5IWLC

Cd47-diabody complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
ELLFNKTKSVDFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords 5F9 diabody
publication title CD47-blocking immunotherapies stimulate macrophage-mediated destruction of small-cell lung cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlC00
4GSDL 1LP9B 4GH7B 1QVOB 4NO2A 1NBYB 2BSED 4WY7L 1B0WA 5JORB 2MQCA 4RIRA 4D9LL 2CK0L 4XXDB 5FECA 2G2RB 5F7EH 2DYPD 4LLWA 4Z5RB 3VGDA 3B2VL 4R4NC 5IFAL 3A6CL 1CVRA 1IGFH 1CGYA 2WNGA 4OCXH 1U3HD 3WHXB 5JHDA 4HZLA 1NMCB 4R8WH 4GG6A 3HZYB 3O6MH 2ATPB 4K7PH 5F7HA 3L3JB 4XRCB 1M7DB 2OL3H 3BE1L 5J13B 4YC2C 3B9KA 3L95A 1MHPL 1EXUB 3KGRA 3DVFA 5GGSY 3QG6B 3ROOA 3AS2A 3CDFA 1HQRB 1FZMB 4JLRA 2Q87A 1XF1A 5J1AA 4PJBF 2HVJB 2LVCA 1VDGA 2NZ9D 1F3JA 3OKNA 1T1XA 2DQJL 4PTUA 2CR3A 4WGVB 1HZHL 3GB7B 3NIFE 5BJTB 4JFFD 4U1IB 1DQML 3U9PH 2IPUK 3EO9L 3QA3B 4JO4L 4M1CD 3T0VA 3FQNB 2NW3A 2ZSVA 3OQ3B 1JGEB 2AI0L 3AREB 3S3SA 2DKUA 3DX9B 3PGCB 1S7RA 1UZ6F 1H5BC 4EQ3A 4XC3H 4BYHA 3SPVA 4NQED 4X9HA 1ZSDB 1T83C 3QYCA 1CF8H 5T1MA 2WQ8A 2NXZB 1N5AA 2PW1A 5AYQA 4M7KL 1RUML 3RY5A 4I3RL 4DGIH 3SO3B 1G7IB 3JV6A 3MLRL 3S96B 3S34L 5F1IB 3B9EA 2AJXH 2EC8A 3H7LA 4WW1A 1KCLA 1RJZB 1W8OA 1F3RB 3G5XB 1U8KA 4MD4A 3RP1A 1VB9A 3M17B 5MI0B 1K3IA 3U30C 2ARJA 1A9BB 4JPIA 1S9KC 3IKKA 3PWUA 5ITFB 3PL6B 4LCWB 1UCBH 3T4YB 3E6FA 4X8JA 5FB8B 3UTSD 5EUOA 3I85A 1GC1C 2GJ6B 1R5IB 4UUJB 2VSDA 1U3HC 3ELAT 4XNUH 1NUFA 1A5FL 3JV4B 5FK9A 2LTQB 1RVFL 2YS4A 2ATKB 3DHMA 3OKOB 3CUPB 2HG5A 5HVHC 4Z6AT 5EZLB 1WBXA 3FB8B 3MRNB 1NCUA 4XNZB 4P59L 4GAJL 4FQQB 5FYKU 2ZKHL 2A6IB 3MLVH 4DTGL 4F7EA 5T1KB 2I25N 2AV1B 1BD2B 2NZ9C 2IEPA 3W39B 3VI4E 3ZO0A 4HWEH 3MUGB 5TE7L 3RWGA 4O51A 3D2UD 1JZ8A 4ISVA 4I3GA 1JPFB 3HI5H 5ITBH 4I2XB 4HJ0D 1C5DA 4M1CC 3HZVB 2AJVH 1HEZB 3K4AA 4LSTL 4TSCL 4OZGA 1LQSR 1U8HB 1A2YB 1QBLL 3TT1H 2QL1A 2OTWA 1A64A 1S7UB 4M43H 3RJDA 1BFSA 1JP5A 2IG2H 3OB0K 3Q6GL 3K4ZA 4J1UA 4F7PB 3UBXA 2OXGA 3WO3B 3QT2A 5DD0H 4EUPA 5EPMA 5FYLE 4M5YL 5EOTA 2A74B 1RURL 5GS0H 3S88H 4OAWB 3WMSA 4AK1A 1JGUL 2VXVL 5HHME 5K9OA 5IB2A 3LPGA 3IGAB 4RX4D 3MNZA 3SGEH 1FLRL 4LLUB 1QSED 3G08A 2VISA 3L5WA 3VXUE 4JR9H 4PY8I 1V3MA 1FFQA 4YDJB 2IBZY 4M7LH 1G7PA 1KIQB 4Y5VA 5D5MF 4I5BA 4XXCA 5D7JA 3PWPA 4XP5H 4P2RE 5HYJA 4PYHA 1R0AH 2VLMD 3MGTB 1KN4H 4JCMA 4CW1A 1Z9SA 1EAJA 2EKSA 3MLTB 4MGXA 2P49B 4V1DB 1YJDL 3VFUA 1JTOA 4NJAL 5TQ0L 4PJCE 4AH2A 4Z0BL 2CUIA 2Q86A 3AAZA 3F7PC 4FXKB 2DQDL 5DD5H 3MRJB 3TBWA 5B4MD 1NLDH 3I84A 3GNMH 4FQ1L 3RVWD 1IAKB 3IU4L 3P0VL 5CUSH 3VDAA 3IF1A 2EZ0C 4M6AA 4XPAL 2E8ZA 4QRUB 1JPGA 2Q8BH 3VRLF 3KR3H 1FLTX 3DBXB 3ARGD 1OPGH 1MFBH 5BQ7A 1RJYB 4JFHE 5HGAA 4RFEB 3I6KA 2I9LA 4M4RA 1I75A 4KPHL 2ADFH 4WHYG 1IGMH 1XF5A 4P5KB 5F1NA 2EIZA 3LIZL 2P8PA 4AIZB 5FKAB 5IJKC 4TPRH 1CDHA 1E28A 2J8UA 4HJ0C 3LD8C 1W0VA 4BJLA 2AGJL 4JRXE 4KTEH 2W0PA 4K8RL 1H3GA 1C7SA 3AMKA 5GJTL 4OD3L 5DJYA 1MJ8H 4YO0A 1AGCB 3C5SA 4Z7WA 3QIUC 2FLBT 2ZCLH 5DD1H 1VGKA 4X9GA 4U2YA 2FATH 3G6AA 5KVEL 4F57H 1QLFB 4NZTL 4OUUB 1U8QB 1FG9C 4JY6B 4YQXH 2WWKT 3FAXA 5IK3B 4WUUA 2ESVB 1IM3A 3AY4C 2DM7A 3SDDA 1AQDA 3SDCD 4KQ4H 5J1SC 1NBQA 4XMPL 3K8KA 1F02I 5TFSL 5IM7A 2ZCKH 1XZ0A 4KDTC 1NUGA 1Q9OB 1KG0B 5KN5B 4JFDE 1FV1B 5D4QA 5ID1A 3V5DA 5IBUG 1JZ3A 3ZKQD 4MXVE 2XWJA 4XCCH 4BUGA 1KTKE 3IJYB 4NZRL 4L3ED 1G7JB 3QAZC 3LS4H 4GKZA 3PQYD 4YXKL 5F9JB 2FECL 1E4WL 3ME0A 3MRGA 1LEIB 3RDTB 3QQ9D 2CKBB 2P24A 1FZKA 1YY8A 1CDGA 5KS9F 4IOIB 5C0DB 1PG7X 4LHUB 3CFJB 5AZ2L 1HOCA 4RAUA 1KOAA 5DJDB 2LAAA 3H3KA 2GSIA 1DN0B 5B4MC 3AGVA 2XN9E 1AKJA 3QQ4B 5EH1A 4QRSA 3RVWC 3ZKSD 5CSBA 2CK0H 5LWYH 4GW5B 2HFFB 1N3NB 5E7FA 2R2EA 1KGCD 1OTUD 1MWAA 3FO2B 3QUML 1SYVA 2C7UB 4FQ2H 1RULL 3IXAA 1P1ZA 3ARGC 4EDXB 4WO4D 3QJHB 1OAZL 3BP4B 4KC3B 3A67L 5HYQA 3QRGL 4YDIL 3WO4B 1QFUH 4OLXH 5EO0B 4Y1AD 1RZFH 3KPLA 1ZT1A 1T89A 1WWBX 2XQYG 5I1LB 1HH6A 2AEPL 4LDLB 4G8IA 4WUKL 5E2WL 4O9HH 5EU6E 2R1XA 3PV7A 1AHWC 3W0WD 3HR5B 3FCTA 2NY2D 1HCFX 4AMKL 3IDNA 1U3YA 43C9B 3MRRB 2PR4L 5F89A 1J7VR 5GSRA 4CVXB 1DDHA 5AG8A 2DQJH 1IZKA 3D6GA 3GIZL 3VXPB 4U1SA 3P4NB 1YQ2A 3ORJA 4PJ7A 5EIVA 1TNMA 4P2YA 3CC5B 1G7HA 5E8DH 5IMKB 3L3GA 4LLWB 5F6IB 4HQQL 2R69H 3THMH 3IDIA 3EO9H 1DQJB 4YZFF 2BVOB 3NIGF 1W0WB 3QUYA 4PLOB 1KLGA 3UPRB 4HWZA 3L1OH 5D70L 4YXLH 2ZJSL 2OXHA 5MEPB 3VGHA 3WUZA 3SDCC 1TDQA 4GG6B 4LRNL 2VC2H 4L8BA 4G8FA 4YK4C 3MV8A 1GOFA 4QHUA 2YPLB 4XP4H 3RA7L 5HDBE 1CN4A 1MCKA 2GCYB 4OFVA 3ZE0E 1A4JA 3HC0A 3EZJB 1IMHC 1Y18B 4DQOH 3RWHB 2BY1A 1HHIA 5FYLH 1X4XA 3S34H 5IQ7L 4KZDL 1TLKA 2CIIA 2HTKD 3BUYA 1XF2A 5IFHL 5J6HB 4CADB 1WIPA 3QQ9C 1I9JL 1ND0B 2KKQA 4NQTA 1H3TA 1P4LA 2FH6A 2BOCA 1ORQB 3INUL 5ELIA 4HCRA 3CSYB 4U6XA 5EOCJ 1DBKH 3QDHA 1KXVC 1I3GL 1IJ9A 3BP7A 3NCYS 1KCVL 2W65A 3ARBB 1NFIA 4LVHC 1OTUC 1OP3H 2E7LA 3CFCH 5CJ8A 3WN5C 1RZJL 4MZ2A 5ICYB 5ISZA 1T0MB 5K59E 4PJ8B 3STZB 3BP5A 1SJVA 5T1MB 2CLZB 1I8IB 4WO4C 3VFPB 3EUUA 4WFED 1YQVL 5ENWB 4JVPA 2Y5TB 4YDLC 1RVFH 1TQCB 3M8OL 4QWWD 4Z95L 2HT4D 3T2QA 1SVCP 2PTTA 4WW1B 5CJ5A 5EIIA 1IILE 1Y6NR 4G7VH 3IKCB 4XCFH 5C0BA 4P59H 4GAJH 2PETA 2MOVA 3REWA 2NY2C 1QR1B 1MFEL 5B8CB 2VLLB 4PD4J 4KHTH 4PRPD 3JUYA 3ZTJG 6FABL 4UOW0 5MERA 4KK9D 4PBXA 1KB5L 4BH7B 4CRPA 4K7PY 4LEXL 1ZHNA 1NMAL 3F7RA 4RGNB 1QRNB 4GRLD 3VFRB 3BW9A 1EV2E 5GS0D 3NACL 3VFVB 1JF1B 2DJ4A 4C83B 1KYOJ 4PGDB 4TSCH 4LPWA 3DXAE 1ZGLB 4F7MA 1CFVH 1CTNA 2GT9A 5FK9B 2LU4A 3MRPB 1MVUA 2G5RA 4NC1E 4XWGH 5B38A 1LO0L 2F53A 2FD6L 3TBYA 4PV9A 2EDKA 5FXCH 1DE4B 1CT8A 1G9NL 4Y4HD 2QSCH 5H37H 4WEUD 3TM6A 1JZ7A 2BJML 3C6LA 4HIXL 3VCLB 1EEUA 2ARJQ 4F3FA 4WWKA 1X5GA 4PGCB 2QADD 3NFSH 4JM2A 4ODHL 2HTKC 1UFUA 4M5YH 3VD9A 5C0FA 1RURH 4Y4FD 4JZOB 4PGBA 1JGUH 2B5IB 4IS6B 3RI5K 5I1IH 5E4IA 1YY9D 2ZUUA 4NQXA 1CQKA 2Q76A 4OKDA 3R06B 4RBPH 5DF0A 5HI5D 3UJIL 1CE6A 3HCVB 2HMID 4MSWA 1NGPL 2CDEA 4P3DA 5B39G 5SWQA 5JMRA 2ZWLT 5LCVL 1ZT7B 1VGEL 5C0CA 2DWDA 3QFJB 3BOVA 3LEYL 4JFEE 4Y5XA 5IB3A 2OTWB 1QR4A 2YBRA 1D6VL 2FCBA 4XPGL 4DUXA 3BZDA 4L4VB 3SKJL 4G9DA 1MRCL 3QNYB 5D2LB 4LCUA 5JNYB 3UAJD 2HLAB 1R5VB 3UBXB 4P23A 2JJTC 4QWWC 4BFIA 2PYEE 1F6AA 3NCEB 4CNIA 2HT4C 2YD4A 3WFCL 3HPJB 5EOTB 3AS0A 3HZKA 1CK0L 1J8HE 1XGUB 2FEEL 2FRGP 5JOPE 2XY1A 3ZDXF 1P5UA 1CXFA 2YR3A 1FZOB 3RRQA 3BPCA 3SE9L 2WLYA 3G5YB 5IG7B 4KK9C 3H0TA 4XH2B 4KPHH 5HY9A 3RUGF 2DTMH 3EYFB 4S11A 4QCIA 4GRLC 5HYJB 3LIZH 1A7NL 4XVJL 1JHTB 4F7CA 4LPTA 5GS0C 4PJEF 3RWCB 4OI8A 4H0GA 2F54E 5FM5M 2AGJH 1RAMA 1AO7B 4K8RH 4PREA 1MAML 2EDFA 4G3YL 1BM3L 2VAJA 3AAZB 5GJTH 1PD6A 3Q3GB 4XNXH 3N9GH 1RMFL 5TQ2L 1V7ML 5L6YL 5TDPB 2IBBA 4NQUA 3GJFA 1X5YA 5C08E 4LGRB 4Y4HC 1I7ZB 2F58L 2VIRB 5KVEH 5F7UA 3FRUA 2MCG1 1TCRB 5BZDA 2QADC 2IALA 1LVEA 4FQLH 4R26L 1IL1B 2IAMA 5J3HD 4Y4FC 1WEJH 4JY5L 1IC7H 2N7AA 1T66D 2OX5A 3QH3A 4NUJB 3IFLL 1YY9C 1G6RL 4PP1D 2D4FA 1C1EL 3I6KB 5HI5C 1IC5L 5TFSH 4YXHL 1XF5B 1HHJB 4I3SL 2HMIC 2IBZX 3IXTA 4L8SA 5ANME 1BWWA 4WFFE 1Q0XL 2EIBA 3FO1B 4PRHE 3WSQH 4ZPTA 3DURB 3P9MB 4QRRE 4JDZA 1YYML 1MLBA 4ONGH 1E0OB 4XBPB 4G6JL 5AZEL 3QEUA 4KAQL 1E4WH 4QXGH 4L3AA 3VXNA 3C5SB 3ULVE 2X9YA 4JG1H 3SGDH 1ZTXH 3T8XA 3UAJC 1MAKA 3GSOB 1A3LL 3B8YA 2BNRA 1BOGA 3I6GB 4JZJB 1KUMA 1FL5B 3MUY1 4HIHB 4HF5H 5ALCL 1YUHA 2NY3D 3K0WA 4OI7A 1ZLUK 1EFXB 2V7HB 4UZGA 3QUMH 3RWIB 3UYPA 4KDVA 1T3FA 3SCMB 2C1OB 3BWUC 2AK4B 3SE8H 3NAAL 3QI9B 3MLSL 2HN7B 5KG9A 3W11D 1RULH 3P11L 4LSSL 2C3XA 5ADOL 4H1LH 4IM8A 1S8DA 4OIIH 3A67H 3TZVB 3QRGH 2XWTA 4EDWL 1A4KB 3O4LA 2RJMA 1F4YL 2ED8A 2P24B 4P48A 3BHBB 5E94B 4AMKH 3H9SE 1CDCA 3T3PF 4FZEH 4IHOB 3QIWA 3PWVA 3X11A 4ZFGL 1MNUL 2W59A 2M1KA 2AP2A 3D0LA 5H8DA 5TF1H 3MMEA 1EJOL 3V0WL 5DQ9A 3GIZH 3D69A 3MYJA 2JK5B 1NBZB 3MV7E 5FYLD 2JJSC 5KSAA 5HHMD 5J3HC 3U79A 5DGRA 1T66C 4WU5B 5DRWB 3AM8C 5D70H 3C60D 2ZJSH 3VXUD 1P1ZB 4YHNA 2NY0D 4DW2L 4PP1C 5GS1B 1FN4A 4LRNH 1IZJA 1R3LB 3GMPA 5HYQB 3EFFB 2WWMD 3RA7H 3WS6C 1CL7L 4QHLB 3UPAA 4APQB 2DWEA 4P2RD 5D5MA 3GJFK 4NDMB 4PJDE 5BVJB 1CXLA 1HH6B 4RQQA 5I1KL 4TUJB 3ABZA 5IMOB 5IFHH 5T33L 3SDYL 1HXYB 1I9RL 4HWNA 4DK6A 4PJFE 3NPSB 4Y8AA 3IFNL 2FBOJ 1LE5A 2IPTL 5CP3H 3TN0A 3QZWG 5E1HB 1FAIL 3INUH 1G7HB 4JHAL 5KSBE 4YFLF 1XCQB 3F7YB 2IMMA 2NR6D 4PJXB 3IRPX 5CMAA 4DZ8B 2VLKE 1LO5A 4HKJA 4BQCA 5C0AE 3HMXL 4YHML 1KCVH 2NY3C 3TCXA 5EFIB 1FSKC 2ZG3A 4PR5A 3BH8A 1EO8L 5DJ6B 3EGSB 4P2OB 2XZZA 2MFNA 5I0DA 5I1HH 4QOKE 4JFHD 1RZGB 4NBYB 3W11C 2KL6A 3U0WL 2VRAA 1EPFA 3ET9F 1ZK9A 1HXMB 5DHYA 1N26A 3U0PA 5TDOA 4Z95H 5E6IB 4IDLA 3WDIA 3MOQA 4ZDHB 4LBEB 2VXUH 3QCUL 4JRXD 1BVLA 2MSPA 5E00A 5D6DC 3GRWL 2WIMA 5E08H 1MFEH 3TBVA 2RFXB 3ZSTA 1ZHLA 2DL9A 4KDWA 4OSUL 1T6WA 2JIXB 5ACZA 3T0EC 4OT1L 3VE0A 1KB9J 1MRFL 2P42B 4CGTA 3VXOB 4GG8A 2W65B 3GO1H 2GITA 1IGJB 1JNHA 3KYAA 3LN4B 1SM3H 4JDTH 4OZFA 4OZIF 4DK3A 3C60C 3BP5B 3DRTB 2PXYB 1U6AL 2NY0C 1NL0L 1M7IA 5K9QG 4JFDD 1FVCB 1G0XA 2FD6H 2WIIA 2VYRE 4U05A 4ZUWB 5L2JA 2WWMC 4OM1L 1C5CL 3MRDA 4X7CC 1XIWD 1B0GB 4M48L 2BJMH 3GSNA 1NC4B 2JB6B 3BEWA 1HQ4B 1J0IA 4ZUUB 2FX8L 4MLIA 4XB7A 3H7BB 5EO1A 5DJ0A 5M95B 2AK1L 3FTGA 3UTPE 3TO4D 4GUPA 5KS9A 1H5BA 4M6OL 4Z7VE 3UJIH 2XN9D 1FH5H 1MUJA 1T83A 1KEMH 4X98A 1JYWA 1OGTA 1PKQE 2XTJB 5C70A 3L3IB 2BSRA 2NR6C 4UDTA 3LCYA 3SJVE 4MB3A 4XP1L 3CVHL 2GJZB 5CS7A 3MNWB 1VGEH 2ZPKL 5I1JL 3LEYH 3BEVB 2J1KA 3FB5A 1S9VA 3DX6A 1IRAY 5EOQL 2GY5A 3TPUB 3ULVH 4XPGH 3U4EA 3SKJH 3TBYB 3E3QE 3V6OE 4QTHB 1EERB 1CWVA 2NY6D 1RZIA 1A9EB 7FABH 4CU7A 1N59A 4HG4J 2FIRT 2JELH 1GZQB 3MOAH 5EOCL 3WL9A 2V9TA 5KJRL 5EU6D 2WINB 2DYPA 2QSVA 3E8UL 4K8RD 1BF2A 1OSPH 4HDIA 2CUMA 5E8PB 3TH4T 4YEEA 1MCWM 4I48A 3TWCL 2F5BL 1U3HA 2DI9A 2IPKB 3FB7B 1F45A 4P3DB 3CCHB 4AEFA 4K7PX 3PXHA 5EU5A 1VADA 2FBJL 1A02N 4DVRH 5JA8B 1A7NH 5EBWA 3U36A 1BIIB 4M62H 1XR8A 3DARA 4LPVA 4RDQG 1AI1L 1KCUL 4NOFA 1CDUA 4G3YH 5IW1A 2QQQA 3KLDA 3QWOA 1EJ6A 4X6BA 4WJ5B 5L6YH 2HKHL 2UUDH 4ZSOB 1IARB 3HE7B 4LCWE 1F6AB 3NIFF 4PB0H 1XIWC 4Y2DB 2F58H 1DLFL 4LSUH 1RZ8B 3G6DL 4JFFA 5AD0B 5AG9A 1HWGB 1XMWA 2YD5A 4YAQB 4JY5H 2GJ6E 1YJDC 3JTSA 4OLZL 3QISA 1UG9A 1LDSA 2XA3A 3TO4C 3IDYB 4KUZL 1C16A 3UTTB 1S5IL 3N1QC 3BRFA 1IC5H 3O3AA 4NQEA 1JRHI 1GGBL 4I3SH 2PF6A 2WBJB 4DKFL 5T5NG 5FGBC 1GPOL 2X1QA 1BLNA 4MNQB 2CLVA 2R2CA 4M03A 5D93B 1WWWX 5LVEA 2FYYB 2XFXA 4G6JH 3QUXD 5AZEH 3VFMA 1WFTA 3FOLA 1J1XH 4HH8A 5DTFA 3KPNB 3NZHH 1D6EA 2K1MA 4XPTL 3P73B 5FDWB 1UXSB 1BD2E 2NY6C 4N1HB 2BFVH 3WD5L 5FKPA 2V17H 5A2JH 1A6VH 1K8IB 2EO1A 4HZAA 3OSKA 4MB4A 4KKCD 4K8RC 4I2XE 3UTSA 5IFJA 5C9JB 2ZUQC 3NH7H 1TZGL 1YN6A 1UZ8A 3NAAH 2OTPA 1SY6H 3HAEB 4DVBA 4PG9A 5ADOH 2I27N 4D3CH 5FEBA 3PDOA 3NBNA 1ZVYA 1FFOB 2P44B 2VO5A 3IJSB 3BKCH 2VQUA 1WAAE 5T3ZL 1EUTA 4JDZB 3MR9A 3DXAD 5HI3D 3QUZD 5GRJH 5K9JL 2J7LA 2Q3ZA 1F4YH 1P4IH 3E6HA 5JIIA 1UA6L 2DRUA 3VI4F 1KPUB 4JKKA 1MNUH 3R1GH 4DKAA 4ZFGH 2DQEL 1XCTB 4QXTA 3W2DL 3V0WH 5I18L 1PZ5B 1F4XL 2APTA 4PRBB 2BHZA 4WI5A 1G7MA 2A1WL 2R56L 2YZ8A 3D2UA 5IJKA 2X44D 1ZT4A 1HK6A 2CD0A 4TUOB 4L8CB 3V79C 5ICZB 4Z7NE 3NCCB 1X5AA 4FABL 4ZO9A 3RX7A 3DVGA 3F7QA 3QIUA 2ICCA 1RZKL 1WTLA 3RGHA 4AQ1B 4C54A 1EEZA 2PO6B 3VFGH 4Q9BA 5DXWA 3O2DA 2ADGA 3CU1A 4N1CA 3DI2B 4LCYB 2CLRA 4GAFB 4JFED 1EBPA 2HVKA 4JDVA 3VD4A 2UYLB 2WBKA 5KVGH 5KANG 4I13B 3K1DA 3QUXC 5T33H 3SDYH 5L7XL 1KJ3L 1I9RH 4TRPH 1KSRA 2QJDA 2P8MA 3AY4A 3BZEA 2QSTA 1RI8A 1DBAL 2X4SA 4RX4A 15C8H 1QSEA 2IPTH 5ICXB 1CD9B 2IH1B 2PYED 4KDTA 2NTFA 4NKMA 3T2OA 5KW9L 1PW3A 1D5ZA 2BVQB 5KSAB 3MJGX 4NKIL 1J8HD 5JOPD 4YHMH 4QKXB 4KKCC 5GGTA 1SJEB 3RBGA 3BPLC 2Y25A 3MXWL 3T0AA 3MBXH 4GXVL 4N5UA 4RFNB 4PJCF 3SBWC 2XA8H 3U0WH 4FG6D 3BGFB 3RNQB 1CFQB 4ODSL 2GUOB 3RUGA 3ZDYE 1DANT 5KBNC 3CFEB 3BKJL 4XCEB 4XNQB 2F54D 4PJEA 5HI3C 1AXSA 3QUZC 4NNPL 2ESVE 4QRPD 4NC1C 3GRWH 3FB6A 5DHVB 1T2XA 3QCTH 4OCYH 3ARDB 4JJ5A 2A9NL 4ODUA 3TN0B 1PKOA 5C08D 5LGJB 3NCJL 1NH6A 3ARGA 1GYAA 3VRIB 5DS8A 1F90H 4OT1H 4DEPC 3LEXB 4RAVB 4Y88A 1MI5B 4QHMA 2E9WA 1XGRB 1ROWA 4MWFB 4XAWH 2W60A 4PR5B 1QP1A 4U1LB 4G8EA 3GM8A 5FF6A 4YHIA 5HYEA 1AHWA 4B5EA 5FOBA 3WLBB 1G7LA 1JNNH 4OFDA 4O2FA 1NL0H 3RWDA 4ZFZB 3WDJA 4WFFD 2CXGA 3NA4A 4PJ9D 2AW2A 5TDOB 4PRHD 3C5JB 4OM1H 4KKNA 1C5CH 2VE6A 1HKLH 1LMKA 1TZHB 2YSSB 4QRRD 4LIQL 3L7FB 5E03A 1EO5A 3OAYK 2H8PA 4XP9L 1F11B 2EE9A 2FX8H 3OGCB 1RZJC 3FN0L 3ULSA 3ULVD 1JPST 3K2MC 4OGXL 2AJUH 3D85B 1SHMA 3SDCA 2G75A 3VE0B 1PVHA 1P53A 4NQCE 1IBGL 4X7TA 2QTEA 4YGAB 4MXVF 1NAMB 3MRKA 3BYYA 4XP1H 2VSCA 4D9QE 2UZIL 4GAYA 1JHLH 4TSAH 2DQCH 2YA0A 5I6XC 3ZKXB 5BV7L 4L3EA 4YBQD 3BD4A 3PQYA 4DUWA 5C2BL 5EOQH 2SEBA 1N7ML 1XGTA 5D8JL 5E8EB 1TJIL 4FG6C 4HKXB 1FNEB 1A6ZA 1KXQE 3TV3L 1UWGH 2OL3A 1IGCH 1CIDA 2FR4B 1AGFA 2VXSL 2I60H 4G6MH 3QXVA 5KJRH 2CO6B 3RZCB 1A7RH 1U93A 2E7CA 4LLYA 3DO7A 3KPPA 4PRIB 4F58L 3H9SD 1NMBH 1CLOL 1YN7A 3DTXB 3HNVL 4M7ZC 3AXLA 3TA3B 3WN5A 3X13B 3BMWA 4EZMA 3TWCH 3C5ZB 5INDA 2F5BH 1XF3B 2VMFA 2XKUA 4WO4A 1FIGH 1I3RA 2BVPB 2YPLE 3MV7D 3LDBC 1KLUA 2AKRA 2FBJH 1QSVA 5IJVB 3OMZA 2C4FU 3KYKL 4Y1AA 5MEQB 5HYSA 3TNNA 4JJHA 2BCKB 4HS6A 1AI1H 2WWKO 3W0WA 4AYFA 1FG2B 4UDUA 2ZSWA 3DIFB 1KIPA 4JGUA 3PDGA 2HKHH 1OD9A 1S7VA 4D0CA 1EIBA 4PJ9C 1U8OA 4JPKL 1E27B 5C0GA 4BK4A 1NFKA 3WL9B 5ALBH 1BQHG 4HPOL 1X3DA 2J88H 4HLZG 1Q9LA 1DLFH 2IBGA 3MJ7A 2X10A 1F3DJ 3M07A 1G9ML 3QUKB 3MBED 3O2WH 4LIQE 2APWA 3PG2A 2GW5A 4GFTB 3W5MA 4LHQB 3FJTA 1DQTA 3ULVC 4IRJD 4X6EB 3QXDA 3HPLB 1RSFA 3NFPA 5FUCE 1UKSA 4UI2A 3VFTB 2EDLA 3QJFB 1S5IH 4XVSL 4OM0H 5EO9B 1DTUA 2N7BA 5HDBF 1KT2B 3FT4A 3S9DB 3CIQA 1XR9A 2VLKD 1ZVSA 3ZE0F 4DKFH 5C0AD 4X9FA 2EYTA 2GFBA 1QQDA 4MNGA 4LVNC 1BJ1J 2NW2A 3C9NA 4KVNL 4M6NH 5DR5H 3KYMB 3PWLA 4XX1G 5HI4D 1PDKA 3NMEA 4YBQC 4QOKD 5JA9A 4KVCL 4S2SB 3GSRA 3MUJA 2OM5A 5HHXL 4LNRB 2AABL 1A1MB 4XPTH 3TPKA 1LO2H 1ZLVH 5KVDH 2QBWA 1DFBL 4JPVH 2GTZB 2OCFD 4J8RA 1FVDA 4JQXC 4ZOCA 1YECL 4NN7B 3K74B 1CXKA 2XZCL 2AEWA 1NKOA 1QRNE 3D3VB 4RGNE 4X4YB 25C8L 4NPYB 2A73A 3Q1SH 1W0YT 3FRPG 1QLEL 2DN7A 1EA9C 3VFNB 4L29B 5K59F 5EUKA 1TZGH 5DC0A 3CU7A 5ECJE 2DQTL 5E8OA 5I8CB 1NGXA 1NGQL 3OKMB 1YNTB 4YHLL 2W0KA 1BLNB 4HD9A 2Y36H 2JJTA 2BC4A 1KFAH 1N2RB 4AEHL 4XGZA 3PV6B 3VFMB 4RAHA 4CL7A 5HVFB 4OZIA 4JFPA 1D6EB 3C8HA 4R0LC 4HMCA 4JRYA 4B50A 3KYOA 1UA6H 3FQUA 2R9HD 4PRPA 5FKPB 3DPBA 2DQEH 3GBNL 3V4VH 5I18H 2ERJC 5CJBA 1F4XH 1CTOA 1DLHA 3VGBA 1JWSB 2R56H 1BBDL 4EI5D 5EA0L 4GRLA 2Z4QA 3UTSB 3MBEC 4MAYB 3QFJE 4P2QE 3STBA 3UTPD 1ADQL 3U46B 1WFUA 4IRJC 1Y0LB 4JO1H 4X7EC 5BMFH 4Z7QE 2CKBH 4QLRA 4FABH 4L4VE 1FL3A 4DVBB 1I8KA 2VZTA 4PG9B 3SKOA 5E1AA 4R4FH 1QYGH 5D2LE 2ICWB 4Z76B 3SJVD 5ID0A 4I0KA 2D9QB 3GSUB 4LU5L 4XVTL 2ENYA 4Y4HA 2E7BA 1KULA 4PTTA 5HI4C 2AEQH 4HFUH 3E6HB 4CU8A 2XY2A 5L7XH 1BBJB 4Y4FA 1VHPA 3MSPA 1NCDH 2F74B 2IMNA 2UY6A 2VITB 1JK8A 1OAXL 3TIEA 1G7MB 2QQNH 4M7JL 1AGBA 1L0QA 1L7TL 1VPOH 2H3NB 5KW9H 2ZP0T 4NKIH 5BRZB 3LN5A 5C6TL 4P5TB 2R0LL 3ARED 1H15B 2B0SH 5DEGA 1YPZB 3U6RB 1QBML 1JGDB 1ETZB 5D7KE 1KPVA 1AO7E 4UNVA 3DVGB 3O4OC 5CEXA 3AS1A 4NM4L 2FO4A 4ORGB 2WLZA 2NXZD 1MIEL 1EEZB 3CX5J 5LXGL 5GGRY 4ELKA 3L3HB 5I30H 2Z93A 5CFHA 3BKJH 5IKCA 2X4NA 1FNGA 5FUZH 2FJHA 5C0IB 4JANA 1HHGB 4K3JL 3BZEB 3VXTA 5TDNB 2YK1H 3DYMA 2PYFB 1N8ZA 1E6JH 5FO9B 2IH3A 2A6KB 2M26A 3PL6D 4LCWD 4OCWL 2AVGA 2R9HC 4MD0A 4NQDB 2YXMA 4M8QA 4NKMB 2X4QB 1UJTA 3R8QA 1BPVA 2B20A 1N0XL 2HH0L 4X4MA 4EI5C 5JW5A 1A6TA 3FQWA 2GJ6D 4RRPA 4LSQL 3BIKA 3VWJB 4TTDD 1NMCC 5EWIH 2X4PA 4N0YL 3MGOA 3W9DA 5T3XL 5J13C 3V52L 3UZVB 3B3IB 1MJ7L 4JFYA 4U1KB 4FFZH 4LIQH 3GMMA 2NNAA 4XP9H 2JJSA 4UAOB 3FB6B 1B4JL 3FN0H 4L9DA 4LVOB 1EDQA 5KSVA 5ESAA 3GIVB 4W6XB 5T1KD 1D5MA 3E3QC 3EFDH 4OGXH 1BD2D 1WFNA 3AM8A 5HJ3B 3V6OC 2AK4E 3OXRA 2B2XL 4MQSB 4EIZC 5CBAA 3WS6A 1JMXA 3FQTA 1BZ9B 1F2QA 1R3KA 3FFDB 2EYRA 4G43A 1N5YL 2FJGB 2UZIH 5DI8B 3AREC 3G9VA 2J5LB 1NFDB 2ZOLA 5C2BH 4DGVL 2DAVA 3MV11 3WNKA 3ULVF 4L8DA 1TVBA 3UDWC 4NIKB 1N7MH 5FO7A 2NXZC 3OBAA 4K9EL 4ZPVA 3TV3H 2AV7A 3SO3C 2J4WL 5D6CA 3PWNA 3RVUD 3BVNB 3WIFB 2HKFL 1KJMB 2BY3A 4F58H 2FEEI 2JCCB 5IHUL 2HLFD 4UB0L 4WCYH 3IS0X 3PL6C 2X7LA 2VLJB 3KPQA 4ZUTA 3CXHK 5I1DB 4FNLH 4X6FA 5EDXA 3GKWL 5L9DH 3DX7A 4IEFB 3CK0L 5C0JA 3O3EB 5F3BB 3ZHKA 1LEKA 4G7YL 2J6EH 3HHRB 5I2IA 2OTUA 4NJ9L 5DMKB 3MC0A 1ZOXA 1MFAH 3VDBA 2VDLL 1RQ5A 4MQ7B 1XGTB 5D6DA 4DOHB 1GGCL 4TTDC 4K23L 1YEFH 1A6ZB 3DX8A 3ARFB 2BVEA 2LTQC 1MRDL 5T3XE 4UOJA 3IFOB 4JPKH 2BSTB 1NGZB 1MF2H 4HPOH 3T0EA 4PJXE 1T1ZB 2X4TA 1QO3A 2R1WA 4NT6A 4XNZC 1G9MH 1OSZA 3L6FA 1IAIL 2CIKA 2IJ0C 5DA4A 1P7KB 3IDXH 1A7BA 4Z0XB 3WUWA 3C60A 3VXUA 1IC4H 5E70A 5GRYA 3VMNA 4YUEL 4YDLB 3ZHLA 1RIHL 4LLVA 4Z9KB 1PX3A 2G60L 4LLQA 4P2RA 1K2DB 5IHZA 4ZAKB 1NPUA 2ICES 2GI7A 4NWUH 4G5ZL 4RGOH 4UDUB 4KMLB 4LGSB 1K4DB 2V5SA 4PJFF 2EDEA 1DBBH 3F12B 3LOWA 3VRJA 4PJCA 5HHXH 4U6HB 4Z8FH 3V0VA 3U7WH 1P5VA 1DFBH 1J0ZA 3SHSA 5CZXD 5KSBF 4H26B 3HLAB 2Y23A 1P4BH 4L4TB 1YECH 1U8LA 1S7QB 1H3UA 3EOBA 4AG4L 5MHSE 1HSBA 2ESVD 5CP7B 1QLEH 4UT7L 1FJ1B 2OS7A 1ZWIB 2HLFC 4Z78B 1QHPA 2XPGB 4P99A 4HUUA 5DUPL 5KTEL 3S5LA 4KWUA 4Y5YB 2P5WB 1CD0A 4OI9A 1NGQH 2EYTB 3FHAA 2FGWL 4LLDB 3CFKA 5IB4A 1FIEA 4WTXA 3QDGB 1TXKA 4NNYA 4QXWA 4AEHH 2UVEA 4JRXA 4ZTPL 3LQMA 4OLUH 3RDTD 5FAAA 5DURB 1CXHA 2HJLB 3ILPA 4F80A 1DQLL 4LHUD 3LV3A 4MAUL 2WSKA 3CH1B 3QPXL 5JOEA 4J3OC 3DOSA 3SQBA 1HI6B 3GBNH 1FP5A 1MPAL 1KACB 5HPMA 4UINH 2XTJE 5JW4R 1AY1L 1BBDH 4S1SH 1OT2A 1BFOB 1FRGH 3BSZL 2IPUG 2D31A 5GGUB 1TETL 1F42A 5AAWA 5EUKB 3ECBB 2WUBL 1AGDB 4ONHA 3EDEA 1RZ7L 4NQVA 4NQCD 1LEGA 1B0RA 4FOMA 3BDYL 4N8PA 1EGJL 1JFQL 4JFDA 4Y2OA 3LKNA 1CL7I 1WBYB 4D9QD 4LU5H 4XVTH 4ONOA 5GS3A 4H8WL 1XIWA 3CDGA 4X4XA 1YEIH 4GRMA 2H45A 2YKLH 3IJHA 4XB8A 1UKQA 1RJLA 1RIVL 1HH9A 3WFHB 4L4JA 1BQLL 4HUXA 5LG1A 3KYOB 4OFKA 4KZEL 3EJJX 1CD1B 4ODWA 1DZBA 4IRZL 5IQ9B 4MA1B 3TO4A 5CD3B 5CZXC 2XN9A 3HC3H 4DN4L 4GBXB 4JN1L 3HMWL 1VERA 4XHQA 1L7TH 2DF3A 5FGBA 2VDRH 1OF2A 2DJSA 5DVKA 2R0LH 3ROLB 4FFVD 1TZIA 2DBLH 3FO9A 4FZ8H 3LS5H 1OP3K 1ZHBA 1NLBL 1M05A 1IKFL 5KSUB 3JV5A 4NM4H 1BX2B 3P9LB 1S7WB 2YPLD 4WI7A 4Z18A 5FA3A 3GSWA 1U92B 4ZSOE 5LXGH 5E2UH 5GRUL 1I1RA 1UXWA 2A9ML 4OZHB 5EU6A 5C09E 3RDTC 1AFVL 5DC4B 2E27L 1JMZA 3OJ2C 4OCRH 3BKML 4CJ1A 3QEGL 1FBIH 4O58L 5TGBB 3UTTE 3G5VA 1KPRA 3UCRA 3AVEA 2OR7A 1UM5L 1N0XH 1MFDL 1IQDB 3K4DA 2Q6WB 5J0BA 2XWBA 3ARBD 2BOBB 4MNQE 3GHBL 2YRZA 2ADIA 4M3KB 3HB3D 3JWDL 1K6QL 4PJ8D 1F4HA 1AD9B 2RQ8A 1CU4L 3O3BA 1BGXH 4N0YH 4HPYL 3QHZL 3WO4C 2B4CH 3W9EB 2YD8A 4AENA 1J05A 3QEHB 1CBVL 2EICA 1GGUA 1NEZA 2UV3A 2ZOKA 3QNXA 4MCZA 4LLMB 3VXTB 3RWJA 4KQ3H 1QTYT 3BRDA 1IQWL 4C57C 3TCLA 4WHTB 4X99B 4ZUVA 1IE5A 2B2XH 1K3ZA 4U6VH 5H94B 4RBPK 1I9IL 4RGND 1QRND 3DSFL 4YBLC 3SN6N 5F6IC 2P8LA 2HRPH 3RL2A 1FO0L 4MA3B 1I1AB 3GMNB 4FFVC 5C0RH 3MA7B 3QUMA 2YEZB 3MFFA 2DQGL 4PRNB 4DGVH 3QUXA 4MNHB 1U8IA 4RMWA 2VQ1B 1ULVA 4Q9RL 2YMXH 4K9EH 2XRAL 4H1LA 5CILL 4JHZA 4UILH 3BFOA 3KJ4B 2EDHA 1V3LA 4HJJL 1EUUA 4JFZH 2HFEB 5EBMB 3EOYG 1IEBB 1I7TA 4NRYA 3WXVL 5C9KA 1PQZB 1D5MB 4K94L 3AROA 5HGDA 4TUKL 1P84K 1S9WB 5JW3L 4UT6H 1FNSL 4DZBA 3SBWA 3PHOB 4DCQA 3ES6B 5DJZA 5IR1A 1RFDL 3BO8A 1VFBA 3EOAA 4XBGA 2Q7NA 3GKWH 1WAAF 5IF0B 1W72L 1OQOA 3CK0H 3QFJD 4P2QD 3ARBC 4M8VA 4XCYA 2AERT 3DXAA 5FUCC 2VDLH 3QUZA 4L8DB 1TVBB 1CR9H 3HB3C 4L4VD 4NRXB 4NBXB 4PJ8C 4K23H 3NCMA 5E5MA 3SDAB 1S3KH 4M00A 2D0HA 4Y0GA 5EZIL 4YE4H 1MRDH 2O5ZH 4IMKC 1BHGA 2V2TA 3PWNB 4XT1C 1TIUA 4YX2L 3HFML 4CDGC 1WZ1H 5IMLB 1XGYL 2VZOA 5CKGA 1ZLWH 4JGMA 5BZWA 4LKCA 3F6IA 3MRMB 4KRPD 1FSKB 2DJUA 1MCQA 4MD5B 1M4KA 1RUAL 4Z7NF 5B8CC 2FB4L 3LKOB 1YEJH 5JR1L 5DRXA 3GUTB 5DA0B 3RY6C 5CP3A 2AXGA 1KN2L 3LPFA 3DX7B 4FRWA 1RIHH 4HIIA 4ZTOL 4RGNC 2DQFA 4HXBL 1MJUL 3KYNA 5CD5D 4U6YA 2C5DC 2NPLX 4JFEA 5D7KD 5DJ8A 1AO7D 1QKZL 4XC1L 5DUBB 4HG4K 2NY1B 1KELL 3UBXG 5IB1B 4EUPG 2DI8A 4LMQI 2FZ3B 2MQ3A 4OF8A 3CVIL 4EI6A 2FJFB 1MCOH 4NSKA 2PYEA 5ERWA 3L3KA 2P7TA 2KPNA 5IV2B 2FWOA 1MI5E 1OSZB 4OLVL 1NJ9B 1JUFA 3VFSA 3PE9A 4ZO8A 3V7AE 4UQ3A 4AG4H 1J8HA 2NY5L 5DJAA 2B5IC 3RJQB 4UT7H 3CNKA 5DUML 2ED7A 1ZAGA 1T03L 2NY0B 4OIAA 4LKXB 3MRIB 4Q0XL 3OJDB 3QQ3B 1KB5A 3ZDYF 5KVMC 2FGWH 4LLQB 1A6WH 1A0QL 2EO9A 4P2RB 5BOZG 1K5NB 5I1GL 1G9MC 3HE6B 4M61A 3FHQA 1MHHB 2NX5B 4QHKI 4PJGB 1T0PB 5IEKB 3UJTL 4NO3B 3O6KH 3MOBL 4QF1A 3VH8A 3DROB 4U31A 4QRPA 5JPMB 1Z5LB 2CDFA 5HHNB 3PABA 1DQLH 5EN2B 4UV7H 5C08A 3U9UB 1D5BA 5F88B 5K9KB 1MPAH 4XZUB 4ZD3L 3I50H 1PEZA 2ZG2A 3MRLB 4O2CB 1KENL 1N64H 3WV0A 2VDOL 1AY1H 4ETQB 3BSZH 1EFXD 4KRPC 5CSZB 1TETH 3SCMD 5I1CL 2AK4D 1FE8L 2P46B 4D0DA 1NUNB 2P5EB 3HA0A 5E7BA 3QI9D 1A1NB 4QYOA 1RZ7H 5HHPB 5F7WC 1CGTA 3F8UB 1G7QA 3BDYH 1AC6A 3U0TA 5ANMA 1S5HB 3V4PH 4PJ9A 1XGQA 4PRHA 4MYWB 4F33B 1ACYL 1IFHL 5B3JE 1Q72L 4JRXB 3F5WA 4QRRA 3S6CA 4N0UB 4N8VB 5L88H 1RIVH 4GQ9H 4PRIE 2H6PB 1IM9B 4GKOA 1BWMA 3KXFB 4IRZH 5GXBB 4P49A 3HAEH 4QTIL 4KK6D 4R9HA 1QFOA 5DLMH 2ITCA 3ZLQC 1SJHA 2DMCA 4DN4H 3UTZB 3HMWH 2CDGA 5CEZH 2BXYA 1WIUA 1OM3L 1C5BH 1FFPA 1P9MC 2YUZA 4PUBH 2Y7QB 5AWNL 2QV2A 2X4UA 5GIRA 3HI6L 4NZJA 4J12A 1NLBH 5D1ZD 3V9FA 1IKFH 5KZCD 5F7DA 2FIKA 1G1YA 4APQD 4CN6A 5F21B 4HSQA 5L8JB 3LSOB 5GRUH 4JQXA 1DEDA 1C7TA 1QUNA 3WNPA 1ORSB 3K3QA 2A9MH 4JFXB 4F8QA 1XEDA 1BP3B 3TJEL 4HHAA 3QIBB 4ONFL 3P4MA 3H9SA 3KG5A 4YIQA 3R0MA 1ZGLM 1WITA 2E27H 4UIMB 2PW2B 3CFIC 5T3XD 1MCPL 3I3DA 4O2EA 4BH8B 1SEQH 4O58H 2IQAB 4JZJC 1DQDL 2R15A 5JOFB 3MV7A 1UM5H 4LFHG 5MENB 1MFDH 4XP6L 3FT2B 2Z9TA 1M6OA 3P0YL 4FQXB 2VR5A 1I1YA 1NBVH 3X3FH 3MRFA 1VEPA 2BSSB 4KJYB 3D18B 3SCMC 3BH9B 4U1MB 5IT2L 1K6QH 1QNZL 3QI9C 4R3SA 3ZHDA 4KJPD 4R0LA 2C3VB 2D03L 1YC8A 3BIAX 1CU4H 4ZFFA 3C08L 3QHZH 1U95A 3DV4A 4YR6A 3OKEA 2ICEB 1RHHA 1PX4A 5C3TA 4Y19B 2D0FA 5E6ID 1FHGA 2MKWA 4NN5B 5EU6B 2Z35A 3JXAA 4P46D 3D3VE 2P4AB 4OCNC 5CINL 3MBEA 1WWCA 1BAFL 1KJVB 1KNOA 3SKMB 4P57A 3EDJA 4PJFA 2HJFA 3OR7A 3QHFH 2ARWA 4IRJA 3K2UH 4OV6F 2EYSA 2X4OA 2JIXD 3I3BA 4LF3B 4RZCA 4KK6C 5KSBA 5GGSB 5GGRA 3UO1L 4JKPL 2VLKA 3B4NA 5MHSD 3FONB 5C0AA 3HRZA 4U1NB 2E6PA 1I1FB 4MJ5B 4J2XA 4AT6A 3D25A 2PXYD 5IVNA 4QOKA 5GS1C 1T5WB 5DHVH 5HGHB 3TESA 1VFAA 4JREB 3REVA 1SY6A 3I75B 3LEVH 4ELMB 1CDBA 1GXEA 1YDPA 4L9LB 2XRAH 1YEKL 2BRRH 4APQC 1EAPA 4JFQB 5CILH 1G9EA 4NO0B 3LKSB 4MDJA 1NC4D 1Q9WB 3F62A 3TFKD 1T0NB 5CIPB 2ZNXA 3GSQB 3RPIB 1N4XH 1TJGH 3GGWA 4HIJA 3WXVH 2DQIL 4K94H 1U8MA 3NPSC 3I02B 4HIEA 4R7NB 4TUKH 2IFFL 5C3LD 1KTLB 1YEHH 2BXZA 4WWID 5DMYA 1FNSH 2B4CC 2R2BB 3B6SA 4X0KB 2XTJD 3IFPB 2M2DA 4OQTL 4OFPA 2C4XA 3V6FA 3ARQA 2CSPA 4P2OC 4X5LA 5I9QB 3EO1B 1F13A 4KJPC 4HEPG 1GJIA 1JPTH 1OCWL 1QVOA 4G9FB 1NBYA 5EZIH 2NY7L 2C1PB 2BNQB 5JORA 1RY7B 2X41A 4NNXB 4YX2H 5E6IC 3WFEH 2UUDK 3L9RA 1KC5L 4N9GB 1JNLL 3STLB 1NAMH 4XXDA 2YUVA 5I71B 2G2RA 3G6JB 1IT9L 4ZOBA 4EI5A 3LAFA 4Z5RA 2VDQL 1FC1A 5BRZE 5HGDB 1RUAH 3EYSL 1YPZE 3ESVF 4Z7QF 5DQDH 3LH2L 4MMZC 1RUQH 3WHXA 4K9EC 1MQKH 4TQEL 2DKSA 5D2LF 5JUEH 3EOAB 1EMTL 1PKQA 2ATPA 4PGEB 3L3JA 1M7DA 4ZTOH 5KAQF 3SDXB 3SJVA 4QRQA 1EXUA 2YPVH 5B38G 3QG6A 3TEUA 4GMSH 5GGVL 3GMRB 1HQRA 3QNZB 2LV4A 1QKZH 1CICD 3OXSB 5EZOL 2PXYC 4JAMB 1KELH 2HVJA 3JWOL 4YBHA 1INEL 2XZQL 3D9AL 5L2KB 1FAKT 3V6OA 3N1PC 2ITDB 3HE7D 3CVIH 1WK0A 5IBLD 4E41B 4E5XB 4NQDE 4Y2DD 3S97C 4Z77B 3GB7A 2R4SH 5BJTA 4UU9B 3TFKC 4LKCB 4U1IA 5CGYC 2EDRA 5C09D 4OLVH 3S37X 2QQKL 3QA3A 1YNLH 1KIRB 2FH8A 2JKXA 3FQNA 2NY5H 1JGEA 1UB6B 1UM6H 4KJWD 2MMXA 3AREA 4KI5E 3O8XB 3PGDB 3DX9A 3GRWA 1VEOA 3PGCA 1RHFA 3UTTD 1KTDB 3ZKND 3LPWA 5D7SL 3UDWA 1ZSDA 4KHXH 4Q0XH 2WBJD 3BN9D 2J8OA 2XTJC 5FOJA 3KYNB 1A0QH 5GZND 5I1GH 4MNQD 2H1PL 1G7IA 4XHJD 1BZQK 3O6FD 3S96A 4NO5B 4GRWE 1KCSL 3WLWD 4MCYB 1RJZA 3HTLX 3G5XA 5DWUL 1IEAB 1A9BA 3ZYIA 5FM5O 2XKNB 1MOEA 4Q6IB 3OKLA 4NRZB 4YHKL 5ITFA 3PL6A 4LCWA 3C8KB 4HBCH 4UIKH 3T4YA 4HS3B 2UZXB 4G42B 1KCRL 5FB8A 1LK2B 1WWAX 2V5RA 4HUWB 3FOMB 2GJ6A 1R5IA 4JQIH 5DJXB 4OFIA 5IBTH 1NFDE 4UUJA 3TF7C 1KB5B 1XH3B 2VKXA 3JV4A 5J8OA 5LGHL 3DRQB 3QCVL 4XI5D 1PLGH 4ZXBB 3KLSA 3PIQB 2ATKA 5INCB 1CG9B 1ACYH 3OKOA 3CUPA 5A2LH 3CPLB 4UTBL 3CVHA 2F54B 5EZLA 1UM4H 3TBTB 1DP0A 3MRNA 4GAGL 1CS6A 4HFWB 3BZ4B 5D9SB 5JHLH 2VR4A 2A6IA 5HDQL 2FO1A 4MXWL 2JCCE 5T1KA 3LKQB 5SX5H 2AV1A 1BD2A 4OCMC 3T4AB 4WFGE 4XCNB 1J0JA 1R3JA 3W39A 2A77H 3HE7C 5IBLC 2VLJE 4Y2DC 3MUGA 2F19H 5F9OH 1X5IA 4WI9A 1TNNA 5LQBL 1J18A 1OM3H 2AJYL 1JPFA 1T04A 4JM4L 4I2XA 4D0DB 2GK0B 3HZVA 3IVKB 4KJWC 1HEZA 4PY8J 3QB7C 5AWNH 1U8HA 1A2YA 2XQBL 3IDYC 1ZANL 3LQAL 3ZKNC 1G7QB 5JQ6L 3U0TB 3LQZB 5KANI 1S7UA 4PJ9B 2WBJC 1P7QB 1U36A 2CRIA 3AU1B 2PO6D 3BN9C 1AE6H 5IB5B 4UT9L 3CSBA 4F7PA 4N5ED 1WAAA 5GZNC 4XHJC 4OCSH 2Q7YB 1FGVL 1AR2A 5D93C 3WLWC 2A74A 2VAAA 1UGNA 4OAWA 4U0RB 2CUHA 4RCAA 3VXRB 4AL8L 1K8DB 5L8LB 2IADB 4E9LA 3QPQD 1MVFA 3TBSB 1MCPH 3LZFL 4YDJA 2CDGB 1DQDH 2XG4A 1KIQA 5HHQB 4BK5A 4XP6H 1GGIL 3BWAB 3P0YH 3OR6A 4G6KH 3V5KB 1Z3GH 1DBMH 4WI2A 5CAYB 3MGTA 1JPSH 2M8XA 2NXYB 1X5LA 3NTCL 5IT2H 3MLTA 3VG9B 1AXTH 5AEAA 2D03H 2QHRH 4LEOB 4S1DD 3O11B 3C08H 4FXKA 4AIXA 1JGVL 4RWYL 4XI5C 3MRJA 5JW4N 1INDL 4X6DE 4PJXF 1IAKA 4PJAB 4L4TE 4R6UA 3P30H 5DZOA 5I1AB 1HINH 1UB5A 4HHAB 4K3HA 2IF7A 5CINH 1HSAB 1BAFH 4QRUA 3MCKB 1S7TB 3ARDD 5BVPL 3DBXA 4TOYH 1RJYA 2NCMA 2VDNL 4RFEA 3AMLA 5FCUL 4GKNB 1I4FB 2P5WE 1MI5D 4P5KA 1E4XL 3UO1H 4RGMB 4N8CH 1ZS8B 2GAZB 4AIZA 5FKAA 1I1YB 4OIBA 3QXWA 3QDGE 4Z7OE 1QLRB 3BX7C 2EH7H 1G6RB 3QRFM 4Z7WE 3UC0H 4JO3L 1II4E 1AGCA 1MCNA 4K2UL 3GSXB 2ERJB 1YEGL 2PO6C 4PJDB 3J7HA 1EEYA 1QLFA 4TULH 4N5EC 4OUUA 1U8QA 4J3WA 3MV9B 3G5ZA 1XGPB 2VZVA 4JY6A 4UOW1 3UZEA 4B7LA 1KNOB 2C3GA 4P57B 2V7NB 4PJFB 2CKNA 3OZ9H 2ESVA 3JWDC 3EJZD 3D85D 3KPMB 3TYFB 2IFFH 3QPQC 1SEBB 3CMOL 1J5OL 1GCFA 4YHOL 1Q9OA 1KG0A 5KN5A 1FV1A 3H42H 3WE6A 5D71L 4LHJB 3S36X 2MCPH 3IJYA 3TT3L 3IRZA 5IBUB 3CLEH 1G7JA 4AT6B 4POYA 5IVXB 5F9JA 1FVEB 4JG0L 4MZ3A 2GHWB 2OJEB 4RFNC 1LEIA 3RDTA 1EHAA 4ZNEE 4HCRL 1F6LL 3BGFC 4S1DC 4PPTA 5C7XH 4IOIA 5C0DA 4LHUA 1NCAL 3CFJA 3MGAA 3WYRA 3H3BC 5DJDA 4MDJB 1DN0A 4FTVE 4H20L 4UQ2B 4K3GA 3QQ4A 4L5FL 1KC5H 1DUYB 1MCCA 1T7XA 3RZCD 2GY7B 1YEDB 4I8DA 3LHPH 1OP9A 1IT9H 4GW5A 3L5IA 4PRID 2HFFA 1N3NA 1IAII 1F58H 5E9DB 3FO2A 3BQUB 3GMQB 1IC1A 3TA3D 1D7FA 3KS0J 4K55A 3ARDC 2C7UA 2HWZL 1EHLL 1X9QA 4WTZA 3C5ZD 1MREH 4EDXA 1FPTL 4NQCA 4TQEH 3QJHA 1FNLA 4R4BB 3BP4A 4OZFG 1EMTH 2F8VA 2VLRB 1T2QL 5T1LB 2VB5A 1QA9A 2VN7A 3FN9A 4WU7B 5IMMA 1SQ2N 5D2NB 3K46A 1UQSB 3CFBB 5I1LA 4N0CD 5HXMA 5GGVH 4K94C 1M71A 4OZHE 2VZ1A 3MRQB 5CZKA 3ZZ1A 3ZT6A 3MPCA 4NM8H 3HR5A 5EZOH 1INEH 1ES0B 1Z2KA 2GSGB 43C9A 8CGTA 3D9AH 2FEDD 3MRRA 4DGYH 1NANH 4CVXA 3A6OA 3L9RB 3O9WD 3VXPA 1ZLVK 2VZSA 3P4NA 4K3DL 4NKDB 5DMIH 3CC5A 5IMKA 4EI5B 1IGTB 3GBML 1DQJA 3WNNA 4BZ2L 1BEYH 2BVOA 2EEAA 3F58H 2I5YL 1W0WA 3UPRA 1MCDA 2EC9U 2NZIA 2YWZA 4MJIB 4OLYL 3EJZC 3QBTB 1JN6B 3EYUH 4Z7VB 5MEPA 12E8H 3JUZA 5MEOB 2FHCA 5D7SH 1PKQB 3S4SB 2YPLA 3SJVB 2A83B 4QRQB 1UYWL 5BS0B 3FQXB 2GCYA 4FFWD 3RNKB 4U6TA 1ZV5A 3LRHA 1Y18A 3RWHA 5JW4M 3ZKXC 1MCIA 1KCSH 3TNMB 3MXVL 3ZDZE 1J0HA 5J6HA 4CADA 1BIHA 3CFDB 4WTWA 3WNLA 1ND0A 5D1QB 1U91B 2YXFA 3U4BL 32C2B 4YHKH 5DD6B 1NEUA 1ORQA 2F15A 3CSYA 1NCWL 3KDMB 3D3VD 4JVUA 3RZCC 1KCRH 1YMHB 3O41B 1P2CB 3MCG1 5T1DH 4MA8L 3BGMB 3ARBA 1ZXQA 2JJUA 1KEGL 5DEFB 3TA3C 4X7SL 3DMMB 5ICYA 1FORL 1T0MA 3C5ZC 4PJ8A 3STZA 3O0RL 2CLZA 1I8IA 1KIUA 1BVZA 4PB9L 3VFPA 5ENWA 2Y5TA 5LGHH 1R5WB 1DBJL 1JWMB 1UH2A 4KK8D 4P4KD 3ZTNH 1MHCB 3I6LE 3VFWB 4IMKA 4FP8L 1FZJB 2MQ0A 4B53A 1CXEA 1S9YB 4UTBH 2PUQT 3MACL 2NY5C 3IKCA 4GAGH 4N0CC 3O3DB 4HKZB 2YD3A 5JLZB 3ARPA 4DAGL 4ZYKB 5HDQH 3OKLB 1UWEL 3GI9H 1QR1A 1F2XK 4M02A 3L3DB 5B8CA 2VLLA 2FEDC 3TC9A 1REIA 2ILLA 1NCCL 3M45A 5AUMB 1G0YR 4BH7A 4KGJA 3RY6A 3O9WC 1YZZA 4J6RH 4LQFL 1QRNA 3VFRA 1QEWA 4U3HA 5LQBH 1D5XB 4EXKA 4MAYD 4JM4H 5IOPB 2VH5H 3VFVA 1JF1A 1A7OH 4C83A 2VTFA 4PGDA 2WBWB 2VUOA 4PLNC 2EIEA 1ZGLA 2XQBH 3LQAH 2LABA 3MRPA 5JQ6H 4YWGH 4B0MM 3B8SA 1DE4A 3ISWA 4OF3A 4PBVC 3CVHB 4UT9H 2R0ZH 3VCLA 1JYNA 4FFWC 2RAMA 1AQKH 2J6EA 4PGCA 5A2FA 2D7TL 1PG7L 4JZOA 4IS6A 1NGYB 3I2CH 3PP4L 1HE7A 4I9WE 1ZA3A 4ZS7H 1R3JB 1OHQA 3ZYJA 3R06A 2PN5A 3N1FC 3LZFH 2O5YL 1L7IL 4MHHG 3HCVA 5D7IB 2WP3T 4MQXD 4AEEA 4WIQA 4NN7C 4EXPX 3KPSB 4RNRB 1T04B 1D9KB 5BRZD 3G9AB 4P5TD 1UT9A 5ADPH 1ZT7A 5B39B 3QFJA 4H0HB 3P40A 2EDBA 1GL4B 2IGFL 4P2QA 3IDJA 3QXAB 1VACB 3NTCH 1CGSL 3DHJA 4L4VA 4LSRL 5J9PB 2QSQA 4J4PD 4ZG1A 2R0WH 3QNYA 5D2LA 4ODTL 1CFSB 1WBZB 5JNYA 2HLAA 1R5VA 4P4KC 4KK8C 4GLRH 4EBQL 4NP4L 3T2NL 3OJMB 2I9TB 1JE6A 3HPJA 2VAAB 5F7YC 5F9AC 4PJBE 1FNHA 3N06B 4XBEL 1XGUA 5HSFA 3BP6B 1O7SA 2H32A 2Y72A 1FZOA 3G5YA 1C12A 4POZD 5F9DC 4NQDD 1YEEL 5GHWH 5IG7A 2VDNH 5FCUH 4O00A 4XH2A 5I73B 2G9HA 3EYFA 1VKXA 1AC0A 4BFGA 1NGWB 4XPBH 3OR6B 4EKXA 2XXMB 4WV1C 3MJ6A 1JHTA 4MAYC 1QACA 4KI5D 3RWCA 3FZUD 2NX5E 4PJGE 1OL0A 4PV8B 4LSDA 5GRZA 1AO7A 5F7LB 3VWJD 2DI7A 2DLEA 1U3JA 5GRXG 5I1EH 3Q3GA 2CJUH 4OCLC 4X4ZA 4HMDA 4LCIL 5TDPA 4K2UH 3NCFB 1YEGH 1ZMYA 1I7ZA 2VIRA 4ZO6A 1UB5B 5E0QA 4QRTB 1TCRA 3T0DA 1FL6B 1FYTB 2OR9L 1IL1A 4JHWL 1P9MA 5CHNB 1VA9A 4NUJA 2CGRL 2P5EE 5B22A 1WCBA 1YNKL 3CMOH 1HHJA 3SGKC 5AYUH 1R3HB 3U1SH 4YHOH 5CJOL 4MQXC 3H3PL 1ZEAL 3DGGB 3FO1A 4ODVH 5D71H 4K71B 4P5TC 4KROB 3DURA 3TT3H 1CDIA 4HULB 3P9MA 4KMTH 1CLYH 4XBPA 4JG0H 4QY8B 3QEQB 4N0UE 1JNJA 1QSFB 4TVSa 3KXFE 4J4PC 1NCAH 1Z9MA 3BESR 1EEYB 3GSOA 5C86A 3I6GA 4H20H 4JZJA 4S1RL 3G5ZB 1FL5A 4L5FH 4U0QB 1BVKB 1F4WH 2RCSL 4HIHA 5JDSB 3DLQR 3KAAA 3TO2B 5IESL 3DV6B 1EFXA 2V7HA 1MFCL 3MLUL 5T5FL 3RWIA 4HC1L 3SCMA 3UP1A 2C1OA 4WFGD 2AK4A 3QI9A 4WW2B 2HN7A 2R23B 1NC2B 2VLJD 4POZC 1JRHH 4O4YL 2VXTH 3GJEB 4PS4H 3CXDL 3WE6B 1ZHKB 3EZ8A 3TZVA 3MJ8B 1L0XA 3CH8A 1T2QH 1N0LA 5B3JF 2FX7L 5I15L 4PLJD 1A4KA 4KI5C 1LDPL 3FZUC 4BSJA 3NA9L 1JTPA 1MEXL 5CWSB 3E2HB 4OJFL 3VWJC 2V5MA 3BHBA 5E94A 5CJXC 4GSDH 3ARFD 4IHOA 4LGPB 3BPNB 4WY7H 4HJGB 3DETD 3H9ZA 5IIEB 4X5WB 4FHBD 3MLYL 3QR2A 4D9LH 4JQVC 2JK5A 3BZFB 1NBZA 5MENE 3GBMH 3KNBB 2BNUB 3B2VH 4LSVL 4UAOC 5IFAH 4LVOC 3A6CH 2I5YH 4OTXL 3CLFL 4WU5A 5DRWA 3ARRA 2KBGA 4D94A 4NQCB 1A3QA 2HJKA 5GS1A 1DVFB 1R3LA 2O61B 3VXQA 5TE4L 3BE1H 3EFFA 3GSNL 4WDIB 1QA9B 1RK0B 1MHPH 4QHLA 4APQA 1UYWH 4Y19E 5IMMB 4ZAKD 4NDMA 5BVJA 1M71B 3IAPA 1I85C 4QNPE 4Q58C 2J5LC 4TUJA 4AM0B 2VQTA 5IMOA 1OB1B 4PJIB 4KU1A 1HXYA 4X7FC 1RV6X 4NCC1 5I8EB 2XYCA 1BZ7B 1DUZB 4FXGB 1HZHH 5FYKL 5IGXL 4LP4A 1NCWH 4YBLB 1XCQA 3F7YA 4L4TD 1DQMH 4MDIB 3QZWB 4PJXA 4QT5B 3TIDB 4DZ8A 3KPTA 4JO4H 1AIFB 9CGTA 3GK8L 5EFIA 2AI0H 2R0KL 3PHSA 4W4OC 5DJ6A 3EGSA 3JWOC 3LKPB 4P2OA 2WW8A 3TH3T 1RZGA 3Q5TA 5HYSG 2P5WD 1QFPA 4PB9H 4M7KH 1RUMH 4ELME 4I3RH 3NVQA 1HXMA 4FP8H 3MLRH 3GFUA 5E6IA 3QDGD 5DK0B 4ZDHA 2Q8AL 4LBEA 4PLJC 4EVNB 3SOBL 1JBJA 4IRSB 1UKTA 4JE4B 4LOUD 5DURD 5C92A 4ZNCD 2L7UA 3VXSB 2EDYA 1UWEH 3ARFC 1T7ZA 4KY1L 2RFXA 3MODL 1OAQL 1J11A 2R29L 3MA9L 4ODXB 5FM4A 4H0IA 1J0YA 1KXTB 2BX5A 2JIXA 3DETC 4JO2L 2BVUA 4ZQKA 4BA8A 4ESKA 4LARL 5DT1L 2R1YB 1MH5B 5ILTL 5IUSA 1RIUL 5FCSH 1CE1L 3VXOA 3BXNB 5DMJB 3HG1B 1IGJA 3R4DA 1UJ3C 3LN4A 3MREB 1OAYL 3DYOA 5E8NB 5BW7C 3DRTA 2PXYA 2E9JA 4ALAL 1A5FH 1WQVT 1FVCA 4G9FE 4ZUWA 2BNQE 1B0GA 3Q6FB 1CZ8L 2ZNWA 4ZAKC 1NC4A 2H9GB 2JB6A 3WXWL 1HQ4A 5BV7B 2D7TH 2ZKHH 3G6JE 4ZUUA 1GAFL 4DTGH 4PIRF 3H7BA 2BZDA 1M1SA 4K3EL 4ODBD 4GKSB 3PP4H 2OQJB 3S8WA 5DVLA 1ZLSL 1V7NL 4GMTL 2F8OA 2UWEB 4FTVD 1KBGL 2BHUA 4KKAD 5TE7H 2EXWD 4GBXD 5FYKE 2ICWI 1QEWB 1IAMA 3AS3A 3L3IA 5DK2B 3SDXE 3RTQB 2GJZA 3MNWA 3CXHJ 3IU3B 4LSTH 2IGFH 4GW4B 4OD2A 5EULV 3BEVA 4CU6A 5DDHA 1QBLH 1V3KA 3TPUA 4LPCA 1ZE3C 5L2KE 4GT7A 4Y5YC 4QTHA 4U1JB 1BFVL 4BQ9A 4ODTH 1A9EA 3Q6GH 1Q94B 2I07B 4E41E 5GRVK 1GZQA 3C2AL 3EBAA 2XNAA 3OGOE 1JWUB 5CLWA 1RU9L 3P77B 3H9YA 2WINA 4JRWA 2VXVH 4LOUC 4XBEH 1YPZF 1ZA3B 1FFNB 5E8PA 1FLRH 3ETBF 3LQAC 3RWEB 3MLPA 2DKMA 2OSLB 2C4FT 4X6CB 3T09A 3U82B 1EHXA 1YEEH 2IPKA 4IIQB 3FB7A 2P43B 3CCHA 4LQ1A 2OR8A 4JN2B 4P2QB 2DOCA 1KF9B 1ZA6B 1BIIA 3IDJB 4D2NA 5DGQA 1YJDH 4NJAH 1F5WA 5TQ0H 2DIAA 3MRCB 3MROB 4Z0BH 2L7JA 2DQDH 4WJ5A 4NCC2 3T65B 4HK0B 4ZSOA 5EZJB 3QG7L 2YD6A 3T0XA 3HE7A 4NGHL 3N0PB 3QULB 4FQ1H 1BJ8A 5K93A 4YEFA 3IU4H 3P0VH 3BISA 4Y2DA 1U8NB 1RZ8A 4XPAH 2V2XB 5AD0A 4LRIC 3RU8L 4KRPB 5C09A 1J1PL 2X4RB 2OR9H 4YAQA 4KI5F 2H32B 3P4OB 2YWYA 2APBA 3TH2T 1C12B 2CGRH 2DLTA 4MA1C 1T1YB 3U83A 1YNKH 4RMVA 3UTTA 4HK3N 1R3IL 4JB9L 1DR9A 2G9HB 3O2DL 1VKXB 4KKAC 1HHKB 2ADJB 2EXWC 4GBXC 2WBJA 5CJOH 1ONQA 1ZEAH 2NY4B 3KHQA 1I1AD 1VENA 3M1BA 4GRWF 4MNQA 3OKKB 3U7AA 1HKFA 2FYYA 1CFTB 2A2QT 5EBGA 5CEYB 2MWCA 4OD3H 3KPNA 4EN3B 3V4UL 1B9ZA 3P73A 5FDWA 1UXSA 1QZ1A 3QFDB 3CSGA 3I6LD 3A6BL 4FQHB 4NZTH 2QKIB 1K8IA 5GGTL 1SMOA 5HHOB 3NGBB 4CVZB 4U4BA 1G84A 2ZUVA 1ZLWK 1OAUL 5C9JA 1NFDF 4HC1H 1WCBB 35C8L 4XMPH 2UVFA 5C07B 3D0VB 3B9DA 3SQOL 3RPKA 3HAEA 2KUTA 4GW1B 4RRPG 2WM0A 1NSNL 3VGAC 1FFOA 1A22B 2QQLL 3IJSA 2O5XL 4HGWA 5CIPH 1ACZA 2EEDA 3EIFA 4NZRH 4P3CL 2FX7H 5I15H 4NWTL 5SWSB 4YXKH 4YHZL 4WI3A 2R2HB 3V8CA 1HIML 4LCCB 2JCCF 2APVA 5CJQL 3SDAD 2VL5B 3VXRE 4BZ1L 4FS0A 5AZ2H 1KPUA 1NANI 2DQUL 1XCTA 3SE3C 1PZ5A 4PRBA 4DKEL 3HS0B 1TVHB 2X1PA 1XF4B 3BRGC 3QDMB 4M6ML 5F9WB 4I9WD 3CLFH 4TUOA 3UTQB 4L8CA 3C09C 3GDBA 5ICZA 3NCBB 3G04B 5E99L 3WFBL 4E42B 1GZPA 1OAZH 5I16A 3PWJB 4YDIH 1T4KB 5TE4H 1OGAE 3SGJC 2VDKL 2PO6A 4C59B 3RVTD 3O2VL 3H9HB 1I1AC 3NN8B 4LCYA 4PJAE 2OK0L 2AEPH 4WUKH 1U2CA 5E2WH 2GIYA 4CJ0A 2UYLA 1OT1A 2NY1D 3WFDL 4H88L 4FXLA 2PR4H 3ULUL 4UV4L 3PJSB 4I4WB 5ICXA 5FYKH 2IH1A 3NABL 5F7EL 3KJ4C 4HQQH 2BVQA 4QO1A 2AEIT 4HX1B 5MP6L 3GK8H 1IGFL 5FO8B 2X1OA 1JZ2A 1SJEA 2DQHL 1T22B 4R8WL 2HJKB 3CZFB 5D1ZB 4K7PL 2OL3L 3VXQB 5KZCB 3RNQA 1CFQA 4W70A 3MFGB 1NDGB 5JPNB 2GUOA 4X6DF 4LSPL 1A21A 3CFEA 2RIKA 3F7VB 3HE6D 5IVOA 4KZDH 5IQ7H 4XCEA 2NX5D 3HZMB 3K7UA 4XNQA 3MV9E 3SOBH 1DEEB 4XNMB 4WVRA 4Y7MA 3MZTA 1JZ6A 1I9JH 1LNUB 43CAB 2V2WB 3KLAB 5FA4B 1QBAA 1HILB 5DHVA 4ZUSB 3SDAC 3ARDA 4KY1H 5LGJA 3MODH 5HPOA 2R29H 2PTVA 3MA9H 3B43A 3U9PL 2E9BA 1HDMB 3VRIA 3WUWG 1I3GH 4I18B 5GSVA 3LEXA 4LARH 4RAVA 2LE9A 5IW3A 1MI5A 3RL1B 1XGRA 1AR1D 4R90L 4MWFA 1T21B 4Z7OF 4U1LA 4Y89A 1OAYH 1RZJH 2P5ED 5IVXE 5FUOL 1SYSB 1CF8L 3WLBA 1J87A 1YQVH 4DGIL 4ZFZA 3M8OH 3C5JA 4X7DC 2VZ3A 2VZUA 4LNVA 3GHEL 3RVTC 2Q3AA 1TZHA 3CX2A 2YSSA 3WXWH 3L7FA 4P46B 2EKJA 1CGUA 3EOTL 1F11A 2K3TA 5EORL 2MNUA 2NY1C 3OGCA 1IM9D 3QHTC 5E9DE 3BUTA 4MJ6B 3WEXB 3QDJB 4K3EH 3KXFD 1XFPA 3D85A 3RGVB 6FABH 3RX8A 4LPXA 5DRZA 4ZQKB 1KB5H 3ULUE 4LEXH 1KBGH 4NHUB 1NMAH 1P84J 5GRWA 2VLRE 1NAMA 3NACH 1S78D 4NFCA 3S5LG 1A6AB 5D2NE 2HFGL 3PQYE 1UENA 4C56B 2B1AL 4XNUL 4K7FB 1LO0H 1J10A 5E8EA 4HUVB 1BMGA 1T5XB 2QR0A 1FNEA 4HKXA 1G9NH 1BFVH 3L3OA 4P4RB 3OG6B 4M5ZL 4XTRD 1AD0A 4GLRI 4HIXH 3MO1B 5L0QC 2FR4A 3FQRB 3FKUS 4X8XA 3HE6C 2GTWB 3U4AA 4ODHH 3RZCA 3RWFB 1RU9H 2E6QA 5H37G 3QIBD 1J1OL 4PRIA 1JI2A 3DTXA 4MJIE 3TA3A 2QEJA 4X9BA 3X13A 1FC2D 1I8MB 4HWEL 2VOTA 4PY7B 3C5ZA 4H25B 1URLA 1BOYA 1XF3A 2AJZB 1NGPH 5LBSL 5EU3B 3NZ8A 1FYHB 5ESVB 2BVPA 3T08A 5MEND 1E4XI 5BS0E 2AQ2A 5LCVH 5IJVA 1AR1C 4FQXD 5MEQA 4OD2B 4OZHF 3BAEL 5DDHB 3ALPA 1WZLA 4NKQB 2BCKA 1D6VH 2XT1B 4M43L 1FG2A 1MRCH 3DIFA 4A6YB 2NLJB 3T3ME 3NCYP 3OX8B 5H2BB 4Y19D 1E27A 2XNAB 3ILQD 3O9WA 1UEMA 3WFCH 1GH7A 4YHYB 3S88L 1TCMA 1BQHB 2UY7A 3HI1B 3QUKA 1CK0H 3RU8H 2E8YA 1J1PH 5CBEA 4U7SA 5BCAA 4JR9L 4KTYA 4X6EA 4HUMB 3SE9H 3HPLA 2X05A 1AGEB 4M7LL 3VFTA 3RAJL 3QJFA 1TITA 1R3IH 5EO9A 2V9RA 4Z7UB 1KT2A 3SY0B 3FAWA 1Z6JT 4XVJH 1B88A 1R0AL 1Y6KR 1S78C 3QDAA 3KYMA 3ZDZF 1T20B 3FT3B 5D7LB 4UNTA 1CICB 4OF7A 1MAMH 4FQPA 1BM3H 2PNDA 4KI1A 4S2SA 1JGLL 4J3TA 2Z91B 1RMFH 5TQ2H 1V7MH 3V4UH 4LNRA 1A1MA 5HGBB 1NLDL 3GNML 1DCLA 4GJTB 4RMUA 2GTZA 4NO0D 5CUSL 4XTRC 2JB5L 2OI9B 1CI5A 1S9XA 4WHYH 5C09B 2Q8BL 1T1WB 3D3VA 3DUSB 4R26H 4X4YA 3PXJA 4NPYA 4D8PB 3QIBC 5J57B 3MRBB 1OPGL 3IFLH 4N0FB 1G6RH 3VFNA 4JKLA 4L29A 1C1EH 3JTTB 1IGML 1TMCB 4YXHH 4WFEE 5I8CA 1ONQB 4Y16B 2Z92B 5B21A 1Q0XH 3OKMA 1YNTA 1NSNH 3M1BB 4P4KA 1P69B 3WIIL 4P3CH 3O6FB 1L9MA 4FQXC 1YYMH 1I1CA 1N2RA 3V5HB 3C2SA 3PV6A 4YHZH 3ZE2E 4KAQH 4AQOA 3WS3B 4I0CC 4JRYE 4F9PC 1WC7B 1NEZG 4G9FD 3DVNB 4R7DB 4YHPB 2OMBA 2FATL 2BNQD 2W38A 3EJYD 2QLVB 3U2SA 1A3LH 3KWWB 4NN5C 4DKEH 3ILQC 4IOFD 5D7IE 5TE6L 1JWSA 3DUUB 2G5BB 5ALCH 5I74B 1OOAA 3S35L 3KPSE 4WGWB 2DM4A 4WV1A 4PP2B 4B41A 4M6MH 4MAYA 2Z31D 3N1MC 4FQJL 4KQ4L 3U46A 1Y0LA 4TTGA 3MLSH 3HRPA 2RHEA 3OB8A 5E99H 1E4KC 3IETB 3P11H 4LSSH 5CGMA 5FYKD 2W9LA 1U42A 4OGAD 2ICWA 4Z76A 4HGWB 2VDKH 1A14L 3GSUA 1P7HL 4YFDB 3LS4L 3O2VH 4EDWH 5F6HJ 4NFDA 4H1LG 4Q74A 4I0PB 5A16B 5IEHB 2OZ4L 4UBDD 5EC2B 3OHXB 1BBJA 3WFDH 4PJ5B 3T1FA 3FFCB 2L0DA 4H88H 5L2KD 2F74A 4JREC 2IANB 3GMOB 2XZAL 4KKBD 4BQ6A 2VITA 5J1TC 4L9LC 3ULUH 3V6ZB 1EJOH 4E41D 5BXFB 4UV4H 5I66B 1S7SB 5LWYL 3NABH 5E56A 3SGKA 1HHHB 3VJ6B 5FM8A 3KPRB 2H3NA 1MIML 5BRZA 4P5TA 4P5MB 4NCDA 5MP6H 1H15A 3O8XD 4OUOA 4FQ2L 1YPZA 3U6RA 3T0WA 1H0DA 1JGDA 1ETZA 2DQHH 3RHWF 4DW2H 1GZPB 4CMMB 2GEEA 4IOSD 5I16B 4YFEA 3D39B 4QHNA 1YMMB 4HUNB 4ORGA 1QFUL 5DYOB 4OLXL 4J4PA 4PFEA 1CL7H 3B83A 1RZFL 4LSPH 1KTRL 3OKYA 3L3HA 1OP5H 3V7MA 3C87A 5I1KH 4O9HL 1LILA 3DVIA 3BI9X 3OG4B 1UWXH 1CVSC 2AXHA 1FYTE 3X14A 5C0IA 3WCYA 5I9QC 1SBSL 1HHGA 2W0LA 3IFNH 5SWZE 1DQQB 5TDNA 3CDYA 4LMQE 2HA1A 3C6SA 2PYFA 5FO9A 3EJYC 1FAIH 2A6KA 1UEYA 2BMKB 4JHAH 5E8DL 5C8JB 5JW4Q 4NQDA 2R69L 1B90A 3L5XL 2X4QA 5SX5K 3THML 4ZFOL 4HW6A 5IW6B 4X4ME 4IOFC 4P9HL 5I71C 5F3HA 3HMXH 4R90H 3L1OL 4P0DA 2Y06L 4YXLL 1EO8H 1VFUA 4PJGF 2Z31C 4YDVB 5C6WH 4U2ZA 2VC2L 4WENB 1GRWA 3QEQE 4MX7A 5FUOH 3VWJA 1O7VA 4XP4L 5CJXA 5I75B 1QSFE 4ZXBD 2H26A 4OGAC 1NDMB 5I76B 4DQOL 3B3IA 5FYLL 4MS8D 4OQTA 4HGKC 1FO0B 3GHEH 3QCUH 4JQVA 4U1KA 5T3ZE 5LJYH 4AZ8A 3EOTH 2WP3O 5J6GB 5EORH 5EU7E 4NZDA 4UBDC 2FNBA 3GIVA 2XTLA 3W5NA 2RB8A 5HJ3A 5E24E 4HH9B 4ORZC 1MHEB 4H5SB 4KKBC 4OSUH 3TVMB 1DBKL 1KJ2B 3UTOA 5GSVB 2X09A 3OAZH 4OKVB 1IGIL 1YYLL 3PNWB 1MRFH 4I77L 1TJHL 3B5GA 4WNQA 1BZ9A 3FFDA 2EECA 3HN3A 1UVQB 1I7RB 3CFCL 3DECA 4KK5D 2FJGA 5DI8A 2HFGH 1I85A 3CAFA 3O8XC 4K07A 5TH2B 1U6AH 2B1AH 1NFDA 3RVXD 2X70B 5IVZB 5DEZA 3AUVA 3IAQA 4OQ1A 1JYVA 3DJ9A 5EU4B 2BERA 5GGQL 1I7UB 4GO6B 1P7QD 1MLCB 3B5HA 3VWKB 3VH8G 4M5ZH 4M48H 2EZ0D 1W72B 3ZTJH 4G7VL 4XCFL 5DVOA 3BVNA 4KUCD 5J12B 3WIFA 4NQSB 1KJMA 2AK1H 5EC1B 1J1OH 3VXRD 4KHTL 2JCCA 4JY4B 4NYLB 4JZNB 4W4OA 5HDOA 3W82A 3EO0B 3IAGC 4OV5A 4Q6IC 5DRZB 4M6OH 4EOWL 3NFNB 2D9CA 1INQB 2VLJA 1PYWB 3IDMA 5LBSH 4CVUA 5I1DA 4FMKA 3CVHH 3O45B 4U33A 5DC9B 3O3EA 1H9VA 5F3BA 5EB9A 2ZPKH 5I1JH 1U8JB 5DMKA 4FQCL 3BAEH 1CFVL 4M93B 2NXYD 1MCBA 4MQ7A 4XWGL 4RFOL 4PJIE 3QIUD 5EBLB 2QR0B 1H3PL 1YA5A 2QSCL 3WJLC 3ARFA 1OGAD 3L3OB 4ZXBC 1AD0B 3T0EE 3IFOA 5EOCH 5F70A 2BSTA 1NGZA 3IDUA 4MS8C 3NFSL 1X5KA 3QXTA 1MCRA 3MNVA 4J3UA 1T1ZA 3PHQB 1U8PB 3E8UH 5I1IL 5I17B 1P7KA 1UJ3A 5DRNB 1QG3A 4Z0XA 1CFNB 5BW7A 1G9NC 3JZ7A 3NZ8B 3RAJH 5DJCB 2ZUWA 4LAQL 4QNPF 1K2DA 4ZAKA 4KK5C 1PY4A 1KCUH 1A6UL 1Q9KB 1K4DA 4HWUA 4YH6A 3RVXC 3OKDA 1JGLH 3ALWA 3F12A 3LKRB 4U6HA 3VXSE 2FL5A 3O9WB 4H26A 3ARSA 4X6DA 3HLAA 4U1HB 1OQXA 3L7EB 3MV9D 2JB5H 4TNWF 3G6DH 4L4TA 1R24A 4JHBA 1S7QA 3QXUA 1X44A 3HG1E 3UEZA 5CBEB 4GXUN 4U0RC 4OLZH 3JVGC 4NOBA 5CP7A 1FJ1A 1ZWIA 4Z78A 4KUZH 2CMRL 1C8PA 2XPGA 1T6VN 4HV8B 2DTML 1EX0A 2DDQL 4ELMF 1GGBH 2VABB 4Y5YA 2P5WA 1UH3A 4Q2ZB 1GPOH 3BT2L 5LAXB 4LLDA 1OLZA 1LD9B 3WIIH 3VFOB 1IAOB 3QDGA 3RKPA 5SX4H 3SKNB 5D96B 2FECI 3MLWL 2DM2A 5DQJB 2NXYC 4XNXL 3L5HA 3N9GL 3AC0A 3VI3E 3VG9C 2HJLA 3QWRD 3WD5H 2A6JB 3CH1A 1XT5A 5F7FA 2UWEE 3EAKA 4X9IA 1HI6A 2AQ1A 4R96B 1S9XB 2NMSA 4FQLL 5TE6H 5DZLA 1U58B 4Q7DA 4HBQA 1WEJL 3S35H 1IC7L 2O93L 1BFOA 5HVWA 5E9DD 4QGYA 1KCKA 3BQUD 3K8LA 5GGUA 3F6LA 2EDWA 4FQJH 8FABB 1EH9A 1H3XA 5ESQB 1PGRB 3ECBA 4L3CB 1AGDA 3BD3A 2Z8RA 3ULUD 4KXZI 3L5JA 4HAGA 4N68A 2VLRD 2MPAL 4P4KB 3WSQL 1CIUA 5T1LD 4RGMC 1A14H 1WBYA 5T3ZH 4NC2B 2WANA 4LASL 1Q1JL 4ONGL 4QXGL 3G6JF 5K9JH 4LRIA 4HKBB 3VXMB 2APXA 3WFHA 2OZ4H 5F44A 2YOCA 4ZNEA 4JG1L 3ZMRA 1ZTXL 2W1NA 1CD1A 3U2SB 1J12A 3LRSB 2XZAH 5IQ9A 4BSWB 3GMLB 4G8GB 3W2DH 1VCAA 4X6CE 5CD3A 4FTVA 4HF5L 3MZGB 2A1WH 4GBXA 3SDXF 2IFGA 4WV1B 1MIMH 2KQNA 3DSNA 3GSVA 1TTGA 4OZ4B 3SE8L 3ROLA 4MJID 1C08B 4PGZA 4OB5L 5DMGD 2DMBA 5JO5B 4OIIL 5KSUA 1L6ZA 1BX2A 3P9LA 1S7WA 1RZKH 1JF5A 1U92A 4Y8DC 5BS0D 2EH8L 4YNYB 4D0BB 3UZQA 1ZKAA 4OZHA 2WMPA 3MLXL 3PDDA 4NO2B 4FZEL 3T1FB 1KJ3H 2AJ3A 4JKMA 1SBSH 5D1QD 1DBAH 3NIDE 4RIRB 5TF1L 2YUXA 4R97B 3S3JA 5FECB 5TGBA 2VJXA 4PBWD 3L5XH 3HC4L 4P9HH 3W81A 1IQDA 2Q6WA 2BOBA 2Y06H 5JHDB 3BQUC 1H0DB 3MXWH 4HZLB 4GXVH 3DMMD 3S4SG 4QHNB 2F9BT 5F8QC 3B9KB 4YJZL 3ULUC 3OF6D 3L95B 1AD9A 4ODSH 4C4KT 2V9QA 2EDTA 3ROOB 5CKAA 4FN0A 3W9EA 3SE3A 4JLRB 5FFLA 3QEHA 5J1AB 4YDKL 5D2NC 1PG7W 3X14B 3P4LA 4NNPH 5HHOE 4LLMA 3O81A 1F3JB 3OKNB 1T1XB 4PTUB 3C6SB 1WIOA 2GQHA 1EVTC 2A9NH 4JVWA 4GXUM 3NCJH 4WHTA 4X99A 5C07E 2BVTA