1P4BL

Three-dimensional structure of a single chain fv fragment complexed with the peptide gcn4(7p-14p).
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
ADAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody Variable light chain
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4bL00
3MLXL 3PQYA 3V52L 2ARJQ 3T0WA 2OXHA 3IDGB 1NCAH 1BF8A 4GAGH 1JPTL 4M1GH 4X9GA 5JZ7C 3C5SB 2E7LC 3QDMB 5GRJH 1ZOXA 1U6AL 4P2QA 5INCB 2A6IA 3U82B 1A14H 4MNQA 2XRAH 1F6AA 3OR7B 5IB5A 5D9SB 4LBEB 1OB1B 1QLEL 3GI9L 4XNYH 3WBDA 3W5MA 2Q20A 1F4XL 4CMHC 4PJDB 2AABH 4XB7A 3BP7A 4G9FA 4XBEH 2EXYC 5DJYA 5E9DB 5K59F 1F4AA 3ARFC 2ITDB 2IPUK 3RKPA 5DSCB 3SKNA 4IOSD 1XR8B 3O6FB 5E8PB 3M45A 3IU4H 4X9HA 3U79A 5D7IE 1A6VL 1Y0LA 3EFDH 1JF5A 4HS6B 5I1CL 4OZIB 3AXLA 1PVHA 5FM8A 4Y1AE 3B43A 4P46C 4RA0C 4J8RB 5LGJB 1D6EA 3HR5B 4YHOL 2A38A 1N0XL 4K3HA 2ADJB 3ISWA 2V7HA 2BRQA 4D8PB 1G9NC 1HIMH 1NBVL 4O58L 4XBGA 5DJZB 1A6TA 1GZPA 2OL3H 3TZVB 1JHTA 5I1AA 4GUPA 1MCJA 3W82A 3N1GC 3WN5A 3OKEB 4HD9A 1KPUB 5EA0H 4GG6E 5CLTA 3U6RA 5D72H 4FQXD 4WFHE 5D71H 4Y7MA 1FVEA 1IGIL 1U8KA 2V9TA 3VXSD 5DJAA 1DBKL 2MNUA 3MRDB 3TO4D 1WFNA 1XGTB 1TDQA 1YEGH 3WO4B 4D9RD 2AJXL 3FQTA 3D3VE 1INQA 3GB7A 3UTZB 4MJ6B 5AEAA 4NDMA 2BSTB 2VZVA 4WFHD 1UWGL 1E4XL 4QRQA 2BVQA 3L3KB 4G43A 5GS2D 1ZHBA 2YPLA 4LHUA 4ALAL 2ZUYA 4XWGH 1NSNH 5CZXD 1DBMH 3VD7A 4LKCA 1HI6A 3NGBB 3F7VA 3E1F1 1LGVA 1ZLSH 4WUUA 5I8KH 5I0ZA 2ZUXA 3QHFH 2G2RA 4NCC1 4AYFA 3QG6A 1LNUA 2D4DA 1XF4A 1WZ1H 5EPMB 1RIHL 3O6KL 3QWRD 5IQ7H 5D2NE 2ENYA 4R7DB 3ARQA 5BV7H 1XIWD 5ACLA 4PUBH 1V3MA 1MJJA 3QCUL 4MSWB 1DQQA 4JFXA 4ZO8A 2VABB 1TVBA 3WNLA 2XZCH 3FQXA 1NAKH 4R4FH 3SY0A 2AK1L 2FHBA 4NWTH 2FR4A 1WF5A 1CD8A 3BEWA 1YN6B 1S7VB 4LDOB 1P7QB 5C0DB 1F4HA 1X4ZA 3QJHB 5BRZB 5MEQA 1OAUL 1VFUA 2W0KA 1S78C 3VFTA 2DQCH 3UTPE 1KLUB 1HN1A 4GRLB 1IEAA 4J3WA 3TBWB 1Z9SA 2JJVA 1RZFL 5J6GA 4FQ1H 1VERA 3HB3C 4PRAB 1MLCA 3HI6H 3WIIH 4XP4L 5D7JC 3QUKB 3RUGB 3UPAA 1LP9B 4OZGB 2UZIL 2J4WH 3OKLB 3W11D 3H3KA 3OKOB 43C9B 3MRMA 2OR8A 3LV3B 3R8QA 4N5EC 4JFFB 3W2DL 1Y6NR 4MXWL 1TTGA 2D0GA 2ICEB 2X40A 3LEYL 1R6VA 3BIKA 3S4SA 2HKHH 4HJJH 4U7MA 3VGDA 2B4CC 1YJDL 4XNMB 2YPKA 5E5RB 4U6XB 2VL5A 3VFSA 1ZSDA 4FS0A 1BIIA 2VSDA 4PRHB 3BZDA 4I18A 1ZAGA 1AE6L 4C83B 5DJ6B 2O5ZH 4YHML 4JREC 5I76A 3TBVB 1JGEA 1TIUA 1MOEA 3GMNB 1JF6A 4ZUSB 1J1XH 1FO0H 1KIPB 2Q86A 4PJFF 1MVUB 1VESA 3RRQA 3ZE0F 1IFHH 3B8YA 4AM0B 2AAVA 4YDVB 1HZHL 4DK6A 4WTZA 3F5WA 2P5WB 5IVXA 3TCXA 2KPNA 1QSEE 1EJ6A 2ATKA 1HWGB 1FG9C 5E2TH 3CZJA 3KJ6L 4GW5B 4H0IA 4OT1H 3FT4A 2BMKA 1IAMA 2FIKA 5BJTA 2W0FA 1MI5A 1CK0H 3BXNA 4N9GA 4IM8A 1JF1B 4JFDA 4K8RH 5HYSA 5DHVA 4FXGA 5FKPB 2FCBA 5JW5A 4MCZA 2HFFB 1GGCH 1QSED 3LN9A 5EBWA 3RVWD 2DWDA 4HWZB 1JYVA 4KK6C 3T2NL 5J13B 2B8OT 3TT1H 5F44A 4U1SA 3TA3D 1MHHA 4ZQKA 1L0XA 3JTSA 2X89D 4DQOH 3WDJA 4X4ME 4RMSA 3GSRB 1J0ZA 3ZHLA 4B5EA 3IFPA 5IVZB 3HNVL 3JZ7A 4ZS7L 3E3QC 4OIAA 1G7IB 1I3RA 3DSFL 3EBAA 1YY8B 2C7UA 2VE6B 3LEXB 4KQ4L 3V6ZB 5TFSH 3V6BR 5B3JE 3FL7A 3GSNH 4FTVE 3T4YA 2IF7A 5JOEA 3IDYC 4GKSB 1U8PB 5MEOB 3OKMA 4M48H 4S0SD 3ARDA 3REVA 4XHJD 4MQXD 4YZFF 4WEUD 3RY5A 3UP1A 2FBJL 1UENA 2FO1A 1NBYB 2ADGA 1XGRA 2J2ZA 3ZTNL 4LRNH 4R3SA 3QIUB 3DVFA 3STLA 3MV9B 4FTVD 5I19H 1I3GL 5HY9A 3WHE1 4YFLF 2W38A 1KCUL 4GAJH 4UT9L 3WSQL 4YWGH 4DCQA 1S5IH 2GT9A 3KR3H 1RUPH 5EU6A 2AEQL 2QTEA 4IS6B 1SM3L 3C9NA 5L8KB 2NMSA 2Z4QB 4OCYL 3GM0A 4JKMA 4WJ5B 2HFTA 1D9KD 3BH9B 1CXEA 3QQ9D 4LPUA 4L8SB 3QA3A 4KJPC 4M9OA 1JUFB 3IDGA 1N3NA 3NABH 1BM3H 2BY1A 1INDL 3BP5A 1TVDA 3QDJA 4BKLB 1OGAB 1JCKA 3B2UC 3QDMA 5E70A 1J9CT 5DS8B 2YD4A 5INCA 3NA4A 3KAAA 4NN6C 3OR7A 4LCUA 5BV7C 5D9SA 1F3JA 2ESVB 1OAQH 4OUUB 3VMNA 4PJDA 4KKCD 3SJVE 1Q72L 4LVHB 3QISA 3ZE1E 3EUUA 3TO2B 1P6AB 3LMJL 5DSCA 1YN7A 3GGWB 5EZLB 2BSED 5L0QC 5E8PA 5DVKA 1C7SA 2C3GA 3MLRL 5T3XE 2NY4D 1AC0A 4NJ9H 1SBBA 1EVUA 4OZIA 3A6OA 3O0RL 3SJVD 1DDHB 4WDIB 1Q0YH 3HC4H 4PJGB 4HG4J 4J8RA 3WIHL 2VDPL 4LPVA 4NUGH 4XMKL 5LGJA 3HR5A 4RMQA 2JLLA 2LU7A 2ADJA 2NX5B 4D8PA 1CICD 4APQD 3TIDA 5T3XD 4YC2C 5DJZA 4ZAKC 5F1IB 4R96B 5E4IA 2B2XL 3SHSA 4PJ7F 2F58H 5FB8B 4M6NH 4EXKA 1P9MC 2MJWA 1JI2A 3OKEA 4N0RA 3AB0C 3HZMB 2B1AL 1KPUA 1DQML 2YRPA 4PTUA 5BVPH 3TYFA 1CLOL 3JVGA 3AY4A 4QF1B 4NSKB 4L8CA 2W07A 4BQ6A 2PN5A 3U4EA 3MRPB 3KG5A 1RD6A 2F15A 5I9QB 1JNLH 3D1MC 3RVXD 3MRDA 4OF5A 1WBXB 6FABH 3RX5A 1XGTA 1U8QB 1DE4B 4YHYC 4Y8DC 5E4EC 4UT7L 4QKXB 3UTZA 4MJ6A 4BFEA 2X70B 2EDOA 2BSTA 4Y0GA 5JW3L 4Z7NF 1YNKL 1MRFL 4PJBA 1KOAA 3Q5YA 4JVUA 3WNKA 4HLZH 4S1SL 3EYVB 1QSZA 3ILQC 2EIDA 1BBJB 2FD6H 3BFOA 5DRNB 3O9WC 1CXKA 5F7LB 4X4YB 4Q74A 2QSTA 3QWRA 2CIIB 4I0PD 5HD8C 4OJFH 5EPMA 1JNJA 1CZ8L 4P3CH 5IJKA 4R7DA 2IWGA 4TULL 1J8HE 5MENE 1DANU 4K8RC 4MSWA 5CJOL 5KSAC 3ARBA 2IBGA 1CGXA 3SDXB 4NQCB 2VABA 3MNVB 2OXGA 3PWLB 4LLUB 1ROWA 3PHSA 3AGVA 1FNSL 3HI5H 3E6HB 1JFQL 3MRFB 4YIQA 1S7VA 5DC9B 3NIGE 1P7QA 1SMAA 5JUEH 1J8HD 5C0DA 5JOPE 2P5EE 5MEND 3JSSA 5BRZA 3DRTA 5E8OA 3MLWH 3H9SB 1UM6H 4JJ5B 5L6YH 2WBJC 1E6OL 4GRLA 4RIRB 4Q97A 4H20H 1ADQA 3SN6N 3B2VH 3S34L 3VH8G 4R26L 5DGRA 3CPLA 3K80A 3D2UA 3V8CA 5JOPD 3QUKA 3WYRA 2P5ED 25C8H 5D1XB 5JW4N 4XMLH 3DVIA 4TVPE 1UZ8B 3RUGA 3WIHA 3HG1B 1LP9A 4OZGA 1AXSB 2K1MA 1EMTL 2ZJSH 4L3AA 3OKLA 5E94B 2GI7A 2V9RA 1A6PA 5GRUH 4RFOL 43C9A 4X6DB 5C0CE 3LV3A 1PDKA 4JFFA 5D5MB 5K9JL 5IW3A 5HVGB 3QWQB 3ZLQC 4DZ8B 1TETH 5JO5B 3S37H 5L9DL 1VEOA 1E6JL 4FOMA 4QRRB 4XNMA 2D03H 3O6FC 4RWHA 2ARWA 3IFLH 4U6XA 4UOW1 5I1KL 3ARPA 4X7DC 4PRHA 4V1DE 1LO3H 2VLJD 1KFAH 4C83A 5DJ6A 3L3JB 2GTWB 3G5ZB 1KLFA 3TBVA 3LSOB 2ZSWB 3A6CL 3O11B 3GMNA 5DA4A 5I17B 2XZZA 5SV3A 4XPAH 2AEIT 4J3OC 3B9VA 1NMAH 4PJ9A 2OYPA 4V1DD 4AM0A 3ARGB 4S2SB 4YDVA 3K8KA 3TZVC 1RVFL 4FNLH 1MF2L 4C59B 4JY5H 1UCBH 1FZMB 1QFWI 5MEPB 3GRWA 1AGEB 1BVZA 1T03L 4JG0L 4Y5YA 5DQDH 1I3VA 2CDEB 2DYPB 5FKPA 5BZWB 2HFFA 1T7XA 3D85B 1UZ6E 3BKYH 4JE4B 3ABZA 4BZ2H 4HWZA 3GNML 5IROA 1HH9A 4HIEB 2XA3A 3U1SH 1J0KA 5JXAL 3WXVL 4JFPB 2C1OB 4JRWA 1V8HA 4OTXL 5T5FH 3B5TA 1QQDB 5EC1B 5HHXL 3CMGA 3RBSA 2CKNA 4OI7A 1FDLH 3LH2H 1U3JA 5DRZB 3GSRA 3CZFA 5IVZA 3RL1A 5CEZH 2PXYB 1GHFL 4MQTB 1EX0A 3NGBC 4YX2L 1G7IA 2YWYA 5EBGA 2PYFB 2VE6A 3LEXA 4HK0B 5D7LB 2EDDA 5IHZB 1GOHA 2YHGA 4XC3L 2GITB 5HYJA 1JPGB 4YQXL 3FQNB 1TPXB 2EH7L 4WEMB 2XIDA 2BDNL 1U8PA 5LJYH 4LLYB 3ARRA 3C6LD 1U8MB 3MV8B 3OTTA 4MJ4A 5MEOA 1V7MH 2BJML 1IC7L 3L3HA 3P11L 1DL7H 2FSEA 2VOTA 4LCWE 5IMKB 5FK9A 3OQ3B 1NBYA 2V2WB 3BQUD 4DTGH 2H8PB 4NQEB 1KELL 4D9LH 4KK8D 1HXMB 1RU9H 3QIUA 3TBSA 4MAYB 4LLAA 4M1CD 4OCWL 5KS9E 1UWEH 4YHNB 1C08B 4LSRH 3FFCB 4J4PA 1X7QB 1YYLL 1HQ4B 1BWMA 1WAAA 5FAAA 4X5WB 1CFQB 1UH2A 4LCWD 3MA7A 1XGPB 3C6SB 4BH7B 2OM5A 5T1KB 3QEQB 1AKJB 2AJZA 4IS6A 1GGIL 3ARED 4U1GB 4I3RL 4N1EA 4RMUA 4AL8H 3BOVA 2HN7B 2Z4QA 3L7EB 4CMMB 4QHNB 3RZCB 4TSBL 2HFEB 4GRWF 3BH9A 4DW2H 2WUBL 1MPAL 4L8SA 1OWRM 1T5WB 5C0GB 3NCEB 4R2GB 5IHUL 3KLHC 3U7YL 4Z0XB 3C60C 4AENB 4BKLA 2ZNXA 4KV5E 4O9HL 3PL6D 4LAQH 3RAJL 3VA2C 5DS8A 3VI4F 1F3RB 4PRDA 1B4JL 3BIAX 3EDJA 3MUHL 3VJ6A 2I26N 2ESVA 4OUUA 1MUJB 1X4YA 4YHPB 3L7FB 4Y4FC 1MIML 3BPNB 4MNGA 3RA7H 4N9OB 2ZPKL 3TO2A 2WAHA 3MCG1 4TRPL 1XGYL 1TJHH 3GGWA 1ZGLM 4OM1H 2R8SH 5EZLA 1G6RB 4LSVH 4NQXB 4MHHI 4KJQC 1CLYL 4QTIL 1GJIA 4KHXL 5IBUB 4EI6B 4MB5A 4LLVB 3GHBH 3RDTB 3WIFB 3ELAT 4X0KB 4ORGB 4K7PY 1JGLH 2PNDA 4Z78B 5I1LA 3ZE2F 1OSZA 4KJYB 4ZODA 1UWXK 4PJGA 2OR7A 3C08H 3DLQR 3KYNA 4K2UL 1U3HD 5F9WC 1MCNA 2UWEE 4PLKD 5JHDB 2KQNA 1RUKH 3D87B 2IADB 5F96L 3FB7A 4HGMA 4PIRF 1ACZA 5F1IA 4LSUH 1S7WB 5ISZD 3IDXH 3GJFH 4LIQE 1AJ7H 4XI5D 4ODUB 3U4BL 4UQ3B 1S3KL 4G8FA 4XRCA 4IDLA 3F12B 4P4KD 1MCOH 1W72B 2VUYA 1Y18B 1NCBH 1K4DB 3C5ZD 4C56E 3LS4H 1X5FA 3HKFA 1DFBL 3E2HB 4NSKA 4M62H 2O93L 1J10A 5GGSB 5ADPH 1ZMYA 3QB7C 2DTMH 5CILH 2PR4L 1CU4L 4POYA 5C7XL 1T20A 5IMOB 4Y2DB 5DI8B 1U8QA 1DE4A 5IMMA 3BPOB 1QLFB 4AEIL 4C56D 4RAVB 2CUMA 2X70A 3MXVH 4X7EC 2BNUA 2ZSVB 4HWEL 3OBAA 3TJHC 5HDBE 4H1LA 2A9NH 4UT6L 4IMKC 2IGFL 4O2EB 1I7TA 4U1MA 4A6YH 4S0TD 1KSRA 3MOBH 5EC2A 1FYTB 1KC5H 1BBJA 5DRWB 5DRNA 1LO0H 3O3AA 3S88H 4I0PA 1OT1A 4ONFL 4X4YA 1RK0B 4R8WL 2CIIA 1CQYA 5DMKB 3G6JE 2XG5A 1W8OA 2VDQL 1E4JA 1GGUA 3MJGX 1CBVL 2F19L 5F1SA 5BO1L 1CD1B 2BHUA 4P2OB 1KIQB 4TTGA 4MA7H 1LO4H 3SDXA 4AEHH 1OWWA 4LHUG 1I9RL 3MNVA 2DKSA 3NVQA 1RHHA 3RPIA 4LLUA 3PWLA 2APFA 1EUUA 1K5NB 5TE7H 1CFVL 5DXWA 4NWUH 4FZ8H 2Q87A 3E6HA 5GIRB 1A6WL 4N0CD 3MRFA 2CKBB 2CR3A 5ICXB 1AHWA 3DX8B 1A9EB 4OZHB 1DVFD 2FLRT 3H9SA 4CN6A 1KN2L 5E1HB 3TWCL 3VMOA 4JJ5A 2VR9A 4QT5B 1RFDH 4RIRA 4CU8A 1GGBL 1ZHKB 5CGYD 4E41E 3HUJE 1M05A 5BS0E 2YXMA 2LVCA 2BFVL 3UCRA 1MAMH 1T21A 4IRJB 5D1XA 1CDBA 1UKQA 1TJGL 5KSBB 5C0RH 3GBMH 5HPOA 5GRVL 4BZ1L 1HH6A 3HG1A 4URTB 1XMWA 4HJGA 2DDQL 4CGTA 5E94A 4Z5RA 4R0LB 1MJUL 1QNZL 4E41D 3CSPA 4X6DA 5BS0D 5JDSB 4JM2D 5D5MA 5AZ2H 4LVHC 4DZ8A 1SY6H 2J8UB 3SCMC 3HA0A 5JO5A 1X5AA 3U9PL 1I7UB 4G42B 3QCTH 4QRRA 4S1QH 3WUZA 4ODXA 1OTUC 3F7RA 1PKQE 3L5JA 5EG6C 3EYUL 4NGHL 3QEGL 4KRPD 5AYUH 1RZJH 2DQHH 5CGTA 2GTWA 1O7VA 1OSPL 2NNAB 2GJ6E 3HCVB 3LSOA 2ZSWA 1YEHL 3O11A 1BREA 1B4RA 1MHPL 1WFTA 5I17A 1CDCA 1QSFD 5JIKA 1OCWL 1VADB 3CAFA 2F5BL 3S4SG 4F37F 5I1JL 2IALB 3ARGA 2WP3O 4S2SA 4KGLA 3VFRB 1V3JA 2F5AH 4Z7VB 2GJ6D 4ODVL 2HT4D 5IVXF 2VO5A 5TE4L 3N0PB 4N0FB 3RWDA 2AJVL 1WQVT 4MXVF 3U0WL 1BOGB 5I15L 1FZMA 5MEPA 3GSVB 1AGEA 1Q0XH 2CDEA 2DYPA 1N5YL 3MA9H 1AQKL 1JZ8A 2ZG3A 5BZWA 1C1EH 3D85A 3RWCA 3EDKA 1XAUA 2DQUH 4YXHL 4PG9B 4AJ0A 4WTZG 4Z76B 4RWYL 2L7JA 4JFPA 1OLZA 1S7SA 2C1OA 5L8JB 5TDNA 3L5WB 1QQDA 4PJ8C 1ND0B 5DRZA 1A7NH 2CLZA 5HYSG 1OP5H 4ODWB 4PGDB 3WLWD 2DM3A 1QRNA 4HK0A 3EYSH 5D7LA 1WWWX 5L88H 1UM4H 2DMBA 3E8UL 4OGAD 1SJEB 1KLGB 1I9JL 4CUCA 2VXTL 5EUOB 1GXEA 5D1QB 3MLPA 2V5YA 2ZP0T 1W72L 3FQNA 2F8XC 4LSPL 2OJZL 4Z7UE 4GRWH 4XTRC 1U8MA 4R90L 5EOCL 3ME0A 1K6QH 3MFFA 1U95B 3RY6C 3IF1B 1NJ9B 3SE9H 1HHKB 2D31A 5IMKA 3QCVL 4OQTA 3MZTA 2IPTL 4M3KB 3T0ED 2ZZUT 1WT5A 2NY0B 2V2WA 4NQEA 8FABB 1HXMA 2OQJB 3NCYP 4JPWH 3IDJB 4NO0D 1X7QA 1JWUB 3SE3A 5C0ND 1HQ4A 4KDTC 3IS0X 1AFVH 4X5WA 1CFQA 3JV5A 5E99L 1GPOL 2QQNH 4IDJH 1ORQA 3SKJH 2IH3B 2F74B 3QEQA 4M1DL 3IU3B 5CSGA 4NKIH 1QEWB 4HUNB 1PEWA 2F8VA 4U3CA 2HN7A 1IT9L 1O0VA 3BJLA 3L7EA 4CMMA 4QHNA 4L1HA 2P48B 2EDXA 1T5WA 1AGFB 5C0GA 1YA5A 5HGBB 2FHCA 5I18H 3K1DA 1TLKA 4ENED 1R3IH 5IWLA 4WRLA 5E5UB 4U6HB 2DQGH 4AENA 1I85C 5H37G 4MQ7B 4NC1C 1C5DA 1NDMB 4C57C 3P0GB 3PG2A 4WY7H 1NLBL 1XT5A 2HWZL 3QDGA 4M7ZB 2AEWA 1A6UL 3V0WH 2YBRA 6CGTA 5D2LE 3FFDB 1N5AA 1MUJA 2W9DH 2XKNA 3GDBA 4GBXB 3L7FA 4YHPA 3PGFL 2EYSA 2FX9L 1BJ1H 1UJ3B 4PJDF 4KI5F 3EZ8A 1F5WA 4FQHB 3SGEI 4L9LC 3THMH 3I75A 1ES0B 2QL1A 4JFEE 4JKLA 4EI6A 4LLVA 1N4XH 4BSJA 1MCFA 2B7DT 3MNWB 3RDTA 5C2BH 4FQLL 5HHMD 4X0KA 1NGYB 4ORGA 3MCLH 4WCYH 5SX5H 1QFWL 4Z78A 5EU4B 4MA3A 4OZIF 1ZS8A 1U3HA 1PY4A 3WE6A 4FMKA 4KJYA 5IFAH 3NA9L 5GHWL 4LASL 3HE6C 1GSMA 3P73B 4JFED 4ODSH 3V7AG 2IADA 4BQ8A 1OAXL 4MXQD 4P4KA 4RBPK 4QXUH 3P30L 3SDCB 2VLKD 4ODUA 1RZKL 43CAB 4KFZC 3F12A 1J1PH 3FO2B 5D6DC 1W72A 5H8DA 1Y18A 3EJZC 3O8XB 4PJCE 2NW3A 5D7IB 1DBJL 3MLXH 5GGSA 4UIKL 3V52H 5EOTA 4Y1AB 5GSVB 4DOHE 4GXVL 1JPTH 1QLFA 4B50A 5HGGS 1RZJC 4MA1B 4LLMA 2Q8BL 4NUJB 5E1AB 3J8F7 3VFNB 5ABDE 1KT2B 2ZSVA 4OCNC 4AQOA 1RAMA 3IT8D 2DTSA 1QLEH 3QNZB 4OLYL 3GI9H 2AP2A 4HKZB 4PJBF 1F4XH 2E9BA 4JKPL 4JZJA 1FYTA 5DF0A 3NPSC 3HS0B 5DRWA 2E8ZA 2LAAA 15C8L 3OKKA 5FYLE 1K8DA 2EICA 2OTWB 4NPYB 3SDYL 3QIWD 3PDOB 2MQ0A 3V4PL 5DMKA 3R8BB 2V5SA 1A6VH 3D18A 4WI8A 5I1CH 2HTLD 2JIXA 3RJQB 3D3VB 5J9PB 4P2OA 3HZVB 2ENSA 1KIQA 4Y16C 3K8LA 1MNUL 1PG7L 4HJ0D 3MUJA 4YHOH 1I7ZB 1KJMA 1N0XH 1KCRL 2NY2D 2BVEA 1NBVH 4O58H 1K5NA 2MOVA 4M9PA 2EXWD 1QR1A 5GIRA 2R0WL 1DVFA 1XF3B 5ICXA 5ALBL 3DX8A 2P8PB 1A9EA 3RTQB 2P24A 4Z95L 1C5CL 3BISA 4OCLC 1J11A 4LCIL 4WO4D 4H88L 3TJEL 3RZCC 2Z8VC 4FQJL 1VPOL 2LFGA 3O3UN 3VRIA 3EJJX 4UAOB 1EA9C 5D2NB 2GY7B 1IGIH 1FORL 1DBKH 3UYPA 2X4SB 4G6KL 4UV7L 1M6OB 4M02A 3INUL 3PJSB 4RMVA 3VXME 2AJXH 3P4NB 1A2YB 1FNAA 2A6KB 2WWKO 5E6IB 3RUGF 4R0LA 1LP9F 4OZGF 1UWGH 1KEML 3LRSB 4HKBB 4L3CB 3NCFB 5HGHB 2VKWA 5I1GL 2CXGA 1E4XH 1NGQL 2C5DC 1U42A 2Q8AL 4LVOC 5JA9A 1RULL 5EZIL 4ALAH 3QUZD 4FXLA 4Z8FL 1HNGA 1Y6MR 4EI5B 5I6XB 2J8UA 2X9YA 4G42A 4K7PL 1WK0A 1M7IB 1JPSL 5C6WH 1MEXL 1RZGA 4IJ3C 4TQEL 5DHVH 4Y4KD 4JO4L 4O51B 4POZC 4WW1A 3VGBA 1NFKA 3EHBC 4TYUA 1RIHH 3O6KH 2JTDA 1QSFA 2NNAA 4JCLA 5DK0B 3BO8B 3U7WL 1JWMB 4YK4B 4HIJB 4POUB 3HFML 2FIRT 4FP8L 3QCUH 5CKGA 4Z7OE 1BEYL 2QSCL 1AD9B 1VADA 5CP3A 3U2SA 1MHEB 3T1WA 5HHVL 2MFNA 3ARVA 2AK1H 3VFRA 3MRIA 2IFGA 3VI3F 2IQ9L 4U4BA 1OAUH 1BOGA 3EOTL 4PGBB 2BZDA 4LP4A 3ET9F 4PJIE 3GSVA 2GY5A 4U0RC 3GEWB 4GKNB 4OLZL 3TESA 4RRPA 1RZFH 4LCCA 1P4BL 1RZIB 2CPCA 3S3PA 3BW9B 1MQ8A 4LLWB 4Y2DC 4F7TB 4XP4H 4PG2A 4PG9A 4ZYKB 3CFJB 4GG8B 3VWKB 1CQKA 3MV7E 4Z76A 3IB4A 1EGJA 3M17B 2UZIH 1OQOA 5JR1L 2XWJA 5DUML 2C4FU 1QSEB 4V2BA 1ND0A 2JELL 4CW1B 4JRYB 4MXWH 4PRPB 3MJ7A 3LEYH 1I8KB 3MV7D 3KVQA 1KTRL 3TA3B 1YEJL 3LKRB 2NLJB 1YJDH 1SJEA 1KLGA 1MFCL 5EUOA 4JPVL 5MI0B 1AE6H 5D1QA 1DQLL 3QUYC 3UC0L 4YHMH 4PLJC 4X9FA 5EDXA 3WNOA 5EBMB 5F89A 5FHAL 4X4XB 2DM2A 2I5YL 3IF1A 1NJ9A 1TQBB 1HHKA 4Y4HB 2E6QA 1HZHH 1R3JB 3NIDE 3BD3A 3QFJB 2OQJA 3WEXB 1A4KA 3QIBD 3VCLB 4XVJL 1K3ZA 3IDJA 2FGZA 3KJ6H 1JWUA 4RX4A 5EUKB 4NKQB 2ATPA 4LVNC 4H8WL 5IGXL 4X8JB 4GKOA 1C7TA 1WAAF 1EHLL 1WICA 2IH3A 4FTVB 1VGEL 1NCCL 1A0QL 4NZRL 4WWKA 5E24E 1QEWA 3TN0A 4W81A 4IRJC 2DMCA 4O02L 3GMPB 4JVWA 1J0IA 2FBOJ 3O4OB 3T2NH 1WWAX 5FO8B 2ILLA 3TNNB 5CEYB 4PGEB 1X5JA 5DC0A 5D7SL 5HPMA 4N0UB 1NLDL 4MQ7A 1A3RL 3HNVH 3CXHJ 1MREL 4ZS7H 1FFPB 5F6IB 3DSFH 2EDKA 4KQ4H 3WS6C 5JNYB 2GTZB 3F6LA 3FFDA 1MRDL 3L5XL 5DD1L 5KZCB 1ACYL 1ZLVK 5ENWA 3ZKNC 4GBXA 3V0AC 3N9GL 3BESR 3MOAL 1UJ3A 1NDGA 2X7LB 2DBJA 5KVEL 3IXTB 1CDGA 5F9OL 4FQHA 5BCAA 2JJSA 3QFDA 3I02B 2BHYA 3MNWA 1G7QB 3OG6B 2FBJH 3SDDB 1T2QL 1J88A 4LEXL 5EU4A 3ZTNH 1ZA6A 3JV4A 3L6FB 3V0VB 3MODL 1I3GH 5KVFH 1LO5B 1A7RL 1DUYB 1R5VA 5INDA 4PJGF 3RJDA 4XNUL 5B39B 5E7BA 1KCUH 4BSVB 5ITBL 2PO6C 1U91B 2VLKA 3EO0B 4UT9H 3WSQH 3P0YL 5GGTL 4F9PA 1YQ2A 2H2PC 4WI6A 4WGWB 1C16B 1LEIB 3VFGL 4NFCA 4NN7B 5F7HA 5JIPA 4X6CB 3O4LB 43CAA 2AEQH 1SM3H 3FO2A 3EYOB 5CJXC 2KBGA 1U58B 3O8XA 4OCYH 2AERT 5GGVY 4APQB 5D7IA 2BNRD 2R1YB 2IAMA 1JRHI 1Q9LB 4XCCL 3HMWL 2IBZX 2QQQA 4Y1AA 4JY6B 1INDH 4NHCL 4JHWL 5HI3D 2DLGA 2WWKT 1MSPA 5E1AA 1OP3H 1ZEAL 5CAYB 1HYSD 1KT2A 3QI9B 4LSQL 2QSVA 3QNZA 3TV3L 3QWOB 1W2KT 3QPQD 4HKZA 4Y5VC 1DLHB 1Q72H 3HS0A 2XKSA 4YDLC 4DGIL 1GIGL 3LMJH 2OTWA 4NPYA 3PDOA 5LVEA 4KUCD 5JXEA 3MLRH 4LL9A 5MHSE 3LVEA 3ZT6A 2APBA 2J3SA 4PB0L 3TFKD 2EDBA 4P2RE 3O0RH 3GJEA 5J9PA 2CQVA 4HMCA 3HZVA 1IQDB 2HJFB 4H1LG 1IAOB 3WIHH 1H5BC 2VDPH 3ULVC 4CN4A 5DJ8B 3PGCB 4DVBB 3SDXF 3RL2B 4ZFOL 5MHSD 2EO1A 3P4MB 4KY1L 4H25B 2B2XH 4YEEA 3PGDA 2AI0L 4P2RD 3HNSL 3DJ9A 5IG7B 4YE4L 4CJ1A 2P8PA 3RTQA 3I6KA 2B1AH 3MRKB 1DQMH 3ZKXB 4CKVX 1JNNL 4DZBA 5K9OB 1K85A 2R0KL 3WV0A 2XWBB 3QXVA 1CLOH 1DN0B 1J0JA 2XFXB 4LKXB 5D2NA 4EVNB 3CDGB 4YHKL 1J8HB 2X4SA 1YJDC 3S5LB 1M6OA 4M4RA 1M7DB 3PJSA 4ZDHA 1E0OB 3DXAA 3P4NA 3FOMA 1A2YA 1IE5A 1SJXA 1X5HA 2GSGA 2A6KA 1I1RA 1BVKB 4UT7H 3NAAL 1WIPA 5D1ZC 2EH8L 1T89C 1RSFA 5JW3H 3CSBA 4HKBA 3LRSA 1YNKH 4L3CA 4ERSL 5HGHA 5GRYA 1KJVB 3KJ4C 1G0YR 3DGCR 2QADB 4X6DF 1WZLA 1EO7A 5D5MF 4S1SH 4EI5A 5IB3B 4XVUD 1B6UA 5J11C 5C0BE 2IH1A 1W8NA 1JTPA 4XPTL 1M7IA 5SX4H 5DR5L 5TF1L 4O51A 1ZLUK 4FA8A 1CZ8H 4MJIB 3MV11 2X4RA 3P4OB 2LQRA 5DK0A 3O2VL 3P9MA 3VU2A 4TULH 4HIJA 4R9HA 3OAYK 5GGRY 5C0BD 5CJOH 1AD9A 1EDQA 1FHGA 1MHEA 3H0TB 5FOJA 5C0CB 1SBSL 4TNWF 4LFHG 3T2QA 1FNSH 1KTDA 1G7JB 3LPFA 1JFQH 4R97C 4ZSOB 3SDCC 1D5MB 1N2RA 1TITA 1D5XA 3TIEA 4GH7B 4YFDB 1O5DT 3IRPX 2ZUQC 4QGTA 5BQ7B 1IBGL 1ULVA 4V1DB 4GKNA 3V5KB 1E6OH 4H5SB 2VIRB 2APWA 4A2MA 3KLDA 2BSRB 1RZIA 3S34H 3BW9A 4R26H 4F7TA 2EECA 1B2WL 3ARYA 2HRPL 3CFJA 2HVJB 4GG8A 3RKDD 1FN4B 3VWKA 5ICYB 1EAPB 3PP4L 4FQXC 1MAJA 4XNZC 5DHYB 2BVOB 4YDJB 1DANT 3C5JB 1EMTH 3L9RB 2EC8A 4AEFA 4EN3D 4RFOH 1FL3B 3TO4C 1XCQB 3OX8A 4L3EE 2ORBL 3B9EA 4OF8A 5CINL 4CW1A 4JRYA 4PRPA 4PRID 1QRKA 4JG1L 5HHNB 4QY8B 5C08D 3VFUA 3VRJB 1QYGL 5IM7B 3FRUB 5L9DH 5DMYA 1E6JH 3KPLA 3LKRA 2NLJA 2CRMA 5E03A 5E2VL 3VXOA 4F9LC 5I1KH 5T33L 4F33B 4L3ED 3LQAL 2LE9A 3ZYZA 5K59E 5F3HB 2A6JA 5CZXC 5EBMA 3A6CH 5HDOA 1DBBL 5HSFA 1D7FA 3O2DL 3DVGA 4Y4HA 4HQQL 5LGHL 5GS0D 3VA6A 1OF2B 4UMGA 4X4MA 2ICWB 1N59A 2DL2A 1R3JA 3QFJA 1S9XB 2EDWA 1FPTL 3WEXA 1F45A 2R9HD 1XIWC 3VCLA 2BXYA 3C6LB 1K2DB 1RVFH 3ALPA 5HHOD 1MF2H 5EUKA 5TQ2L 3CX5J 4X8JA 4JFZL 1XZ0B 4WW2B 3NBNA 1T03H 4JG0H 4UAOC 2KZWA 4NQTA 3WKNA 1ZHNB 3QUMB 1QUNA 3DMMD 2AXFB 3GNMH 3KPQA 4ZFGL 4B0MM 3GMPA 3VRLF 4LCWB 5JXAH 3WXVH 3TNNA 4OTXH 2X9WA 4HGWB 1V7NL 4BQBA 4TNVF 2P1YA 1HK6A 4PGEA 2AQ1A 4F3FB 3VD3A 5HHXH 2BVPA 3AREB 5KS9B 2PW2B 4N0UA 3PIQB 1JWSA 5DTFB 4AZ8A 4HCRA 1FFPA 1GHFH 4UDTB 3GSQB 4YX2H 4BYHA 5I71C 3SBWC 3G6DL 3W11C 3SKMB 2W91A 5JNYA 4XAKE 2GTZA 5FGRA 4HBCL 3IDMB 4YO0B 4UBDD 5FM5M 4P23D 4XC3H 5EU3B 4YQXH 3BKCL 2EH7H 3O3EB 1Z6JT 2BDNH 2NXYD 2HJKA 3IXTA 4YK4C 2YOCA 2BJMH 1NQBA 1CGUA 1IC7H 3B3IA 3I02A 3P11H 5SWSB 4XAKD 4DEPB 1Q9OB 1RZ8B 4HGKC 5HDQL 1FRGL 3SDDA 1CXLA 1A1MB 2M1KA 5JHLL 1KELH 3L6FA 4H0HB 1A6AB 1NAML 5H2BB 3V0VA 4M7KL 1LO5A 4OCWH 4HG4K 1DUYA 3W39B 1EBPA 3ZYJA 3WDIA 1YYLH 1OPGL 5DFVD 1U91A 1IGML 3EO0A 4H1LH 1LEIA 1BX2B 3F58L 5IFHL 4X6CA 3O4LA 5IBUG 1YPZE 4N90E 1GGIH 5TDOB 2VDNL 4I3RH 3UO1L 3S6CA 1U58A 1XFPA 4Q9RL 2I07A 3T1FB 5CGMA 1KCKA 2OZ4L 4TSBH 1E28B 2YUVA 1HSAA 2WUBH 1MPAH 1Q9LA 1XH3A 1ITBB 3O2DA 4ZMAT 5IHUH 1T5XA 3U7YH 3RVWC 4QOKE 5M7QA 4JFQB 1BVLB 1FVCB 3LKPB 4HX1B 4O9HH 2Q6WB 2UWEB 3RAJH 1MFAL 3JXAA 5JLZB 3TVMD 4U31A 3TA3C 2N7AA 1B4JH 3QI9A 4OLXL 1RJYB 1QO3B 2IPKB 2OI9B 5F1OB 3VXUB 4KRLB 5MI0C 3RY4A 1OD7A 5JIIA 1MIMH 4QOKD 1DR9A 5I66B 2A6DA 2ZPKH 4LSTL 4JQVC 1XGYH 4TRPH 1T04A 2P47B 1ZVHA 1IEBB 4G3YL 1CLYH 2VISB 2HG5A 4QTIH 3VMPA 4KHXH 4BSWB 3B6SB 4DKEL 3OHXA 1HINL 3MGTB 1EZVX 2ID5A 1EO5A 2Z8SA 4A2LA 5DMJB 1IQDA 2NPLX 1IAOA 4OV5B 4X8XA 4PJFE 5DJ8A 2LTQC 3PGCA 4MQXC 4XHJC 4K2UH 1PGRB 2FO4B 1PLGL 2MMXA 5A1AA 5AD0B 3RL2A 2ADIB 4XVSL 3ZE0E 5B4MD 4QTHB 5F96H 2M8XA 3Q6FB 4CVWA 4P9ML 5TQ0H 5IG7A 1VFBB 3U4BH 1Q1JL 2CR6A 1H9VA 1S3KH 3G9AB 3GK8L 3T8XB 1ZT7B 3RZWA 4X7TB 4ZXBB 1MVFA 3MRKA 4I4WB 5FA4A 5I2IA 5K9OA 4DK3A 2PYEE 2XWBA 1XGUA 1DN0A 1H3GA 3CFIC 1DFBH 2XFXA 2F53E 1F3DH 2FH8A 4LKXA 5T1LB 3WJLC 4EVNA 3CDGA 2ZCLL 2PR4H 1CU4H 3AFLA 5C7XH 5E2UH 1UWXH 1M7DA 3W0WA 5ADOL 5GS0L 2AJYL 3T3PE 3SGKA 3W9DB 2K7QA 4AEIH 5H35A 1BVKA 1D9KC 1HE7A 2X6MA 3MMEA 3QQ9C 3SDAD 4WI4A 5F6IC 1T2JA 1D5ZB 3CGTA 2F53D 1YMMB 1VFAA 4HWEH 2V2XB 2XT1B 1KJVA 4JRXE 4UT6H 2IGFH 5IQ9B 2CJUL 2W0PA 3CFEA 2OTUB 1MFBL 2FL5A 4R4ND 2DL9A 4WV1C 5IB3A 2Z31B 3QULB 1PKOA 4P4RB 1V3LA 2J8UF 2Z35B 3J7HA 4ONFH 5J57B 2DQJL 1WUNT 2OZ4A 5DMGD 4R8WH 3HUJB 4E41B 3G5VB 3LIZL 1II4E 4JRXD 4MJIA 2Y5EA 4JM2B 2VDQH 2NY3B 4KKCC 2N7BA 1CBVH 2F19H 1AGDB 5BO1H 1FL5B 4WIQA 5J8OA 4YZFE 1JHLL 1OW0C 2NY7L 4TSCL 5IBTL 1I9RH 3H0TA 4KZEL 3PDDA 1YY9D 4ZG1A 1GC1L 2NY4C 2G5BA 2RGSA 1J8KA 3IAPA 5HTSA 3GSOB 3OAZH 32C2B 3ES6A 3H3PL 5GGVL 1CFVH 4NZDA 2LVEA 1A6WH 3AROA 1JRHL 4ZSOA 4HBQA 1D5MA 1QBML 3FKUS 2CRYA 4WHTB 4AMKL 1TTFA 5FYJU 1KXTB 2VZTA 2BVUA 3P0VL 2EIEA 4NO5B 3U9UB 3C8HA 4FQQB 5CEZE 4YAQB 1KN2H 1PKQB 5DDHB 3TWCH 1CICC 4APQC 4EZMA 3V5KA 4XVTL 3DI3B 5DMIL 4H5SA 3ULUF 1GGBH 4KI1A 2VIRA 2QQLL 2BSRA 1CWVA 2GJ6B 1HHHB 5F7DA 2BFVH 3VD4A 2CGRL 2HVJA 4AIXA 1FN4A 1TJGH 5CUSL 3M1BA 3WKML 1T0MB 5GQBA 3VGAC 4JDZB 5DHYA 4PD4J 4BZ1H 4YDJA 3C5JA 3WLBB 2DDQH 3RGVB 3X12A 2Y07L 1MJUH 1QNZH 2VTFA 4M93B 3RVXC 4Y5XB 1XCQA 4X99A 2DBLL 2XTJB 4MS8D 4PLNC 4RRPG 3VG9B 5HHNA 1IAIL 3LKSB 4RGNE 3VRJA 5IM7A 1I1FA 4MAUL 2GEEA 1BD2B 2DOCA 3O6LL 3U9PH 2MKLC 3I50L 1VEMA 4PRBB 4WENB 4DVRL 3WFBL 4PY8I 4AT6A 3EYUH 4NGHH 5DRXB 3QEGH 4MB3A 4LRIA 3ZZ1A 4F33A 3JWOL 5F9AC 2PTTB 3FQWB 5EUOF 5F3HA 1Z3GL 4BUHA 1OSPH 4I3GA 1H3UA 2HLAB 1YEHH 3BDYL 4RGND 1MHPH 1IC4L 4S11A 1OCWH 3UJIL 4HDIA 5ANMA 1I1AB 3MRQB 4HF5L 5F7UA 1BLNB 2APXA 4L4VB 2F5BH 3GSXA 1CE1L 4ESKA 1OF2A 5I1JH 5HHOA 4L4TD 1S9XA 5EB9A 2FJFB 1HYRC 2OLDA 4ODVH 1K2DA 3BZ4B 3QUXD 5TE4H 3QP3A 5B22A 1DBAL 2AJVH 3ZKXC 3U0WH 5HI4D 5I15H 4WW2A 5D4QA 3WJJC 3BPCB 4MCYA 2B20A 1L9MA 3UTTE 4PJ7E 4F15B 3DMMA 1ZHNA 1X5XA 1N5YH 1Q9WA 1AQKH 2EYRB 1MHCB 1F8TL 3FZUD 4F7PB 3BWAB 3LEVL 4YXHH 4HUVB 2DM7A 3PWVB 5JPMB 3JUYA 1T7ZA 3HRZA 4NT6B 5C07E 4MHHG 4RWYH 4KMQA 3JWDC 1KPRB 2L4OA 3UTTD 3KPMB 4HGWA 5BOPA 2HMID 3ZDYF 4F3FA 1NCWL 3MRBA 5DTFA 4ZO6A 3REWA 1NC2B 1R3KB 5C07D 4HWBL 4UDTA 4Z7NE 4PYHA 3GSQA 3GMLB 5DEFB 3SKMA 3BEVB 1KTLB 3E8UH 3WHE0 3IDMA 2AXGB 4YO0A 2VXTH 5EU3A 1K8IB 1B0RA 3UMTA 1ZVSB 1W72H 4QRUB 2FATL 2VYRE 4LSPH 4EIZC 2OJZH 3O3EA 1BAFL 4W6XB 4JB9L 4R90H 5EOCH 5GJTL 1OOAA 3S3SA 4S1RL 4Y19D 4KJWD 5SWSA 1WVZA 1Q9OA 2DWEB 2D0HA 3QCVH 2FYYA 2IPTH 4HWUA 2UUDK 3OR6A 1A1MA 4HFWB 3BI9X 3V6OA 4O2CB 5H2BA 2C3VB 1LEGA 2XZQL 3RHWF 1NFDE 5DJXB 5D2LB 1WC7A 1IAIM 1K3IA 2YZ8A 5E99H 4JLRB 1GPOH 3LN5B 5E2JA 1BX2A 3HE7D 3OJ2C 4M1DH 3LKQA 1EERB 3WNNA 4F7MB 4Z18A 5TDOA 3MBED 1BF2A 1IT9H 3JBG7 4JFEB 4YBLC 3WL9B 5D7IF 5DA0B 3DX7B 3I3DA 2MWCA 5MP6L 2HTKD 4NC1E 4H26B 4M8QB 1NC4D 1TNNA 4JCMA 4U3XA 3BN9D 1QFUL 1BVLA 1FVCA 3LKPA 4JFQA 1BJ8A 2JB6A 2Q6WA 1FAIL 2R56L 5JLZA 1UFUA 1NLBH 2HWZH 1A6UH 1AO7E 2BXZA 2J8HA 2XI9A 5C6TL 2CK0L 5CWSA 1TCRB 2IPKA 3MRGB 4OFVA 3VXUA 5GS1B 3GIVB 3V6FB 2BSSB 3PGFH 4RGMC 3NFSL 1Z9OA 2FX9H 1PY9A 2VZ3A 2VLRB 3WS3A 3DRQB 4ZUVB 4ZUUB 4CU6A 1AO7D 2B5IB 2VISA 5SWZE 4KGJA 1MWAB 2V5MA 1PX3A 1FNHA 4NQVB 4DOHB 4FQLH 1U8OA 5J6HB 3OF6A 3MGTA 1F00I 1KPVB 3OPZL 4PP2B 4LAJH 1QFWH 3L95B 2QR0B 4NNPL 1RJZB 3C6LC 3NA9H 1A3QA 4OV5A 5TDPA 5GHWH 4LASH 4CMHB 2FO4A 3OMZA 5AD0A 2ADIA 3FB5B 4TUOA 5SWZD 5IK3A 4HWBA 4PJEA 3ARFB 1FFOB 1INEL 1A22B 2YN3A 1OAXH 3BQUC 4KK8C 3P30H 5GGRA 4M1CC 1RZKH 1JI1A 4NM4L 4P49A 1ZT7A 3PWPE 2ITCB 4X7TA 4ZXBA 1ZT1B 4I4WA 3D0LA 4QRPE 3ZSSA 2HJLA 1DBJH 1G7PB 2BRRL 2I60L 4F2MA 5J89A 1NMBL 2A0LD 4FQIL 4P46B 4LEOB 4FFWD 5T1LA 4UIKH 4JN1L 2UYLA 3CSYB 4GW4B 3VD5A 3AREC 4GXVH 5DUPL 4WO4B 3GMQB 3W9DA 2AXHA 3NCJH 5CP3H 2FX8L 5GRWA 4F8QA 2GK0B 4QRPD 2Q8BH 2F54E 3SKUD 1D5ZA 1UKSA 1YMMA 4RBPH 3GMRA 4OLYH 5IQ9A 1QLRB 3K1KC 2OTUA 1OTSD 3PV7A 4LSSL 3PL6C 4JKPH 4EEEA 2Z31A 3B9KD 3QULA 2V6HA 15C8H 3KXFE 3VXRE 3SDYH 2F54D 1JZ3A 1S5HA 3MJ6A 4P3WA 5BW7C 3V4PH 4EOWL 5F9JB 4I9WE 3T4AB 3QH3B 5DQ9B 3VXMB 1T7WA 4HUXB 1G9ML 1FL5A 2H32H 3CVHL 2BY3A 1IGYB 5E95B 2R2HB 1MNUH 3KXFD 1FFRA 1PG7H 3VXRD 2R29L 4Y4KB 4LQ1A 3VWJD 1BFOB 4NC0B 1NCTA 1KCRH 1WITA 3OV6A 3GSOA 4I9WD 3EDFA 3ZSTA 4U1IB 2ED8A 2R0WH 3I9GL 5L2KE 5ALBH 4WHTA 2GYSA 2RR3A 1IM9B 1DQJB 4NO5A 4Z95H 3U9UA 4FQQA 1C5CH 5CS7A 4PLKC 5DDHA 1PKQA 4LCIH 2AK4E 4H88H 5AAMA 3TJEH 4FG6D 4FQJH 1VPOH 1T22B 1F11A 3MBXL 4YR6A 4XI5C 3CFKA 1FORH 3BGFB 1KNOB 1HHHA 4UOW0 1BBDL 4Q6IC 4G6KH 4PPTA 4UV7H 4P4KC 5L2KD 4IRSD 3INUH 2GFBB 3R1GL 4GRWE 1A21A 3C5ZC 3PWNA 1AQDB 1DEEA 2CD0A 4DAGL 2VQ1B 3WLBA 5KJRL 3RGVA 1XGQB 3SGJC 1KEMH 2CLVA 4PJHE 5F72S 4Y5XA 1NGQH 2Q8AH 2OI9C 3T77B 1RULH 5EZIH 3VFVB 3VI4E 3U0PA 4Z8FH 3KPTA 4P2QE 4PJIB 1BD2A 4K7PH 4MNQE 3PQYD 5D7JB 1JPSH 1MEXH 4TQEH 5DRXA 4JO4H 1S7QB 5B8CB 2VMFA 3FQWA 4OF0A 4G9FE 2FJHB 3U7WH 1J18A 2BNQB 4XPHL 3HFMH 4P2QD 4JZJC 4FP8H 1BEYH 3L5HA 1AR1D 2G75A 1D6VL 3MRQA 2QSCH 4MNQD 1MJ7L 1BLNA 4L4VA 1I8LA 1F6FB 3HZYA 5HHVH 4ZNEA 3ZE2E 1TVHB 1CF8L 4G9FD 5C2UB 1YNTB 2FJFA 3FOLB 4UILL 1BIHA 3G04A 5F8QC 2IQ9H 2DN7A 3P40A 2Y6SD 5ELIA 1F13A 4JREB 1I9IL 3EOTH 1JGDB 1T3FB 4OLZH 4ZPVB 2OP4L 3CFBB 4N0CC 3S35L 3H9YA 1MHCA 4F7PA 1I4FB 4U1JB 1IZKA 2C3HA 1DVFC 4HUVA 3PWVA 5JPMA 1U8NB 3BZFB 4NT6A 3CVHA 4QHUB 3K2MC 2XICA 1A02N 4U1KA 3IKCA 5CGYC 1BOYA 2O61B 1KPRA 2ZUUA 1AH1A 5JR1H 5DUMH 3V4VL 3WNMA 2XY1A 4LNRA 2JELH 1SEQL 4L4JA 1A8JH 1KUMA 1NC2A 3UTQB 1R3KA 3PWUB 3UJTL 3MACL 2ZKHL 3FO9B 1MCIA 3GMLA 5DEFA 1YEJH 3BEVA 2DKMA 2VITA 1JE6A 5LAXA 2AXGA 3PHOA 1MFCH 5E08L 2PW1A 4JPVH 4JM2C 1TTUA 2YPLE 3IJSB 1DQLH 1ZVSA 5AUMB 4QRUA 3UC0H 4Y19A 2E8YA 5CMAA 2FRGP 3W81A 2BCKB 3NZ8B 4PP1D 5FHAH 4WUUE 2I5YH 4WNQB 2DWEA 1CIUA 4KRPC 4XXCC 4XB8A 1IAKA 4LHUD 4HFWA 1KB9K 5K9QI 2C3VA 1X9QA 3HMXL 2YK1L 2C4FT 4XVJH 4G6FD 5JPNB 5IB2B 2X09A 4P57A 2W9LA 4ZOAA 1ZA3A 5IW6B 1FL6B 4NBZB 5LXGL 2EO9A 4H8WH 4ISVB 5GGUB 5IGXH 5D93C 2AKRB 1NUDA 1EHLH 2OL3B 4LP5A 3IFNL 1CCZA 1VGEH 1NCCH 4X6CF 2HT4C 4F7MA 1A0QH 4M00A 5C09B 4NZRH 4ZFZB 3GZKA 5IBLD 4OKVA 4OCSL 1T6WA 3V5DB 4O02H 1R24B 1YEEL 1DQDL 3N1PC 3WL9A 4PBWD 1Z9MA 4H26A 5B39G 2BX5A 4M8QA 4M93C 4WGVB 5FO9B 4TUKL 4CVXA 4IOFD 5B38B 5D7SH 1K4CB 4KROD 1NLDH 1A3RH 1HWHB 1NANH 3LS5L 4HLJA 2DLHA 2VERN 1MREH 4JN2B 3EYFB 4K3DL 1UYWL 2EEDA 4XPGL 4HUWB 4KRNA 1LDPL 4TVSa 1MRDH 3L5XH 5DD1H 1TCRA 2KH2B 1ACYH 3MRGA 4GSDL 5GS1A 3GIVA 1BQHB 4QRSB 3V6FA 3P9WB 4OFYA 3N9GH 3MOAH 4OBSA 1PD6A 5KVEH 2ZWLT 3FQUB 4BFIA 2R2CA 2VLRA 2YMXL 3WLWC 3DRQA 4ZUVA 5JA8B 4ZUUA 1BZ7A 4OGAC 3O3BB 5I1EL 4NQVA 2E7LA 3RVUD 1C5BL 3EO9L 5J6HA 5FECB 1KPVA 1T2QH 4PP2A 4LEXH 4NN6B 5BV7B 1SYVB 2R4RL 1CFTA 2QR0A 5L8LB 3MODH 4RAUA 3S36X 1P7HL 4BJLA 1A7RH 1U8HA 3PNWB 4XNUH 5ITBH 2VR5A 3FB5A 3ARFA 5CBAA 1OL0A 3WFDL 2XN9A 3P0YH 5GGTH 1FFOA 3F65A 1ZLVH 3T0EC 4B53A 3NZHL 1IZJA 1OAYL 2WQ8A 3VFGH 4F15C 5IEKB 5IVXE 5L0QB 3M8OL 4KH2A 4GKZB 1CD9B 4X6FB 1OVZA 2YD1A 4N1HB 1EVTC 2ITCA 1D5BB 4YFEA 3NACL 5F97E 1ZT1A 3RX8A 5C0NC 1MI5E 5BXFB 2YC1B 1G7PA 4P46A 4JFDE 4LEOA 3DX9B 1LILA 1QBLL 2Q3AA 4XCCH 3HMWH 3VFWB 4S10A 2P7TB 5D70L 1NGZB 3JUZA 3CSYA 3K4AA 3X3GL 4NHCH 4JHWH 5C0AD 4YC2B 4ZAKB 3GMQA 4M8VA 2GK0A 1MI5D 1ZEAH 4CRPA 1UM5L 3ULSB 4JFDD 1Q9KB 4ENEC 4UIMB 3AB0B 4KMTL 4LSQH 5F1KC 2B4CL 2O5XL 3TV3H 5CBEB 4U1LA 1QLRA 4P2CG 4QXWA 5F7KC 3RWFB 5I75B 3DGGB 1YQVL 4DGIH 1CVRA 1GIGH 8CGTA 3S5LG 4UTBL 2AV7A 5SX5K 5E6YA 1HNFA 7CGTA 2YD9A 4YHYB 3EFFB 1AY1L 5E4EB 1SMOA 1VEPA 3T4AA 1C12B 3QH3A 3P77A 1A1NA 4PB0H 1KJ3L 2NY1D 2AQ3A 4HUXA 3MNZA 4IOIB 4XCEA 4DUWA 2R2HA 5IOPB 4X6BB 1FO0B 3UZQA 1BFOA 3K3QA 2ZNWA 3O9WB 1BZ9B 1TMCB 3UBXI 4U1IA 2QHRL 4KY1H 4K3JL 5F1NB 2HT3D 2AI0H 2YD6A 3HNSH 3W5NA 4YE4H 3UPRB 1F2XK 1DQJA 3B5HA 4Z7WE 3ARDD 2VZSA 1AP2B 1JNNH 2R0KH 4U2YA 1T22A 3C2SA 5KTEL 1F58L 4MXQC 5EU6E 1BHGA 1DUZA 5KSAB 4HK3J 4JVPA 1FGVL 1J87A 3HLAA 4YHKH 4X7CC 3GI8L 2GFBA 2NR6D 5J1AA 1RV6X 1AQDA 1WFOA 3R4DA 3NAAH 3UTOA 2VQ1A 2EH8H 4BK5A 3U46B 4JQIL 4HWNA 4NRYA 5ERWB 1XGQA 4YHIB 5EU6D 1WFUA 4ERSH 5DQJB 3SGEH 4E0RB 3QDJE 2WBJB 3T77A 4EBQL 3QDME 1AGCB 1HEZB 2OJEB 3MRRA 2MQ3A 1KB5L 3OKNB 4PR5B 4PJIA 2HFGL 2AV1B 2B5IC 3B9AA 3FN3A 1M71B 4XPTH 1JPFB 4HKXA 5DR5H 4WU5A 5TF1H 1S7QA 4PJDE 4ZS6C 2HT2D 3QDJD 3GSNB 3O2VH 4KI5E 2JJTC 3V7AE 3QDMD 2BNQA 3F7YA 4LCYB 3QIWC 5E00B 1I8MA 4HMDA 5FF6B 1H3WM 1EO8L 3LHPL 2C3WA 4PJ5B 3UJJL 3GMMB 1FGNL 3WO3B 1SBSH 4OZIE 5HYEA 1TVHA 3DX6B 3UTSB 2HTLC 1YNTA 3FOLA 4XCYB 4JKWA 4XAWL 5E9DD 4KI5D 1JZ4A 4YXKL 1FZJA 5HVFB 4HJ0C 4L29B 4CVZB 5CLWA 1UB6B 5K9KB 1IBGH 1ZLUH 1YNLL 1FNGA 4ZPVA 2EXWC 4WW2F 3CFBA 3EOBB 3EZJB 5IESL 3FO0L 4F37K 1I4FA 4U1JA 2MQCA 2SEBA 5EO1B 3OAYH 1B2WH 1LEKB 2C1PB 2CLRA 1MJ8L 2HRPH 4WO4C 3ZL4L 1U8NA 4PB9L 5D7KD 3VXSE 3PP4H 1VACB 2BY2A 4QHUA 2R23B 3DOSA 4I48B 2O61A 4G6ML 4D9RE 4M43L 2FEEI 3OKDB 4HMEA 2RIKA 4W4OC 2MCG1 2ORBH 1X5ZA 4HH8A 2R4SL 5CINH 2XYCA 1RPQA 4JG1H 3UTQA 3CXHK 3WXWL 3PWUA 4DFIA 2IBBA 1QYGH 3FO9A 2NTSP 1IRAY 1CI5A 3X11B 2HLFD 5E2VH 3P9LA 4PJBE 5T33H 1N7ML 1PFCA 3LQAH 5AUMA 3VXPA 2CSPA 4GAFB 1OD9A 3QUZC 5FOBB 1DBBH 3SOBH 3I84A 3DBXB 2CRIA 3EDEA 5J0BA 2E7CA 4AEEA 1C8PA 3O2DH 3GSUB 4WNQA 3QQ4B 4Y4KC 4HQQH 5LGHH 1YMHA 5LBSL 5IFJB 1IJ9A 1PBYA 5C0EB 1CT8B 3C87A 4NYLB 1FPTH 4KV5F 5DHXB 3DUSA 5DEGB 5I1DB 5TQ2H 1FL6A 5IW6A 4WU7B 5FCUL 5GGUA 1KB5A 4JFZH 2AKRA 2JCCE 2GUOA 5HI5D 3U4AA 2OL3A 2R1WB 4HKJB 3JTTA 1T1WB 4JGMA 2FLBT 3BGFC 2VXSL 5C09A 4ZFZA 1LO2L 4M61B 5BRZE 3ZT5A 3ARBD 1XF2B 3V5DA 4ZFGH 5T1MA 4ZOCA 4FMFA 4CU7A 3IJYB 1A6ZB 1S9YA 1CTOA 1V7NH 3PABA 5H94B 1P7QD 5B38A 4JAMA 1K4CA 2LU3A 3CK0L 5BRZD 2EE2A 5IB4B 5HHPA 3RUGE 3LPGA 1AD0A 1NFIB 3FJTA 4JN2A 1LP9E 4OZGE 4PY7B 1OM3L 4GRLD 5C0FB 2GHWB 3G6DH 2UVEA 2X4NA 3O41B 4HBCH 3AUVA 1YPZB 4ZNCD 4JFFE 4QRSA 5B8CC 3D2UD 3D39A 3K2UL 1CDUA 2ARJB 3DVNB 3BKCH 3EW3B 3FQUA 4NBYB 4P5TB 3C60B 2YUZA 3WUWB 4GS7C 3O3BA 5EFIB 4PRHE 1QOKA 4M4PA 1P4LB 4KKAD 5HDQH 1FRGH 4I2XB 5FECA 4JFFD 2P46B 4XP1L 5JHLH 1NAMH 2VXVL 4M7KH 1UXWB 3PNWA 4HHAB 1S8DB 4PBVC 4XP9L 3E6FA 2NZIA 4Y4FB 2NY6D 1OPGH 4PRHD 3G5XA 1IGMH 2IG2L 4PJEF 3F58H 4TOYL 3V8OA 2R69L 4NOFA 3VI3E 4UNUA 5IFHH 4XT1C 4GKZA 3QIBC 4OB5L 3K46A 1D5BA 2VDNH 3UO1H 4PGJA 4Q9RH 2OZ4H 5BXFA 4NP4L 1F90L 4KVCL 3UBXB 4PJ9D 2YC1A 3F62A 4CNIB 4J3VA 3DX9A 2H3NB 4IIQA 3VFWA 2OK0L 5C0AA 4NZTL 2P7TA 5F9WB 3IVKB 3NFNA 1S9WB 4Y2OA 4HUUB 2EZ0D 2KL6A 5I0DA 1MFAH 3DIFA 1OGTB 3BVNA 5IKCA 3L3GB 1JZ5A 1KF9B 1P9MA 3KPSA 4Q7DA 4UIMA 4OLXH 3SE4C 1G6VK 3IKKA 1DLFL 4EUPB 2EDTA 2Q76B 2WIMA 1L7IL 3DGGA 4LSTH 2PYEB 4HFUL 1S7TB 1ETZB 3QXUA 1KG0A 2Y5TB 4OGYL 4G3YH 5FV1L 3EFFA 3MLYL 5HYJE 1C12A 2EKSB 4DKEH 5K93A 1HINH 3IFOA 3H6JA 1XR9A 4OM0L 4JFYB 1RHFA 5C6PB 3O45B 5F88A 4LLDB 5DK3A 5IOPA 4IHOB 4X6BA 2H2SD 1A64A 1TZHB 1PLGH 4AIOA 4JRXB 2DIAA 4XVSH 2XZAL 3P3YA 2A9ML 1R5IA 2EEBA 3O9WA 5HYJD 5D6CA 3HNTL 5F1NA 4KTEL 1KULA 5HDLA 3Q2CA 1H3PL 1Q1JH 3OAUL 1JMXA 3GK8H 4JHAL 2IFFL 3SQBA 3LDBB 1AP2A 4ZFFA 3KPPB 2CMRL 4LPTA 2I9TB 2X4OB 5BZDB 5KSAA 3QIUD 2ZCLH 4AY0A 1OP3K 5FFLA 2CDGA 1R0AL 4YPJA 1UCTA 2XNAB 3HC0B 4J4PD 5ADOH 5GS0H 2LU4A 2AJYH 1WWBX 5EN2B 2ERJB 3LQAC 3R06A 4XH2B 2OMBA 4KMLB 3U46A 5FUZL 5ERWA 4YHIA 2P8MB 1UXSB 2VWEE 5GZND 5TH2A 2H6PA 3FCTB 2XQYG 2V2TA 4E0RA 2CJUH 2WBJA 2E5EA 5HI3C 1AGCA 1MFBH 1FJ1B 1T66D 3OKNA 4KAQL 1HYSC 4Q9CA 2AV1A 2DQJH 1M71A 1JPFA 2WIIB 3L3DB 1MCKA 3C5SA 3LIZH 2ESVE 3QPQC 4E42B 3CMOL 3EGSB 2WNGA 2K7PA 2E27L 3GSNA 4MNGE 4MD4B 4NQDB 4F57L 4UU9B 4ZD3L 1NH6A 1DQTA 4LVEA 2I25N 1OB1A 1J0HA 3EYQD 2RJMA 4LBEA 2WMPA 2VDML 4Z7QE 2OS7A 5E00A 1GOGA 5FF6A 1IGJB 1JHLH 1V3KA 4TSCH 2NY7H 5IBTH 1JPST 4PJ5A 4KZEH 2ICCA 2WLZA 5E9DA 1E4WL 1GC1H 3KYAA 3SCMB 2ESVD 2ITDA 3MC0A 4WI7A 3TFKC 4K23L 3DX6A 3UTSA 3H3PH 5GGVH 1XR8A 3O6FA 1ADQL 2CIKB 1JRHH 3HN3A 1QBMH 4RGNB 4AMKH 1UH3A 3HPLB 3NIFF 4L29A 4CVZA 3P0VH 4HS6A 1UB6A 1S9KC 1J86A 1TXKA 3CX5K 4KK9D 5K9KA 4RMWA 4XVTH 5DMIH 1Z0MA 2QQLH 1R3HB 4WHCA 4L8BB 2DQDL 3WFHB 2C1PA 2V17L 2CGRH 3LCYA 5CUSH 3WKMH 1CFNB 1VACA 3TZVA 3BRFA 2WANA 4RFEB 2ED9A 4HUMB 3T0XA 3DROB 4UDUB 2Y07H 1UEYA 4XP5L 3KHOA 2G9HB 2DBLH 2EE6A 3QT2A 3MFGB 4GMSL 3QNYB 1LHZA 4JHZA 4RMTA 1S7RB 5I75C 3OZ9L 1IAIH 4MAUH 3O6LH 1P1ZB 3I50H 1RUML 1IILE 3X11A 3VGFA 4OI8A 4DVRH 3WFBH 4JGJA 2R0LL 1MFEL 3JWOH 2WM0A 2WINB 1Z3GH 3BAEL 5GZOD 4XVUC 1MCEA 3BDYH 4PJ8B 1RI8A 1G7HB 1CDHA 3AU1B 3L3KA 1IC4H 4YUEL 1A7QL 4MD5B 3UJIH 2XPGB 3GSUA 4HF5H 1MCPL 1Z5LB 3NCMA 4LPWA 1CE1H 4YDKL 4UB0L 5C0EA 1CT8A 3GRWL 5DLML 1EFXB 2PETA 4N8VB 4TSAL 3OJDB 5DEGA 1GRWA 5I1DA 1DBAH 4GT7A 4WU7A 4WI5A 1BQLL 1CL7I 5ALCL 2R1XB 5FXCH 5KAQF 2R1WA 2CUHA 4D0DB 3GJFB 5IIEB 4HKJA 4QWWD 5J12C 4AG4L 1F8TH 3LEVH 1H0DB 3H9SE 1XF2A 4NQCD 4ZTPL 2ICWJ 2Z91B 4RQQB 4EKXA 4YHLL 1YN6A 4G7YL 5GGSY 2FDBP 3IJYA 5DD5L 3X17A 3QJHA 5H94A 1JV5B 1QBBA 4M6AA 3FN9A 5C0IB 1NCWH 4I77L 5KAQG 4HV8B 5D8JL 3D69B 3MBEB 1KLUA 5EU5B 3RKDC 1NFDB 3H9SD 3TBWA 1I7RB 1AGBB 5IB4A 1I1YB 3VH8B 2DI7A 2IANB 4HPOL 1NFIA 3HG1E 4HWBH 1GL4B 4PRAA 3K81A 4BH8B 4EN3C 3BRDA 4X6DE 2E7MA 3O41A 1HDMB 1NC4B 4A6YB 1YPZA 5D5ME 2QKIB 3KPRB 5D1XD 2ARJA 2FATH 3DVNA 2DLIA 4JQXC 4B41A 1BAFH 2WK2A 3OKOA 4IBLT 2JB5L 2ZG2A 2VLJE 3HG1D 4JB9H 1T80A 3C60A 5GJTH 3QO1B 3WUWA 4PV8B 4S1RH 5EFIA 1P4LA 3IS1X 2ICEA 1FVDB 4I2XA 4YXLL 3KHQA 1IARB 3BSZL 1JYWA 3KYOB 2XZQH 1TFHA 1UXWA 4LFHD 4HHAA 4QRRD 5FKAB 1Q8MA 1T7VA 2W60B 1NBZB 1NGXB 3NFPB 5GS0C 3MROB 1RJCA 5C8JB 4ZUSA 4N5UA 4HIIB 3RBGA 4U6VL 2R9HC 4L9LB 3LOWA 4M7JL 1KIPA 1T83C 4BQ9A 1MVUA 4QRTB 1CFBA 4OLVL 1IM3B 4OFPA 5EIIB 3UBXA 2P5WA 3FN0L 5ITFB 4CNIA 3ARGD 2H3NA 1YEDB 2UUDH 4GW5A 2CRZA 3HE6B 5DC4B 5MP6H 2J6EL 4NIKB 3L1OL 1F4WH 1UB5B 3DMMC 1QFUH 4ORZC 4HH9B 3V9FA 3UYRL 1JF1A 4CBPA 35C8L 1FAIH 2R56H 4AQ1B 2YRLA 5FYKU 2R2EB 3L3GA 5JW4Q 2DRUA 3ZHKA 2DYPD 2FB4L 5C6TH 2CK0H 2APTA 2R0ZL 3D85D 1J05B 5ESVB 4EUPA 5DJDB 3PWPB 3NFSH 4J3XA 1GC1C 1WISA 5LKNA 2X42A 3BZEB 2Y06L 4QRPB 4WUKL 2PYEA 1S7TA 3MGAA 4KUZL 1QRNE 5I8OL 1EHAA 5D7LE 1ZWIB 5HVHB 3GFUA 4Y89A 2Q7YB 5FO7B 1UT9A 1IMHC 2APVA 4BK4A 4UBDC 4P23C 4Q2ZB 4PJAB 1YZZA 3OPZH 1YY8A 4JFYA 3B9KB 3V6ZA 3BD5A 3V95A 2X1XR 5EWIL 2NXYC 2PXYD 3CUPB 4NNPH 4IMKA 2X10A 2DI9A 1QRND 4IHOA 2F54B 3RIFF 5D7LD 1TZHA 3NPSB 3EJYD 2EE3A 4GKSA 3HAEB 1INEH 4NQEE 4RA3A 4EQ3A 3U30C 3ESVF 3VFOB 4NM4H 3U83A 3MV8D 1T6VN 2C3XA 3KPPA 5DFVC 2X2YA 3QZWB 4NKDB 4L8DB 2UY6A 1UH4A 3MV9A 4Y16B 1KACB 2X4OA 4YBQD 2BRRH 2I60H 3ZHDA 1NMBH 3QEQE 4FQIH 4NQED 4FFYL 5DGQA 1MCBA 4JN1H 4MAYD 1SVZA 2Y9RT 1HKFA 5BVJB 5M94B 1U92B 3VRLE 1FBIL 5DUPH 1UVQB 1FCGA 1IKNC 2FX8H 4BFBD 2JF1A 4XH2A 3C8KB 1MCHA 2P8MA 4WHYG 3QEQD 1UXSA 1AKJD 4TTDD 3FCTA 4XBPB 3DETD 4WJ5A 1NEZB 1WBZB 5IP4A 3MOQA 1KN4L 4AIZB 4PTTB 1SEBB 4LSSH 2ZCKL 1QHPA 1WZMA 3TP4A 3ESUF 3RZCD 5F6HI 2AK4B 3QDGE 1JUFA 3TVMC 4P5TC 4PJIF 4MA8L 5M95B 5IV2B 2WIIA 1OGAA 4R2GD 2NXZB 3CDCA 4OGZA 4EOWH 4PJXB 1XCTB 3MZGB 1LK3L 2J6EA 4MD4A 1NEUA 4NQDA 1J5OL 1HXYB 1G9MH 3CVHH 1X5KA 4K94L 3QDGD 1AXIB 1IGJA 4LVOB 2FX7L 2J1KA 2R29H 3BH8B 2QQKL 1S9VB 4PJHB 2IBZY 3SCMA 4G7VL 5EOQL 3ETBF 1EEZB 2WUCL 3I9GH 2CIKA 4G8GB 4IJ3B 3S37X 1D5IL 4MNQB 3FB6B 1F6AB 1KENL 5ISZE 2FNBA 4YH6A 5B4MC 1DDHA 4WDIA 1CGTA 4G8EB 1VB9A 2DI8A 3RDTD 3SE8L 3MBXH 4WTXA 1JGUL 5IUSA 1JJUA 1R3HA 3RGHA 5E56A 2NX5A 1G1YA 5FGBC 4L8BA 1BBDH 4TNWK 3TT3L 3PE9A 3WFHA 5LGKA 1AI1L 3R1GH 4R96A 2WBKA 4M7LL 1CFNA 3CLFL 3SO3C 4JZNB 2P8LB 4DAGH 4RFEA 5FB8A 5KJRH 3DROA 3AM8C 4UDUA 1ZLWH 3MGOB 3HZMA 5EH1A 1OQXA 1ZGLP 4QF1A 4U0RB 5E6ZA 4ACPA 4P0DA 2ZUSA 1EBAA 3MRPA 5A43C 3G6AB 2D4FA 2Z8RA 4NO2B 3UEZA 3SDAC 1WBXA 2QBWA 1GZPB 1P1ZA 4FABL 1OAKL 1JHTB 1E4KC 3QAZC 1G7LB 3OXSB 5A3ID 4GUPB 4OAWB 2DIBA 2PF6A 1JHKL 2FH6A 1FYTE 2XXMB 4R4NC 3RVVD 4XNQB 3U6RB 3DSNA 4XPHH 4PJ8A 1MCLA 3OAZK 4NCC2 2VAAB 4MDJB 4MD5A 1N8ZB 5DMGC 1D6VH 1FVEB 2XPGA 4KZDL 1BWWA 1MJ7H 3EYVA 1ONQB 2BVYA 1EFXA 1FYTD 1CF8H 4OZFB 4N8VA 4UILH 4X9BA 4HPYL 1GAFL 4MJ5B 1NCDL 3T3MF 1X5IA 3LDBC 3QUYB 1YY9C 1I9IH 4QRQB 4OD3L 2BVQB 2R1XA 2Y72A 4G43B 4PLOB 1A47A 1UQSB 4D0DA 1ZHBB 2YPLB 3GJFA 5IIEA 2OP4H 3RY6A 3V2AR 2JIXD 3S35H 4NQCA 4LKCB 1HI6B 1L0QA 4P2OD 4IEFB 5GRVK 4S1DC 4DN3L 1H0DA 4WUUB 3UAJD 4GXUM 2G2RB 1LNUB 2Z91A 4RQQA 2ERJC 2K9UA 2J12B 2ADFL 12E8L 1JV5A 2W92A 4KDTA 4LVNB 1KYOJ 5C0IA 4C54A 3SEPA 4HV8A 1X5GA 3V4VH 3MJ8B 5EU5A 1SEQH 1NFDA 5ILTL 2YS4A 2IANA 3KYKL 4FQCL 4ONGL 3UJTH 3MACH 2ZKHH 4BH8A 2FR4B 3VW3L 4QXGL 5GJSL 3BEWB 3F6IA 4A6YA 1UZ8A 4KROB 5E08H 2QKIA 1EEYB 3KPRA 4MS8C 4OQTL 1U36A 5MEQB 5F71A 1AXSA 1F6LL 4TNVK 5HHQB 1GH7A 3L3OB 3VFTB 5CJBA 5DWUL 5B38G 1OHQA 1RUQL 1I85A 3QO1A 4PV8A 1VFOA 5HYIA 4O4YL 1MLCB 3LRHA 1FVDA 3G9VA 1QSFE 1SJHB 3HMXH 2YK1H 3KYOA 4RGNC 5FKAA 2W60A 3L3JA 1NBZA 1NGXA 2DLFL 3G5ZA 3NFPA 3IYLW 3MROA 5C8JA 3MUY1 3OXRB 3WD5L 1I8LC 4L9LA 3IFNH 4J2XA 3AS2A 4QRTA 3QUXC 2FECI 2NYYD 3KYMB 4OCSH 4R4BB 3VFSB 2VL5B 5HI4C 1IM3A 1BIIB 5EIIA 1YEEH 1DQDH 2RFXB 3BE1L 5ITFA 5GS3A 1BP3B 2EDEA 1YEDA 3DECA 3HE6A 1JVKA 5I76B 1KBGL 3FZUC 4X7SH 4TUKH 1UB5A 2PO6B 3H7BB 4OD1L 5GXBB 4HH9A 4G6AD 1CXIA 3LS5H 3ULUD 1FFNB 4K3DH 1UYWH 4XPGH 4OGXL 1G9MC 5D6DA 1G6RL 2HMIC 1LDPH 2YKLL 4LU5L 1NMCC 4HIEA 3S7GA 4GSDH 5KW9L 2Z92B 4HT1L 1EH9A 3GKWL 3FT4B 2E6PA 1TZGL 4J1UB 4F80A 5F7MC 1CR9L 5EC1A 3BP4B 2YMXH 1KCLA 4ETQB 5DHVB 5I1EH 4FXGB 5EUOE 5DJCB 1CVSC 1C5BH 2PXYA 3EO9H 4PJAA 2P42B 2DWDB 2PYFA 1CL7L 2R4RH 4YLQT 3BT2L 3CUPA 5IHZA 3D0VB 3GO1L 2BK8A 3T0EE 2GITA 4Y5VB 4NN5C 1JPGA 4ZQKB 4KJWC 3JTSB 4YDLB 3SGDH 3WFDH 2NTFB 3HAEA 4LLYA 4K3GA 5D1QD 1CS6A 3MV8A 3NZHH 2BOBB 2ZOLB 1OAYH 3IFPB 3M8OH 5GSRB 5E8EB 4UNVA 2CO6B 3VFOA 1F42A 3V0WL 1I3RB 2C7UB 3QR2A 4ODHL 3NACH 3FT3B 1WV7T 2H8PA 4BFGA 4L8DA 4WFGE 4MAYA 4Y16A 4CAGA 2VRAA 1P2CB 4OIIL 4YHNA 2NY0D 1C08A 1H5BB 1QBLH 3PXJA 3FFCA 3HE7C 3T4YB 4MGXA 5D70H 3U36B 4ELMB 3X3GH 5KVDL 3OKMB 1WCBB 3MBEC 5BVJA 3ULVD 1XGPA 4RX4D 3C6SA 4BH7A 1UVQA 5T1KA 1AKJA 4UQ2B 4WFGD 1X3DA 2ADGB 3RVTD 3ZDYE 1UM5H 1B0WA 2HTKC 3C09C 1MIEL 3G5YB 4KMTH 3STLB 2B4CH 4XBPA 4LSDA 2O5XH 1NEZA 1WBZA 3MSPA 5D96C 3RZCA 5FDYA 2HFEA 4WWKD 4OCXL 4X98B 5C9KA 4KK5D 4AIZA 3BN9C 4J6RL 4KDVA 1SEBA 4Z7WB 2XKUA 3TN0D 5EIVA 3BPLC 2AK4A 1Q94B 1YQVH 2GSIB 2WSKA 3VGEA 1YEIL 4Z0XA 4UTBH 2J8OA 5EU6B 1DZBA 3HC3L 1AY1H 5DD3L 4PJXA 1XCTA 3V5HB 5D1ZB 3WFEL 5CSZB 3C9NB 4U7SA 1KJ3H 3ZDXF 2HYMA 1FFQA 2VDLL 2CKBL 3KJ4B 5HHME 3UDWC 3QA3B 3LKNB 3MLZL 3H9ZA 3BH8A 1EV2E 1S9VA 3O2WL 4PJHA 1N3NB 3ZT7A 4XMPL 3BP5B 3NTCL 5FYJE 5J11B 3CH1B 3QDJB 4GBXD 3SO5A 1VSCA 1FLRL 1OARL 1G6RA 2QHRH 1EEZA 3KDMB 4NQXA 4K3JH 1J12A 3DPBA 4OBRA 4G8GA 4ZUWB 1W0VB 5J1TC 4XXDB 2GQHA 3WIFA 3FB6A 5EORL 4LCUB 2VLKE 1F3JB 4G8EA 1QFPA 5KTEH 5FYJD 1F58H 4PY8J 3W9EB 2EEAA 1KCVL 1FGVH 5JHDA 1YN7B 3QG7L 1PG7W 3GI8H 4NKOB 2AS5M 2D7TL 1ZK9A 1S7WA 1NGPL 4JZNA 2P8LA 3Q48A 2Z8WC 4R97B 4UQ3A 2A0LC 4JQIH 4FFWC 3MGOA 4Z0BL 3KS0J 1EZVY 3SDCD 1QTYT 1K4DA 2MCPL 2ZUQB 5EBLB 5K9QG 2UVFA 4KKBD 4EBQH 3O8XD 3TIDB 3G6AA 1KB5H 4NO2A 5IMOA 2IAMD 4Y2DA 2AJSL 5DI8A 3FONB 2MTPA 2A83B 5HVHC 2HFGH 3H7LA 1G7LA 3OXSA 5A2LH 4Y1AD 4OAWA 3S9DB 3FAWA 1HSBB 4RAVA 4FQXB 4XNZB 1OTSC 1U6AH 3BKML 4D0CB 3B9KC 4PTUB 4XNQA 3VXSB 3TYFB 4NOBA 1KXVC 3TO4B 4L8CB 4O2EA 2VAAA 5CZVL 4MDJA 3U4EB 1N8ZA 2VLLB 1EO8H 3LHPH 3UJJH 1FGNH 1ONQA 4GG6B 5CZKA 3ULUL 1VFMA 5KSVB 3RU8L 4OZFA 1RK0A 4XAWH 4YXKH 1FG2B 4MJ5A 5FGSA 3QUYA 3VWJC 5JXED 2X9XA 3IXAB 1CD1A 2GCYB 4PJBB 4DKAA 1UQSA 1YNLH 4NNXB 1EGJL 4LHQB 1P7KB 2UY7A 5IESH 3D3VD 2HP4A 3FO0H 4QXTB 2WP3T 5AG8A 1MJ8H 1JK8B 3F7QA 3H42L 3ZL4H 2VR4A 4PB9H 4FG6C 5AAWA 2CKBA 3RWHB 3KGRA 1XIWB 3H8NA 4G6MH 4M43H 4OZHA 2YWZA 2DQEL 3BYTA 1RMFL 5LQBL 3GSWB 4CDHA 3VDAA 3MJ8A 4IRSC 3RTQD 4QT5A 3ARBB 3DXAE 2R4SH 5DJ2B 1TQCB 1ZHKA 4N8CL 2KDGA 4OSUL 3WXWH 2JCCB 2X41A 1MELA 3PP3H 4NJAL 4IRJA 4YIQB 3WFZA 5KSBA 1QFWM 2NXZC 1EEYA 1N7MH 1YPZF 3IJHB 2XWTB 3DRTB 5E8OB 5HHQA 4FZEL 3DXAD 3U48A 3L3OA 3HR6A 3LD8B 5E6ID 5JDSA 3Q5TA 3ULVL 1ZKAA 3CPLB 4M6ML 3D2UB 2D7QA 3B9DA 5LBSH 3BP6B 1WIUA 1I7UA 5I71B 3WS6A 4EI5D 1SJHA 5AG9A 3UTPD 4HLZG 9CGTA 1AR1C 4HS8L 1W0YT 5FCUH 1PZUB 3HCVA 4LDEB 2M26A 3OXRA 3WUWG 5I16B 1HCFX 1RUAL 2VXSH 4QO1A 3TC9A 1LO2H 1L6XA 4U7KA 3TGXA 3KYMA 2IALA 2Y6SC 4R4BA 2BERA 2NY6B 3GKZA 3DNKA 1H3TA 2RFXA 5E0QA 3RHWK 4Z7VA 5J56B 3AS3A 3OL2A 2C26A 5CFHA 3BKJL 4HIHB 4N0FA 4DJMA 5T3ZE 4HS3B 2PO6A 3H7BA 4BZYA 3CK0H 3ROOB 1BGXL 3O6ML 4PJ9B 2E7BA 1FFNA 1OM3H 1BMGA 1RZ7L 5CJXA 3U0TB 3UBXG 4F7EB 4DKDC 5L7XL 5T3ZD 2Z92A 1FV1B 3LB6D 3WN5C 4JRYE 4PRPE 4J1UA 5FYJL 3L5WA 3K2UH 3VWKD 1CTNA 4OLUL 3BP4A 4OCRL 4ETQA 4Y5YB 2YUXA 3W2DH 3QDAA 3C2AL 1NUFA 1UC6A 5DJCA 1OTTD 2YA1A 1EUTA 4ODWA 4PGDA 3CIQA 4XP1H 3ZDZF 4JRYD 4PRPD 5H37H 1HH9B 1RURL 1RIUL 1LE9B 4Q58C 3Q6GL 3T3PF 2VXVH 4QEGA 4PP1C 1I1CA 3D0VA 4G80B 4FQPA 4EUPG 4Y5VA 3NCBB 4XP9H 1FP5A 3FO1B 3DYPA 3DUHA 4P48A 2IG2H 2YZ1A 4GMTL 2NTFA 3N06B 2G60L 3ZKSD 2C9AA 5IW1B 2BOBA 2ZOLA 3QFJE 1EHNA 1U95A 4TOYH 3CZFB 5DT1L 2R69H 5GSRA 5E8EA 3RL1B 3O81A 1MRCL 4OB5H 4OF7A 1NGWB 4Q0XL 2EC9U 5DURD 3FT3A 3I6GB 8FABA 4HW6A 4NP4H 4Y4HD 1F90H 4KVCH 5CKAA 5HYJB 4KXZH 1P2CA 4K71B 1H5BA 2OK0H 4NZTH 1F2QA 3QFJD 2LTQB 4LMQE 1D3CA 4YPGB 3U36A 4ELMA 4JKKA 4JEGB 5IBLC 1WCBA 1QSVA 2AVGA 4WFFE 3L3HB 2F74A 2FSEB 5FK9B 3IU3A 4UQ2A 4OD2B 4UOJA 2AXJA 3G5YA 3TBSB 3BDXA 5KVFL 4IOFC 3P2TA 4X98A 4KROC 4N0UE 1DLFH 1FC1A 4Z7WA 1AGFA 1BPVA 5HGBA 4LOUD 3MLVL 4WFFD 1A7OL 2GSIA 1L7IH 1Q94A 4HFUH 5J3HD 3MA7B 3UPCA 3BMWA 4U6HA 5DO2D 2MKWA 1AC6A 4OGYH 1UACL 1NDMA 3D5OF 2DIJA 3MLYH 2AJZB 1JTOA 3V5HA 1D9KB 1DN2A 5D1ZA 5CSZA 1T89A 4XX1G 4Q6YA 3CU7A 5FA3B 4OM0H 1ZT4B 3T2OA 3GMOB 3LKNA 3WFCL 2YEZB 2FECL 3RVUC 2X4PB 1BFTA 4WV1B 2XZAH 5KZCD 2A9MH 4YGAB 3R0NA 3CH1A 4L9DA 2ICWI 4MYWB 1I8IB 5GPRA 3KDMA 3HNTH 3QXAB 4KTEH 4ZUWA 1W0VA 4XXDA 1ES0A 1H3PH 4PRDB 2QSQA 3MRLB 3OAUH 5KSUB 3TPUB 1NGYA 4JHAH 2IFFH 4KKNA 3VJ6B 1BQUA 1FSKC 2CMRH 4KPHL 3VDCA 1N6QL 4RISL 4I18C 4DN4L 3SDDD 1CGWA 4KVNL 4X6CE 4MNGB 3O4LE 5CJQL 2R2BB 4UV4L 2H9GB 3W9EA 1NL0L 3P73A 2BNRE 5JTWA 1ZGLB 2NY4B 3BYYA 4J3SA 1JNHB 4NKOA 3VG0L 1R0AH 3SJVB 3SDCA 2V7NB 5FUZH 2FZ3B 2NCMA 5I1LB 1EK3A 1OSZB 3O4LD 4PFEA 1P53A 1CICB 4RNRB 4IIQC 5EBLA 2IEPA 1CDJA 3KYNB 5F9DC 2XTLA 4OLEA 3FB7B 4KAQH 1HHGB 1VENA 5GSVA 3B8SA 3FONA 3BIBX 2A83A 2N1KA 5IMLB 5FV2A 4G8FB 1HSBA 3FRPA