5IWLC

Cd47-diabody complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
ELLFNKTKSVDFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5F9 diabody
publication title CD47-blocking immunotherapies stimulate macrophage-mediated destruction of small-cell lung cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 23
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlC00
1R5IB 5EBLA 1EUUA 2P5EE 1I8MA 2HJLA 4G8EA 2OM5A 1NDMA 3K0WA 1A14H 1OTUD 4GRWB 2VDOL 3H0TA 5J57B 1LO2L 1RAMA 5EO9B 4HUVB 3FTGA 3TA3B 3EJYC 5KSBA 1MHPH 4NZTL 3BKYL 4MAUH 1ZA3B 2X4QA 5EIQA 5EIVA 3K46A 1G7QB 5JDSB 2W65B 3KLAB 1S7RB 2AXJA 1ZS8A 4IMLA 4NQDE 1CGXA 3LZFL 1TPXC 4OBRA 3VCLB 2ADFL 2HJKB 4F58L 2RFXB 2CO6B 4TVPL 2KKQA 3QEUB 3ULUF 3BKCL 1V3KA 4AEHH 5E8EA 3M17B 1UG9A 4LSTH 3X17A 4X80H 1EGJL 4U1MA 3VGDA 1VB9A 3MJ8A 1VHPA 5D1ZB 3WN5A 4ONFH 1REIA 3O2DA 4U1LB 4KQ4H 1HCVA 2DQEH 3MZTA 3KYMB 5C07B 4X6DB 3DX7B 2APBA 1LK3H 4LBEA 5GGSA 4L4TD 1Y6KR 4OZHA 1RHFA 1SJXA 5TQ0H 2N7BA 1KIQB 2C3VA 3B5HA 5CMAA 1HILB 5B22A 4UV4L 1J0YA 2L7JA 3BO8A 5KAQF 4HIIB 1FFQA 1CR9H 3D25A 3T0AA 2AQ2A 5H35A 4FFYL 3QNXA 4M43H 3SDXB 5ETUB 1ZHKA 3MBXH 5DJZA 1IEHA 1E27B 4DAGH 4C56D 3IDXL 3RTQC 3V2AR 4U4BA 2FBJH 3RAJL 3C6SB 4V1DB 4AQOA 4L4TA 1FGNH 1HHGB 3LPFA 1IGYB 4XVUD 4IM8A 2FATH 3QO0A 2I07B 1N4XL 4UOW1 3K8KA 1A4KB 4D0CB 5ESAB 1KCVL 1ZLWH 3G5XA 1MIEL 4B7IA 4XXDB 3BZEB 2FDBP 5CZXC 4MXQD 4S1DC 1T21A 2OTWA 5I66B 3DURA 4XMLH 4EOWL 1KC5H 1WLHA 2JJTA 2UV3A 1GAFL 5D7SL 4K23H 4OZIE 3HUJB 4K71C 4C56A 3VRIB 3BKMH 5T1DH 3SBWA 1N0XH 2HVJB 4O02H 3TH4T 4HKBA 5T3ZH 1W8OA 2FEEI 4HX1B 4L3AA 3KLSA 1NGQH 4KVNL 4NKOA 4MWFB 1WV7T 2X05A 3ARBB 3BI9X 4NO0B 4X7FC 3R0MA 3VDCA 1GHFL 1LEKB 3CFKA 1DR9A 3IJHB 5HGBB 4JFFD 4EVNA 1N5AA 1WEJL 2Y5TA 2X42A 3GIZL 1IE5A 4PJ7B 3JSSA 3VGGA 4ZFFB 4QOKE 3IGAB 5ISZB 1CQYA 1F4XH 2BOCA 3QPXH 4P5MB 4QHLA 4R26L 4PJCF 3VXSA 5K9KA 3KPNB 3P3YA 4BQ8A 4ZFZB 1JGEA 4HDIB 4HT1L 3O6FC 3I6GB 5J9PB 2D0FA 4TUKL 2A9NL 3TBVB 1UACL 4G42B 4M7ZC 1YNTA 2VE6B 2DKMA 3HG1B 1T83C 3C60A 4KRPC 3FQRA 5JW4M 1MF2L 2F54E 1QFOA 1CL7L 1RK1B 1NMCB 3H3PL 1U9KA 3TYGH 3VFOB 2W0PA 1J87A 2VXUH 1SJHB 3MRJA 4Y89A 5I6XC 2EYSB 1YUHB 5I71B 1X4ZA 4JJ5A 1C5DA 2VTFA 5I76A 4YHMH 3QXAB 4R7DA 5CJOH 3DTXB 5SWQA 4NHUB 1S7TA 5KS9A 4KDWA 1FNGB 3OQ3B 3IS0X 5KSBE 3TNMA 1BF8A 3ZTNH 5L2KD 4AG4L 3SKOB 1RUAL 2B0SH 1QFWI 1CT8A 4FP8L 3WUWA 4R0LB 3LV3A 1CICC 3S88H 3MV9D 1T5XB 3PWLA 5CINH 5EWIL 5H37H 1YEJL 3ZE2E 43C9B 3IDUA 1H9VA 1YEKH 4ONOA 5FKAB 2WAHA 2XWTB 4LHUA 3SOBL 3KPPB 2QHLA 3QULB 1SBBA 1TXKA 5EZIL 1YYML 2AI0H 4CADA 5B38A 4BSJA 1A1OB 4WU5A 2BMKA 1B0GA 1W0VB 4PG2A 5JHDE 2YPVL 2Y9RT 4ZXBB 4JKLA 3QDJD 3WKMH 4JFQB 3LKPB 1ORSB 3B9KD 5L2KA 4OZHE 3AUVA 3RIAF 4JRWA 2X1XR 3QI9B 1XGUB 4KV5E 4K94L 1G7IB 1ZA6A 4R4NC 1ZMYA 3IFNH 1RI8A 5F8RC 3LKQA 1V3LA 2DN7A 4F7TA 5DJ0B 4R4FL 4DGIH 4HK0B 3U0PA 1K3IA 3CIQA 3BAEH 4ODHH 4KROD 4GRLB 1P4IH 3UJJL 4OD2B 1NEZG 4KXZH 5DUPH 2ICES 4QLRA 3PDOB 1B6DA 3QDJA 2Q76B 5EFIA 4L4TE 1BVZA 5T1LD 2JIXB 1HSBA 2BERA 1AD9A 1AC6A 1P4BL 1UA6L 3KLHD 2EDYA 4ZQKA 3H7LA 4DGVH 2FH8A 1CI5A 1U58A 1D6VH 1U91A 5DYOA 4E42B 3IB4A 2ZUVA 1YY9D 5EU3A 1AGCB 4P23B 5IKCA 4XNQA 1RJLA 4LSVH 4M61B 4OCYL 1AFVL 1JPGB 4NT6A 1MCDA 3U7AA 1XMWA 4HK3N 4YBHA 3ARDC 4MDJA 4FFWC 3UC0L 4DW2L 7FABL 4I4WA 5EUOF 4U05A 4S1QH 5LAXA 2WWMC 4MLIA 4LSRH 1F90L 4MX7A 2QSTA 5T1LA 1SYVA 3SDCC 4PJAE 2EH8L 1C12B 3CFJA 2VISA 3F7PC 1JWUA 2IF7A 4Y88A 3ZDXE 4U49A 3O8XC 5IB3B 1BQLL 4WFFD 1UZ6E 3IDYB 3PJSA 3HFMH 2ESVB 3BN3B 2X4UB 3X3GH 2GSGA 5I1GL 3NIFE 3C5SA 2O5ZH 5DQ9B 3ULVC 1RURH 2H45A 4IMKA 1T03H 5D93C 5ESVB 2V17H 5IEHA 4RWHA 4M9PA 3DUSB 1FLRH 3VXSE 1H3UA 5FYJL 3SCMC 1AIFB 2IEPA 2AXHA 4NWTH 1C7TA 5D70H 4Z0BL 4KK5D 5F7EL 2NY5L 5CCKH 4PTUA 5AAMA 3DETD 2D3VA 3OKLA 1XF5A 2P8LB 2XICA 5F96L 3BDXA 3DVIA 4MNQD 2EE9A 1CTNA 4JR9L 1YEFL 3BIBX 3MV01 2ARJA 1CXIA 3EHBC 1D5XA 3GJFB 2HTLC 1U8MA 3CU1A 1AHWB 4Z6AT 1X5HA 1TZIA 2VDMH 1GZQB 5C0AD 5I1DA 1NCWH 4DVRH 3ARGC 4JZJB 3FMGH 4HUNB 2DLFL 4G6JL 3LKOB 1NAMB 35C8H 2R4RH 2VLJD 2EKJA 3D0LA 3GHEH 4QRRA 4DN3L 5CJXA 3QG7L 8FABB 4JM2D 2G75A 4KZDH 2R0LH 5HVHC 2I9LA 2VDRH 5ID0B 4OLZL 4KRNA 1K8DB 5FM5M 2R23A 3MUY1 4XPGH 3SY0B 5KS9E 2EC9U 1OW0A 1Z3GL 4MHHI 1GYAA 4NN6C 2NLJA 4DJMA 5BZWA 3GNMH 5FO9A 1OTTD 4HH9B 1BAFL 3HE6B 2OJEA 3HI1A 5EC2A 5DUML 4LFHD 2ATKB 1JV5B 1V7MH 4YR6A 1B3JA 4JPIB 1A9EB 5C0AA 4GLRH 3VFPA 3QYCA 4U1HB 3SGKC 4GG8B 2VN7A 4NJAL 3SPVB 3GO1L 1FORL 5DJ8A 3BRDA 4U0QB 3F58L 5GGTA 4KMTH 5J1SC 3V95A 2A6KA 1J8HB 3FO9B 4ALAH 1OAYH 2DBJA 3C2AH 4F7CB 1A6VL 3ZE1F 1G0YR 3EZJB 4G6FB 1CBVL 2OQJA 4IHOB 3VFNA 1NBYA 4M7JH 4HZLB 4WDIB 3VRLF 4P4KC 5IB1B 4WCYL 4I2XB 5L2KE 1KNOB 3OF6D 5HGAA 5CUSH 1J1XH 2AXGB 3QFDB 1KYOJ 5IEKA 5M7QA 2OR9L 5IBTH 4K07A 3S5LB 1MRFL 4F3FA 3HR5A 2OK0H 5H2BB 4I9WD 3BEWB 5ITFB 5IUSA 3IJSB 3PWVB 1PLGL 1LNUA 5D4QA 1P4LB 3CMOH 3NCYS 4WJ5B 1XF3A 4FZEH 1S7XB 3IDIB 2J8UB 2HRLA 4NQEE 3UCRA 1CD1A 2X1WL 4NOBA 1CU4L 3OF6A 3RWHA 1A6AA 1BBDH 1U2HA 2UZIL 3CLEH 5EBMA 4B41A 5AD0B 3FT3A 2X4TB 4KGLA 4GS7B 2JK5B 4XNMA 3NN8A 2WV3A 4JM2C 3U9UA 4ZPVA 5K9QG 1A2YA 4FOMA 4AYFA 4CJ1A 4N0UE 4S2SB 5JNYB 4HS8H 4UU9A 4ZOCA 1XIWB 2DTML 4RAUB 4YEFA 5DFTA 3TV3H 2X4OB 2A73B 3VWKD 3CSYB 3FJTA 4BFBD 2JB6A 4P5TC 3WDIA 4RZCA 1M1SA 3WHE0 3E6FB 2G2RB 4PRPB 3TZVA 1EAJA 2V7HA 2YEZB 3B2VL 1LK2B 1H3WM 1CG9A 1YEHH 4ESKA 4HG4J 4JGMA 1GC1C 4HQQL 5JLZB 2F19H 1IFHL 1EEYA 4N1HB 2YC1A 1U8KB 2NXYD 2FX9H 3OKKB 1SHMA 1L0XA 4ELMB 3B9DA 4QXGL 2C7UB 5D1XA 1KBGH 3WO4C 3QCVL 3VWKA 1GSMA 4H5SA 3JVGA 5JIHA 3EBAA 5E8DL 5KG9B 2VWEE 4N9GB 5TDNB 3LRGA 3IRZA 1R3LA 2P44B 4PJ8D 1TETL 3WIIL 4UAOB 3HZKB 2EDLA 1DBBH 4PJHF 4XMKL 4H1LG 5IR1B 4G7YH 5DVOA 4CW1B 2FX7L 3OX8A 1A1NB 1G6RL 2EYTB 3KPSB 2IQ9H 4GJTB 4NHCH 4P0DA 3WYRA 5FF6B 3X3FH 5HYQB 3NOIA 1OQXA 2VNCA 4K8RL 4OLYL 4DQOH 4K3DH 2J8OA 5D71L 1P84K 3QG6A 3VFTA 2GK2A 3OKEA 3F8UB 4X99B 1PVHA 2YR3A 1JIBA 1IC5H 1O0VA 3L7FA 4NKMB 5JZ7D 5GPRA 2IPKA 5AUMA 2ZUQB 5LXGL 2R4SH 3GIVA 4LLMA 4PJ8A 4QRRE 2W9DL 4Y2DD 2Y36L 4WTWA 1J0ZA 5F72S 4XVUC 3PNWB 2DOCA 4M7KL 3UYRH 2UY6A 1MAML 3GMLA 4R7NA 5BV7L 4HJJH 5DD1L 1XR9B 1QG3A 5DHVH 4MXQC 2FJFB 5C0RH 5EOCJ 5E1AB 1NANI 5J4MA 3SKMA 3M8OH 1FG2B 1S7UA 3VE0B 5CLTA 3TBTB 1MJUL 1NLBL 5C0AE 4FQPA 1AXTH 4HWBL 1TQBC 3FN3A 1QHOA 3DSFH 2FJHA 1X5AA 2AJZA 3QUZB 3CC5B 4MAYD 4OCSH 3X14A 4Y2DA 3MOAL 5KVFL 4ODXA 4OGYH 4PY8J 4F15B 1LHZA 2HT3D 1PKOA 1SEBB 1AXSB 3JWOL 3HZMA 5CSGA 1KTDA 4F9LC 4JY6A 2IMMA 2WSKA 3SDYL 3QIBB 4HPYL 4N90D 5A1AA 4A2LA 3UPRA 3HHRB 3H9ZA 5D7IE 1FBIH 5FGRA 1QSVA 4D3CH 2KL6A 3BIAX 3DIFB 2X41A 3QIUD 1K2DB 4PRID 3WFHA 1OAUH 4ZUUA 2Q3AA 2ICEB 4UT9H 4XP6H 1JGLH 1HHJA 1BJ1H 4YK4C 1KCUL 1DFBL 2C1OB 4GAYA 1TITA 5FAAA 3P30H 2NNAB 4JE4B 3O41A 4M6ML 4KUCF 4MAYA 2RGSA 2N1KA 3DVNB 1ORQA 5IB4B 4NPYB 3ME0A 1H15A 4PGZA 1FZKA 5F7DA 5JOPE 5J06A 2BC4B 1U3ZA 3UTZB 3MNVA 3UP1A 4PJBF 5DA4A 4EUPG 3WV0A 3H9SE 3O45B 2D03H 4LVOC 4J12A 3QIUA 4UIMB 4BSWB 1BFTA 5L2JA 3MYJA 1N6QL 2OMBA 2SEBB 3IF1B 4BKLB 2MQ3A 3NCFB 5C0IA 4LPCA 5I1KL 1ERNA 4NN5C 5FB8A 4OAWA 1AGEB 2HKFH 4X7DC 3OZ9H 3QQ4A 4MQSB 4Y5XC 4GMSH 1IGML 4L9LB 3U4AA 4J8RA 3JV4B 12E8L 3NZHL 3BW9A 5D8JL 5IOPB 3ES6A 4KPHL 2Z8SA 2YMXL 5E0QA 3QWOB 5LJYH 1MI5D 4JAMA 5JA9A 2A83B 4LVHB 4D9QD 1IC4L 4LAQL 4ACPA 4MHHG 1LD9B 2WBJC 1NEZA 2VXVH 3OV6A 4NIKB 3DYPA 1IAII 2G60L 1D5ZB 3GGWA 2YD9A 4P46D 5DMJB 3D39B 3C09B 3V0AC 1PBYA 1N5YH 5C3TA 3DI2B 2N4IA 1YMMB 4KI5C 2R1YB 3SE8H 3MRGB 4G6KH 3TYFA 1XEDA 2DDQH 3U7WL 1JHTB 4WENB 2W9LA 4PJXE 4MA7H 4KDTA 1Z9SA 1NQBA 4GMTH 3RNQA 5IT2L 1MI5A 3B9KC 2Z93A 2MHAA 1K85A 2DQCH 1KB5A 3QDAA 4M6NH 1ADQH 1SBSL 4I1NB 3WD5H 2P5EB 4NM8L 1ZWIB 3OR7B 1AE6H 4LLVA 2ATPB 4MA3B 2J4WL 1G1CA 2BVEA 4HLJA 3RUGA 1OT1A 1DQMH 2OZ4H 5HD8D 1R6VA 4YNYA 3BVNB 3C08H 4JFOB 3GMNB 1KIPA 4PJ9D 3ZSSA 2V5SA 4P46A 4AEIH 1F3DJ 1L7IH 1TVBB 3EOAB 4NCC1 1AR1C 2E7MA 2GUOB 3MV8D 3RPIB 5D5MA 4NGHH 3EGSA 1DBKL 1MFEL 1I1FB 4PGEB 4RISL 4UV7L 4ZO8A 3KWWA 4IRJC 4NQDB 4RMWA 4XT1C 2QSCL 5CKAA 1A6UH 1HE7A 3BKJH 4OLXH 4QRPD 1E6OH 1DUYB 1FPTH 3IFPB 4OZ4B 4XNYL 3MRNA 4X6FB 4YXKH 4OF7A 3B83A 2RQ8A 1E4KA 2JF1A 5FHBL 4XP9H 4M8VA 4U6YB 1QBMH 4Z78B 3HCVA 4P2QD 3WDHA 5KZCB 3NVQA 4PJ9A 5FUZL 3BZFA 1U8IB 1PY4A 3F7YA 2AV7A 3RDTB 4U1JA 4XRCA 4FZ8L 3ULVH 3GM8A 4P2OD 5T1KD 4EI6B 3MV8A 3F65A 2PXYD 4XZUB 2NY4B 2CLVB 3RIFK 1X5YA 1HOCB 3BWAB 3WE6A 2DMKA 4QRPA 3MACH 4NBXB 1FHGA 2O5XL 1NSNH 5CILL 5DVLA 2UWEA 1NCNA 1U95B 5T5NF 1T0PB 3BZDA 4Z7VE 3QNZB 5M95B 4P2QA 5CBEB 4HC1A 3VWJA 3SDDD 1IGJA 4XBGA 1FYTD 3BPCB 5IGXL 2NMSA 4P2OA 5T1KA 1CZ8L 5IF0B 2PXYA 4GKZB 3P0VL 4TVSa 1OD7A 1MCLA 2AJ3A 4PGCB 1FO0B 4X6BA 4XTRD 5CEZH 5ADPH 3IT8D 2CDFA 2ZPKH 1A64A 4HBQA 1UYWL 4ETQA 1KLGB 3SDAD 1HXYB 4X9FA 1VKXB 5CJXC 2D7TH 1MRDH 1LDPL 3GDBA 2F8XC 4HEPG 1MHEB 1OW0C 5FHAH 3P2TA 5EU6D 2OL3B 4OZIB 3FL7A 5HHXL 3WNNA 2VN4A 2O61B 1MVUB 2NW3A 3T2NH 3SDDA 2NX5E 3TESA 2D7NA 1FYTA 4IIQC 5HHMD 4IOIA 4ODTL 3ZDYE 3LEXB 2OBGA 5KSVB 1OSPH 3V6ZA 2XNAA 5E2WH 5DK2A 1DQDL 3MLRL 4JFYB 4KHXH 4NN7C 3REVB 5DEFB 1B0RB 3IDNB 3EDFA 5DGRA 1VDGA 4YDJA 1RD6A 2E7HA 3SDAA 1HDMB 4NO3A 4OCRH 4HULB 5HTSA 2HTKC 4PREB 5FOJA 4YHNB 3MRMB 4K7FB 1YEIL 1DN0A 4YX2H 2VAJA 1DBMH 2NY2D 4QOKB 4TNVK 5K9OB 2CPCA 5FKPB 1ZGLA 5ICYB 2DM7A 2F58H 4ONHB 3RY5A 4OGXH 5D6CA 4KI1A 1FAIH 3MR9A 2BP3A 3QRFM 2I9TA 1S7QA 3L5JA 5EZJB 2AAVA 2Q86A 3FOMA 5MENA 4YGVB 3P9LA 3QZWB 5JPMB 2MKLC 1A3RL 2E3VA 1IGCL 5C0GA 1S5IL 1N3NA 2F54B 4Z0XB 2X4PA 4K9EL 3W39A 4BA8A 1MCWM 1G6VK 1S3KH 5HY9B 5HBBA 4OCXH 3NABH 1RJYB 4CMHC 2R8SH 2VABB 5IM7A 1A6WH 2HT2C 5DEZA 4BJLA 5IROA 1WWWX 1KPRB 4N0CD 4HFUL 3M07A 4F8QA 2EDTA 3NZ8B 4YEEA 5HYSG 4CVUA 4IRZL 4HCRH 5EBLB 3G04A 2HJLB 4Q6IA 1ES0A 2CIIA 3HR6A 4G8EB 4WTXA 3BISA 3EFFA 1NDMB 4LIQH 1OB1A 4Z8FL 3RUGE 2BK8A 4ZTPL 3FTGB 4XWOD 4HPOL 5KSBB 3WEXA 4HWUA 3HN3A 2X4QB 5KANI 2Y72A 2ENYA 4Q0XH 4G3YH 5D5ME 3PL6C 1NGPH 3PXHA 1ZS8B 4IMLB 4N9OB 2JCCA 3TPUA 1JTPA 3CXDL 1BQHA 4YHOH 3UTQA 4FQCL 2LV4A 2BFVL 5AAWA 1GC1H 1KN4L 1NAKL 3ARTA 3QDGA 4UT7H 2DIBA 3RGVD 2EDHA 4XMPH 3BP4A 5E8EB 5MEPA 2Z8RA 3H9HA 1XGQB 3LCYA 4U1MB 3EYQD 3I6KA 5DWUH 3MJ8B 1NCDH 4FFZH 2CD0A 3WN5B 1NFDF 1TFHA 1JZ5A 2FR4A 4LBEB 2AK1H 4PJIA 5D9SB 5I1LA 4OZHB 3RWGB 3W9DA 2C3VB 4H1LA 1Z6JT 1MELA 4XCYA 3O6KL 4QRPE 5H94A 4ZDHA 3UTPE 4PUBH 4JB9L 4OZFB 4ERSL 3G08B 2C1PA 3D25B 3RGVA 1JWMA 1Q94A 5H35B 3HNVH 2X2YA 5I2IA 4LARH 2J5LB 2UWEE 3QNXB 5IV2A 4MQ7A 1ZHKB 2DI7A 4OM0H 5DJZB 4P2QE 2DICA 1UB6A 1A7BA 5GJSH 3D69B 4DN4L 1P6FA 5EZLA 4U7MA 1NC4D 2YN3A 4MJID 2YD2A 5TGBB 3FO0L 4L4TB 1ZT1A 1MHCA 1I3GH 4Z5RA 3UTOA 4S1RL 4RMTA 1XZ0B 4YBLC 3U1SH 4WFHE 3VH8G 1UJTA 4EI5D 3L5XL 3LSOB 5IFJA 4Z7WF 2B4CL 1CXKA 1T21B 2OTWB 2CK0H 2PN5A 2WW8A 4XVTL 3DURB 4P99A 2ED9A 3N1PC 1TJIH 1TQCC 3SO3B 1FYTE 1NC4A 4RFNC 4MJIA 2Z8VC 5TE6H 1MJJA 3PGCA 4JHAL 3SHSA 1F4AA 1U8HA 3I9GH 1NBQA 4NKOB 2YD3A 4PJAB 1BFVL 2MQ0A 4LMQI 3VG0L 4G7VL 3U48A 2D31A 1HKLL 5E8PA 1Q1JL 3EOTH 3EYUL 2X7LB 3CFKB 3CXHJ 2WK2A 1OF2B 3GMPA 3QH3A 1CL7I 4EVNB 1N5AB 2Y5TB 1FVDB 2PF6A 2MCG1 4OF8A 2QL1A 4GRWF 2HLFD 4WW2A 4K3HA 5LWYL 5GZND 1JZ8A 5GGUA 2VIRB 5I8CA 2BOCB 2K3TA 1LE9A 4QHLB 4OUOA 2ILLA 5HHME 1FIGL 2VAAA 3VFGH 3VXSB 4X4XA 3DMMB 5J3HD 5K9KB 3FO2A 4MCZA 4O58H 3TBWA 3DX9B 2ZP0T 1P7QD 2LAAA 3ALPA 1FNSH 5T3XD 2CUHA 2J3SA 2BDNH 5MENE 1YNTB 1A9BB 4MAYC 4JCMA 3C60B 3LEVL 3FQRB 5D7KE 4RBPH 3H7BA 3OKNA 4HWEL 2QADB 2ZNWA 3X11A 2B1AH 3VMNA 3K2MC 2JLLA 5IVXE 4MS8C 2AXFA 5FA4A 4CDGC 3MRJB 4X6DF 4OGAC 3MXVL 1NDGA 1V7NH 5IVZA 4NZDA 4U6XB 3MA9H 4BH7B 5D7JD 2BNRA 4JJ5B 1WZ1H 5I76B 3KYKH 3GSNH 3ULUC 1OAZL 4FTVD 4R90L 3S34H 3WFZA 5SWQB 4NJ9L 1P7QA 5KS9B 4UTAH 1JPFA 2BSED 1A14L 3C5ZD 2YBRA 2YZ8A 2H3NA 3LB6D 4W68A 3TNMB 25C8L 1MHPL 2W9EH 3U83A 2AJYH 4MAUL 3P4MA 1CT8B 3WUWB 5F71A 2X10A 3LV3B 2X9XA 4X8XA 5C70A 3NACH 3TGXA 3W11D 1HYSD 4LHUB 3QDGE 5TDOB 1HYRC 5F7UA 1QKZH 4M7LH 3UXFA 4ZO6A 2J2ZA 5ACMA 5B38B 4YDVB 3MRKA 2BMKB 1B0GB 5KN5A 4LSTL 4X80L 5DURB 5DRXA 3C5ZA 1MAKA 4NNXA 1BBJB 3S4SG 5L2KB 4NFBA 4ONFL 5I1AA 4KQ4L 2MQCA 1IRAY 1ED3A 2VSDA 3HUJF 3BD3A 4I18C 5LGJA 5TQ0L 1ZA6B 5CBAA 2J6EA 2X1PA 4WI3A 4JREC 1AD0B 4X9GA 4F7TB 5E70A 4D0BB 2ZUUA 3QT2A 3C6LC 5EOTB 1NCCH 2B8OT 4M43L 4PJEE 4NQEB 1CD8A 1JNHA 3MBXL 1ZSDA 3V5HA 4YHZH 4DAGL 1G7MA 1MWAH 1WISA 5EFIB 1NANH 4PJ7F 2FBJL 4XVJH 1JHKH 4Y5VC 3UBXI 3H3KA 1GIGH 3TO4B 1K8IB 1HSBB 1AD9B 5SX4I 4QWWC 1FGNL 4N8CH 4UOJA 1FL3A 3RZCD 1U58B 1U91B 5DYOB 4I5BA 1BIIA 2FATL 4N0UB 5CEYA 4EDXA 4KROB 4KAQH 5IKCB 4XNQB 1RJLB 2DMBA 3RX5A 3O6LH 4NT6B 2MTPA 4PJ9C 2B20A 4MDJB 4XMLL 5CJ5A 1KC5L 4QF1A 4I4WB 3B43A 4ZFOA 4K23L 3CX5J 1T6WA 4MJIE 5LAXB 3BKML 4XPBH 5T1DL 2H8PA 3T4AA 4MX7B 4O02L 4QTIH 5T1LB 2Z9TA 5T3ZL 2FL5A 1KCSH 4BH8A 2ZG3A 3IDMA 5J11C 2VISB 4KTDL 1NGQL 5AG8A 2UZXB 4F9PA 2VB5A 5KANG 1JWUB 3ZZ1A 3WNOA 1Y18A 3PJSB 4LIQE 5B4MD 4WI6A 3FAWA 1WIPA 3BH8A 3BN9C 2B1HH 3VMOA 2GSGB 4TQEH 1JN6A 3C5SB 4JLRA 1I7ZA 4U1GC 1R0AH 2X1QA 5B39G 5IEHB 1GCFA 5HHPB 3U4BH 5HPMB 3NPSC 3QPXL 4U1IA 3BH9B 4WEUD 3NA4A 4QHMA 4W70A 3EOBA 1S8DA 1DVFD 1T6VN 2GY7B 4PTUB 5DLMH 1RZKC 3H9YA 3OKLB 1WAAF 4OF5A 3REWA 1CLZH 2ARJB 2VZSA 3OJDB 1D5XB 3N1GC 3W5NA 1U8MB 4M7LT 2D9CA 3W2DH 5CJBA 1TZIB 4G43B 3I02A 3SDDC 5I1DB 5JO5B 5HYIA 3QR2A 1Z9OA 3TYGL 3QJFA 2VXUL 3D0LB 1I1RA 2BNRE 2ITDB 3IAPA 4QRRB 1HH9A 1KPVA 2G75B 2H2PD 5IJVA 2I9LB 2R23B 1DVFA 4YHML 1UXWA 1FVCA 1KJ2B 3SDAC 3LQMA 4RDQF 4KQ3H 5CJOL 5BZWB 3GZKA 4AH2B 5FO9B 2L4OA 4BZ2H 1YNKL 4Y16A 2AEQH 1UEYA 4GG6A 4GBXC 3FFDA 1UM6H 4YR6B 5C0AB 3VFPB 4P9ML 4LKCB 4NO2B 3S88L 4ZNCD 1CD9B 4HAFA 5CINL 4B5EA 4FQLH 5DJ8B 1Q0YH 4QRSB 4HIHA 2Z4QB 2OX5A 2OS7A 2OMNA 5L0QC 4TUJA 2OQJB 5F3BA 4G6MH 2AI0L 3L3OA 3VFNB 1NBYB 1ETZA 1BHGA 3MCKB 5HGAB 2NY2C 4RA3A 1A7PH 3C87A 3WKML 5LVEA 3TN0C 2DQHH 3ZO0A 1I3VA 5IEKB 4KKCC 4KJYB 1EO5A 4F3FB 3HR5B 4XB8A 1CYGA 1F6LL 5I1CL 3IFNL 3HMWH 2KBGA 3B6SA 4NYLA 5C3LD 1LNUB 4DGIL 3NMEA 1FQ9C 2R2HB 5GZOD 3BAEL 3DXAE 5IW3A 1CXHA 1XF3B 3AB0B 4EDWL 4ODHL 3QSKB 1P4IL 1CD1B 2BVOA 4XBEH 3DX8A 4PR5A 3V7MA 5DUPL 4S0TD 4Z7OF 1M4KA 3ZSTA 3H9SB 3UZVB 2I27N 3ARYA 3RWHB 4P5KA 4Y5YA 2FHFA 1DL7H 3F5WA 2VDNH 1A6AB 1AQKH 4P3DA 5EBMB 5HHQA 3FT3B 3GSVA 1A7OH 1U93A 2IC2A 3ARFD 1Q9WA 3E3QC 3NN8B 3U9UB 4OSUH 4ZPVB 2J1KA 1A2YB 3GSXB 4P57A 4DGVL 4UU9B 1D6VL 1K6QH 2NY1D 4WEBH 2DWDB 3N06B 2ZOKA 3MODH 4KK8D 4JFHD 3TIEA 3GKZA 3VG9B 2EDWA 3TZVB 4LSVL 4FQIH 2V7HB 4CU6A 4MB5A 1CG9B 4ZAKB 3CDGA 4LSUH 4S1QL 5C9JA 3HAEG 4LSRL 1CGSH 4LVNB 1EEYB 2Q1EA 2HA1A 2IQAA 1MCJA 3VGAC 3GUTB 3RWIA 3QWRA 1LWRA 2A2QT 2JTDA 5C0EA 5D1XB 5I75B 1J0KA 2EDJA 2X89D 1EJOH 9CGTA 5FUCE 2X4SA 2R0KH 1HZHH 4H5SB 4AK1A 4LLUA 3VH8A 5F88A 3HFML 4PJXB 4UUJA 2Q6WA 2GTZA 2R2CA 2O5ZL 1T03L 2V17L 3RFZC 4I0KA 4L4JA 1FLRL 1RJZB 4PY7A 4XCFH 1QFPA 1QSEE 3OX8B 2NXYB 5HHNA 3NA9H 4NWTL 1NCBH 5D70L 5CCKL 3E8UH 4H0IA 2X89A 2D2OA 3QG6B 3VFTB 3HE7A 2CKNA 4YPGB 4KI5E 1J05A 1GGTA 1W72A 1LO0H 2OP4H 2IPKB 2ZUWA 5AUMB 1UWXK 5FA3A 5BZDA 1I7RB 2VDML 4LLMB 3TIDA 1NCWL 3ZDZF 4PJ8B 4DVRL 3TC9A 4GSDL 1FZJB 3FMGL 2DLTA 35C8L 2R4RL 3JZ7A 1UVQA 2YA1A 3GHEL 5D6DA 3WNKA 1T7YA 4EI5C 4X6CF 3PHSA 5FYJU 4KZDL 2R0LL 2VDRL 3CAFA 4P3WA 1VACA 5CZKA 2B5IB 3GMLB 4XPGL 2OTUA 3CJJA 5DZOA 5GGRB 4XX1G 3UBXG 4GG6E 4RGND 3P11H 1SJVA 4LRNL 3LZFH 3SKMB 3GNML 3HPLA 5TE4H 1NFKA 4HIEA 5CZVH 1S7UB 1UJ3A 4UDUA 1O7SA 2J8UF 3BD5A 3GBNH 4TNWK 5AG9A 1V7ML 2V9RA 4Y4HD 2FJHB 4N68A 2AJZB 3RQ3A 3L7EA 3I85A 4AEFA 1J1PH 5FXCH 1I9IH 4Y2DB 3X14B 1AGDA 4ODXB 4WWKD 2FRGP 1J11A 3WKNA 4LCUA 1B88A 4X6EA 1CK0H 5DEGA 2CUIA 2VXQL 4WO4D 4ALAL 1OAYL 3C2AL 3UPRB 4PJFA 1XGPA 1QFUL 2HLFC 4M7JL 3WFHB 4U7KA 3RKPA 3P4LA 3O6MH 2F8VA 1J1XL 1HHJB 3ULUH 4GAYB 3WJLA 5F70A 1A4JA 1VEPA 4Y4HA 4FFYH 4KK9D 1D5MB 3O41B 4ZS6C 5J3HC 4PRHA 2WMPA 2YS4A 2OK0L 1ZEAH 1EX0A 4PLOB 4WWKA 2FYYB 3DUUA 1H15B 3SE4C 1VGEH 3NGBC 1CVSC 1FZKB 1V3MA 5F7DB 2WQ8A 4LEOB 3FQUA 3K4DA 4X4ZA 3CMOL 3NAAH 4XC3H 2ZOLA 1RV6X 3MNVB 3NBNA 3T3PE 4FZEL 3T2PA 1BGXH 5C9KA 1UCBH 2CJUL 4JG0H 3S9DB 2IAMA 4G80A 2VYRE 3QIUB 5F7MC 3GRWA 5HHOD 1N4XH 5L2JB 3MYJB 4NKIH 2XZQH 3BZ4A 5C0IB 4LPXA 5D7JC 3CLEL 3S36H 1MLCB 3QQ4B 4ELKB 4OCLC 4XP1H 1ITBB 5HDOA 4HKZA 5C1MB 5C0CD 1T5WA 2VQTA 4MSWA 5JW5A 1R5VB 4J8RB 2NW2A 1JPSH 4HS8L 3IKKA 2WBWB 3ES6B 1O5DT 4M93B 2R1XA 5DS8A 3TV3L 5GGRY 3T0ED 3LB6C 1EHXA 1KACB 1HKFA 4JAMB 4H20H 4FQXD 4E5XA 5T1MA 2P48B 5HHOA 4TVPD 4TYUA 4U1NA 1NEZB 1YEHL 1GHFH 4NQCD 1M05A 3W11C 3AS3A 4U1SA 1HYSC 3GGWB 1WEJH 2F19L 4KRLB 5J7CC 4PRBB 5BV7C 2FX9L 3RNKB 5C0CA 3OPZH 3O3AA 4JZNA 3TYFB 6CGTA 2AK4D 4JFHE 2V2XA 1EEUA 1KBGL 2CXGA 4QXWA 3O9WD 1OP5K 3T0EA 4JEGB 3RNQB 4NO5A 3QXUA 1IEAB 5GISL 2MHAB 2A77H 1KB5B 2EIZA 4OF0A 3V5KB 3DSNA 5C92A 5HHVH 5DMGD 3RUGB 2PTTA 2BY2A 2W60A 4YNYB 1DBBL 4W4OA 4K7PH 3O6FB 1EGJA 1YN7A 4G7YL 3LS5L 4NHCL 1Y0LB 2IQ9L 3X3FL 5FYKL 1C8PA 5D5MB 3EGSB 3CK0H 4DQOL 2AK4A 4K3DL 1P1ZA 3KWWB 4H0GA 3VXPA 5F44A 1YDPA 3O9WA 1CFQA 5L7XH 3MRNB 3U30B 4G9FE 1T7WA 2OI9C 1IC5L 2V5TA 4NNYB 2GT9A 1WSST 4ZOEA 4XPTH 3FZUD 3KYNB 2R4SL 2E6JA 3LOWA 1G7PB 3Q3GA 3SE9H 2XXMB 4YBQD 4F9PC 3RZCC 1NBZA 2AABH 4X4MA 3BZFB 5D1ZD 3QHTC 3V5DA 3F7YB 5F6IC 2AS5M 5C07D 2AV7B 4U1JB 4XRCB 1R3HA 2HFEA 3UYRL 2VLLA 4HJJL 3EW3B 5EWIH 1BPVA 4MMXC 5C0RL 1JZ2A 1S5HB 3MLWH 1ZHBA 3WE6B 2VXSH 3GSWA 4QRPB 3M8OL 3SOBH 1OTSD 1E28A 1BFSA 1I7TA 4U31A 5D2NE 4NC1C 1AXTL 2UWEB 1RZKH 1FNEA 3DSFL 5E95B 3M17A 4J6RH 4OCSL 4E41E 4P2QB 1FDLH 5GQBA 1MY7A 4OGYL 3VWJB 1IGJB 1WZKA 5D1ZA 1TNMA 3MROB 1H5BC 4U1LA 3KYMA 4OCWH 3DX7A 1KGCD 4V1DD 5B4MC 4P2OB 4PJFE 2H9GA 5JORA 3QDMA 4Y19D 4RGNE 5F6HI 4YHKH 1MFCL 2AJ3B 5D1QD 1QFWM 2CDFB 3QIWD 1HILA 1JPST 1FBIL 5GHWH 5EN2B 4ETQB 4D3CL 4NQVA 1CLOH 4GXVH 1OAUL 1TTUA 1NMBH 4UT9L 4F7PA 4XP6L 1JGLL 1FNHA 3Q5OA 4PRHE 4TULL 5HGGS 5EIIA 5GGVH 3GSUA 2ZJSH 1OY3B 3SDXA 1UC6A 4FABH 4BQCA 3TFKD 2NW3B 1P9MC 4HWNA 3ESUF 1FYTB 4IOIB 1WBZA 4V1DA 4XNUH 4F7MB 4Y19A 3V6ZB 1Z0NA 2XNAB 5DK2B 5KOMC 1UA6H 2FZ3B 1OP3K 5D1QA 1IKNA 4HXBH 4HLZH 1OAXL 4CL7A 3MOBH 2CGRH 3QIWA 4XGZA 3ARBD 4NO0D 4NO3B 3Q2CA 4L3EA 2H2PC 1DN0B 1QYGH 4OCYH 2FSEA 3BRGC 2HKFL 1QPPA 3I6LD 3OZ9L 1ZGLB 4U3HA 4GMSL 1EK3A 4DKEH 3MPCA 5ISZD 3HUJA 1F90H 5HHMB 5HDBE 1K9TA 1DQTA 5KBNC 3MR9B 5HHOE 5CP3H 1S7QB 5SX4H 2Q86B 3IJYB 3ARBA 3V6OC 1U8PB 2J88L 3FOMB 4NO0A 5MENB 1BQLH 1INQA 1T4KA 5E9DA 1X5LA 3HG1D 5C0GB 1N3NB 5C8JB 1EBPA 1Q38A 1OT2A 4O2FB 2X4PB 5C0CE 3MRPB 3KPQA 4LLYA 5CP7A 3ROLB 3W39B 3LY6A 1YMHB 5IVXB 1N5YL 4O9HL 3WFBH 2KH2B 2R9HD 1E4XH 3SE8L 4LLWB 5IM7B 5ISZA 4LK4A 3S37H 5BMFL 4G6KL 2DDQL 1RK0A 1I8IA 2YSSA 3AFLA 5D93B 4LSPH 2ERJC 4MA7L 3G04B 4GMTL 5EOCH 4FRWA 4Q6IB 1ES0B 2CIIB 4Z0BH 2ARJQ 1X4YA 2DQCL 5J0BA 1OB1B 4TVPE 4M6NL 4RQQB 3WD5L 3NIGF 2W92A 1AE6L 4GOSA 5KVGH 5J9PA 4MA1B 5I74B 3GI9H 2OZ4L 1DQML 4J3OC 1AQDB 4G42A 3WEXB 3WLWC 2VE6A 4XP5H 3C08L 3HG1A 4Y1AE 3MNWB 5HJ3A 1FSKB 2AK4E 5GRYA 4XAKE 3HAEA 3GK8H 4S1SH 2JCCB 3TPUB 4K3GA 3UTQB 3BSZH 2VDQL 4N5ED 1YUHA 3QDGB 1A6UL 4OLXL 1E6OL 2WP3O 1FPTL 5DC9B 4OLZH 3TVMB 3BP4B 5I0ZA 4MLSA 5MEPB 1T0NA 3H9HB 2ZSWA 4W6WB 1RUQH 3QXAA 1XF2A 3I6KB 3DTXA 1N6UA 3ARFC 1KEMH 1QBML 3E6HA 3LRHA 4X4ME 1MFBH 4ZXBD 4PJIB 5I1LB 3BPNB 4J3WA 4KK8C 3SGJA 4H1LB 4EBQH 1I1AD 4OZIF 3ULVL 4PB9H 2VZOA 4XCYB 5H94B 1II4E 4ZDHB 3VXME 1FORH 5MP6H 5DMYA 3BDBA 4OI7A 3RGVB 3MACL 1BF2A 1JWMB 5HGHA 3WXWH 1IZKA 3PWPD 3G6AA 1NMAH 2EDBA 3FO1B 4JFZL 5IV2B 1CBVH 3LKSB 1UB6B 1W0VA 5EZLB 3P0YH 5SWZA 2P24A 3MREA 2Z92B 3A67L 1ORSA 3EYSH 4GFTB 1ZT1B 3QDME 1MHCB 1JNNL 5ADOL 3CH1A 3JWNC 4DTGH 4Z5RB 3H6JA 1I1AA 3RA7H 3DV6B 1HNFA 2XTLA 2JIXD 1U8QA 3K7UA 5FYJD 5CEZL 5ADPL 3ZKXB 2NTFA 2XA8H 2ZPKL 4I0CC 4WFGE 5DJ0A 1GRWA 5IFJB 1UZ8A 3PWPA 3BYTA 2D7TL 3BP6B 2FWOA 4P23D 1MRDL 4HUUB 3QDHA 1G0DA 1GPOL 4XVSH 1VSCA 4OLUH 3QEQA 1Q8MA 5FHAL 1OLZA 1NC4B 4MJIB 3T2NL 2H32A 1MJJB 3PGCB 2ADIB 4Y19E 5GS1C 1MY5A 1QRKA 4HMDA 4CU8A 1OSPL 2JIXA 4PJDF 5E2WL 4YH6A 2D31B 4KHXL 4A6YH 5HPOA 2XT1B 3GMPB 4L3EE 3FRPG 4OCRL 2FX8H 3PV6B 4LMQE 1AGCA 3CX2A 5CGYD 1S9WA 5IIEB 2NY6B 4YIQA 4WW2B 3OG4B 1DBML 5I8CB 1RIHH 5KSBF 3UTSE 2VAAB 1A0QH 2YD7A 2VL4A 2ZCLL 2VC2H 3CVHB 2EDOA 3FQNA 4MCZB 3ZE2F 1FAIL 2EEDA 5EG6C 1T7ZA 3VFUA 1C12A 3LN5A 2R0WH 5E9DE 4XPFH 5T3XH 4YFLF 3FT2A 4EUPB 5FUOH 4M3JA 4ZUVB 4AEEA 2XQBH 3H7BB 3OKNB 3I84A 4J4PD 4U6TA 1L9NA 5FYLH 3LIZH 3X11B 4L1HA 2Q8AH 2AXFB 3VFSB 5IB2A 5FA4B 4WO4C 5T5NG 2EDDA 1JWSA 4KKAC 5BVPH 1S3KL 5IVZB 5C6PB 1X5ZA 3NABL 4OCXL 4OZHF 2BNRB 1A6WL 3DUSA 3RHWF 1DANU 5K33A 4KV5F 2QR0A 5GS3A 1G6RH 1P7QB 4HCRL 4M62L 3TPKA 1JPFB 4OLYH 1BZ7A 3D0VA 4LIQL 2YBRB 2YRLA 3KLDA 3CZFA 3HE6D 4J4PA 3KPMB 2EIBA 4DGYH 1AHWA 1CLCA 2EZ0D 4G3YL 2ORBH 1MCBA 4R8WH 1LILA 1SYSA 5GS0D 1CDCA 2W9DH 3RWDB 4UB0L 2F5AH 4DEPC 4YHOL 4AJ0A 3MBED 4PLJD 4WFEE 4JVUA 3ELAT 4UT7L 1T7XA 4FA8A 3MRKB 5ID0A 4XXCA 1J8HD 5BV7H 5DD1H 3W9EA 3NH7L 2FB4L 1OAQH 5EU5A 4ZD3H 5DRXB 3C5ZB 4NNXB 2A6IB 5DWUL 1KB9J 1QQDB 1NCDL 4FFZL 4HH9A 5I1AB 5KSAA 1R24A 1NLBH 4AZ8A 4RGMB 1HSAA 2AK1L 5DJXA 2ATKA 1JV5A 4HMCA 1QR4A 1TVDA 3T0EC 1D3CA 5CBAB 4DOHE 4U1HA 1X6LA 4GG8A 4Y4KD 4FQXC 4JKWA 5EUKA 4PUBL 3MBEA 4KUZH 4PJAF 3OJVC 2QEJA 3DXAB 4OTXH 4LARL 1J8HA 1ZK9A 3FO9A 3U79A 2QTEA 1XGYH 3ZDXF 4F2MA 1JNHB 4OM0L 4IHOA 3FCTA 3UO1H 5SWZE 1G7MB 4HZLA 1UZ6F 5GJSL 2ZUSA 3KPRD 5IB1A 4I2XA 4IRSD 3PQYD 3BP7A 3NIFF 3CFEA 5D96C 3O9WC 1I3GL 1TTGA 2J7LA 3BIKB 1FL3B 4M6MH 4MMZC 4J3SA 4I5BB 2AEPL 4Y4KA 3U1SL 3HS0B 1DQLH 4PBXA 5F21B 3HZVB 4XX1E 1ACYL 5DMGC 5CEYB 4I0PD 5ITFA 1JMZA 2NTSP 2BNUA 1XIWD 3G6DH 4OBSA 5DMIH 3E2HB 1EFXD 3VW3H 4K8RD 1F13A 1KSRA 1CGUA 3RVTD 4HIJA 4BQ9A 2CK0L 1ZLSH 5I0DA 3TA3C 3QEQE 1ROWA 1S7XA 5HYJD 4ZFOB 1D5IH 1FL6A 2CKBH 1TJIL 3KPRA 1T04A 5JXED 2H8PB 4IRSA 3WS3B 1N6QH 2JJSA 3PQYA 4JHWH 1KJ3H 5TE6L 2Y07H 1N6VA 2FL5B 1ZTXH 4BH8B 3IDMB 3MRBA 3I9GL 2X4TA 1WCBA 4P2CG 4PRAA 4P4RA 1V8HA 3E3QE 5DRZA 3EOTL 4I0PA 4S2SA 1N7MH 2EE3A 1XIWA 5KS9F 1EFXA 3JUZA 4JVPA 1I7ZB 5D1ZC 3E6FA 4LSDA 3OB0H 5E5UB 5HYJA 3RVWD 2YEZA 1LK2A 4U1IB 1M7IA 5JXEA 4P2RE 2DJUA 1IJ9A 4R3SA 3S97C 1C7SA 3ZHDA 1HXMA 3EOBB 3VFGL 1QSEB 1S8DB 2QSQA 2XQYG 1OTSC 2GCYA 2WWKO 3HKFA 4KKLD 4O58L 4KTEH 2FEDD 2V9TA 3OKKA 1FNSL 5BW7A 3F7RA 1T1YB 4ELMA 2BDNL 4YLQT 2C7UA 4XCCH 4NUJA 2GTWA 2PNDA 3I02B 2YWYA 5J12B 3K3QA 2B1AL 1SBSH 3QJFB 2EDEA 1HH9B 1KPVB 1JF6A 2QQQA 1IKNC 2G5BA 1V7NL 5IJVB 1MFNA 3UTTE 5I8KH 1L6ZA 1M7XA 1WZ1L 1DVFB 3KYKL 3GSNL 1FVCB 5KSUB 2HN7B 3S34L 4CW1A 2GJJA 1OD9A 4H8WC 2XQYK 1IAIM 4UTAL 1VGKB 4Y16B 1OPGH 4GG6B 2CDGA 4WUKH 3FFDB 2A6JA 4ZYKB 2BOBA 3LVEA 4MXVE 2EC8A 4X99A 2W9EL 2AJYL 3UAJC 4NKMA 1MWAB 5FHBH 4KFZC 1SY6H 1MJ8H 4POUB 1AGFA 3NACL 3LPGA 4WTZA 1KPUB 2IBZX 4LPTA 2FBOJ 3A6BH 3PNWA 3ARBC 4JO1L 1QKZL 3FFCD 5CD5C 4M7LL 4DK6A 4KXZI 4R96A 4TUJB 4X5WB 3L3OB 3UROR 5DQDH 1M6OB 1D9KD 5HDLA 5HYSB 3WIHA 4HXAH 3ZE1E 5IMLB 4EJ1C 1H3TA 3OG6B 2BCKA 3VRLE 5TE7H 1T1XA 2B2XH 1U3JA 1DBJH 1Y6NR 1CFNA 1NBVH 2WLZA 2Z35A 3O4LE 2ZUYA 3LPWA 3CC5A 1KLFA 3B6SB 1L7TH 4NYLB 4QRUA 3EUUA 4X5XB 3VXTA 2F74B 5C2UB 3W0WD 3FFCA 1SEBA 2V5YA 3HMXA 1NCCL 4POZD 4RMSA 1D9KA 2BVOB 3DX8B 3QUMH 4PR5B 2ADJA 4AIXA 3R1GL 1MCOH 5DD0L 3BFOA 3C8KA 4YHZL 4Y5YB 4JG1H 4RMUA 3F5WB 1NMCC 5DK3A 2R9HC 4P3DB 2Y6SD 5HHQB 2JJWA 1U8JA 4XVJL 5I71C 4X83A 1Q9WB 1N8ZA 2C1OA 5SX5H 1LDPH 5CJQH 1BECA 2NNAA 4P57B 1INDL 5JA8B 5D72H 5E00B 1VFAA 4NZUH 5IB4A 3FQWA 3U6RA 1FC1A 2ZOKB 4NWUH 1XGRA 3EYOB 1KENL 4KKBC 3TIEB 2EKSB 3W0WA 1BFOA 4XP4H 3O6LL 5TF0A 4XI5D 3QQ9C 3KPRE 1VFBB 3SGJC 5ITBH 1JL8A 3BQUD 3O45A 1T1ZA 2BSSA 2EECA 5EOQH 3VRJB 5C9JB 4R0LC 4XPBL 1N26A 5CEXA 5TF1H 4RMRA 1A5FH 4O5LH 4JFPA 2IQAB 3DARA 4MB3A 1YEIH 4BKLA 1KCSL 2DMCA 2VERN 4KWUA 4YHPA 3D39D 5C0EB 3QHZH 1AGEA 5D2LA 2M2DA 4BFIA 1ZAGA 3B2UD 1OWWA 3DECA 4ZOAA 1U6AH 3DUHA 3HNSL 2X4SB 3O0RH 3UPCA 4LLUB 3VH8B 3JV4A 3IAGC 1Q0XH 4WV1C 5IOPA 2NY0D 4PD4K 4UUJB 4ZXBC 2B1HL 3CH8A 5HYJE 4TQEL 2GTZB 2YD8A 1JRHH 2Q3ZA 1U36A 3GBMH 3D87B 1R0AL 3BWUC 3BQUA 3QI9C 4L8CB 2P5ED 3U4BL 1V5JA 4KJQC 2APXA 1LD9A 2GI7A 3MGTA 3MJGX 2PYED 1BIHA 5HHNB 3AMKA 5EZOH 4TOYH 2H26A 2Z8WC 4D8PA 1F6AB 5DLML 4LQFL 4O2EA 4NC2B 2Y1VA 4GRLC 3HE7B 4YDIH 1DEEB 3MRGA 1J05B 4NQDD 1W72B 4GLRI 2PYFA 3W2DL 2X44D 5FA3B 4OF6A 3TIDB 1IT9H 3FRPA 4OCMC 4OB5H 4TSCH 2P5EA 1CE1H 3OR7A 3TCXA 1UVQB 5DJDA 4R2GD 4ZTPH 1KJVA 2YKLH 1YEGH 4J23A 2PYEA 1WC7B 4OD3H 3VD3A 1VACB 4JFOA 2BVTA 5I16A 2RCSH 1MCCA 4L1DA 4QCIB 3RDTD 4KQ3L 5LKNA 4IJ3B 3KPLA 4P23C 4BZ1H 1X44A 3HPLB 3RPIA 4HIEB 2LU3A 1RSFA 2YUXA 3CXDH 3MLYH 4UQ3A 4BZ2L 4FQCH 1UJ3B 4UDUB 2AEQL 1VFUA 2LE9A 3B8SA 1NAKH 5A2FA 1UM6L 1I8KA 4PP1D 3IFPA 1KEGH 3F62A 2FJGA 3DVGA 3L7EB 5D2NB 1UWEL 1ZLWK 5IHBA 3AXLB 4F37F 4JQVC 4U6YA 4OKVA 4LCUB 1KXQE 3MLSH 1MCSA 4X6EB 5DEGB 3F7QA 1MCFA 2AGJL 3TM6A 4U33A 2UVFA 2DI9A 2FLBT 3GJEB 4NBZB 4PJFB 1XGPB 3IDYC 1X5XA 4RGNB 1JYXA 5ICXB 4EI6A 3NCJH 3ZTJH 1HIML 4AMKH 3NPZB 3BDYH 1A7PL 3H2WA 3GRWH 3ZKMD 2DQHL 2X70A 3PDGA 1A4JB 1MUJB 1X9QA 3MJ9A 4Y4HB 2EYRA 1N59A 1BWWA 4PRHB 2HFGH 5IWLC 1OP9A 5FO7A 4WWKB 1BJ8A 3DUUB 4LRIC 8CGTA 3QEGH 3HMWL 1JYWA 3QNZA 3FFCE 1KIUA 3EZ8A 5IMMB 3FQUB 3HA0A 1T7VA 1AO7D 4MQTB 1JFQH 1U3HB 4PJ5E 5KVMC 2IAMB 4G80B 5IF0A 5DZLA 4GKZA 1AHWC 2AERT 4PGCA 1FO0A 3BZ4B 4JZJC 5ELIA 1DL7L 2VDNL 4CAGA 1KLGA 1AQKL 1H0DA 3GSRA 3S4SB 3N9GH 4GAGL 1A7OL 4WHDA 4WU7A 1RZIA 2EEAA 4UILH 4HKZB 4OSUL 1T5WB 4MSWB 5JW5B 5BRZE 2IFFH 3ARRA 4QOKD 3W0WE 1K6QL 2OL3A 4WEBL 2R1XB 3P40A 5DS8B 3VXRE 1MVUA 3MODL 1YC7A 4U1KA 4JHAH 2EDNA 1AO7A 3JUYA 3S3SA 4RDQG 3HE6C 5MI0B 3O3EA 4E5XB 4FQIL 5T1MB 5HHOB 5DSCB 5MHSD 4U1NB 3NFSH 2H6PB 5GS0C 1M05B 4U1SB 4LSUL 3MGAA 4WHYH 1CGSL 1BWMA 2PCPB 4OIBA 4PLJC 1B9ZA 5D2LE 1MLBA 3MRMA 5C0CB 2F54D 5EU4A 3O3AB 4JZNB 4QOKA 2V2XB 4GW1B 3R8QA 3RVUD 4MZ3A 3RY4A 5CD3A 4NO5B 3WHXB 1MH5A 5E2TH 4BZYA 2NY3D 5GRWA 5CJ8A 3FN9A 3V7AG 2PTTB 1L0YA 5EZJA 3BUYA 3F6LA 3PF2A 3RRQA 5F1NA 3R06A 4XCFL 1YN7B 4JPWL 4GRWH 5I8OH 4IOFC 5JPMA 1T20B 4ODBD 3NA9L 1NCBL 2F54A 3V52H 1P53A 2AK4B 1P1ZB 3E8UL 5J8OA 2QQKL 5IJKC 3ZYZA 5HY9A 4Y4FB 1B4JH 4WUUE 3VXQA 1YDPB 2C5DC 1CFQB 1RJYA 1QLRA 4X7EC 1N64H 4WRLA 4AL8H 2OP4L 1LO0L 4WEMB 2GT9B 4PG9A 2VLRA 1QTYT 1E4JA 4JHZA 1R3JA 1ACZA 3MX0A 3Q3GB 2I26N 4JY4A 5F93C 5AZEH 1UH2A 4M6AA 5JHDD 3B3IA 3KXFE 1NBZB 2PYEE 4GS7C 5B39B 3L95A 25C8H 5FECA 3V5DB 4HJGA 4JDTL 2NZ9D 1YPZA 2XV6B 4LCWD 4H25A 1R3HB 2HFEB 1XIWC 3ZL4H 2VLLB 2G5RA 4YUEL 4NP4H 3RVTC 2F5BH 1ZHBB 4V2CB 1UQSB 3GSWB 3P11L 3MOQA 5TE4L 2P45B 3VXMB 1E28B 3ZDYF 5CZVL 1I7TB 4X7SH 5JXEC 3GBNL 4HIXH 3CFCH 2P5WE 3CGTA 1FNEB 1XGQA 1FV1A 1XF1A 1J1PL 1I9IL 3F6IA 3ZYJA 1EVUA 1CDBA 2DRUA 4EQ2A 5JHDA 4OKDA 3JV6A 3K81A 2EIDA 1YN6A 5HGDB 3RWFA 2QHRH 4LCWA 1CK0L 2PO6D 2H9GB 5JORB 3QDMB 5D9SA 3RWGA 1C5CH 4UDTB 1CCZA 4NQVB 1TZGH 4FMKA 3V79C 3O6ML 4F7PB 4OZFA 4QXTA 3ULUL 3G08A 4UAOC 5EIIB 32C2A 2AV1A 3GSUB 4H8WH 1S78D 1ZEAL 5IMKA 3D69A 3HPJA 1VGEL 3GJFK 3S36X 3RGHA 3PGFH 1WBZB 2PO6A 1XR8A 5TGBA 1VFMA 4Y19B 3NAAL 4XC3L 2V2WB 3RL2A 2WIIA 5D1QB 5GIRA 1BGXL 1UCBL 4JG0L 4Y5VB 1CFVH 1XZ0A 3QIWB 4XGZB 2CQVA 5GS2D 2ZUQC 1RQ5A 2E7LC 5F9OL 4NKIL 4L3EB 2XZQL 5C0JA 1ODAA 3LSOA 4P3CH 2X4NA 2DBLH 2RJMA 3Q48A 2FSEB 3S36L 3RUGF 2ICWI 3EDEA 1QLFA 3SGEH 3L3IA 4XP1L 2XY1A 3UTSB 1UFUA 1JPSL 3MLXH 1BM3H 1H3XA 2DLIA 1VEOA 1FIEA 1AO7E 4FQQA 3MLZH 3VA2C 4APQD 2DLHA 2VL5A 5D5MF 3VXSD 1CDJA 2NXZD 3DMMD 4M48H 4H20L 5IW1A 4KTDH 4J3UA 4Z7QE 2OSLA 3RJQB 4PJAA 1IL1B 1BZQK 2XOTA 3LAFA 2YPLE 4OLVL 1INQB 1T4KB 5E9DB 1GGYA 5J11B 2R1WB 3QUZC 2X7LA 4ODVH 1PYWB 3QUXB 1HWHB 3HRZB 4KZEH 3F12A 1OF2A 5DI8A 1D7FA 3C60D 5KW9L 3OAZH 1FVDA 1QUNA 4LLYB 3KPQB 5CP7B 4F15C 3JBG7 5E6IA 2QADD 3ABZA 3KYOA 2CO7B 3OPZL 1HN1A 4K7PX 2VIRA 5INDA 3JTTB 3MGOA 1RK0B 1I8IB 2YSSB 3QIBC 4CJ0A 3OAYH 4APQA 1MCPH 3G6JA 4DUWA 3RWEA 2ZUTA 1ZHLB 3DMMA 2A77L 2APTA 3STLA 5ID1B 3CU7A 5MHSE 4UIKH 3INUH 1MFAH 3DX9A 4PFEA 1BVKA 2YA0A 5HHVL 1N0LA 4JRYD 2DKUA 4JPKH 5EU7E 3MRIA 1ZHNA 1A9BA 2UWEF 3AM8A 4K7PL 5HJ3B 4M1GH 1K4CA 4FG6D 3HC4H 3UDWC 3AY4A 3HAEB 4LCCA 4ZO7A 3ARED 3CK0L 4E9LA 4JQXA 1B2WH 1IKFL 1IC1A 2FGZA 5J6GA 4JN2A 4JO3L 4LHUD 4U6XA 5L7XL 4BH7A 3DBXB 2VLRE 5C08E 1T0NB 2ZSWB 4P9HL 2Y6SC 1XF2B 2NZIA 1G7JA 3IETA 4XPTL 2C3XA 4RFEA 4YZFE 3E6HB 2AJVH 4JRYA 2OXHA 4PLKC 1YNKH 5DURD 3BE1L 3SE9L 1YPZE 1TENA 1NFDE 2AABL 2XTJD 3CFBB 4TSBH 4K7PY 4L9LC 3KJ4B 4P9MH 1NEUA 3AREA 4DOHB 3GEWB 4X9HA 2GFBB 3MLWL 5T3ZD 2VXSL 3KS0J 5HGHB 4EQ3A 2BSTA 2PUQT 4LVHC 5TDOA 5F9WB 4QHKI 3G6AB 4J3TA 2N7AA 1QBAA 5L8LB 4YDVA 1RZKL 5DMKB 3RY6A 5JTWA 4J6RL 3MUZ1 4ZTOH 4NQED 5SWZB 1FDLL 2P24B 3C09C 3MREB 5JIKA 4LCWE 4ORGA 1BBJA 1DJSA 2R29H 1A7RH 4TRPH 3CH1B 1OGAA 4OCWL 1I1AB 5AEAA 3CZJA 5IVNA 3CVIH 5C09D 3TO4D 1U8QB 4YHKL 5JIIA 5I1CH 2NTFB 2Z0BA 4KH2A 4LHJB 1LMKA 1AD0A 4D0BA 5GHWL 1UZ8B 4K3JH 4JDZA 2VJXA 1CLOL 4GXVL 3PWPB 4H26A 4WHTA 1NMBL 5EOTA 4EDWH 2FWOB 5IFHH 4Z7WE 5HI5C 1LEGA 5TPWH 1A1MA 5GGVL 3EYFA 1JZ4A 1X5IA 3IFOA 4MNGA 2ZJSL 5HI4D 3ILQC 1H3PH 3QEQB 4FABL 3DVFA 4NQEA 1EMTH 1F4WH 4J3VA 2H32B 5CGTA 4LDEB 4Q9RH 1MSPA 5CWSA 5IVXF 4XNUL 5C09A 3TO4A 1K8IA 1F45A 3V6BR 4I3GA 2W0FB 4HXBL 1P5VA 3MOBL 2CGRL 2H1PH 3BUTA 5DDHA 5BVJB 4N0UA 5SWSA 1C5BH 2ED8A 1S9WB 4W6XB 4YIQB 1QYGL 3ULSB 4X0KA 3G9AB 1BZ9A 4EN3B 1F5WA 1RHHA 3NIDF 2P4AB 3RDTC 2PETA 4DKEL 4EZMA 2APVA 4OLWH 4MJ6B 5J89A 5F8QC 4OT1H 2NY4C 1BLNA 3FQNB 3QFJD 2JCCF 3EO0A 4KC3B 5DFVC 4C57C 2GJZA 5GGQH 5GRZA 4CN1A 3S37X 3VFUB 4PP1C 3LN5B 2I5YH 5J13B 3DX6A 1Z9MA 3FT2B 3WJJA 3K8MA 1U92B 3WNLA 5L8JB 4XNZB 5IB2B 2HMIC 3GJFH 1JWSB 1S7VA 3LS4L 3WFBL 4PJIF 1E4XL 1FFOA 1CGYA 4LQ1A 3S37L 5HHPA 5HPMA 4MQXD 4QRRD 3G6JE 2QBWA 3BH9A 3QFJA 3UTTB 1NAMH 2QR0B 4LSPL 4QRTA 5F7FA 3MRQA 1T89A 5E4IA 5EOCL 3ZKMC 3O3DB 1BZ7B 3D0VB 3SJVA 1IQDA 4M00A 5KVGL 2K7QA 3I3DA 5I1EH 3CZFB 5DRNA 3GI9L 4PJGE 4HKJA 3OJDA 4XP5L 2AEWA 3RVVC 3Q5YA 1LEIA 4LDOB 4OIIL 1QBBA 1AXIB 1SYSB 1UKSA 4G43A 3SQOH 3ZT7A 5JO5A 4P59L 3MTRA 3GK8L 4GSDH 4S1SL 1PJ9A 2A38A 5GS0H 3ZE0E 1QO3A 2K7PA 4CDHA 2ITDA 3BSZL 5D7LE 4QT5A 3W9EB 1KJ2A 5FM4A 5EU5B 1RUQL 4JRYE 4KJWC 4AH2A 4LRNH 1KEML 4I3SH 1MFBL 1BMGA 1PD6A 4KK6D 2X9YA 3KAAA 5KSAB 1R24B 1HSAB 2DYPD 1F3RB 2VSCA 5DJXB 5CIPB 2EXWC 4MD5A 1BJ1J 3TO2A 4EBQL 4NZRL 4LKCA 4NO2A 4PB9L 3O4LB 3ISWA 3QPQD 3DNKA 5EUKB 3MBEB 2OR7A 5MP6L 2CLZA 1R5WB 4QRSA 5B8CB 4MGXA 3TJHD 2Z4QA 3MRCA 1W2KT 1JVKA 5E8NB 3GM0A 2QV2A 3WXWL 2VXQH 3I75A 2LTQB 4F2MB 5JOPD 1NMAL 4JN1H 1Q72H 1QFUH 3FCTB 5FGBC 5DUBB 4C55A 2XTJE 3P0YL 1MCRA 3MCKA 3H9SD 5D7IA 1OGAE 4WW2F 2DYPA 1S9XB 2CDEA 3BP7B 4CNIA 3CFEB 3EYSL 3L5HA 3H8NA 3RVUC 1F8TH 2MWCA 4P2YA 4DTGL 4D0DA 3RA7L 3K8LA 4KJYA 4Y4KB 5T3ZE 1LVEA 1UXSA 1KG0A 2BNUB 2EO9A 2XA8L 3DLQR 2R2HA 2DS4A 3LQZA 4HIJB 4QRQB 1UT9A 4C59B 2NYYD 4MNGE 1OQOA 3KR3H 3WFCH 2CJUH 3GMRA 3TZVD 1FL6B 4ODWB 4XVSL 2YUVA 4OLUL 4X5LA 3KPRB 4M5YH 2YD6A 1YJDC 1T04B 4ZAKD 3H9SA 4IRSB 3PQYB 4LCIH 2BXYA 3B9VA 3RWJA 4YGAB 3T3MF 4HS3A 1EO8H 2FIKA 5C09E 3MRBB 1D6EB 5JDJA 4MNHA 1WCBB 4PRAB 4P4RB 5HI3D 2WINA 1GL4B 4X7TA 2KDGA 1I1YA 3GSXA 2BSRA 5DRZB 4I0PB 5SWSE 4UBDD 4A6YL 3LDBB 5D1XD 1EFXB 1OTUC 2DWDA 4JFEA 1FN4A 1PGRB 5FM8A 4QO1A 5M94B 2E7CA 2FX8L 3CUPA 3WN5C 4Z95L 2NZ9C 2HFTA 5HYJB 4NZJA 3WCYA 3L3HA 4PGDB 1T2QH 5DK0A 4NKDA 1RIHL 5E94A 1M7IB 4ZAKA 5DHYA 4R3SB 1HXMB 2QQLH 1YYLH 1A0QL 5LCVL 2VC2L 2GCYB 4WI9A 3QQNA 5INCB 2XKUA 4LSSH 5IQ7L 3WLBA 5TQ2H 4UTBH 3GUTA 2GEEA 4C83A 3MJ6A 3QBTB 4PPTA 2J5LC 2R0WL 5BS0E 4XPFL 5T3XL 2RAMA 5FUOL 4NUJB 2GTWB 2XQBL 3O4OB 5GISH 3MFFA 1IQWH 2YD1A 5FYLL 3LIZL 4PJXA 5DRWB 1EDQA 2Q8AL 3WXVH 1P7HL 5BVPL 1YECH 2G5BB 4TUOB 2WANA 3QFJE 1MFDH 1RJZA 1CGWA 3LS5H 5DJ6A 4AT6A 1I8LA 5FYKH 3RIFF 4LGSB 3SJVE 4N0FA 1CXFA 4OFYD 4Q9CA 3EJYD 1ND0A 5B3JF 2CDGB 4XHJD 2JJTC 2A6JB 5FDWA 2K9UA 3UZEA 3EDDA 2BOBB 4YPGA 2D4DA 4ZFGH 1FRGH 1ZLVK 4CMMA 4OV6F 3SBWC 3SO3C 4DGYL 1I85A 3T04D 1EERB 1AGFB 2ORBL 1OARH 4R8WL 1I7RA 1LP9A 4L8SA 1MCEA 3ZT5A 1FZJA 2F5AL 1VENA 4GUPA 1CDYA 1D5BB 1NGXA 4KTYA 2IBGA 3AS2A 1CLYL 4R96B 1HHKA 1MCQA 3GKWH 2DAVA 4HAGA 2DQIH 2JB5H 3N85L 4YHIA 4W4NA 3WNMA 1OAQL 4OFYA 5GGRA 4ZD3L 4DZBA 2BCKB 1P84J 1RZ7H 1T1XB 3V7AE 3FB6A 5I9QB 2YHGA 2HYMA 3VI4E 4OQ1A 1CFNB 1RIVH 5I17A 3OMZA 2Z35B 2O93L 5EBWA 1OAKL 3TF7C 3DMMC 5BXFA 4QRUB 3VXTB 1CN4A 4Z7VA 3FFCB 4KUZL 2W0LA 4WI7A 1D9KB 2NX5D 4OTXL 3D2UA 2ADJB 3C60C 4G6AD 1MFCH 4PJ5B 1OOAA 1XGYL 3BGAA 2V7NA 4WY7H 4YC2B 3C8KB 3DHJA 2QADC 3UO1L 1PSKH 4LAJH 1PDKA 1MIMH 2GHWB 5I1JL 2D9QB 3QAZB 3MJ7A 1U8JB 4YDKH 2ZWLT 1N8ZB 4ZSOA 4TULH 4UT6H 1D5MA 1VFAB 3FQWB 3U6RB 1DQLL 1XGRB 2FYYA 3L3DB 1CD0A 5CZXD 2CRYA 3W0WB 4S1DD 3ZKSD 5I8EA 3G6DL 5DMIL 5IB5A 4U6HA 1BFOB 3VXRB 3VW3L 4LEOA 2NX5A 4L29A 1ZLSL 4LNRB 3QCTH 2HT4D 1A3LH 4HJ0D 4OQTH 1D5IL 1OAXH 1T1ZB 2BSSB 2CKBL 3MLTB 1QR1A 2EICA 1AY1L 5CEXB 5TJWK 2YWZA 4JFPB 4JHWL 1KJ3L 2L7UA 2Y07L 1ZTXL 3VU2A 3UJTH 4YHPB 3B9AA 1MLCA 5D2LB 4BFIB 4ELKA 4HMEA 1NUDA 1QA9A 2C4FT 1YY8B 1CGTA 5DFWH 4JFEE 4W6YB 4PG2C 1R5VA 3RY6C 2EO1A 3CMGA 1N7ML 3OKDA 1FCCA 4PP2A 2DD8H 2GSIA 3ARPA 4YDLB 4DKAA 4GG6F 4ZNEA 1VPOH 4FN0A 1A22B 1HEZA 3BQUB 5FM5O 4EXKA 5F7HA 2J88H 3A0OA 3MGTB 4N0YH 2H26B 3O6FD 4BSVA 1WJ3A 4D8PB 1Q9LB 3LEYH 4O2EB 4KTEL 4O9HH 4PRBA 3RNKA 4KRPD 1J88A 5BMFH 4KDVA 1CGVA 4WUUB 3VDAA 2IADA 4XCCL 2NY0B 1T0MA 2PYFB 2UVEA 1TIUA 5DHVA 4OGZA 5GRXG 2Q87A 4DWHA 4YE4H 1IEAA 2KZWA 3OKMA 1NGYA 2WLYA 4XB7A 3CDCA 3WMSA 4W81A 1A7NH 3V5KA 3ZDZE 5DJDB 1X7QA 1KJVB 1MHHA 5E2VH 1WBXB 2PYEB 5I8KL 1UB5A 3LH2H 3QEHA 5I16B 3O6FA 4X6CE 3D1MC 2VITA 4L9DA 1Y0LA 3KPLB 4KROC 4O51B 1T83A 4UQ3B 2XIDA 1OPGL 1U8NB 4G8GE 2VDQH 1I7UA 3Q0HA 4WUKL 4NRYA 1I8KB 2AQ3A 3UTPD 2BX5A 3MZGB 3MLVH 2OXGA 2FJGB 3DVGB 3PUCA 3DI3B 1LP9E 3MJ9H 4NNYA 2P5WB 1SY6L 1MJ8L 4ODUA 3MRHA 3KYNA 4OKVB 4ONGL 4R2GB 2JJUA 3KLHC 1G7PA 5FDYA 5I73B 3FHQA 3VWJD 1DP0A 2GYSA 3A6BL 4M6OH 2I24N 1RU9H 4PIRF 1FVEA 3QQ3A 1OCWH 1YY9C 1JPTH 5DQDL 4M1DL 4HXAL 4YJZL 2ZCKH 1TLKA 3L3GA 4IMKC 1S5HA 4WFHD 2VWEC 1KV3A 5TE7L 2X70B 4JDVA 1CICA 1FO0H 4OFIA 1WCQA 4RAHA 2EYRB 1N59B 4ZUWA 4R4ND 2B2XL 1DBJL 4QTHA 1JBJA 4JFZH 1NBVL 5FO7B 1DQJA 3PV7A 4PB0L 3VMPA 1L7TL 4KGJA 4N1EA 2XACC 3QUKA 3A67H 3KPTA 5E7BA 5ADOH 2OL3H 1JNNH 3MROA 2YXFA 4XPHH 4MJ2A 4HGMA 1IC7L 3QUML 4Q9QH 1MCOL 4UQ2B 1Z0MA 1QSFE 1ZLVH 1BVLA 3N0PB 4JG1L 1MRCH 3OTTA 5EN2A 4ZSOE 1H0DB 3GSRB 4MQXC 4XNXL 5MERB 4EKXA 4WU7B 2G9HB 1RZIB 5E1HB 1FL5A 5CJQL 1GPOH 4RBPK 5D72L 4OUUA 1QHPA 4KK5C 1PKQA 4NZUL 3DETC 3TWCH 1FH5L 4NWUL 2IMNA 4U1KB 1BD2A 2YOCA 5JOEA 1AO7B 2GIYA 3ARDD 1PX4A 3O3EB 4J1UB 5JOFA 3ARWA 2ICWA 4QHUB 3VI3F 4XP4L 5E7FA 4Q74A 4F7MA 1QRND 3WFEL 4HF5H 2WWMD 2FZ3A 1DE4A 4O00A 5ITBL 1MNUH 4YHYB 1EHLL 4HHAA 3JXAA 2UY7A 3D6GA 4PYHA 5EOQL 2YPLB 5TDPA 1QFHA 5TF1L 5JW4Q 5MEND 1ADQA 1A5FL 4O5LL 2BVYA 1MLBB 3RL1A 5D7KD 5EU4B 3O8XD 3EAKA 3QHZL 2DQTH 5FYKE 4RSVA 1U6AL 5KVDL 3O0RL 5CD3B 1PEWA 3AVEA 2ZCLH 1OTTC 3ARDA 1WIOA 4ZNEE 1Q0XL 5K9JH 1MH5B 3U0WH 3OKOB 1FNFA 2IFGA 1JNLH 1QRNA 4U0RB 4QNPE 1JRHL 3VD5A 3GBML 1QACA 2F9BT 1UKTA 5J1TC 1MCWW 1JF1A 1GOHA 3SCMD 3BUYB 1DEDA 4NUGH 3SDCA 3IJYA 5E8OA 5F1NB 3R06B 1U8PA 1Z5LB 1IM3A 1UH4A 3DJ9A 3HLAA 5E5MA 5CGMA 5EZOL 3GSQA 1CFSA 4TOYL 5C8JA 1HK6A 2Q7NA 5F1KC 4FXLA 3W81A 4O2FA 3ZHLA 3O8XA 4FQ1H 5JR1H 3MRPA 4Z7UA 1A3QA 3ROLA 1YJDH 1YMHA 3EHBD 5IVXA 3VXQB 1KF9B 1FZMA 4OV5A 2HTLD 1VESA 1QLRB 4LLWA 4YDIL 4PBVC 1CWVA 4PJFF 3QDGD 4GW5A 4PG9B 2VLRB 2ZSVB 4Q7DA 2NY3B 5C08B 3TVMD 2AQ1A 3U9PH 4QGYA 4M62H 1R3JB 1IT9L 2APWA 2IH1A 4JY4B 4OB5L 2XRAL 4TSCL 4RQQA 3Q1SH 4J3XA 3SCMA 3B3IB 1CE1L 3BPLB 3DYOA 1ONQA 1IARB 2E8YA 3L95B 1DANT 1SM3H 5FECB 2W0KA 4HJGB 2YKLL 1YPZB 1YEGL 1OGTB 4H25B 1AQDA 4C4KO 1NFDB 3E1F1 4OD3L 3O2DH 3MNWA 4GKNB 2FO4A 2RCSL 1GVIA 1P6AB 4HK3J 2Z31B 4JCLA 2XWBA 3VG9C 3P73A 3UZQA 4BZ1L 4PV8A 4UB0H 3TZVC 2E9BA 3MLYL 1MEXL 2W38A 1S9VB 4NQTA 4ZAKC 4HGKC 4GXUN 4YAQA 1KEGL 1HHIB 3TVMA 4DEPB 5FK9A 3MC0A 3NH7H 2FB4H 1FV1B 1IEBA 4LVNC 4R97B 1U8OB 1QZ1A 3EKCA 1DQQA 4LL9A 5JHDB 3JV6B 1M7DA 2PW1A 1RUPH 1YN6B 2Y4SA 3MLSL 1BJMA 2BVPA 1HCFX 3RWFB 2CLRB 3IDJA 1TCMA 2DIAA 4LCWB 4HH8A 4UBDC 4UI2A 5D1XC 5I75C 3T08A 2HWZH 1RJCA 4P4KD 3VWKC 4B0MM 3IAQA 3JVGC 5BQ7A 3NCJL 2XKNB 4AMKL 5HDBF 3ILPA 3BDYL 3JV0A 1CVRA 3D18A 4QXTB 3GRWL 3SGKA 32C2B 2AV1B 4Y2OA 1G9NC 4M5ZH 2HFGL 3FO1A 5IMKB 3LKSA 1I8LC 1X6NA 2NXYC 1WT5A 3HPJB 3QEGL 4PJEA 1IAMA 3NFNA 2PO6B 1XR8B 3OL2A 2Z92A 1S9KC 3RL2B 2WIIB 4P4KA 3VFMA 4NQXB 1JFQL 5GIRB 1URLA 3DV6A 3O2WH 2AEPH 2AJSH 4MZ2A 3SKNA 1I85C 2X1OA 3DO3A 1ACYH 1NCAH 3NCMA 1PQZA 4RMQA 3CFDA 1RZJC 4PJ8C 5C0JB 1CXLA 2VXTL 5GS2H 3T4YB 1GOFA 1RZGB 2GITB 2X4NB 1J10A 4Q9BA 1YQVL 3FKUS 1QVOA 4FXGA 4QXUH 3N9GL 4LEXH 3T77A 3BP6A 5E4EB 2NY6D 1QLFB 2Z91A 3L3IB 4LFHG 4UILL 1PKQE 4HUUA 1JE6A 1WTLA 4LGRB 4O4YH 4YXHH 5F97E 2M8XA 2B5IC 3QXVA 2IFFL 1BD2E 4P5TD 4FQQB 3U36B 1TCRA 4S11A 2VL5B 4XHJC 5IK3A 2ADIA 2XN9A 3MLUL 5IW1B 2OSLB 4WNQA 2VO5A 4LPUA 5JZ7C 5EORH 4JO2H 3NFSL 1C08B 3ARSA 4HCRA 3F12B 4RCAA 5DI8B 3ARUA 4Y2DC 3N1MC 4JM2A 5E6IB 3PV6A 1HQ4A 1A47A 5IIEA 3KYOB 1YEDA 5EPMB 5INDB 4Z7NF 5T5FH 3MGOB 4P5TA 1OVZA 4R4BA 4APQB 2R2EA 2BNRD 2HG5A 3G6JB 3RWEB 1QRNE 3CVHA 2NXZB 3STLB 3GI8L 5E2TL 1JYNA 1BVKB 2NQCA 2VQ1A 2BY1A 5E6YA 4LVEA 3NIGE 4HWZA 3K80A 3MRIB 1ZHNB 4ZUSA 4EUPA 1SJEB 3MRDA 4Y8AA 4ZUVA 1K4CB 2FHCA 4PJGB 5I8OL 2HT3C 5GJTH 1X5FA 4LF3A 4LCCB 4Z7UE 3C5JA 3VFSA 1A6TA 3V52L 5JW3H 2MCPH 1LQSR 4G6AC 5J6GB 4JN2B 2HVKA 3ULVE 1B4JL 4F37K 4WI2A 4L3CA 3SKJH 1ZE3C 1N64L 2GK0B 5D7LB 3QIUC 4AL8L 2KPNA 4Q6YA 3IETB 1G7JB 1WF5A 3EJJX 4RFEB 1ZLUH 3M1BA 4JRYB 1YEEH 3BGFB 3B5TA 5AZEL 1UENA 3LN4A 3SDXF 3GMMA 4F57H 3KPMA 3I2CL 3ZL4L 1OLLA 2BHZA 3WSQH 4M93C 3BPOB 3AREB 3KNBB 4NP4L 2F5BL 2HT4C 4Y7MA 4HJ0C 3RWDA 2IWGA 2BSTB 5IW6B 3P77B 1Q9KA 2CIKB 5JQHC 1BX2B 3KHOA 2RHEA 4JO1H 5CEZE 1GGIH 4X7SL 4JRXE 1JZ6A 5JXAH 4HIXL 1L0QA 5FCSH 4L5FH 3CFCL 3DXAD 3MUGB 1NJ9A 3ARVA 5E99H 3D48R 2P47B 1XF4A 4ORGB 2A6IA 1AH1A 1QQDA 4NRZA 2XTJB 2VDLH 5JIPA 4MJ5A 1OGAB 1HI6A 1NLDH 1KUMA 2QHRL 4FHBD 4J7RA 2MKWA 4GW4A 5E2JA 4KDTC 1C5CL 1YC8A 4DFIA 3T0XA 5F1IA 4JDZB 1TZGL 1MPAL 2DL2A 3MRRB 4H26B 4WHTB 2O5YH 3HNTH 2W1NA 1PEZA 1G7LB 3LRSB 1A21A 5C2BH 1LEGB 3I3BA 1A1MB 3OAUH 3DXAA 5F1OB 3EYFB 1RY7B 4H8WL 3IFOB 4MNGB 3AC0A 4P46C 2HKHH 3R1GH 5DD0H 4F9LA 3JWDC 5CWSB 4JFFA 2BRRL 5K9QI 3PGFL 5KVEH 4QYOA 4Z76A 5C09B 6FABL 4A2MA 4JVWA 2WUBH 1INDH 1YQ2A 3BIKA 4LCYA 3U30C 2FD6H 3PWUA 1CFVL 4PJDE 3RKDD 3UX9B 1E4KC 5DJCA 2APFA 2C9AA 3HS0A 3L5IA 5DDHB 4M03A 3HZVA 1KENH 5SWSB 1UKQA 3T8XA 2P43B 1MQ8A 4P3CL 5HD8C 1EAPB 2DBLL 4X0KB 1BZ9B 3QCUH 3CCHB 1IZJA 1E4XI 4AENA 1RHHB 3K4AA 1KJMB 5HSFA 3AAZA 1SVCP 3LQAC 3MLXL 1BM3L 1BLNB 1WBYB 2XN9E 3MLZL 3QUYB 2ZCHH 3WS3A 3EO0B 4PRDA 3N50A 3RI5F 2GJZB 1QSED 4P9HC 2XPGB 1I9EA 4TN9A 4M48L 2WBJD 3DX6B 5DVMA 4GO6B 4BELD 1RZFL 3GSNA 3HNSH 3A6CL 1WWBX 5BS0B 4NC0B 4ODVL 4M9OA 4KZEL 1BEYH 2WIMA 4PY8I 4Y5XA 3CLFH 4KI5D 3VWJC 1S7VB 3VXUD 4U2ZA 1RULH 3PWJA 3OGCB 4WV1B 1C16A 1FFOB 4P2OC 2PXYC 4Q2ZB 2YUZA 4MD0B 3QFJB 2BNQD 5GSVA 1ZT7A 3FB7A 4QRTB 3MRQB 1KXVC 1LO4H 1QSEA 1MCPL 3SGDI 3MV9A 3QA3A 2WBJA 4UIKL 4LQFH 3INUL 1MFAL 1WZMA 3SJVB 1KJ2H 5IFAL 1IQDB 5KAQG 2C3HA 4TNWF 5DRNB 1T1YA 3G5VA 4Y16D 4JPKL 4HKJB 4OI8A 1AR1D 1LEIB 3AROA 3GMOA 4M1GL 1KCRH 5DA0B 3HC4L 3VXUA 4IRJD 5ENWA 5IMOA 4DCQA 1QO3B 1B2WL 2ZKHL 3BP5A 3B9KA 5IG7B 5AYQA 3S3JA 2BNQA 1VFOA 2BJMH 2Y06L 4XTRC 5EBGA 1GOGA 3WFDH 1EJ6A 4G8IA 4QT5B 4QGTA 4UMGA 5EA0H 1UH3A 2IJ0C 5KSUA 2HN7A 5GGTH 5FCUH 2V9QA 3TT3H 1IM9B 2O26U 1DUZA 2AJVL 1VGKA 1NGWB 2E9IA 5F7KC 5IQ9A 4BUHA 5J1AA 2HAZA 2DB8A 4TSBL 1NCUA 4OFKA 4ZYKA 1TJHH 1HQRB 3S6CA 4MD5B 3TO2B 4DUVA 2VDKH 4IRJA 1UWEH 2X4RA 4C56E 4NFCA 4XC1H 1MWAA 4F80A 2D7MA 2PTUA 4TTGA 4HFWA 2CLZB 1P69B 2KQMA 3MRCB 1E4WH 2YD5A 3I75B 1KPUA 1HWGB 2AGJH 3W5MA 2GJ6D 5ILTH 2R69H 1SMOA 3D85D 4JM4H 1A7QH 4X5WA 2AJUH 2I60H 3OXRB 1M6OA 5JHLH 5GRVL 5HYSA 5IMLA 1HIMH 4LGPB 3TNNB 5D7IB 1FNAA 4ZTOL 4OD1H 1JMXA 2ED7A 2DYPB 3AS0A 2CDEB 4CNIB 3BJ91 4RMVA 3RJDA 2R29L 1A7RL 4TRPL 4TSAH 4D0DB 1VADB 5IROC 3CVIL 3T2QA 4BUGA 1UXSB 1KG0B 4Q6IC 3TBSA 1OM3L 4K3JL 4X5XA 3LQZB 3W82A 2GJ6A 2F74A 4MA1C 3MXWH 5I74C 3D85A 3MCLH 5IFHL 4NCDA 1XAUA 1A6PA 2AP2A 3GMRB 4I8DA 5DTFA 5TPWL 1H3PL 2FECI 4OZGA 4DVBB 1FSKC 4JFFE 1EMTL 2MNUA 1F4WL 3RWJB 4Q9RL 4HS3B 2FIKB 1JK8A 4NKQB 2E8ZA 4MXWL 2MSPA 4MNHB 4GAGH 3OWEA 4N0CC 3X13A 5EO0A 2WINB 2XXCB 3LD8B 4RX4D 4X7TB 1I1YB 3CSBA 3QWRD 3TVMC 2BSRB 4EXPX 5E00A 2DQDH 2HTKD 1KTRL 2H1PL 4OJFL 4JFEB 1FN4B 3EYOA 3L1OH 1C5BL 2EKSA 2VKXA 3CUPB 3FB8A 4XWOC 3U7YH 4LSQH 3EO9H 3L3HB 5DK0B 4NKDB 3BPNC 3QP3A 3FONA 4BYHA 4MNQA 5E94B 1VFBA 3G5ZA 5DHYB 1IAOA 4IIQA 3VRJA 4OLWL 4MXVF 1MCNA 4OT1L 4RGOH 1F11A 1KYOK 2YUWA 5I18H 1G9NH 3WLBB 3DO7B 5GGQL 5AWNH 4RX4A 1UEMA 2X09A 3RGVC 4C83B 1LO3H 2I5YL 2VLJA 1UADC 3V0VA 3KYAA 3EYQC 4HGWA 4HUWA 3VJ6B 1TDQA 1DN2A 3K2UH 4CVXA 3HE7D 1LDSA 1WT5C 3MFFB 4G9DA 2WUCH 3BESR 4G9FD 2VDPH 3EDJA 3U4EA 1GH7A