2W59A

Structure of an avian igy-fc 3-4 fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
215
Chain Sequence
PIQLYAIPPSPGELYISLDAKLRCLVVNLPSDSSLSVTWTREKSGNLRPDPMVLQEHFNGTYSASSAVPVSTQDWLSGERFTCTVQHEELPLPLSKSVYRNTGPTTPPLIYPFAPHPEELSLSRVTLSCLVRGFRPRDIEIRWLRDHRAVPATEFVTTAVLPEERTANGDGDTFFVYSKMSVETAKWNGGTVFACMAVHEALPMRFSQRTLQKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords IGY FCU3-4
publication title The Crystal Structure of an Avian Igy-Fc Fragment Reveals Conservation with Both Mammalian Igg and Ige.
pubmed doi rcsb
source organism Gallus gallus
total genus 40
structure length 215
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w59A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w59A02
4Y16A 3PWNB 4PJ5D 2PXYD 3RKDD 2B4CC 5MERB 1X5YA 3BAEL 4X6DF 1GPOH 2X89D 4YLQT 1FP5A 5F96H 1NUFA 3BP6B 2FHCA 3TN0D 3TBTB 3CGTA 1ZWIA 1HOCB 1AY1L 1BJMA 4JM4L 4G6AC 5DMGC 1TJHL 3BO8A 3BSZH 1B6DA 4Q6IB 5IFAH 5AD0A 4S11A 3UDWC 5GS0D 3PE9A 2W0FA 1HHJA 2BNRE 3PIQA 5AYUL 5IHUL 4J3VA 4QHNB 1AJ7L 5JZ7D 2HVKB 1I8IA 3BXNA 1AE6L 1D5BB 1T7ZA 1Y6MR 2I27N 1MVUB 3ILQD 2F58L 4Z95L 4DK6A 5T3XE 3FQTB 4L9LB 3VXRA 4MX7A 3AB0C 1R3LA 5E00B 5C0CE 4Q9QL 4M7ZB 5J06A 1LP9F 4X9HA 1FSKC 2NZIA 3O6KL 3LCYA 1CXKA 2WM0A 3LH2L 1S3KL 1P4BH 2F5BL 4JY4A 1C5BL 2G5BB 3VFSB 4D9LL 2A83A 3V9FA 4F37F 5IBUG 4OV6F 1Q9LA 2HMID 5I73C 3UZVB 2OBGA 4J3TA 2CDEB 4R8WH 4GW4B 2JIXA 2OTPA 2YMXL 3O6MH 1LEIB 3LIZL 4KV5E 3VXPB 4PRNA 5FDWB 2EH8H 3DETC 5C08D 2V17L 1ZA3A 4NHUA 2W65B 1QSZA 1QRNA 4FTVD 4J2XA 5DHVA 2AJYL 5T3XL 1MAJA 2B1HH 1ZEAL 3HI6H 3P9MA 4IDJH 3PWLA 2FATL 2E5EA 1OARH 1T7VA 1NBVL 4GG6B 4UNTA 4Y5VB 2KQNA 1FPTL 2ATPA 5E9DA 3GJFK 1DFBL 4LCUB 3VDBA 1B4JL 1NDGB 5C0EB 3V5KA 3EFDL 4HMCA 5FV2A 4JY6A 5K9KA 3OR6B 2VDPH 1GZPA 3WXWL 4MD4A 4RX4D 3P4MB 4M43L 1B4RA 1MCBA 2ORBL 3GRWH 3V6ZB 3CZFA 5J4MA 1U8LB 3H9YA 3ARFA 1WT5C 3NCBB 4QTIH 1T4KA 1UXSB 3ZTNH 1RZJL 4P4KB 4FQLL 4GW1B 2GUOA 1D5XA 3GMMA 5DTFA 2MTPA 3OKKB 4OLXL 4JQVA 4XGZB 1P6AB 3LKNA 4HSQA 3WD5H 3WJLA 1VPOH 2C3VA 2YOCA 3MSPA 5BV7L 5KSBF 1BFSA 3VFWB 5LCVH 1S9VA 5E03A 5LBSL 4APQC 4EIZC 1J7VR 1AHWC 1HEZB 1WAAE 1U92A 5A43C 5ICZB 4TUOB 3PGFL 1KCUH 3EOAA 4ELMA 4ZAKC 4U1GB 3S34H 3RL2B 3TZVC 1AGBA 4JCMA 4CW1A 2X4TA 5LQBL 2C7UA 3L3GB 4XNQB 1E4WL 2YRLA 5J13C 1E4JA 2CGRL 3CAFA 2OXGA 1KPUA 2DIJA 4XH2B 1NUNB 5E8PB 2IFFL 3NABL 4LOUC 2VDNL 2BDNH 2NX5E 4AG4L 3ARED 3QUXC 4QCIB 3N9GL 4I4WA 1E27A 3TH2T 1LO4H 3BH9A 5ECJE 4PRIB 1A6WH 1P84K 5T1KB 3L9RB 1SYSB 5ESQA 5LXGH 5D6DA 3LRSB 2BOBA 5MEPA 3U7WL 2EZ0C 2LE9A 2GIYA 5E99L 3RUGE 3U46A 2OQJB 1XCTB 3QULB 3D3VB 4JPVH 2WBWB 2O61B 3V79C 3T4AB 1OWWA 3G08B 3QIWC 4YHKL 3BD4A 4J1UA 3BISA 3C87A 4GRWB 4MCYA 1CICA 4OFVA 1TJGH 1UWXK 3BZEB 1T0MB 2QJDA 3HG1B 1MHCA 1BD2A 1I1AA 3DGGB 1EMTL 3AAZA 3OPZL 4NFDA 5CINL 3D0VA 4YBQD 3BPNB 4HV8A 2V7NA 5I1IH 2Q3AA 4HK3J 4WHCA 1A6TB 4PP1C 1NCAH 4LVHC 1IMHC 1MFBH 1ETZA 2P5WA 1ORSA 5GGVL 4JFFE 4NQDD 5JW4M 2YA0A 3ROLA 1F4XL 5HTSA 1IQDB 4MQTB 1KTLB 4CVZA 3ULVC 3Q48A 2IAMC 4TVSa 3DXAB 4TPRH 2QHRH 3BDYL 4X6CE 4WUUE 1X5ZA 1I9JL 4GLRI 4JRYD 4PY7B 5I19H 5C7XH 5I71C 2FBJL 3LKOB 3QG7H 1QFUL 5FKPB 3P77B 3RU8L 2NY5C 1T1ZA 4XCEB 1LO0H 5C0GA 1LD9A 2AJ3B 2FGWL 4OQTH 2DYPA 1NBZA 4JKKA 1V7ML 3JTSB 2UWEA 1SY6A 3C8DA 4M7JL 2NW3B 4WV1A 3TNMA 2J12B 5AG8A 5HGHB 1N0XL 3DROB 3QDGB 4KUCF 5JUEH 3QO0A 1LILA 1EEZB 1XR9A 1FNEB 4MNHB 5TDOB 4LNVA 1JV5A 3OKDB 2FZ3B 4OZHF 5H37H 4EXPX 3BEWB 4MQXC 3MMEB 1NLBH 2DN7A 4PLKC 4NO3A 4HQQL 3C5SB 3CNKA 1QR1B 2DQTL 3RNQA 2R1WA 1OLZA 5CJXC 4DKFH 3V4UL 2A2QT 4M48L 1KJ2A 3U7AA 3ZDYF 3TJHD 1G7JA 1BBJA 1TVBA 3GMPA 1RZ8B 3QWRD 4N8VB 2WLYA 1NJ9B 1F58L 2JCCF 1Q0YH 5F1IB 5JW3H 2X4QB 3H7BB 1M71A 1FZMA 3T4YA 4LF3A 4OLWH 4XNMA 2IANB 5M95B 3CZJA 5HJ3A 1LK3L 1UZ8B 4EI5C 1FHGA 4MNQB 1O7SA 4FMKA 5E24E 1KCKA 1EHLH 4ZXBC 2VO5A 3ZSTA 4I3RL 1MF2L 1S7XB 2YUZA 3JWDL 4XP4H 3DRTA 4GXUM 4FP8L 2QKIB 2DQDL 2YA2A 4NQCD 3D5OF 4ZSOB 4PGCB 5IVXA 2VABA 5BXFB 5T33H 3L6FB 1JL8A 3QDAA 2FJHB 5EO0A 3NGBC 3ARRA 4XCNB 1EZVY 4X9IA 3ARBB 5FOBA 5I8OH 4TQEH 1K6QL 1MIML 1U42A 3OGCB 4R96A 5EC1B 1WZMA 5GS1B 2BY1A 3ARYA 5ALBH 4Y5YA 2A9NH 1U8OA 1KT2A 2XTJC 4LLDB 4YAQB 4R0LB 5DQJB 5C2BL 2VC2H 4RAVA 2EEDA 4UQ2B 3LN4A 4Y19A 2BMKA 4RAUB 3P4OA 4P48A 3QQ3B 4WO4B 2D7MA 4H0GA 4G80B 3MR9A 4BH8A 5CJ8A 4NNPH 4K8RD 1P84J 3CVHH 1N3NA 5CSBA 1IARB 2JELL 1FO0B 3MV8D 1BFVH 4RQQA 5GXBB 3EO0B 4DGIH 4LKXA 2VN7A 4XWGH 1SJEB 2BX5A 4UT7L 2EO9A 1TZHB 3GSOB 5F7DA 3EDKA 4QRRE 4QHMA 1I3GH 1SYVA 4KV5F 4ZUWB 2X4NB 2MJWA 2JJWA 1VKXB 3WIIH 2EEBA 1KOAA 3IU3A 1YN6A 1JNLL 4MDJA 3FN0L 5D7IE 5GIRB 1XIWA 3QDJE 4L4TD 1YEGH 3MRIA 2VDKH 4G6JH 3MFGB 2OJZH 3UTOA 4ACPA 2CJUL 4X7CC 3C60D 3EYQD 1WFUA 4UAOC 4H0HB 2Y6SC 5HI5C 1PKQA 5ISZB 1ES0A 1A1MB 1DDHA 4GRLD 4NNXB 1GGCL 3QXDB 3FQUB 1WV7T 3PDOB 4MVBD 5KJRL 5LJYH 4WHDA 5FYJD 1RHHB 4Q2ZA 4LAQH 3KXFA 4M8QA 1XR8A 4YE4H 4ODTH 4UILH 5I9QC 4OKVB 2E9JA 1I3RA 1T89A 1J0JA 3QRGH 4LEXL 3P3YA 5T5NG 1QLEH 4EN3D 4F7CB 2V2XA 4X6EB 2AJXL 1NBQA 3QFJE 3KLAB 2VIRA 1TPXC 2C1PA 3T77A 3C9NB 5EFIA 3FQRA 1ZS8B 1C16A 1UWGL 1OAKH 1IKNA 1WAAF 1G7HA 1A9EA 2RBLA 4C56A 2IALA 4FZEL 1ZT1B 2ZKHH 4U0QB 3C09B 2AXJA 3JBG7 4FFZL 3TT1L 1TCMA 3CFJB 3Q5OA 2ZUWA 2DDQL 2YD6A 5DGRA 1GGTA 1MELA 5DR5H 1L7IH 4N9OB 4HUVA 4MZ3A 4C59B 1X5KA 4JKMA 5FHAH 2GAZB 2VLLB 3FQNA 5FGRA 4LSPL 4MAYC 3GSXA 1MWAB 1I1RA 5CZXD 4U6VL 1X5LA 2DQUL 2LU4A 3P4LA 4N9GA 5FK9B 4KI5D 4BFGA 2H45A 1KXQE 3DX9B 2A77L 2EDDA 3UTQB 3JTTB 4A2MA 4CVXA 1T03H 1TMCB 3RUGF 3RJQB 4HJGA 4POZD 5EB9A 4JHBA 1HE7A 5HVHC 2XG5A 4GBXC 1MFDL 2HFGH 3QP3A 5GHWL 5A2KH 4Y4HB 5HY9B 1U93A 3IFNH 3IETB 1JI1A 3MRHA 4MJ6A 3DBXA 3RVVC 3O9WB 3AC0A 4UBDD 1F2XK 4HH9A 3WLBA 2ICCA 3CFCL 4L3EE 2IH3A 4G7YL 1PSKL 4QGYA 1FYTB 3SE8H 4EKXA 4X8JB 3HZYA 5B38G 3EYOB 4OZGA 3SGDH 5E95B 3ZYZA 1OL0A 2BVYA 3NCJL 5BRZE 4WU7B 1J10A 3OV6A 4PJGE 4EI6A 9CGTA 2YC1B 1HHKA 4MJID 5FYLH 3EO1B 4X6CF 5C0BB 1KCVL 2QSCH 5IVNA 2P24A 3MROA 4LKCA 3WEXB 1WZ1L 1BQSA 2MHAB 2GFBB 2EYSB 3GB7A 3UTTE 2HWZL 2QQNL 1LK2A 1OTUC 2GJZB 3UPRA 1XGQB 5DFTA 3BN9C 4FQJL 4KMLB 1T1XA 1WUNT 3NCMA 5F7YC 1K8DB 1KTDB 1KYOK 5IB1B 2XRAH 3VH8G 4O4YH 4JQXA 3AB0B 3BX7C 2NY0D 3GMNB 1UXWB 4IRZL 2EXWD 2WBJC 1FSKB 2BVOA 5JHDA 1RURL 1D6VL 1S9WB 1OTTD 4FXLA 1IT9H 1M7DA 1UYWH 1LO2H 4H1LA 3OKEA 5FO8A 1AGFA 1CFSB 4XB8A 5I1GH 4UDTA 4GAJH 3KLHD 3HZMA 4M7KL 2W60B 1DEEA 2M26A 3T2QA 2WIIA 1HHHA 4OZHB 4ESKA 3GO1H 3MACH 3H3KA 3P0GB 1AKJB 4U1MA 4ZUTB 4R2GD 3U1SH 4CN1A 2CKBB 4Y2DA 3FTGB 3M07A 4TNWK 1X6NA 3U9UB 2Y9RT 3TBVB 1IL1A 1D5MB 3QI9C 4RZCA 4WI6A 1AFVL 1BF8A 1U8MB 2JCCB 3LV3B 4I9WD 1CT8A 2WIMA 3LQAC 1AD9B 2YKLL 1YEDB 3ARGC 3QCUL 3EJYC 1I1CA 1QACA 2BSTB 1FVCB 5C0AA 1A6UL 5CGYD 3O2DL 4U1HB 3KPSD 2AS5M 1E6JH 2OZ4L 3HE7A 5EIIA 4ODXA 2E6JA 2X4OA 3BJLA 4OCRH 2GT9A 4NO0B 3A6BH 5T1DH 1NC2A 1K8IA 3QQ4B 5DUBA 3GGWB 2IMNA 2Y06H 3LDBC 4PJXA 1EGJA 1QFWL 2YPKB 5I8EB 3VFGH 3CSYA 1CLOH 1B0GA 1OW0A 5GGTA 4DFHA 2HH0H 2WWKT 2HT3D 3JZ7A 5CCKL 1MJJA 2N7AA 3TVMD 4P3DA 3SDAC 3MRRA 4NQEA 4KZDL 5FECA 1ND0B 1V05A 2DI8A 4LHUB 1HH9A 3AM8C 5GPRA 5C6TL 2UYLB 4QNPF 5A2IH 8FABA 3LB6C 1V3LA 4X99B 2KZWA 1E6OH 2PR4L 3LQMA 4APQB 2QADD 3T3PE 1AHWB 4M6AA 4ZPTB 4JDZB 2J2ZA 5MENE 3D87B 3KWWB 3U2SB 4NZTL 4DAGL 3FCTA 2E7LC 4JM2A 5KBNC 1X5FA 5IEKB 4OQ1A 1CWVA 4ZAKB 3TZVB 1G9MH 3MRNB 3CD4A 3FB5A 4OCXL 3ZDZE 5C0DB 4TRPL 4JHAH 5J13B 2F19L 4IRJC 5SWSA 3B5GA 5BQ7A 4RBPH 1G7QB 4W4OA 1A7NL 4D0CB 5CILH 3I50L 2VITB 4I8DA 2E8YA 4YDIH 3QCVH 5DVNA 2OTUB 3QUXB 4L4VB 1JF1B 1DBKH 4BQCA 3AUVA 3TPUA 3MV7D 1NC4B 1AQKL 5JIIA 5BO1L 2DLGA 2DMBA 4LQFL 3EGSB 1S7SB 2OK0H 4HIJB 3PHSA 3G6DH 3N1MC 1JNNL 2WUCL 4Q6IA 2ZUVA 5F7NC 4PBWD 4XVJL 3I3DA 4ZYKA 1U58B 3MO1B 3QIWB 5DHVH 2HVKA 5GJTL 1MVUA 5EZJB 4L29B 1KUMA 1MJ8L 4PJHA 4MXWL 1YUHA 1EHAA 3FQTA 4J4PA 5TPWL 1OP3K 3WIHA 2DMKA 1YNTB 4ZPVB 4Y2OA 3WS6C 2Z8SA 3IDGB 1QYGH 1KYOJ 25C8H 5E00A 4KXZH 3CMOL 3Q5TA 3QUMB 2FJFB 4XMPL 2FR4B 3MLVH 3NAAH 3MLSH 4G8GB 4LVHB 1P7QB 1J8KA 4BUHA 1UKQA 4X9GA 2C26A 1R5IB 4G3YL 1INEH 2G5BA 3EKCA 3OJVC 4H8WL 3VFSA 2YA1A 4RAHA 3DVNB 2IAMB 3PWUB 5F97E 2Y5TA 2CDEA 5E6IC 5I71B 1LEIA 4XVTH 3VXPA 2C3HA 4Z8FH 2XTLA 5GJSL 3Q6GH 4NO5A 5CD3A 2XY2A 2W65A 1M7IB 2EIDA 2A1WL 1X5XA 1JZ3A 3I9GH 4JANA 5DJCA 3BHBB 4GG6A 2JJSA 5IB4A 4P46A 1W72H 4WY7H 3VRLF 3LVEA 3UX9B 3FO0H 3WFDH 3DI2B 3IJSB 1H3PL 2Z91B 1U3ZA 4NWTL 5EULV 4GMTH 3E8UH 3IDJB 4LMQE 4HXAH 3N1PC 5HD8D 2OLDA 2Q6WA 1NDGA 5E5MB 5C0EA 4TULH 2R0ZL 4WI9A 1Z5LB 4YDVA 3HHRB 2R9HD 1L4IA 4MMXC 4WWKD 4WDIB 3K2UL 3WNPA 3V6ZA 5GZND 3VXME 1RIVH 1QFHA 1BIHA 1QSFE 1TZGL 2D0FA 1I8KA 4LDLB 5GS2D 2B2XL 5IQ9A 3N06B 4F9PA 2V5RA 1OVZA 4GW1A 2F8XC 5JXEA 2H2PC 5MEOB 1G0DA 4OCWL 3INUL 3OKKA 3SGEI 2CDGB 4GKSA 4XGZA 3OJDB 4EI5B 3DX8B 4PYHA 3FFCB 5I17B 2HAZA 4HUXB 5EUOF 1QZ1A 2Q76B 4MJ4A 5GS3A 4PJGF 4ZXBB 5IMOA 1EJ6A 2VAJA 4JKLA 1P4LB 5F7MC 4ZUSB 1MQ8A 4Y4KC 5JW5B 1MUJA 4TUOA 1JPST 2C1OB 5ALCH 1F13A 4P2YA 5J12C 3GSQB 3B8SA 1KENH 4XMLH 5KAQG 2J6EL 3RL2A 1YJDH 3UROR 3NGBB 3VG0L 3EJZD 1H3UA 4C54A 1FNLA 2JB6A 1FBIL 2Q86B 4X6CB 2VDQH 2QLVB 3MV11 5E8NA 2VLKD 3RGHA 3VXUE 1CLZL 4YK4C 4XH2A 5E8PA 2XTJB 3HCVB 5D7LD 4ETQA 2Y5EA 4FS0A 2HT2D 3QIBA 4ONFL 3FONA 3E6HA 2NXYC 4AENB 1NMCC 1OGAA 2ICEA 1TVHA 4PRIA 3FFDA 5T1KA 4N0CC 1P1ZA 3L9RA 1SYSA 4I3SH 2DLIA 1RUKL 4PJ7F 3C5ZA 3LKSB 4HKBA 5FUOH 1N2RA 2IADB 5DRNB 3X3FH 3W0WB 4GKNA 2O61A 1F8TL 1U8IA 1UG9A 4U05A 5E2TL 3G08A 4NBXB 3TBSB 3GHBL 3MXWL 4LVEA 4DGYH 1JTTA 3KPOB 4KKLD 1FFNB 3PHQA 1SY6H 4ODSL 5BS0E 1N5YL 4EBQL 1T0MA 4WW2F 3HG1A 5ID1B 3DGGA 1ZLUK 4OZIF 1F3RB 3RZWA 2BJML 1UQSB 4D0DB 3GK8H 5CBEA 4PRPE 1A02N 3HR6A 4UAOB 1CXHA 5F88B 4ODHH 2E9WA 2EDQA 2VLRA 1J87A 3DUSA 3QEQD 1A3RL 2YPVL 5ITFB 2YXFA 5HVGB 1V7NH 2R29L 1XGPA 2R15A 4PRHE 3TESA 4L8CA 1A9BB 3FJTA 4PY7A 1EV2E 3O6FC 3LKOA 4MJ2A 5FUZH 5I9QB 1JWUA 5FO9A 3RVUD 5FKPA 3V8CA 1LE9A 1L0XA 3U7YL 1HQRB 3GHEL 5DQDL 2W9DH 1FORH 3MODH 1I9IH 2X10A 1MJUH 1WSST 3D39D 3QDMD 3VWJC 5HGHA 4JVWA 3IXAB 1MFAH 4YHIA 5FYLD 4WI7A 1EEZA 2R4RH 2R2EB 1TPXB 5ITBL 4HIIA 4U1IA 5TDOA 3BUTA 4F7PB 4NQTA 3BKML 4JB9L 3MMEA 1SEBB 3T3PF 3VXSE 1XMWA 5TE4L 1QR1A 3C5SA 3MJ6A 1GIGL 2X70B 4OLYH 4HJ0C 4P23D 4KROD 4N8VA 1RZ8A 5DFVD 4JPIA 4OD3L 1OAQL 3ZE2F 1NJ9A 2NY7L 3ZDZF 3WFZA 5F1IA 4KTDH 1GL4B 3GUTA 1MRDL 3H7BA 4DN3L 1KJVA 3T0EC 1SM3H 1NFDA 3L5IA 3GKWH 2CXGA 4MAYB 2IANA 1CLYH 1G0YR 4W81A 1UZ8A 4J3WA 5AZEL 4MNQA 3DTXB 3VI4F 1XF4B 1YMMA 3RWFA 1NLDL 1YQVH 1CGWA 4ZQKB 4GLRH 4D0BB 1YECL 4MSWA 5IOPA 3F6LA 1NCWL 5CEXB 4GW5B 3Q5YA 4TNVF 3U4BH 5FIEA 5E8EA 4BZ1L 2D2OA 3K0WA 3PGDA 2QKIA 4ZSOA 4PGCA 1JGLH 2KKQA 4YC2C 3L6FA 5HVHB 4GBXB 2FCBA 2FJHA 4X6DA 5EU6B 5IJVA 1VCAA 3SGJC 1PY4A 5IT2L 1NSNH 3QWOB 3OGCA 2J88H 1F4HA 4HUKB 3S6CA 2DL2A 3IDIB 2XFXB 1U3HC 4OJFH 4TTDD 3OKNB 4E42A 4R0LA 4YAQA 5DQJA 1R0AL 1RZKH 3SJVB 2V6HA 2MQ3A 4UQ2A 3DVIA 4RAUA 3U0WL 2APFA 5EU5B 1DUYB 3DUUB 3LMJH 3TA3C 4JCLA 1CD1B 2FSEA 5JMOC 2YPLE 4KHTH 1AXSB 3WDJA 3TBWA 2LU7A 3EO0A 4JO1L 1J12A 4Y16D 1SJEA 1LP9A 4NPYA 1TZHA 1YEJH 5IQ7L 1VGKA 1KCRH 5ENWA 2A9ML 4F58L 2A38A 4P9MH 1OGTB 5DZOA 5GIRA 1PX4A 3S5LG 1HHIA 1RUAL 2X05A 2WQRA 1AD0B 1H3GA 2HT4D 1MNUH 3L7FA 5ISZA 1A1MA 5HHQB 2WBJB 2EE3A 4KWUA 3LPWA 2LAGB 1P6FA 4QWWC 5EZIH 4OTXH 2R56H 1RVFH 3QIUA 4TSBH 3C8KB 2VXSH 4HWZB 4BA8A 3WHE0 3T0AA 3VW3L 2FX8L 3TYFB 4OKVA 2FL5B 3B9EA 1VEMA 3X14A 4GRMB 2IBZX 4BKLB 1HNGA 1CDHA 4UB0H 4XNXH 1QO3B 3IF1B 3C2AL 5ANME 4F7CA 4KVNH 2VAAB 1ZANH 3QI9B 3KLAA 2BFVH 4BH7B 3HS0B 5HVFB 1B2WL 4LLYB 3B9KD 1CS6A 1WBXB 5ETUB 1ZS8A 2XWJB 3ARGB 3QQ9C 1U6AL 2ZUYA 1N6UA 4MHHG 5FF6B 5TQ2L 1HSAA 1LWRA 1CQKA 1CQYA 3B9VA 3OR7B 5FB8A 3CFJA 3LS5H 5EUOB 4ISVB 1JN6B 3QUYC 4XWOD 4P2RE 5KSBA 5E9DD 3PJSB 1RJZB 2R8SH 3WYRA 4U6XA 5DT1H 3UTSE 2YD1A 1PX3A 4I13B 2VLLA 4TNWF 4FZ8H 3LDBB 1BQLH 3OKOB 3VXNA 2GK0B 4XNYH 4XC1H 5FK9A 4OZFB 4P2OD 1EBAA 2LAAA 1AI1H 1D6EB 5K9OA 3SDAB 3DX9A 3PV6B 5CS7A 3DRQB 3HC3L 4LCIL 2Z0BA 4XAKE 1CG9A 5F1KC 1BZQK 1ZHNB 5DMJB 3KPTA 1IGYA 3ULUD 8CGTA 2P44B 1R5WB 1IGCH 3FMGH 1LMKA 4HS8H 5DJDB 2YN5A 1YYLH 3O3DB 1NGYB 3BP4B 5HGDA 1RIUH 5IFHL 5IGXH 4PJ7B 2Q3ZA 1NCBL 3X11B 3O9WA 1G1YA 1X44A 4WUKL 1U8JB 1YY8A 4V1DB 4YX2L 2APVA 2EDEA 4RGNC 4YIQB 4IRJB 5E2JA 2WWMC 3U79A 3WUWG 3DIFA 1AQDB 4KAQL 3V7MA 5D1XC 1JHKL 4H1LH 4UDUA 4HGWA 1T20B 3V6OC 3PQYD 4ZO6A 3DX7A 5SX4I 2UY7A 4WFHE 4P9HH 2P8LB 1MCEA 2ZCLH 3ZYIA 4OZIB 4Y1AE 5C0BA 1EUUA 2WV3A 5DWUL 4OUUA 3KYMB 4X5LA 2QSTA 2ADJB 2EYSA 3CX5K 5FYKU 4CJ0A 3CU1A 1ZLSL 2GJZA 4OM0H 1MCCA 4GMSH 1XGQA 2HKHH 4YNYB 1S5HB 2F53E 2WZPD 2QR0B 1MH5B 2FHBA 4YXKH 5F3BA 3SKOB 4BZ2H 4OI8A 1IGTB 1FRGH 1KTDA 5IB5B 3RFZC 5HYSB 1J8HD 1YN7B 1UZ6F 3HMWL 3PG2A 1MAKA 4LSUL 5DZLA 3OGOE 3T3ME 2IFGA 3TH4T 1N4XH 3A6OA 1BD2D 3ZHDA 4OCLC 1OD7A 1OQOA 3DUHA 1X6LA 3ULVL 2V2TA 3F12B 4TVPH 2FX9H 2X4SA 5I76B 5CIPB 1EGJH 2VLJA 3F58H 1EBPA 4MZ2A 3CFDB 2W60A 3MV9B 3AVEA 4X7SL 5DC9B 4GAGL 5GGTH 4XP5L 5E6IB 1AKJA 4ZUTA 4HWBL 5GGVY 3EZ8A 4KHXH 3RVTC 1EO7A 1KJ3H 5F89B 4KJWD 4FFYH 1NGQL 1D5MA 1H0DA 2Z8RA 3JV6A 4ELKB 4R4ND 3C5JA 2JCCA 5EO1A 4G9DB 1A7RL 2VXTH 1HDMB 1KEML 1UM4L 4NQXA 3H0TA 4WFEE 4JY5L 1BJ1H 5J0BA 3AS1A 2R2BB 3ETBF 2HJLB 2YD7A 2BNQE 2R2HA 2AQ1A 4NFCA 4OM1L 3T2OA 5C0RL 1JZ4A 1CU4L 1ZTXH 4JZOB 2IH1A 1YEHH 1XH3B 1MFEH 1NEZB 3N1GC 1ONQB 4NT6B 3MUGA 1CF8L 3OBAA 2VKXA 3GGWA 3V4PH 2I60L 4OF7A 3BDXA 1WT5A 1XZ0B 2H8PB 4KK6C 5E8OA 3QR2A 1LDPH 5E2VL 1FE8H 1NFIB 5ADPH 5I1CL 1BBDH 1FDLH 1A0QH 1AO7E 5DMKB 4LDEB 4LLMB 2XPGB 4K07A 2PO6A 3P9LB 1UFUA 1WWAX 1B6UA 5CP7A 4N0FB 3IFPB 4PJFB 1NCTA 5C0CA 5T5NF 5BVPL 5ID0B 1KIRB 4Y4KB 4ZPTA 1QSEB 4N5ED 3U2SA 5F9OL 4BK5A 5GGQL 2J8UE 4L9DA 5IEKA 5J12B 3OJ2C 3WFCH 4ZAKA 5C07D 2NY2D 1FIGL 3TZVA 3MRNA 1Z3GL 4ODUB 1GSMA 4QRPB 1GOGA 1JUFB 3K1DA 3HNTL 5C0DA 3RY5A 5CBAA 4LGSB 4KZEL 3KYKL 2YRZA 5LGHL 4OD1L 3DECA 1QSVA 1YEEL 2VQUA 3T0WA 1G7QA 2ICWA 4YK4B 3MA9H 4J8RB 1KIPB 3EUUA 3CSGA 3QUXA 2WMPA 1JF1A 2NXYB 1NMCB 3B43A 4Y8DC 2XZCH 1T22B 4M4RA 4HPOL 4K9EL 1NC4A 3MBEC 1I85C 5C0NC 4N0UE 1EJOH 3S9DB 3EGSA 1S7SA 5C09E 3QEGL 4HIJA 4EEEA 1IC4H 4XTRC 3GSNB 1N59A 1FAKT 3LSOA 1Z9MA 1U58A 3CX5J 5HGAB 3MO1A 3QEUA 2FHFA 3NIDE 4MLSA 3K80A 3EYVB 4ONGL 3SDCD 2NCMA 4PG2C 2KBGA 1RULL 4U3CA 2ZG2A 5EZJA 2B0SH 2DI7A 3HE6A 4G8EA 5DHYA 4NZRL 4QF1B 3RVXC 4JRXB 2Z31C 4ZPVA 4LLWB 3IDGA 1UT9A 5DLMH 4QHLB 4TSAH 3UO1H 5D6CB 1SBBA 2FJFA 2A6IB 3HAEB 1QBLH 5DD1L 1KBGL 2L7JA 3ALWA 4AJ0A 1QLFA 4JFDD 5CKGA 1H8NA 3W5NA 2XV6B 7FABL 3SDDC 4LQ1A 5HHME 2X44D 4UUJB 3SDXF 1OAYH 1XGYL 1ZSDA 4DUVA 1J1PL 2YS4A 2H1PH 3HUJF 2I5YL 3S4SA 4LCYA 5TFSL 3PWUA 2IWGA 2LABA 1V8HA 1Z9SA 1AXIB 3TFKC 2NX5D 1WAAA 1MRCH 3HFML 4G42A 1JGUH 3O6FB 1JIBA 5DGQA 1GGIH 3UJTL 3ZKMD 1TZIB 2UZIH 1N5AA 5DD0H 1M7IA 4RDQG 3DWTA 3KXFD 2HTKC 1A5FH 4PGEB 3VWJB 2IPKB 3CXDL 1Q0XH 3QZWG 1INQA 3SBWC 3KS0J 1OTSD 3AMKA 3H9SB 3JWOL 4OCSH 4MNGB 2AJVL 5CGMA 3L5WB 3T04D 1Z5LA 3DVGB 1A1NB 5T1LB 5JOFB 2ZSWA 4JO2L 2ZUTA 5T5FL 3FHQA 1Q72H 4WDIA 4P2QB 1U8PB 4S2SB 4ZUUB 3RUGA 4POUB 2HLFC 4D8PA 4LSTL 3FHAA 5IV2A 3SE4A 1MI5B 1MCOL 3F5WA 3T0EB 3KR3L 1JPSH 3R1GL 4D9RD 3QUZC 4IRSA 4H25B 5TF1L 4K7PX 2CDGA 4ZS6D 3BMWA 5I75C 1Y0LA 4EI5A 5I17A 4F7MB 1I8LC 3PWJB 2AI0L 2Q76A 4DGVH 3MZTA 5HHOB 1MPAL 4CUCA 5LGKA 3BE1H 3FZUD 1FNGB 5JO5A 1H3XA 2AK4D 4ONHA 3WNLA 4EDXA 5JW5A 4ZTPL 2BK8A 3FT3B 4GRWH 3IDXH 5HGBA 4PV9B 4U6TA 3SQBA 2VXUH 4OGZA 3FQXB 1NEUA 4YC2B 1WVZA 5DQ9B 5CD5D 1FH5L 1GHFH 2PETA 5DA4A 2Q20A 4MWFA 4P3CL 5GS0L 1FL6B 4X6CA 4WUUA 5AAMA 4PRHB 5C08E 2OTWB 2DM3A 1AGDB 1KNOA 4NWUH 1JGVL 1U3HB 3R8QA 1O0VA 4AZ8A 4FTVE 4XPGH 3HCVA 3RWEA 3ISWA 3P9WB 4TUKL 4BK4A 3DO7B 3GBLA 4LSDA 4HLZH 5FO7B 1FYHB 4AMKL 4A6YB 3B3IA 3TA3B 1G9EA 4DTGL 2FD6L 5HI3D 2QEJA 3RKDC 1NMBH 2F54B 5MEQA 4MCZB 4YPGA 5TE6L 2Y4SA 2IADA 1CVRA 2A74B 1I9RL 3Q0HA 5AG9A 4M6OH 3WLWD 4Z7OE 3W0WA 4E41B 3NA4A 3TBSA 3BRFA 4LASL 4GS7C 4NOBA 1WBZB 1OM3L 2EKJA 4LRNH 2AJSL 3I75B 4BSVA 3WIFA 3OX8B 1IM9A 1Q9KA 4YEEA 5ID1A 5JR1H 4NKOA 5ESAB 3TJEH 4D0DA 3BW9A 4R7DB 5I2IA 1W0WA 3ILQC 1MEXH 1MCWM 5EU4B 3IAQA 1U9KA 4K3JL 1NMAH 5HYFA 3SDYL 4BQ9A 2HRPL 3U48A 4RWYL 3U4EA 4JJ5B 1FC2D 1JZ5A 5B4MD 1VHPA 2G2RA 3BPCB 5ITFA 1VSCA 3O0RH 1M6OB 3NIFE 5L7XL 4GKZA 3P0VL 4N0RA 1HIML 2DD8H 3VCLB 5JHDD 2I24N 2JKXA 5DI8B 3OKMB 1IC5L 1J5OL 5D8JH 3EOTL 2D7NA 2YD8A 2H32B 5F21B 4HPYH 1M4KA 1HQRA 5GISH 1HKLH 3LQZB 2P8MA 3KG5A 3RP1A 4I2XE 3IXAA 3QPQC 1KCSH 2VWEC 3BEVB 3MNZB 2R2EA 4Y2DD 2BP3A 4ZS7H 3ARFC 2NY1D 1SEBA 3OF6A 4M1DH 4PFEA 2FLBT 1MCDA 2W9EL 5SWZE 1DZBA 4F15C 3MXVL 5EO9A 5E4IA 3M17B 3VFOB 2YEZA 4M6NH 3GMQB 3GJFA 3QUYB 4QTHB 1EZVX 3WJLC 4DKEH 2G9HB 1FFOA 1ACYH 1IAKB 3QPXL 1NAML 3TIDB 35C8H 2XKNB 1C5CH 4MA8L 5E8DL 4QRRA 4AQOA 3HE7D 1ZA6B 2KH2B 4K94C 4XPBH 4RRPG 3VD9A 3CXHK 2XN9D 2P5EB 1FO0H 4MAUH 1NC2D 1IE5A 3RGVD 4TVPD 3A6CL 1AR1C 4D0BA 4ZTOH 5J6HA 1JF6A 3ALPA 4GW5A 1L7TH 4NQDE 1WCBB 4JRYE 5I16B 4AIZB 3NIDF 1HH6B 1S78D 2MQ0A 3PL6D 4PJEF 3N85H 2EDBA 1RJLB 2ZCHL 3WE6B 2CPCA 3IDNB 4X5XB 5KS9E 5DURD 1W0YT 2V5TA 4P57A 1WC7B 4BFIB 4B41A 1IEAB 3OKNA 3OKLA 1PLGH 3SJVA 3EFFA 1R24A 1RZFL 4N68A 4RGNB 4XNZC 2VR4A 1VGEH 3GBNH 5D1XB 2GQHA 3MFFB 1CD1A 4KTEL 4K23H 5IG7B 3AREC 3TBYB 4LRIC 3QFJA 1JCKA 1AXSA 2R4SH 1CICC 5SWSD 1UM5L 4RNRA 3FT2B 3MCKB 4ODVL 3S88H 2CKNA 3LS4L 3TYGL 1I1AC 4DVBB 1YJDC 2EDOA 3R06B 3NCEB 3F6IA 3IKCB 1B0RA 2CIKA 5KVEH 1DQJA 3FO2B 4PG9A 3BWAB 1I1FA 2P4AB 3QHFL 1HN1A 4PD4K 2NZ9D 3A67L 3SDXB 1OGTA 3HUJB 3ZKQD 5E5UB 1RZ7H 3GI8H 5C0IB 5B38B 32C2A 4HCRL 3IJYA 5KAQF 4HC1L 3VI3F 3I6LD 1AD0A 2BSED 3TWCL 1LO5A 1J1XH 1DQLL 2FLRT 5HHQA 2C3GA 2UY6A 3CJJA 4L1HA 4YUEL 3LRHA 5FKAB 4XI5D 1J86A 2PYEB 3VFPA 1A6PA 4NQCE 2FGZA 3FRPA 4XP1H 5FHBH 3C8KA 5E2WH 1PEZA 1RK1A 4X4ZA 1II4E 1MWAH 3PXHA 3T09A 1ZVHA 3I6KB 2FL5A 4AH2B 2Q1EA 1OAZL 2EXYD 4GRMA 3NA9H 4J6RL 3WL9B 3VH8B 1CD8A 2N1KA 3VD3A 4OSUH 3MRDB 1XF2A 4OCMC 5EBLB 3QI9A 1QFOA 2OS7A 3P30H 3DV6B 3GMRB 4JN1L 2XWBB 4CNIB 4ZFOL 2XWJA 2MCPL 3ARGA 1TCRA 2O5XH 3GMOB 5J89A 3WKMH 2APTA 3MV8E 2XICA 4MD0A 3SY0B 1QNZH 2DKMA 4O9HH 5EUOA 2GCYB 5BRZA 4ZO9A 1JN6A 4HDIA 3C08H 4PJGA 5E0QA 3NZHH 2APWA 1G9NC 1RJZA 4G8FA 3UBXB 4PIRF 3HPLA 2P43B 2UVFA 3L3HA 3CSBA 5JQHC 3QDHA 1ADQH 5TQ0H 2B4CH 5M7QA 5DHXB 5IB2B 4L4TE 1MHPL 2GK0A 3BZ4A 5I1HH 3OXRB 4OZFA 1D6EA 1N0LA 3PV6A 3DRQA 4YFLI 4MHHI 3ECBB 4K7PL 2YSSB 4K7FB 4NDMA 1G7LB 4XP9L 4P4KD 3AM8A 1CFQB 4UT9H 3D6GA 4PP2B 5JXAL 1HXYA 1YYML 2ESVB 4K8RL 4ERSL 5IF0B 2EDNA 4Z7OF 2VYRE 4Y5YC 4Y8AA 1IQWL 2MQCA 3BKJH 1YY9D 4IMLA 5GGRY 1JWSA 3VD7A 5DJDA 1CK0L 1JHLL 1R3JA 2OZ4A 3O3DA 1KPRB 1CL7H 2E7LA 4Z7UB 2H26B 2AEQL 2XI9A 3BP4A 4MXVE 4PJ7A 4YWGH 3I85A 4PLNC 2IPUG 3W2DL 1IEBA 4ELMF 3QG6B 1NL0L 4IOIB 1QPXA 1UH2A 3G04B 1OB1B 1A6AB 4IRJA 3RZCC 3UTZA 1AQDA 5LGJB 1KC5L 3BAEH 3HI5L 4PJBE 2IC2A 4DOHB 4XBPB 1Y18B 5DUML 5D71H 3EO9L 3GSUB 4WW2A 2DM4A 3GSWB 3VFVB 5HYJB 4OZIA 3RL1A 1UH3A 2AW2A 4Y5XA 2PTTB 3NIFF 3MBEB 3G5ZA 1WLHA 4F80A 5IHLB 4O2CA 1IGIL 1XIWC 2BC4A 1FGVL 4IHOB 1KJMA 2XA8H 5DUPH 3RA7L 2CKBH 2XZQL 1T66C 5IHUH 1VA9A 4PRID 2IBBA 2EIBA 2JK5B 1I7UA 2RFXB 4YNYA 2F58H 4BFBD 1RZIB 2QR0A 1MH5A 4PD4J 1RZKC 1CXIA 2XWTA 4I0PA 4R26H 4LGRB 1IGTA 2GJ6B 3BZFB 5FA4B 4X4YB 3D3VD 3O4OC 3KYAA 4PB9H 1GPOL 5AUMA 2Z31B 1QA9B 4KI5E 2VOTA 1YN7A 1U3YA 3W11D 4AM0B 4K71C 3RWJB 3LH2H 1XGRA 3X3GL 3G6JE 5F6HJ 5EOCJ 1CBVL 1C5BH 2ITDB 3HG1D 1DR9A 3Q3GA 3BSZL 2YD4A 3EYQC 5IFAL 1T89C 4XMKH 1X7QB 3SDDB 4U1LB 5IR1A 1MCNA 2ZG1A 3IDMA 4O2FB 4ZO8A 3BGAA 5CIPA 4NGHH 1R3HB 2DWDB 2CLVA 1MCLA 5D2NC 3F7VB 4WW1B 5IW6B 5FGCE 4M1CD 1ZHKA 4Z0XB 1B9ZA 3K3QA 3RPIB 5E6IA 5MENA 4JFHD 1P2CA 1IKNC 3BD5A 3EJJX 3DXAD 3X13B 3LKPB 4H26B 3DPBA 4L8DB 2BHUA 5CUSH 2OL3B 5D9SB 4EN3C 1WWCA 5EZLA 5KVFH 4QRUB 2P47B 4O58H 4FQXC 3EFDH 3H9HB 4U2ZA 4MJIE 4KRLB 2X4UA 4JZOA 3K81A 4R8WL 4CADB 2L7UA 4LSQH 3QDGD 3O6ML 4M43H 1NEZA 3ZKNC 2EH8L 4MS8C 1CDJA 3NFNA 1F97A 3MYZA 2BVEA 2B1HL 4IDJL 1TDQA 4HMEA 3ZO0A 1OARL 1VESA 1S5IH 1S7QA 3QUZB 3LN5B 3VJ6A 1NFIA 4PJEB 3LY6A 5DMKA 5I75B 1C1EH 5BV7H 1LNUB 4LLMA 5CZXC 2CUMA 5JDSB 1PJ9A 2V7HB 3WSQL 4N0FA 3IFPA 1ZHLA 1FVDB 2VDPL 2DRUA 1EPFA 5ID0A 1CXEA 4KKCC 3H3PL 4MNQD 4Y4KA 1QSEA 4HK0A 1L0YA 3GRWL 2V5SA 4NRZB 2J8OA 1X4YA 2ZCKH 3ZTNL 1MCSA 4IJ3C 5HHMB 4WJ5A 2CGRH 4EZMA 2DQJL 5F7EH 3OXSA 3VWKD 1DBBH 2VDNH 1VPOL 4E9LA 5J6GA 3CDGB 4J8RA 3ARBD 4FQHA 1F5WA 5HGGS 3ZL4H 4I9WE 5LCVL 3RI5K 3BO8B 5KTEH 2ZOLA 3R0NA 5F9AC 5AD0B 1WITA 5DVKA 4KUZH 4DW2H 4PJ8A 1KCUL 3QT2A 1FL5A 4UINH 2W0FB 1HHJB 3U7WH 4PJ5B 5B39G 2MFNA 3KPSE 1QSFD 1CFBA 4LCWB 3TO4A 1GXEA 1A7OH 2YK1H 3GSNA 3VXRB 4WO4D 4YHKH 3O81A 2NY5H 4JQXC 4OLZH 1R3LB 2VERN 3DGCR 1IFHL 4GS7B 2J6EA 2CO7B 2BDNL 5BOPA 1ZVSA 4QXGH 4N0YH 3H3BC 4JRXA 1LO4L 3MRLA 3VXMA 4LLWA 1A6WL 1DANT 4QHLA 5B3NA 4QLRA 5LXGL 2F5AH 4UT6L 2A6IA 1Q9WA 1UEYA 4YHNA 1MREH 2JIXB 1DE4A 4JPVL 4PRNB 3BDYH 5AWNL 4U7MA 4BM7A 3RDTC 4U1KA 4HKXA 1OTTC 1ZA3B 2D7OA 2EO1A 2FBJH 1QRNB 1TJGL 1KLGB 5ISZD 1PG7X 5F7KC 5DHVB 3P9MB 4YZFE 1MIEH 1RK0A 2ATPB 1TZIA 1V7MH 5I1IL 2EEAA 1NCAL 4V2BA 1MFBL 3VWJA 4PGEA 3SKJH 4KK5D 2CIIA 1EAJA 4MD4B 3AFLA 5D1QA 3LZFH 4LLVA 2QHRL 3H9SA 4HQQH 3MV7E 4M62H 4MNGA 3V4UH 3ARFB 1DBAH 4YBLC 1T4KB 3N50A 4M48H 5I19L 3PWPB 5C7XL 1WIPA 3SOBH 1N64H 1A1NA 3N1FC 1BOGB 3QG7L 4KKBD 4F15B 5JOFA 2GUOB 2JB5H 5CGYC 3EHBC 5DTFB 3FKUS 3QFDA 1C7TA 3BD3A 4M61B 4P2QA 1U8PA 4S2SA 4WTZA 1LO0L 3LKNB 2C3VB 4OQTL 3T0XA 1GGBH 2AQ3A 5ACZB 1MI5A 2E9IA 1OSPH 3RX8A 1NAKH 3GBML 3T0EA 3ZMRA 3NZ8B 1LK3H 4DK3A 3S3SA 5JUEL 1VFMA 2AK1L 5CMAB 1U92B 5BS0A 5DEGB 1TETL 1FG2B 3H2WA 3PWJA 4JM2C 5BJTA 4I3RH 1MF2H 4ELMB 2AJUH 3TVMC 1D3CA 4KKAD 1BZ7B 4DKFL 4UNVA 4FP8H 3MLTA 5KN5A 2HTLD 2CR6A 1D9KA 2ZWLT 1Q0YL 1F4WL 2IMMA 4PV9A 3AROA 1BLNA 5JW3L 1K6QH 4OIIH 4Z7NE 2R69L 3MZGB 3D0LA 1IZKA 4OLWL 3GM0A 1E27B 1GOFA 2HFEA 2OM5A 4PRHA 1AGDA 4ZDHA 1U3HA 1EO8L 3WDHA 4KI5F 4C83A 1EHLL 3MJ7A 1EERB 2RAMA 3QNZB 4AL8H 5J1TC 4Y4HD 2NMSA 5MEPB 5IBTH 3G6JF 1TTFA 4XNZB 3DO7A 5FO7A 1ZV5A 2OP4H 2WUBH 3MUY1 1DQMH 5T33L 5ADOH 4OCYL 3AREB 4J1UB 4MCZA 4MCYB 1CICB 2A74A 3MLWH 5J1AB 5I8OL 3HI1A 4TQEL 1FYTD 1D5IL 4J4PC 3LD8C 1I1AB 4WI3A 3AAZB 3MJ9A 2GY5A 3VXSA 3VD4A 5D5MF 3D0VB 5ALBL 5I30H 2A9NL 3GIVA 3QHZH 1S7RA 2V7NB 3IXTB 1G0XA 3I75A 1T1WA 5C0BD 2B39A 4R3SB 3HMXA 5I8CB 1ETZB 4G6AD 5DMGD 2JJTA 5F7HA 2N56A 5IW1A 2P5WB 1CFTB 4R7DA 3ROLB 5D1ZA 5L2KE 2MKWA 1PYWB 4NNPL 5EU4A 3CVHL 1JPTH 4XXCC 5J9PA 1FG9C 1BFVL 1IAIM 2GTZB 4PJAE 4DGIL 4XWGL 4HUWA 3D2UB 2ZPKH 1ZGLA 1HYSC 5KJRH 3GJFH 1I3GL 1R6VA 4S10A 3IRZA 1KPVB 1JHTA 1LD9B 2DYPB 4RISH 1A6VH 2JJSC 3TNMB 5FYKH 4FNLL 4P46C 1YEGL 3KPPA 2VDKL 4G6JL 3S5LB 2OJZL 1HILB 1XR9B 3ZDXF 1OD9A 5BW7C 2VLKE 4X0KB 4KUCD 3FB7A 1B90A 5IIEB 4M4PA 5D7LE 4NO3B 3I84A 4PRAA 2R1WB 2YR3A 1KJ2B 2E7MA 4PLJD 5BMFL 2J4WH 1BBJB 1TVBB 3GMPB 5DJZA 3DETD 3NTCH 5E1AA 4X6FA 3G6AA 4FFZH 4LAQL 4YE4L 3NIGE 1M71B 4UILL 1FZMB 4F9PC 3T4YB 3D18B 1Q8MA 4LF3B 3M17A 4XNMB 3VFOA 2K7PA 4Z77B 5HJ3B 3QRGL 3V0WH 3QUYA 4QTHA 2G9HA 2FH8A 4LSPH 1IAKA 1MHEB 3CIQA 3K4ZA 3TIDA 1L9NA 4DZ8A 1K3IA 2V5YA 5TGBA 3ZHLA 3CVIH 1HWGB 1IZJA 3ET9F 4NO0D 4OFIA 1OAKL 2P5EA 4NJAH 2VABB 3MUZ1 3L5HA 2EC9T 2ZKHL 2XG4A 4NM8H 2ARJQ 5JA9A 1CIDA 2ZUUA 3IT8D 4RDQF 3QEQE 3V95A 1F02I 4R96B 3TV3L 4MDIA 5DR5L 1ZVYA 1X3DA 4Y5YB 1U8OB 1KT2B 2Z9TA 5FHAL 1FFRA 1N7MH 4LHUD 1L6ZA 1HH6A 5GRVL 3QIBC 5IKCA 3SCMA 4Y19B 3ROOB 3VFNA 3P4OB 4JM2F 4DCQA 4QEGA 4APQD 1WC7A 4BFIA 2OR9H 3C5ZC 4XCFH 3MR9B 4BH8B 2VSCA 4JFEB 2J7LA 1N3NB 4X98B 1I9EA 3D39E 3QDME 3BRGC 4H20H 4RQQB 2NQCA 3RZCB 5FYLE 4LKXB 3TZVD 1P7KA 2VDOH 3PP4H 1KLFA 5ANMA 4QHMB 4XPFH 2HFGL 1SYVB 5GSRA 5C86A 3FT2A 3MCKA 3MRKA 3IFNL 1FAIL 1YN6B 4PJDF 2Z35B 4LOUD 2PF6A 2X4PA 5FCUH 4OT1H 1XIWB 2FWOA 3QUXD 1B0WA 4W68A 4Q9RH 4L4VD 3QCTH 3STBA 2EE9A 3FO2A 4OLVH 2DJ4A 1PDKA 2IBGA 5F7FA 2M2DA 5FA3B 3U0PA 5T3ZH 1NC4D 2L4OA 1FLRH 3WUWB 3SDXA 3ARDA 1PKQB 4L3AA 3HUJA 4EVNB 4P2RA 3SE8L 2EZ0D 3LQAH 4JFPA 1TQCC 3CH1A 4LSVH 5D2LF 1SJXA 5B38A 3O4OB 3UTSA 4H0IA 4POYA 4IRZH 3QIWD 4OI7A 2D7PA 4GFTB 5FYLL 4K71B 4Q2ZB 1XR8B 2YWYA 5FKAA 4JR9H 5A16B 1DCLA 3GSVA 4M7KH 3O4LB 4XP6H 1VEPA 1IAIL 4LCCA 2AABH 3P0YH 4PP1D 4G8GD 5D2NB 4AH2A 1P7QD 2CLRB 3F7YA 5E7FA 4OZFH 2VIRB 1IKFH 4JN2B 1QHOA 4ZD3H 5BZWB 4NKMA 1PG7L 2XRAL 3WL9A 3T77B 3VH8A 3FQRB 4O4YL 5CGTA 1SEQH 3DMMA 4HEME 4OFPA 3MRDA 4LDOB 3ULVD 1G7HB 1A9EB 4C56B 2IAMD 1J0ZA 2KQMA 4Y1AD 3DV6A 4I5BA 1IT9L 5CP3A 1UYWL 3GMRA 3ZT7A 1LO2L 3BN3B 3O11B 3SGDI 4EN3B 5DF0A 4YFEA 1YPZE 1PBYA 4GAJL 5I1KH 1C08A 2IBZY 4FQXB 5IMKA 5CWSA 3SY0A 3FQNB 1WTGT 4S1DC 4BQ8A 3GO1L 3MACL 4AIXA 2GCYA 3GSXB 5M94B 3U1SL 4JFOB 4N9GB 4GUPA 1QFWH 2A0LC 4RFNC 1Z9LA 1RAMA 4MQXD 5E08H 4PLKD 5IB2A 4CVXB 3O6LL 1M1SA 1AC6A 1I7TA 3AXLA 2W92A 3ECBA 2YSSA 4K7FA 4O2EB 1G7LA 1E6JL 3KDMB 4R7NB 3CLFH 1L0QA 2PR4H 3KYOA 4PP2A 3CDCA 3MRHB 4MJ6B 2ESVA 4OCRL 4X4XA 5EOQH 3IJHB 1RI8A 4M6MH 1LGVA 3G6JB 4HH9B 4EI5D 4YJZL 3FFCD 5IB3B 3SKMB 2H26A 3N1QC 4ZXBD 3RBSA 3VFGL 2VMFA 4RMSA 1GC1C 1GCFA 4X7TB 4IJ3B 2ADGA 2W9LA 1JNHB 2HH0L 3HZYB 4JKWA 4JAMB 1QD0A 6CGTA 5JNYB 2AJZB 3I50H 5C9JB 4EI6B 3WKNA 5F7LB 1HHKB 1NUDA 5D5MB 3H7LA 4YPJA 1KF9B 5EORL 3MROB 2P24B 3TCXA 4LKCB 1Y18A 2WBKA 4PJAF 1CZ8L 3IDYC 5DRWB 2J1KA 5CIPH 3ARVA 1AQKH 1LK2B 3MLZH 5HYJA 1QHPA 4P5TC 1EIBA 3UPRB 3DHMA 2XTJD 2WUCH 1CE6B 2PTTA 1I85A 1G9ML 2UZXB 4XVJH 1KACB 1EFQA 1F11A 1FFPA 1HSBA 4YXLH 5D7JA 4NRYB 2CLZB 5E9DE 2ITCA 4JHAL 2RFXA 5IWLC 3VFTB 1CGXA 4QXUH 3P4NA 4OAWA 5DO2D 3IS1X 4FQCL 5TPWH 1PQZA 5CILL 3F7RA 4YDIL 3QCVL 3BZFA 5FA4A 5TJWK 4U6HA 4PJCF 3W0WD 3O8XA 1DBKL 4H1LB 1U95A 5FO8B 3QIUC 3RI5F 1GGYA 4YDJA 3WHXB 2LTQC 1PD6A 4NC2B 4UDTB 3HZMB 3RWJA 2X1QA 3C6LA 4F33B 2OK0L 2BNUA 1CN4A 1DEEB 2AQ2A 4G3YH 3G6DL 3PP3H 2WIIB 4FQIH 1X7QA 3OAZH 3SO3C 4U1LA 3ULUE 5KZCB 4O2FA 1R3HA 3RDTB 4J12A 1IL1B 5IW6A 4RZCB 2FIRT 2Y6SD 5HI5D 2YBRB 4NC1E 4O51B 3RPIA 1JTOA 2AGJH 3NACL 4WCYL 4WU5B 1P9MC 3AS3A 1Z9OA 3MPCA 4NUGH 1CGUA 1QYGL 25C8L 3CSPA 1EHXA 4KY1H 4OBSA 4L8DA 4S1RH 5IW3A 5C0AB 2OL3A 3MLVL 3NAAL 4Y4FC 5EBMB 4NC0B 4ODXB 3PQYE 4JG0L 3O3UN 5E4EC 5HBBA 1INEL 2LVCA 2XZZA 1K8IB 3CC5A 5ABDE 1YNKL 4K3HA 4HFUH 5ESVA 4CADA 4YBLB 5EU3B 1DVFA 3ULUL 3AU1A 3CSYB 4XVTL 2W0LA 3K2UH 1B0GB 3K4DA 4Z8FL 3QNXA 4P3DB 1XF1A 1Z0NA 3MRRB 4NQEB 3CFKB 3INUH 1L6XA 3I9GL 8FABB 3PDGA 1W72L 4WY7L 3FO0L 3DHJA 2KUTA 4PJEA 3WHE1 4KXZI 3E8UL 4HXAL 4CVWA 1T7WA 3Q2CA 3SE9H 3FCTB 4JM2B 5JDSA 4TULL 3GSNH 1BWMA 1BD2E 4I48A 1FVDA 1RPQA 4UNUA 3TVMB 4MAYD 4LL9A 5A2JH 5JPMA 5FYKD 3BWUC 3VXTA 1EFXA 4Z7VE 3VG0H 1RQ5A 5DJ6B 3ES6A 5F70A 5BQ7B 3MNVA 5ERWA 3SE3A 5F9WC 1JBJA 5EU7C 1T1YA 4P5KA 4AEHH 3BESR 1MCPL 4PJDB 1FVEB 4NCC2 2JJVA 1CTOA 3HAEH 4GBXD 2EC8A 4KK9C 3TPUB 5EU6D 1E28A 4ONFH 3CDGA 3V0VA 1N6QH 1MHHB 4X7EC 3ZYOA 2VZTA 5I66B 2QV2A 5ALCL 1YEFH 4ZYKB 3RVVD 4PJ5A 2PXYA 5D2LB 1KENL 4XMLL 3SJVD 4P49A 4LCWA 3RWGA 2X89A 2UWEE 2RCSH 4PJHB 5DMIH 1YUHB 3GHBH 3RHWK 4BSJA 3D9AH 3LD8B 3TN0A 3FRUA 2IPTH 4U33A 2AV1B 4RMVA 1RJYA 5DJXB 1MSPA 3UZEA 3CH8A 5L2JB 1OOAA 3E3QC 1HXMA 4E0RB 3HR5A 5DD3H 2COQA 2XY1A 1F4YH 4I3SL 5C0FA 5HXMA 2VR9A 5DMYA 2VQTA 2QQKL 5E6YA 5FUOL 1CDGA 1WJ3A 2ADFH 1S7TA 2Y5TB 4P2CG 4FXKB 1KELH 5I8KL 3BN9D 4HLZG 3X3FL 2D03L 4GJTB 2ZNXA 2NY4C 3VGAC 4WFFD 3VGBA 1CR9H 5CD3B 4NO5B 2X1WL 1CE1H 2UUDK 2VZOA 1SY6L 3LKRA 1KLGA 4HW6A 4DKDC 5C07E 2WBJD 4JDVA 4JANB 5DJCB 1A7BA 5IB4B 4P46B 2QQLL 3G5VA 3GK8L 3MGAA 4NKIH 3IS0X 5ICYA 1NKRA 2Q6WB 4Z7QF 1UA6H 4L3CB 3RIFK 4ODHL 3TH3T 5C08A 4U7SA 2NR6C 4YDVB 4PY8J 4FTVA 2CO6B 4U1JA 1V7NL 3O45B 1GIGH 5E7BA 4OF0A 3LOWA 3OHXB 5T3ZD 3PWPA 1I8KB 3W39B 4ORGA 3DSNA 3T0VA 1BOGA 1K4DB 5IQ9B 5FUZL 4OD3H 2NY7H 1SBSH 5H8DA 4PTTB 4M61A 3ARGD 4OFDA 4GKSB 3EJYD 4KU1A 4OV5B 1BEYH 1U2CA 5DVMA 2W9DL 2PO6C 1VFAA 2RGSA 4HHAB 4X9BA 1FORL 3MODL 1I9IL 5ACZA 1MJUL 2E27L 4RX4A 1MFAL 3NZ8A 4HS6A 4A6YH 5IMOB 2DM7A 1QR4A 2R4RL 1FC1A 5CMAA 3CCHA 1MUJB 5A3IC 5DEGA 1FG2A 2YRPA 2EDKA 3E6FB 4CRPA 5IVOA 2VH5H 1BZ7A 4JFDE 3MJ9H 3UAJC 1YDPB 2JB6B 4NQVB 5E8NB 3L3KB 4PJAB 4KTDL 3SDAD 4K7PY 1RZJC 3HMXH 3SO5A 1SM3L 2IJ0C 5LWYH 4ETQB 3K7UA 1CDUA 3VFRB 3QIBB 3FONB 3E6HB 3LB6D 1RUQH 1OGAB 2ICEB 1TVHB 3FFDB 2Y25A 1KV3A 43C9A 1P1ZB 5L88H 3CFBA 1NAMA 4OF6A 3C5ZB 1YQVL 5BV7C 3F62A 3QNZA 3U0WH 4HKBB 2C3WA 1FV1B 1N2RB 2EDLA 1W2KT 1DN0A 2X6MA 3KXFE 4FQQA 4PJIF 3JVGC 5SWZD 1Z2KA 4G8IB 3U4BL 4PGDB 1WIUA 2EKSB 1T7XA 4GKNB 1U8IB 1JGLL 4S1QL 3ULUF 4I2XA 4JO1H 3AREA 4V1DD 4LRIA 4PBXA 4PJCB 3PHQB 4XB7A 3HE6C 5J1AA 1G1CA 1NSNL 5JQ6H 3O3EB 2J88L 3IFLH 2D3VA 1TVDA 4ZFFB 2H32H 4AQ1B 3IKKA 3UYRH 4BSWB 2EDJA 2JE8A 1DLHB 4OJFL 1JYVA 5CBEB 3IXTA 5TF0A 1I3VA 4M00A 3V4VL 4R3SA 3V52L 5I8CA 4D9RE 1ZHBA 2F74A 5DDHB 2VLRB 1DEDA 1TQCB 1CFTA 3DUSB 1V5JA 3SQOH 2PKDA 1JRHH 1PYWA 5E94A 4KHTL 3THMH 4ZO7A 4X7FC 1DTUA 1XGPB 1J88A 1MCIA 2GTZA 4L8CB 2SEBA 2AV7B 1A14L 3D2UA 4Z5RA 3WXVH 2AK4E 4HWEH 1YEJL 1JWUB 5FO9B 1LE9B 1KPVA 3VDAA 1KCRL 3VW3H 2FX8H 4KJPD 5IM7A 4P9ML 4WIQA 4GAFB 4NQDA 5KSVB 3F7PC 5K33A 4YHIB 4EDWH 4XVUC 3S5LA 1HILA 3MREB 4GG8A 1Y6NR 4HIIB 4JRYA 4JZJA 4U1IB 4X0KA 3CMGA 6FABH 4F7EB 1MNUL 4HXBH 4JEGB 5IIEA 3ALXA 3MV9D 2DQIH 2HG5A 4KFZC 5EZIL 1S7UA 4OTXL 1U6AH 4TTGA 2R56L 1F6FB 1HZHH 4HCRA 5DK0A 4HJJH 4DFIA 1RVFL 4HC1A 5FOJA 1T0NA 4JPIB 2VXQH 4TSBL 5HDQL 5J1SC 1NCUA 2VXSL 3SE4C 1NGPL 4H88H 3GUTB 1KJVB 5AYQA 4PY8I 1Z6JT 3WNMA 1NFDB 3D18A 4IRSC 1G6RB 4Z77A 1D7FA 1E0OB 4OZGE 2VB5A 1G7MA 4F7TA 5AZ2L 1MHEA 2DBJA 1MLBA 1YMMB 2ARWA 4KVNL 3RWFB 4RFNB 2VDLH 3LRGA 2EDYA 1WWBX 1AR2A 4GAYB 1IBGH 2BFVL 2CMRH 3QWRA 4MSWB 5IOPB 3GSRB 3JV0A 3R4DA 2I9TA 4JO3H 1H3WM 4LIQH 5E8EB 4Q58C 2R0LH 1XGUB 3PGDB 4LCIH 1INDH 4XHJC 4X6DB 2VLMD 4KMTL 3S8WA 5IJVB 3LS5L 1FNAA 2H2PD 1YEIH 3NCYP 5C0JB 4LFHD 1BWWA 5JOPD 2R8SL 5DT1L 1PY9A 4E42B 5IFHH 4HMDA 3MOQA 3B9DA 4FZ8L 5JHDE 1BQLL 4JG1H 5FAAA 5AAWA 2VZVA 4XT1C 3ROOA 2EYRB 4XC1L 4YX2H 2FEDC 2ZJSH 2FSEB 1QSED 4JFEA 3FAXA 1JHKH 4RGOH 4X98A 3T65A 3TBWB 3RZCA 4HIHB 4B5EA 3JWDC 1VACA 1WF5A 1LP9B 2BY3A 4NPYB 2BOCB 4R4FH 3IDYB 4QRPD 4G6MH 3KPNA 5BVJB 12E8H 1K4CB 2FX7H 3W9DA 3ZKXC 1IGCL 1VGKB 3CX2A 3FMGL 4HS8L 5ENWB 4P5TB 2GW5A 2Z35A 1T7YA 5IGXL 1RIUL 4HAFA 4JKPH 1BP3B 5EA0H 5HI3C 1ZLSH 4CAGA 3V5DA 4MJ5B 4FFVC 1HHIB 4IMKA 4M3KB 2CUIA 4N0CD 5FA3A 1H15B 4Z7WE 1EO5A 3RIAK 3WUWA 3L7FB 3KPRB 3BKCL 4EVNA 2VZ3A 2B1AH 2WAHA 4QYOA 3X12A 1KGCD 4CKVX 3HMWH 4AEEA 2E8ZA 4P9HL 2XN9E 3QIUB 4KDTC 3BYYA 2ZCLL 4TVPE 2LTQB 2C3XA 4PJXE 2QHLA 4PB0L 4M5YH 1GAFH 2XIDA 4JRXD 1DSFH 5DJ2B 3X14B 1WISA 2ENSA 1YNLL 2DTML 3TNNB 5A16A 2DLFH 3SO3B 4GMSL 3O4LA 5IBLC 4NHCH 1WZLA 5D2NA 3E2HC 4YXKL 1ACZA 2CLRA 1FRGL 3OB8A 4JN2A 2YD3A 5BZWA 2Y36H 4KQ3H 4IEFB 1UM6H 2WSKA 5F1NB 3H9ZA 3QNYB 5CZKA 4KPHH 4JGJA 2OR8A 1IGJA 3NFSH 1HSAB 3ZYJA 1KEMH 4YBHA 1QFWM 4YHPB 4Y4FB 5J3HD 5FB8B 1F3DJ 3RY6A 4UTAH 3O6FD 2HJFB 3O11A 4EN3A 1U91B 4TVPL 5E4EB 5KSBB 2EYTB 2FX9L 3BQUC 1EGJL 1OAXH 5SWSE 4FQXA 4U6XB 2ZNWA 5DSCB 5EUKA 3HNVL 3BKYL 3VRJB 3WFHA 4EUPB 4F8QA 2Z4QA 4PPTA 3S35X 4Q9CA 3VWJD 2EH7H 3VXNB 4X4ME 4JFOA 1KJ3L 4RMWA 2I60H 2X9YA 4FFYL 3H9SD 1N26A 2CRYA 4QOKB 5K9OB 4W70A 4AY0A 4LBEA 1BVLB 1A1OA 1CG9B 2VE6A 2VXTL 5MHSD 5T1LD 1PZ5B 1ZLWK 1NANI 1IGYB 4HJ0D 4LHUG 3MLPA 3C6SA 3I6LE 4P2QD 1KB9K 2RIKA 5DD5H 1OCWH 2OYPA 4HIEB 4O2EA 3KDMA 1ZTXL 1MI5D 4R7NA 3UPCA 2BVQB 4OGAC 1MFEL 4PGBB 5HGDB 1A3LH 1W8OA 3RKPA 2P48B 4OI9A 4JHWH 3IJHA 4PJIB 1RU9H 3MGOA 2FBOJ 4DN4L 3G6JA 2Q8BH 1R3KA 1YY8B 3V4PL 5IB3A 3IVKA 5FGBA 3SKMA 5H94A 1CFVH 5HHOD 3DIFB 1T6VN 5HSFA 4UDUB 4X7TA 1NCNA 4HGWB 5F9WB 1JNHA 3BPOC 4ORZC 1FE8L 4JAMA 5ADPL 3DX7B 1FDLL 1A0QL 5JNYA 2AJZA 3MRMA 5C9JA 1SJHA 4KVCH 5D5MA 4OUUB 1FZOB 2OMBA 4U31A 5DRWA 1U3HD 4I0KA 3QEGH 3IAPA 5L6YH 4IOFC 1CE6A 3WFCL 4IS6B 3DX6A 4G9FD 2Z93B 5I74C 4GG6E 5F3BB 1C8PA 1A47A 1KN4H 4WHYH 4NRYA 2CLZA 4ONGH 3TA3D 3L3OA 1RULH 4NOFA 2F54D 4UV7H 3VFTA 2OL3H 3MA9L 1JPGA 3GZKA 3NCFB 4NZRH 1EUTA 5GGUA 3HC0B 2PN5A 5F9DC 2KZ1B 2W1NA 1U8KB 4E41D 4MGXA 2GJJA 1BZ9A 2XZCL 3KHOA 5GSVA 2V2TB 4TOYL 5B3JE 3WHXA 2X4SB 2OMNA 2I07A 4QXTA 5IESL 2VLJB 1EJOL 4TUJB 4F33A 1MY7A 2NYYC 5KSUB 1J8HB 5DD6B 1IC4L 4ZUVA 5IK3A 3CK0H 4XVSH 3WFEH 3BZDA 5TFSH 1FNSH 1BQUA 2EDWA 4ZODA 2NY4B 3VGAB 3RHWF 3RDTA 4LSRH 5GGSY 4WWID 4F3FA 1H0DB 3JV6B 2YBRA 4D9QD 3PUCA 4KK8C 4O51A 4MB4A 3C5JB 2R0WH 5EO1B 1MLCA 4WU5A 2X7LB 3OQ3B 4QWWD 4NQXB 4XPAL 3H0TB 3STLB 5DLML 3UO1L 4TSAL 3VGDA 2R1XA 3W81A 5DC0A 2R2HB 1QBLL 2A73A 3CXDH 5EBMA 2IH1B 5I15L 2GK2A 3D25B 5J11C 3MUGB 3MRQB 5AEAA 1OAYL 4UQ3A 3B2UC 4ODWA 4K3DH 2H1PL 4GSDL 1UCBH 1QBAA 2DAVA 1J0IA 1P4IH 2Q7NA 2WK2A 4AT6A 1MRCL 5EU3A 1JGUL 5E8OB 2BNRB 2ZOKB 2AXGB 4PRIE 1A22B 1GGIL 2UZIL 4LSTH 5DD0L 3MLRH 3QQ9D 2I26N 1SVCP 2M1KA 2PW2A 4AK1A 2PO6B 2H3NB 3CFKA 4KGJA 1A5FL 5CP7B 2FJGA 3D3VE 1Q0XL 3RWHB 3QZWA 5C0CB 1U36A 1OAUL 5INDA 3QUYD 5DJ8B 3DURA 1KB5A 1MPAH 4OCSL 2LQRA 4GRWE 1KB9J 2QBWA 3HG1E 4Q74A 2DQFA 2FYYA 3TVMA 4FQ2L 3KYNA 3LN9A 1YQ2A 5D7IF 4QT5B 1U2HA 2Y07H 1Q72L 2VNCA 5CBAB 3HLAB 1RUMH 5KG9A 5FUCE 5DJ6A 1FH5H 4Z7WF 2ICWB 1AP2A 4V2CB 1W8NA 1JPSL 1O5DT 5IHZA 5HHPA 4E5XB 2WINB 1JGVH 1MAML 4HWUA 4JFHE 4WW2C 4HT1L 4PJDA 3QXAA 1FVEA 2LV4A 1DQDH 3DXAE 1FZJB 4UOW1 1SVZA 4LGPB 4Y5XC 4DGVL 3SGKA 2D4FA 5BV7B 4XCCL 5FM8A 4AMKH 1JMZA 2FD6H 1MHHA 2Z8VC 1N59B 4ZOEA 3LSOB 2ADIB 5I66A 3IDXL 4JZNA 5D2LA 3EDDA 2VXUL 1I9RH 3QEUB 3VGHA 2OR7A 5IVZB 4XPHH 1N8ZA 5E5RB 3LAFA 4I0PC 4RGND 1GHFL 2WWMD 3HE6B 3QDGE 4L5FH 4G8EB 5DHYB 5D1XD 2ATKA 3B4NA 3MV7A 1OM3H 1PFCA 2AJSH 3U83A 1IEHA 2AV1A 4UIMA 5DJXA 4XPGL 5I1JH 5L2JA 1A6ZA 1UKSA 4U1NA 1CDBA 4E0RA 1QLFB 1UJ3C 1NFKA 4KRPC 3O2VL 4CU8A 3BGMA 1ZSDB 1RJCA 3S4SB 3DVFA 4LCYB 5DJ0A 5E56A 3WUZA 1CD9B 4XXCA 4RWYH 5BOZG 2VDRH 4FXKA 4M6OL 3OTTA 3ZT6A 4G42B 4MNQE 2C9AA 2FEEI 3ARWA 1N5AB 3ARSA 4LRNL 4HFWB 1J5OH 5C3TA 2WP3O 4K94H 2X09A 4WHTA 3VU2A 3FO1A 4X83A 3L5JA 3TJEL 2PYED 4S1SL 3HB3C 4JPWH 2O5YH 1MEXL 1INQB 1OF2A 5BW7A 2NX5B 2QTEA 1NMAL 2DJUA 4YDLC 3UYOD 4L3CA 3MLXH 2EDFA 5KVGL 1YEKH 4H8WC 2ZSWB 5FXCH 1U8HA 3RVTD 1KN2H 4HKJA 5GGSA 3O45A 2W9EH 3RUGB 3OHXA 4D8PB 1TJIH 2B20A 4K55A 3W39A 5IV2B 3F5WB 1K4DA 5D8JL 2XA3A 2GY7B 4IRSB 1JGEA 1G7IB 4PTTA 5ELIA 4HPYL 3WJJA 1NAMH 4B7LA 1Y0LB 3S35L 1HKLL 4OV5A 5L2KD 4JPKH 3ZTJG 1LVEA 4HHAA 4ENEC 4JO4H 4EQ3A 1A4KA 4YGVA 2ARJB 1KCSL 4WWKA 3KHQA 5CJQH 5JO5B 1WBYB 4M5ZL 1Y6KR 4ONHB 4EDXB 4TN9A 1BAFH 2Y7QB 3V6BR 3Q6FA 4ZS7L 5D72H 3S36X 4M1DL 1T3FB 5HGBB 3E6FA 3VXOA 4FRWA 2D4DA 2VZ1A 4JFFB 3QSKB 4NRXA 4MWFB 1YDPA 4M6NL 4KK6D 1BQHB 1NGXA 1YA5A 1P7HL 4WUUB 1ZGLM 4DKEL 4NQVA 1AXTH 1DL7H 1ACYL 1KNOB 3L3KA 4PJAA 2Q7YB 1J0HA 5ISZE 2ZCHH 2AK4B 3BUYB 35C8L 1C5CL 3QBTB 3RWEB 3QO1A 3VFRA 1K85A 3UYPA 4RRPA 4M3JA 3K8LA 1CGSL 1BGXH 2ESVD 4ALAH 4PJ8C 2D7TH 4W6XB 3B3IB 5HI4D 1FO0L 2OSLB 3VXQB 1RZFH 5IMMA 5MEQB 4M7LL 5B3JF 3SEPA 4YPGB 5EBWA 3VWKC 1FV1A 5C6PB 3TO4C 4ZTOL 4EXKA 4KTEH 3DSFL 4G8IA 3MX0A 4PGDA 4EOWL 2EKSA 3FN9A 2VDML 4HF5H 2IEPA 4Z78A 5I18H 4PJCA 3ZKXB 3MOAH 5DYOA 4BSVB 3BT2H 5JA8B 3WIFB 1IM9B 1Q9KB 3O3EA 2D0HA 3NCYS 3N85L 4ZFFA 4NKOB 1QBML 4BSWA 1BM3L 1DLHA 3BW9B 5DVLA 5B21A 5I2IB 3MRGB 3KPMA 1W0WB 3V6FA 4LP5A 5D93C 1PLGL 5MP6H 4M9PA 3MBED 5C0ND 1KJ2H 1VGEL 1P5UA 1C12B 4XTRD 4HC1H 5DDHA 4JFZH 3U4EB 4XBGA 2X9WA 4K23L 3TWCH 3QXVA 2G2RB 1NCDL 2R4SL 3MBXH 1SQ2N 1CDCA 2ZZUT 4GKZB 5TH2B 1I4FA 3G5XA 3S88L 5I1DA 2HRLA 2AV7A 2BY2A 3EOYG 4K2UH 2BSSA 2GJ6D 5KVEL 1GRWA 3UC0H 3RVXD 5CJOL 2Z31D 4OFYD 1ZT4A 1BVKB 1G9NH 3MJ8B 4NM4H 3MLYH 4P5MA 2P8MB 1WFNA 3O2WL 5KSVA 3QEQA 4HS3A 5EIQA 5DJAA 3E2HB 3RIAF 4ODBD 3QEHB 3MREA 1RZ7L 3GI8L 5CEZH 4OF3A 4XX1G 3SDDD 5JIPA 5D1QC 4P4RA 4MA7H 4F7EA 1NQBA 1J1XL 1EH9A 3U9PH 3B2VH 5IJKC 5EO9B 1HNFA 2YEZB 3LHPL 2FB4H 1TNMA 3GJFB 1ERNA 3QDMA 3BFOA 3OAUH 4XP1L 2HKFH 3MGTB 1FFOB 3BQUB 4L8BB 1P53A 2X4RA 4XNUL 5E2WL 1MWAL 3RWCA 3R0MA 5ICXB 1FYTE 3HZKB 4KTYA 4QRRB 4JFXA 2HTKD 2Z92B 5CHNB 4DUXA 1G6RA 3NA9L 3TGXA 1UCTA 4OSUL 3NH7H 1OP5K 1MJ7H 5D7IB 3TT3H 3CPLA 1MHPH 3QDJB 4LLUB 5C0BE 1CGYA 4GAYA 4P23A 1IILE 3L3JA 3P30L 5J6HB 2DICA 3GSRA 1MRFH 1MCKA 3TCLA 3BRDA 1D9KC 4CDGC 1XGUA 1UACL 2O5XL 1EEUA 1K2DB 4L8SC 1RMFL 3REVB 4XRCA 5EWIH 4PRBB 5KOVC 3RTQD 3D69B 3OB0K 5J7CC 4GQPH 2BVUA 1QNZL 1NBYB 3S97C 4O9HL 4XAWH 5F1OB 4NP4H 3C08L 3QUZD 2HYMA 5C0JA 1WWWX 4P57B 1JVKA 3STZA 5CLWA 3OKLB 3W5MA 1ADQL 3EFFB 1R24B 5TQ0L 2B4CL 3EAKA 2EYRA 4K3EL 4LU5H 1NL0H 5I1HL 2GTWB 4NCDA 3BPOB 2PCPB 2BHZA 5CZVH 3QFJB 3FOLB 4MXQC 1QVOB 4OLEA 1J0YA 4RNRB 3I02B 4HIHA 1HINH 4OZHE 1B0RB 2BOCA 2CIKB 3IU4H 1S7VB 4D3CL 5BVJA 1DQJB 1K4CA 4PG9B 3BKJL 4UOJA 1I1FB 4DUWA 1FGVH 4KKNA 4P5TA 3MRJB 2AEPH 2BSRA 4YWGL 3NN8B 2JJTC 2ILLA 4UIKH 1BFTA 4MJ5A 5FYJH 5I74B 5I6XC 3V5HA 4F9LA 5D1ZC 32C2B 3IJYB 1MFCH 2O5ZH 5K9QI 1H15A 5IWLA 3KLDA 1LO5B 5EBGA 5H35A 3KPRA 5HYSG 4LCWD 1R3IH 2IQ9H 5F7UA 5D71L 3BOVA 4QRTA 3VXRD 5B8CC 3VFPB 1FN4A 4OGYH 3X3GH 3RWDA 2HFFA 1CBVH 3MCG1 5IMLA 1LEGB 1IC1A 5I1LA 1RK1B 1QEWB 4MD5A 5DUPL 5F9JA 2XA8L 4XBEH 2CKBL 1T0PB 5DJ2A 4LPUA 5IEHA 3TNNA 5A40E 1V3JA 4C57C 1XF2B 1CL7I 1OT1A 4R26L 4GO6B 2JIXD 4PB9L 4LEOB 4L3EB 1P9MA 4HZLA 1OPGH 5F1NA 1TCRB 3QNYA 5F1SA 1QRND 2VJXA 1JMXA 4MD0B 3TM6A 4YHPA 4Y4FA 2PYFA 1UENA 1YZZA 2HJFA 4XMKL 5BRZB 1U91A 4HDIB 3OJMB 4PJGB 5J11B 2EYTA 5L9DL 4NGHL 4G8FB 4XXDB 2MOVA 4BJLA 3HPLB 3JV4B 3B9KA 1NEZG 4NUJB 4PLJC 5DSCA 3DYPA 1GJIA 3L3HB 3VRJA 4CU6A 4WTWA 5D4QA 4EUPA 3UTTB 2EDXA 2IF7A 3QPQD 2A6KA 3BZ4B 3GEWB 4L4VE 2CR3A 2H6PA 3QXTA 1A7PH 5GRUL 4QOKA 4OGXH 3ARFD 4NDMB 5CUSL 1BVLA 3PWPD 3SKNB 3NBNA 2G75B 3EYSL 4LFHG 5KVFL 1PZ5A 4L1DA 1HXYB 4O58L 2NXZC 1EEYB 2C4FU 4NBYB 3WSQH 4IMLB 1JWSB 4HIEA 3FQWA 4FFWC 3ILPB 4ZFGH 2E6PA 1R3JB 2MNUA 2BVQA 3L5XH 4MB3A 3SCMC 4LSQL 4PGBA 3S36L 1T04B 4P2OA 3H3PH 4HLJA 3PWVB 4PJIA 3AY4C 1KULA 1IEBB 1H5BA 5SX5H 3OSKA 1GOHA 2EIZA 5C8JA 2DQJH 4G8GE 3UTZB 1AR1D 3MCLL 1IAMA 4IIQA 1DJSA 1S5IL 4G43A 3LEVH 4YQXL 4WW2B 4O02H 1C1EL 4CGTA 3ULVE 1DBMH 3RL1B 4KQ4H 1RIHH 5JHLH 4Y5XB 3WS3B 1S8DA 3G5ZB 5DS8B 1FZOA 1W72A 4O2CB 2BC4B 3CFEB 1KJMB 4P59H 2WLZA 1IGFH 5EOCH 4RA0C 4RWHA 4JQIL 2DQHH 1I7UB 5HVWA 2YD5A 3J8F7 5EN2A 1JYXA 3ARDC 4RFEA 2ZCKL 4IS6A 3PQYA 2Z93A 2NY6C 2XWTB 3UJIH 4I0PB 2FO4A 4PV8B 5F7EL 3U36A 3OZ9H 2BRRH 1IFHH 5AUMB 1DBBL 1NANH 2D7QA 3M8OH 2ICWI 3QUML 4NYLB 5ILTH 1HHGB 2AXHA 1CICD 2ENYA 1XGRB 3HC0A 3ZL4L 3Q3GB 5E70A 1I1AD 5KTEL 1U8KA 4NN5C 4UT6H 1UJ3B 5JOEA 4KUZL 5K93A 4DW2L 2XNAA 2MWCA 5IR1B 4UINL 3IDMB 3HAEG 5J57B 1WK0A 4KRPB 5B39A 3F7QA 4LCCC 3G9VA 4AIOA 1WTLA 3T1WA 4TUJA 2CLVB 3CUPA 5KSUA 1J8HA 5DD6A 1A7OL 2YK1L 3U0TA 1ZHKB 5AWNH 1Q94B 5MENB 2P5WD 5HHVL 2NY5L 4OLZL 5FGSA 3DMMC 4NQSB 3RVWC 1P2CB 1QKZH 3FFCE 3BGFC 4OD2A 1JI2A 4OB5H 1IC7H 2QSVA 5EOTA 4QXGL 2KPNA 4N0YL 4KJQC 3D2UD 4R90H 2X7LA 5EZLB 4JDTL 3V8OA 4Z7VA 3STLA 1JNJA 1KB5H 4G5ZH 2F5AL 2HLAB 5EH1A 3GM8A 5IBUB 5DZNA 1MFNA 3UTPD 2DYPD 1PEWA 5D7SL 4YDLB 2X4UB 1MREL 4NNYB 1H8OA 1S9YB 3D25A 5DRXB 2E7BA 3MRQA 3WBDA 1WEJH 1PGRB 3NFNB 2VUYA 2MPAL 1G7PA 2XTJE 5JLZA 2VQ1A 4WTZG 2BNRA 2ZOKA 2AXGA 1MIEL 2XACC 1S7QB 3VJ6B 1KTKE 1QQDA 3GBMH 1F90H 1JGDB 4U7KA 2VXVH 2R0KH 2H3NA 3VFUB 5HHNA 3GNML 1LO3H 2AK1H 3SKJL 1ZHLB 3RWHA 3W0WE 1TETH 1DP0A 4FABL 5DJ8A 3LZFL 2OJEA 5GZOC 2O26U 3NFPA 1NUGA 4HK0B 4Z9KB 2DOCA 1FCGA 4M62L 1DBAL 1RFDH 4XCYA 5L8KB 3SOBL 1UWEH 1N64L 2R1YA 1X5AA 4HBCH 3WIHH 1JK8B 1WCQA 4WJ5B 2JB5L 1EK3A 1F4WH 2NNAA 4QT5A 5JTWA 3OXSB 2FIKB 3Q1SH 5CEZD 3HLAA 2R69H 1T83A 1GGBL 5J6GB 1T2XA 1OSPL 1NAKL 4KMQA 4FQHB 3BH8A 3SPVA 2PW1A 4E5XA 2GHWB 1TIUA 2WINA 1EO8H 2ZOLB 5CJBA 3TF7C 2F8OA 4PJ8B 1FL5B 5C07A 1FZJA 3BVNB 5GGRB 1I1YB 3I6GB 2AJUL 3VWKB 3TO4B 5EZOH 2W0PA 4Y19D 3JVGA 3PF2A 3RBGA 4ZMAT 4LVNC 5D7JC 4OCYH 2ADIA 4YHLH 4JFED 1D5IH 4OIIL 5IVZA 1WGOA 3RZCD 1DBJH 1ZVSB 5CEYB 3HC4H 1MVFA 3O8XC 2P8PB 3MRLB 1DUZB 1CVSC 4UU9B 3RJDA 3VXMB 1QSFB 4C58B 2NW2B 2H2SC 3C6LC 4HUMB 5D93B 4AL8L 1BOYA 3WMSA 4KJYA 1J05A 4O5LH 5IBTL 2IG2L 5JPNB 1Q9WB 2BXYA 3RNKA 4NN6C 2MSPA 4YHNB 1XIWD 1ROWA 2OP4L 2WUBL 1LHZA 1DE4B 5HHXH 1T66D 4FXGA 2UZYB 5DO2C 3SDCA 4QNPE 4YXHH 3EZJB 4K9EC 1DQML 5ADOL 4U1KB 4X5WA 4HKXB 1IGMH 3OAYH 3TO2B 3MLWL 1X5JA 2ZP0T 4HIXH 5FYKE 4F57L 1RK0B 5I30L 3KPQA 5ACLA 4UTBH 3QHZL 2RHEA 4PJ9C 4JFDA 4FNLH 3HZVB 4HFWA 4PUBH 4YDKL 2J3SA 1EHNA 2CIIB 4U1SA 3VXUB 2GSIA 5GS2H 3RPKA 4WEBL 3EYUH 5D1QB 3O4LD 3LEXB 2NX5A 4LLVB 1JPTL 5EU6E 2RR3A 1FCCA 4TSCH 1EXUA 1DVFC 1HQ4B 1UKTA 3EYFA 5BMFH 2ZPKL 5C70A 2CK0H 2DL9A 3MOBH 5EDXA 3QFDB 4WENB 2EE6A 5K9JL 3FB8A 4C56D 3SJVE 3L7EA 4RISL 4UV4H 3GIZH 1A6VL 5FYKL 1ORQB 2IGFH 4J3OC 1NCCH 1OSZA 3HNSH 1G7IA 2JJUA 5BS0B 1I8MB 1VADA 4FQXD 4W6WB 5BJTB 4M9OA 3ULVF 2W59A 2ARJA 3PP3K 1JZ6A 1A8JH 1WBYA 1KTRL 4PRPB 2NY3C 2VL4A 3MLTB 3OAZK 5KN5B 2J4WL 3ZKND 4TNVK 2Y7QA 1D9KB 3JWOC 4MS8D 5H37G 3NTCL 1T3FA 1NDMB 1BLNB 1VDGA 4L8SB 3SE3C 5DXWA 3ZSSA 4FG6C 5INCA 4JFFA 5FM5O 2NLJA 3TV3H 3P11L 3D0LB 3QJFB 5F72S 5J56B 1BQHA 2HFEB 3FO9B 4LLQB 3V0WL 5C6WH 4WFFE 5GRYA 4ZDHB 2Q7YA 4QHUB 1FGNH 4C83B 2DBLL 3MJ7B 2AK4A 3BUYA 4M8VA 5KSAC 3T2NL 4ZNEE 3T3MF 3CVIL 2VL5B 3M1BB 4FA8A 2PXYC 2OSLA 4KKCD 4NJAL 3VXQA 1T80A 4Z18A 3VRLE 1J1OH 4NFBA 4XPTH 1RUPH 3T2PA 1SJVA 2HJKB 4NM8L 3HI1B 3VD5A 5E2UH 3TN0C 3LPGA 3B83A 4NZDA 3VXSB 1E4XH 3VA6A 1KFAH 1FAIH 3DJ9A 3GIVB 4XX1E 1N7ML 1S7RB 1A2YA 5T3ZE 3EW3B 1T1WB 4NN7C 5GS0C 4LHQB 2VZSA 1O7VA 5JZ7C 1UC6A