 1BQSA 3MBXL 2GUOB 3JXAA 4K3GA 2FR4B 4NUJB 1HK6A 4G9DB 2VKWA 3VXTB 4JQVC 4BKLB 4MNGB 4PD4K 1Z5LB 2HVKA 3RX8A 3SQBA 3VFGL 4LSUH 2DQTH 4AZ8A 1FZJB 4O2EA 3NIDE 3MV7A 5HI4C 3ZSSA 1CN4A 5D2NA 1JNLH 1RZGA 3BKJH 3TA3B 1NGWB 3MOAH 1ZSDA 4M7JL 1Y6MR 4JLRA 5JHLL 2OCFD 1EAJA 1XIWA 1Y0LA 1VEMA 4PG2C 3SJVB 5HI5C 4CUCA 4H25B 1Z9OA 3DHJA 1CLYL 4JY4A 3U0PB 1XF4B 4LPWA 1SJHB 3C6SA 5ADOH 5BOZG 2VO5A 1J87A 3MJ8A 1BAFL 1CXKA 2HJFB 4BZYA 1TMCB 5HI4D 4LLDB 4PGBB 4PJAF 3O3BA 5HGHA 1ETZB 1UENA 3GSQA 3S36L 1S3KH 5IBLC 1YECL 4NKOA 5A2IH 4XNMB 5A40E 1INEH 3IAPA 1LNUA 4YGVB 5T3ZE 3DGGA 4PJCB 4MXQC 4UV7H 3GSNA 2HFGH 5FO7B 3EYUH 4ZO8A 3P3YA 4LF3B 1CICA 5GGTA 1WJ3A 3VW3L 4JDTL 4YHIB 2GUOA 3FB8B 5JORB 2FR4A 4OB5H 4NUJA 3DUSB 3AGVA 4LQFH 3QPXL 4JM2C 3GK8L 4MNGA 1Z5LA 4JM4H 1TNNA 1KFAL 1FZJA 4P2OD 4X0KB 5I1LB 3WHXB 2X44D 5GRYA 2P8PB 3FO0L 2XY2A 3N0PB 5KZCB 3FN9A 1PKOA 4Y19E 4C83B 4MXQD 2MQ3A 3BH8B 3KWWB 3TA3A 4M9PA 1NGWA 3VCLB 3ESVF 4JB9H 2DQJH 4UILL 3SJVA 1QRKA 3ZL4L 4U0RB 3FMGL 3HN3A 4H25A 3EIFA 3GSWB 5D8JH 4LHUD 1IAMA 5ITFB 3U0PA 2N7AA 1XF4A 4YC2C 5TJWK 3V4UL 4MAYD 4FQCL 4G6FB 3T0ED 2HJFA 4X7DC 4M7JH 3VH8B 4EIGB 4LLDA 4PGBA 2RB8A 1ETZA 2ZKHH 4PJ9D 4JY6B 3VXRB 1XGTB 5FUCE 2J6EL 3EKCA 4X6DB 4XNMA 1CLYH 2Y07L 3RDTA 4DKFL 2MJWA 1MELA 1U3HB 3DIFB 3MRFB 4PJBF 3OAYK 4PJCA 4EN3D 5FO7A 4LF3A 3ZTNL 1KELH 1V5JA 1JPSH 3V6OA 4I18B 4CMHB 1BAFH 4YHIA 5ALCL 3FB8A 3DUSA 3SGKA 3V7AG 2A6KB 1YJDH 2VR5A 2FATL 5CCKL 4HKJB 4LL9A 4KKBC 2NY5H 5JMRA 5ACZB 3VWJC 1GGCH 1YECH 4S1RH 5I74B 1F11B 4JG1L 2BNQB 1HQ4B 4B7IA 5L0QB 3IB4A 3VW3H 3WHXA 3GIZL 2P8PA 1FFOB 2AVGA 2BERA 5J12C 2JKXA 5E6ID 2HFFB 4C83A 3BH8A 3KWWA 1UXSB 4NC0B 4NO0B 3QPXH 4UZGA 2EEAA 3VCLA 1RY7B 4N8VB 5EOCL 4HMDA 2Y1VA 2R1XB 5TE6H 4Y88A 5ITFA 1A6ZB 1XZ0A 3RUGB 4OCXL 1CD9B 3SQOL 1I1AD 3EYVB 1GC1C 4GH7B 3S37H 1ZANL 5CIPB 3VH8A 3H9YA 1OARH 4G7YL 5IJKA 3QXTA 1YMHB 4J4PA 4PJFE 1IC5L 3NPSC 4OLZL 1U8JB 1U36A 4JY6A 4P99A 3U36B 4X6DA 1IGFH 2VDML 1U3HA 3DIFA 3MRFA 2BY2A 3C09C 2R0WL 1ZHNB 3KGRA 3G5YB 1JWSA 3K80A 3O3AB 4WHTB 4I18A 4AENB 5DJ8B 2C1OB 3PDOA 1ZT1A 2A6KA 1M7IB 2XPGB 4HKJA 3D3VE 3OJDB 4ODVL 1MCBA 1NSNH 5ACZA 3T77B 5DT1L 1FL3A 3QCTL 2Y07H 1ZK9A 4NNPL 4F15C 1F11A 2BNQA 5CSZA 3KPSA 3D87B 1OT2A 1LP9B 3NIFE 4NIKB 5SWQA 5B39B 3F12B 2E7HA 2I9LB 3FL7A 4N8CH 3I02B 2F15A 4NP4L 2HFFA 4ZTOH 5JXEA 2AXHA 3RTQD 4A2MA 5CCKH 1BZ7B 4KMLB 1RIUL 1VA9A 4M48L 1UXSA 2NY0B 2HTKD 3HB3C 1I9RH 2OR7A 4N8VA 3KYKL 2R1XA 3W39B 5FF6B 1YQ2A 4KDTC 4C54A 2EECA 2AERT 5BOPA 3DMMB 1LO3H 3W2DL 3KNBB 1ORSB 3LSOB 4N0YL 4M62H 3DOSA 1FQ9C 3MJ9L 4ZUVB 1FSKB 3RUGA 3TWCL 3WDHA 4DCQB 5AG8A 3EYVA 5C2BL 3BKYL 3U48A 1E4KA 4Z7UF 3THML 1OGTB 1CFNB 1CLOH 3I50L 5CIPA 2YA1A 1YMHA 2H2PD 1KCKA 4NN5B 1IM3B 5DSCA 3W9EB 1U8JA 3U36A 2R4RL 4L29B 1IEHA 1RSFA 3OAZH 3UDWC 5GZNC 4Y5VC 2IAMD 3S4SB 3QWRD 2RJMA 4MJ5B 2R1WB 4M4RA 1ZHNA 4AEIL 2X4UB 1QTYT 4MQ7A 3O3AA 1NAMB 1SBSL 4AENA 1K6QL 5DJ8A 5F21B 3V0WL 2C1OA 1C7TA 5C09A 5CJOL 3SDCC 1M7IA 2XPGA 3OJDA 1ZKAA 1IC5H 4R3SB 3T77A 3QFJE 5IQ7L 4UB0L 2YD1A 4M6NL 5I1HL 5DC0A 1K85A 2I27N 1LP9A 2R0WH 3FOMB 1A1MB 2VLLA 3EYQD 5B39A 3F12A 3CC5B 1YY9C 2I9LA 5GZND 4Y4HB 1RZJH 3I02A 1GZPB 3BH9B 3LPGA 1MFBH 3PL6B 1ZS8B 1NKRA 1BZ7A 2WINB 5HDBE 2D7TL 1S9VA 1BBDL 4RGMC 3VGAB 2OJZL 3G6JF 2A6IB 2EDEA 3W39A 4LGPB 5DT1H 3QCTH 1TJGH 3SDCD 3BIBX 4ISVB 3O2DA 3DMMA 3ORJA 3KNBA 1ORSA 3LSOA 5J11B 1S7TB 4ZUVA 2W1NA 3L5WB 4NP4H 4DCQA 4KZDH 1D6EB 4K3DL 2BRRH 1CFVL 4K7PY 5D1ZD 4XX1E 1CFNA 4XHJC 1JZ5A 1UC6A 3W9EA 5E9DE 4JREB 4L29A 4YXKL 3HG1E 5I71B 2D0GA 3LAFA 2P43B 3S4SA 3F8UB 1U3YA 4MJ5A 4N0YH 2R1WA 2X4UA 1KEML 2CKBL 5KVEH 4PIRF 4PUBL 1A6WL 2AJSH 5D7IB 1NAMA 3C8KB 4M00A 2DWDB 1J8KA 2DWEB 2VOTA 1FNAA 3WN5C 1TETH 4R3SA 4MWFB 3CLFL 3LEVL 1N6UA 4E41D 3IDMB 4JHAH 4X80H 1UQSA 4XHJD 3V4PL 5J3HD 1A1MA 4HIHB 3CC5A 5HI3D 3ULUL 5IBUB 4Y4HA 4HF5L 1GZPA 3BH9A 3KYNB 2AEPH 2LE9A 3PL6A 4KDVA 2WINA 3LQAL 3RJDA 2X4SB 3BIKB 4X7SL 3HC3L 3MZTA 4LCWD 4M5YL 2A6IA 4QT5B 4HWBL 1OTTD 3LPFA 2BK8A 4ISVA 2DAVA 4RMRA 1YNKL 4OV6F 5A2JH 2OI9C 5EWIL 4K23H 3TO4A 4KHXH 1VGEL 3L5WA 4PP2B 1D6EA 3QHFL 4XPAL 3UJTH 3K1KC 1L6ZA 5F3BB 3MCLL 5HYEA 4L4VB 2KBGA 4MZ2A 4OLUH 2W9DL 1JFQH 3S98A 2WANA 5IF0A 3U7WL 2YRPA 1VPOL 4JHBA 3ZYJA 4MCZB 4MJ6B 4OZHE 4KQ4H 1E6JL 1ED3B 3LS5L 4UT7L 1KGCD 1SVCP 3D1MC 5D6CB 3ZT6A 1RAMA 3NCYS 3M1BB 5HD8D 5D7IA 5EN2B 3C8KA 1WGOA 3PWNB 4B7LA 2DWDA 1N4XL 1H9VA 2DWEA 4GMTL 1X5XA 1J0IA 1U8PB 1RZFL 3CUPB 4KAQL 1J7VR 3X3FH 4MMXC 4W6XB 1X6LA 5FHBL 2NX5D 1JHKL 4YXKH 3BISA 3JWDH 4HWZB 2UYLB 3O0RL 5FYKL 4NUGL 2AK1H 1Y6NR 3CLEL 4J6RL 1KEMH 2CKBH 4HIHA 1KACB 4JFEE 1A6WH 2F54B 2ZCHH 2YPVL 2R9HC 3MACL 5EC1B 1QACA 3MRDB 2B5IB 2X4SA 3BUYA 3BIKA 1P7HL 5IVOA 4DOHE 3OPZL 4U31A 4Y89A 5FGSA 4QT5A 3LEVH 4LPXA 3TEUA 4QNPF 4PY7B 4NKIL 1ZVHA 1BZQK 3VI3F 2DJSA 3WIIH 4PP2A 2QLVB 2VNCA 5C08E 5F3BA 5K59F 3LQAH 4G3YH 4L4VA 4XZUB 4X7SH 5BS0D 1U8QB 2VC2L 4M5YH 1U8IA 1UYWH 4HWBH 4I3SH 3QYCA 4MCZA 4MJ6A 5ERWA 4UT9L 3QFJB 1CIDA 1KBGH 3ULVE 3PWPD 5SX4H 1T66C 1MY5A 5FYLH 5D6CA 3VD5A 4AY0A 3EDFA 1VGEH 3M1BA 2MQ0A 5DFWH 2IADB 1F2QA 3RVWC 5EN2A 1KNOB 2FD6L 4M93B 5F96H 1ADQH 3VDBA 4HG4J 4LCUA 1U8PA 4Q0XH 4TNVK 3U7WH 3QH3B 4BH8B 3CUPA 5FUZL 2YPKB 2XXMB 1GPOL 4PBXA 5J6GB 1E6JH 2AI0H 4HWZA 3LS5H 5CGYD 2UYLA 3HMWH 1ZHBA 3RA7L 3VFPB 1G7JB 3W82A 2Z91B 4PRBB 5GZOD 2F54A 2BOBB 2C3GA 4J3TA 3GSOB 1LO5B 1T66D 5ILTH 1FYTE 1H8NA 3MRDA 2BXZA 3D85D 3Q5YA 4KAQH 4OGYH 3SDYL 3DV4B 3EFFB 1UM5L 4XBPB 5FHBH 4XVTL 5E9DB 1JHKH 2BZDA 5DA0B 2PNDA 4LSQH 4ODTL 1Q9WB 1OCWL 4L9LB 4NUGH 4PY7A 3AROA 2W0PA 3HUJB 1BIHA 4LBEA 3ROLB 1F2XK 5FYJL 1KENL 2EIZB 4JPWL 4L8SB 3R0NA 1VKXB 1FZMB 4FZEL 3ARPA 4XZUA 3V4VL 1YEEL 4YPGB 1U8QA 2APFA 1HHJB 1QBLH 2A9MH 3NFNB 1B0GA 3D25B 1FO0H 1H5BB 2W38A 2QL1A 4CVUA 4C4KO 4ZUUB 1JGEA 2C1PB 5FYLD 1ZGLM 4KJWC 1I3VA 1BQLH 2IADA 4J3WA 5DEZA 1KNOA 1HHGB 1NCWH 4YHYC 2VC2H 3QDGE 3CX2A 3WJLC 3FO9B 5SWSB 4BH8A 3EZ8A 5D2LF 5D7JC 5J6GA 3QO1A 2OR8A 1HNGA 4MNHB 3VFPA 4R97B 4YXLH 1RU9L 3DVGA 43CAB 2Z91A 4PRBA 5L88L 4ODUB 1BVZA 1SMAA 3L3JB 4NQDB 3GSOA 3MLTB 4ZODA 5FA3B 3DTXB 1V05A 3C60B 3SDDD 2W0FA 3DV4A 3EFFA 4OCRH 4F3FB 1QRNE 4XBPA 1L7IL 5E9DA 2AXFB 4YFEA 4XP1H 3SE8L 5DJ0B 3PXJA 4KXZI 3MRGB 2ED7A 4YHML 3BO8B 3HUJA 5D7JD 4L3EB 3ROLA 5I8EB 2DQEL 3MUZ1 15C8H 2EIZA 4L8SA 5CHNB 4L4TD 1VKXA 1EJOL 1FZMA 5EU5A 4R4ND 3WV0A 4YPGA 1UM5H 1HHJA 3T2NL 3NFNA 4WEBL 2PW1B 2EDRA 2G5RA 1YNTB 4KMQA 1KB9J 3QWQB 4LLUB 3MFFA 4ODTH 5D72L 2GJ6E 3DX7A 3TGXA 2Q86A 3U7YH 4K8RH 3IDUA 1BREA 2C1PA 2YXFA 2AK4E 1NCUA 1HNFA 1KENH 4E5XB 2G60H 1J1XL 1HILB 1AQDB 1BQUA 1HHGA 4FZEH 4G8GE 1XR9A 2EEBA 2EZ0D 2QJDA 2Z8SA 3FO9A 3HZYB 5SWSA 1NBQA 4DOHB 3JTSB 3ILPB 5FM8A 3L5IA 4X4ZA 3WBDA 4JFFE 4MNHA 3OXSB 3H0TB 2LQRA 4XNZB 4PJDE 4WUKL 4OJFL 4ODUA 4RCAA 5D2NC 4NQDA 4YDLB 4RMWA 1PY9A 4P3DB 3GSNH 5FA3A 4MXVE 3DTXA 4KJPC 5GGTH 4F3FA 5KS9B 4HZAA 32C2B 2JK5B 5DJ0A 1PAMA 4KI5C 2HN7B 4YQXH 2OSLB 3MRGA 1N7ML 1RU9H 3RNQB 2ZSVB 4XMLL 1JL8A 4Y16C 5J1AB 4L3EA 3K8MA 2I07B 1OF2B 4TTDD 3CVIL 5I8EA 5CHNA 2E9IA 1E6OL 3MV7D 1Q38A 3QUML 3D69B 5EZLB 5F1IB 1KCVH 1MIML 1YNTA 1CS6A 5FCUL 1RV6X 3WXVL 5ANMB 1UVQA 2R29L 1CXLA 1SYSA 1EO8L 5IIEB 4O2CB 3SPVB 1XIWD 3BD4A 4Q97A 5D7KD 1ACZA 4Q2ZB 1MUJB 3MJ9A 1AE6L 1CICC 3CVHL 4M6OL 5DJZB 1M71B 1MAJA 4E5XA 3QJHB 1A47A 3QB7C 1PDKA 1HILA 2VZ1A 1AQDA 3PQYB 3T3ME 5K9JL 5DVLA 4NQCB 2HH0H 1FVCB 3HZYA 4CADB 3JTSA 4WEBH 3BX7C 2VUOA 3HZKB 4WI8A 5I73B 1PG7H 2F5AL 1SHMA 1SYVB 4P2RE 5ESAB 3OXSA 3H0TA 3LHPL 1UJ3B 4KK5C 5HGBB 2Y9RT 2W9EL 3DVIA 1BF2A 4L8BB 5HHXH 2B0SL 4QXUL 2BVQB 4HIXL 4P3DA 3TA3C 3K46A 1CICD 2R0LL 4N68A 2XZZA 4ODBD 1GAFH 2PN5A 3F58L 3OL2A 4XMPH 5KS9A 3G5ZB 3LMJL 4X5WB 32C2A 2JK5A 1TJIL 4ACPA 4AG4L 3QEGL 2HN7A 2OSLA 4UUJB 4A6YL 1M1SA 4QRSB 4EEEA 3RNQA 2ZSVA 3S5LG 5J1AA 2I07A 4OJFH 2VLME 3BAEH 4G6AD 1OF2A 4YO0B 3LB6C 1UT9A 3L3HB 4RISH 4P9HL 1KXVC 3MLRH 4X7TB 1U2HA 2A74B 3RNKA 1JMXA 3QDGB 3D69A 2CO7B 4PJCF 4TVPE 5EZLA 4XBEH 3MLXH 4PJXA 3TA3D 5JMOC 5ANMA 1N7MH 3WHE0 5IIEA 3RDTC 3SPVA 4UIMB 2I60L 1QVOB 3SJVD 1MUJA 2KPNA 3HZVB 5DD3L 1M71A 2R39A 2IANB 3QJHA 3V6OC 2EH7L 1T7WA 4FFWC 3PQYA 4H8WC 1TJHL 2V7NB 4NQCA 1FVCA 3BP4B 3QUMH 2FCBA 2R15A 4CADA 1QRNB 3HZKA 5FCUH 3BRDA 1SYVA 3MUGB 1DEDA 5ESAA 1T2QL 4JFZL 3S34L 2E5EA 1U8KB 2R56H 1UJ3A 2CO6B 3ZT5A 1NEUA 4U6TA 2XV6B 5HGBA 4QRUB 1A8JH 5EUOB 1FRGL 4L8BA 1MHCB 1QYGL 2BVQA 5DLML 2IFFL 1D7FA 1OW0A 1NFDE 5DVNA 3G5ZA 4FFWD 4X5WA 3IETA 5IESL 3OKEA 4OLEA 2GJ6B 4KKAD 4UUJA 4W4NA 3X14B 2HVJB 3OZ9L 4QRSA 3CMOL 3LHPH 4QWWD 3P4OB 5EIVA 1U42A 2W9EH 4YO0A 4JO2H 4YNYB 2B0SH 3MRLA 1QFPA 4DGVH 4K94H 2A74A 4X6DF 2VXVL 3QDGA 5L2KA 1GZQB 2VWEE 3F58H 5F70A 5KZCD 1CE1L 5DUPL 3T0DA 5DEFA 3FJTA 4POYA 3ZE1E 1EVUA 4A6YH 4MA1C 4GKOA 3RY6A 3O3DB 3MNVB 4UIMA 4Q7DA 1MF2L 1QVOA 2VQUA 3FAWA 3QG7H 4PJDB 3BE1L 2YKLL 4YAQB 3D39E 3HZVA 3MV11 1A02N 2IANA 5AD0B 4JPIA 3ELAT 5CKGA 2ENYA 4POZC 2ZNWA 3U46B 4QTHB 3HFMH 1L0XA 1S7QB 4G6FD 1QRNA 3ZO0A 2CXGA 5DD6B 4YEEA 1U0QA 1B2WL 5CIPH 3MUGA 1A7QH 5I74C 1YEFL 3BPCA 4J4PD 3QRFM 2CRYA 1W2KT 1AGFB 1CLZH 1KCUH 5L0QC 3VXRD 4ONGL 2WP3O 5I17B 5IB3A 5KVGL 4QRUA 1P6AB 5EUOA 1TQCC 3BMVA 1P1ZB 1UKTA 1U3HD 4QHKJ 1MHCA 5FOBB 3UAJC 4RX4A 5JXEC 4Z8FH 5GS1B 4JPVL 4PJ8B 4W6WB 4N5ED 5F9AC 5GJSL 4POZD 3RUGF 3LQZB 1U3ZA 2GJ6A 2O5XH 1T2QH 3EOYG 3X14A 2HVJA 1U92B 3P4OA 4PRPB 1DANT 1G9MH 2ED8A 2D0HA 3MRRB 1A7NL 3WNLA 5BW7C 2NNAB 1XR8B 1QYGH 1HYRC 2BNQD 4YNYA 3BPOB 5C6PB 4WHCA 1E4KC 3T2OA 3NIDF 1GZQA 1F58L 2XNAB 4FQJL 3B9KA 5LVEA 4OI8A 4HWUA 3FTGB 4NO0D 3OZ9H 3LKOA 3O3DA 2E9BA 3FQTB 3MNVA 3KG5A 2OR9H 3ZKXC 1GJIA 1AXSB 4RBPH 3NABH 1BBJB 1ZOXA 3MV8E 1RZIB 5AD0A 5EO1B 5T3ZH 1B3JA 2PYFB 5DUMH 3U46A 4QTHA 1NBVL 1BFVH 1BOGB 1U91B 4RIRB 3NIGF 1T22B 1LP9F 1S7QA 5E4IA 1E0OB 1YN7B 3KLAA 5DD6A 2G75B 4P4RB 1P4BL 3QPQD 4R9HA 1UM6H 2DKMA 4S1DC 3UTSB 5MI0C 1UWGL 2OTWB 1AGFA 3BEWB 4NPYB 3BE1H 4N5UA 1BJMA 2JCCA 4XB8A 3QCUL 3MTRA 2UZYB 3MYJB 4L4JA 5I17A 1LO0L 3L3KB 5HDQL 1P1ZA 1AO7E 5FOBA 4P23B 4BQBA 5DJDB 5GS1A 3SGEI 2EYTB 4PJ8A 4FOMA 2WBJC 2IBBA 4HLZG 1NFIA 4LDEB 4LK4A 1NAKH 4WFED 5EDXA 1U92A 3IFNL 3K2UL 1AXIB 3D18B 5JOPD 4PRPA 1FP5A 5KVGH 4OZGE 3MRRA 4EBQL 1BFSA 4R8WH 2IPTL 1XR8A 2NNAA 3G9AB 4S1DD 5CD5D 2E3VA 5LCVL 1DN2A 2B8OT 2BC4B 1F97A 4V2BA 2X4QB 1I8MB 2XNAA 2JB6B 4M7LL 1CVSC 1MCDA 4QRPE 4NN5C 3EO9L 1QSFB 3FTGA 4PBVC 5IGXL 3EUUA 3FQTA 3CFJB 5HXMA 3PWJB 4PRIE 1AXSA 4CDGC 3IAQA 1A7NH 1BBJA 1RZIA 4JKPL 3QCVL 4XCCL 5T3ZD 2R2CA 4I48A 3DMMD 4S0TD 3VDAA 5D96C 4FRWA 1S7WB 4JN1L 4RIRA 1U91A 1T22A 1NFDB 1IBGL 1YN7A 4M7KL 1IGYB 2G75A 2IBGA 4P4RA 3ARGB 3RVTD 2VZSA 3AVEA 3UTSA 3WNNA 1N64H 3BEWA 4NPYA 3HAEH 3NBNA 3MYJA 3L3KA 4Y4HC 1BEYL 3WS6C 1FZKB 2IPUK 4P23A 5DJDA 1FHGA 2DQFB 2V9QA 2EYTA 3NTCL 3VGAC 4Q6YA 4Z0BL 3BPLC 4PTTB 2NXYB 4PS4H 2QSQA 3BWUC 3VFVA 1P4BH 3C8DA 4RQQA 3A6CL 4Z0XB 4X83A 3RKPA 3KDMB 1UWGH 2EXWD 1G7MA 3UTZA 2FYYB 5F1KC 1KV3A 3D18A 3TO4C 4ELKB 2XFXB 3C9NB 1LO0H 3BP5B 5SX5H 1NDMB 3CZFB 1NLBL 3CH1B 2BJML 4QXWA 4WGVB 1WZ1H 3AB0B 4K71B 4Y4HD 1KB5B 2X4QA 1I8MA 3T0XA 2K9UA 4RWYL 3PL6D 1QSFA 5BV7B 1GGYA 3FB6B 5D7IF 5I15H 1GGIH 5I71C 4DW2H 3IFNH 1F3DH 2OM5A 3CFJA 3PWJA 3FN0L 3V0VB 7CGTA 5E2WH 4OAWB 3PWLB 2XTJC 4AMKL 5K9OB 5J8OA 1KT2B 4X7FC 3X11B 1S7WA 1OPGL 3S36X 1AGEB 2J12B 3L6FB 4OCWL 5KW9L 3EO9H 4TTGA 1LEIB 1A9BB 3UPCA 1IGYA 3ZE2F 4XT1C 3WFZA 2J8UB 5EU7E 3ARGA 3LN9A 5B3JE 1SBBA 1CFTB 2IH3B 4P4KC 1MOEA 2IQ9H 4H0GA 4YHZH 3FHAA 4KY1L 1MRFL 3N9GL 3FFCB 1UZ6E 4PJFF 3DHMA 4GG6B 4XCCH 2JJWA 1A7PH 4OQTL 4RAHA 3MLPA 4IOIB 4PTTA 3FOLA 2E7LA 2UUDK 3VD9A 4Z0XA 3KDMA 4P57B 2FYYA 3B8SA 4EQ3A 2FB4L 4ELKA 4PP1C 2XFXA 3BP5A 3WYRA 3MLSH 2VLRE 3CFEA 1NDMA 3CZFA 3MV8B 3VFOB 3CH1A 4I5BA 4M6AA 4HMCA 1E4XL 4FG6C 1KB5A 4Z0BH 5FO8B 1CBVL 1EERB 1C08A 1URLA 4O2FB 1MWAB 2VKXA 3FB6A 1MCOH 2JB5H 2Z9TA 4WDIB 4NJAL 2H2SC 1MI5B 1FNEB 3KPPB 3PP4L 2FH6A 4D9QE 3V0VA 3LD8B 2CLRB 4HXBH 4OAWA 3PWLA 4HX1B 2DQHL 2LVEA 3NZHL 2BJMH 4WW2C 4GAYA 4PP1D 1KT2A 3X11A 4XPHH 3DI2B 5KSAB 1AGEA 1MVUB 1WEJH 4RWYH 1LEIA 3EJZC 4M1DL 1A9BA 4OCYH 1PEWA 4L4VD 1AGCB 4JRXE 5E24E 2J8UA 4FG6D 5LGHH 4MA8H 3QWOA 3QNYB 1CFTA 1KIQB 3FFCA 1CDUA 4OZGB 4UIKH 4GG6A 5GPRA 2H2SD 2QQLL 4NOFA 3I6KB 3BJ91 3UEZA 2J4WL 4M1GH 5EU3A 2QHRL 3KPOB 1N0LA 4WUUE 4PJ7E 3QDJB 2DRUA 5CBAB 4IOIA 1DFBL 4QRPB 1SJVA 4QGTA 1RZKH 4JQXA 2MTPA 5H2BB 1J8HA 2X42A 4QRRE 1MRFH 3N9GH 1UJTA 1HCFX 4YX2L 1ZLSH 3TVMB 3S5LB 1ZA6B 3VFOA 5I0DA 4CN4A 2W92A 3NFSL 4OQTH 1IL1B 3FKUS 2F54D 4BZ2L 3D0VB 4O9HL 4KGJA 4TPRL 5FO8A 3WFCL 3NCBB 4O2FA 1G9EA 1MWAA 3SKMA 3WIHL 4GMSL 4WDIA 1MI5A 1FNEA 3KS0J 3KPPA 3IFLH 5KSBE 1JK8B 1L7TL 2EDXA 5TPWH 3WFEL 5CAYB 2CLRA 4OT1L 1U6AL 2HJKB 4N9OB 3HE6C 4HX1A 5F7MC 2ZCKL 1E4XH 1FPTL 4FFYH 3REWB 1F02I 1X4YA 5KSAA 1CBVH 1MVUA 5CZVL 1AGCA 1TENA 2XZQL 3CXHK 4NJAH 4YXHL 5IFJB 5I1DB 1KIQA 4WVRA 3WO4B 4U1SB 1P9MC 4WO4C 2EDYA 4IJ3B 4C57C 3WHE1 25C8L 3QFJD 4OZGA 2HYMA 4NDMB 3I6KA 2QTEA 4BUGA 1WCBB 1GXEA 3T0VA 3KPOA 3QDJA 3HUJF 4M1DH 1R6VA 5DHVH 1A6VL 3MROB 4EZMA 4MA3B 1B6UA 2JLLA 1B4JH 1OTSC 5EOTB 3V52H 3E1F1 1BOYA 4HJ0D 3SDAA 5I1AB 3BFOA 1G0XA 4NBYB 3CD4A 4QXGH 3TVMA 1IT9H 1QA9B 3S5LA 1ZA6A 2QHRH 1G1YA 2SEBB 1IL1A 2DN7A 4JFQB 4HAFA 3RWGB 2VR9A 2NY3C 4YFLF 3AC0A 4LLMB 3BN9C 3LDBC 4J3UA 4QRQB 1A7OH 3G04B 3WFBL 2ICEB 3R4DA 4ZPVB 2JJTC 4R90L 3VU2A 1MEXL 4RFNB 2WWKT 3C5ZB 3D48R 5E9DD 3K7UA 4TSBL 3VFSB 3F7QA 4UNVA 4LVEA 2UVEA 2HJKA 1WFUA 1I9IL 1DQML 3NFSH 3H9SE 3MGOB 3FB7B 4BZ2H 3REWA 4TPRH 4YHOH 3WFCH 1TZGH 2VDNH 4LU5L 3SE9H 4LHJB 1PKQB 3BDBA 3WIHH 4GMSH 1D5XB 5IFJA 3HMXA 3JV6B 1DBBH 4U1SA 1W8OA 3BN9D 4WCYL 1CIUA 5EIIB 1L7TH 3FQXB 5IHUH 5IR1B 3Q3GB 1T5WA 1U6AH 4NDMA 1OTUC 2VLRB 3ME0A 5DRXA 3P73B 2ZCKH 1FPTH 3BJLA 5LBSL 3DROB 3ZTJG 4ZAKB 1T1YB 3QHZL 1JTPA 3GHBH 5CZVH 4EI6A 2XZQH 4J1UB 4FQLH 4MA3A 1RHHA 2CXKA 2HT4C 4LVHB 5SWSD 4PGZA 4NGHL 1J1PL 5DK3A 2VDKL 5EOTA 2FBOJ 3JV5A 1HN1A 5C71A 4GKNB 4LKCB 4B0MM 4NRXB 2H9GB 2BVOB 2ERJC 1PFCA 1Z6JT 3BZ4B 2FJHB 2X5PA 3P4MB 2SEBA 4Q9BA 4MVBD 4JFQA 4JDVB 4K9EH 5JW5B 1Q0YL 3O6ML 1S8DB 1OTUD 4NQDD 4LLMA 1XGPB 3GZKA 4QRQA 5ELIA 5EIQA 1IGIL 2IFGA 3C60D 3G04A 2ICEA 5KBNC 4ZPVA 3U7AA 2NW3B 4B41A 4HK3J 4P9ML 3TFKC 3IJSA 5HHMB 3ZHKA 3C5ZA 4IRSC 5HHVL 5T3XE 3VFSA 4DZ8B 2HT4D 2N7BA 1AR1C 4KUCF 5J13B 3ULVH 4M61B 4QOKE 5IUSA 3L5XL 4OI9A 5AZEH 3FB7A 4L3ED 1PZ5B 1GH7A 4KUZL 1DJSA 3I3EA 2X4RA 4QF1B 3OBAA 1PKQA 4N1CA 5IFHL 5CILH 2XQYK 1D5XA 5GGQL 1JRHL 4GAFB 3JV6A 2GY7B 4J3VA 4QRRB 4TSBH 4XNZC 4IRZL 5EIIA 2ARWA 1FIEA 2PTVA 3Q3GA 1GIGL 1I9IH 2MOVA 5A16B 5KS9F 2VLRA 4U7KA 3P73A 1FN4B 3BPNC 5CSGA 3ULVF 3DROA 1OD9A 1AR1D 1F8TH 2NY7H 4ZAKA 2AABL 1T1YA 3RIFF 3RI5F 5GSVB 1C5CH 3LZFL 4M8VA 1KTLB 5DUBB 4Y2DA 4LSTL 4J1UA 3O6FB 2RGSA 4OQ1A 4P46B 1UCBL 5BQ7A 4KUCD 4JO1H 4OF5A 4KPHL 3TLRA 3I84A 5T33L 4DAGH 5KSBB 4NKMB 2ZG2A 1BJ1J 5DMIL 5I9QC 2H9GA 4EJ1C 4LOUC 4U2ZA 4IHOB 2BVOA 2QADB 4RGOH 2K3TA 1WC7A 3BZ4A 4KKLC 5LBSH 5MEOA 2FJHA 3P4MA 3GI8L 2GIYA 4JDVA 4C56E 4DUXA 3QHZH 5JW5A 2H32B 1S8DA 2YUZA 1XGPA 1GHFL 1NEZG 3RWCB 3T2PA 3V95A 4NGHH 1CVRA 3S35L 5ENWB 4RMUA 4YR6A 2NW3A 4O4YH 2AV7A 4NM4H 3F6LA 5E2VL 5GJTL 4G9FA 8FABB 4HT1H 1Z9SA 4DZ8A 4W81A 3ULVD 4M61A 3PP3H 3GHEL 2YHGA 4JR9H 2HT2D 5C0CB 4Z7VB 1PZ5A 2D31A 2VTFA 5GGUB 3GB7B 4PGDB 1CDGA 1AI1H 5I73C 1IJ9A 3RKDC 3EYSH 4P9MH 1N6VA 3TCLB 5F7UA 4X4MA 3IFOB 2OP4H 2MSPA 4QRRA 1UJ3C 3C6LC 4LRNL 1XAUA 1ZEAL 5A16A 1DBKL 4C59B 3L5XH 1FN4A 5F71A 2YEZB 4CDHA 1J05B 5D1QB 1U93B 1KLUB 4PRHA 4KUZH 3WSQH 1OW0C 4F58H 4KV5E 5GSVA 1KTLA 5DUBA 5IVZB 3ZKNC 3PQYD 4PLKC 3O6FA 4NQCD 5GGQH 3T1FB 1WIOA 1JRHH 4NWTL 2EDKA 4P46A 4IRZH 2X2YA 5GHWL 5KSBA 2AKRB 5SWZE 3RKDD 3MLWH 3ULUC 2GJJA 5ID1B 3UYPA 5DDHB 4IHOA 4OD2A 3KPRE 4LASL 3EDDA 3BVNB 2FX8H 4FQQB 1T04B 5KANG 4TSAL 2KH2B 2AABH 2Z8WC 3ZDZF 1YNLL 4FFZH 3E6FB 4OFVA 3RWCA 1M7DB 4MLIA 4JGUA 2EICA 2EYSB 1ROWA 5ENWA 3RY6C 3QULB 4APQB 1NCTA 3UTPE 4KPHH 2RBLA 2XT1B 5KOVC 8FABA 3DBXB 4X4YB 4UBDD 4AL8L 4KI1A 4HWEL 4MHHG 3BDYH 5DK0B 1K4CB 3U6RB 3PV7A 5C0CA 4Z7VA 4PPTA 3ULUD 4XCNB 4IDLA 4JGJA 1KN2H 2PTTB 2O5YL 5GGUA 4U33A 3GB7A 4PGJA 4KZEH 4H1LG 3S35H 1SVZA 5EUOF 3QDGD 1OQOA 2ADFH 3CMGA 3UC0L 5L2KD 1C8PA 3JBG7 5IBTH 3TCLA 2GEEA 3IFOA 4W68A 4QEGA 2VISA 5KTEL 2VSCA 1BGXL 2IWGA 1D6VH 4QY8B 3GHEH 5CINL 4JN2B 4AM0B 2CDEB 2HFTA 2YEZA 1J05A 3BQUC 5D1QA 1U93A 5F9WC 5DZOA 5HGAB 3OAUL 3O2WL 1MJJB 2IAND 5HVGB 2VDQL 5IVZA 3E0GA 4P5MB 4WRLA 1ACYL 3T1FA 1RVFH 4OLYL 4RMSA 2X70B 1QRND 3LEXA 2M26A 4LRNH 4XAWL 4TVPL 5DGQA 2W0LA 1P53A 4OF8A 4WW1B 5ID1A 4NT6A 5DDHA 4JZNB 1UA6L 2Z35B 3BVNA 5DJ2B 4CN1A 1ZMYA 4FQQA 4M7LT 1T04A 3V5KB 4PB9H 5AG9A 1HCVA 3RVVC 4WEMB 3ECBB 4KK8C 4PJDF 4RX4D 5IEHB 3B9KC 2VXUL 1EO5A 1M7DA 2EYSA 3RY5A 3HNVH 3QULA 4APQA 5AAMA 1EZVX 5BXFB 3DBXA 2GJ6D 1HWGB 3KXFB 4CL7A 5EO9B 4X4YA 2A9NH 1MAKA 2B4CC 4XVUC 2XRAL 3R1GL 5JXAL 3IKKA 1K4CA 3U6RA 3DJ9A 3KJ4B 4FHBD 1RPQA 4R6UA 4XCNA 3U0WL 2FIKB 2FGWL 2PTTA 5EH1A 4LEOB 4R96B 1RZ7L 1WK0A 3QUXB 4XWOD 3DVFA 2YRZA 3RVVD 4KK8D 4X7CC 4ZMAT 3FRPG 1U8HB 5J56B 3B9EA 4TOYL 3MV9E 3NCFB 4HWEH 4QY8A 4K3EL 3G6AB 1T1XB 1X5IA 2CDEA 2C3VB 5F97E 2A1WH 1LGVA 4WY7L 4YDIL 1G9NC 1JNHB 4GRWE 5C8JB 1JZ2A 5HGAA 3U0TB 4TSCH 1CFBA 1MJJA 2B1AL 4PJ8C 5ECJE 2FEDC 3WNKA 4P5MA 3MLYL 1SJEB 3UC0H 2X70A 4RA0C 1KCSL 3T3MF 1F4XH 3VG0L 4OD3L 5CINH 2H45A 4JZNA 2Z35A 3BPOC 5DJ2A 1A0QL 2X6MA 1MFDH 2ZOLA 3T0EE 1RK1B 3V5KA 2RR3A 3ECBA 3NCJL 4LGSB 5IEHA 4WI2A 1DLFH 4OLYH 3RWIA 2NW2B 4L8DB 4ODSL 4PJ8D 1YDPB 5BXFA 2DQGH 5DTFB 3KXFA 5EO9A 5DD1L 5AZ2H 1X44A 3D2UB 4TN9A 3IS1X 3IU4H 4PRPD 4BSWA 1EGJL 1JI2A 1FV1A 5IROC 2FIKA 4LEOA 4R96A 2VXUH 4R7NB 3QUXA 1DSFL 3GSVB 4AEFA 4H5SB 4D0BB 2BP3A 1P7KB 1IKFL 3MRHA 4U3HA 1P2CB 3O81A 3PWUB 2DBLL 5T5NG 1ZWIB 3G6AA 3R1GH 1T1XA 4TQEL 1F6AB 2C3VA 3M17A 4BFIB 1JNHA 4JPKH 3U0WH 2YK1L 5EORH 2FGWH 5E2UL 3U0TA 2QQQA 5GIRB 2FWOB 2CK0H 4EI5C 1RZ7H 4M6ML 2ATKA 2DQDH 2V17L 3DNKA 4HCRL 3TBWB 1SJEA 4HULB 5CEYB 1MFCH 4U1GB 1T0NB 1EJ6A 4PJBE 5E8PB 2IBZY 4ZFFB 3MXVL 4TOYH 3E6HA 4K3EH 4NO2B 5TDNB 2XICA 4NO5B 3UTSD 5CJQL