5IWLC

Cd47-diabody complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
114
structure length
114
Chain Sequence
ELLFNKTKSVDFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CD47-blocking immunotherapies stimulate macrophage-mediated destruction of small-cell lung cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords 5F9 diabody
total genus 23
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iwlC00
2X40A 1HI6A 2L4OA 3Q6GL 5EULV 5C0FB 3UYRH 4FQ1L 3GI9L 3RU8L 4WWKD 4YHML 3VRJA 5CJQL 3T77B 4M7JH 3CLEL 5F8QC 5J6GB 2VDKL 1OP9A 1ZA6B 3EYUH 3WD5H 1VA9A 4D0BB 5I16B 1RFDL 5JW3H 1CFVH 1DQLL 4RWYL 1ES0B 3VMOA 2ZUXA 4I48A 1FLRL 1G7MA 5MEOA 1FSKC 3LKSB 3GBNH 5GPRA 5ISZB 4K94C 3QIBB 4KI1A 1HXMA 4LLQB 4JVUA 4DEPB 1SJVA 4MB3A 4QOKA 4L5FL 3W9EB 4EIGB 5FB8A 3DI3B 1MCWW 1BBDH 4EI5A 4XPGH 1GGBL 3GI8H 5AD0B 3ULUD 1M7IA 3OG6B 2WINB 3GK8H 3KPLB 4LQFH 3E3QC 4K3HA 4R8WH 1A8JH 2B2XL 4RRPG 4XRCA 2H3NA 2YD2A 1WTLA 4YQXL 1A6ZA 3EFFB 1L0YA 4I18B 1GGTA 1K3IA 4ZFOA 5KANI 5DJCB 1JZ6A 3MV9A 1S9XA 2DOCA 2AERT 1QRND 4LLUB 2R1XA 1KLGB 2FR4B 1A6PA 5ENWB 5HI5D 4GRWE 4NQEB 4QEGA 5CINL 4KRPC 3QWRD 4UUJA 1NH6A 2F8XC 1RURL 2MFNA 5KSBA 3F7VA 2LABA 4LLUA 35C8H 4N0FA 2BVYA 1ZSDA 2QSCL 1S5IL 1HHKB 4D3CH 2GAZB 1GH7A 3ROOA 3NCBB 4FFZH 3VD9A 1F6AA 3O2WH 3MNWB 3RPKA 2HKHH 5DYOA 2ZUYA 2I9LA 4YWGL 3TVMB 4MVBC 4LHUA 3EO1A 2NCMA 3FOMB 3OXSA 5L7XL 4PJ8D 4P4RA 3KXFA 5EN2B 2BFVH 1HHJA 3ARQA 1PX4A 3BWAA 2DQJL 3V8OA 4FTVD 3P40A 2D7QA 2BRRL 4MJIA 5IHBA 1LEIB 2X4RB 1RIUL 2EKJA 5KZCD 4BSVA 5C2UB 4GG8A 4R3SA 3KNBA 4PV8B 4EN3A 2FIKA 3KYMA 3OZ9H 4HZLA 5HTSA 5F72S 3AXLA 4S1RL 2AW2A 2BC4B 4XPGL 2PXYB 3RY4A 2R0WL 1MCBA 3AMKA 1BAFH 4G43B 3FN0L 4R97C 1I4FA 4PRBB 4HPOL 1TTFA 3H9YA 3O3BA 3KXFD 4FQHA 3RHWK 4WHYG 1T3FA 2MNUA 4HLZH 2YN5A 4IDLA 1I3GH 3ULUE 3U6RA 2GJJA 1FPTL 3BDXA 3B6SA 4ZSOA 2ZCKH 4HWBH 4PTUA 4HWUA 4PJGB 4UTBL 2YD1A 5D5MF 2YMXL 1SBSL 3P77A 3PIQB 5HHPA 2XKSA 3JTSB 3WD5L 3U36B 2BVUA 4M8VA 3QI9A 4Y0GA 4HZLB 3CFJB 2E9BA 4JRYA 1AIFA 5I71C 1CFNA 5J6HB 4OSUL 2DWEB 3GZKA 1AXIB 3VI3E 4AM0B 5IJVA 3QDMB 4MJIB 2IQ9L 4G5ZL 4WFED 2YSSA 4H8WC 4MQSB 1CGTA 4OCSL 3OR6B 2VLJB 4OCLC 1DDHA 2ATPA 1RZGA 1NGZA 4JR9L 5BXFA 3T8XA 2VAAB 4OCNC 3SGEI 1EMTH 3P4MA 4KKCD 2PYFB 3QEQD 2JJTA 4P5TA 1JZ4A 3VFSA 4C4KO 3ULUF 4RZCB 3RGVD 4AYFA 2GSIB 1CFNB 3VWJA 1QFPA 5GZOC 3V6FA 4NN6C 3FZUD 4HUUA 4ODUA 5CWSB 2ZJSH 3NTCH 3UPRB 3V7AG 4LDLB 3WUWB 5IHUL 3OPZL 3JBG7 5HJ3A 1INQA 3MPCA 4KTDH 4PG2C 2RR3A 2Y23A 1U6AH 3DIFB 3G5YB 1M05A 4MD4A 1GJIA 2H26B 4Y5YA 1J8KA 4GUPA 4LMQI 1BZ7A 5IVXF 3ZE2F 1T3FB 3OHXA 2EC8A 4B0MM 4M1CD 3WDHA 3EFFA 1XF3A 2Q7NA 2JIXA 2CKNA 3HFML 5DJ8A 3FB8A 3IXTA 3AY4C 2V2TA 4NKDA 3BKJL 3U2SA 3VJ6B 4A6YA 3WFDL 4PJEE 3KPRE 3QFDB 1KCLA 5B8CB 3ZL4L 4LCCB 4HIJB 4NHCH 4EN3B 3GRWH 5LBSL 1H3PH 4FQXD 3MLVH 1RJYA 1ULVA 3QBTB 3ZYOA 5KN5A 2VLKD 3K4ZA 4JFFE 5K9OA 1PG7H 2P24B 4P57A 5HHXL 5GRJH 1KEMH 4AIXA 2EXYD 3FOLB 2WQ8A 5CJ8A 4XMPH 1T7WA 3LPWA 5CJXA 4OBSA 3DRQA 3H3BC 3ZT5A 3QWQB 1ES0A 3IFPB 4ZO8A 4P9HH 5EUKA 4FZEH 4OUOA 1YPZB 3EYQD 4TTDD 3D9AL 5DUMH 4BZ2L 4UQ3A 4HFWB 5H35B 3EYFB 3WO4C 3ZTJH 5B21A 2XG5A 4WRLA 3G08B 2NY0B 3T2QA 5HYSB 3RHWF 2VLRB 1R3JA 2AJZB 2Z92A 1F4YH 2J6EA 5GRYA 1CE1L 4G8FB 3MRBB 5KS9F 4KDWA 1LK2A 4X6DA 1MCQA 4IMKA 3RUGF 3AU1B 5HHNB 2DYPB 1C7TA 4M93C 3ZDYE 3CXDL 1HHGA 2AXHA 5K9JH 1H0DA 4O2CA 4Z78B 5T3XD 3RWEB 1T80A 3GM0A 3HMXH 3U30C 3HI6H 4M00A 3RNKB 4M7ZC 5C0ND 3I50L 3HHRB 1VACA 3IU3A 4NGHL 1JPFA 3MO1B 2YUVA 3KHQA 5GRZA 3TC9A 2B5IC 4GBXC 2AK1L 3KPRD 5KANG 2AAVA 2B1HH 4QT5A 4XBGB 1NANH 3GDBA 2JLLA 1IGTB 1LO0L 2ICWI 4WW2B 1TETH 5EOTA 4XMPL 3TA3A 4JE4B 3FO1A 4LSRH 1AJ7H 4L4JA 4HEPG 2R1WA 3RZCC 5DVLA 4YHPA 4HJJL 3TZVA 3PUCA 2GYSA 4L9LC 3GSOB 3W11C 1U58B 4ZFZB 3SE3C 4Q9RL 3ILQD 1T2JA 5EORL 4GXVL 4MJ6B 1G9NH 1H5BA 2EE6A 3GO1H 2FLRT 3QQNA 2NW2B 5F7YC 1NGYA 1CVSC 4TSCL 5BV7C 2FGZA 2R2BB 2XKNA 2VERN 3VMNA 4LL9A 3ZT6A 1EFXB 1JWUA 1KTDA 1JWSA 1FVCB 1TLKA 4QOKD 3D69A 1DFBL 2Q86B 4ZO7A 2J5LC 1LP9A 4D0DA 1A7PH 3CMOH 5FO9A 3LRSB 3KYMB 3MACH 1E4XH 3MGOA 4GKNA 5CLTA 1E4WL 4O5LH 1U8LB 1NMCC 2FHFA 4P4KD 4K3DL 5FF6A 2IJ0C 5IIEB 1DUZB 2GJZB 5IB1B 1XCQA 3KPSB 3QDAA 4R2GD 4UI2A 2KZ1B 3BKYH 3IDXH 2ADFL 2N1KA 4OCWH 4ERSL 3L6FA 4OCMC 5H37G 1TJIH 3OAZK 5E8DL 1HCFX 3ARDD 4EZMA 5EIIA 1G7HB 5F1IA 2DMCA 3W2DL 3HNTL 3L3JB 2GTZA 3QB7C 3PDOA 3RDTA 1OT1A 5D8JH 4WI7A 4HS8L 1V7NL 4LNRB 3ALXA 5C0CB 3QIWB 3IU4H 1KYOJ 2WBWB 1YEIH 3VGHA 2NYYC 1OSZB 2ESVE 2J7LA 3NIFE 3RWDB 2I27N 3QISA 1Q94A 4HJGA 1XGYL 1UFUA 1Q1JH 3MA9H 4GQ9H 1IBGH 3BN9D 2GFBA 2J6EL 1PDKA 1YEJL 5IJKA 5C8JA 3HN3A 1X9QA 4K2UL 2KL6A 1DP0A 1FVEA 1MH5B 2R2HA 3WNPA 4PB9H 4ZS7L 5EG6C 1B6DA 1AQDA 2V7HB 3O6LH 4PYHA 4MA3B 4MQ7A 5CZVL 5I18L 4IRSB 1A2YB 1A6ZB 4N90E 1U93B 4AENA 3EOTH 5CIPB 1ZHNA 4MA8L 5E9DD 4M5YL 2D0HA 3WNMA 3QHFL 1RI8A 1NCAL 1XGPB 3D39D 3QA3A 2NZIA 5AD0A 1NCBL 1ZLVK 3RU8H 1YNLH 2ICCA 5DVKA 5C0BE 4F7CA 3IRPX 3S36H 3K1DA 4UDUA 5IW3A 4YEEA 1BFVH 2HVKA 2BY3A 4K94L 5AYQA 4K8RC 4N0CC 3DI2B 4JFOA 2HT4C 3KLAB 4F7CB 5JPMA 3V52L 1FFNA 4NFDA 3TT1H 3QFJD 5IV2A 3JWDH 1FVDB 4J6RH 2FHBA 3J7HA 4MSWB 4N9OB 4JRYE 4IDJL 1JZ3A 2B0SL 1JMXA 4NWTH 1F3JA 2IH3A 1J0JA 5TE4H 4K7PL 4A6YL 4OI8A 3L3HB 4NM8H 3SDAB 4IRSA 1LO3H 2DMBA 3CFEB 1YPZF 3GMNB 5JUEL 2ZUQB 4RWHA 3T77A 5E5UB 4CN6A 2DLFL 3F12A 1CG9B 1W0VA 1OM3L 5H2BA 2EDXA 1A7OL 3P4OA 2CLRA 4PRPB 1T20A 1EDQA 1GPOH 2X4QB 1YMHB 3LRHA 3TO2A 1QD0A 3WHXA 5F9OH 4XXDB 1ZGLP 2PO6C 2W9LA 5EUOB 1XZ0A 3L3KB 1MHEA 4ELMA 3KPNA 4H88H 4F3FA 5IW6B 1MLBA 4PY8I 2NY6C 4NKMB 3M17A 4LNRA 1BOGA 4Y2DC 2V7NB 1RUPH 4HC1A 4TSAL 4W6WB 3W0WE 2X4SB 3SJVA 4DUWA 2JF1A 5F1IB 2HT2C 5F93C 4MA7L 4R8WL 5I1CH 1ZAGA 5AZ2L 5D1XB 4H20L 1FNEA 2GJ6B 1U8LA 1QFUL 3U83A 3CU7A 3QG6B 4GKNB 2BOCB 3HZYB 3SGJA 3O45A 2R15A 5D2NC 2KUTA 3DX6A 1BD2D 1HH9B 4OLUL 4UBDC 3S36L 4PTTB 1OWRM 3GIZH 1BGXL 1PKQA 2H41A 5I0DA 4NT6A 1PLGH 1NC4A 2CDGA 3ELAT 3BP4A 4HF5H 3SBWA 4G9FB 1BQHB 1CDYA 3Q5TA 2J3SA 3EFDL 1A4JA 1PKQB 1MFEL 3TYFA 5JA9A 4JGUA 2XQYK 2Y5TA 3F7RA 1S7UB 3HC3L 1A6TB 5LGJA 3TYGH 5MEQB 2GY7B 1S7VA 2OQJA 2O61B 3AGVA 3GSOA 4R7NA 2W0LA 2OL3L 5FDYA 1MRDH 4NNYB 4EXKA 5JHDD 1MY5A 1U9KA 5C7XL 1A14L 5F7DA 4K8RH 5F96L 2P1YA 4M8QB 3ARXA 3CMGA 4UU9B 1UWXK 4JREB 4HKJB 3SDXA 3MYJB 5HHOA 1TJIL 5C07E 2BRQA 1JUFB 4JPKH 3MV8E 3V0WL 2LE9A 1JYWA 4Y4HD 1G1CA 3TCXA 3V4VL 3ZHLA 2VYRE 3FFDB 1J5OH 1NFIB 5A2FA 2EIEA 1MHEB 3C2AL 1BM3H 5E8OB 1WICA 1C16A 1BBJA 5T1KD 2VXTH 5IIEA 4Q2ZA 1FRGH 1IGCL 2OMBA 5DHYA 5HYQA 4MNQE 3LMJL 3SKUD 3IJSB 3IDIA 3TBWA 3TT3H 4JN2A 4WO4B 3FT3A 5BOPA 4XTRD 4HS3B 1QSEE 3G5VB 1JNNL 5GS3A 3P4OB 4PGBA 3NZHH 4MA7H 5I8EA 4MNGA 1EEZA 5INCB 4BQ6A 3CNKA 4M43L 4NQEE 4GRWF 1YPZA 2EDQA 1YEGL 3SQBA 3SKJL 1F3JB 2IH3B 2XG4A 4L8DB 1CD9B 4PJ9C 4PJAE 1KJVB 5EBMB 4D8PA 4KMTH 4GAJH 4RX4A 2J4WL 3BT2L 4JDTL 5HD8D 2NY5H 3N0PB 4GRMA 5MEND 1EAPB 3MV8B 4QXGL 3WFEH 4D9LH 3BAEH 4YPGB 1HKLL 4HC1H 2J8UF 2BCKB 3VFOA 4EI5D 2VAJA 4MA1C 1WEJL 2D31A 2PTTB 4NO5A 4U0RB 1B4JH 4RFOL 2FECL 3C8KB 4LPXA 5B8CA 1YY8B 3UTOA 1R3IH 2GJ6D 5FECB 1C1EH 4G8GE 3PL6C 3CZFA 1NKRA 1ZHNB 1OAQH 3TYFB 2XRAH 4Y16D 2QEJA 4ZTOH 3UCRA 1A2YA 3L7EA 4CJ0A 5TFSL 1OD7A 3BUYB 4N0YL 1BZ7B 4K7PH 5SWSE 3DETD 4Z7VE 4WEMB 3BPNB 4HBCH 3DO3A 4APQD 2DKMA 2F54D 4AQ1B 1MH5A 2H2PC 4K3JL 3CXHK 1T0NB 1C5CH 3OGCA 3CH8A 1D5IL 4AEHL 5HYQB 4PJEB 2X4TA 3CH1A 3ARBD 1T0PB 1FNEB 1REIA 4L4TA 2H32A 4J3XA 4UOW1 1UG9A 5JOFA 1Q94B 2Y72A 2P46B 2YD8A 1F4YL 5F7HA 1IAKB 5EOQH 4DQOH 1KFAH 4G8EB 3WJLA 1WEJH 5AG9A 3ARWA 4MDIB 4WDIB 5C0BD 1NGPH 3MZGB 3X3FL 4Z0XB 4F37F 3HPJA 4JZJA 3WFEL 4QGTA 3LY6A 1KV3A 5DRZB 1CLZL 3NCFB 1F2QA 2OJEA 4X7SH 4KPHH 2WBJA 3HMXA 1INDH 4PJBE 1X44A 2QQLL 4M7LH 1GYAA 1KENH 3F7YB 1K4DB 2B20A 1I8LA 5F44A 1T89A 2X4QA 3ZKSD 4RAHA 1DL7H 3NVQA 1QFWL 2BJML 4GW5B 5FKAB 1L7IH 3KYKH 1PG7W 3D69B 1EMTL 4A6YB 3S4SB 1S7RA 3WUWG 2BXZA 3FB8B 3IXTB 1MF2L 1FHGA 5DEGA 1XF3B 1YECH 3R0MA 2WWKT 3PXJA 3WIIH 5BW7A 1NDMB 3VXSA 4GSDH 5GGSA 1Q9OA 3KWWB 1W72L 5H8DA 3FMGH 2E5EA 1AR1D 2NW2A 2IWGA 4GT7A 3M1BB 1NBZA 1J8HA 4UT6H 3FO9A 4QGYA 4J3VA 3CFDA 4S10A 2EH7L 4UDTA 3ZKNC 3MV8D 5HI3D 5JLZB 3L3IA 5GRWA 4AT6A 3MV9E 3SCMB 1JPGB 4EBQH 4QHMB 3TA3B 5DD0L 1L0XA 3EYQC 4TTDC 1U2CA 1F4HA 4KROC 3QNXB 1F4AA 3TGXA 4KPHL 4CVZA 5I74B 1FYTB 1I3RB 2QHRH 4KAQL 3T0WA 3BQUD 1HQ4A 1HZHL 1MLBB 1M6OB 5ESVA 3Q6FB 5JIPA 4G6AC 2OMNA 1UWGH 1AQDB 3MLTA 1B2WL 2HH0H 3D1MC 4J2XA 2ARWA 1FO0H 2XWJB 3OSKA 3L3OA 5JOPD 3K2UL 3EIFA 1DVFD 4XP5L 2XZCL 4F7PB 1RZIA 2YD7A 3GMPB 4QKXB 2RJMA 4HBCL 2EDKA 2FO4B 2VWEC 4HJGB 5TE6H 1IC5L 1EEYA 1WBZA 3G5XB 5TDPB 2AJ3B 1PX3A 5DLMH 5EWIL 3SN6N 3MV9B 1KCSL 2IAND 2JKXA 4K07A 3NCCB 3RY6A 5EUKB 4LSQL 2EH8H 4GRWB 1ED3B 1WFNA 4GXUM 3B9KD 3QO1A 3PDOB 3RDTB 5K59E 1TZIA 5FOJA 2WWMD 3BD5A 2NY7L 1I9IH 4DVRL 3NFNA 2BOBA 2BHUA 3LZFH 4OZGB 3QCTH 1F8TL 1TITA 1UCBH 4G6ML 4G42B 3BWUC 1UB6B 1ZT1B 2QHRL 4JG1L 5DDHA 5DMJB 2GJZA 1J1PH 1UKSA 4G7VH 4J3WA 2VUOA 4MQXC 4YE4H 5GGQH 5DQJA 3LKSA 2NXZB 4X80L 3NGBC 1HHJB 1A5FL 1CCZA 1N3NA 4W68A 1AY1L 1LEGB 4OD3L 2R69H 4P4RB 3VJ6A 2JIXB 3WMSA 3U2SB 3WO3B 5F3BA 1EFXA 1JWUB 1WFTA 3S6CA 4L8SB 1JFQL 2PN5A 5E8PB 5IVXA 2LTQB 1ZVSB 3D2UB 3ZT7A 3ZKXB 3DURB 3RIFF 4C83B 2OSLB 2ZSWA 1ZHKB 2HVJA 5MP6L 1KXTB 3CUPA 1LVEA 1UQSB 4IOIB 3O8XC 1CD1B 3GUTA 3O6FB 4Y5VB 4XC3H 1KLGA 2FR4A 3VWJB 4NHCL 1KPUB 4PRHA 3TT3L 4I9WE 4G7YH 1RURH 3LDBC 3VFSB 2Z8RA 5GISL 1HIMH 1CGXA 2PUQT 3O4LA 3SGKC 5JXAL 1EGJA 1AC0A 2P5WE 4HXBH 1NJ9A 1OSPL 1I1AC 5AUMA 2UZYB 2IEPA 4Y89A 3NIDE 5GSVB 4AZ8A 1KIUA 3QUXB 1J5OL 1MHPH 1XR8A 4R4ND 43CAA 3HLAA 3G6JA 3HRZA 1VEMA 1OAZH 3QIWC 2C3VB 1ETZB 1K9TA 5I19L 1IGYB 3T0EC 1MRDL 1MFCH 3IVKA 3BD4A 3A6BL 4AM0A 2DWEA 5GGTA 3DJ9A 3GSNL 5I1KL 3V4PL 4HSQA 4HJ0D 4ZFOL 2YPLE 3LRSA 4AT6B 1ZOXA 4AIZB 1FL3B 4KKBC 1AGCB 2VLJE 5C0CE 4Z7UE 1G0XA 3CLEH 5SX4I 2OSLA 3U1SH 4P2QA 5CP7A 3D0VA 5IEHA 4U31A 4FP8L 5GJTL 5DK3A 2R2BA 2AABH 2XKNB 3P2TA 3VRIB 4OZIB 4PRHE 4Z77A 4OLUH 3RUGE 4POUB 3HE7C 3BX7C 2YC1A 43C9B 5JPNA 5L2JA 4MXQD 1I4FB 4HK0A 2NY1D 3O3BB 3F5WB 3IDMB 3ULVC 2CMRL 3PHQA 5BMFL 4Y4FA 1R3LA 3QDJD 3W82A 2E9IA 4RGNC 4XNUH 5C9KA 1K4DA 4FQ1H 1QR4A 4P2OC 3H2WA 1RHFA 3OAUL 4Z7QF 2MCG1 5JA8B 1EO5A 1C1EL 1OLLA 3T4AA 2B1AL 5KJRH 5J3HD 3RGVC 4HXBL 3TO4B 1GXEA 4XVUC 2RQ8A 4WWKB 1QOKA 8FABA 1PZUB 1LD9B 3FOMA 3OXSB 1OQOA 5D7IF 1KN2L 4KGJA 3RWEA 1A3RL 2Z31B 4Z78A 2GCYA 4FQLL 2D2OA 1S8DB 3GKWL 2CGRL 4PLNC 5FHAH 2GAZA 3VGDA 4BQ9A 1JNJA 1T66C 1OP5H 1IEAA 5IOPB 5CKGA 3TFKC 3GEWB 1JHLL 4NC1E 1CXHA 1I1CA 2J88L 4QY8B 3KGRA 5CHNB 4BM7A 4NCC1 5TE7L 3L9RA 3ARGA 4PRPD 4Z7OE 3MBXH 3BHBB 4Y1AB 4YHYB 3KR3L 1CN4A 3QUMA 4GKSA 3X14B 4ODBD 4HFWA 3JTTB 1S9XB 1S7XB 3R4DA 5C1MB 1D6EA 3OKOA 3UTSD 1OM3H 4K7FA 3OF6D 2H3NB 3H9SB 3O4OB 5F3BB 3WN5A 3CDYA 4JO1H 1R5WA 5CBEA 2A9MH 3BZEA 4TULL 1OAYL 4FG6D 4R4BA 2WWKO 5I1HH 3SGDI 3TO4A 4XCCH 3GO1L 4Y4FD 4NZDA 5DD5H 3LQAH 3TH4T 3DVFA 4KK9C 4PJCB 5FUCE 3D3VB 2Z0BA 4HJ0C 5J6HA 1Z9LA 2OCFD 4DUVA 3FB6B 3L1OH 2BNRD 4CVXB 2PXYD 4LCCA 1V7MH 3D39B 5DD6A 5J1AB 3F58H 4Y4HB 1ZHLB 2DQCL 3IT8D 3CFDB 3H0TA 4UV7H 4JFFA 3QIUC 3F5WA 3IDMA 4I48B 4HCRL 5I30H 2GHWB 5ACMA 1U8KA 3MV11 5DJ2A 3SOBL 3C08L 2GK2A 1UENA 1A0QL 2E6QA 5DTFB 2GW5A 2J8OA 4ESKA 2OK0L 5C0FA 4HPYH 3IS0X 1MCJA 3TVMD 3VFMB 4GW5A 5FKAA 1MOEA 3TBWB 4KZDH 3L3OB 2JB5H 5DHYB 4ZQKB 2NY5C 1KBGH 4PV8A 5DUPL 2C3GA 2XQBH 3T09A 3V5KB 5E9DE 4W6XB 5D7LD 2NY1C 1I85C 1XGYH 3PWPA 4IJ3C 1NFIA 3IXAB 1ZT4B 2OJEB 3V4PH 5EZJB 4Z7UA 3LN4A 4RWYH 2VZSA 4NQDD 1LP9E 5FO7A 3QUXA 3SGKA 3R8QA 2G75A 4NO2B 4GW1A 4PJ7A 1T5XB 2A73B 2VXVL 3ZO0A 1IGIH 1KEGH 1AGDB 1XAUA 1A9BA 2E7HA 1EXUA 4NPYB 3LKRA 1VGEH 5EPMA 3STLA 3LAFA 4KRLB 3GHBL 5CILH 1OAKH 4P46C 2VKXA 4K23H 4RQQA 4P2OB 5I6XC 5J1TC 1KOAA 1OP3K 4O58H 2WBJD 3MLVL 4P5TC 5IMKB 3OGCB 4RAUB 5E7FA 3K0WA 4XWGH 1NUGA 1OTTD 1QKZH 1SY6H 1X5FA 1L6ZA 3QYCA 3MACL 4RDQG 4M4RA 5I1IL 4X7CC 2R1XB 1ONQA 2ZUSA 1RY7B 4ZMAT 4LSTL 1N4XH 1FL6B 5F1SA 4OFPA 1GPOL 3RVXD 3BUYA 5MENA 5J9PB 1KC5H 1NUNB 4YAQA 4MD0A 5DEGB 5E03A 3JUYA 3OL2A 1A7RH 1LP9F 4PJ5E 5I73C 4F15B 3QI9C 4LPVA 3VRLE 1AH1A 2RCSH 5C0AE 3NABH 1G9ML 3SE4C 4CGTA 1KJ3H 3ARBB 4Y5XB 1YUHA 3GFUA 3NFSL 4M9PA 5CZXD 4BUHA 1ZGLM 3CK0H 4GOSA 5C0DA 5D72L 1HQRA 4PREA 4B5EA 5L8LB 5CILL 4LSPH 1I9EA 4U1LA 1MIEL 5T1LA 1VGEL 4Z0XA 4J4PC 1YNTB 1AD9A 1CR9H 3VG0L 2W9EL 3MRPB 4M3JA 1RZ7H 5D6DA 5HVFB 4NKMA 1T1YA 4ETYA 4YH6A 4OI7A 2A74B 4U6HB 1HHKA 1U8IB 2UZIH 4RFOH 3KPNB 3O2VH 2H32B 2OX5A 1JZ5A 5IR1A 2X4TB 3LDBB 4U4BA 5D7LA 3TVMC 3WHE1 3VWJC 2DQEL 1AGBA 3RNQB 4Z5RA 4DKAA 3D85D 2VL5A 5HSFA 4P2QD 5C9JB 5C09A 2FSEA 4XNXL 1LILA 4KHTL 2AQ1A 2B4CL 3BZDA 3S5LA 3U7WL 3PXHA 1RAMA 1SBSH 2JB6B 5DJCA 4OLYL 4JQXA 1YEJH 2XPGA 4Q0XH 5E2VH 1NPUA 3VDAA 5C6TH 4F9PA 3RL1A 3RWGB 3V6OE 2MSPA 4XRCB 2WBJC 2BVPB 5KSVA 1GZQB 1VENA 5IG7B 2Y6SD 2XV6B 3NFSH 4KI5F 1X4XA 4OF5A 2Z8SA 5HGDA 4TSBH 5FM5M 4HGMA 4LCWE 2R0ZL 3SHSA 4PGJA 1JNLH 1G6RL 4L29B 2BCKA 3UP1A 1MFBH 1EHXA 4G6FD 1FAKT 1CDJA 4YPGA 4S11A 1QSFB 1NCWL 4PY7A 5ERWA 5DMGC 4NRYA 1JPGA 2VXTL 2R4SL 3QDGA 4IIQB 1ZGLB 3Q1SH 3P3YA 4OZFH 1LMKA 2AJYL 1BM3L 4UDTB 3QA3B 3CK0L 1QLRB 2CH8A 1OGTB 1A1MB 2BRRH 4D8PB 1HXYA 1W2KT 2X89D 2DN7A 3KAAA 4G8IB 4JFQA 4LGRB 4RISH 4DN4H 2PNDA 1VFBB 4YXLH 5EA0L 2RAMA 1VCAA 1U6AL 4JQVA 4OZFA 2BFVL 3DVGA 4OCXH 3FCTA 1ZTXH 4J23A 3DX8B 5LWYL 3LS4H 3HS0B 4PJIA 2V7HA 4KY1L 5D2NE 2NXYD 3CC5B 4PG9B 4M43H 1PKOA 4GBXA 3ZDZE 3SJVE 4N0UA 4FS0A 2EDRA 2V5YA 1URLA 3DXAD 3UBXA 5ID1A 1HYRC 4ZXBC 4LP4A 1ERNA 3RVXC 3QH3A 4L3CB 4RGMC 5MI0B 3KPQB 1OAUH 4IOFC 4NN7C 2OTWA 1S7SA 1U8OB 3RWDA 4MQXD 4LFHD 1JGLL 2DMKA 2YXMA 1OSZA 1BIIA 1T22A 1D6VL 3SY0A 4O58L 2YA0A 1OB1A 4FQLH 4OIBA 2C1OB 3GMQA 3G9VA 2ZKHH 4JHAH 1PQZA 2GQHA 5FK9B 1U92A 5EDXA 5KSAD 4ZOBA 3OGOE 4RISL 5HYJE 5JOFB 2F54A 3MA7A 1DQLH 1VB9A 2UV3A 3CH1B 2VISB 5FYJU 4LIQE 5J13B 4LAJH 5B3JF 3UTSB 3GBMH 1WLHA 4ETQB 4QHNB 5T5NG 1OTUD 5DMYA 4LCUA 2BK8A 1BWWA 2Y5TB 3CC5A 3FQXA 4LP5A 3GRWA 4Y4KA 3P0VL 3O8XB 4ALAH 5KVFL 1DLFH 5DS8A 3S3SA 2VDRH 5D7JA 3PGDA 4XVJH 1D9KC 4BQBA 2WIIB 4KROD 4QRRA 2DBLH 1CS6A 4M61B 5KVEH 1NFDF 1TFHA 1HH9A 3EYUL 1M4KA 4DQOL 1P7QD 4UILH 4HF5L 4ZFZA 5EFIA 4H26A 3K74B 3PGFH 5BS0A 3HI1B 4WJ5A 5D71L 4NRYB 5C71A 2VDQH 2RBLA 1RJLA 3LQZB 2W07A 1BX2B 1YN6A 3E2HC 1R5VA 4NKOB 5KSUA 5I2IA 5I8OH 3GSXA 5DD1L 4K3JH 1NANI 2HFTA 5EOCL 4XBGA 1J1OL 2FYYB 5BV7H 4AMKL 4S0SD 5E99H 1U8MB 4E5XA 4YDKH 4L8DA 2NR6C 5EBMA 5GS0C 4A6YH 3PF2A 4HKZA 3HAEH 4IEFB 3RNKA 3RVTD 4XMLH 2GTWB 5ITFA 3C5ZD 3EZJB 2DYPA 3WFBL 3MRLA 2VDPH 3L5WB 1CFSB 3LN9A 3IKCA 1MJUL 3CFBA 4Y8DC 5I76A 2QADC 4Q6IA 1QR1A 3C5JB 4UT7H 3OTTA 3S36X 1OPGH 2A77L 1L6XA 5TE4L 1KG0A 1BBJB 1RUML 5E8OA 4LVNB 2EYTA 3ARFD 1F4XH 5FEBA 1EJOL 1JHKH 1QBLL 1S78D 4DGVL 1ZANL 4PGZA 5FKPB 1FZKA 3MRFA 3PJSB 2HTLD 2QSQA 4LKXA 4IS6B 3GMLA 1P4BH 4I9WD 1BQSA 2ZUQC 3Q5OA 3BISA 5K33A 2FATH 1G7JA 5CEYA 5C0DB 2Y7QB 2JK5A 2YN3A 1A22B 1S3KL 1T66D 3MRIA 3CVHH 3HNSL 3HUJF 3DPBA 4XNZC 5GS1B 1O7SA 4KK8D 3ULVE 5JW4Q 1MREL 1AP2A 1WIOA 3THML 4HIJA 3CFKB 3MLXL 1P2CA 3VW3H 1EA9C 5FGCE 2DD8L 3UEZA 4FFWD 3AAZB 5DEFB 4JG0H 3EDFA 2QR0B 5I1AA 3SY0B 2VSDA 3VFWA 3D87B 4O51A 2VZ1A 5A2JH 4JO4L 5ABDE 3ULVL 1NCAH 1HEZA 2J6EH 3NFPB 3RX5A 1CXLA 1EX0A 3GB7A 1YEDB 2C3WA 4WHCA 1EBPA 1UA6L 4S2SB 4HX1A 4HPYL 3W0WD 1AI1L 4XCEA 1ITCA 4DK6A 3ILPB 2HFGH 3QZWG 1FZJA 5KG9B 2ZCKL 4HWBL 5CZVH 3RVUD 4FZ8H 4N0UB 4WHTA 2A0LD 1LE9A 4EUPG 4HUUB 2GJ6A 3MFGB 1G7PA 3FO1B 1BVKB 4IRJA 2P5EB 3BYTA 5FDWA 5GGVL 1PY4A 4LDOB 2O5ZH 3JWNC 4Z9KB 1AD0B 3HUJA 4WU7A 4JFED 1QFWM 1HKFA 3R0NA 1NGZB 4HIEA 4U6YA 2GI7A 3UYPA 3WIHL 5I1LA 2XWTB 3OB8A 2Z4QA 3MRMB 3GSNH 1RJCA 3AM8C 4ODXB 5KVDL 3WXWH 1CDIA 4WFGD 4ZFFB 1IC7H 3TH3T 3CMOL 3MJ9L 1RQ5A 1HHGB 3QEGH 5FCSH 5K93A 3L3KA 3KPSA 4Y5XC 4FTVE 1DN2A 3CPLB 3CDFA 4EN3C 1OCWL 2ZCLH 4L29A 5TGBA 4N0CD 1FIGH 3O4OC 4WO4D 3MGOB 1WK0A 4JFEB 4KJWC 4V1DE 3VGGA 2VXQL 1MFDH 2MPAL 5E00A 5HGDB 3ARED 2ZSVB 2IAMC 4KMLB 1FNHA 1OGAB 1C08B 3BGAA 1RUAH 3N50A 5DQ9A 1OF2B 1AGFA 2OTPA 3IGAB 2JCCA 3EYFA 1QFHA 4PTUB 2BVOB 4XPHH 4UQ3B 4ORGA 5HVGB 2DQGL 3C8DA 4XMKH 4LCWD 1J12A 5CMAB 6FABH 3D39E 3C5ZC 2VDOH 1QO3B 2UWEE 5T5FH 1LQSR 2EEBA 4GSDL 5LWYH 5DC0A 4WI6A 2HT2D 4Y4HA 3U0WL 1AXTL 2FX9H 4QRPE 2XIDA 4UT9H 5ESAA 4IMLA 1N5YH 4KK5D 4LPCA 5J56B 1UJ3C 5IF0B 4P46B 3QT2A 4RIRB 3RWIB 5C6TL 3RZCB 2X10A 1YDPB 2DDQL 1BIHA 5DJ0A 5JHDA 2W60B 1XFPA 3MV7B 3G5ZA 2IC2A 3GSWA 1QZ1A 5D7IB 3UMTA 4JFXA 1XF5B 3MNZB 4U2YA 1MELA 1RIVH 3BQUC 1FNAA 1X6LA 2R2CA 5C0BA 1AO7E 4LARL 3IDYC 3JTTA 4JHWL 1KJ2A 2NW3B 5J1SC 4IDJH 5BZWA 4Z7VA 4D0CA 1RK1B 3WJJA 5DZNA 1FV1A 1NLBL 2OM5A 3LKQB 1KGCE 5JO5B 4OF0A 5SWZA 3FN9A 15C8H 1TVHA 4LSVH 2UWEF 3MUY1 1Q0XL 4WY7H 1RMFL 3HZKB 2OZ4A 5JIKA 1S8DA 3KHOA 2GCYB 5FYKD 3JZ7A 4ZFOB 3PQYD 5HY9B 1EHLH 5IT2H 4YC2B 4JDZB 1TQBB 4RFNC 1P7KB 4JO2H 5F7UA 3QQ4B 4YHZL 3ARTA 3HC0B 2Z91B 3JV0A 3PWVB 5I9QB 5DT1L 3VWKB 4YNYA 4QRSB 4FXGA 2AXFA 4JREC 1H5BC 3CFJA 3G04B 4LLQA 1KCUH 4OCRH 3U36A 3BKCL 5ISZA 3JTSA 1I7TB 3O3EA 4H8WH 2YPLD 4PJ5B 1NBYB 2WLYA 2NTFB 1F58H 1IGJA 1DEDA 4XC3L 1N59B 4WCYL 5LXGL 2Z9TA 4QHKJ 4FTVA 3WFCL 1S5HB 3NACL 4P5KB 3IDGB 1BQUA 2G9HB 2YPLB 3VXNB 4YXHH 3UJTL 1OAKL 1MHCB 2R9HD 4J1UA 5CGYD 1DBKL 4WI3A 4AY0A 5HYSG 4HGWB 3AXLB 2DRUA 1KEGL 5IUSA 2DYPD 4YHPB 1MHCA 3WNKA 1J86A 4J8RB 3KNBB 4L3EE 1A7NL 4RMUA 4JKWA 5DGRA 3SKOB 4RZCA 2HTKD 2J8UA 1FFOB 1JL8A 2PYFA 1RUKL 2ZCHH 4P5TB 2AJVH 2VE6A 3PWUB 2AKRB 5GJSH 3MOBL 1J1OH 4GG6E 2Z31C 2FHCA 5GZNC 4G6JH 1P4IH 3SDXE 4JZNB 4PRIB 3T3MF 4UAOB 1XIWD 5DT1H 5AUMB 1R3KB 1I7TA 4XNZB 2IPKA 1N6UA 2NQCA 2CQVA 2L7JA 4S1RH 2QKIB 4MZ3A 1RJZA 2NXYC 4JJ5B 1Q72H 1A6AA 3UDWC 1EO8L 4DEPC 1AIFB 3C9NB 5C08A 4LCIH 2OI9C 3TNNA 2VLKB 4RMVA 1UQSA 5CJXC 1P7KA 3VA6A 4R4BB 2HVJB 2E7CA 1BWMA 4FQXB 4LGSB 5SWSD 4PJGA 3ZTNL 3K1KC 4B7LA 2JJWA 3SE9L 4CADB 3TBVB 3TYGL 1AQKL 1CFQA 5MERA 4X8JB 2B4CC 2IPUG 5E70A 4L8SA 4NGHH 2HKHL 4NQVA 2XFXB 5IB2A 3DRQB 3RPIA 1RZJH 4H1LH 4WGVB 2WP3T 2H2PD 5D9SA 5M94B 3ARGB 3QXAA 3ESVF 1OVZA 5CHNA 1GHFH 5F71A 3VFTA 3U0WH 2A6DA 1T21B 3H7BB 1RJZB 4JJ5A 3T0EB 4X4MA 5CP3A 5LGHH 4PJAF 4CNIB 3WKNA 5FYJE 4HZAA 4GAYB 4LCIL 3SKNB 3TBTA 2OXGA 5IMOB 1JPTL 3BN3B 4YPJA 5DJ8B 1I1AB 2V2TB 3VCLA 1IAOB 3EO1B 3ISWA 2DQIL 1A7RL 3ZL4H 4QXGH 4L9LA 1X6NA 3BH9A 2HKFL 4KQ4H 2NY5L 4H5SA 5I1GH 2W92A 1I8IA 5SWSA 2BY2A 4JFZL 3BPCB 2A6DB 1U3YA 5ESAB 1KPRA 3MRQB 2XZQL 1FGVL 3ET9F 4ZYKA 2C4XA 4EVNA 5K9KB 1CGUA 1JTOA 3FFCD 1K6QH 5IBLD 4LVEA 4ODUB 1G0YR 5HGAA 2E7LA 4ZUTA 1U0QA 4LGPB 1JI1A 3WEXB 4Y2DA 5CD5D 5F3HB 3Q6FA 4NQDE 4DCQA 4ZOCA 3MLWL 2YPKB 3MRRA 3K8MA 4ZS6C 4NNPL 1KC5L 4L4VB 1KUMA 3MR9A 3DLQR 1D7FA 1YEKL 4PJ5A 5I8CA 1FL3A 5DUBB 4MZ2A 2DL9A 2A6KB 4PB0L 1CICA 2VLLB 1F00I 4QRSA 3HMWL 3HA0A 1GGIL 4JRYB 1NMAL 2VZ3A 4OGYH 1HXMB 1CVRA 4MNQD 3UJTH 3GSRA 3C6LA 3HR5B 5EU7E 3QUZD 3O2DH 3VD5A 3DUSA 4UB0H 5IWLC 2NY0D 4XZUB 1KB9K 4GRLC 4U6YB 4RGNB 3PP3H 4YDJA 5E9DA 4V1DD 4JR9H 2YPKA 4G80B 4FFVD 3PWUA 1WIPA 1ZV5A 5BS0D 5KW9H 2WNGA 3OJ2C 2Q20A 5C09D 3WEXA 3H3PH 4NZRH 1BVKA 4IRJB 4KXZH 1IM9B 3HE7B 4JHWH 3SOBH 5DRWA 3ZKMC 1JRHI 2ARJQ 3AS3A 4EJ1C 5DC4B 1I7UB 3GJEB 5CJQH 3SDAD 1FZJB 5T1MA 4Z76A 5I1DB 5JO5A 5T33L 2XXCB 1ZVHA 4W70A 4ONHB 2AEPL 1DUYB 4J3TA 1WZMA 2HMID 4H5SB 4QYOB 2ED8A 4PLJD 2E8ZA 1NAMB 3N9GH 3I3BA 1NMAH 4OGYL 3TBYB 4X4ZA 3B9VA 5I74C 1IGJB 4KUZH 4UINH 5IQ9A 5F70A 5EN2A 4Y19D 4WW2C 4DZ8B 2IPTH 3EJZD 1DQML 1CGSL 4GAYA 2WWMC 4UMGA 5GHWH 2I9LB 4RMQA 2AJSL 1B3JA 3AREA 5C08E 4LOUC 5GGSY 4MDJB 1GGCL 2AK4E 3WBDA 5HHMD 2V17H 2NY1B 2R0WH 5IF0A 3DTXB 3BXNA 4CU6A 4NQDB 4MX7B 4LF3A 3RTQB 4GMTH 1NGWB 4YWGH 3D6GA 3HC0A 4LLYB 1G7JB 2AJUL 1SHMA 3X13B 4P3CL 5HYJD 2P42B 4I2XB 1TZIB 3LRGA 4OZGE 1KIRB 3MRFB 3LKNB 4LCWB 5I8KL 4IRSC 3QDGE 5DD3L 5FV1L 3Q5YA 5ISZD 1C12A 4RMWA 4HT1L 1YZZA 1P5UA 3L7EB 3RGVA 3PQYE 1LDPL 1JHLH 2NY2D 3GKZA 4GJTB 1FDLH 4QTIL 4WTZA 3S3PA 3STZA 3R06B 5INDA 2PCPA 5H94A 3GMPA 4F7PA 3QCTL 3W5NA 3FTGA 1N5YL 3IKCB 2X70A 2F5AL 5CBAB 2FX7L 3MRLB 3ZYJA 2NX5D 3BO8A 4F7TA 4M5YH 3IF1B 1QNZH 3LN5A 1AJ7L 4MB5A 1Q9KA 5DJZA 5IFJA 1MNUL 4L4VE 5IVNA 1T7XA 1IGCH 3OAUH 1I7RA 1BQLL 1FO0A 1TJGL 4DW2L 4G9DA 4Y1AD 5ETUA 5B3JE 5F96H 3IYLW 1UCBL 4G6MH 2FL5A 3PWNA 2W60A 1WV7T 3LZFL 3GNML 3DROA 2ARJA 3PGFL 3QNXA 2AKRA 2RIKA 2BNUB 4NJ9L 3GBLA 3GBML 4WTXA 1XCTA 4J3SA 5FDWB 2A6JB 4GAGL 1QA9A 4JM4H 1RIHL 1B0GB 5DWUH 1E6JH 5CZKA 3V5DA 2GT9A 1VKXA 4N9GA 4AL8H 1DBAL 1YQVH 3LV3B 4O9HL 3TCLB 4Z7NE 1RZ8B 3DOSA 1E27B 4CMMA 2ITCA 1J0KA 3TPUB 5ESQA 5DZLA 1QFWI 4YHLL 3VD7A 1ADQL 4FTVB 5FYKH 3K8KA 3AS1A 3V7AE 3ARFA 4HAGA 1AGFB 4NC2B 3L7FB 2WUBH 1CK0H 3PG2A 1ND0A 5ALCH 5I1JL 1UA6H 4X7TB 1Z6JT 4I3RH 4LRIA 1SEQH 4HKJA 1JGVL 4FXKA 4C56B 2X4PB 3W5MA 1S9VA 3ZE1F 3F7YA 2GK0A 2AGJH 1WCBA 4XCCL 3EJYC 2APWA 3TO4D 2VWEE 2CRIA 5GIRB 3MODL 3UJIL 2HFGL 1JHKL 1P7HL 4OLXH 4XBEL 3RTQD 3G6JF 1S7VB 4LHUG 1PBYA 4ZAKA 1D5XA 4XHJD 2FZ3B 3O8XD 3U79A 3OXRA 3PL6D 4X9BA 4EBQL 2OP4H 5F89B 1KIQB 2R29H 3PJSA 1LO5B 2F53D 2WMPA 3ARFB 1LO4H 1SYSA 4UT7L 2ERJC 3P30H 1I1FA 2VC2L 5D96B 4QRUA 3QIUA 3EYOA 4JFYA 4KKNA 1O7VA 1I1YA 4MCYB 1RZKH 4EI6A 4LLMB 2BNQD 3V0VB 3ARVA 4FQ2H 5LVEA 1HIML 4ZPTA 3OAZH 4DOHE 4QRTB 4FABL 2BOCA 1FCGA 3HZYA 3HB3D 4H88L 1MAJA 3JV6B 3HG1B 1ZT7A 4EEEA 4B7IA 1U91B 5DRNB 1CFSA 2AXGA 3QUYD 1W0WB 4JFYB 4NUJA 4U6XA 4NWTL 4O2FB 2Q7YB 2NYYD 1WC7B 1NFKA 2FH8A 5ITFB 1W0YT 5CJBA 4M9OA 3MNZA 2H45A 5GGTH 3TN0B 2P47B 4TQEL 3W11D 5I15H 5FOBB 1B0WA 2ZP0T 2APFA 4JM2F 4TUOA 5IK3A 5SX5H 2XN9B 2OYPA 1XH3B 1QLRA 4X6BB 1MAMH 5CSZA 5JXEA 1XF2B 2CDEA 4I4WB 3ARZA 2D31B 1LO2L 3U9UA 5E4IA 2W0FA 2PYEB 3PQYA 1MI5E 2O5YL 4MNHA 3MV7D 5CBAA 5LGHL 4JGJA 1N0LA 3QEQE 4BFGA 3N1FC 5I75C 4YBQD 4C55A 2QL1A 5F6HJ 3GMLB 2MHAB 4G8GD 3GMRA 5C0RL 4ORZC 2OR9H 5KVGL 5L8KB 5TDOA 3E6FB 2BVOA 3NZ8B 1MY7A 3IFOA 3RIAF 3HZVB 1SMAA 2VABA 5GRUL 1QSFD 5IGXL 4HIIB 4Z7OF 1I3GL 3CFIC 2XZZA 3A67H 3I6LD 4LPUA 5E4EB 4L1HA 4XP4H 2BSTA 1K3ZA 3PL6B 4Q2ZB 3T2OA 2F54B 3MA7B 4KRNA 4M1DH 4HQQL 1MJJA 4H25A 3AREB 1HN1A 3PNWB 1IAII 4MJID 2OJZL 4Z8FL 2ED9A 4U1NB 5DD0H 4Y16B 2IADB 4P9ML 5ETUB 2HFFA 4NIKB 5IQ7L 3TN0A 1OB1B 2O5XH 3RDTC 5E5MA 3QEQB 1RD6A 4BK4A 2VIRB 1FJ1A 1NAMA 2XICA 1WC7A 4LLDA 4QYOA 2P5EA 3UTTE 4XPTL 5KSAB 1U91A 5JDSA 5JIHA 6FABL 5E6ZA 1MLCB 2DF3A 5KAQG 3PHSA 4WTWA 3PHOB 5JW4N 3PGCA 2V5RA 3TJHD 2VC2H 3PABA 3OF6A 3BZFB 3WFCH 4LLMA 4LQ1A 1SEQL 1NUFA 1NFDA 1J11A 1YN7A 1F58L 1X5AA 4XVTH 5FYLL 1S7QA 2CDGB 1FIGL 3O3AA 4NT6B 3VI3F 3MODH 3UJIH 3KPRB 3OXRB 4YE4L 5GGQL 5F89A 3X3GL 3ULUC 1D5XB 4Y4HC 1CXFA 1RSFA 4PP2B 1A64A 3CU1A 2VZUA 3FB7B 3V4VH 2R0KH 2XTJB 1NSNL 2BVQA 3WS6A 3S3JA 3A67L 1BVLA 2LVCA 1AO7A 1CU4H 4H8WL 1U3HB 1CT8B 3GK8L 1WCBB 3CD4A 3I9GL 1K8DB 4NBYB 3MLZL 1KCVH 2E8YA 3DWTA 3FO2A 2CPCA 3MRIB 1IKNA 4GBXD 2SEBB 2DI8A 3K8LA 4PRAA 5I17A 4PJ7F 5FO9B 2DIAA 5I8CB 1EHLL 2Q76A 2IMNA 3GMQB 4GW1B 4MD5A 4I0PB 1GAFL 2HYMA 4UBDD 3TV3L 5FYJD 5FXCH 3L7FA 1CLZH 1EGJH 3O3AB 3T0XA 2HG5B 3MRNA 1TJGH 3FQWB 4PIRF 3S96A 2R39A 3X3FH 2D7NA 3M8OH 4JFEE 5SX4H 2EYSB 3EYVB 5FUCC 1IJ9A 3GJFB 3ULVH 5IVZB 3V79C 4OF8A 5DJDA 5EU6E 4EVNB 3CFBB 5K9KA 3VFRB 5IFAL 4N5EC 1FP5A 4BQ8A 1KPRB 2GT9B 4MNHB 2H6PB 4KKCC 2K7PA 4P3DA 3AS2A 3CFEA 3GMNA 1KJ2L 4WW1A 1UM4H 2NTSP 1NQBA 4YK4B 1PG7L 1NGXA 1K2DB 1WTGT 4P59H 4PP1C 2BY1A 1F90H 1G1YA 3BGFB 1VACB 3DUSB 3FO0H 1RUQL 3IU3B 4ZUVA 1FC2D 2AV7A 4LRNH 4PPTA 5JHLH 4CJ1A 1H0DB 4O2CB 3BH8B 3N1QC 1NCUA 3OX8A 1OARL 3BO8B 1CF8L 5HYIA 1G0DA 1PAMA 5BS0B 4YXHL 3OMZA 5EZOL 2V17L 1XGPA 1RUMH 3SPVA 1J8HD 3RJDA 2PO6B 5INDB 3GSUB 5I8KH 3BEWA 4KHXH 4OTXH 4OZIE 5MENE 3VXRD 4HWZA 3HE6D 3QUXD 5HI4C 3RUGB 4DKEH 5C70A 1DQMH 4FQXC 1I3UA 3PWLA 5IM7B 3B2VH 4C54A 4ENED 3MBXL 5KS9E 3SO3C 3JV5A 5JW5A 4XVSH 2FWOA 2DAVA 3WFBH 2DQFA 2B1AH 2ZPKH 1DANU 4H0IA 4I2XA 1QSEB 1MPAH 4LPWA 5C09B 5HPOA 1KENL 1P6FA 4ETQA 4KJQD 2WQRA 3UTSA 3SDXF 1G7LA 1A6UL 2MKWA 3JV4A 4WI8A 3TNNB 3MZTA 3BXNB 1NC2D 1X4ZA 1ZA3A 2CMRH 1Q0YH 4OCSH 1JWMA 1J05A 4LBEA 5C0AA 1SEBB 4OGXH 4EUPA 2DTML 4X6FA 1BECA 1O5DT 2P48B 2NZ9D 4DZ8A 4PLKC 4WTZG 1ZXQA 3QEHA 1QSFE 4D9RD 4M7ZB 3U30B 3ARBA 1U8OA 1AHWA 1T7YA 2E27L 4FZ8L 2WSKA 4L4VD 3O6FC 4Y5VC 5ANMB 4XP6H 5J11C 4OCYL 4U6VH 4OKVA 5EBWA 3LKOA 2G5RA 3WUWA 1A0QH 4XB8A 2VDRL 3BIAX 4JZJC 2VB5A 2E3VA 2J1KA 2AV1A 2OTUA 3ILQC 1UVQB 2W9DH 1OTUC 4DVBA 1B0GA 3V5DB 5B3NA 4HPOH 3ARUA 3WE6B 4PJIB 3QIUB 1IGIL 4R97B 3SDCC 3FCTB 3QG7L 1F11A 3MRCA 1XGUA 5I1JH 1E6JL 1YJDC 4H20H 5IEHB 2H32H 3BKYL 3IDXL 2FL5B 3LEXB 1QQDB 1I7RB 5TQ0H 4RNRB 4KRMB 4WEBH 4PJCE 3GIZL 4YIQA 1N6QL 5I19H 1EH9A 4NFCA 1A7PL 3QDJB 1J0HA 4P2OA 5DR5H 1XF1A 4R90H 1AO7D 4YO0A 2R23A 3GIVB 1OAYH 4PD4K 4RFNB 5TDNB 5IHZB 1MHPL 1GC1H 5DMGD 2VITB 2GK0B 4PYGA 5E8NB 2YXFA 2H8PA 5CJOL 3LKRB 1K4CB 5HDQH 1QLFB 1FQ9C 1R24B 3QI9B 3WCYA 5F9WC 3KXFE 5AZ2H 4FFZL 4HGKC 5HHPB 5C0CD 4P23C 1RHHB 4FQJH 1NMCB 4JZNA 4G7YL 2Q1EA 3RIFK 2ZNWA 5CLWA 1T89C 1BD2B 3TNMB 1ZT4A 4O4YL 1B9ZA 1F11B 3MRCB 4OD3H 4HWEH 4EDXB 1MVUA 4N1EA 4QXTB 4XCNB 1CXEA 1FFOA 2X4NB 3DGGA 2HLAB 5H37H 3EJJX 1B0RA 2FD6H 4CMHC 1Z3GH 2WZPD 4PY8J 2X7LB 2PXYA 5HPMA 1U3ZA 2AJSH 4J1UB 2P5ED 4X9IA 4C83A 5F9JA 2CR3A 5JHLL 2A9NH 1YYMH 2D0GA 4NQDA 3B3IB 1NAML 4B41A 1I8IB 4WWKC 2QJDA 4L9LB 4HV8B 2ARJB 3BH9B 3TN0D 5FO8A 4AMKH 2IMMA 2FJHB 4RMSA 1FDLL 2APVA 4OB5H 4YGVA 5A16B 3UAJC 2JTDA 2VSCA 1D9KA 1HQRB 2R8SH 3DUUA 3MNWA 3LSOB 3QHFH 4CVXA 3T4AB 1HHIA 5B38A 4P46A 5GGVY 3CSGA 4P3CH 1EFXD 3BW9B 3WKMH 2Y1VA 4E41B 1T5WB 4Q0XL 1Q72L 3BVNA 4AH2A 2ED7A 5I8OL 5JW3L 4RRPA 4M93B 3VXME 3QFDA 1JPST 4HUWA 4U6TA 2CJUH 3RPIB 4NKDB 4JDZA 2VLKE 4JFFD 3BD3A 1RK0B 4OFIA 4HS6A 3V2AR 2D7TH 2YA1A 4LRIC 4AIOA 4I18A 4TPRL 4MD4B 1F97A 4OFVA 5TDPA 1FLRH 5CP7B 1I9JL 1P69B 1RHHA 3P4LA 1OGAA 2ZUUA 3O6LL 5IMKA 2C4FU 1YEIL 1YEEL 3HR5A 4DAGH 3QG7H 5CWSA 3BVNB 1QLFA 4PJIE 3CCHA 5C86A 3C60D 4NM4L 1AKJD 3W2DH 2ZG1A 1XGQB 1T1WB 4MAUH 3MA9L 3WJJC 3SJVD 3QPXH 4ZO6A 5DQDL 4NQCE 5F7FA 4L4VA 2LAAA 3OKKA 1U8JB 1K2DA 1GRWA 3HNSH 3CVHL 1XGUB 2YZ8A 2ZG3A 1AD0A 3HUJB 3EO9H 4TNWK 1IL1B 1QFWH 1OP3H 4LDEB 2NY6D 5D70H 3SKOA 4RMTA 2J8UB 5D93C 3ZKQD 3ZKXC 5T5NF 2ATKA 1IKFH 4KRPB 1WZ1L 3QEUB 4OGAD 3BOVA 4KY1H 3QR2A 2X41A 4MHHI 3FQRB 3MRQA 4TVPH 1MCNA 2ADJB 2ADIB 3BPCA 3DURA 2AQ2A 3VXNA 4OFDA 4LFHG 5SWSB 4HX1B 5IQ7H 2V5TA 4PJIF 5F97E 1AC6A 1U36A 1YEDA 5DSCA 2C3XA 5D2NB 1UXSB 2BDNH 2MMXA 5I1AB 5DQ9B 3QSKB 2LAGB 4OQTL 1PG7X 4RBPK 1RZKC 2V5MA 4XXCA 4JG1H 4KDTA 4M1DL 4XVSL 4CVUA 4K94H 1F8TH 1KXVC 5C6PB 2Q6WB 1KN4L 1NCDL 2BNQB 1EUTA 2F19L 3DMMA 4MCZB 4DAGL 1DVFA 3HPLA 3V6ZB 5AYUL 2I9TB 1DQJA 4BFIA 2R23B 2IGFL 3GIVA 2P5WA 3BE1L 3EDDA 2EDEA 3NN8B 1UB6A 2UYLB 1U3HA 3O4LE 4G6FB 5E99L 4W6YB 3KLSA 2EH8L 4M5ZH 3TJHC 1NAKL 3NCJL 2VZTA 5EZOH 1NCWH 4JQIL 1CD0A 1I1RA 2LQRA 3VD3A 2Y6SC 1T7ZA 4L3ED 4NBXB 4Z95H 1MFBL 4ODXA 3BPLB 5DFWH 3HPJB 5GGRY 4MAYB 5HY9A 5DA0B 4PUBH 4N8CL 1PYWA 4OIIL 2E9WA 3W39B 4R7DB 4BZ1L 2NY2C 3QJHB 1DLHB 1QRKA 3L95A 4V2CB 2YBRA 3I75B 1HHHA 3RZWA 4JFDB 2PO6A 3MV7E 1QHPA 3L9RB 3GUTB 4I2XE 4Q6IB 2DBJA 4D9LL 1VEPA 1WWBX 3RRQA 4PJFE 1JJUA 1T5WA 5JHDE 3WIHA 5ACLA 4NBZB 4OT1L 4RGOL 2XWJA 4UV7L 1KSRA 1RK1A 3CFCH 3B8YA 2NW3A 2PXYC 5ICXA 2CRYA 5GSRB 5E8PA 5C0BB 2DDQH 1FJ1B 4XP9L 25C8L 4JHBA 4U1SB 1QUNA 3FONA 5D1ZA 1KIPA 1FO0L 1YA5A 4RAVB 2ZCHL 4LMQE 3HE6A 5FA3A 3VXRA 4N1CA 5IB5B 3KPSE 4NN5C 2F54E 5JOEA 2WINA 5J06A 4GLRH 3OQ3B 4RIRA 2ICEA 3LPGA 1GOGA 4B53A 3VFOB 1MEXL 2BDNL 3S88H 3QAZB 4Z18A 3WLWC 5F9JB 1RJLB 4LIQH 4OZGA 1RZKL 3TJEL 3NFNB 4Z6AT 4H26B 3UJJH 5HHVL 4HWNA 5L2KB 1G7MB 5MEOB 3LB6D 4F58H 3PWJB 4TRPH 1WWAX 2YC1B 43C9A 3UTTB 2YPVH 1HH6B 4U1IB 3O11A 4IHOB 4PBWD 4XH2A 3AM8A 1QKZL 1SY6L 2Z31D 3VH8B 5J6GA 1QVOA 1KCRL 4KTEL 1Q9OB 3TNMA 4HWZB 1R0AH 5DVMA 3STBA 1IQDA 5KS9A 1OF2A 3DSNA 4PGBB 1UH4A 3VGAB 1C08A 4HLJA 3UROR 5C7XH 1FZOA 2B39A 1AGCA 2Q76B 1QR1B 4LSSL 5I17B 1JRHH 1FN4B 4OF7A 4NQED 3WNLA 1JNLL 4F2MB 2G2RA 4KI5D 1MF2H 3L5WA 5FV2A 1LGVA 4KVCH 3FHAA 1E4JA 4XCYA 3H9SE 1U3JA 5EC1A 3IVKB 3BKCH 1SMOA 4GRWH 1OW0C 1RVFL 2EEAA 3O9WA 4MAUL 2BY0A 25C8H 1BFTA 5I1LB 4E5XB 3LEXA 4YHMH 4M7KH 1MVFA 2X9WA 4CMHB 3ULUH 3S7GA 3CFCL 3T65B 1YECL 2VE6B 1X5HA 2E7BA 4L8CB 1FFPB 1A7BA 1MJ7H 1KF9B 4M02A 4OBRA 1KCUL 4NC0B 2VDMH 4JKKA 2O5YH 2XA8L 1FPTH 5EBLA 4R96A 2QLVB 3QO0B 2EDDA 3PHOA 5C07A 2X4OA 4BZ1H 2VZOA 1KNOB 2HLFC 3LKQA 4F9LC 3VE0A 1QTYT 3VG0H 1S5HA 5ADOL 4HCRH 1D3CA 1FORL 2C26A 3O6FD 4JO2L 3EGSA 3DYPA 3LD8C 2E7LC 3FT4B 1MAKA 3DVGB 1QSED 5DS8B 4O51B 3CX5J 1W8NA 1VFBA 1CL7I 3P11H 4X6FB 4KZEH 5A3ID 1BZ9A 3BE1H 5GS2H 4N0YH 4YGAB 5TPWL 3LQMA 1CXIA 3MLYH 4LVOC 4Y4KC 2ADGA 1F3DH 1R3IL 4NRZA 2YK1H 2VN7A 1MWAL 3SQOL 3TA3C 4MS8D 2AQ3A 1EVTC 1IRAY 4M6ML 1RIUH 2OBGA 4NM8L 4UT9L 3OKEB 2HAZA 4QTHA 1WT5A 1U8PA 2VH5L 1J1XL 4NNXA 5EU3B 1BIIB 4KTDL 5F6HI 3OPZH 4RFEA 1MI5A 4F7MB 3HR6A 1ZVYA 1KG0B 3O3DB 5D4QA 3LB6C 4TVPD 3ZE2E 5D1XD 2ZSVA 2VR5A 1ZLUH 5D70L 1G7QA 2V9RA 4PS4L 3ZTJG 4PRPA 3O2DA 1SJXA 2NY3D 1D5BB 3GKWH 4FFVC 2EECA 4XAKE 3X12B 4LLDB 4TUKL 1MCOL 4X7FC 3OX8B 2VIRA 2AI0L 4TNVF 1F13A 1GC1C 3SDYH 5EOCH 1MRFL 3L5XL 5HXMA 1UM5H 2ZNXA 5D2LA 2A83A 5GGVH 2XWTA 5KVFH 4QRPB 1YDPA 3C8KA 4GKOA 1I8LC 2NY7H 2IANB 4M48H 2YEZB 4JPIB 2DKSA 1R5VB 4NKOA 5KSUB 1YQVL 3I02A 5I2IB 3O81A 1JE6A 3PL6A 5ECJE 1Q1JL 3CLFL 2FDBP 2VOTA 1G7QB 4LU5H 2ZCLL 4QRTA 1TTGA 4JZOB 2R56H 3KLHD 3C08H 5T1KA 3IU4L 1XR9A 1GAFH 5EZLB 2IFGA 3O6KH 4GRLB 3V0WH 3BPNC 3ZHKA 1A7QH 1FNGA 3WIHH 1D6VH 5INCA 4JQXC 3HC3H 4HFUH 4DTGL 5DWUL 3AAZA 5DEFA 3FQXB 1T04A 3EO0B 2EXWD 4J12A 3G6AB 4PLKD 4WI4A 1LEKA 1D5ZA 2ZOLA 1V3KA 2QBWA 4U0RC 1T4KA 4QNPE 4MHHG 3CSPA 4JY4A 3QUYB 3GSNA 4B50A 4M6NL 4PR5B 4U6VL 3RWJB 4G6AD 3FQNB 1QPXA 1EJOH 1MCDA 1QBLH 3KDMA 1CDHA 4ZFFA 3QUZA 2X4SA 3SJVB 1OSPH 1QFOA 4U7KA 4IS6A 4J4PA 1OW0A 1TPXC 4XPBL 3G6DH 4PREB 4G8EA 4WU7B 2D9CA 1FG9C 3CX2A 4M6MH 1HWHB 3MLUL 4X5XB 4BH8B 5C92A 4NOFA 4NZJA 1FLTX 2DD8H 3MOAH 5CINH 3MRGB 4JRXB 2IPUK 1D5ZB 2ZOLB 3QQ9D 3QUKA 4XNMA 1DQQA 5LCVL 4N5ED 1CLCA 3R1GL 1JNHB 4MQTB 3BDYL 1A6UH 3VXUA 1U8HA 3KYKL 4HUNB 3U82B 4QRUB 1S7TA 1BQHA 1JZ7A 3BP4B 1MPAL 1P4BL 5JXED 4KUZL 3JWDL 1T1ZB 2DL2A 4GRLA 2ORBH 4KWUA 1BVZA 4TQEH 3V95A 3X17A 4XPAL 3B83A 2FZ3A 4H0GA 4NO0D 3QXDA 3VG9B 5JZ7D 1G6RH 3RX8A 4KHTH 3BIKA 5FHAL 3O9WB 2FEDD 3QDGB 5DJZB 3I2CL 4ONFH 4X99B 1E4KA 1QSFA 4PY7B 1OPGL 4JRXD 1FNLA 4X6CF 2EE3A 5DA4A 2ESVB 3ARGC 1KACB 1J0ZA 4WJ5B 2E6PA 1NC4D 5CCKL 5KJRL 3MGAA 5HD8C 2KQNA 4BZ2H 4LSUH 3JUZA 4PRNB 5FO7B 5TQ2H 3STZB 3VA2C 4EXPX 2AEPH 2X9YA 4NQSA 1BQHG 3K4DA 4KK9D 3O0RL 5EIVA 2ICES 5GHWL 3WS3A 3P73B 4DGYL 5LQBL 1HOCA 1SYVB 3C5SB 4FQPA 4APQC 1WBYA 4LVOB 2F74A 4Y4KB 2RB8A 3S5LB 1BREA 3KYNA 4HS3A 1FVEB 5MHSE 3V52H 3X13A 1UC6A 3IDIB 5HI4D 2XTLA 1RPQA 3HZMB 5GS0D 1EV2E 2DLHA 2W9EH 1XCTB 4PJCF 5IFAH 5DTFA 3PQYB 2ICEB 4HW6A 3DX7A 4P49A 3D0LB 2ZUVA 1KEML 5EU3A 1A3LL 2CIKA 5IK3B 4OLVH 5M7QA 2W91A 4U1LB 4RAVA 3DBXB 5BZDB 4OLWH 5EO1A 2APXA 3QRGH 2KH2B 3TBTB 4UU9A 3KLHC 5ID0A 1ORQB 2W38A 3GSXB 4M8QA 5F7DB 4XBPA 4PBVC 1W0WA 4NUJB 1XCQB 3TA3D 1DBAH 2VRAA 1ZT7B 1XMWA 3FTGB 5E94A 4FG6C 3F7PC 2F53A 3HCVB 3MROA 1JV5B 2A1WL 4F33B 5BO1H 4C4KT 3F6IA 4PG9A 1FH5L 5M95B 3BZEB 4P23B 4E42B 1ZHBB 4POZD 4ZFGH 5D2LF 4Y19A 5EORH 3MNVB 1BZQK 5DZOA 3E8UL 3RVVD 5E7BA 3S35L 1FL6A 4UT6L 4OZIA 3MUGA 3LKNA 1KIQA 1KIRA 1ONQB 4MJ6A 1KNOA 4ZAKB 4AEIL 3BUTA 3KPPB 4BA8A 1I7ZA 1U41A 2PETA 3UZQA 1XF4B 4LF3B 4JDVB 3BKML 4HUVB 3MJ9A 2UVFA 1JRHL 3EJYD 4PV9A 2A6KA 5ALBH 5DUBA 3HMXL 4H0HB 1P9MC 2R9HC 4NYLB 3T8XB 3WFHB 1ZKAA 2N4IA 1QHOA 1LD9A 2ATPB 1HYSD 1KJ2H 2VLJA 1IEHA 5L2KE 1UXSA 4Z7UB 1FNFA 1U8QB 3PP4L 3MRRB 2DQIH 3QNYA 4P9MH 4ELMB 4ISVB 1AGEA 5EOCJ 3V5KA 2BSRB 2NY0C 1QSVA 5DHVA 4NN5B 4XGZB 3KJ4C 3PHQB 2DTSA 4I5BA 1OTTC 3LKPB 2F19H 3MRKB 2COQA 4L8SC 4LSDA 4XP4L 4F7EA 5JNYA 2EIDA 4PUBL 3OKYA 4PJ5D 2A6JA 2NX5E 3IDGA 1FCCA 4NC1C 2AK4B 5IVXB 4HK3J 3EDEA 4OZFB 1S9YB 3WN5C 3VH8G 2P49B 3K2UH 3TBSA 1UM6L 4PJFB 3U4BL 3PWJA 2C1PB 4C59B 5DJ6A 2VXSL 4YFLF 4I3SL 1RZ7L 4YHNA 4XNXH 2UY7A 2HWZL 4NQTA 5ISZE 2VLLA 4PJCA 5HHQA 3GMOA 3D3VA 4F8TA 3HAEG 2X70B 1MCFA 4N8VG 1A47A 4I0KA 1A6WL 4PJ9D 1YEGH 2EIZA 4FNLH 1LO2H 3B5TA 1R5WB 3HB3C 5I1IH 1RZJC 3D9AH 5DUML 3IAPA 3ZYIA 4NUGL 2BMKB 1KN4H 1KLUA 3TZVD 5E56A 1L7IL 5GGTL 3QUMB 4GKSB 4K23L 5FCUL 4JPVL 4D9QD 2Y07H 5HJ3B 1BBDL 4AG4L 5JMOC 4PJHE 4OZHB 4UIMA 3U9PL 1X5ZA 4HUWB 4K3GA 3NPSB 3RNQA 2VLKA 4NQCB 3QI9D 2VJXA 1ZHKA 1HINL 1TNNA 1DQDL 3LS5L 3IDUA 4ZAKD 3CSBA 1JYVA 3WIIL 3RTQA 2IBZX 3T0ED 1BEYH 5LCVH 2F8OA 1ZVSA 5IOPA 3WXWL 5ICZB 3QNZA 4OLVL 3OV6A 1LK3L 2BJMH 5BVJB 3MBEC 1TVBA 2Q87A 5IKCA 2EZ0D 3SDCB 1T7VA 4OSUH 3EKCA 3RWHB 4L5FH 3G6DL 2HLFD 3FOLA 3RZCA 2WLZA 3GBNL 4MA8H 1F4WL 4C57C 2IBBA 3HAEB 3TFKD 4HCRA 5F7EL 1WISA 4XP6L 3NTCL 4M6NH 5IGXH 4X4XA 1F6FB 4WHYH 1XGRB 4Q9BA 3QAZC 3N1PC 1PZ5A 2OL3A 5D96C 2FX8L 3REWB 1ACZA 1HSBA 1T0MB 5EO9B 4YJZL 4R26H 1KBGL 5DUPH 1YYLH 5AWNL 3TBSB 4JO3H 1CE6B 4ELME 3M1BA 5DK2A 1NGYB 5TQ2L 4HMEA 3IJYB 5C0NC 4DTGH 1ACYL 2FJGA 4PP1D 1U3HC 1JP5A 4FQHB 4FQXA 3RA7L 4PRBA 4JM2B 1YC8A 3FQRA 4CN4A 1BEYL 2D7TL 4XAWL 3UPRA 4I13B 1E6OL 4R0LC 3FJTA 4ONFL 2DQJH 3LEVL 5DHVB 2GITB 4FQIL 1NL0L 2JB5L 1RZFL 2JIXD 2FATL 1YEKH 1Q0XH 2Y07L 1MCEA 4FQQB 1EXUB 2BP3A 4NPYA 2Z91A 1FAIL 5K59F 4QT5B 4JM4L 3BJ91 5CCKH 4QHLB 3DECA 3HLAB 43CAB 2XKUA 4TOYL 2NY2B 3MR9B 4UQ2A 3C87A 4HC1L 4LHUB 2RHEA 4YDVA 1AY1H 2EDBA 3GSVA 1MCCA 3VXQA 1BQLH 1S7WB 2VXQH 3BPLC 4ELMF 2CUIA 2VNCA 2NY4B 4N0FB 3T1FA 7CGTA 2C7UA 1I7ZB 4D9RE 1JZ8A 1T03H 4NQCD 1OY3B 1SJEA 2BXYA 4PJEA 4CW1A 1A02N 1HE7A 1NFDE 5SWZB 4XCFL 5F9WB 2Q8AH 3QHZH 3FO9B 1IGML 3BGFC 4MXVE 4HMDA 4MXWL 4EOWL 1FBIH 3B6SB 4S1QL 3NFPA 1U8KB 1X7QB 4HKBA 1W8OA 1DBJH 2K1MA 4R0LB 3MNVA 3BI9X 4MJIE 1ZHBA 4OB5L 3T04D 4F37K 1I1AA 4WWKA 5DLML 5EWIH 3TWCH 4F33A 2BC4A 1XGRA 1C8PA 4PJDA 4DKDC 1U95A 3C5ZA 4XAWH 4M6OL 1FSKB 3QHZL 3T0EA 1JGVH 2BNQE 2VR4A 3I50H 5EB9A 3SE8H 1V5JA 4XPFL 1BFSA 1G7LB 3JV4B 5MEPA 1TDQA 2Y7QA 3ZYZA 4GRMB 5CEYB 3DBXA 5FAAA 1OCWH 2F53E 3NACH 1QSEA 4FP8H 4XX1G 5GJTH 4BJLA 1NL0H 1H8OA 1ADQH 2CIKB 1J88A 4KMQA 1TVBB 4ALAL 1MSPA 4N8VA 2Y06H 1IAIL 1Y6MR 2Z8VC 4HIXH 2NLJA 4YUEL 4WGWB 1WSST 2H9GA 3MREA 3IFNH 2GY5A 3V5HA 5KSBB 3QP3A 4P2QB 1HI6B 4K3EH 3QIBD 3CLFH 2AEIT 1UCTA 1EAJA 5E00B 2AABL 2Q3ZA 3IETB 5I76B 4QY8A 4JFEA 4M48L 3RVWC 5ENWA 4OGZA 4R90L 3O6KL 4JLRB 1EPFA 2X9XA 4N0RA 1KJ2B 5J12B 1P4IL 1JF1A 3MLTB 3EHBD 1ZK9A 2GUOA 4ISVA 3K2MC 4JVPA 1NBQA 4U7MA 2VQTA 4NZTL 5BXFB 5EO0B 2IPKB 2X44D 1UZ6E 3HRPA 5KW9L 3BJLA 1MREH 1XR8B 4PRIA 3BEVB 5SV4A 1RFDH 3TLRA 1N64L 4M62H 4DKEL 3VXPA 3KPLA 2DQTL 1K4CA 4WW1B 2X05A 5IJVB 4FN0A 3A0OA 4UNVA 1Z2KA 3BP5B 4HH8A 4IMLB 4KKLD 2EO9A 5E8DH 2GITA 4JDVA 1TQCB 4KQ3H 3UYOD 2NX5A 4IRJC 3L3IB 3EOYG 4Y2DD 3LH2L 5SWZD 1UYWH 3SE8L 4YIQB 5F7EH 4WUUD 1Q9LA 3L5XH 4KJWD 1H15B 5LXGH 4RNRA 5DJ6B 2CLVB 4FQCH 4ACPA 1E4WH 1QQDA 4HT1H 5JORA 5BOZG 4I3GA 1Y0LB 2D0FA 2YPLA 5DRXA 3D2UA 4LKCB 5D7JC 4JRXE 4Z77B 1FG2B 5DK2B 1ZA6A 4NP4H 5F6IB 4FA8A 1NC4B 5SX5K 4KUCF 1HNGA 4P5TD 2BERA 2JE8A 1MIMH 3P9MA 4UZGA 3UO1H 3G5VA 1NBYA 4GFTB 5L9DH 2CD0A 3B2UD 3MRKA 4GMTL 1N3NB 2HWZH 1FBIL 3O3EB 3CFKA 4JB9H 2RFXA 3UTQA 4X4XB 5AZEH 1KPVA 3MRGA 3VXUD 3NA9L 4U3XA 4Q9CA 4FNLL 3TJEH 1CGSH 1CFTB 5L6YH 2C3VA 4LVNC 5A3IC 4POYA 1G6VK 4U05A 1Z9MA 2WUCL 5GGRA 3QDJE 1DBBH 1D5MA 5KVGH 4MDIA 3KPRA 1K8IB 4XPHL 1QYGH 4NUGH 4X6CE 1HCVA 2AK1H 3H9ZA 1T22B 4L1DA 4DN3L 1C5CL 1JVKA 2OTWB 1EEYB 2DQEH 2VL4A 4P3WA 4YHKL 4NO3A 1HWGB 4UUJB 5T3ZL 4KDTC 4ZUWB 1CLOL 1N8ZA 2HTLC 3SE9H 3RVWD 4F57L 4X9HA 5LGJB 5FUZH 4KJQC 3ROLA 4O02H 4IOFD 4HEME 4LRNL 5E0QA 4EN3D 5HBBA 1RZJL 5FFLA 3SKJH 2BMKA 4R4FH 5C07D 1EUUA 4P2QE 5E5MB 5BVPH 1FYTA 1I3RA 3QDME 3GSWB 5T1KB 3QPQC 3MJ8B 5E8EB 4BQCA 4ERSH 4PGEA 3MOQA 2EIZB 1JV5A 3DX9B 1NDGA 2FH6A 3MRHA 5D7JD 1E4XL 4W4NA 4DZBA 5ACZB 1CIDA 4YX2L 4Y4KD 4LSSH 5GS1A 4QHKI 1CBVH 5F8RC 2BSTB 4WUUB 1BHGA 5T3XH 3V4UH 5J11B 4Y8AA 3Q3GB 3MXWL 1Y18B 4ZFGL 5DXWA 3RVUC 1JGUL 3D18B 4BSWB 3OJMB 1SM3H 4D0BA 3O3UN 4UIKL 5C0IB 3VXUE 1MFDL 1X5LA 2MPAH 4KDVA 5E6IB 3T4YB 3X3GH 5I8EB 1EO7A 2VR9A 5EU6A 3VGBA 3WHXB 4LIQL 1S7RB 2EXWC 3FZUC 2QQKL 2N7BA 1RZIB 2DLGA 5C8JB 5E5RB 4Y16C 2VL5B 5K9QI 4OLEA 1MFAH 2VQ1B 3BKMH 2AK4D 4QXUH 2LV4A 3AREC 3FFCA 4JFHE 4TVPL 4YBHA 4N8PA 4NSKB 3RWCA 4JRXA 5EU6B 1K85A 2EDOA 4ZODA 2H1PH 5GRVK 3MJ7A 2APTA 4C56D 5IVOA 1TJHH 2I24N 3DXAA 3GSQB 4X0KA 2DI9A 3MRNB 4JPVH 1HSAA 4D2NA 4HJJH 3FB5B 5D1ZC 4IRJD 1U8MA 4WUUE 1CL7H 2DJUA 4HIEB 3VFVB 3EOBB 2OL3H 1A1OB 3EYSL 3VFGH 5KSAC 4Y5XA 4RGND 2ADGB 5DJYA 3W0WA 1Z0NA 2IANE 1IT9H 1KPVB 4NNYA 3C09C 3ESUF 4XNQA 4BZYA 5HVWA 3FB7A 5EOQL 4HHAA 3O2VL 5KG9A 3ARDC 5BS0E 2MWCA 3GI9H 4KXZI 1J8HB 3BMWA 1MJ8H 3HS0A 4XWOD 4FHBD 4IIQC 3DX8A 1NBVH 3KWWA 5IFHL 5MENB 3MCLL 1BAFL 1UM5L 2C5DC 3AMLA 4LK4A 1LO5A 1NUDA 4URTB 1CI5A 3O9WC 3N1MC 3OZ9L 1XR9B 4QF1B 3CZFB 4LCUB 2MCPH 2LU4A 4GG6F 3NA9H 1RIVL 1I9RL 5E94B 3OBAA 2F5AH 3BGMA 4HMCA 3C6SB 3DV6A 3IS1X 5JDSB 4GAJL 5D1XA 4L8CA 5HHOE 5I1HL 1ZLWK 4NCC2 4P9HC 2X1QA 1B4JL 5EPMB 5D93B 4NCDA 5KTEL 3UBXG 2QQNL 5HYEA 3U0PA 1M7XA 5GGRB 3BAEL 1KJVA 3VI4F 1N4XL 5TJWK 1QBML 2IGFH 4KVNL 1MQ8A 3LIZH 1EGJL 1GGYA 5EH1A 5EIIB 1E28A 4ZTPL 4KC3B 1OQXA 4OD2B 4XWGL 3VMPA 4TUJB 1IEBB 3MJ7B 1JF1B 4GH7B 2EEDA 1KLFA 3ARFC 3FHQA 2IQAB 1XZ0B 1CDUA 2VXUH 1KT2B 3SQOH 3TO2B 4OQTH 2DB8A 4NSKA 3RWCB 2G2RB 3B4NA 1II4E 1J10A 1IT9L 3BZ4A 3KJ6L 3QCUL 3VFMA 1ORSB 3DYMA 1N0XH 3VWKC 5I9QC 1G9MH 1DE4B 3W9DB 1W0VB 4Z7VF 5H2BB 4WU5A 2P8PA 5IW1B 3F12B 3VRLF 4FQCL 1UWXH 1T6VN 2WUBL 5EZIL 4KK6C 1ZLWH 3ARGD 3DROB 4LKCA 5ADPL 2EDFA 2KDGA 5I73B 1EFQA 3MJ9H 3U0PB 2G5BB 3H8NA 1NEZA 5JZ7C 2HMIC 1UADC 4PGCB 2PTTA 5MEPB 4BKLB 3KLAA 1FFNB 1QEWA 4XNUL 5ERWB 1JNNH 3FB6A 4LQFL 2QTEA 4JFOB 1BX2A 1YN6B 3LQZA 5JXEC 1P9MA 1YEFH 1U95B 3C5ZB 1U42A 3N06B 4JANA 1MCPH 4X6BA 3VXPB 4MNQB 4P2RD 1N2RA 3HE6B 5FA3B 1S7UA 5DHXB 1NC2B 2A0LC 2VLME 3P30L 1VFUA 3UPCA 5KVDH 3HNTH 1OT2A 1X7QA 3O9WD 4JKLA 2IAMB 4MQ7B 1C12B 4V1DB 1M05B 4K3EL 4JLRA 4FOMA 5C6WH 1Q9WA 4XNYH 3MBED 2VDKH 4F8QA 3ULVD 3Q1SL 3JV6A 3OKNA 2M2DA 4BH7A 4LLYA 2YBRB 3I75A 2C7UB 2PTUA 5IR1B 1BLNB 4HK3N 3L95B 3QFJE 3U0TB 4MS8C 4F57H 3E2HB 3NBNA 4RFEB 3BRFA 4MMZC 5T1DL 3GSVB 1AGDA 3VXQB 2Z31A 1UJTA 2R4RL 4RA0C 3FQUA 4HFUL 1T5XA 3MLWH 1JGDA 2EO1A 4P2CG 1PFCA 2V7NA 2XYCA 3DXAE 2MQCA 4ZNCD 1PLGL 2J8HA 4U0QB 4TSAH 1YUHB 2H2SD 1CFTA 4WIQA 5BCAA 3QDMA 4X8XA 1MCRA 1MCPL 3LQAC 4KK6D 5FF6B 4X7EC 4ZUSB 3VXMD 2I9TA 5IMLB 3C6SA 2R0LH 2M1KA 4FXKB 1FL5B 3HI5L 3P9LB 1BZ9B 5D6CB 1OHQA 1JWSB 3V6OC 1FVCA 3O4LD 5A1AA 1CG9A 2B0SH 2PR4L 3BP7B 3DHJA 2BHYA 4AK1A 4PJGE 4ZNEA 1UZ8B 4G80A 3TIDA 2I25N 5L9DL 4YDJB 3N9GL 5E9DB 1WFOA 5DRXB 4BYHA 1KELL 3SO5A 5LGKA 1KTKE 1Y18A 4P23D 2R0LL 4NP4L 2X4OB 3REWA 4JZOA 3Q3GA 5EC2B 2X1WL 1I8MA 4GG6B 4R96B 1NCBH 3SDDC 4KVNH 1VKXB 3BDYH 5JQ6L 3DRTA 4NFBA 5BMFH 4DVRH 2HVKB 1ZWIA 3HTLX 4JB9L 4UDUB 2KQMA 4U2ZA 1MJUH 2P8MB 5EIQA 3TT1L 3FFCE 1Z5LB 1LWRA 4ZG1A 4XVUD 3M07A 2FEEL 1JCKA 4OZHE 4PGEB 4RBPH 3U7WH 3OR6A 1GC1L 3S4SG 3FT2A 3LN4B 1PJ9A 3O41B 3HG1E 4RDQF 1P7QA 3UYRL 1QBMH 4P2YA 5F7KC 4K71B 3QIWD 4X4YA 3INUL 1YJDL 3X12A 4NHUB 2EDWA 3K46A 2K9UA 3IDNB 5C9JA 1DANT 1MWAH 3ZSTA 1FORH 4HDIA 5DFTA 4ZXBD 3RI5K 1FZOB 3P77B 3PIQA 5FHBH 4ZUWA 4YZFE 4LASL 4I18C 5HYSA 3G08A 3BKJH 2HJKA 5KOVC 1XEDA 4BSWA 5GRJL 3FKUS 3OG4B 5JTWA 1P1ZA 1RK0A 4UINL 3OKEA 4EIZC 2BSED 4MWFB 1YNTA 5I1KH 1D5MB 2GTZB 1T0MA 4ONGH 5FYKL 3L5HA 3C60B 3U7YL 3WHE0 3P0YL 1GSMA 1MFCL 5C0EA 1FYTE 1M7IB 4CNIA 4U3CA 3ZDYF 4GW4B 4EI5B 1MCIA 1E4KC 4MJ5A 3VFNA 5FYLE 1KTRL 1DEEA 2P5WB 3NN8A 4DZBB 3C2SA 5ACZA 5JQHC 4G42A 3KYAA 4CRPA 2G60L 2D03H 4Y7MA 1KCRH 2AVGA 2IBZY 3KPOB 5C0EB 4Y4FB 1D9KB 3NIGF 4PJDF 2Q86A 4HUMB 4WFFE 1F2XK 2FEDC 2EE2A 5A16A 4U1KB 3DSFH 3A6BH 4YR6B 1FC1A 4ENEC 4MA3A 4X8JA 4JN1H 1MHHB 3WDIA 4CDHA 2H26A 1ZSDB 4CADA 4JM2D 4LSRL 3DIFA 3G5YA 1H5BB 5C2BH 4MLSA 5T3XE 1INQB 5J13C 4JFZH 4LPYA 5DURD 1NKOA 1N8ZB 4AIZA 2PKDA 4KJPC 3QEUA 4I0CC 4PJEF 3CXHJ 2XN9D 4IRZL 4L8BA 4M6OH 3ARBC 1IEAB 2HRLA 5DC9B 4ZNEE 4KHXL 4OTXL 1F90L 4YFLI 4HUXA 4KKLC 5ESVB 1WWCA 1ETZA 1NGQL 1T03L 4UTAH 3HRZB 1AE6H 2HJLB 4P5MA 4XPTH 5DVOA 1CGWA 3O41A 1DVFC 5FGRA 5L0QB 4YX2H 2G75B 4NO2A 3NIGE 2YSSB 4PJDE 2UZXB 3LIZL 4ZTPH 3C6LB 3FN0H 5EZJA 4MXWH 5MI0C 4Q9QL 4X5WB 2FJFB 3ALWA 1KTLA 2H2SC 4FQQA 2ERJB 3MXWH 4XCYB 4Q9RH 1DBML 2F15A 3V6ZA 4F9LA 1O0VA 3O6FA 2UWEA 4Y5VA 3DMMB 1FN4A 1JPSH 3FRUB 3REVA 5GRXG 1AHWC 5FUOL 5KAQF 1P5VA 3CSYA 5D7IE 4O2EB 3NGBB 2XTJC 4S1DC 2XTJE 3VFUA 1F42A 2X6MA 4IHOA 2ZUTA 4YR6A 1NDMA 3VXSB 1NGQH 2Z93B 2CR6A 3WE6A 5GRVL 3FRPA 2OXHA 4PGDA 1TNMA 1QLEL 1NBVL 5IFHH 2GKIA 2D4FA 5EO9A 4I5BB 4H1LG 4LPTA 3P9LA 3NIDF 1OTSC 2F53B 4FZEL 1FL5A 4QCIB 2ATKB 1L0QA 3S8WA 4LEOA 5IMLA 4BSVB 5FM4A 2IALB 4M1CC 4WW2A 1CLYH 4JO1L 1DCLA 3P4NB 5D72H 2FJFA 4PJ9B 5L88L 12E8L 2BOBB 3QEHB 3QQ4A 2DM7A 4TYUA 2NPLX 3IDJA