1Q9KA

S25-2 fab unliganded 1
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
b'DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 Fab (IgG1k) light chain
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2003-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q9kA01
4JQVC 2FWOA 3T3MF 3ARSA 3OAUL 1RIHL 1PEZA 2YA2A 1MI5D 3VD4A 3OGOE 4Z7WA 4HC1H 1JZ8A 2UWEB 4Z7VE 1BIIB 1UB5B 2ID5A 3V5KB 5LBSH 3VFTB 1KG0B 2FBJH 2VXTH 1BZ7A 2HKHH 1DBJH 1F6AB 1LHZA 3O3BA 5F7DB 1CDJA 3FONB 1FL3A 2CQVA 1HKLL 5EN2A 3ZO0A 2V2TB 5DJ8A 4NNPL 1F3DJ 4OCNC 5T33L 2EH8L 4L8DA 3GJFK 3P0YH 5L0QB 3FQNB 4OD1H 2E8ZA 4G6JL 3WNMA 5I8CB 3K8LA 3OKNB 4CMMA 5F9AC 3NA9L 4HUUB 4WJ5B 1IGJB 1TZGH 4F58L 1IVLA 4G8EA 4PJGE 5JW3H 2XN9D 5CJQL 4G6ML 4LDEB 5ITFA 1MCOH 2IPKA 5AAWA 5FF6B 3TO2B 1DBML 4LSSH 4L3ED 1NCUA 5F7NC 5ICXA 4N0UB 3SO3B 4Q58C 1DP0A 2F53A 1YDPB 5JLZA 4Y5YB 4CW1A 5I66A 3L5WB 4N5EC 1R3IH 4S11A 1OW0A 1J8HA 3BPOB 4BQ8A 5DJ2B 1U95B 5CBEA 3UTSA 2X4UA 1ZS8A 4EDXB 5J57B 1DVFC 4K71C 1LEGA 2EXWD 4U2ZA 1D6EA 2BOCA 4XBEL 4MLIA 3MFFB 3STLB 3BXNA 1DDHA 1I7TB 1BQSA 1CF8L 1LP9B 2X4SB 32C2B 4NWUL 3QEHA 1K9TA 2HT3D 2G2RB 3JXAA 4G6FD 4MDIB 2NZ9D 3SPVA 3WMSA 1KJ3L 3OKDB 2HMID 4Z95H 1N6UA 4LSRL 4KTDH 1G7IA 3MCLH 1LQSR 1A7NH 3MNWA 2I9LA 4BH7A 3QDMD 4FMKA 5D7IE 5DUPL 3CSYB 2Q87A 3MV7A 3QRGL 2W65B 1EJOL 4GSDH 5IW3A 1JGEB 2V7NA 2CJUH 4NZDA 5K9JH 2V9QA 3LN9A 1NUNB 4RBPK 4MAYB 3WXWH 1A0QL 2CRMA 1JGLH 4MLSA 5E8PA 2X7LA 1M7DA 4KMTH 3WFHA 5HGBB 5HJ3A 3U83A 5F89B 5IHZA 3FHQA 2CKNA 2NR6D 4IRJD 3EKCA 1FE8H 4K3DL 5D7JB 3SGEH 2WBWB 5BJTB 3GO1L 1GAFH 4ONHA 3RY6A 1MJJA 1BBDH 1RVFH 1ZMYA 3GJFA 1J7VR 3QEGL 1RQ5A 1CDYA 5C07D 5JHDE 2HFGH 1ZE3C 2WANA 1HXYB 4XMPL 5F96L 3FFCE 4NCDA 5C9JB 3OAZK 1MFEH 2FLRT 3I75A 4U6YA 3HAEH 4Y16B 1OL0A 1ZANH 5GJTH 2KQNA 2NY3D 5HVWA 4FQHB 3TESA 4OFYA 4MNQD 4PRPA 5L8JB 5IEHA 1AY1H 4BKLA 2CGRL 2P48B 2XZAH 3TBVB 5FGBA 5DR5H 4TUJA 4LIQL 1U58B 2CH8A 1S9YB 2FYYB 3HS0B 5F9OL 2WLYA 1X5XA 3V5HA 4P5TB 3WNOA 3MBXH 1INQA 3QT2A 4WI4A 4EUPH 1S5IL 4MWFA 2J8UA 4DZ8A 4C4KO 5DMYA 4JDVB 2YEZA 4M61B 5IVOA 3UYPA 2BNQE 4NYLA 4HXAH 3MLPA 1QTYT 1LDSA 5JR1L 3PIQA 1K2DB 4E41D 2YPLB 2UZYB 3HKFA 3ULVC 4X6DB 4DN4H 3BWAA 1PEWA 3FOLA 3RPIB 1LK3H 5CIPB 4ZG1A 2YD9A 1KIUA 3PQYA 4M6NL 4YDJB 2ZP0T 3SBWC 5DWUL 3RHWK 3ARPA 4OCRH 4X99A 1FLRL 5E4EC 3VG0H 4JG1L 3PWNA 4PJIE 1QYGL 3O3AA 5FYLH 4NUJA 4WEBH 4K9EL 5KSBA 3MLWH 1GGCL 4POZD 1K4CA 4UV4H 1KIQA 5CSZB 3QXAA 3OKLA 5T1LD 1LMKA 3BKCH 4G9FB 1DANT 5IUSA 1BD2D 4R7DA 3UYOD 2BK8A 1BBJB 1VGKB 1P2CA 4FXGB 5GJSL 4PJCB 5J1AB 1AR1D 3JVGA 1KENL 3W9EA 1U2HA 3EFFA 2DLTA 3IFOB 2GYSA 3B9KC 2F54D 2D31B 4LCIH 4DVBA 4OZIE 3OX8B 1A1MA 5EPMB 3V6BR 3C60A 5HGHA 4EJ1C 5DQJA 4KROD 1JN6B 4P57A 5FYKE 3REWA 1QLFA 4QXTB 3UO1L 2NX5B 3GSNB 1J1PL 1YEJL 2BC4B 5KZCB 1GGIH 2X2YA 5F7LB 5IT2L 4KI5D 4E5XA 2YUWA 4OSUL 5CP7A 5AZEH 2WIMA 3ESVF 4KKBD 3D87B 1HK6A 5D7KD 1QSZA 2MPAH 1T0MB 4PP2B 2OSLB 2QSVA 3L3DA 1MCDA 3X3GL 1RUKH 3HNVL 2XQBL 4GRWE 1QRND 2GHWB 1JNHB 1JL8A 3RVUC 3FO9A 3SKNB 2LAAA 5E2TL 3FT4B 2VUOA 4D9LL 3TA3B 2KPNA 3BEWA 1YQVH 2CIKA 4HJGA 3MOBH 1T6WA 4ONFL 4RA3A 3RWEA 5HYIA 5FM5M 2WUBH 3GZKA 4U4BA 5SWQA 2PW2A 3OF6D 5DK0A 1T21A 2K9UA 1T2JA 4DGVH 1FFNA 1E4WH 4GKSB 5HDLA 1KJVA 4NHUB 3BAEH 4PG9A 2DQFA 4PB9H 5E4EB 4WUKL 5MP6H 2HG5B 2H6PA 3P11L 4NNXA 5JDSB 1RZ8A 1GC1C 3NCBB 4MVBD 5J56B 2W9EH 2JJTA 2JK5A 4NKOB 1KYOJ 4JN1L 2GFBB 5H37H 2BJMH 1V3KA 3MTRA 4D0BB 3EYFA 3NFPA 2KZ1B 2ERJC 3LV3A 4P9HL 2AJZA 2W60B 2XZZA 3SE8H 4ZAKC 3GJFH 3MBEC 2BVTA 4P46A 5C0BE 4P5KB 1RZJC 1KXTB 3LH2H 4OZFG 1MWAA 3E6HA 3AGVA 2D9QB 4PJAB 4FNLL 4EI5D 1A1OB 2ED8A 2YWZA 4JQXC 4YDVB 5DJDA 5I75B 4M7LL 2E7LC 5DS8A 4CNIA 3FT3A 4ELKB 3T1FB 4P2QB 5D9SA 4YUEH 1I85A 2NTFB 4IIQB 3QDGE 4UT6H 2H1PH 4CVZA 5C0IB 1Y0LA 4OLVH 5EZOL 3EYSH 4NJAH 3TNNB 5MEPA 1P9MC 2E5EA 2NY5L 2WV3A 5AYUL 1ZA6B 4LCCB 3VFGL 4P2RD 4YHIB 5HI3C 3ME0A 3CSGA 3CJJA 5DDHB 4M3JA 1LO2H 4ZPVB 1FRGL 3V6OC 1NH6A 4M1GH 3H9HB 2UWEA 5TF1L 1MHCA 1BIIA 2NW3B 1UB5A 2P43B 3V5KA 3VFTA 1KG0A 4RIRB 5DZLA 2G5RA 4YXLH 4BH8B 5F7DA 3FONA 5EZIL 2V2TA 4HC1L 3OBAA 4NZRL 3F12A 5DLML 3MV8B 2FBJL 2VXTL 1SMOA 4K23H 1T0PB 2X1XR 3FQNA 5LVEA 1DBJL 5I8CA 4RBPH 1KCVL 4HUUA 1IGJA 4WHDA 3VW3H 1VPOH 2BVOB 2HN7A 5E95B 1FFRA 1A7PH 5FYLE 1J86A 2GTZB 3TO2A 5FF6A 1HSBA 5DTFB 3G08B 3LZFH 2VZOA 2N4IA 1A6PA 3MBEB 1TZGL 4N0UA 5JW3L 4NPYB 1YDPA 3ARDD 4Y5YA 5F6HI 1MCOL 1AC0A 2RCSH 2DQIH 4Y8DC 5DJ2A 1U95A 2NY1C 1J10A 4PRIE 1H8SA 4LSSL 3AY4C 3U9PH 5F3BA 1WICA 4AMKH 1WT5A 5JW4M 1FYHB 3AXLA 4R7NB 1IRAY 3MV01 1R3IL 3STLA 3OAZH 2X4SA 32C2A 3QNXB 1QFHA 3KLHD 2G2RA 4MDIA 5IOPB 2VAJA 1S7UB 1EHAA 3OKDA 4M9PA 2CK0H 4P23C 3UTPE 1UB6B 4JQVA 1OP5K 4ONGL 3OQ3B 1XF3A 4MJ6B 4LLMB 2YS4A 5J6GB 1WFUA 4RA0C 4QRPD 2ZZUT 3C87A 4Z95L 2B7DT 5DA0B 4KTDL 4MAYA 3UTOA 3MCLL 2JKXA 4L5FH 2XA8H 3ETBF 2P24B 4ZFZB 2VN4A 5HGBA 4GSDL 3EOAA 3NPSC 5F89A 2CJUL 1WWWX 3KDMB 2OR8A 3PL6D 5HSFA 3WXWL 2AVGA 5TFSL 1I1AB 2NXYD 1JGLL 5K9KB 5BJTA 4PTUB 2OR7A 3MUJA 3RI5F 4I9WE 3MA9H 1L0QA 1V8HA 3MV7E 4KDVA 2OMNA 1OTSC 3CAFA 4GQ9L 3TC9A 5EU5B 1A7RH 3DX7B 4G6AD 3E3QC 1N5YH 1T89C 5C0GA 1UT9A 1GAFL 3G5ZA 4XCNB 3X3FH 4RZCB 5C9JA 2NYYC 3BD3A 3KPPB 1RVFL 4GBXC 5C0AA 4PBVC 5I1KH 5I2IB 4LDLB 3L3OB 1QPXA 3EYOA 5CKAA 3EZ8A 1QLEH 3VU2A 2HFGL 4FQHA 4TSAH 4Z8FL 1TPXC 2ICEB 4ZYKB 2SEBA 5TDOB 4XC1H 4L4TE 3ROOB 1T1XB 3MSPA 3N50A 3OPZH 1DVFA 1RZKC 3IRZA 2DLHA 3HE6C 5GJTL 4GKOA 4PD4K 1AGEB 4UOW0 5FGSA 1ROWA 4XCYB 4P3CH 1U58A 5SWZD 3I3EA 4JVPA 1CZ8H 1DBBH 1AY1L 3QJFB 2FYYA 1RUAL 3HS0A 1ZLVK 3A0OA 2QHLA 3NFNB 1MWAH 1GIGH 4D8PB 4O00A 4UAOC 4I77H 4E9LA 3EHBD 4XTRD 2ENYA 2WWMD 4XXCC 3UJJH 2QADD 1RMFL 3MBXL 1T20B 3HPJB 5C0CE 5E1AB 4MA3B 1QSVA 4G43B 1AC6A 1IBGH 5GGQH 4PJBF 1K2DA 2YPLA 2UY7A 4X6DA 1FP5A 3ARBD 1MNUH 3RPIA 3BDBA 5CIPA 3IDMB 1SHMA 3TJHC 3FO1B 3LRHA 4F37F 3PXHA 1P53A 3QSKB 4G7VH 4FG6C 2EE6A 1LK3L 4NFDA 5HXMA 4WI9A 1FO0B 4HUMB 3QG6B 3WUWG 3V79C 4PJEA 4G9FA 2ESVB 4WEBL 5GS2H 2GSIB 4HCRL 4R3SB 1N4XL 3IFOA 4UV4L 5SWSD 3C5ZD 1ZXQA 1A6ZB 3WHE1 4UBDC 2D31A 3BKCL 1MY7A 4A6YB 3QI9C 4IOSD 4YEEA 1EMTH 1F00I 2ADGA 1QRKA 3OX8A 5EPMA 2EC9U 3ZKMC 3VD5A 3HPLB 4GW5A 1JN6A 3HE6B 3IFNH 2AEWA 4QXTA 1CDBA 2NX5A 3GSNA 3PGFH 3VRLE 1RK0B 2BC4A 4ZUSB 1I1FA 2F8XC 2YD7A 5FM4A 1IARB 3BQUD 5GRJH 4JZJC 1T0MA 2OSLA 1NFDB 5DJYA 4PGJA 1ORQB 1DQLH 1H9VA 1P4BL 1JHTB 1UM6L 2KUTA 4UAOB 4DVRH 1I9IL 1T0NB 1JNHA 5FEBA 1HE7A 5AZEL 1BPVA 3DXAB 3QNYB 3SKNA 1OD9A 3FT4A 1FBIL 4KAQH 5J3HD 2GJ6B 1RUKL 3GKWL 3CPLB 3K0WA 4Y19E 2F74B 1UJ3C 1U9KA 4BSVB 2VLRB 4KK8C 4YAQB 5BV7L 3SE9H 3CDCA 4YBLC 1GHFL 1NJ9B 4NHUA 3TJEL 3MGAA 5J11C 4HLJA 1FIGH 5I1EL 5ESQB 5LGHH 2HG5A 2A6IB 5JDSA 1GZPB 3MUGB 5C09E 2XKSA 4NKOA 1AD0B 4RGND 3W0WD 4ETYA 1WWAX 2GFBA 3BAEL 4GLRI 1AGFB 1XAUA 4PB9L 3T0EC 2YXMA 1IT9H 2R29L 4XX1E 5KSAC 5MP6L 4TULH 3F62A 1G7MA 2YBRB 3NA4A 3P4OB 1YEKL 4LQ1A 4RRPG 2W60A 2W9EL 1HSAB 2E27H 4AEIH 5DRXB 3LQAH 4OM1L 3RPKA 2CLZB 1OGAA 3QI9B 2PF6A 4PP1D 2DQDH 3LQZB 2AXGB 5EU4B 5IVZB 4PY8I 4PGCB 1KOAA 4J4PD 1P84K 2DOCA 5KS9E 3SE8L 4PJAA 3GHEH 1A1OA 4X98A 3HB3D 1U3ZA 4P4KD 1OOAA 4P2QA 3VWKC 2NTFA 4LGRB 4KJYB 4IIQA 4QRRB 5HI4C 1VFUA 5I8OH 3RVXD 4OLWH 1SJVA 5C0IA 2EEDA 4Q7DA 3G9VA 4YHNB 3W11D 4C83B 2EDOA 4TQEL 3TNNA 3WBDA 1Q0YH 4HT1L 4OCMC 1ZA6A 4LCCA 5CGMA 1CGVA 1WC7A 3O8XC 1HI6B 4UT6L 5DDHA 4C56B 5E94B 4ZPVA 1U0QA 1R3LB 4GKNB 5D1XB 3FO2A 5DMJB 3H9HA 2MTPA 4ZMAT 4OLVL 4GW1B 1OTUC 1FGNH 3EYSL 4NJAL 1KT2B 1W8NA 2VQUA 3ARRA 2DQEL 4WI7A 9CGTA 1VESA 1X4ZA 3A6OA 4RIRA 1HIML 2V5YA 5I76A 4XAWH 4BH8A 1LO2L 4F33A 5IQ9B 1M7XA 4TVPD 3WCYA 2FCBA 2QBWA 1OP5H 1T2XA 1IAII 1XGPA 1U3HD 2YA1A 3DVFA 3WHXB 1JF1B 1R24B 3B3IB 5DFTA 5I74C 3KPRD 5CIPH 2VXUH 3EOYG 3KYOB 4PJDE 5CZVH 4ZUVB 3LHPH 4PR5B 1T80A 3T0EB 1G7JB 2UWEE 5TQ0H 1CDHA 3S96B 5KSAB 2BVOA 4PJ5D 1TJGH 4XI5C 1A3LL 1RHHA 5LKNA 3UTTE 3R8BB 3QIUC 1MF2H 2GTZA 5DTFA 3G08A 4XAKE 3MBEA 5JHLH 3D85B 1VPOL 4NPYA 5FB8B 2EKSB 3UBXG 1WK0A 1EO8H 4XP5H 4G9DB 4BSWB 3EJJX 3SCMD 3FFDA 1PX4A 1S9WB 3OGCB 2NW2B 3TPKA 2GY7B 4JQXA 1DSFL 4OZGF 4J2XA 4R7NA 1ED3B 3BDYL 2DQIL 3QNXA 3C6LB 2BXZA 4O51B 3U9PL 3NCMA 3ZE2F 1A21A 4MDJB 5GHWH 5IOPA 4PJBB 5TE6L 1S7UA 3D3VB 1F45A 3GSNH 4JZOB 3PGDB 1P9MA 1UB6A 5I1IH 3RAJH 3LIZL 1JTTA 1M71A 3U82B 2B5IC 4W70A 3V6OA 3I84A 4LLMA 5F8RC 5J6GA 1CICD 2CK0L 1DQDH 3MRFB 2ZUWA 4QWWC 5HDQL 5ALBH 2GEEA 2P24A 4O9HL 4ZFZA 1PY4A 2X4PB 4TUOB 1LP9E 2XPGA 4RAUA 3KDMA 3NAAL 5LG1A 4MA7L 1NBVH 4L5FL 2XA8L 3JV0A 5K9KA 4PTUA 3O6LL 3ULVH 2XTJD 3TV3H 4IRSC 2DWEA 3GFUA 4PGEA 5I74B 4M02A 3QUXD 5SX5K 5IF0B 1INDL 2W38A 5EU5A 5TJWK 3DX7A 3GSUB 5ESVB 4NN5C 1IZJA 1H3XA 4D9RD 1I9RH 4UNVA 4XCNA 1G7QB 3OKYA 3QIUB 4QRQB 4RZCA 4X7SH 4YGVB 3KPPA 5ADOL 5I2IA 4OGZA 3L3OA 3G5XB 4QF1B 1JPST 3CFCL 1B9ZA 3MUZ1 3QDJD 1N5YL 2ICEA 5TDOA 1RU9H 3ROOA 4C58B 5I30H 1T1XA 3SO5A 2DYPD 1KB5L 5MEOB 5IWLC 3QFDA 4NT6B 1AGEA 4TSAL 1MCPL 4XC1L 4XCYA 5F97E 5EC1A 4KDTC 3OPZL 3QQ3B 2AJSH 3QJFA 2BSSB 2X1OA 5DMKA 5I16B 4D8PA 2C7UB 3LB6D 4TUKH 4P23A 4P3CL 1F3DH 3VXSB 5F7UA 4KUZH 1DBBL 1LE5B 3RIFK 1TIUA 4NZUL 3NACH 5DMGD 3KVQA 5DJ6B 4M7JH 1MWAL 1ZA3B 2UZXB 1QSFB 3HPJA 4DK3A 4ZTPH 3OZ9H 3Q3GB 4LCWB 4G43A 4MA3A 5E1AA 5GGSB 5E08H 2CR6A 1JWSB 3UJJL 3WNNA 1Z9LA 2UUDH 3WJJC 4KKLD 1BM3L 4O02H 4UIKL 2EXWC 3V4VH 5D5MF 4R97B 5FYJD 3ORJA 3IDMA 3T09A 3RTQC 1IBGL 5GGQL 3IJYB 3FO1A 1K4DB 2DM2A 4PRBB 3HE7D 3TNMB 3QDHA 2HT3C 4IRSB 1MNUL 3KXFA 1Q72H 3GMLB 4L8BB 4WHCA 3BPNC 2HMIC 2HWZH 1FO0A 3WKMH 3QG6A 3IU3A 4JM4L 1T89A 4KMQA 3CSPA 1ZT7B 3NABL 4G7VL 2ESVA 2YPLE 3LSOB 1MI5B 1ZLWK 2GSIA 4R3SA 2ZUXA 3ZKQD 1GC1H 2J6EA 1B4JL 1C08B 1A6ZA 3T0DA 3IDIB 3KNBB 4A6YA 4YX2L 5KANG 2NY2D 2KKQA 4OCWH 2X89D 4G6KH 4WO4C 3HPLA 3QIBD 2R2HB 3HE6A 4JHWH 4HAGA 2B8OT 1RK0A 4ZUSA 3JV6A 3H9YA 1EMTL 1FV1B 4N8CH 3T77B 1F2XK 2PTVA 4QHUB 4WI8A 3IFNL 4HQQL 1NFDA 1CFSB 1FG2B 1ORQA 2DLEA 3PGFL 4PJCE 5FKPA 2L0DA 3ZYIA 12E8L 1F4AA 3HTLX 2XN9B 1JVKA 4WI2A 1T0NA 4AK1A 5GRJL 1JF5A 3QNYA 3WIFB 5GGUA 5HYEA 2GJ6A 3M17B 4L3EB 3CPLA 1DQLL 4OI9A 1SBSL 4LRIA 3OMZA 4DVRL 4LPUA 3PNWB 2NY3C 1YYMH 1YEDB 4DKDC 3T3ME 2YRLA 3F58H 2VLRA 4ELMA 4KAQL 1AHWC 5KAQF 4F8QA 1I8MB 5BCAA 2WWKO 3T2OA 1RHFA 1NJ9A 1B0WA 4MJ4A 4LK4A 4RFNB 2VAAB 1AE6H 3VA2C 1ZK9A 5IW6B 4O4YH 4OZHF 2QQLH 2EDKA 2VDMH 4ZS6C 3O0RH 5L88L 4G6FB 5DUMH 1RURL 2A6IA 2YWYA 3SE9L 5EO0A 1GZPA 3MUGA 4M9OA 4KRNA 1AD0A 1I1CA 3SDCD 1AGFA 3T65B 4EXPX 1IC4L 2PO6D 3OSKA 3QDMB 4F7MB 3R1GH 5E2JA 2M26A 3IFPB 3ULVE 1HQ4A 5CEZE 2YBRA 3MLSH 4JRYD 1YEIH 1HSAA 5JXED 4HF5H 4KTEL 5D6CA 2CLZA 3QI9A 5FAAA 1QBAA 4MAUL 1IT9L 5EUOF 3LQZA 3DBXB 4YFEA 3H3PH 3B9EA 1OVZA 3UZVB 1CT8B 4PGCA 4AEIL 2VQTA 1OB1B 4IRJB 1KBGH 5I1HH 3LKQB 5D71H 2H8PB 2AK4B 4NRXB 1QR1B 5KBNC 5JHDD 1E27B 1CD9B 3FFCD 3GI8L 5JMOC 4KJYA 3DSFL 4QRRA 4POZC 2VR5A 5IV2A 2FL5B 4OTXH 3GHEL 5C07B 5LWYH 2W92A 2R1YB 5C0JA 4C59B 3BP4B 5MHSE 2VISB 4LGPB 4F37K 1AR1C 1ONQB 2AP2A 4LNRB 4C56A 1IQDA 5E94A 5I8OL 1MFDH 1R3LA 2NY3B 4GW1A 4PJAE 5C0FB 4I5BB 4MNQB 5BS0B 1MFAH 1Q0YL 1LO0H 4NRZA 1AHWB 4P4RA 2Q8BH 1BOGA 1JNNH 3DUSB 1MREH 3OWEA 5DA4A 1F42A 2GJJA 4POYA 4YC2C 4KI5C 5IQ9A 1GGYA 3F7YB 1PGRB 2EYTA 4O2FA 1U8QA 4CJ1A 1R0AH 4KKBC 2VLJD 2CDFB 1JF1A 4XAWL 4TRPL 4QKXB 1ACZA 3B3IA 2W9LA 3CXDH 2FJGB 2BNQD 3T0EA 3KYOA 4PR5A 4G8GD 4Y2DC 1G7JA 4HUKB 3S96A 5KSAA 5CWSA 2GK0B 3SDXF 4NC0B 3JUZA 2YC1B 4BELD 3MGOB 2R4RL 4I0CC 5CZVL 3LHPL 4OF3A 2R8SH 1MFCH 4MXWH 4E41B 4UI2A 1FO0H 2YMXH 3BIKB 5FB8A 5MEQA 4Q9QH 1CTOA 4QRUB 2EIEA 3U0WH 3MV8E 5SX5H 1S9WA 3OGCA 2HT2D 1H5BC 3FRPA 5JHLL 3OJMB 2J6EH 1ED3A 5DJXA 4OGYH 4OIIH 4A6YH 4HWBL 2HJKB 1I3VA 1N7ML 2FATL 4O51A 3TP4A 4MDJA 1RZKH 5T1LB 3D3VA 3BWUC 4ODTH 4HH8A 4ZPTB 3G6DL 3PGDA 4IMLB 1BEYH 1T83C 2VB5A 3P40A 4N8PA 4BM7A 5E99H 2EDTA 4H0GA 4MZ3A 3BW9B 3GUTB 1A5FL 4D94A 5GHWL 1YNLH 5FYKD 2F54B 2FJHB 3GSNL 3SDYH 3MRFA 1XIWD 3T08A 1FQ9C 4U1GB 5I1IL 4KGJA 4KROB 5JOPE 3KJ4C 4ENED 4LVEA 3UTZB 1DN0B 1HZHH 4YC2B 1DQDL 2AGJL 3L6FA 3FB8B 2Z0BA 4H1LB 1H3GA 3A6BH 1BP3B 3P2TA 4U3CA 4CVXB 2UZIH 2FGWL 5ALBL 3N1QC 4M8QB 3RIAF 3LPGA 2BOBB 3DLQR 1RD6A 5D72H 1QRNB 5IF0A 1IAOB 4EVNB 3VMNA 1NBVL 3GSUA 5GZOD 1MQKL 5CILH 2FHCA 1G7QA 3QIUA 4QRQA 4XHQA 1YC7A 3H6JA 4NC1C 4WEUD 3AREC 2R2CA 5F7KC 5MI0C 1N2RB 4QF1A 1X6LA 2VE6B 1I9RL 2DJSA 3S5LB 5IEKB 4F2MA 5JOFB 4X7SL 1H5BB 1BQHG 3VXPB 1W0WB 2Y9RT 2O5XH 3QG7H 4GLRH 1L9NA 5MEOA 1EX0A 3TLRA 2DBLH 3WIHA 3QRFM 1MRFH 2B2XH 3K81A 2QEJA 1ZLWH 2R0LL 5I30L 3QQ3A 3TBTB 5BVPH 1I7UA 4FQXB 3BDXA 5I16A 1MFNA 1L0YA 1UFUA 4LHJB 3RGVB 1FCCA 1WBXB 3BP5A 2AXFB 1RZ7L 2R4SH 5FDWA 3VXSA 3VXNB 1UXWB 3VGEA 1LE5A 5C0BD 2AJSL 3AS1A 5DJ6A 1NCDH 2IQAB 1QSFA 4OZHB 3S8WA 1A14L 2BY1A 1IM3B 1F3JB 2D7QA 3ARDC 4LCWA 4M5YH 5GGSA 3WNPA 4WU7A 5J0BA 1JWSA 4JO4L 3KJ4B 4YBQC 4EI5B 4M7JL 1I4FB 3EJYC 3ZHDA 5KVFH 2UYLB 3MROB 2VABB 2CLVA 1TCRB 1BAFL 3IJYA 2RR3A 3TNMA 3EOBA 4PYHA 4IRSA 3GMLA 4JFPB 4L8BA 4O02L 4Y8AA 5EUOB 5HD8D 3NMEA 4X8XA 4HUVB 2WLZA 4WIQA 2E6PA 5TPWL 2JJWA 1NCTA 1ZT7A 5T3XD 1MCEA 1CIDA 4NWTL 3HNSL 4WFGE 1MI5A 3VI4E 4CN4A 4LARH 2GI7A 1WZLA 1P7QD 1HHHB 2HWZL 1IAIH 1C08A 3TGXA 3S36X 1NC4D 1QEWB 2AJUL 3QHTC 1FNSL 2FSEB 5IFJB 4XB8A 1GC1L 2R2HA 3K74B 4JM2D 1CD8A 5DRZB 5ISZB 1MHPH 1TVBA 2PXYC 1UG9A 2VN7A 4CADB 1FV1A 2EIBA 2NXYC 3DX8B 3T77A 4KDTA 1K6QH 3T0WA 4OCWL 3UXFA 4QY8B 4I3SL 4JHWL 4QNPE 2ESVE 1CFSA 1FG2A 1OWRM 4UTAH 1XZ0B 3T4AB 2YD6A 2XN9A 4G6AC 2AEPL 4H25B 3GBLA 1MPAH 1RZJL 2J4WL 4NQTA 3M17A 2AQ3A 4L3EA 3VGDA 1R5WB 4WU5A 4K7PH 1S3KL 4KC3B 3ARDB 3PNWA 1UQSB 4EDWL 4CBPA 3WFBH 1F4HA 3JBG7 6FABH 1BHGA 5ILTL 3WDIA 4F9LC 5J12C 5DJ0A 3WDJA 4ZNCD 3SDXB 3TYGH 5IFAL 1YYML 2VAAA 3AB0B 2YPKB 3UTPD 4IEFB 2ITDB 3DXAE 3RKDD 3IDNB 1FNEB 3L3JB 4UTBH 4NRYB 3GSOB 3T65A 4N1EA 2VDML 3QDMA 4F7MA 2APXA 2WWMC 3O0RL 3IFPA 5DUML 1GYAA 4QRPB 1A6VH 2JJSA 4DAGL 4D2NA 5I0ZA 3T3PF 2EZ0D 3QUZD 3R1GL 3DBXA 1OAZL 3ARBC 1YEIL 1CT8A 4YFLI 4HF5L 2N1KA 4J3WA 1OB1A 1RK1B 3PL6B 1KPUB 1FDLL 3T0VA 2H8PA 2NY4D 3VDCA 2M8XA 2FB4H 2NXYB 1QR1A 4EXKA 2J8HA 1E4XI 4M00A 4X4XB 4B5EA 4CGTA 1E27A 2P42B 4QLRA 3ZTNH 5DURD 4XNQA 2B39A 2FL5A 1KBGL 2OTWA 5I1HL 4LLUB 5D71L 5DQDH 1BIHA 3FQXB 3ZE0F 3BP4A 3RU8L 3WIHH 3UMTA 4YEFA 2VISA 4ISVB 4L4TD 4JRXE 2Z35B 1VKXB 1ONQA 2Y07H 2D4FA 4ZFGH 3C5ZC 5LWYL 2MQCA 2X05A 1VFAB 3W9DB 25C8H 4JO3H 4L29B 4OGAD 5C0FA 4I5BA 4MNQA 4JDTL 2NTSP 1AHWA 5J12B 4IM8A 4KRMB 5CMAA 3U0PB 4U1IB 3BZDA 4M1CD 3DUSA 5TQ2H 4LLYB 4QRRE 2P5EB 2ZCLL 1GCFA 3F7YA 1MFAL 5SWZB 1CE6B 1LO0L 2X42A 1OM3L 1U8IB 2Q8BL 1JNNL 1MREL 5INDB 1XF4B 4C56E 1JZ6A 2FJGA 4P99A 4WENB 4GXVH 4CL7A 3ILPB 5C0CD 2DQTH 1X7QB 2GK0A 5F9DC 1BJ8A 2QADB 4ZDHB 5J3HC 4Q6YA 5D8JL 2Z8VC 3WO3B 4OCLC 2D0HA 2N7BA 3EOTH 2KZWA 2YD8A 3CCHB 5BRZE 4JHBA 4DW2H 4E41A 1NCAH 3BIKA 4Y5XC 5SV3A 2DLIA 4QRUA 3ARBB 4U31A 4ERSL 3GIVA 5LGKA 5D6DA 3EDDA 4S10A 4H88H 2HKFH 2R8SL 1MFCL 4MXWL 4MB5A 1BREA 1FO0L 2YMXL 3ZKXB 4Q9QL 2RB8A 2GUOA 3U0WL 1CTNA 3KG5A 2HJKA 5E2WL 5CUSH 3CFDB 1J1OH 5T1LA 4WTZG 4JANB 5ACLA 2AKRB 2P4AB 1T5XA 4OGYL 4ZPTA 1BD2A 4FXLA 4OIIL 2XT1B 1DR9A 5SWSB 3GUTA 3BW9A 1RZKL 5DK2B 5C9KA 2F54A 2C4FT 2FJHA 1VADB 4PP1C 1EFXD 1MCJA 2YD5A 4WGVB 1ZHBA 1LEIB 1B4RA 3HZKB 4JFQA 2A1WL 4J4PC 1DN0A 1M1SA 3T1WA 1XR9B 3M45A 4FA8A 2Z91B 1TNMA 5KW9H 3SDYL 1J1XL 3ZTJG 3BQUB 4PJBE 5CEYB 1WWCA 3FB8A 2XY2A 1RZIB 4H1LA 1Z9OA 2OYPA 4CVXA 4P4KC 4EQ2A 2HT4D 2P7TB 2Z31D 4M8QA 1A3RH 5J6HA 3DMMD 3WJLC 2A9ML 4OD2B 3L9RB 3RVXC 5IQ7H 3CLEL 1QRNA 4Y19D 1IAOA 4EVNA 4CU8A 1WVZA 4RMRA 3W11C 4AL8L 3MA7B 2FGZA 3C09C 1FVEB 4ZUWB 2DBJA 1YEHH 3GB7B 2IWGA 4LKXB 4EN3D 4WHYH 3BN3B 2EDEA 4ZNEA 1FNHA 1N2RA 4R26H 5CILL 4Y5XB 2AK1H 3OF6A 2V2WA 2VE6A 5GGVH 1V05A 4Z7OF 5C7XH 4DN3H 1JPTL 1WZ1H 5JOFA 2QJDA 4JG0H 1DANU 1H5BA 4LCYB 5EOCL 1W0WA 3L3IB 3UEZA 2ATKA 1J87A 4OD3H 5C09D 5FGCB 1UYWH 1SVZA 4K7FB 5LJYH 1SJEB 4YDLC 4HS8H 1U3HC 4OFIA 4K8RD 3E6FB 4MQ7B 2O5XL 3TBTA 3W0WB 4RGNB 3BGAA 3ALPA 1WBXA 1Y18A 1JFQH 2AXFA 3W39B 3I50H 1T83A 4PJ8C 3VXNA 1AO7B 1UXWA 5IB2A 1A7OL 2I07B 4YXKH 3U7WH 2KL6A 2IQAA 1HCVA 4OZHA 2EEBA 2F9BT 2DQGH 2WSKA 2EDQA 2MJWA 3IRPX 1IM3A 1F3JA 2R4SL 1HILB 3ZHKA 5HGGS 5HTSA 5KSUB 3T0BA 2QLVB 2J8OA 4YBHA 4TNWF 3VXOB 4EI5A 5E8DH 1I4FA 4XNZC 1NCDL 1CGYA 3WDHA 3IKKA 2UYLA 2BRRH 1F4XH 4M5YL 4P4KB 2B20A 3Q0HA 2DQHH 5FHBH 3OJVC 4EI6B 3VXSE 1G6VK 3TN0D 3U4EA 3DSNA 4HZAA 1JGUL 3Q48A 4JFPA 5EUOA 2NXZD 4LLVB 3WIIL 3HUJA 2HLFC 2Z4QA 4HUVA 3FQTB 3VFWA 1PVHA 3C09B 1C7SA 5IBTH 4P2RA 3PWLA 3RX7A 1LNUA 1I8LC 3NFSL 2DIBA 3FAXA 4ZQKB 1MY5A 1A22B 1U8NB 2XTLA 5D1ZC 1HHHA 4OBRA 1FGVL 1CICC 3QCVH 4M6MH 3IDXH 1KTDB 2ZCHH 1QQDA 4GG8A 3UPRB 2WZPD 4FOMA 2VMFA 5IFJA 1NC2D 3ZLQC 3GSWB 3QHFH 1IAIL 1KPVB 4G42B 4CADA 3DX8A 1ZGLB 4HKZB 2CIIB 2XTJC 4QY8A 5C2UB 5EU6D 3UTTD 1MI5E 5E2UH 3QUXC 4CU7A 1K3ZA 4BUGA 4XAKD 4OJFH 1Q0XH 2QSCH 4GG6B 1K6QL 4H25A 3QUYD 4WGWB 4XP9H 1CGSH 1U36A 4XVTL 4UTAL 4N1CA 1R5WA 5DF0A 3ARDA 1B3JA 3TM6A 2XWTA 5C92A 3SCMB 1NGQL 1H3UA 1LO5A 1MPAL 1YUHB 3H0TA 5T1DL 1SBBA 1BF2A 1G9NC 5DFVC 5FV1L 3VD7A 4UNTA 3SDXA 4RCAA 1GOGA 2EIZA 2XN9E 4S2SA 2YPKA 5C2BH 4J3VA 1T7WA 2ITDA 1JMZA 3DNKA 4LPCA 3GNML 3IDNA 2BHZA 2DIAA 2AJ3B 3LB6C 1MHEA 3TYGL 4NRYA 3GSOA 1MJUL 2EDJA 3U6RB 3MRBB 3WD5H 4H1LH 3N0PB 3GJEB 1SM3H 4ORZC 3L95B 1LEKB 1TZHB 2A74B 1ZTXH 1CICB 4QRPA 3DGCR 1R6VA 2A9NH 1WIPA 2IFFL 1P4LA 4LGSB 3KPLB 4HZLB 4XHJD 1DQQA 4KKLC 2BHUA 1A6VL 1RK1A 2BY3A 1WEJL 2AV7B 1L7IH 3H9SE 2VR9A 4GUPB 3QIWD 5JIPA 1ETZB 2XTJB 1FNAA 3HE7C 3TO4C 1YY9D 2FBOJ 1MCFA 4OZGE 4LLUA 1XCQB 1Y6NR 1CFVL 1OAQH 2FB4L 4NO0B 4I8DA 4FHBD 5IMKB 4GAYB 1ZAGA 4OCYL 2DD8H 4U6HA 4ISVA 4GOSA 4ZO7A 3NGBC 2Z35A 4XC3L 1VKXA 1V7MH 2D4DA 2ZG2A 3EDFA 1YMHB 5AZ2H 1VFAA 3W9DA 4OIAA 3QDJB 1WWBX 4L29A 2NY2C 1GOHA 2AK4E 4O58H 4F9LA 5HHXH 2Y07L 5JORB 3U0PA 2DYPB 4U1IA 4ZFGL 4Y4KD 2F5AL 4YHLH 4LLYA 3QJHB 25C8L 1J9CT 1K8DB 1T04B 1G6RB 5EFIB 5C07E 2UVEA 5SWZA 1R3HA 4JPWH 1CE6A 1NAMB 1Q9LB 1U8IA 3TBSB 2Q3AA 1EV2E 1T7YA 3CFJB 2J3SA 3QUML 5INDA 4QEGA 1XF4A 4HH9B 4OZFB 2BVPB 3SKMB 3ILPA 1V3MA 3IDJB 1X7QA 5DVMA 4JQIH 5BS0E 1HHGB 5JDJA 4ZDHA 5BZWB 3NTCH 1TQCC 1NBQA 2XOTA 4HUXB 5GS3A 3VH8G 4TVSa 1T3FA 4GXVL 3BYTA 2DQTL 1AJ7H 4P5TD 4QTIL 3PDGA 1YC8A 4UB0L 2ADIA 3ARBA 1UM4L 4LP4A 2C3GA 2Y5EA 3EOTL 5EOQH 5I1CH 4X7TB 1XF2A 4DW2L 3GSXA 3GK8L 4KQ4L 3BISA 3HLAA 3HE7B 2D7TL 1UC6A 1V3LA 1TLKA 2KQMA 4H88L 35C8H 3CFDA 3CX2A 2HKFL 2YZ1A 3P0VH 1BJMA 4JANA 2AKRA 4Z7VB 4HG4K 3WS6C 2PO6C 2MSPA 2A6DA 4E41E 1CR9H 5DXWA 2RIKA 3NGBB 4F80A 1U3JA 5SWSA 5CUSL 3C5ZA 5JXEC 5DK2A 1QNZL 4ACPA 1TTFA 4I2XE 2D0GA 4LEXH 1VADA 3BP7B 4YDIH 1U41A 4QHKI 2NY2B 1QBBA 4NQED 2FR4B 1LEIA 4AYFA 2CPCA 2WBJC 1QSED 3HZKA 3PUCA 3QIBB 4S1RH 5HDBF 4MJ5B 1QFUH 4OLXH 4P5MB 4B50A 1XR9A 1KSRA 2OK0H 1NKRA 3ILQD 2Z91A 5K59F 4U7SA 3KLSA 4PJGB 5CEYA 4FQ1H 1IAIM 1QVOB 4H8WC 3Q5YA 3UJTH 3KPNB 5D5ME 1QFWH 3L3GA 5KW9L 5CGYC 1AR2A 1JRHH 1HCFX 3C5JB 2ZUQC 1Z9MA 2X6MA 3QXVA 3MA7A 4LAQH 1ZGLP 1FVEA 4ZUWA 4NQUA 3GB7A 3TCLB 3I02B 4LKXA 5CD3B 3DYMA 3NCCB 1ACYH 4JKLA 5IQ7L 3OAYK 3CK0H 2W9DH 1MCHA 4F7PB 4R4FL 3Q6FB 1QBLL 4Y5XA 3ZDYF 5E5MB 4HUWA 2GW5A 1JGVH 3ARGD 4YHOH 3L3IA 4ZXBD 3TA3D 3JTTA 2AK1L 5J13C 3TT1L 5GGVL 4DN3L 3BO8B 5D96B 2QQNH 3BJLA 3E6FA 4MQ7A 4ODWB 5CEZD 4K2UL 3W0WA 1NLDH 1G7LA 3SDCB 5F71A 4NO3B 1UYWL 5FHAL 3VGHA 2PO6B 2R2EB 2FX8L 4HS8L 1KB9J 2BXYA 4QXUH 2I07A 4JRYB 5CSGA 3O3EB 1FL6B 5FGRA 4KDWA 4M93B 1C5BH 1MCQA 1RJYB 3IJHB 4M62L 3Q5TA 1CDIA 3EGSB 1HILA 1JPSH 5KSUA 1AH1A 3BZ4B 4DGYL 4KZDH 3U7WL 4F9PA 4J4PA 4HXBL 3G6AB 4XMKH 3VXOA 3VFNB 4RFOL 4Z0XB 1HHIA 2DQGL 5JHDB 4P4KA 2HH0H 4LCUB 5D7LE 4OFVA 4EI6A 5MHSD 5B4MD 3FFCB 5E5RB 1UWEL 5HHNB 3WJLA 1F4WH 3MACH 5E8DL 1RUMH 3K4AA 3P0GB 3CD4A 4XCEB 3QO1B 4LLVA 1F4XL 4AT6B 3FOMB 2D3VA 2K3TA 5JPNB 3FQTA 4PJHF 4OZHE 4XXDB 5JIKA 1MCRA 4Y89A 2VXSH 4YHKH 5FHBL 4M7ZB 5L2KE 4RAVB 3MXVH 1A9BB 3MUY1 3SGDI 1KN2H 4RGOL 3ROLB 4ZQKA 1U8NA 2B1AH 1PYWA 2H41A 3GDBA 4F3FB 2M1KA 5IBTL 1FFOA 3PWVB 3EYUH 1IC7H 4Z9KB 1FFPB 2VZSA 4MXQD 3GSWA 2AW2A 3HNTL 2PYFB 2A38A 3QCVL 4G42A 4M6ML 3TVMB 2ZCHL 5EUOE 3SDAD 1MCKA 4NO5B 5J13B 1U3HA 5CLWA 1ZGLA 2VLJB 2Q6WB 2CIIA 1OCWH 4ODUB 3P30H 3MREB 3DRQB 3VD3A 3QHFL 2BNQB 3KPRA 3BYYA 4G8GB 2ICWI 1HOCB 1AI1H 4PJ5A 5GZOC 3OR7A 4JPIB 5DHYB 4GG6A 3C2SA 3PJSA 5EU3B 1HHKA 1IGMH 5E2UL 5EA0H 1MFBH 2CMRH 3GEWB 1CGWA 3KPQA 1Q0XL 2QSCL 1DJSA 5ISZE 3S35H 1HN1A 4J6RH 3SCMA 4PJIB 2XG5A 4JKKA 3WUWB 4Y1AD 4XP9L 1CGSL 1CIUA 3M07A 1TTUA 5DD1H 2JTDA 1LD9A 1NBYB 5I8KL 4WFFE 4HV8A 2VDRH 4K3JL 3I6GB 4FP8L 1KXQE 3CVHL 3INUH 5CCKL 3O9WD 4I18C 2OZ4A 2LTQC 2GSGB 2R56L 3W81A 4JDZB 2GIYA 3WL9B 4ZFFA 3U6RA 3MRBA 4APQB 4GO6B 5C2BL 2IH3B 4I13B 1I8LA 5DI8A 2Y06H 5EORH 3GJEA 4F57H 3L95A 4F7EB 5JOPD 1TZHA 4UQ3B 4JFOB 5CJ8A 1CICA 1XIWB 3B2UD 4HFWB 4TSBL 4J3OC 4HPOH 3SDXE 1WAAF 1SM3L 4HZLA 1ZTXL 4E0RB 3GM8A 2AV7A 4GRWB 3O6ML 1KJ2L 4HKBB 3ZDZF 4GUPA 3NIGF 2ADJA 5JW5B 4CVWA 1ETZA 3TBYA 4OF8A 1X5LA 4CU6A 1QBML 3L3KB 2EH7H 4X5LA 1J0HA 2GCYB 3QUXA 4IOFC 4TNVF 2FX9H 1DBKH 2O61B 5ANMA 1L7IL 1XCQA 3R06B 4GAYA 5ALCH 2APTA 4X6FB 2EC8A 3GBNH 3LY6A 1I1AD 4GAGH 2EE2A 3V9FA 4BYHA 5F7HA 1X5AA 1YMHA 2F58H 3QDJA 2FECI 3QQNA 5E4IA 2V2XB 3NVQA 2QSTA 3IB4A 4KJPC 2RQ8A 5JORA 2DYPA 4Z7UF 2EEAA 3SGEI 4JM2C 5AZ2L 3QJHA 1GVIA 1K8DA 1T04A 3ESUF 1G6RA 5EFIA 3SGKA 2WMPA 4KKAC 4LSQL 3H42H 4O58L 5I1GH 1NAMA 2IALB 3S37H 43C9B 3JTSB 2LTQB 4FQLH 4YHLL 3BKMH 2Q7NA 4I1NB 3CFJA 1D5IH 3PWJB 5C6TL 5KVDH 4HH9A 1PAMA 2HTLD 4OZFA 1D6VH 2VR4A 2BVPA 3F7PC 4LEOB 3SKMA 3IDJA 3JWNC 1HHGA 5BZWA 5F7FA 1S5HA 2DWDB 2WQ8A 3WSQL 2QL1A 3DI2B 4X9BA 4D0DB 2P5EE 3TPUB 1VEPA 3QUKB 1IGYB 4JQIL 5SWZE 3LPFA 1YYLH 2BVQA 3FB5B 1HH6B 1PX3A 3NTCL 1U8PA 2VDNH 2CKBB 4XP6L 5CINH 3RUGA 2JF1A 3HE7A 4J1UB 2L7JA 4KZEL 3RKDC 1E6OH 5IFHL 3RY4A 5I1CL 4WFGD 5T5FH 2QHRH 3FCTB 3QEQD 3U46B 3OV6A 3RL2B 1HHJB 4Z7VA 3IETB 4TVPH 5D1QD 2IC2A 2VLKD 2NY7L 1HKFA 4L3AA 3LMJH 1P7QB 4P2YA 1S9VB 4NJ9H 3P0VL 5EIIA 3MRCA 3BP7A 2EZ0C 2H26B 3QUZC 4U0QB 1NC4B 1MCBA 1CR9L 3N85H 3RBSA 2X89A 3PWUB 4MJ5A 3Q1SL 3U4AA 4P5MA 4LEXL 4YDIL 1RJZA 2NY4C 1SMAA 3DVIA 3KYKL 5LAXA 4PJGA 3UBXI 1QVOA 3BPLC 4KK9D 1MHHB 2D7NA 2J12B 3BSZL 3EJZD 4OLXL 1NSNL 3AU1B 5H8DA 3UBXB 3KPNA 2OK0L 2Y6SC 5TDPB 2ZUUA 3C5JA 2YKLL 5IVXF 1Y6MR 4LU5H 1DFBH 3UJTL 4MD4B 3EDJA 1BQLL 1JCKA 3TCLA 5CD3A 5KVEH 3N1PC 3RY6C 1EEZB 4GKZB 1G84A 2OZ4H 1MVUB 3MLZH 5T5NG 4OGAC 4F7PA 1N64L 3Q6FA 4BQCA 5GS1C 4PRHB 3PWPE 3S36H 4W4OA 4OM0L 2IMMA 4FQIH 4XPAL 2YZ8A 1Q9WB 3PP3K 3CK0L 1WUNT 2W9DL 5L8LB 4YE4L 3K8MA 2OP4H 4OB5H 1F4YH 5D7IA 4MHHI 1BQUA 3BO8A 4YHOL 4ALAH 1M7IA 3JWDH 4NZJA 3SDCA 4NO3A 1I3UA 3DVNB 1B0GB 4XBPA 1LE9B 4KXZH 5TH2B 3WS6A 5IB1B 2PO6A 3MFGB 4UV7H 4JRYA 3O3EA 1FL6A 3FB6B 2QQNL 1A64A 1IJ9A 1P4IH 4YNYB 5JXEA 3GSRB 1RJYA 3IJHA 2P8MB 2IPUK 4LSUL 3PV6B 3EGSA 4ZFOL 2WQRA 1RPQA 5FGCE 2OJEB 3BZ4A 1YN6B 1DZBA 3KPSB 4Z77B 3G6AA 1C5BL 1MLCB 3VFNA 4KHXH 3OXSB 3W0WE 2NY4B 4RGNE 4Z0XA 1E4XL 1U93B 4R0LC 5JHDA 4ZTOH 3BPLB 1D5BB 4GMTL 4ODHH 3EO0B 4LCUA 3I2CH 1B0RB 4KZDL 5C6WH 3FFCA 1RZGB 1AO7E 1H0DB 5HHNA 5FUZL 4JRXD 4OZ4B 4UT9L 4OLEA 3K1KC 3RWFB 1U8LB 3FOMA 1G9NH 5KAQG 2YD1A 3BH8A 2HH0L 4XXDA 3SQOH 4L4TB 1G6RH 3G5VB 4F7TB 4FABH 4S0TD 4U2YA 1WJ3A 1C5CH 4OI8A 1NFKA 4RAVA 1NAMH 3MACL 1CDCA 2ARJB 3ROLA 2B1HH 4NM4L 4XB7A 2AI0H 3IDYC 3OKOA 2VXSL 4F3FA 4OZFH 3PWVA 4FZ8H 2WUCH 3MQIA 1X5HA 1IAMA 4YPGB 1FFPA 4WI3A 1HH9B 1KN2L 5EU7E 2B1AL 5HHVH 3OKKB 1JK8A 3JVGC 3T3PE 1X3DA 4DTGH 4NO5A 4ZUTB 5D1XD 4LSVH 2HT4C 2GK2A 2VLJA 2Q6WA 2Z31C 3ZKSD 2F53D 1KEGL 4HFUL 4ODUA 3MREA 3DMMC 3DRQA 4OUUA 5B39G 1OAKH 2BNQA 4R4BB 4YPJA 2HTKD 4G8GA 5FYJH 3KHOA 5C0CB 1HOCA 5BRZD 5JTWA 2DKSA 5HI5D 4Z7UB 1OCWL 5DHYA 5T3ZE 3P30L 5EU3A 5TE7H 4JY6B 4MYWB 4F7CB 2NY6C 4EN3C 4XCFH 4XP4L 5DJAB 3ZE0E 4RMWA 1DUZB 4P49A 4R9HA 4JY4A 4PJIA 2X4TB 3WUWA 4X6BB 4Q9CA 5LCVL 1IGML 3MRNB 2E9BA 1ZVSB 2V5MA 4U1KB 4ODBD 2CMRL 3BKJL 4HIXH 5CZXD 4EKXA 1KCRH 1NBYA 1IMHC 1REIA 4BK5A 3U2SB 2EECA 4IHOB 4J6RL 2ITCB 2FX7H 3I6GA 2GT9B 4GG6E 1AFVL 1CLZH 4CRPA 5DD1L 1T7VA 5TF0A 4X4YB 2GSGA 4ZD3H 4JDZA 5HYSA 3ULUF 5HYFA 3WL9A 2OQJB 3S3JA 2IH3A 3INUL 1EERB 4V1DB 4F7EA 3JSSA 4NZTL 3RY5A 4YR6B 1ZEAL 3C6LD 1VSCA 3IDYB 3LKSA 1XIWA 1EFXB 1NGXB 4HFWA 5GRXG 2I5YH 5IBLD 2Y06L 5EORL 4ODVH 2ZNXA 4MGXA 5IB5B 3MRMA 4MD0B 1YEFH 5J89A 3GGWA 1OP3K 2BRQA 4HK3N 4M7LT 1WSST 2Z31B 4P59H 3FL7A 5JW5A 2BDNH 2VJXA 1Z0NA 3TN0C 3DMMB 3L3KA 2EDHA 1I9JL 2GCYA 4Y19B 2NXZC 4ESKA 5KVGH 1WF5A 2Y4SA 3FQUA 3QISA 4KJQD 1U8JB 4WV1B 4C55A 4UQ2B 4X6FA 3W5NA 5EBMB 3B9DA 4EN3B 1BZ9B 4XPHH 2I24N 1A4KB 2FX9L 1DBKL 2HAZA 3L5XH 2FEDD 4Y5VC 3GHBH 3DETC 2V2XA 2DICA 3QHZH 4OV5A 3ARFB 4FQQA 5ALCL 4RWYL 2DDQL 4B41A 1GXEA 4NQCE 3N9GL 1BJ1J 5A43C 5C09B 1Z3GL 2F58L 1ZT4B 3LCYA 4RRPA 5GISH 1NCWH 3MODH 1SVCP 4BQ6A 4NBZB 2CXKA 4ZOAA 1KGCE 2IALA 3T4YB 3T2QA 1YPZF 1WTGT 1RZFH 3VXUE 4XPTH 4Z0BH 2AJXH 1LO4H 1YECL 4HMCA 5GIRB 5C0BA 1FNFA 3HC4L 1EFQA 5C0DB 1VCAA 4J7RA 4R90L 2IBZY 4FQLL 2CK2A 5KS9B 5IB4B 1FSKC 3RWJB 3ZL4H 2OXHA 1FIEA 2EDXA 3SOBH 2BP3A 1X5IA 3TPUA 3VXTB 3QUKA 1IGYA 3FB5A 4FXKB 1I1YB 1N6QH 1HH6A 5I1DB 4YWGH 3N1GC 4HEPG 2CKBA 2BSTB 3WLBA 4MNGE 3RDTD 1F58L 3CZFB 5EIQA 1JBJA 5BOZG 1MAML 1N0XH 2RHEA 1TITA 4WWKD 4Z7OE 1YYLL 2FD6H 1Q1JH 4J1UA 4NQSB 3HRZB 4Y5YC 4O2EB 2VDNL 2H3NB 5AYQA 5DUBA 2IPTH 3FCTA 2BVUA 4RMVA 5CINL 3GMOB 3RL2A 3OR6B 1KF9B 5D2LF 1HHJA 2ORBL 4DOHB 3S6CA 1WT5C 4UDTB 1EBAA 3G6JB 3GSQA 5K9QI 4EBQH 3BHBB 4YHPB 1E6OL 3PP3H 3BKYH 1P7QA 2PW1A 1CBVL 2NPLX 1S9VA 4Z18A 1QUNA 3ULUL 4TVPL 3X13A 1NC4A 1WQVT 1O5DT 4D3CH 3FO0L 1NC2B 3DX9B 3PWUA 4XHJC 2PR4H 4JM2A 4NJ9L 2YXFA 4PJDB 5I17B 3LKRA 1MHHA 1YY9C 4MAYC 5DD3H 5EU6B 5C3TA 3UTTB 3WFEH 1JNLL 3AU1A 3UBXA 4NM8H 5TDPA 1Q38A 5F1NB 1CXIA 3JUYA 1FVCA 4G5ZH 4JO1H 5B8CB 3IDGB 4QTHB 3QUYB 4WW2F 4XVUD 5E6ID 4J3XA 4OQ1A 3K80A 4MD4A 5D7JC 5EG6C 1LO3L 3F7VB 4PRIA 2ZUSA 1FSKB 4Z78B 4JN2B 3MRGB 4HD9A 1EEZA 3LQAC 4GKZA 1A6WL 4GRLD 5FYJU 1FZKB 2C1OA 4PTTB 1JE6A 3ECBB 4OLZH 5FCUH 3ELAT 3IFLH 5CJ5A 4G8IB 7FABH 3LN4A 1SJXA 5HVGB 5KVEL 2IEPA 1Q9WA 3N06B 5FYKH 2OZ4L 2MKLC 3DIFB 1FCGA 4Y16C 5F3HA 5EC2B 3K7UA 1P7KB 1YN7B 5AEAA 3S36L 2VC2L 2NNAB 2GQHA 1VHPA 1MH5B 3QXTA 4Q6IC 3QPXH 3DVNA 1B0GA 4PUBH 1LE9A 5TH2A 1G7HA 4KK5D 2OP4L 1CDUA 1F4YL 2YD3A 4GRWH 2VDPH 1QOKA 3S4SG 3T04D 2R1XB 2BHYA 1HXMB 3FB6A 4JGJA 4OF7A 1I3RB 4GJTB 1ZVYA 3D0VA 3GSRA 4LHUG 5BO1H 3RJQB 3QUZA 4Y4HD 2IQ9H 1RIVH 4HWEL 1MIMH 4P5TC 4UV7L 3H9SD 3LN5B 2OJEA 4Z77A 4IDJH 3HC3L 1NCCL 1MLCA 4LBEB 1UM5H 3OXSA 1FFQA 1U93A 3QIWB 3VXMD 1J12A 3V0VA 4K3EL 1D5BA 1B90A 3EO0A 1NDMB 2XG4A 1RZGA 3BH9B 1H0DA 4X9IA 3RNQB 4JRYE 2V5SA 5C0EB 1NUDA 4OZ4A 2EDLA 4GMSH 1CLOH 1BQHB 3RWFA 1U8LA 4PLKC 3I2CL 4L4TA 1MCWW 3MR9B 3BGFC 1DQMH 4F7TA 4U0RC 2AK4D 3RJDA 1FVDA 5E5UB 2ARJA 5GSVB 1G9NL 1G7PA 1HDMB 4I48B 1DCLA 1YJDC 3SQOL 1G6RL 5GS1A 3NN8B 3AMKA 3BOVA 1BFSA 4Y4KB 3HI5L 4AIZB 1IGCH 1HH9A 2YR3A 5KTEH 5D4QA 1EEUA 3ILQC 4CJ0A 4E42B 1J0IA 3OKKA 1EHLH 3WE6B 2AABL 4ZUTA 4FZ8L 3L5HA 1S7XB 1LK2A 5BS0D 1Z6JT 4XPGH 1D9KD 4NBYB 4Q6IB 4Z7QF 1P5VA 4R4BA 1YMMB 2CKBH 4DTGL 3L1OH 5C0CA 4LSVL 1E4JA 4YO0B 2Y36L 4JY6A 4U6XB 1DEEA 4LP5A 2XZCH 1OAKL 1OP3H 4GS7B 1JGDB 1JYNA 1NCBH 5FYJL 2Y25A 2EE3A 2QQKH 3FB7B 2O5ZH 1F8TL 3MV11 1YPZB 2DAVA 1EHNA 5T3XH 3ARGC 2VLJE 2OI9C 2MOVA 1IGIL 1ZVSA 3FT2B 3V8CA 4XCFL 4R0LA 3TA3C 4G3YH 2WNGA 5BVJB 4G8GE 4I3RH 4IHOA 3WXVH 2YSSA 2ITCA 4P2CG 4X6CF 3NH7H 4L4VB 4CDGC 2GT9A 2KDGA 15C8H 1I9EA 4TPRH 4PJ7F 5LXGH 4HIXL 4XPFH 2V7HA 4M4RA 4X4YA 2G60H 3U7YH 5F93C 2ICES 2X4NB 1YNKH 3BGFB 4U0RB 3QA3B 2FX7L 1MAJA 2OQJA 1QLRB 5F1OB 4X5XB 1NQBA 1YNTB 3LQMA 4YR6A 3V6FB 1N5AB 5DD0L 3VI3F 4ZD3L 3QXWA 5C08D 3V52L 5HY9B 1EFXA 1NGXA 4NQEB 1ZT1B 2JELL 1QSEB 1NLBH 4HHAB 4WHTB 5IB5A 2IAMD 3CX5J 2QQQA 4MD0A 43CAB 1ZGLM 3TYFB 4KTYA 3BZFB 3KS0J 2ARJQ 4JAMB 5I18H 3RZWA 5J1TC 3CMGA 3T0AA 3QR2A 2Z31A 3AROA 3LKOB 2VXVH 3C6SB 3IVKB 3ZT7A 4ODVL 3DMMA 2Q3ZA 3ARVA 4XPBH 3MLXH 3LEYL 2R0ZH 4Y19A 2C3VB 2R0WH 3ZYOA 3K2UL 2V17L 1JUFB 1DN2A 5HHOB 1G1YA 5E2VL 1NEZG 3ZZ1A 3RFZC 4HBCL 4LAJH 4UQ2A 2OBGA 2VTFA 3ZE1F 5EBMA 4EQ3A 5I75C 4EN3A 1OPGH 1BZ9A 5JO5B 1KCSH 1A4KA 3B2VH 4IIQC 3BP6B 4M6OH 4BUHA 2XWBB 5M7QA 1NAKL 3RWIB 3ARGB 2OI9B 3GKZA 3MLYL 4OZIF 4ZXBB 4MXQC 3IKCB 3BUYB 1QKZH 4LCCC 4TOYL 5C09A 2VSDA 4WW2B 1ZT4A 3DJ9A 3SDAC 3GHBL 5INCB 1I3GH 2C4XA 3P4LA 4ZOCA 1CQKA 2C4FU 5HDBE 3HMXL 5IJVB 4I3GA 1NGPH 3T4YA 3SKJL 1MJ7H 1MVFA 5K59E 1A47A 4JO2L 4WCYH 5FYKU 2YUVA 4DCQB 1ZSDB 2W0LA 5GRWA 3C8KA 5GXBB 3D18A 3RKPA 2RBLA 3ZT5A 5CJOL 5GIRA 1JYVA 2CLRB 1RUQL 1Z9SA 1KTRL 5C0DA 3TZVD 1S7SB 3ARTA 5KS9A 1FZOB 5IB4A 2B0SL 5HDOA 1RZFL 3ZYJA 4AM0B 4XPTL 2AJXL 3RWJA 1D5XB 4FQXD 2CRIA 3VXTA 3MRDA 2CUMA 3RGVD 4CMHB 4H8WL 3LRSB 5D7LD 4FXKA 5D93C 5I1DA 3BFOA 4JY5H 4XBGB 2DIJA 4XGZB 2BSTA 1VA9A 3ZYZA 3CZFA 4Y7MA 1QD0A 3ZDYE 4M5ZH 3GMPB 3MLUH 4LLWB 1XGRB 3EYVB 2XQYG 3TN0A 3AM8C 4NQSA 5L2KD 4O2EA 3ARQA 1WCQA 4CKVX 2H3NA 5GGTA 1SY6A 4N0FB 3G04B 3GMOA 3OR6A 1K5NB 1I7RB 3GBMH 4UDTA 2FD6L 1Q1JL 3AAZB 3G6JA 1HINH 5F88B 3BHBA 4YHPA 1S7RB 4QOKE 5F44A 5GS0L 1QACA 4Y5VA 1CL7I 4IRZH 2YN3A 3C8HA 3MJ7B 4PIRF 1G0DA 5E6YA 3V4PH 4HDIB 1NC2A 3DX9A 1XCTB 3BKYL 5B3JF 5IKCB 4MA8H 2ZJSH 3BMWA 3N1FC 3E2HC 4K7PX 4LASH 3SDAB 4NOBA 4PJDA 4R4NC 5I17A 2VZVA 4D3CL 5FUOH 1FYTE 4QT5B 5T3XE 2PR4L 3TIDB 3UTTA 4ZSOB 1ZWIB 4Z76B 2ZSVB 1F6AA 5F1NA 1M6OB 4QTHA 5E9DD 4JVUA 3QUYA 5ISZD 4R2GD 4KPHH 5LBSL 2Z93B 1P6FA 2VNCA 1I1AC 3F7VA 4NM8L 2HKHL 4Z78A 1XEDA 4JN2A 3MRGA 4JO1L 2LABA 2Z92B 3OKNA 1VB9A 1PLGH 4WFFD 1FZKA 4AENB 4WJ5A 4PTTA 4Y1AB 5H2BB 4KKNA 3MRKB 3ECBA 5D93B 3P0YL 4G8IA 3V5DB 4OD1L 3PV7A 4DKAA 2W59A 2MCPH 3S98A 3F6IA 3B9KD 5EC2A 1P7KA 1TVDA 5FCUL 7FABL 3IFLL 3L5WA 3O9WB 1II4E 1MH5A 5DHVB 2P45B 5FYKL 4EDXA 2HTLC 3CDYA 2DI8A 5BW7A 1VGEH 3RX5A 3MFFA 4Z7WF 1I7TA 2R1XA 1LP9A 4PRHE 4NN6C 3GMQB 3HFMH 3P73B 5GZND 4OCSH 3EBAA 1T2QH 2VDPL 4PGDB 4PLNC 4PJ7B 1K3IA 3MOAH 5BO1L 3E2HB 1CU4H 3CSYA 1A9EB 4POUB 4LBEA 4PYGA 2W65A 3BE1H 3MC0A 1JGEA 1SYVB 3DROB 4KVCH 2PN5A 2IQ9L 3QIWA 1MIML 1D3CA 5K33A 1AP2B 1NDMA 2EDBA 2P1YA 5C3LD 4UOW1 5IVNA 1ZLSH 1A7NL 1RULH 4IDJL 3HR6A 2DJUA 3RNQA 1R3JB 1T7XA 3D9AH 4U1HB 1FORH 1BQHA 5K9JL 2DM3A 4WVRA 4N0RA 4NDMB 3TEUA 4MB4A 4HWUA 3MR9A 1IM9D 4Q9BA 5D7JA 4K8RH 4X0KB 4KMTL 2FECL 3KPSE 2P5WD 5GRVL 4GMSL 1CLOL 4PRDB 5GSVA 5FO7B 1EK3A 1HDMA 4I48A 2PYEE 4LDOB 1FE8L 3NN8A 4WI5A 5A16B 1HXYA 4N0CD 1S7QB 4Y4KA 1JTPA 4AIZA 3NIDE 4NFBA 1WCBB 5F72S 1BBDL 1ORSB 1OSZB 2HA1A 4Y16A 1WAAE 4ZAKD 3C08H 4KK9C 2JJUA 2GITB 1S7XA 3D2UD 3EJZC 5KTEL 4Q6IA 4FQJH 1MFEL 5D2NB 1XGQB 3S34H 3ZDZE 5C1MB 3TBVA 5I6XB 1ZANL 1U6AH 3NIGE 4WW1B 2RFXB 3ZSTA 5K9OB 1SEQH 2P5ED 4FTVD 4KGLA 4U6XA 4NN6B 5IK3B 4YQXH 2C1PB 1S9YA 3FJTA 2CKBL 1JGDA 2XZAL 3E1F1 5DR5L 5GGTH 4P5TA 1SY6H 4PY7B 1IQWH 3FB7A 3Q5OA 5EOTB 2B4CC 4OF0A 2DLFH 1U92B 3T2NH 2QTEA 3LEXB 4JKPH 2HRLA 3FT2A 1GOFA 4JDVA 4M61A 1MSPA 2NZIA 2QQKL 2O5ZL 4LRIC 2ARWA 5BVJA 2K1MA 2YA0A 3C2AH 5IJKC 2ED9A 4EZMA 5LGJB 5IGXH 4Z7UE 4OGXH 3QEQB 4LF3B 2W0KA 1IKFH 3VJ6B 1RI8A 4G3YL 4HXAL 5D1QB 4YJZL 2X4NA 4J8RB 1JYXA 2OMBA 1X5FA 4YDJA 4I3RL 3WXVL 4XT1C 2VLKB 3NH7L 1B6DA 3Q6GH 1X5KA 1QLRA 2HYMA 5E7FA 4DN4L 3FQRB 4TPRL 4X5XA 5CHNB 1YNTA 4XPFL 3V6FA 1N5AA 3D25B 2CXGA 2G60L 3U7YL 3RZCD 5E6ZA 1YNKL 2H32B 5HY9A 4WUUD 3VE0B 5AG8A 4NQEA 3MJ6A 5CSZA 3ZDXF 1ZT1A 3UZEA 3HMWH 1QSEA 3PHQB 3GMNB 4OCRL 3VG0L 4HHAA 1A6UH 1HYRC 1P1ZB 1BBJA 1VGKA 4FXGA 4OLYH 5FYLL 2VH5H 4PJCA 5J1AA 2OL3B 3MLWL 43CAA 4QHNB 3TYFA 3BZFA 4JAMA 4HW6A 5C8JB 2WK2A 3UYRH 3LKOA 2DMCA 3C6SA 3IVKA 1ADQA 2RAMA 5E03A 4WI6A 1Z5LB 4LRNH 4V1DE 2J8UF 2C3VA 1JUFA 4X4ME 1RAMA 2OM5A 5I18L 5EWIH 2OXGA 1UVQB 2XFXB 1F5WA 3M1BB 4LCIL 1TENA 2MFNA 5F7EH 1S7VB 4XPBL 3PWPD 3N1MC 5JO5A 2R0ZL 3HAEB 5EBWB 5FUCC 4KKCC 2R0WL 3KWWB 4PP2A 1UWGH 4QHLB 1GGIL 3BP6A 2UUDK 2XWBA 1MCLA 2XRAH 4QO1A 2VXQH 3O6KH 3RWIA 4P23D 3ARGA 2MPAL 3IKCA 3B2VL 3TA3A 4WW2A 2J2ZA 5I19H 4Q74A 3OHXB 3DUUB 5INCA 3A67H 3HZVB 3QZWG 5KSBF 3KLAB 5D1XC 4LHUD 2CR3A 1RUPH 2XV6B 4XRCB 1KNOB 1X44A 5IJVA 3LKPB 1QKZL 1S9XB 2EDDA 3O2DA 1N0LA 4JKWA 1YQVL 1IEHA 2HTKC 4GKSA 3MOBL 1I3GL 4DCQA 1ZSDA 3U36B 5HI5C 3MJ9A 4BQBA 2WUBL 3BGMB 2CO6B 1BZQK 1MJ7L 1V7NH 1S7SA 3S3SA 4YHZH 4DGVL 1E4WL 1FZOA 4JPKH 4X9FA 4AM0A 3KXFD 3QH3B 1D5XA 5IVXE 1OTSD 5DO2D 3GI9H 3LRSA 4D0BA 1OTTC 3P4NB 1AO7D 4OKVB 3O3DB 3K46A 4XGZA 4GBXD 5GSRB 4Z7WB 1JZ3A 2BJML 4JFHD 3GMPA 5IESH 2OR9H 1PBYA 4LLWA 1XGRA 3EYVA 4AQ1B 1BWMA 4JRXB 3MZGB 3MRRB 4P5KA 5GRUH 1BZ7B 2V6HA 3U30B 4N0FA 1T22B 4M5ZL 3RVTD 1I8KB 1K5NA 1I7RA 3MLUL 4QGTA 3NA9H 4L1HA 2R2BB 1IFHH 4F58H 3AAZA 5J4MA 4YDVA 5CJQH 5F88A 4G6MH 4ELKA 3T1FA 3LH2L 3C6LC 4CMMB 2BNRD 2A73B 3VGGA 5SX4H 1OAYH 5IBLC 5HYJE 4MQXD 4HDIA 5IKCA 3REVB 3PDOB 4YUEL 4YHIA 3CH1B 3SDAA 4IRZL 2H1PL 2XICA 5CSBA 1X5ZA 2F8VA 1QO3B 3RHWF 2LU7A 2F53B 3V4PL 3VH8B 4DOHE 5I66B 2NW3A 4QT5A 4LKCB 1NMAH 2BY2A 1J8HB 3EO1B 5T3ZD 3G6JE 4ZSOA 2ZJSL 1ZWIA 4Z76A 3QAZB 5CBEB 4LASL 1MEXH 4C54A 3UTSB 2ZSVA 5BRZB 2ZKHH 4M1GL 1MELA 3FN0H 4KJQC 1M6OA 1KJ3H 2BOCB 4HIHB 3TJHD 4RAHA 5HGDB 2Z93A 3MV8A 4HLZH 3QEHB 5BV7B 5DUPH 4YXLL 4LLDB 3QRGH 1EJOH 2FEDC 3UPAA 2Z92A 3K8KA 1OGTB 4HIEB 4KPHL 4Y1AA 5H2BA 2ZUYA 3D39E 3MRKA 3V5DA 4K23L 2F15A 5EU6E 1LWRA 1W2KT 3SGJC 1PLGL 3SKOB 5IB3B 3VW3L 1YJDH 2H2PC 1UACH 3AM8A 4K3DH 3DV6B 3O9WA 5JNYB 1A7PL 3F7RA 3BESR 1Q9KB 3LZFL 2MCPL 3W5MA 1OY3B 3QEGH 4KQ3H 1NKOA 4NBXB 2FEEI 2UWEF 2RCSL 1WTLA 4MSWB 1I8IB 3SDDD 3GMQA 5FV2A 1ADQH 1P6AB 1VGEL 4AMKL 4KY1H 3PE9A 2XIDA 5JXAH 3CX5K 5ETUB 4XWOD 1AKJD 4BK4A 3VXQB 3HFML 1A9EA 1H3WM 5JA8B 3RDTC 4MJ6A 5FCSH 3TH3T 2J1KA 1SYVA 4OCSL 3DROA 1BLNB 2J7LA 4YFDB 4N8VG 3BN9C 3MXWH 1OAUH 1CU4L 1VENA 1R3JA 1U2CA 2I60H 3VGBA 3BE1L 1EXUB 4U1HA 4KVCL 3SE4C 1BECA 1L9MA 4TUJB 4JHZA 5HGAB 4R97C 4NDMA 2X9WA 1I1AA 1WLHA 2QR0B 4X0KA 3WFCH 4KMLB 3D9AL 5CEZH 4NQCD 1EAPB 1FORL 4PRDA 1EBPA 3O2DH 2VITB 5FO7A 3BT2H 1XH3B 3CFEB 2D7PA 4NO0D 3MJ9H 2J8UB 4MWFB 4XMLH 5KOVC 5A16A 5IIEB 1KGCD 3MA9L 5DC9B 4YZFE 4LVOB 3QULB 1WCBA 3F7QA 5CGTA 3IJSB 1ORSA 5ACZB 4OBSA 3VXUD 4M6NH 1A7RL 1TCMA 2GITA 5DWUH 3PIQB 4ZYKA 2KBGA 2JE8A 3LEVH 1FLRH 3X3FL 4HS6B 4YDKH 1H8OA 1K8IB 5LQBH 1ES0B 4K9EH 5D2NA 1X9QA 5I1KL 4UOJA 4QHMB 4ZO6A 4R8WH 4WW1A 1KIPB 3J8F7 1QLEL 2RFXA 4JGUA 3C08L 1UA6H 4XVUC 5K9OA 4X99B 1KYOK 1BMGA 4KRPD 3PWNB 3VFSB 4FQJL 3O3AB 5IK3A 2X4OB 3VWKD 2C1PA 4JFFD 1KENH 3K4ZA 1K4CB 3NFNA 4PY7A 1SEQL 2D0FA 5EOTA 3GMMB 2A6KB 1U92A 3LEXA 1CZ8L 2O26U 4YQXL 3RDTB 3EFFB 3O8XD 5GGTL 1GIGL 1SY6L 1IQWL 4ZUUB 1YMME 4WWKB 1T20A 3V2AR 4I77L 5IT2H 4DVBB 4JPVH 3T2NL 2JB5H 5LGJA 4LSPH 1CL7H 3QEQA 4LF3A 5DQJB 3VJ6A 2F8OA 3X3GH 5D1QA 3HNVH 4J8RA 4KK5C 2AJYH 4RFNC 3ABZA 3LS5H 1YPZE 1IKFL 3FQRA 5E24E 2P49B 4HMEA 5T5NF 3SE3A 4D9LH 1B6UA 3D25A 2NZ9C 4AG4H 4Y4HC 2H32A 4ONFH 4I0PD 3Q6GL 3WNLA 3H3BC 4XI5D 4L4VE 1WBZB 5I1JH 2OL3A 1VACB 4QHNA 2CIKB 2BERA 4JB9H 2WM0A 2JJSC 5C8JA 1DLFH 3HMWL 1IAKB 1J88A 5KJRH 2PW2B 5IR1B 1UEYA 3ISWA 4WUKH 3G9AB 2UV3A 4OLYL 4RMTA 1UZ6F 3BMVA 1Z5LA 3IAQA 4NQXB 1KJVB 1N3NB 2NR6C 4OFPA 4IRJC 4JN1H 5E6IB 1ZV5A 2DQFB 1UVQA 3DRTB 4X7CC 4NQEE 2XFXA 3M1BA 4JZNB 1S7VA 3NCYP 1QSEE 4K55A 3D48R 4DUVA 4LRNL 4PD4J 5EBWA 4H5SB 4GRLB 1KB5B 1BWWA 4X6DF 5EWIL 1JHTA 5K93A 2HJLB 3V6ZB 5HHMD 1UEMA 1LDPH 1PG7X 5F7EL 3DXAA 3ZTJH 3H7LA 3RI5K 1A4JB 1PKQE 1UWGL 4PLJD 4HJ0D 3OHXA 4FNLH 2XRAL 3HZVA 3KLAA 4IOIB 2F74A 2VXQL 3O6KL 5HHOE 5IJKA 2Z8SA 2EDWA 4BSVA 4M7LH 1D9KC 4XRCA 1KNOA 4YAQA 1S9XA 3B5GA 4PJEF 2L4OA 3E6HB 2ADFH 4U6VH 3U36A 4WFED 2E7BA 3RWHB 3BGMA 1RUPL 5DJDB 4U1NB 4LIQE 5EZOH 1JPFB 5BMFH 3CDFA 1J0ZA 1OQXA 5ESQA 5AYUH 2NY5H 4LPTA 2V9TA 3VFGH 1MCIA 4Y4HB 3QH3A 4JGMA 3H9SB 2N7AA 1KC5H 1UZ8B 2BVYA 1D7FA 5TF1H 2VDQH 2PTTB 1FIGL 3V95A 5LGHL 4LPVA 1V7NL 3P4NA 1IEBB 4YHZL 4OKVA 3P4OA 4JPKL 3O3DA 3VXMB 4WY7H 4OZGB 3IYLW 5DRXA 5EZIH 5GSRA 4HWNA 3GI9L 3UAJD 4HIIB 3MMEB 5J06A 2AERT 4NZRH 3AC0A 4KH2A 1MHCB 2DMBA 3B5TA 1PZ5B 4JRXA 4H0IA 4TULL 5DLMH 4HS3B 2AXGA 5EU4A 3MRRA 5IVZA 4BQ9A 4HCRA 1KN4H 2E27L 4M3KB 4V2CB 3LQAL 1R3KB 1T22A 5D6DC 1I8KA 5IESL 1KCVH 8FABB 2OR9L 1NPUA 2R2BA 3F12B 2DQDL 4PGBB 5GRUL 4OI7A 3ULVF 2Y1VA 1CFQB 1S7TB 2KH2B 2A73A 1IFHL 1EAJA 5FOJA 4YHNA 2HN7B 4C83A 2OX5A 3OKEB 2IAMC 3REVA 5DMIH 3PDOA 4NFCA 4NN7B 1IKNC 3CH1A 1HSBB 2VERN 3PG2A 2HJFB 1HI6A 5I9QC 4GKNA 3DTXB 3DV4B 4OLWL 5D1XA 1BFOB 1H8NA 1OAYL 1QO3A 3S35X 1KT2A 3VH8A 1D9KB 4LKCA 4U1GC 3EO1A 1CCZA 4KROC 1WGOA 1NMBH 3CDGB 5BRZA 5F3BB 2NMSA 4PV8B 1FGNL 3AXLB 4HIHA 3KS0H 5HBBA 3BD5A 3RTQD 3TVMD 2JB6B 3HG1D 1NMAL 5HGDA 1F2QA 5HPMB 1TQBB 3QB7C 2EO9A 1C8PA 4L9LC 2MWCA 1MEXL 4ONGH 3WHXA 4LLDA 5C70A 4L8SC 2ZKHL 2EXYD 3FN0L 1R24A 1OGTA 1T7ZA 3X14B 3VXRE 1U8HB 4HIEA 4ZUVA 4TYUA 3NCJH 4PJAF 1IZKA 4PJXF 1XF3B 1EHXA 4W6XB 4ZSOE 1CXHA 1ITCA 1Q9OB 4L9DA 3SKOA 2VXUL 5IB3A 2H32H 3D85A 5TQ0L 5TFSH 1TJGL 5I1LB 3DV6A 2EKSA 1MUJB 2HVKB 5EZLB 4BSWA 1PFCA 1X5JA 2VRAA 4G9DA 3SJVE 1CGTA 5JNYA 1MF2L 4DKEH 4JEGB 3VRIB 2NW2A 3O45B 1Q9KA 4WO4D 4PBWD 3EOAB 4I2XB 2F5BH 2OL3H 2HFEB 4LNVA 5F6HJ 1YJDL 1A6TB 4GQ9H 1UACL 1BVKB 1P84J 4XP5L 1EO8L 4Y1AE 4Z7QE 4DEPC 3R4DA 3KAAA 3HCVB 3TZVC 3C6LA 1I8IA 4MSWA 5C08B 4MVBC 1GGUA 4FQXC 4U1MB 2D2OA 4KQ3L 4PJBA 3RGVC 5ETUA 1F90H 5C0GB 4JZOA 4Z8FH 1AXTH 3G5ZB 2IAMB 3VXQA 5DSCB 4M8VA 4APQD 2YPVH 5D5MB 3VA6A 1ADQL 5F21B 5I9QB 5C0AB 2D03H 4OAWB 3O4OC 4KY1L 1AXSB 1CLYH 3EYOB 5JXAL 1BLNA 4RX4D 2SEBB 2H2SD 2B4CH 4W6YB 2VUYA 3RAJL 2X4PA 4TUOA 4MCZB 1FJ1B 1DVFB 1EXUA 1RUAH 4K71B 4PGZA 4DUXA 4EI5C 2Q76B 3DUHA 1BVLB 1NL0H 4X6CE 1CGXA 5JQHC 5HGAA 2XYCA 3S37X 4AIXA 3IDUA 3MXWL 2VLME 1MCWM 1OAUL 4L3CB 2QR0A 4L9LB 4PJ7E 5L7XH 4YGAB 4ZS6D 2I60L 4L8SB 1HWHB 2YN5A 5FOBB 1EAPA 1KLUB 4UINH 2VITA 4JFXB 3TT3H 1EZVX 1RMFH 2R15A 3P77B 4K94C 1JNJA 1XH3A 4G7YH 3CFEA 2GY5A 4KJWD 3T2PA 5ESVA 2MMXA 4R96B 1CD0A 3WFDH 3S3PA 5IIEA 3OKMB 3WFCL 3ULVL 3NPZB 3VI3E 5TE4H 5CEZL 3TV3L 5IMMB 3KYNB 3SGJA 3QULA 4YGVA 3IJSA 3O2DL 4JFYB 1UKTA 3DECA 5ACZA 3FKUS 2E9IA 3BT2L 1AD9B 3G5XA 3J7HA 4R6UA 2FO4B 4NCC2 3MJ9L 4XMLL 3U9UB 4HS6A 1K8IA 1R5VB 4J3SA 5DD5H 1ES0A 5AWNH 4QHMA 1KIPA 3MLVH 4NT6A 4FFZH 4R2GC 3IT8D 3P3YA 4DEPB 1RU9L 3LEVL 3TZVB 1ZOXA 4YDKL 5C71A 3VFSA 5LQBL 3FMGH 2PTUA 2X4OA 1PDKA 2EO1A 1J0YA 4JREC 4HCRH 2BVEA 1N4XH 2BSSA 4R8WL 2BX5A 2BFVH 2IANE 1RFDH 4KK6D 4MX7B 2VLLB 5F8QC 2C7UA 3QPQD 1UA6L 1EO5A 5D7LB 3ZE1E 4PJEB 3GMMA 3TH2T 2A6KA 3TH4T 2YRPA 2W07A 3RDTA 3O4OB 1EEYB 2VQ1B 1ZA3A 4TUKL 5D2NE 4JFED 4ZUUA 5HVHC 1JZ4A 4WWKA 4X7EC 4YLQT 4UU9B 3Q3GA 2I26N 2MKWA 5L2KB 2ADGB 4KUZL 4YIQB 3NACL 5FO9B 4GW5B 3CU7A 3SE4A 4QOKD 2GKIA 4NKIH 2WAHA 2LQRA 3HRPA 1P4BH 1KCLA 1I1FB 1UM6H 4ZTPL 3OZ9L 4ETQB 5E08L 1I9IH 4JPVL 2JB5L 4HPYH 4LSPL 1CL7L 1K4DA 3AB0C 4PRBA 3KLHC 3DO7B 1FBIH 5GZNC 5L2JB 5DJYB 1KLGB 5DVLA 3O2WH 3GKWH 1M4KA 3V4VL 5B39B 4I4WB 2XWJB 2AJYL 3QEUB 5ELIA 4KVNH 4XNYH 4Y2DD 3LS5L 1FYTD 4Z7NF 3LRGA 2X70B 1WBZA 1Q72L 1NBZB 3LSOA 3QEQE 5BV7H 4AG4L 1VACA 4MJIE 1GHFH 3U4BH 3WKML 3TJEH 5ECJE 3IDIA 3OG4B 1IAKA 3KNBA 2DTSA 5EB9A 4RNRB 2VLKE 5IR1A 4NSKB 5I1EH 4QXWA 5I1JL 3X11B 4NQXA 4M6AA 1UH3A 1YZZA 1JP5A 5E9DB 1N3NA 4JB9L 5E6IA 1DLFL 3PL6C 4R2GB 2R69H 3DRTA 4NQDD 1D5ZB 2YUXA 4JZNA 5KJRL 2R29H 2C3XA 3QCTH 1OQOA 2E9WA 4JREB 4QHUA 4G6KL 4H5SA 1YEKH 1KB5A 4GRLA 1IGFH 3VI4F 3STZB 3D0LB 5F9JB 4OM1H 4PG2C 2HJLA 3HI1B 4N8CL 4PFEA 3TIEB 3V6ZA 4N0CC 3WN5C 1G7MB 4UT7H 4LSTH 3WIFA 4NKMB 1A4JA 3DOSA 1CLCA 3B9KB 2CO7B 5HHQB 5HVHB 1OGAB 4IOIA 1QFWI 1GH7A 1LDPL 3CFKB 5FA4B 1UJTA 1JRHI 5B3JE 1YEDA 1FHGA 3DI3B 1MLBB 1CG9B 1I8MA 4PRHD 4X8JB 4QNPF 1X4XA 5CJXC 3UCRA 4X98B 3IAPA 3RWHA 2APWA 4PJXB 3LPWA 4LMQE 4U1NA 5IW6A 1JPFA 3F58L 2PCPB 4TQEH 2D9CA 1CXLA 4HT1H 5EOCJ 2ADFL 4U6VL 4Y4HA 1S8DB 4Q9RH 5D70H 3H9SA 4HIJB 1XGUB 1UZ8A 4Z5RB 1AE6L 5A2LH 3V8OA 2X1QA 3EHBC 4O4YL 4EIGB 2PTTA 2QQLL 4MCYB 4QXGH 2DQEH 5BMFL 2AS5M 5CP3A 4XTRC 2AEIT 2FHBA 1WC7B 2QADC 1IEBA 1HIMH 3VXMA 1OD7A 4OZGA 2VWEE 3ARED 3FO2B 1KC5L 4JJ5B 4HIIA 3MMEA 1NFDF 2VDQL 1PD6A 4MS8D 4M48H 1PZ5A 2YD2A 4HS3A 4PV9B 3MLSL 4WY7L 1PY9A 4JHAH 4M43H 5I76B 3KPSD 4F33B 2PKDA 1R3KA 4IRJA 4LL9A 4X7FC 4X9GA 1F6FB 8FABA 3LKQA 1IM9B 2AK4A 4PY8J 2PYED 4NRXA 1XGPB 4PGBA 3H3PL 3ZKXC 3RIFF 2EIDA 3VFPB 2P5WB 1A1NB 1A3LH 1KN4L 4U7MA 1T03H 4FZEH 3RZCC 4ELMF 1QPPA 1CFQA 1S7TA 5C07A 3SQBA 2R1YA 3JV4B 4Z7WE 1SQ2N 1UCTA 1DEDA 4DKFH 2DF3A 5I1AB 3WN5B 2ERJB 3EO9H 1RHHB 3OKEA 1N59B 2IG2H 4MJ2A 3VFMB 2HJFA 2ENSA 4LNRA 2J88H 4OTXL 4ZAKB 5JPMB 3DTXA 3DV4A 3TFKD 1BFOA 5FDYA 1DSFH 2LVCA 4P2OD 1UXSB 3D2UB 5BS0A 1CVSC 1QP1A 1D9KA 2IBZX 2G9HB 3BDYH 3FFDB 5DMIL 2FJFB 5A2FA 2FO1A 4YBQD 5FUCE 1EGJA 3CDGA 1XT5A 3H3KA 5GGRB 1MFDL 3EJYD 3I6LD 4AJ0A 4PV8A 5TE6H 4FTVB 2JB6A 3MV9D 3BQUC 1F3RB 5HPMA 3P9MB 4LOUD 3MNVB 4PJ9D 3LIZH 3ZMRA