3FFCE

Crystal structure of cf34 tcr in complex with hla-b8/flr
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
MGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSFTWTSGGATDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The shaping of T cell receptor recognition by self-tolerance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
total genus 57
structure length 247
sequence length 247
chains with identical sequence J
ec nomenclature
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffcE02
4O58H 1V3MA 4UU9A 2W0KA 3KXFD 2VZTA 2HT2C 1HKLL 5BVPH 2CKBA 2D7PA 4F7TB 2AJ3A 4OF7A 2AVGA 5T5NG 3OJVC 1JGUH 1XIWA 3F7VB 1GIGH 5E9DA 4POUB 3T2NH 3MRGB 4XPBH 4Q2ZA 1NQBA 5JR1H 3HE6D 1XF1A 2A9MH 2R56H 4X5WB 2W38A 3VXMA 1WICA 3T2NL 2EEAA 4CMHC 5D7JD 4LK4A 4BZ2L 5EZLA 3RVWD 5ID0A 5JA8B 4YQXL 5MERB 1BP3B 1YECH 2DM7A 3GBNL 5DA0B 2QSTA 3LIZH 3BH9A 2BHYA 1RK1A 4Z7WB 1XF4A 3QEQB 4RX4D 1JMZA 1WK0A 5EU5A 4Y1AB 1WBXB 4HUNB 1ZHLB 1BOYA 4POZC 1CICC 4KZDL 3TCXA 5C0CB 1RVFL 4I18C 3NTCH 4XPAH 1ZTXH 5H2BB 5KS9E 4XVJL 5HYIA 5HHOA 4HAFA 4X6CA 2L0DA 4JZJA 2O5XL 3TGXA 1QOKA 3QYCA 3W9DA 4PJEA 5D8JL 1OOAA 2IBBA 3DV6A 5D7IE 1HHJB 1NEZG 3SJVE 1NANI 4KROB 2P24B 1QLEH 1AR1C 3U9UB 2EYRB 1MHCB 2HT4D 3MSPA 1HYSD 2R0WL 5D6CA 2DQUH 4A6YH 1EJOL 5DJXA 2IPKB 5I74B 4OFDA 3QPXH 3NGBB 4NC2B 5MEPB 2EE9A 1I4FB 1B2WL 3SGKA 3TA3B 3HCVB 4TNWK 2AK4A 4P99A 4DK6A 4PV8B 3SCMB 4GT7A 5IIEA 4PJXA 4PS4H 1EXUB 4X9BA 2ZG1A 3HUJB 4HV8A 4W4OA 5FA3B 1S9WA 4WW2C 4Y1AE 3G08A 2GAZB 2VC2L 1CLOL 4Y89A 2OI9C 2VISB 3BPCB 1BJMA 3EOBA 4PB9H 4Y5YC 3HKFA 5B3JF 2NY5L 5ESQB 1P84J 3UYOD 3SDXA 1MREH 12E8L 3OPZH 3SDCC 2P5WD 3TFKC 3QXAA 4HJ0D 1C5CH 3GSOB 4F7PA 1TPXB 5DGRA 4TVPE 2F53E 2PCPB 3FFCA 1RZGB 5ETUA 4NO2B 3QEHB 4CNIB 4I18A 3VDAA 4NCC2 2GK2A 4EXKA 4BFEA 1LK3H 4PLKC 4J6RL 4ZQKB 5SWSE 5D2NA 3FB8B 2Q86B 2AJXH 4R0LA 3IXTB 5KZCB 5FDYA 3RNQA 2OJZH 5E7FA 2MFNA 3X3FH 5H94A 1H3VA 1H5BC 1VEOA 4WUKH 2EDDA 4GXVH 2JCCF 3TBYB 1OW0A 5DF0A 2FDBP 3KDMB 4OM0H 3SE4C 1MCRA 2VDPL 1BIIA 1QFUH 4FQQB 3F12A 3IS0X 1UT9A 4I0PB 3IJSB 4QHLB 3BPLB 5E99H 1JWMA 3DX9A 3RWCB 2Z35B 1HN1A 4F15B 1F4YH 2DLEA 4KROD 1N7ML 3UAJD 4KHTL 4W81A 1HYSC 5I17B 4OZHA 5I0DA 5GGQL 5FA4A 1PZ5B 5L8JB 1R5IB 4LPUA 4XNYH 1QUNA 2W0FB 3BHBB 1N4XL 4UINH 4OZIA 4L3EE 3OAYH 4AENB 2IANA 1U8KA 4NT6B 2RJMA 3WFBH 1BBDH 2NW3A 1XCTA 1UXSA 3SOBH 3G6AA 4X6BB 5DI8B 4YNYA 1BZ9A 3QQ4B 2X4SB 1ZLWH 4LKXB 3R8QA 3ZE2E 3OWEA 4NKIL 4G6ML 1A7PH 2CGRL 3IGAB 4JREB 4K94H 1M7IA 4PJAF 4N1EA 2X09A 2Q8BL 4U2YA 3OB0H 1Z0MA 4M6OH 4MB5A 1P7QA 4Z7VA 1GHFH 1WAAE 4YC2C 2L7JA 4YHYB 1KPUB 1B0RB 1F13A 3MRNB 4YHOL 3MYZA 1BX2B 3CXHK 1CL7L 5EZIL 1O7VA 2Y7QA 3MCKA 4UDTA 4GG6B 4HK3J 2YPVL 4DQOH 5JHDB 5ANMA 3CIQA 5DUBA 5T5FH 1N0LA 3VG0H 3V5KA 5EOCH 2NY1C 1RIUL 3VFWA 1WBYB 4CU8A 2X4OA 3ARQA 4DW2H 3PIQB 4R2GC 4ZFGL 1YY9D 4G7YL 1ZA6B 1NUDA 3EO1B 3SE3A 1NCCH 5TE6L 3CXDL 3IDYC 1A7RL 4LRIC 5GZNC 1IC5L 1TPXC 3BKMH 4G3YL 5DLML 2WWKO 5I1DA 5F44A 4X9FA 3INUH 5HHXH 2NQCA 4TULH 1NGPH 2ESVA 4Z0XB 1G7QA 5GGTA 3TV3H 4H26A 5JXAL 2AKRA 1RZJH 4MDJA 5T1KB 4ZFOA 3MBEC 3E6HA 2J8UA 4M9OA 5DD0L 1RJLA 4IRSD 5D2NC 4Y2DC 1HOCA 3MQIA 1MPAL 2YD1A 4XB7A 2VL5B 4H20H 3PQYE 1A1NB 4I0PD 4I3SL 4ODHL 5D93C 1ED3B 3BO8A 4EI5B 1I7ZA 1FN4A 1MFBL 4WUUB 3SO3B 3TWCL 4QHKJ 4PP1C 3QUXA 5SWQA 1ZT4B 1MPAH 1MFCL 1NJ9A 4ODHH 5DHXB 1OP5K 4YX2L 3ZT5A 2XWTA 1KIPA 5JOEA 4Y8DC 2F58H 1CXEA 5EU3B 2OBGA 3U2SA 1NKOA 4QOKE 4I77L 4HBCH 3TCLA 4YDJB 1G7PB 5KVGH 1B2WH 1JZ7A 2G75A 2QQNH 5EUKA 4N8VA 4ACPA 4F9LC 1G7IB 5D2NE 5D71H 3KJ6H 2C7UA 4K3EH 3ARDA 1KB9K 5ICYA 4L1HA 1G0DA 4ZOBA 3IU4L 2JJSA 1UCBL 3BIKB 1TMCB 4JO2H 1HHKA 3QSKB 3ZKXB 2OK0H 6CGTA 1RZJL 3VXSD 4XNUH 4HWBL 3VFNA 3PWPD 4KK6C 5DD6A 3OTTA 1K4CB 3B9KB 4QRQB 1YYLH 1KXVC 1A1NA 2BK8A 2C4XA 3KS0H 1FFPA 1ZKAA 4N5EC 3IJYB 1KCUH 2AJVL 1CLCA 1MNUL 1SEQH 4MNGA 1NMBH 1IC1A 5CS7A 1X5HA 3QUXC 1SYVB 4HQQL 5A2KH 3ULVD 4ZFGH 1MJUL 3MV8E 3GJFH 1MRDH 1LWRA 1S7XB 3GMQB 3R0MA 4YIQA 4LAQL 1CCZA 4Q6YA 5FKAB 4MCZA 4PJ5E 4TPRH 4L9LB 5CINH 1NMAH 5F7EH 1VFAA 2H2SC 3QHFL 3IVKA 3HG1B 4KAQH 4LAJH 3TO4A 5E8OA 2K7QA 1NGWB 3PIQA 3ARXA 4UTAH 5IG7A 4ORGA 3HE6B 4ZYKA 3TC9A 3S6CA 1BEYL 5I8CA 3LPFA 1OAQL 3UYPA 1NC4B 4WI2A 1OP3H 4H20L 5D7JB 3HRZB 5I6XB 3TN0C 2CK0H 4HSQA 1AD0B 3WKMH 5F71A 1QLRB 1FGNL 2EXYC 4XVSL 4JM2A 2UUDH 3V0WL 2OMNA 1DBML 5B38G 4M7JL 1F6AB 3QULB 4QXUH 3HN3A 4BKLB 5KVFH 4CDGC 2QQLL 3QUMH 4MNQA 3MRQB 3QWOB 5ACZA 4G6JH 4F33B 3BKML 1BZ9B 3QQ4A 1DBMH 5JPMB 3ZHLA 3NACH 2OX5A 3MUZ1 5JIKA 1JZ2A 3MRJB 3CFEA 1OGTB 1QO3A 1TJGL 3R06A 4K3JL 4P2RD 4RGMB 5EN2B 2EDJA 5JDSA 1CVRA 2IANB 4AENA 1FC2D 5F7WC 5I1IH 4DVBA 1QBLH 4L1DA 4ZOAA 2BVEA 4WHCA 1BQHG 5TPWH 4LCIL 3T4YB 8FABA 3GSQB 3GSNA 4O5LL 1TJHH 4GBXA 3SKMA 4X5XA 2N7AA 2Y23A 1F58L 3V4VL 4E42A 3GSXB 2QTEA 1M1SA 2E9IA 4C56D 1TITA 4PRDA 2KBGA 2IAMB 4R97C 4F9LA 1JUFA 5HGHB 2BXZA 4Y4HB 5TDNA 4Q9BA 3T0BA 4MX7B 3SDXF 4QHLA 5GGSA 2YUXA 5C8JB 3B9KD 1P4LB 4NN6B 3SGDH 4ZPTB 5T3ZL 1QBMH 3FB7B 1GAFL 4WTXA 1GJIA 5A2LH 2WLYA 4D94A 4D2NA 2WLZA 4PJXF 4OFKA 3REVB 3TESA 1U9KA 1K5NB 1VEMA 2VSDA 4D9QE 4I4WA 5H94B 4CN6A 5C8JA 3MROB 2YMXH 4LVHC 1HXMB 2AJSL 1U8PB 3B2UC 2FGZA 2I07A 1XGPA 4YHIA 15C8L 1IGIH 2VOTA 2L4OA 1ORSA 3QI9A 3R1GL 1WZ1L 4ZQKA 4KMQA 2VDLH 4DKEH 4X5XB 4BZYA 4K2UH 5EBMB 5F7EL 5L2KE 4HH9B 1ITBB 4N0RA 3T4YA 5C0AD 1EHNA 1UCBH 1T0MA 3MLSL 2F54A 1U92A 1OAUL 4LLUB 3IDGA 2JK5A 3RIAF 1QO3B 2VKXA 4QRTB 1QFHA 1JN6B 3UTZA 4HUXA 3MLUH 3QEGH 4PG2C 4OKDA 4M9PA 2VXTH 5AZEL 3B9AA 5B8CA 2VAAB 4JHZA 2Y5TB 4FQJH 1F6AA 5HI5D 4JRYB 2R2HB 1OSPH 4FQHA 2G5BB 4M62L 2GAZA 4YPJA 5B3NA 4K7FB 2JJSC 4UV4H 4BSWB 4AH2A 3WHE0 3BUYB 4JFPB 3L5XH 4LLDA 5IIEB 1QA9B 1QLEL 1DN2A 2XFXA 4OLYH 1KFAH 2ADIA 2B0SH 3LKSB 3L5WA 2XZQH 2BVPA 4P4KB 2DQCL 4WI6A 5D6DC 1RAMA 5FGSA 3LN9A 3OR7B 4N0UE 3CXHJ 3OG4B 4MAYD 5I1AA 4EI6B 5GIRB 3EYUL 1YN6A 4RFOL 2CR3A 4HUUB 3TJHC 4CU7A 5DR5L 5F7UA 4L9LA 4IDJH 4MA7L 1EAJA 5HGDB 2QR0B 4A2LA 3ARTA 3MRDA 3WS3B 3D85D 2VC2H 1R3JB 5AUMB 1R5VA 1ZE3C 5I1HL 4KXZI 4OQTA 3DO3A 3UYRL 4IIQB 1OAZH 1H3PH 4F15C 4XMKL 1KTRL 1CGSH 1XF4B 3LQZA 5F88A 2Y07L 3TPKA 5LKNA 2M8XA 3U6RB 4GAGL 4MXQD 4R26L 4ZTOL 2IF7A 3NIFF 1MWAB 1VFOA 1A5FH 5FUCC 3RZCD 2BERA 3C60D 2DKMA 3FQRB 4ODTH 5B39G 1P2CA 4HWZB 5I1CH 1A7NL 1J0HA 3MNWB 4L9DA 5C0AB 2DWDA 1QQDB 1GGTA 1QHOA 4U1HB 4ZS6C 3N1FC 2ZOLA 3D48R 1INEL 3T1FB 3FCTA 3MOBH 2B8OT 3BE1H 4OZFH 2GJ6B 3GI8L 5E94B 2GFBA 4U1IA 1Z9SA 2MOVA 2CUIA 4MJ5A 4K7PY 3EFFA 3RGVC 2EDKA 3K81A 1MHHA 2GHWB 3KNBA 4PRPA 5I1JH 1P53A 1ONQB 5E56A 5EO0B 1ETZA 1AGBB 3PL6C 2J5LC 4BFIA 1ONQA 3G9VA 1IM3B 5C2BL 4LVNB 4Q6IB 2R0LH 4M8QB 5IF0A 5E8EB 1B9ZA 5GGVY 4KUCF 3QPQC 2QSCL 3NMEA 3PQYD 2BVOA 2JELH 1X7QA 4PGCB 3KPTA 5F1NA 1X9QA 4ZSOB 3F58L 1JHLH 4XPHH 2XRAH 4RRPA 1NAKL 4J3TA 3FOMB 2A83B 4J3WA 3BP4B 4NUJB 2AJUL 1N4XH 3EO0A 1UWEL 4Y19A 4U6XB 1C08A 1HK6A 4RZCA 1YEDB 5D2LE 3UTPD 4O02H 4ZXBB 3L5HA 3EYVA 1AD9B 5FECB 2V5TA 5DZLA 3WBDA 1OAUH 3KLHD 4TUOA 2NY4C 3F7QA 3BDYH 5F3BA 4Z7WE 3KYAA 1LEGB 4BFGA 1LO2L 2XTLA 5JLZA 3CDGB 1F6LL 3T3MF 2UWEB 3WS3A 4HS3A 5MI0C 2WINB 3JWOH 4L8SC 3O9WD 3RVWC 3FT2A 1OAKL 4KK5C 5SX4I 1VPOH 4JY4B 4O9HL 5TDOA 2GTZA 4LQFH 1U8HA 4UDTB 1IAII 1HHGB 2WWMD 3F6LA 1OVZA 4R4ND 3SCMC 3RNKB 3SDXE 5EO1B 3RZCB 5FAAA 2P5WA 2MQCA 3K2MC 2A6DA 2ZNWA 3MXWL 1N3NB 5BVPL 5BRZA 2UVFA 4Y88A 3H3BC 4QXTA 4FZEL 4HIXL 1PY4A 3X14A 5LWYL 4LP4A 1WVZA 3CZFA 4YNYB 1FHGA 4P2QB 4PJHA 4HWNA 1OGAD 1UXSB 4HXBL 5TF1H 4FQHB 1IKFL 2UWEE 4YZFF 3HG1D 1LVEA 3I85A 3FONA 1IT9H 2YPKA 4O51A 2FB4H 1IBGL 1LO3H 4HXBH 4EVNA 5IWLA 2XG5A 3EUUA 3QDGB 1DE4B 4ALAL 1T4KA 5IQ7H 3GMMA 3MUHL 4X9IA 3IDGB 4HEME 1Y0LA 3FHQA 1PYWA 3STBA 4HLZH 5L2JB 1QSEA 4RQQB 2OLDA 4L9LC 4PJ9A 1TQBC 2E27H 4XNZC 3DUUA 5DS8A 3SDDA 3U82B 2KPNA 3GJFK 3O2DH 3W11C 3V4PH 3WUWG 1VPOL 3OKLA 4X7EC 2VL4A 3KYMA 3UDWC 3QI9B 2E6QA 4KTYA 2X40A 2D7MA 2KQNA 2E6PA 1WJ3A 3LEXB 2Q20A 3ABZA 5BXFA 4M8VA 1IAOB 3RDTC 3DVIA 5EC1B 4NUGH 4NP4H 4XBEL 5CUSL 3W0WA 3HUJF 4H88L 2VO5A 3VXMD 4OBRA 1MRFH 5IR1B 3QZWB 5DJZB 4P2RE 2HJLB 1FDLH 3MFGB 4JPVL 1S8DB 4BSJA 1BQHB 5IKCB 5HGHA 4P3WA 1WWCA 5ETUB 1I3GH 2IAMD 1FNFA 4P2CG 4U1MB 1E6JH 4YQXH 2JLLA 3NCBB 5CD5D 3SKMB 4C56E 3QXAB 1MNUH 1VA9A 2AV7B 1SEQL 1TZHB 3VXPA 1U8IA 2HTLC 4ZUVA 3EYSL 1T1WA 4G8FA 4CMMB 4QOKD 2HH0H 3BPCA 3QO0A 2YR3A 5JDSB 4OLWH 2QADD 3K1KC 1DL7H 5CZXD 4ZNEA 1KJ2L 4HUMB 1KEML 4JZNB 4F7CB 1A7BA 1YEIH 4KY1L 3CZFB 4NGHH 5E6YA 1WIUA 3QWOA 5ACZB 3VFGL 1OW0C 4YDIL 1L0QA 4RMUA 5D2LA 5I19H 5MHSD 1TJIH 5MEPA 3PV6A 5IGXL 4U3XA 5I8EA 1XAUA 2E7LA 4PJBF 1TZIB 1CS6A 2EH8H 1K8DA 3FO0L 3QDGD 3U0TA 2PW1B 3GO1L 2HVJA 5E8PB 1EHXA 4ZMAT 1RIVL 5IOPA 2LABA 1OL0A 1H0DB 4GMTH 4MD0B 5DRXA 4RBPH 4R90H 2XTJC 4M5YH 4S1DC 1OP5H 1QD0A 4PJEB 2OTPA 3KGRA 2JELL 1M7DA 4KRPC 5E8OB 3RZWA 3MXVL 1S7RB 1P69B 1K6QH 3H9YA 4CN4A 5JPNA 3C5SA 3HHRB 2X1PA 4RFEA 4FP8H 1GGBL 2VDQL 1RQ5A 4KRPD 3FB5B 3EHBD 1GL4B 2VRAA 1MCQA 4QTHA 5EZLB 32C2B 1NLBH 1S9KC 2DN7A 4ONHA 1YEDA 3LPGA 4U7KA 1CFQB 3ZTJH 3W39A 4GRLC 3T4AA 3IT8D 1OHQA 2ED8A 3DTXA 3BP4A 3D87B 4NUJA 4OFIA 1G9MH 4EBQH 1QPPA 2HP4A 4QRQA 3MRGA 3OJ2C 5F1NB 1WAAF 5EU4A 5KVEL 3DMMA 3RDTA 5DVKA 2BVUA 4H5SA 1KENL 1HHKB 2F8OA 1IC4L 5E8EA 3ZT6A 3AB0B 4KKCD 4M93B 4HS6B 1Y18B 5GRWA 3D3VB 4X7TB 5I8OL 4OCXL 4JFFB 2YPLB 4BFIB 2C7UB 2QHRL 3KYKH 4HX1B 2QADC 2DF3A 1GZQA 1T66D 4IIQC 3KPOA 3I9GL 2FATL 3KWWA 1RIUH 1W0VA 2WWKT 3ULUE 5D2LF 4HIXH 5LGJA 1KTLB 4KKAD 3UPAA 1FH5L 3T3PE 1KJ2H 3MXVH 3LS5H 4M5ZL 3SDYH 3HE7D 4Y2DA 3ZSSA 1A22B 1A14H 1WWBX 4KI5F 4XP4L 4HWZA 1JJUA 3MRMA 2NY2C 4BH8B 1NGPL 5KG9B 1H5BA 2GCYA 3ZE0E 4LDLB 2VLRB 5I16A 5JUEL 2DDQH 3BI9X 3GUTA 3KPPB 4RMQA 4V1DD 3TH3T 5FO9B 3AM8C 3P11H 3ZKXC 4P4RB 5TGBA 1R3KB 3BESR 1I3GL 1U8NB 2Z0BA 3DNKA 5FXCH 3WIIH 2LU3A 3MOQA 2VL5A 4ONGL 3U6RA 4PYHA 4X6FB 5C9KA 1ZT7A 4XCCL 2M1KA 3DYMA 4PR5A 3LKNA 1XEDA 3L5IA 4PV9B 5T1KA 3CVHH 2BOCA 4ZAKA 5HYJE 3LEVL 1CE1H 1WC7B 4UZGA 2B4CC 1R5VB 3QJFA 3S37H 3MRDB 5HGBB 5GS0H 3VGDA 5HHMB 3QNXA 2R2EB 4Q9QH 4OCXH 3GZKA 5I1DB 2I5YH 4S10A 4ZOCA 2O61B 3F65A 5I0ZA 4TOYH 1WFTA 3PHQB 2X9WA 3PL6B 4QYOA 4ZNEE 5GRZA 3TEUA 1AXSB 5I75B 3SDCB 3L9RB 3DGCR 3R4DA 1X5XA 1CR9H 1FH5H 3CC5A 5ALCH 1G9ML 2W91A 3CXDH 2G2RB 5ID1B 1ZSDA 3MJ9L 1UVQA 1U8QB 1PG7L 1JTOA 3OZ9L 4RAUB 4ERSL 2XZCL 4PJ8C 2OQJA 3IDNA 5L8KB 1FC1A 1U91B 1CG9B 1TVHB 3JSSA 3QT2A 1M7IB 2YPLD 3TZVC 3C8KB 2XKSA 4ODBD 4YBQD 1KIQA 4D3CL 1XH3A 4ZS7L 3U0WL 4H8WL 2F53B 2P49B 4L8SB 5HVGB 1RUQL 3N9GL 2X89A 1LNUB 1LQSR 5T1DH 1I3VA 2MCPL 3KS0J 4YEEA 4LLAA 1PX3A 3WIFA 1WSST 3ROOA 3TJHD 4OCMC 4KWUA 4HKXA 2FO4A 5GGVL 2CMRH 5I17A 1YUHB 4HK0B 4JE4B 4XMLL 2MQ3A 4LCYB 4P59H 3KPSA 5DEFA 3RY6C 5I71C 4YE4L 5EULV 4V1DB 1AR1D 3CK0H 3BIAX 1FGVH 4ZO7A 43CAB 5C0JA 2DDQL 4DFIA 4Z95L 1ZWIB 4HS8L 4JFOA 1K5NA 3CFKB 2X4TA 2F74A 1T22B 2BRRL 4YXHL 1DANU 4I3RH 5IFAH 2B5IC 4F57H 3MR9A 3TBYA 3MMEB 3ZE2F 4HKZA 2ARJQ 4KV5F 2PTVA 1FZOB 3HNTL 3N1PC 2IPTL 4HHAA 1P5UA 3ZKMC 5T33L 3BT2H 1K6QL 4MD4B 4S0TD 4Y4HA 1DLFL 1REIA 1RUML 5HHMD 3V0WH 5L88H 5ALBL 2OXGA 2X4RA 5DK2B 1G6VK 2YN5A 3NFNA 5FEBA 1RZKC 5INCB 4LLVA 1MCDA 3CU1A 3SQOH 1XF2A 2R23A 1NFIB 2DQEH 3QPQD 4UINL 4WHDA 3FQNB 3P0GB 1DLFH 4GBXB 2FEEL 2J88L 1NBZA 2QLVB 3LQAL 3T0WA 4Q9CA 4I18B 5J6HA 3WEXA 3EZ8A 1T6WA 5HSFA 4OBSA 1RZGA 3UZQA 5BZWA 1JK8A 1KPRB 1G9MC 2IH1A 3HNSH 3OX8A 5FYJE 1QSED 1E4XH 1MCWM 1JMXA 3HI5H 4GW4B 4P5TA 4QCIA 2VN7A 4HPYH 4U7MA 2HWZL 4F33A 1T2QL 1WIPA 4FHBD 4Q74A 3MRBB 2D03H 2P8LB 5FIEA 5I15H 5HPOA 4I9WE 3TM6A 3DWTA 4YDLB 4CMHB 4DKFH 2RFXA 1FZOA 1T7WA 4P4KC 4RX4A 1RUPH 1QSZA 3BZEA 1NAML 1AD0A 2UYLA 1CDBA 3BGMA 1NBQA 4HIJB 2B2XL 5DJ6A 3FFCD 4O58L 1V5JA 5D1XC 1Z3GL 3VD7A 3FRPG 2NY0D 3D0VA 4ORGB 3IETA 3QXVA 4ZYKB 2IC2A 4ODSH 2J8HA 1YMMD 4TULL 4U49A 1UEMA 1CLZH 1KCSH 5EBGA 3CFCL 1UH4A 1PQZB 3NABH 1BOGB 4UBDD 2A9ML 2HJFA 5KN5A 2XACC 4MCZB 3QNYA 3QO1B 1Q9LB 3C08L 1IARB 4BSVB 1RZFH 1T5XB 1TJGH 5F9DC 2I26N 2MKWA 4GKSB 3VFOB 1P84K 1ZHLA 3QFJD 3HPLA 1Q9WA 2YZ8A 4OZIE 2WSKA 1KBGL 2CPCA 1YQVH 2BXYA 4NBZB 1XIWC 2RR3A 3HZYA 2WANA 2WV3A 4I13B 5GGUA 1SJEB 5F7FA 4I2XA 1K4CA 1T83C 3MUGB 4X0KB 1U3HA 3WHXA 1YQVL 3OKDA 2BHUA 4S1DD 3OKOB 4K71B 2D7NA 3HMXH 5ERWA 4HXAL 4KU1A 5JHDE 2PXYB 3LN4A 1DQMH 1W0WB 5D1ZC 3CC5B 4KHXL 4EKXA 3ZE1E 3PDGA 5A16A 1DQLH 1GVIA 5DYOB 3C8DA 2QQQA 4CJ1A 1XR8B 2Z9TA 3H7LA 1BJ8A 4POYA 1U8OB 5J06A 4LNVA 1Z5LA 2BJMH 3QDJA 4KRPB 4OV5B 5DVLA 4MJIE 1XGTB 5EU7C 1IVLA 2XTJB 2OL3A 3RTQD 1CLZL 1KCSL 5ICZB 4ERSH 3TPUB 2P8PB 4M6AA 3W9EB 1NCWH 3WDJA 1AY1L 2AK1L 4G3YH 3OKMA 1OLLA 3UO1L 2YA1A 3BEVA 3EOTL 1L7TL 1S3KL 1WCBB 3MLXL 2VLKA 4PR5B 5CMAB 3RFZC 1AIFB 3L95B 2IMNA 5I73B 5BS0D 2EDWA 2Q87A 3UJJL 3B5TA 1ZT4A 1D5XA 1R3LA 1NBYA 3LZFH 4JFEA 3UTSE 2P48B 1GOFA 4XVTL 3ARBA 4L3CA 4P4RA 3FQWB 5TGBB 1NBYB 3RWHA 2J8UE 2HFGL 4XCEB 4LPYA 4DUXA 4YHZH 1TVBA 4IBLT 4MJ6B 4JFFD 2GJZB 5JW5A 1J0KA 2ZOKB 2V2WB 3BYTA 2DKSA 4YHPB 1PEWA 2HFGH 3ILPB 3PG2A 1HILB 4PGBA 1LP9F 4TNVK 5F6HJ 2Y36L 1LE5B 2OZ4H 2IG2H 1MVFA 3U48A 5DEGB 1AGDA 1XGRB 3OXSA 3WNOA 4RWYL 2JIXA 4Y8AA 3ULUC 1UB6B 3ARSA 4PJAB 1MLCB 5J0BA 5FYKL 4RGNB 1QTYT 3GI8H 2VUYA 4N9GA 4QRRA 1FO0L 1BF2A 4GMSL 4NWTH 3VGAB 1RU9H 4MQTB 3CX5J 4XP5H 3RI5F 5ELIA 5KW9L 4MS8D 3ARGA 3DV4A 1NCWL 4HGWA 1J0IA 1U3HB 3WHXB 3ZZ1A 5EPMA 2BX5A 3MUJA 4NZTL 1FFNA 4NQVA 3TWCH 2ZKHH 4Y4KB 4PGDB 1F4YL 3U4AA 1KC5L 2RCSL 1ZLVH 4NO3A 5KJRH 5D6DA 1DQML 4WCYH 3BPNC 2VDQH 1AQKL 4PJIB 1Q9WB 1DANT 5K9JL 4X6BA 1OARH 4G8IA 3QUKA 3WHE1 5L0QC 5DJAA 1XCTB 4JRXA 2ZUSA 2A0LD 3DGGB 2XTJD 3LH2H 5DHVA 3IXAA 2FX8L 1A7RH 1CDJA 3MX0A 1I8MB 4PRPE 5HHXL 4C57C 4ODTL 1CT8A 1I85C 3VFRB 1R5IA 5HVWA 4RISH 4TUJA 4P46B 2VZOA 1RHHB 1RUPL 4QHUB 2ORBH 3PWLA 3ZYOA 3IAGC 3H8NA 1F3JA 4EUPH 3I50L 1ZHKB 3FMGH 2XWBB 1FFRA 2OP4H 4WFGE 5IHZB 7FABH 1MLBB 5T1MA 4KI5C 3P4NA 1ZA3B 3FQTB 4R2GB 1OAKH 1CL7H 1D5BA 3HZVB 4AL8H 3BGMB 5B21A 1J12A 2HT3C 3OMZA 3ZKNC 3HZKA 2YD8A 1B4RA 3B3IA 4ELMF 3G04A 3QRGH 4PP2A 2RFXB 3WLBB 5C0EB 1NGQL 3CFCH 3W0WD 3PHOA 4AEHL 3TT1H 1SBBA 4LIQL 5D2NB 4XNQB 2EH7L 2IH1B 3PGFL 2EEDA 1EDQA 1TCRA 1UWEH 3UO1H 3S36H 1OAYL 5F70A 1F02I 2P4AB 4A6YL 5M95B 1NDMB 1J1XL 2FJHA 1PAMA 4KDTA 1TNMA 2A73B 4LRNL 1IGML 2R23B 4PJ7F 5HDBF 1BEYH 4PG9A 5HGAA 2ZG3A 3CPLA 1NAMA 3AMLA 4RBPK 2OJEA 1CFNA 1D7FA 1U3HD 3MLWH 3VI4F 3RDTD 4MVBC 2HTLD 5ESQA 4K3HA 1TCRB 5CKAA 1IM9B 3TBVB 3MJ7B 3MV9D 5AZ2L 1ZTXL 4IRJD 2VSCA 1OPGH 1IGFL 3MMEA 3P30L 3OQ3B 3STZA 1IZJA 3QB7C 1P9MC 3SKOB 3G6JA 4O2EB 4ODUA 1QEWB 4OF5A 1VACA 1OTTC 4JHWH 1H8NA 4NM4H 1N5YH 5T3ZH 4PBWD 2D7QA 1JWSB 3RHWF 1S7SB 3RJQB 1FFQA 1AJ7L 4YK4B 4JG0L 4LLMB 4A2MA 4HK0A 2RB8A 3L3JA 2Q7NA 4P46D 4NUGL 2IQ9H 2VQUA 1MCIA 3FO2B 5DS8B 1S5HA 3QJHA 1SJHB 3O3UN 3O8XA 4OAWA 1EHLL 1I7RA 1ZHKA 2NX5D 1F3JB 4WEMB 1G6RB 1U8MB 4BK5A 3KHQA 4HWUA 2ERJC 1A8JH 2YWZA 3PWLB 3BKYL 4P57A 4HJGB 1QR1A 4LDOB 3WSQL 2B39A 4WU7B 5C0ND 2WIIB 2GY5A 4WU5B 5FYJD 5HYJD 2PR4H 4H8WH 5EBWA 4KPHH 4O51B 3QUZC 3QEQA 1T20A 4QTIL 1MREL 4WCYL 5CKGA 3C5ZA 3BH9B 4K07A 5DFVD 1IQDB 3BP7B 5GS2D 2A0LC 1FGNH 5MERA 2MCPH 4XCFH 4G8IB 3LY6A 3KXFE 1G9NH 4HJJL 4PB0H 3D0LB 1A7NH 4FQJL 4LSRH 4RMVA 5DSCB 3WE6A 3CAFA 4YGVB 4LPWA 2YSSA 2NY0B 1VERA 3RWGB 3ELAT 5J11C 2XICA 2LTQB 2CKNA 3AC0A 2OL3L 1YMMB 4FTVE 1EJOH 1WFOA 3P2TA 1VGKB 1A3LH 5IGXH 3N85H 3CX2A 2O5ZH 4N8CL 2B0SL 4P23C 5TPWL 3T65A 3QUMB 2BNQE 4WFHE 3QCTL 2OXHA 2GTZB 3DVGB 4BK4A 2AV1A 3SEPA 1DDHB 2B1HH 2IQ9L 3PWJA 4XAKD 4TNWF 4MA8L 3WKML 3BKCL 1HHHA 1BQSA 2PUQT 2YA2A 5HXMA 3PWUB 1WC7A 4K94L 4MWFB 1QFOA 4PJAA 3RI5K 2BOCB 4ZAKB 2ZUWA 4E41E 3BZFA 1OT1A 4M4PA 4NO0A 5F6HI 4JQVC 1LEGA 1W72A 2AK4D 1YEHH 3DSFH 1BWMA 4H1LA 2FBOJ 2IQAA 4MJ4A 1EJ6A 3RVVD 2GI7A 3GJEA 1TQCC 2CRYA 3LMJL 2Y1VA 2ZUYA 3O4OC 4DJMA 4PJDF 2J8OA 2VLRE 4LHJB 2GJZA 4WI7A 5ITBH 5GSVB 1C08B 3I3BA 4P9ML 4JB9H 2DYPA 3ET9F 2A83A 3SJVB 3BDYL 3DO7B 4NC1C 4DZBA 5EG6C 3HI5L 1KEMH 4Y16B 4JY6A 1ES0B 3ARFB 4JO4L 4MLIA 1N2RA 1DSFH 2EKJA 5LGJB 1NEZA 4C54A 7FABL 3HI1A 5IHUH 4G6MH 5TFSH 4BH7A 1D9KC 4JKWA 3IDYB 2ZPKH 4XNZB 3W9EA 2EECA 3MOBL 3LSOA 1BZ7A 3MLUL 5IQ9B 3K4DA 4NO5A 2GSIA 1UB5B 1DDHA 1XGTA 2VXVH 4HG4J 3LKPA 1BJ1H 5DWUL 4YFDB 2CLVB 4Z7UE 3MV7A 2VQ1B 3BKCH 3RVTD 4CADA 4KKBD 1EMTH 1U8OA 5TJWK 2ZOLB 4PTUA 4ZO9A 5EOQL 4ONOA 1BLNA 2YWYA 4F7EB 4X6EA 2AJYH 4HJ0C 4V2BA 4YC2B 3SKJH 3F8UB 3U36B 4HKBB 4NZDA 4NM8H 4JY5H 1MCPH 1JNHB 3AAZB 1BVKB 3C09B 3MA9H 1Q38A 5EUOA 3UTPE 5C0NC 1I9IH 1SJEA 1CFVL 5CP3H 4Q9RL 5ACMA 5IFHL 5TE7H 1YMHB 5DR5H 3DOSA 3K2UH 1CIUA 2XV6B 3TH4T 2ZWLT 3DIFA 3F7YA 3H0TA 4OUOA 5EBWB 3D18B 3MRLB 3H3PH 4FXKB 4FFVC 4U1NB 3TBWB 3VRJA 2E9WA 3Q6FA 3AS3A 3MRKA 5HDLA 5HI3D 3OL2A 5ECJE 3JUYA 4PJ7E 3BVNB 4NZUL 1YN7A 3WL9B 1M6OB 2NXZB 1N8ZB 1EEZA 4DQOL 2F54D 2BVQA 1EEYB 2C26A 4OLYL 4YO0B 1K8DB 3U0TB 3MJ8B 3O4LA 4Y4KD 2K3TA 4YPGA 1GCFA 1O0VA 1EAPA 1RZ8B 1DR9A 4N0FB 1JPFB 3A6BH 2YA0A 5AYUL 3MRFB 3PV6B 4F3FB 3VGFA 3EDDA 4O2CA 2QEJA 4JRXD 4HF5L 4YHNB 2DAVA 5HYSA 4MD5A 3RPIA 4EDXA 3KPRE 2NLJB 2BDNL 3SKOA 3VDBA 4F7CA 4JZNA 3STLB 5BZDB 1MF2H 3VFSB 5BMFL 1GZPA 3CGTA 2ZCKH 3CVHA 1TQCB 3QUYA 3RQ3A 3NH7L 5C7XH 4OD1H 5DMIL 4MDIA 2H2PD 1U8IB 3G6DL 4PRPD 4N5ED 4RSVA 1YECL 4IMLB 2ZCKL 1RMFL 1QRNA 1OAQH 3VXME 1NAMB 3OX8B 2LU4A 4PG9B 3V6FB 3U4EB 4WRLA 1I75A 4JQIH 4PYGA 1P4IL 1JNNH 3B2UD 5JHDD 2J5LB 2VLLA 3DROB 3Q48A 4WWKC 1EEQA 3WN5A 1BBJA 2R1YB 3I75A 5J12C 1KSRA 1B4JL 4WFGD 1J1PL 4JQIL 3SY0A 3FQNA 5D8JH 3OHXA 3E3QE 3BP6B 5F9AC 2LE9A 1FL3A 5INCA 4NQCE 5LCVL 5HYEA 4HBQA 2FZ3B 3KR3H 2UZIL 1V05A 2I07B 2CMRL 3EIFA 5FHAL 5FM4A 1NFDE 3V4PL 3UXFA 5C70A 2YRLA 4XNYL 5GRUH 5IB2B 5KS9F 1TETH 1JZ8A 5ISZD 4QXGL 5KANI 3GEWB 2B1HL 4ETYA 1S9XA 4L8BB 4IRSB 5F7MC 4OLXL 3UPRA 4LKCB 3L7EA 1D5BB 2VYRE 3HZVA 1U3JA 4WUKL 1KLFA 5CEYA 1Z0NA 1HKFA 2FB4L 3S3PA 4JPKH 5KOVC 5IHZA 2APXA 2A6KB 4J3UA 3I6KA 4G6KL 1QFPA 2ITCA 1QFUL 4V1DA 5C0GB 5BS0A 3ULSB 4PRDB 3LKQA 4BQBA 4JQXC 4JFZH 3QDGA 5EOQH 1J11A 4ESKA 3O6FA 1QBML 3UMTA 3QDMB 2OS7A 4Y2DD 3RY6A 4IRJB 1UJTA 4XNXH 1GPOH 1CFTA 1LEKA 5E8NA 2AXJA 3S88L 3MNZA 4JN1L 2BOBB 4X9GA 3QIWD 3VFVB 4OZFB 4LRIA 1BGXL 4JRXB 2X42A 2YK1L 5T1DL 1WQVT 3MRJA 1FZMA 5E2JA 2W9DH 1GPOL 4P2QA 4FQCH 1UWGL 3S88H 3THMH 1KIQB 3EYOB 5GJSL 4KJWC 3LAFA 4NO3B 3P9LB 2AJXL 4Z77B 3KR3L 5BRZB 1L0XA 5E6IA 4KK9D 3EJZC 4G42B 4PGDA 1CG9A 2OTUB 1MWAH 4LSSL 3LRGA 1C5DB 2DM3A 3K8MA 1SBSH 4DOHB 4BELD 3NCCB 2ENSA 1IT9L 4X6DF 2CR6A 2ZCLL 1NC4A 4U2ZA 2ICWJ 2XZZA 1CK0L 3FT2B 4ETQB 5E1AB 3HNVL 2XT1B 3RIFK 3HE6A 3QG7L 5C0FB 4XMPL 2MWCA 2WBJC 3BJ91 1F8TL 5INDB 5FB8A 3RUGF 2ENYA 2EH7H 1OT2A 3PGFH 3FN3A 1GYAA 2XOTA 3LOWA 2W0LA 3X3GL 3GMQA 4YIQB 3S9DB 4I8DA 1KNOA 1PG7X 3DRTB 5E08H 2EYTB 1S7WB 4LIQE 2UV3A 3CH8A 3EFDL 3FB6A 4U6XA 3MLYL 4ODXB 1DFBL 4XAWH 2HFTA 4ONGH 1FL5A 1LE9A 2VITB 3ARBB 1RMFH 1NC4D 1MJ8H 2YBRA 1A7PL 3DPBA 4YFLF 2NX5E 2Y6SD 5BW7C 5E99L 1NCNA 2XQYG 3VMPA 3FAXA 2HJKA 1EO5A 4HDIB 3O6MH 2R15A 1EGJL 4L5FH 2FD6L 5E1HB 5ICYB 1HDMB 2JKXA 4LCWE 4Y2DB 5CILH 5C09B 1HHIB 4XPTL 5L9DH 3MBEB 3VWKA 4L29A 4YX2H 1JI1A 3UJTH 3EFFB 2VDNH 1CN4A 2C1OB 1G7PA 2C1OA 4OI8A 1KTKE 5C0IA 5E94A 1U36A 2B4CL 3QG7H 2ICES 4D8PB 1ZHBB 3R1GH 3KVQA 4Y4FA 4F9PA 3T2PA 4BQ9A 5CZVL 3MBEA 2AAVA 1M71A 2DWDB 5C09A 4QRPA 5K9QG 4GO6B 2IALA 3GDBA 3LN4B 3SJVD 2JB6A 4Y5VB 1UJ3A 4OV6F 2F8VA 5DMGC 4ZOEA 3VD9A 1AQDA 3C60C 2DI7A 4X4XA 3WMSA 4HWEL 3IDXH 4Y16D 3MUGA 4X0KA 3FT4B 3UTQB 3ARFD 3A6OA 4Y4HD 1H3TA 1QYGL 1I7ZB 4OCLC 3C6SB 5FOJA 3ES6A 4QGYA 5C0CE 1HEZB 4EUPA 4TVSa 5DXWA 2GTWB 5BOZG 3C87A 4GKSA 1S7WA 5J7CC 4JPIB 3VGHA 4EJ1C 1YEKH 4BSVA 1C12A 3PWNB 3FZUD 4AIOA 3DURA 3O81A 1FNSL 3E8UH 2I9TB 3HRPA 1EGJH 4L5FL 3EZJB 5BV7C 4NQXB 3D5OF 5D7LA 5GS2H 2XZQL 4KVCL 3RAJH 1UQSA 4C83B 4P5MB 3IDUA 3PE9A 1T0PB 3VD3A 5GIRA 1WITA 3DJ9A 2PO6C 1HCFX 1PJ9A 3B9DA 1F2XK 3F7PC 1NLBL 2EIZB 1XF5A 2OSLB 4LSSH 1S9YA 5F1SA 5DUPL 4WY7H 5DRXB 5I66A 2RAMA 4P4KA 2BVPB 5JHDA 1VFUA 4OIAA 5KSUA 1MIML 2R0ZL 4K7PX 4FG6C 3OXRB 5D1XB 5GQBA 2VN4A 5KANG 1TZIA 4ZD3H 4DGIH 2F8XC 5FGBA 3MFFA 3L3GA 3WNNA 4OI7A 5I1HH 3WIIL 1E4WL 5IESH 3QEQD 1MCFA 4EQ2A 1CICD 4YHML 5KAQG 3MREB 3SBWC 5C0CD 3NCYS 3UROR 5FUCE 4NNYB 2C9AA 4KJPD 4X80L 4E41A 2VNCA 1FZMB 4NFBA 5IK3A 3ZDXF 1Z2KA 3WKNA 5GS0L 3GKZA 4XPHL 5HHVH 4PRIA 5D7JC 2F54B 3RJDA 1I7UB 3VFUB 4LEXL 1OF2B 1W8NA 3BEWB 4O00A 1IGCH 3ZTJG 4HZAA 4MQ7A 3NBNA 3ULVH 1UKQA 3BPOB 3AXLA 1U0QA 4WI9A 3HE6C 5HHVL 1PZ5A 4TPRL 5HHQA 2YUVA 1CGWA 1IGTB 5FUZH 3GJFB 1BM3L 1RZJC 1AFVL 4RAVB 1FO0A 3SKNA 1KN4L 4DGVH 3LV3A 4XXCA 5HDBE 1X5KA 1JWMB 3DI3B 2D9CA 3MROA 1ORQA 4K55A 4L3EB 4PBVC 1FNHA 3D85B 1MCCA 5E00B 3A6CL 5CBEA 5C09E 5DHVH 1ZT1B 1KJ3L 1FL6A 1R3IL 2Y72A 4ZS6D 3HNVH 4GRLA 2DQIL 4XP1L 1BQLL 1UM6H 5SX4H 2BFVL 4ZPTA 3WNPA 4DGIL 5HTSA 1F8TH 1CTOA 1DBBH 1BPVA 3TVMC 1JUFB 1A6UL 4F80A 4WW2A 4O4YH 4X99B 5BOPA 3KYMB 5F7DB 1FORL 4E42B 5HHQB 1NC2D 2D0HA 3O2DA 3TFKD 5D1ZD 4R96A 4IS6A 3C08H 3ROOB 3O6KH 3VG9B 2VLMD 1EH9A 1S9VA 2MCG1 4CNIA 35C8H 3U9PL 3VFUA 3E0GA 1GOGA 3FT3B 1KJVB 3WS6A 3GMMB 5EO9B 5IFHH 5TH2A 5FDWB 4EEEA 2K7PA 2YUWA 4GRMB 4NWUL 4PJ8D 5F8RC 1P5VA 4NNYA 3RBGA 4L4TE 3BGAA 3NFPB 5EU6B 4F9PC 2GJ6E 3RL2A 3BRGC 1CICB 2R4SH 2W9EH 4KUZL 3OAUH 4I5BA 3QEUA 5IQ7L 1GZPB 4MAYC 1XR9B 3ZSTA 4JFXB 4P23B 5DMKA 4YHKL 5IMOA 5L9DL 1RFDL 3VFSA 5K59F 1P4BL 1XGYL 3BXNA 2FSEB 4KJQC 4KUZH 1ZLVK 4MD5B 3PHSA 4JO1L 4NRZB 3DMMD 4HPOH 5JQ6L 1I4FA 3VI3E 3PQYB 3MPCA 4XMKH 3NZHH 1ZS8B 2D0FA 3SBWA 1JPFA 2DQFA 3S5LA 1AGFB 1QRNE 4JLRA 1OTUC 4H1LG 1SY6L 5CEZL 1H3UA 4ZDHA 2EDYA 3L6FA 5EZOH 4RMSA 5E9DD 1X6LA 2YZ1A 5HDQL 4WJ5B 1U8HB 1TNNA 1HHJA 4NHCL 5D7LB 4P2OC 3N0PB 4L3ED 3QQ3B 4YR6B 1KEGH 1GGYA 1I1FA 1D6EA 3ZDYF 3NOIA 2OI9B 1QHPA 3TBWA 4NHCH 3IAPA 1GSMA 4Z7NE 4GW5A 1FCGA 5MEND 3VRLF 3IJYA 3MTRA 5LVEA 4JM2C 4OFPA 4F57L 5GRVL 5F1KC 1U8NA 1R3KA 4QGTA 5BO1H 2X9YA 3JVGC 3FT4A 4EUPG 2EE3A 3QIBC 5BJTA 3GUTB 1C5BH 4XWGH 1OSPL 2M2DA 4TVPD 4OD3H 3S8WA 3KPMB 1DN0A 1F90H 1NDGB 4BQCA 3S97C 3BP5B 4FQ2L 5J89A 1JTPA 1HIMH 4XB8A 1U3HC 4ENEC 4QRPB 3MV7E 1JHKL 1K2DB 4ZAKC 4TSBH 2XKNA 1M71B 3MRIB 4PTUB 5T3XH 1OTSD 1JGEA 4F8TA 5EUKB 4GRWF 2DQTL 1LO4H 3MV7B 3D39E 1ODAA 2CUHA 1CL7I 3H3KA 4YDJA 3SE8H 1S7VA 5IBUG 3E2HC 5IB5A 1SY6H 5CEZH 3ULUH 4N8CH 5EU6D 2E7CA 4H88H 1C8PA 4ELMA 3VXRE 2X70A 5T1KD 1A3RH 3U2SB 3GBML 4JFFA 4R7NA 3PDDA 3BRFA 1OCWL 3RA7L 5BRZE 1X5FA 3F5WA 3RU8L 3WV0A 1NEZB 4JKPL 1CD9B 3ZTNL 3GRWL 1KC5H 4TVPH 4KTEL 2OTWB 3B4NA 5ITFB 3DMMB 3UYRH 3UBXG 4WUUA 1V7MH 4NBXB 1ED3A 4M7LH 3BPLC 5FYJL 5B4MD 4MMZC 4I0PC 4G6AC 4NHUA 3BP5A 1Z3GH 3AY4C 4QTIH 1RJLB 4RIRB 3W39B 3QI9D 4NN7B 4ZFOB 4LVOC 3MBED 4LASL 3RPKA 5FYJH 4XCFL 3QXUA 1BZQK 5JW4N 2APBA 1RUKH 2ESVB 1CF8L 4QRRE 3ALXA 4PREB 4MSWA 5HHOD 5INDA 5D5MF 3WFDH 1WGOA 3OAZK 4I1NB 4LSQL 2YKLH 4Y5XB 2WBKA 2D03L 4UILL 1UH2A 2JCCB 1KCLA 3V52H 3TV3L 4ZUSA 1ZANH 4ETQA 3VDCA 4RA3A 3Q3GB 3MODL 4MD0A 1YNKH 1CGSL 3ULUL 5ANMB 5ICXA 3LHPL 4ZFZB 5E95B 1KB9J 2HVJB 3KPLA 4ZFFB 3UTSB 5T3ZD 2AGJL 4J1UB 2VXVL 5DVOA 3RVXD 1UM5L 1LHZA 2A77L 1VFBB 5KSBF 2W9LA 4QRUA 1YEFH 2OTUA 2X1OA 4IOSD 4G42A 4QOKB 4WV1C 4KTEH 2D7TL 1H3WM 4GUPB 1X5GA 2DJUA 1QA9A 1OTTD 4HKJA 1JHLL 4Q9QL 3BXNB 5J3HC 4BSWA 3REWB 2LFGA 4NKDA 2VQTA 2ITDB 1A14L 3EBAA 4LPVA 3CFIC 3P3YA 3WFEH 2GW5A 2Q7YB 2ZUVA 1CZ8L 3EFDH 5F89A 4OZIB 2BZDA 2VAAA 5ISZA 5TQ2L 4ZUVB 2YHGA 2JCCE 5JOFB 4P9MH 1UKTA 1T7XA 1TZHA 2DRUA 3MLZH 1MCKA 4RMWA 1HZHL 5AD0A 4OZHB 5D71L 5J12B 1CZ8H 4UV7L 3BQUD 2JK5B 3PP4H 4UOJA 4YH6A 1G6RA 1TQBB 3TO2A 2F5BH 2Z35A 5J1AB 1X3DA 4R4BA 5TFSL 1DQJA 3FO9B 4R96B 1FDLL 2GK0A 3UDWA 5EBMA 2XY2A 4ODVH 3V5DA 3MOAL 1Q9KB 1J18A 3BKJH 1XFPA 3T77B 1EBPA 1JF5A 3Q6GH 1LP9B 3HAEB 1HXMA 3ZDYE 5EIIA 1AC6A 1NFDB 3W11D 3EW3B 4I4WB 2BSSB 4DVRL 3W0WE 5AYUH 4YXKL 2P8MB 4HT1L 3VH8B 4ZPVA 1JGUL 4DGYL 3TYFA 3EYQC 2A6IA 1ZT1A 2IMMA 5DRNA 3MJ7A 4MHHG 3WFDL 1P4LA 1IM9A 2AERT 5GGSB 3MA7B 1Q0XL 4PJBE 1U2HA 2XWJB 4J4PD 3LV3B 3QEHA 2VLLB 3UTOA 3ZHKA 3WFZA 3B9VA 4NDMB 2HYMA 4IRZL 5HGAB 4OIBA 1WV7T 1YZZA 3V8CA 2VZ1A 3LHPH 4IMLA 4YJZL 3O4LD 4DVBB 2OR9H 1UGNA 1RIVH 4NN7C 3SDAA 2FX9H 3CVHB 3MACH 5E2UL 1A9BB 4OGXH 1FAIH 5K9OA 5EUOF 1SY6A 3G9AB 4HKJB 2BSTB 4JFDA 2G9HA 2OR9L 4CGTA 5LWYH 4TOYL 3X14B 4GUPA 3T04D 3Q6GL 2GQHA 1Z9LA 2A6DB 1OTSC 2X4QB 3D2UA 2P46B 1NC2B 1BVLB 1DUYB 3JV4B 4PJ8A 1U95B 4YO0A 5D4QA 1HHGA 5L6YH 5L2KD 4N90E 5KSUB 1IE5A 1W2KT 1WFNA 1T1YB 2F15A 5ICXB 5E2VL 3DV6B 1YA5A 3GBLA 2R1XA 3Q3GA 2VB5A 5FF6A 2VTFA 1U3YA 4LVNC 1ZGLA 5LJYH 3WO4B 4C83A 4EN3A 2PTUA 3D18A 3MRLA 5ABDE 4PJFA 3CCHA 1CQYA 1HQRA 1G7LA 1BAFH 4K7PH 3OAZH 3J8F7 3IXAB 1D9KB 2W0PA 3S98A 9CGTA 5JIPA 1U41A 5GSRB 2YN3A 5DFWH 3PNWA 4OLVL 4WW1A 2D4FA 4P4KD 3JWDC 5DVNA 5T3XE 1HEZA 4JGJA 5IFJA 4Q7DA 5HHPA 4ZSOA 4ORZC 4Y4KA 5JQHC 4X6EB 1KV3A 5E9DB 2DD8L 2IAMC 5EPMB 3LS5L 1DUZB 4M5ZH 3OKYA 1IILE 1OWRM 1A64A 3IFOA 5D7LD 5J8OA 4JGUA 3OGCA 4OI9A 4AY0A 4UU9B 1J1OL 1IFHH 2DYPD 5CIPB 2D31A 3PGCA 1YJDL 4NO5B 1A1OA 3IKCA 5EO0A 2F19L 2FLRT 3O0RL 4LGPB 5A43C 1T5WB 4YBLC 5MENB 3MV8A 2CXGA 2HH0L 4E5XB 4WVRA 2GFBB 4U1IB 4MAUL 4K3DH 2P42B 1HE7A 1LE5A 5CJQH 3UBXI 1HILA 1L7IL 2DQEL 3T0EE 3PWVA 1K2DA 1HHIA 5I9QB 5TQ0H 5I30H 1TDQA 4P3CL 1UA6H 5J4MA 4YHPA 5FYLE 2VXUH 2FYYA 4WFFD 2X2YA 3SN6N 4CN1A 4QRPD 3HE7A 1CXFA 3EDEA 2FECL 3CH1B 2MKLC 3QUYC 5L2KB 3K2UL 3RWHB 2H32A 1BGXH 1IGJA 2AEIT 1FNEA 2IQAB 3QH3A 3MV7D 4KKNA 2WUCL 3MGTB 3CSYB 3ARYA 3B2VH 1LEIB 1HOCB 2HVKB 3QCTH 4GW5B 5CMAA 5DVMA 3E6HB 1VDGA 4DN4H 5I1GH 3WO3B 1RJZA 3BKYH 3T3ME 4M6OL 3RVUC 3CSPA 2HRPL 4Z8FH 2P8PA 1K3IA 2A1WL 5DDHA 1PG7H 4E0RA 3LD8B 1OPGL 5ICZA 2BNUA 1V3JA 5LBSL 3RWFB 3LEVH 4C56A 3ISWA 5FV2A 4JDZA 5CEXB 4EI6A 5I1AB 3MZGB 2AK4E 1YMME 5E1AA 1OM3L 2G60L 1PDKA 1AJ7H 2WP3O 2A74B 4KZDH 4S1QL 2JF1A 4XVJH 1NMBL 2FIKB 2Z92B 1KN2L 3QQ9D 3SDAC 1LO0L 4JAMA 1BX2A 1QACA 3WE6B 25C8L 5EZJA 2EIBA 2Q3AA 1ULVA 3VWJA 5JDJA 2Y36H 1R3HB 1ZOXA 5DK0A 5AWNH 5GGRY 3BIBX 1Q9OB 1PLGH 1YPZA 2VZ3A 5E6IB 4I5BB 4JFHE 1JGDA 4Z77A 4CAGA 3HZYB 2FRGP 1A6AA 4M61A 4KAQL 4YBHA 3BISA 3G6JE 5CJXC 1AR2A 1RZKL 3BAEL 3QQ9C 2XQBH 1NSNH 1ZGLM 1P4IH 2W60B 4WHYH 4K3EL 4NNPL 1PLGL 2A9NL 3UX9B 1QRKA 1EGJA 4EXPX 1P7HL 5EC2A 1FIGH 4N1HB 4BA8A 2BMKA 4OZFA 4I3RL 4KDTC 3T8XB 4TTDD 4AEFA 4KVNL 1S9VB 5KN5B 4FQ2H 3QXTA 4IRJA 4LSRL 4GSDL 1H8OA 2IPTH 5BV7L 2PW2B 3BD5A 2JJWA 1T80A 3HLAB 4XP4H 5FHBH 4DTGL 2R29H 3SQOL 1BD2E 1CGTA 3QRFM 4FQIL 2COQA 4P2QD 1MVUA 1JWSA 3O2VL 5CEYB 4XPGH 5GJTL 3ZDZE 5KAQF 1SM3H 2ZCHH 5DUPH 1YNLH 3TBTA 1DEEA 4O2EA 3CK0L 4ODUB 4P48A 1FYTE 4L8BA 4DN3H 1CLYH 1FLTX 1X44A 2VLJA 3O4OB 1OY3B 2R9HC 3RKDC 3QUYD 4Z7UF 3F62A 4U0QB 4ELME 5H37H 5IMKB 4FQ1L 1FV1A 1PFCA 1D6VL 4AEIH 4HMEA 1S7QA 4GLRH 4WHYG 4L4TA 3BQUB 1IL1A 1RZ7L 3I50H 1Q0YL 5FKPA 5C0RH 3QNZA 4URTB 1CLOH 5D9SB 4LOUC 1MY5A 1CD1B 2HFFB 2X05A 2PXYD 3SY0B 1NDMA 1RUQH 3VI3F 1GAFH 4OKVB 1MRCL 4G6FB 2XN9B 4XC1H 1LO5B 4CVZB 4X4ZA 3C5ZC 3R06B 5EN2A 4J3VA 2AJYL 3ALWA 4UOW0 3S5LG 1SHMA 2X1XR 3GSOA 5E2TL 2V2TA 4WW2F 2NTFB 1RURH 1INQA 3RTQB 3B2VL 3PHOB 2X4UA 5C92A 4FZ8L 4R8WH 2PF6A 3NABL 4EDWL 3TIEB 1FGVL 3IRPX 5BW7A 2LVCA 3X11B 1G6RH 1LILA 2F19H 4KRNA 2ZCHL 4OGZA 4I0CC 2NY5H 4MCYA 2N56A 1JTTA 3MNVB 1LGVA 2DLIA 3P4NB 4LSDA 3OPZL 3TN0B 3U7WL 1T03H 2DQDL 4LU5H 1PKOA 5AEAA 1UM6L 4XBPB 1IZKA 1UZ6F 4PJBA 3W81A 4G7VH 1WLHA 5CJ5A 5CJQL 2NY3D 3NIGF 5D1ZA 2APTA 1BFOA 5FM8A 4LCYA 5IWLC 3O6FD 4LARH 3O4LB 3MJ8A 1FVDA 2OM5A 2FO4B 5L88L 1I1AD 4OFYA 4D9RD 1D3CA 4GSDH 2JE8A 2BVQB 1IEHA 2YRZA 4G9DB 2MJWA 5TE4L 5EOTA 3Q2CA 1PVHA 3ARGD 4X7FC 4UV4L 2DLFL 1A1MA 3DX7A 1OQOA 5MEQB 5GGRB 5H2BA 4AG4H 1YEGH 3T09A 4HC1H 5AWNL 1DFBH 4U1NA 2YMXL 4FXKA 1RK0B 4X98B 4RGND 1HI6B 3H0TB 2OZ4A 1RHFA 1N59A 3O41A 5HD8C 4GKOA 2AEQH 1U8LA 4EIZC 3GSVB 1JGDB 5EFIB 3NA4A 4N9OB 3P9WB 1ADQA 4ZUUB 3OKNA 4I0KA 5HY9B 4R3SA 5DJYB 5HD8D 2CO6B 4Z7OE 5ID1A 2RIKA 1MAKA 4HMDA 3LRSB 3MRHB 4NZRL 3IU4H 1RUAH 1F4XH 1FE8L 1PKQB 2A74A 3OGOE 1WWWX 3EJZD 3KAAA 3VXUE 5JZ7D 4JDZB 3L3DB 5CEXA 4L8CA 3PL6A 4XNXL 4N0CD 4HLJA 3LKPB 4UIMB 3VGBA 3VXRD 5C9JB 2VLKD 3QNXB 4PB0L 1UB5A 2BNUB 5MHSE 4E0RB 4WWKB 5EU3A 2XNAA 5A1AA 1T2XA 1FLRH 1J88A 1A02N 5EUOE 4P9HL 4HIIA 1T83A 2CDEA 3GSWA 4NQEB 1A6WH 4JY6B 1G7MB 3O3AA 3TIDA 3QISA 1WEJH 4J3XA 2CUMA 3QH3B 1CGYA 3I6GA 1ZGLP 1TZGL 4NWUH 1IGJB 2O93L 3W5MA 4XHQA 1OP9A 2CDGB 5DT1H 2O26U 2DYPB 2NY3B 5D93B 4HIIB 2ZUTA 2YPVH 3BEVB 4WNQA 2VLRA 5I16B 4OFVA 3OKMB 5DO2C 3I6LE 4WO4A 2ICWA 2EYTA 3RGHA 3DRTA 4PD4K 3T08A 4XBGB 1FAIL 4H1LB 2PKDA 4M6MH 5CGTA 2Y07H 3H42H 3QI9C 1KGCE 4NRXA 1W72B 2V5SA 4JANA 4PB9L 3RWEB 3DETC 1KT2B 4G6AD 4HUVA 5E4EC 3MO1A 1T5WA 4QY8A 4P0DA 4Y5XC 2AEWA 1MSPA 3NCMA 4U0RB 4PGEB 1XR8A 1TETL 5DJ0A 5JXAH 1PG7W 3FTGB 1OARL 5F1IB 4NKMB 1N64L 3UC0H 2AEQL 3QUMA 1YEEH 5JHLH 4WFFE 4JO4H 4X4ME 4ZUUA 2R9HD 3MYJA 3RKDD 1GHFL 3RDTB 5EU4B 2VR5A 1HSBB 4WFHD 3CLEH 3E1F1 4CVWA 3TA3C 1LO2H 5EH1A 1QR4A 2V7NB 1WWAX 3O41B 4KDVA 4TUKH 5T5FL 2Z8SA 3V4UL 5IVXE 3WYRA 3D2UD 5JOPD 3CLEL 4ZO6A 5EU7E 32C2A 3QDAA 1N6QL 3PNWB 4NT6A 4M48L 2CK0L 5DQJB 1HKLH 4JFQA 5E8NB 4OCYL 1LEKB 1IEBB 5KVGL 3HR5A 3I2CH 1ZLUK 5IBUB 3CCHB 4RGNC 4G9DA 3AS2A 1PQZA 1MFDL 2ZSWA 3ZL4L 5FA4B 1RY7B 1NAKH 1JPST 3GMPA 4NQED 3UZEA 5KSBA 5C0GA 3EO9H 5A40E 1A7OH 4CU6A 5FF6B 4PJBB 4GBXC 5GRVK 3QJHB 2JJUA 4P9HC 4Y4FC 1FG2B 1IGYB 2PO6A 4NKQB 2FJGA 5KSBE 1FZJA 5HYJB 1HH6B 3TNMB 2AJZB 3JV4A 3MGOB 3X11A 1RULH 2NY4B 4P2OD 5JHLL 4LHQB 2IADB 2KZWA 3V7MA 3ZYJA 3NN8A 4GKZB 5D5MA 3H9HA 2FWOB 4FXGA 4XRCA 2VZVA 5TE4H 1QEWA 3BZDA 5DC4B 1OTUD 2V2TB 4NZUH 1YEKL 4XZUA 4M7JH 4HBCL 3E8UL 1H9VA 5F9JA 1T7VA 3KPNA 2I60H 2R4RH 4YHLL 4QWWC 1MCLA 5M94B 4G6JL 3I75B 3FFCE 2X9XA 1ZVSA 3E6FB 4KJQD 2GSGB 4KC3B 1U93B 4XVUC 2CDFB 5CLWA 2HKFH 4LGSB 3RGVA 2CDFA 1U93A 3RWDA 1MAML 4J7RA 5DRWA 3QWRD 3IB4A 1JZ6A 4OM1L 3C9NB 4PRHD 4NQSA 1JYXA 1WIOA 3SKUD 4YDKH 1JF1A 2IFGA 3E2HB 4Z76B 1U58B 4JFYB 4PY8J 5TF1L 4ZXBC 1UKSA 2ZKHL 3FMGL 3PXJA 4NC1E 2A6IB 4JHBA 4ZAKD 5FA3A 3GMRA 5C0DB 5EDXA 2RHEA 1IAIM 4QEGA 43C9A 5KS9A 4PRID 3TBTB 4ODVL 2AK4B 1C5CL 1CVSC 3NN8B 4GKZA 3UJTL 1U6AH 3BFOA 5C0EA 3MRFA 1I1YB 3DUSA 5C0JB 3HUJE 1I8LC 4WDIA 4GBXD 4KGLA 2P7TB 4H8WC 4J2XA 2BSRB 5D70H 3TJEL 3O3BA 4UT7H 4XHJC 3U79A 1CQKA 4HFUH 2WIMA 1J10A 2GK0B 3ZKQD 3JTSB 2Z8RA 1D5ZB 2BNQD 3GGWA 1TTFA 1KB5B 2VLME 1YNTB 4K94C 3FHAA 1QSEB 4RQQA 4OCWH 4UMGA 1PYWB 2YXMA 4LEOB 1A7OL 5I2IB 2BMKB 2BC4A 1Q1JL 1JGLH 4LLQB 1QBBA 2HN7B 1MFEL 1A4KB 2FH8A 3TT3L 1J1XH 3HS0A 5F72S 2ICWI 3G6DH 1JI2A 1IEBA 2J6EA 1KB5L 1A6AB 4M61B 1TIUA 1CGUA 2GITB 4M6NL 2Q7YA 3AS1A 5TDPA 5JTWA 4BYHA 3GHEL 3QEGL 4BM7A 3B43A 5C07D 2NTSP 1VESA 3U7AA 3DLQR 4JR9H 1JYVA 2XPGA 2YEZB 5EZJB 3AAZA 3DMMC 2VXQL 3V7AE 5ACLA 3M8OL 2FIKA 4Y0GA 3P4OB 1MELA 1I1AB 2D9QB 4OZGF 3V6OC 2RQ8A 3F7VA 3G5VA 5HJ3A 4KJPC 5IB4B 4MYWB 5E2WL 5EO1A 3RZCA 3OJDA 4XTRD 1LK2A 4FTVB 3G5ZB 1YDPB 1FNAA 1XZ0A 1FG9C 3NZHL 5HPMB 2MPAL 4O5LH 1QSEE 1VGEL 5JIIA 4MNQE 2Q6WA 4HFUL 2XZAL 4U1GB 3QFJB 4JFHD 4ZUSB 5IEHA 4QRRB 5CD3A 4JDTL 4IEFB 4X8JB 4UUJA 3CLFL 1FPTH 2DIAA 3RX7A 1KYOJ 3Q5YA 1RJZB 1L6XA 1MLCA 1EHAA 2NY7L 5JW3H 3ZT7A 2JIXB 1HCVA 2PNDA 3MRPB 4MSWB 5LXGH 3PWPA 4PGBB 4PRNB 2Z4QA 1YY8A 1BQUA 1U8JB 3NIDF 2H32B 2DMCA 2IGFH 2V2WA 4E9LA 1KULA 5GZOC 1GGUA 3QDHA 3DXAA 1CXHA 4NHUB 4NCDA 1CF8H 2YUZA 3GJEB 3FQWA 5LCVH 4WIQA 1D5MA 3QBTB 3MACL 4JFEB 1YY8B 4UILH 4FP8L 4JB9L 3VXTB 2X4PA 3THML 1AIFA 5CFHA 4UDUB 3VXRB 2VLKB 4Z7WF 1NMCB 3GSNL 4S1SL 2QQLH 3QUML 4IOFD 4H25A 3KWWB 5MENA 2CRMA 5FCUH 4ISVB 1DZBA 1KCRL 4JM2F 3TPUA 2UWEF 5CEZE 3PWJB 2X70B 4PJFE 3CJJA 4UIMA 4PRPB 4X7SL 5CIPA 5D96B 4EBQL 3O3EB 1VHPA 1QLFA 3LIZL 1MIEH 4NPYA 5IW3A 3VW3L 1FPTL 3CLFH 2EZ0D 4H5SB 3DARA 1DUZA 3AGVA 1VGKA 2FEDD 5JW3L 5JW4M 4O4YL 5EA0L 4RGOL 1A2YB 1ROWA 3EAKA 2VERN 5LAXA 4Y19E 3LRSA 5SWZA 2PXYA 1F90L 4N0CC 1V7NH 2DQCH 3FQRA 3KPMA 4PJGF 2DBLL 5BCAA 1EX0A 4J3SA 3WFEL 4KRLB 4PUBH 4WUUE 1I1RA 4GQPH 3LMJH 3X3GH 1YEGL 4M1DL 3I6LD 1NCUA 4Q6IC 1D9KA 3FRUA 2I9LA 3BGFB 1TENA 4RFEB 4O02L 4QRRD 1BD2B 5F88B 3GIVB 2ARJB 4XC3H 3RRQA 4WU5A 4LSUL 5IW1B 3V5HB 4UOW1 4QRSA 4O2FB 1D6EB 3JV0A 2JJTA 2BDNH 3JUZA 4NNXA 4P5TD 1U8MA 1A1MB 3IDMA 3P73B 2QR0A 4NP4L 3BSZL 4XBEH 2MQ0A 3L7FA 1A47A 3H3PL 2OK0L 5CSZB 4UB0L 5FCUL 4X4YB 5IOPB 4FQXB 5B22A 1ZANL 4OJFL 4M4RA 4U31A 5IBLC 3MRRB 3O3BB 4GOSA 1S7TB 1QFWL 5DJCA 2GEEA 4IMKA 4S2SB 4OLZH 3NAAH 3DUSB 4GRWB 3U7YL 1CFBA 2VWEE 3L5WB 1MEXH 3FOLB 3QIWB 2ADIB 3VCLB 5DJ6B 5HDQH 1OGAA 3JBG7 4NN6C 1AE6H 5ISZE 4JFPA 4Y4HC 1F2QA 4EOWL 1JWUB 2FBJL 1E28A 3MV8D 1XR9A 2GKIA 2KUTA 4HF5H 1CYGA 3QO0B 1JF1B 1FRGL 4TYUA 4A6YB 5DMGD 2ZP0T 1F4AA 5KSAC 4KKLC 5A3IC 3ZE1F 3NFPA 5EU6A 1FIEA 1NGYA 5MEOB 1DBAL 1MJ7H 3VWJD 3DVFA 1GC1C 1IJ9A 3UTZB 4NWTL 4EN3C 1EK3A 1KYOK 5E5RB 3WFCL 1B0GA 3QDJE 4D9RE 4LSPL 4GG8B 1CD8A 4M7KH 3WEXB 5J6HB 1T0MB 1AGEA 2C3VB 3VXUB 5IMMA 4OGXL 3S4SG 5CP7B 5E0QA 4LVOB 1MFAL 1PZUB 4M7KL 3S37L 3NFNB 3IU3A 1QKZL 3W0WB 5FKPB 1JNLL 1F3DJ 2AEPH 2P8MA 1XF3B 4PPTA 2VH5H 1S7QB 1SQ2N 2ZJSH 2BSSA 4MD4A 5DURD 5DTFA 1N26A 2B4CH 4IRSC 1EO7A 2JJVA 2Y6SC 5IMKA 5HHOE 4KFZC 3HAEA 1Q94B 2PXYC 5B3JE 3FL7A 5TE7L 5CJXA 5FYLH 4HZLB 3H9SD 3LKOB 5I73C 5HYJA 5HYQB 5C6TH 3RX8A 4PRAB 2F74B 5F96H 5HYSG 1MH5A 2QL1A 3SO3C 5GRUL 3CFKA 2PYFB 1ZWIA 3FO9A 1IEAB 1OCWH 3VXSE 1ORQB 4L3EA 3DBXB 1YEIL 4UIKH 3WIHH 2WQ8A 4JM4H 5EB9A 2ATPA 5J1AA 3VFGH 1KN4H 3QIBD 2HLFC 4HPYL 2E3VA 4XI5D 2N7BA 3GMPB 4MHHI 4PRHB 2Y9RT 3B6SB 2SEBA 3GMOB 1II4E 1MY7A 3FAWA 3UP1A 1UWXH 5JOFA 4YDVB 5HHNA 2RBLA 3HR5B 3P0YH 2DQIH 1A4JB 4U1KB 1I7UA 3DGGA 4XAKE 3BKJL 5T1LA 4PJ5D 3ILQC 5A2IH 3ALPA 3L5JA 2W59A 3U46A 4M1DH 4YFEA 5I8OH 3IJHB 4E41B 3CUPB 1F3RB 3MRQA 5IV2B 5CWSB 3C8KA 3GSNH 2V7NA 4S1SH 4CVUA 2VDLL 4QXTB 3T0EB 4OZHF 4LLWA 4IHOA 5FUZL 4LCUA 5GGQH 1MRFL 3HB3C 2R2CA 2EKSB 3GSRB 2P5WE 4RAUA 1BWWA 2BNQB 3VWJB 2YD4A 3DHMA 4J1UA 3UTSA 4J23A 4XX1G 2H2PC 1J8HA 3AM8A 2I24N 4TRPL 3KLAB 2G2RA 4IOFC 3S36L 4AQOA 4HS8H 5DGQA 3LDBB 5F1IA 1SBSL 1S9YB 3I3DA 1X5JA 1ZVYA 2WINA 3VXUD 1SJXA 4B53A 3RVXC 4N9GB 2A77H 3U7WH 2R4SL 2W9EL 3P11L 3CDGA 3MO1B 2XXMB 4WI4A 4ZFOL 1VFAB 4NKOA 1NEUA 3TNNB 1HSAA 1QPXA 1KENH 1OSZB 4P3CH 4PG2A 5E24E 5C0BE 2J4WH 4KMTH 3CSBA 2FLBT 5KOMC 5FKAA 3DURB 4XBGA 2F58L 3KYOA 1UZ8B 1CDHA 2CIKA 2F9BT 4NQDA 3MGAA 4OFYD 1H8SA 2UVEA 1GGBH 4WNQB 4MNGB 4YGAB 5DD3L 1J9CT 3KPQB 1LEIA 4KZEH 3BW9B 3FOMA 3VXQA 4P5KB 4DW2L 5C6TL 1MAMH 3I6GB 5HYFA 4F2MA 3VFNB 2BVTA 5CZVH 5B38B 4PRBA 5D1XD 5J9PA 3NPZB 3KPSD 4X6DB 5IF0B 1RZIA 2KZ1B 4G6KH 5D7LE 3O9WA 4AIZA 1H5BB 2GCYB 4HIHB 4Q6IA 4IRZH 3Q1SH 4XTRC 1JBJA 1OAZL 1WZMA 5J6GA 4XP1H 3MOAH 1ETZB 3EKCA 5JA9A 5IM7A 2UZXB 5C9JA 1RUAL 5ADOH 4D8PA 1J1OH 5E4IA 5D7KE 5D1QB 5IB5B 5F1OB 4OV5A 4GAFB 3TCLB 4E41D 1Z5LB 3KPOB 2GJ6A 4YXLH 3FCTB 1U2CA 1J86A 1C5BL 3QXDB 4HWBA 4OLVH 4UQ3A 5I8KL 3T0ED 4DZ8B 1P2CB 5I19L 1Y18A 2F54E 4F58L 2HJKB 3IFOB 4R7DB 1NGXB 3OKDB 5BQ7A 4PJEF 4L4TD 4X6CF 4LVHB 5EFIA 1DEDA 1EFXB 1R0AL 3HAEG 1JPGB 3ARZA 4KXZH 3C5JB 4IOIB 4C4KT 4FS0A 3ZKMD 1YJDC 2HG5A 4ZTPL 4XHJD 1WCQA 5BO1L 4N5UA 5AUMA 4ZD3L 4MA8H 1E6OL 1Q9LA 3S96B 2VDOH 4JKLA 3OKKB 3S4SA 2QSCH 3Q1SL 4RA0C 5FB8B 1BOGA 2IFFL 3DX8B 1C16A 4J8RB 4OF8A 1S7RA 4M6ML 4WENB 5FGCE 5T3XD 1ZGLB 1YN6B 1FVDB 2XRAL 5T33H 2VDOL 1DQLL 1KJ2A 5D1ZB 4AMKL 1NMCC 3IETB 4LSTL 3WO4C 4X80H 2X1QA 2Y25A 3UBXB 3V6ZA 2V2XA 3S34H 1J8KA 3V5KB 2VIRB 4OIIH 4B5EA 3TYGL 5IB3A 3LKSA 1M7XA 4GG6A 5GISH 3G5YA 1W0YT 3KLAA 5AAMA 2EYSA 5I76B 4ODWB 3I3EA 1RUKL 1AGCB 1ZEAL 4PJ8B 1QSVA 4S1QH 1A6PA 4W4NA 3MC0A 3JZ7A 4AH2B 1MHPL 2IH3A 4K7FA 4MNQD 5GGVH 1BD2D 3GI9L 1S7UA 2R0ZH 5I8EB 4P59L 4WTZA 2I25N 4K9EL 1Z9OA 4RISL 2HT2D 2P8LA 3EYOA 3IYLW 1INQB 2DL9A 3RTQA 1FYTD 4LL9A 3CUPA 2HRPH 1ND0A 4Z8FL 4HUXB 4MJID 3MLRH 5FDWA 3ARED 1KPRA 2EC9T 4U6VL 1NUFA 3MCLH 4KKBC 5FUOH 3FT3A 4FQXD 3CNKA 4U1KA 4ZS7H 2VDRH 3U0WH 3VWKD 1EO8H 1T1WB 4G8FB 2DWEB 1FZKB 1AP2A 2P43B 1F97A 4XH2B 1L0YA 3W5NA 4IS6B 3U4BH 2H9GB 2W07A 3MXWH 2GUOA 4JN2A 1RURL 1NFIA 3L3OA 2VDRL 3C8HA 5B8CC 4XXCC 1IKNA 4NDMA 4JZOB 3EYQD 3SKJL 5D72L 4JPWH 4YHIB 4DUWA 4WW2B 4L4TB 1A21A 2J7LA 2V9RA 3MJ6A 1G7HB 3IJSA 4HIEA 5E70A 1EFXD 3ARDC 5L0QB 3BZ4B 1NCAH 3LQMA 3OKEB 1NUGA 5FHBL 1I7TB 4G8EB 1I9IL 3UPRB 4GQ9H 5I74C 1CFVH 4RWHA 4Y16C 1T22A 3LPWA 1F45A 2BCKA 5IEKA 3TVMD 1F4WH 5H37G 1T1ZA 4MJIA 5CBEB 1SM3L 1S5IH 3AMKA 5E00A 5BXFB 1GGIH 3GRWH 5DTFB 4MVBD 1N0XL 5EIIB 1ADQH 1FYTA 3D25A 2X4NA 3BN9C 4NBYB 1T2QH 4K8RD 5DEFB 5CP3A 3UJIL 2O5XH 3GMNA 3V2AR 2H45A 1IGTA 5J13B 4WWID 2GUOB 4DFHA 1PX4A 5CP7A 1HXYA 4PY7B 5IMMB 8FABB 4XH2A 3DUUB 2R1YA 3RIFF 1AP2B 3K7UA 1OF2A 3BX7C 4GG8A 2A6JB 3AU1B 4MNHA 5E8DL 2VDKL 1OD9A 2QHLA 3WXWL 5JZ7C 2EDOA 4KJYA 3SGJC 4LGRB 3U4EA 3RY4A 4K23H 1QRNB 3C6LA 2C3WA 4FG6D 1JZ4A 3TT1L 3I2CL 4FFYL 4MNQB 4CBPA 4UQ2A 3SDXB 4LSUH 4D0CA 5IMLA 5ISZB 1KJMB 3TO4D 4GW1B 2P1YA 4PJAE 1AFVH 2DIBA 3CD4A 3T0DA 4UV7H 2P5EE 1BHGA 3ZKND 4HEPG 4DKEL 4ZUWA 4MXVF 2IH3B 5GRYA 5CJOH 4TNVF 1MQKL 1QLRA 2VR4A 2R1WA 4PJXB 1NL0H 4Q0XL 2APFA 4D3CH 4H0GA 4PJGA 3QIBB 4KI5D 4DWHA 3JWDL 3QIWA 4XX1E 1W72H 1FBIH 2IFFH 5EIQA 5LBSH 1N3NA 1XGYH 2ADFL 5I8CB 4Y19D 3UBXA 4AJ0A 2GT9B 5GGTH 3UJJH 2NZ9D 1KJ2B 3MRRA 1R5WA 4QYOB 4R97B 3IVKB 5DO2D 4Y2OA 1C16B 1KN2H 1KXQE 4PJ5B 5TDOB 3S4SB 5F7LB 1NCDL 4UT6L 1MFCH 2ESVD 3P73A 3QAZB 1V3LA 4GRWE 3S96A 4JPWL 2UWEA 5I1CL 5HHOB 4JPIA 4QRSB 3HAEH 1NLDL 4PV9A 1Q0XH 1S78C 5BRZD 3X3FL 4FZ8H 1RK1B 4Z7WA 5ADPH 5GHWL 1JPGA 3PABA 3C6SA 4ZG1A 2O5ZL 1FNEB 3WFCH 3QFDA 3FN9A 1UWXK 1AD9A 3MLRL 4OQTL 5L2KA 4R90L 3CH1A 4Z0BL 4MS8C 4NZJA 1JNHA 5CSBA 5JW4Q 3JTTB 1U42A 4LP5A 3U36A 2X7LB 1TFHA 2BVOB 3CFDB 1BLNB 1ZLWK 2NY2B 4JREC 2XQYK 2WUBL 5AYQA 2CXKA 1CGXA 1JRHL 2AJ3B 2B1AL 4CADB 4JQXA 1N5YL 35C8L 3U9PH 4J12A 5EWIL 2CLVA 1KLUA 4M8QA 3IF1A 3O3EA 1UCTA 4R7NB 4XWOC 4DGYH 4DCQB 3LKRB 5E2TH 1BZ7B 1KGCD 3SDDC 3LKRA 4LOUD 4RAHA 1VGEH 3BYYA 1JNJA 2WK2A 3TO4C 4HIHA 3EYFB 4ZO8A 3OGCB 2NY1B 1T3FA 3VXTA 2R56L 3T1FA 5CJOL 4EI5C 3VXSA 3QDJD 2L7UA 1NL0L 2YBRB 4CUCA 5HHPB 4QHKI 1PW3A 4HW6A 3KYNA 1LE9B 3D9AL 4DZBB 1IFHL 1FL5B 4QHNB 3MLXH 3VXQB 3VFTB 1T03L 4QO1A 5GSVA 2J8UB 2DQGH 3KLDA 1UZ8A 3GHEH 5GSRA 3WXWH 2Z4QB 5IJKC 2ZG2A 4NJ9H 2PYEE 4ZUTB 1OSZA 1BFSA 3SGDI 4NKOB 3GB7A 4QT5A 3RL1A 4IIQA 2BY1A 2XI9A 1NGQH 3WCYA 3F58H 4AG4L 2OL3H 4UUJB 1CFSA 4TTDC 1F11B 1A3LL 1WBYA 3M17B 5J3HD 1OAXH 3QFJA 4TSAH 4UTBH 4U1LA 1T2JA 3DI2B 3WXVL 1N7MH 2R1XB 4QKXB 2YKLL 1JPSH 3QWRA 4YBLB 4KJWD 5DD0H 2H32H 2Y7QB 3U1SL 4MQSB 1N0XH 3ZDZF 1W8OA 2JB5L 1JE6A 4YUEH 4LMQI 3G5VB 1YMMA 1BBDL 4IHOB 3ZKSD 1I8LA 2AGJH 3IGAA 5LQBH 4YGVA 4NRZA 5IJVA 1A6ZA 1MCWW 4HFWA 5CBAB 4OCRL 3CVIL 2R4RL 4M7LL 2WUBH 7CGTA 3IFNH 2UZYB 5LGHH 4MZ2A 3IAQA 3BN3B 1I9RH 2BOBA 3IRZA 2V7HA 1A4JA 1EV2E 5DD3H 5IVZB 3CVIH 1KJMA 4RWYH 3D3VE 1NLDH 3EGSB 5GS0D 4PTTA 4YHOH 3NFSH 4JHAH 3HS0B 3C6LB 2OR7A 2WIIA 5IJKA 1A3RL 5GXBB 1A4KA 1OB1B 1T1XB 5EO9A 1KLGA 1DBJL 1ZLUH 4LLUA 4YFLI 1U92B 3HTLX 4V1DE 1I7RB 4NN5B 3VA2C 1S8DA 4IJ3C 3FO2A 3R8BB 3Q0HA 2C3GA 2ICEA 1DBJH 1GOHA 3BSZH 3MV01 5DRNB 5GRJL 4LKCA 3L3JB 3VG9C 2C1PA 3WFBL 3T0AA 4Y5YB 1C7SA 1RZFL 1XGPB 5EC1A 1U8PA 3MLPA 3N9GH 2V5YA 2EIDA 1IAOA 3KJ4B 2JB5H 1LO3L 1BREA 1CDYA 3BUTA 3NAAL 5FGBC 1AO7A 3A0OA 3TZVA 3DRQB 5D7IB 3RUGB 3P77A 1LP9A 3U7YH 3IXTA 3S35H 1JNNL 3KLHC 4Y5YA 4EZMA 1MRDL 4B7IA 1QBAA 1FL6B 4S1RH 1I7TA 4G8EA 3OHXB 3FN0H 2C3HA 4JM2D 3RVTC 1VADA 3D85A 3OR6B 4Z76A 1NMAL 4MX7A 4DEPB 3FKUS 4OT1L 5AG9A 1UH3A 1FYHB 4JHWL 4DTGH 3OF6D 1MCBA 3GJFA 2VABA 1RU9L 3RVVC 3V6FA 5AD0B 3O8XC 2H9GA 3GSNB 4PJGE 3HPJA 5MEOA 3CFJA 1AXIB 2YPKB 2IEPA 3GK8H 4U1GC 4HG4K 2CQVA 4OGYL 4ZTPH 2DWEA 1GC1L 1DQTA 2WNGA 5F89B 3L1OL 5BVJB 1P9MA 1FIGL 3CFEB 2MSPA 4FQLL 3SGKC 1S9WB 4Z78B 2J6EH 3PXHA 3HUJA 4HV8B 3VFMA 5E6IC 1M4KA 1N6VA 3SCMA 4HFWB 1DTUA 4NJ9L 4PJFF 4O2CB 3R0NA 3FOLA 4M3JA 3RIAK 1Q72L 4QOKA 5E2UH 3LN5B 4P49A 3U83A 1AC0A 3MFFB 5HI4D 3VMOA 3C6LD 1FZJB 1F42A 1U6AL 2NR6D 2C5DC 2LAAA 3OXRA 4ONFH 5D7JA 4FQXA 1T21A 4M3KB 3IFLH 1N64H 1P1ZB 1H15B 4FFZL 1M6OA 5SX5H 1X5YA 1ZK9A 2E9BA 1FJ1B 2LQRA 4OLUH 3FN0L 2E5EA 5KSVB 3IDMB 2EIZA 3FQXB 1F11A 4FQCL 3FZUC 4X6CB 2XA3A 4JGMA 4OZFG 5AG8A 3Q6FB 2NY6D 5J13C 3H7BB 5IW1A 3WD5L 4J8RA 4QT5B 3DIFB 3F7YB 3N85L 4P23D 4NQXA 3DHJA 1AO7D 3LS4L 3TZVD 4HULB 2C4FU 3BRDA 3FRUB 4TUOB 5J11B 2YD6A 3ECBB 1S7XA 3MCLL 4I3SH 1KELL 3QUKB 3IFNL 2QHRH 5GS3A 2VLJE 2BHZA 2K1MA 3PF2A 2FO1A 4YXKH 2E6JA 3ES6B 1AKJA 5ILTL 3TBSB 3T2OA 4XPFL 3MLVH 5IHBA 3KYNB 2BSED 4PJCB 4HJJH 5D72H 1G0YR 4X7DC 1X7QB 4PGCA 4F7EA 4NZTH 4PGZA 4PJ9D 4XVSH 5BQ7B 5CGYC 2OTWA 1IQWL 1IMHC 2CKBB 4JN1H 1JPSL 4PJCE 3MRCB 4YBQC 1QLFB 1JFQH 3BIKA 1NPUA 2JJTC 4UI2A 2CLRB 5E6ID 1CLYL 5ENWB 4QWWD 5E2WH 3T0XA 2DQUL 2OMBA 4KQ4L 4CKVX 5JXED 1G7IA 4ELMB 3MLYH 1N5AA 5FYJU 4H25B 3KPRA 1KLUB 4HMCA 4JO3L 3EDFA 1FP5A 5A2FA 4JPKL 2E8ZA 1UYWH 2AI0H 2X4PB 4YLQT 2OCFD 4XP9L 2GJJA 5GS1A 4M02A 1QQDA 4UTAL 3S35L 5C08A 1XGUB 3ILPA 2HT4C 4WO4B 1RVFH 3NTCL 3WJJC 1BJ1J 1HQ4B 1KUMA 5DD1L 1WTGT 2VXQH 1FE8H 2X1WL 1YYLL 1DQQA 4X9HA