1P4BL

Three-dimensional structure of a single chain fv fragment complexed with the peptide gcn4(7p-14p).
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
b'ADAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Variable light chain
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4bL00
3ARFC 2P8MB 1DUYA 1A4KA 1MJJB 4CVXB 4NKOA 4BQCA 3S36X 2R1WA 5C0RL 4KY1H 3K4AA 3HCVB 1BWWA 1LILA 3PNWB 1IC5H 2HT2D 4OLUL 4JFXA 1YY8B 1OGAE 3BPLB 4GOSA 4IRSC 1N6QH 3BRGC 1I1YA 4Y16A 1MQ8A 1N2RA 3IFLH 3C09C 2X4OB 4GG6A 3MLRL 3U0PB 1SBSH 4A6YH 1M6OB 4FZEL 3V5HA 1QBAA 5EC1A 4EDWL 3DVGA 2D4FA 2G75B 3R0MA 4K7FB 4N5ED 4P2OD 1F6AB 3T8XA 3RWFA 4NRXA 4B0MM 2FSEA 4E0RB 3WHXB 4Q9BA 1CGWA 1BM3L 2IBBA 5I8KH 1C16B 1MF2H 3NPSC 3I9GH 5EU6E 5E8EA 1IGJB 3TT1L 1AC6A 1NFDF 3MRPB 3VXPA 4L8BA 1YECH 2YPLD 1CF8H 4UT7H 1FYTA 2P24A 1DL7L 1IGMH 5HHQA 4X5WB 5DYOB 3MODL 3BIKA 3CJJA 3OKKA 3WIHH 4HX1B 4P2RE 2YD5A 3TYFA 3NFNB 7FABH 1QD0A 4DN4H 1ITBB 1SBBA 4GW4A 3PDDA 5IVZA 3JV5A 1M05A 4YAQB 3VCLB 4GXVL 3GNMH 4R6UA 5EBGA 3BQUD 3FOMB 2X70B 1YMMD 1T1ZB 3SCMD 2IQAA 3QFJE 3RBGA 4KVNL 3MV8A 1AXTL 5MI0B 2NZ9C 3CDGB 2HJKB 3T4AB 2R2BA 2XY1A 3BEWB 3RVWC 2CLZA 1IE5A 4NM4H 1T5XB 1QPXA 3RA7L 4KRLB 1RZJC 4PJAA 1G7JA 3I6LE 4U6HA 1OAYH 4WU7B 1CDCA 2P5WA 1M1SA 5EH1A 3I6LD 2BNRB 5HHMD 3CDFA 1BECA 1WCBA 3PWPE 4ZD3H 3LOWA 1NFKA 4R3SA 2F53E 2FX7H 1TDQA 3QR2A 4PRNA 2NY3C 3IDJA 1XF2A 4GRLB 4Z7WA 3PL6A 4P23A 3HPLB 1RSFA 1JZ3A 4ZPVB 5DMGD 1JGVH 5IFAH 4HC1H 3VMNA 5DXWA 2BK8A 3QUXB 4LKCA 4K3EL 1EUUA 5EOQH 4Y16D 5FGCB 2GTWA 3QO1A 4DVBB 3L5WB 3ULSB 3QDAA 1YPZE 4LNVA 2PW2A 4X7TB 2HG5B 3MLYH 4OGYH 2VB5A 3DGGA 3QNYA 3LRSB 3UPRA 1RAMA 1P69B 2CIKB 5IESL 1DTUA 2OQJA 4MAYA 4KK6C 3K8MA 5EBMB 3MZGB 1ED3A 1I7UA 1A7OL 4R26L 4HUWA 3QI9D 3QUZB 1MCLA 3UAJD 3FCTA 4NQCA 3G04A 4G8GD 4RISL 2F58L 4LCWE 1T21B 4XPTL 2VDPL 3UJIH 2MCG1 1KTDB 5KBNC 3L3JA 3L5IA 3S9DB 1TPXC 4PB9H 1D5IL 3BIBX 4LLQB 1MY7A 3H42H 4PJ9C 2AXJA 5MERA 2RFXA 4BYHA 3IU3A 4NNXA 4NZRL 3FB7A 2QKIB 1QR1A 1CWVA 3HE7C 3P40A 1EAPB 2R0ZH 4ODUA 3N06B 4Y2OA 1E4KC 3DMMC 3SDAC 3JV4B 2ERJC 2OR8A 5FK9A 3E6HB 4FABH 4YLQT 4NSKB 3QDHA 5L2JB 3NZ8A 5J13B 5I75C 2R69H 3MLVH 5HDLA 1F58L 1SQ2N 3MLXH 2JCCF 2WWKT 3VI3E 3NCJH 1I3GL 3OJDA 1UJTA 1QSFA 2BDNL 3TV3L 2A74A 4TUJA 4JY6B 5C0CA 1G7PB 2DMKA 3CPLA 1CD1A 4ZUSB 5LGKA 1H3TA 2NZIA 1OW0C 4KDWA 5KANI 4Y5VA 4GMTL 4NJAL 2Q7YA 4KDTA 1T5WB 4WJ5B 4LSUH 3BX7C 3FONA 4LSQL 1LEGA 5JPMA 4NBZB 2R29L 3MLSL 4KGJA 2GK0A 2AXHA 5I74C 5D70L 4ETQB 1T0NA 4PUBH 3L3KB 4LVOC 4PG9B 3S5LA 3KR3L 4WO4D 4Y5YB 2ADGA 2YEZA 4GRWE 3MGTB 3T2NH 4YHOL 2O61B 4O00A 1YEGH 2NQCA 1ZSDA 4G6AD 4S0TD 4PJGB 1ZANL 1JZ5A 1T6VN 4GXUN 4RWYL 2DQHL 3WFEL 1AGDA 2PTUA 2VXUH 2ZPKL 4J3OC 4KVCL 5AUMA 5DGRA 1H3XA 25C8L 3HC3H 1AGEA 4EDXB 1G6RL 1H9VA 2B39A 2D0HA 4JB9H 3WFZA 2HRPH 2NR6C 2WP3T 4M8QB 3KLAA 4KRPB 1SYVB 1NBYA 1G7IB 4HKJB 4U1IA 2R56H 5MEQB 5E1AA 2L7UA 1YYLL 5D2NA 3VW3H 3QIBD 4HJJL 5GS2D 5DQDL 1OWRM 5LBSH 4CNIB 5T1MA 3T0EC 4XPHL 4LOUC 1V3MA 3MRLB 5FM8A 2Q8AH 4EEEA 3TZVB 3MBED 2BY0A 1TJIL 4ZYKB 4JFDB 2ADIA 5E9DD 3MNVB 5I1LA 3EYSH 1A2YB 2OMNA 2FZ3A 4W70A 3P4MA 3C5JA 4QTHA 2QHRL 3GHEH 4B41A 2IBZX 5GZND 3VD7A 5LGJB 4F9LA 3WSQL 4EI5A 3V7AG 5AYQA 2FEEL 4MJ6A 5IMOA 3O3DA 2O5XH 5I9QC 1TCRB 5E95B 5DLMH 1FQ9C 3HAEG 4L29B 4EQ2A 1GGBL 3F7YB 1QSFD 5IJKC 5HVGB 1C5DA 1F2XK 5C0CD 1O0VA 1WTLA 4TSCH 1CLCA 2EIEA 2X1XR 5TQ2H 1FZMA 2BSRB 2RGSA 3O45B 5E8PA 1NAKL 4M1DH 2VQUA 4HUUB 1PLGL 1RZJH 1BLNA 1H3VA 3VXUE 2GSIB 1AC0A 3WMSA 1B6UA 4Y5XC 5KVGL 3WKML 5ACZA 3LHPH 1OAXH 3S88L 4ZUUB 3NCFB 3KPSB 4LPXA 2LFGA 3MJ6A 1H5BC 4LEXL 4ZPTB 2I60H 1H3PL 1PZ5B 1PJ9A 3AROA 4RZCB 1WBYA 4JPWL 3HNTH 3MLWH 1K5NB 4XPBL 5EUOE 2EH8H 1Z9MA 1L0XA 5F1IA 1UB6B 4UIKL 2XNAB 4E42A 3VXOB 4UV4H 4IJ3C 1H8OA 5C8JA 12E8H 1C5BL 1Z6JT 1CZ8H 4N90D 4TNWF 3EO0B 1OSPL 3JWOC 3P11H 5L88H 1WCQA 1ZGLA 1IGCL 3MV9A 5DI8B 4OJFH 5E5UB 1NC4D 2Y72A 3QXAB 3GMPA 1FE8L 3PJSA 4NN6B 3SQBA 3MR9A 1RIHH 5E08H 4FQXB 3AB0C 4P3CH 1JHKL 4DGVL 4K8RD 4IS6A 4BUHA 2J8UA 4JDVA 1MOEA 3OKEB 3QWQB 1G7LA 2H8PA 1JJUA 2PNDA 3B43A 3LN5A 3EYQD 5IKCA 1HSAA 1E0OB 3O41B 4L4JA 5KVMC 4JN2A 4MLSA 1IC7L 2FO4B 3KS0H 5C08A 4U1KA 4FMFA 4HH9A 4TTDC 3KXFA 3BGMB 4P5TD 2CSPA 5EPMA 3V5KA 5EOCH 5I16A 4R96B 1JWUB 2QBWA 4PD4J 2F74A 1ES0A 1N59B 4ODBD 4MB5A 4KHTL 1NMCB 2W1NA 3H7BB 3ULVE 5CHNA 4JQVC 4EUPG 2BHYA 2FIKA 5DR5H 3ALWA 4UTBH 4G8IB 3L3DB 4KK5D 1F4WH 1QOKA 4A2LA 5EO9B 3D69A 3SQOL 4R4ND 3FT3A 5SX4I 4CW1A 3U36B 2X4UB 3WO4C 4QCIA 1BF2A 1KBGH 1NMBH 4XP5L 4JCMA 1WWWX 4FQHA 4Z95L 4WGWB 4K3DH 2A6DB 4YEFA 2W9DH 3FB6B 2DIJA 4QRPA 5F6HI 1I1AC 5DK0A 4I3SH 3E6FA 2WM0A 2BSED 4YK4C 5LVEA 4X7SL 3PDOA 1LE5B 1C7TA 2R23B 4B7IA 2GSGB 3O6FD 1IC5L 1H3GA 4U1SA 4MX7A 4FXGB 1CTOA 4YUEL 4PJFB 1Y18A 1N6QL 3FB5A 3HAEB 4FTVB 4DKFL 4HZLB 5DFVC 1P6FA 5EIIB 3HUJB 3ARDC 4A6YL 5A3IC 4UINL 3VI3F 4CBPA 5BO1L 5DUPL 2AABH 2R1XB 4Z6AT 4JDZB 3ARQA 4AEFA 4M6AA 2J5LB 2YWZA 4PJCB 1PSKL 3SE9L 4XCEA 4NQSB 4Z7VB 5B3JE 1MF2L 3C08H 4U7MA 3OF6D 2YD1A 4H8WC 3QPQC 4FXKA 4HUXA 1OM3L 2WBKA 1Q8MA 4XPGH 4MA1C 1ZT4B 2VE6B 2QSVA 4QWWD 3NFSH 2H41A 1MAJA 4NGHH 1IGML 1P9MC 4WUKH 1GL4B 4JG0L 3RL2B 2CKBH 4GRWF 5BV7B 1P7QB 3FKUS 1XZ0B 5C08D 4AYFA 3PV6B 5F88A 4AH2B 1RZFH 2DIBA 1HK6A 5TF1H 4JRYB 2VDLL 5DUBA 1L7IH 2HJLA 4X4ME 4ZAKA 5TDOB 3ZE2E 5IBTL 5FV1L 3RTQC 1JMXA 3NMEA 4M5ZH 5F6IC 5H37H 1MHHB 4ZOAA 1RJLB 3HZYA 5D93B 1ETZA 2YKLH 4ZUWB 2WV3A 4S11A 3ARFD 3VFMB 4ODHH 1LHZA 5J4MA 1IZJA 4IMLA 1KTKE 4K8RL 1HNGA 3T1FB 3GUTB 2ZUTA 1U93B 3D9AH 2IANE 1OAYL 3NN8A 4TYUA 3BZDA 4OM1H 3QFDA 3ZT5A 2HAZA 2AXFA 1FJ1B 2FO1A 4IRSD 4DAGH 1BVLA 3VWKB 3O2WL 4YC2C 1WWBX 5CJ8A 4TTGA 32C2A 4W6WB 4ACPA 5JW4R 1DBJH 3KYNA 4N8VA 3HG1E 1J1OL 2F54E 1Q38A 1ERNA 1LDPH 2AJVH 1DN0A 2EDJA 1JGVL 4HC1L 5DHVB 4PJXE 1F3JB 1QO3B 3MO1A 3W0WB 5D2LE 4Q0XH 3QEQB 4PRPD 5DJ0B 2BXYA 2FR4B 1WFNA 1DEEB 4N8CL 3ULUH 5C0IB 3VFVA 1EERB 4HIHB 4OGYL 1P4IH 4DZ8A 4R0LC 3LQAC 4UILL 1QA9A 5BS0A 2X4QB 4EKXA 3Q5OA 2NMSA 3VGHA 2VLKA 2LABA 5ACMA 3D48R 2YUVA 3CH8A 3MNZB 5K9KA 4I0CC 4PJ8A 5HPMB 1JPTH 1KJ2B 3RVTC 1KTLB 3VFWA 5GRJH 5GSRA 4EUPB 4BSVB 3RWCA 3U6RB 4LARL 2AK4A 5BMFH 5DDHA 4HFUH 2HTKC 4PJ9A 3WS3B 3PGDA 2VH5H 5C0DB 3BWAB 5D6CB 1ONQB 2NZ9D 3UJIL 3H3PL 1XFPA 2X1OA 2Y6SC 5GRZA 1I8MB 4H5SB 3RVWD 3QCUL 4Z18A 1FRGH 3ZZ1A 2D2OA 3MCG1 1X5FA 1EXUA 2MKWA 4WHTA 1GC1H 1E4KA 3GMLB 2BMKB 4PB9L 5A40E 4U1HA 4RMVA 5IHLB 1BQUA 1XGPB 3H42L 3BRFA 5F1NB 4Q9QH 1TCMA 4N0CC 1CLZL 2BOBB 1F6FB 2A9MH 3FFCA 4MJIB 2NY3D 3TT3H 1NBZB 4GBXC 2FNBA 4YIQB 5D1XA 2NY1B 1J10A 2VXQH 1D9KA 5KS9B 4P3WA 3O6KH 3QPXL 1FGVH 3HZKA 3RY4A 3M17A 1XCQA 5C9JB 1Q94B 3EYUH 5IV2A 2DJ4A 2EH7L 4GAGH 3VXRE 1I1CA 1TVBB 4ORGA 2OI9B 2R69L 3QDME 1RHHA 4OKVA 4GSDH 1FV1B 5DJAA 4F8TA 2BVQB 5B21A 2NXZB 3VD3A 3BO8A 3UC0L 3LEXB 5C1MB 5T5NF 4C56E 1WVZA 2GYSA 1JP5A 4JFQA 4KK6D 2PCPA 3IDMA 4MQXD 1F4XL 4WWKB 4XCNA 1R3JB 3M1BB 2EC9T 3TJHC 3TO4B 5DJ6B 4BZ2L 1KLUA 4CMMA 4PUBL 5BS0D 5E8OB 5T5FH 2VLKD 1YMHA 1MHEB 1U3HC 5ESVA 4OFDA 4XBEH 4OLXH 4M6ML 2ARJA 3C5ZC 1IKFH 4ODXB 4BH7A 1JGEB 3X14A 1MHCA 3KPRA 5FYJH 4X7DC 2VXUL 2Z0BA 1NDMA 2XQYG 1BZQK 3OAYK 4X4XB 2C3WA 3ULVF 2AK4D 4JB9L 5BRZD 3REWB 3EFFB 1FYHB 2B2XH 1BVKB 3INUL 3T0EA 4PJ9D 4CMHB 5DUML 4GS7C 3WS6C 4TPRH 3WNKA 4ONGL 4HKBB 4WW2B 2IPKA 2X89A 3HE7D 4K2UH 5IOPB 4LBEA 3BHBB 5JOPE 5IVXE 4YHZH 2PXYB 3DMMD 3SDAD 3MRMA 5LBSL 4GT7A 5J11C 4TN9A 4XC3H 1AJ7H 1QLFB 1IGYA 1FNSL 2Q8AL 4U1LB 3VFUB 3T77B 3WHE1 1Z9LA 5KOVC 1X5HA 4H8WH 1R5VA 4P2OB 3OKNA 3FFCD 3DNKA 2HKFL 3MC0A 4OZ4A 3HA0A 4LVHC 2EE6A 3D39E 3P9MB 4UNTA 1NGQH 4Q9RH 1TETH 3O3EB 3WN5B 3SHSA 1DVFA 4P4RB 1P4BH 3AU1A 5EU6B 4N9OB 2BRRH 2EYRA 2YPLB 3DJ9A 1FL3B 4LPTA 1MJ7L 4RGMC 2X4TB 5CZVH 2XQBH 1F3RB 5JMRA 2O5XL 1F11A 5E00B 1H8NA 3AAZB 1I8KB 1GAFL 2XTJC 3CLEH 3T04D 3WUZA 5C6WH 1LE9A 4Y5XA 4P2RB 3TEUA 2V9TA 2R4RH 5IHZB 4OV5A 3CDCA 2C1PB 3IJSB 1BPVA 4XXDA 3HC0B 3EFDH 4ZUTA 2ICWB 2JB5H 3BQUB 1YMMB 1S7SB 1H5BA 3MJ7A 1ZOXA 4M1DL 2DYPB 1I7RB 4P5KA 5FO7B 3TVMC 1IEBA 4F37F 3FHAA 1RZJL 3QFJB 1OAUH 1NCDH 5JR1H 3X13B 5FKAA 3RNKA 2YA1A 2NR6D 4PLOB 5GRUL 4OIIH 5TQ0H 4GUPB 4WFHD 3G6AB 1KC5L 5I71B 4XAWH 1W2KT 2OR9L 1EHXA 1FORH 1MI5E 3BDYH 1WUNT 5HHMB 1EEZB 4RNRB 2I60L 2B4CC 3CZFB 1RJZB 3RY5A 5JNYA 5T1LB 1S9WB 1ORQB 2DWEB 1CFQB 3K46A 1A6TB 2UUDK 3HNTL 4GAJH 3MLWL 1D5XA 1GRWA 3D0VA 1E4WH 3NAAL 5IMKA 3PP3H 4HZAA 2H6PB 4KROC 5DJ2B 4LOUD 4JGJA 1UWGH 1NGYB 2V7HA 3D6GA 1JGUH 1VEMA 3X3GL 12E8L 1V3LA 1JWSB 1CGUA 2X89D 3LCYA 4OZGF 5JW3H 1Z2KA 1ZT1B 3SGDH 5K59F 3AC0A 4KI5C 1OAQH 2B5IC 1KIPA 3BN9C 3KYMB 4BZ1L 5L88L 1U8OA 1VACA 4TULL 4XRCA 1CLOH 4QHKJ 4AK1A 2P8LA 3Q0HA 4G9FE 1YPZB 4QT5A 3FMGH 5TE7L 4ETYA 1W72B 2YSSA 1G7MA 5HGDB 5KSBE 1XF3A 1FIGL 3BKCH 2YK1H 4GQPH 1U8NB 1S3KH 3KLDA 2C1OB 5CILH 3VGAB 4JANA 2DL9A 2UWEA 3G5ZB 2HRLA 5DQ9B 5C0AA 3QUMA 4WVRA 5IFJB 4PJXF 4XH2B 3QI9B 5C7XH 5EO0A 1B0RA 2CO7B 4K71C 5HGHA 2Q8BL 4I3RL 5FDWB 4WU5B 3VXQA 4FQ1H 4GMSL 3F6LA 4M93C 4CU8A 1IGTB 4U1MA 4G8GB 2AV1A 5HDOA 3NABH 3PWJB 4UBDC 5FYKH 1CLYH 1TNNA 5T33H 5JW4M 1YEDB 4XNMB 1WIUA 4JE4B 3BVNA 4HS6B 4TVPL 4LCWB 2XWJB 4MSWA 2IAMC 5FO9B 1NQBA 5CJBA 2VLMD 3VRLE 3ULUE 2VLJD 3PQYA 3L3HB 1AD0A 2ZOKB 3MUGB 4P59H 4JFEE 1S9YA 1QSVA 2O5YL 5MENA 1JHLH 1A7NH 5F9JB 1FVEB 4LP4A 4AG4L 2J4WH 1ZVHA 3FFDB 4IOFC 3ZYJA 4NQEA 5HHOD 1D6VH 4X6CE 4M61A 5C07D 1QFOA 1QBBA 1NMBL 3DBXA 4Y19A 3AS3A 1IAIH 5HYJE 2A9NH 1TMCB 4JRXA 1JPSH 1F8TL 3QEUA 1VFBA 4F80A 1Y6NR 2RAMA 4I3SL 4AM0B 3ME0A 3S98A 1KUMA 3BEVA 5DGQA 1JGDA 4UI2A 3MFFB 2Q76A 4KJYA 4U2ZA 1RVFH 1H15A 5DURD 2FJFB 2GITA 3ZDXE 4PTTB 4MA3B 3VD9A 1N7ML 4JM2F 4NQVA 1FH5L 4KTDL 4LLUB 3VJ6B 1RJYB 2D9CA 1U42A 3O6LH 4RAHA 2EDEA 4CU7A 2DQGH 2VUYA 3MFGB 2P47B 4HWEL 4WO4B 3RX8A 3G6DH 2PYEE 5DJ8B 3N85H 3RWDA 1IQWH 3LAFA 4JJ5B 4NN7B 5C0JA 1AHWC 1HHHA 1V05A 4ODWA 1T20B 2AJSH 4L3CA 4UOW0 4NNYB 2JKXA 1KPUA 4TTDD 4I0PB 5DC4B 3C08L 5JA9A 2VTFA 5KJRH 1CFVL 1UZ6E 4ALAL 3CFEB 2WZPD 3QZWA 4JG1L 3MRKB 3GMNA 4V1DE 5GGRB 2BSTB 4E5XB 1TTGA 3BMWA 1RK0A 1KPVB 2WBJA 4FQCH 1EFQA 4J6RL 4NGHL 3O2VL 2UV3A 4KK9C 2HVJA 4WUKL 2CKBL 3DUUB 1VKXB 4OFIA 3QIBB 1MFCL 2LE9A 2C4FU 1VFAA 4N0UA 4N0YL 3WL9A 2NXYB 3G5VA 4PRBA 1C1EH 1BJ1H 2DL2A 5IB5B 4MA8H 3W2DH 2ICWI 3MBEB 4WI5A 2XFXB 1BIHA 2XQYK 3EDEA 4Y1AD 4JPVH 4RMTA 4XMLL 5E9DB 1JPFA 3R4DA 1NCWH 4NQED 5JDJA 4PBVC 4L1HA 3NGBC 1I1AD 2G9HA 4RFEB 5IROC 4X0KA 1NGWB 1EFXA 3KHQA 3K2MC 1SJHA 1KJ3L 5FYJD 1JF1A 4X98A 5IVXF 4Y19D 3D9AL 5IMMA 5FF6B 4LLVA 4TNVK 3KPLA 1MCSA 1Q9OB 3P73A 4O4YH 2DQJH 5FOBA 3QQ4A 5EDXA 2X4PB 4IOIA 4Z7UA 4DAGL 3U82B 5HYQB 5JUEH 5F7MC 3SGKC 5DFVD 2EDBA 4S0SD 4ZTPH 1DBJL 1D3CA 3ARDD 4ONOA 4X6FB 5A3ID 1DP0A 3EYOA 1LDPL 4MDJB 1N8ZA 4MJ2A 5IBUG 5J12B 3DUSA 5C92A 4R8WH 5IWLA 1KGCE 1XGTB 5E4IA 5FYJU 4A6YB 2ICEA 4OFYA 1ZHKB 1INQA 3JUYA 1CL7I 4JFFD 2XI9A 5F7FA 3VWJC 4YZFE 5I30H 3QPQD 3TBTA 4LHJB 1MCWM 4I77L 4QHMB 2A83A 3DX7B 5TE4H 4YDJA 4GKSA 3NZHL 2BFVL 2GUOB 4UU9A 4CVZB 5KSVB 4EXKA 4MQ7A 1EVUA 2YRPA 4JQXC 4ZNEA 4QRQA 1G9MC 4EBQH 4LKXA 1T4KB 3DRTB 5GRJL 4M62H 4R97B 5EUOB 3RWJA 4K9EC 3M8OH 3NIDF 2IEPA 4MD0B 3JWOL 3WD5H 1DLHA 1XEDA 3RTQD 5FGBC 3I84A 5E2UL 4AQ1B 2NY0C 4NWUL 4I5BA 2NX5E 4HFUL 3JTTA 5I17B 3ROOA 5CJXC 1RPQA 3H2WA 2CR6A 1HWGB 4PJCF 1OP9A 4JPIB 4OGXL 3AUVA 1OAZH 3L9RB 3GSNH 1NC4B 3QDJE 1OP5K 4FRWA 3H0TB 2D7PA 4BK5A 1HYSD 1S7WB 3T2OA 1JNHB 5CIPA 1N3NB 4M02A 4Q9QL 3WUWA 3B5TA 1WIPA 4JVUA 4C54A 3NTCH 3TT3L 2BNUB 3QUML 5A2KH 3C6LC 3BGFB 5D1QA 1UENA 1EEYB 1FGVL 1IKNA 3P9LB 1A64A 2QADB 4LU5H 2AS5M 2DTMH 1OSZB 1PAMA 3ABZA 5KSBF 2I9LA 3UO1H 4OBRA 4I9WE 5EC2A 4Q6IB 1JZ7A 3QCTH 1RU9H 2ZJSH 4LDOB 4QY8B 5DZNA 3DO7A 4P5TB 1MUJA 3VD5A 1I4FA 5GIRA 5H94B 1MRCL 2KQNA 3DX8A 1U3HA 5E0QA 4GG6E 3V6FB 1NDGA 1I7ZA 4K55A 5F9AC 1QSZA 2YA0A 5IHUH 3MA9H 1GYAA 1A0QH 2J2ZA 3RVTD 3TH3T 1FNEA 4WV1B 3RPIB 1JRHL 1DQLL 6FABL 3GMRA 5SX5H 1R5WB 2DS4A 2X9WA 4PREB 4XNQB 3OWEA 5T5FL 3E3QE 3ISWA 3KYOB 3GSRA 2HLAA 4YGAB 4XBEL 4OLXL 3KPNA 2HTKD 4ZXBB 3VRLF 1FFOB 2H9GB 1VADA 3WS6A 4LPVA 5FYJL 3QJFB 4EXPX 4XGZB 1FYTE 1OTUC 4LLAA 3DVNA 4GJTB 3PXHA 5FYKD 2HJFB 1NCNA 1GCFA 2YPKA 3OX8A 2DI8A 3MA7B 3STZA 4HWBH 1QSEA 2FBJH 2OZ4H 4X99A 4X6DA 2Y36L 4LP5A 1RZ8A 5EN2A 4KJPC 4TPRL 3O6FB 3W81A 5TPWH 2AEWA 4N0CD 4GBXD 4YHZL 4NP4H 3L3GB 4L4TD 2DQFA 4XC3L 5IVOA 4QF1B 3MV8E 1CFTB 1NUGA 1OGTA 2VIRA 5ESQA 5INDA 4AIOA 1MHPL 1QFWL 3U0TA 2A6KA 1QNZH 3NA4A 5FYKU 4DFIA 5CEYA 4PJDB 4H8WL 3A6CL 5CJ5A 5IBUB 5JW5A 1KB5A 2P5WE 3BUYB 3ZDXF 4DQOH 3BPOB 5GGQL 3CXHJ 4LLYA 4F7CB 3C6SB 1NGQL 1F00I 4RGNE 3S4SG 1XCTB 4QYOA 3V52H 5E24E 1T7VA 2ZUQC 5EORL 1OD7A 3V6ZB 1P4BL 5KSAC 3T0BA 1CR9H 2J1KA 1HSBA 2XOTA 3MLUH 4Q2ZA 5CZVL 4Z7WE 3I02A 1EBPA 5HYSA 2Y7QB 1S7TA 4XBPB 5DD5L 3TJHD 3TVMA 1VPOL 3QA3B 1UEYA 3GB7B 4U4BA 4MD4A 4ONHA 3MREA 3RU8H 3IFNL 2R2HB 1U41A 4FNLL 2IH3B 2XWBB 3G6JB 3MMEB 4JZOA 5KS9F 5DRZA 3ZLQC 1T1XA 1X5ZA 1MCHA 2Y06H 3HC4H 3C5ZD 4HIEB 2VL4A 2JB5L 1LO4H 1RZGB 2VZTA 4B7LA 3UBXG 4MAUH 4NO5A 4TQEH 5JO5B 1P1ZA 2FJGA 4OCWH 2HKHL 3ARFB 3SKOB 5JR1L 1KLGA 4G9DA 3ECBB 1U8KB 4PJIF 2LAAA 3G5XB 1QLEL 1F97A 3HN3A 4L9LB 4UDUA 4DW2L 1FDLH 3G08A 3ETBF 3CFJA 3BZFA 4PJEB 4QRTA 1EO8H 4TSAL 5D4QA 5TQ0L 4KZDL 1I3RB 2UYLA 3IDXL 1IL1A 1FFPA 2IANB 4NCC2 1WT5C 3QCVH 3OZ9L 4HT1L 4NQCE 1U36A 1F90H 5E56A 1DFBL 4XP6H 4IRSB 4UV7L 3QRGH 4F15C 5IEKA 3NFPA 4JFPB 3C09B 2VQ1B 3BPCB 3DETC 1UWXH 2A6IA 4G8FA 2NW2A 1IBGL 1QSED 4GKOA 1EK3A 1E6JH 4XX1G 3HG1B 5I1AB 1LO0H 4U1JB 2F54B 5D7KE 1JGUL 4JHZA 3L7EB 4WI8A 1KIRA 5JW3L 1IGFL 2YRLA 3MRIB 1OAQL 4WENB 4PRPB 2CRMA 3ARGC 3LQAL 3DRQA 1QFPA 1D5ZA 1BOGA 5D2LB 4WTZG 2EXYC 5T1KA 3TWCH 3NPSB 4Z77A 5FECA 1JZ6A 5HSFA 1CLOL 4DKDC 5BCAA 5D9SA 1KN4L 4WRLA 1BJ8A 1Q0YH 1RZIA 1U9KA 3SE8L 3IU4L 2ATKB 5ID0A 3BKCL 3AXLB 3T0VA 5KZCD 1T3FA 1J5OL 5E99L 4Y4FC 1Z9OA 3T0XA 1AY1H 4C83A 5C7XL 1TQCC 3UTZB 2IAMA 2EICA 4XPAH 1EH9A 1X7QB 5JORB 1LNUB 3CC5B 3LQZA 1QACA 2BSSB 4XVTH 3DV4B 5D5MA 2N7AA 5IB2B 3UZVB 2APXA 5HDBF 3TVMD 5FYKL 1CLYL 5T33L 4BA8A 1FAIL 3D87B 5ILTL 4UTAL 4QRSA 1BQSA 1AGBB 5LCVL 5D96C 1KFAL 1A7BA 4Z7NE 1IM3A 1KXVC 1YNTB 1HHIA 3WNPA 5AG8A 3L1OH 4K7PL 4M43L 4LIQL 1QZ1A 1A22B 3IKKA 4NFDA 1JHLL 3K1KC 5K9JH 3WEXA 3BPLC 3ARRA 4DN3L 5C71A 1MREH 3FZUC 5E1HB 2NY3B 2EDNA 1WLHA 1RUPL 4KROD 2UVFA 2DD8H 1D6VL 3D3VD 5C0BA 1S9KC 3OJ2C 3H9SD 4Z7QF 1LDSA 2AK1H 4G80A 5CWSB 1MSPA 5GGSA 3VRIB 4KI5D 2B7DT 4PJ7F 2VDRL 3BN9D 2X7LB 4M7LL 4WDIB 3KPQA 2FWOB 2F19L 3ILQC 5ETUA 2FGZA 1DE4B 2V6HA 5AD0B 2W0FA 5CGTA 1WZ1H 5KSUA 2DWDA 3D25A 1XGUA 3ARPA 1M7DB 3L6FA 5D2NE 3S4SB 4F33B 4HKZA 4IDLA 4LFHG 5CZKA 3EKCA 2OJEA 1AHWA 3O6LL 3K81A 2E8YA 3QWRA 2DQGL 2XIDA 1UWEH 5L2KA 5DFWH 1UJ3C 2BCKB 5E8NB 2XZQL 5ALCH 3G6DL 4PY8J 1U92A 3BUTA 3N85L 3QISA 4OM0L 4UBDD 1JNLL 4R7NA 1HOCA 2A38A 3LKSA 3WIFB 3GSXB 2IALB 3UBXB 3QJHB 5KTEH 4GG6F 4PS4H 3IDIB 3D18B 5E6YA 3GJEB 4ISVB 3BWUC 5BRZB 1GGCL 2D31A 5A2IH 2HVKA 4MNQA 4V2BA 3FQXB 4PG2C 4OZIB 1UM5L 5DJDA 2ZCLH 3ZL4H 1MAMH 2ITDA 4NKQB 1J05A 5JDSA 1Q9WA 3QXUA 1YQVH 3HE7B 3L3OA 3N1MC 3QIUD 1FPTH 4IOFD 3DMMB 2BVPB 3SDAB 3SDXE 3GIZH 1JUFB 1Q1JH 2ERJB 2A73B 4HW6A 1CDBA 5IROA 1V7ML 3CH1A 1NJ9B 3ARWA 4J8RB 3BH8B 5FA3A 3U4BH 1T03H 4QEGA 3P4OA 4GRLC 1HH9A 5CP7B 4KZEL 4NOFA 3KPMB 5I75B 2BHUA 1U6AL 4PB0H 1KCUH 5DHYA 4YHKH 3GMQA 5F7KC 3VH8A 4P9HL 3L3IA 4O51B 4OCLC 4ZUVB 3EGSA 3SO3C 2BVOB 1KB5L 5HGGS 2CH8A 3C8HA 3SPVB 2DQJL 1P7KA 5A2LH 1ZT7A 5F7HA 4IHOA 1ZGLP 4M7KH 5FHAL 3BP4B 5JUEL 1TJHH 3UTTA 5ANMA 1QRKA 5EU5A 4LVOB 4PJAF 4AT6B 4KWUA 2OSLA 3QUZC 1GPOH 3VWJA 3B9AA 3MCLL 1I3UA 3TBYB 2ENYA 1KJMA 3DROA 3MV9E 5MHSD 3BP5A 3QG6B 1WAAE 1AXSA 3OKDB 4UQ3B 5DD1H 3QWRD 4D0CB 4KHXL 2IADB 4JQXA 4CJ1A 4Z7WF 5L2KD 1D5MB 2B4CL 1CE1H 2JIXB 4NYLB 4F2MA 4X83A 1UFUA 3NBNA 3FN3A 5SV4A 5FGBA 1DQDH 4KK9D 1EZVY 5LGHH 1K8IA 1J0HA 5CJXA 4NM8H 5F3BA 2AJYH 3MOBH 3IAPA 4MNQD 5DVOA 1YDPB 2CKBB 1T2QH 4PRHE 4IRJB 2ESVA 4LL9A 3M8OL 3GJFA 3WD5L 3F7VB 8FABA 4BKLA 1T1WB 3KXFE 3TCLB 4N0FA 4D9LH 4G7VL 1XR8A 4HAFA 3MXWH 4LSTL 4QHUA 3MNWA 5J13C 2UZIL 4L3EA 4OCXH 1K4CB 1FL5A 5EU7E 3ORJA 3R1GH 3F5WA 3GSNL 5GJSH 2Z92B 1QEWA 4PTUA 5I1HH 1MFBH 2PKDA 2ZNXA 3C6LA 4H1LG 4M48H 5D7LA 2SEBA 2X4NB 4FFVC 4XHJC 3TIEB 3MRNA 2JJUA 2H26B 1NEZG 1U3JA 2E9IA 2GJZA 4BSWB 4LDLB 3X3FL 3W5MA 3GSUA 1FO0A 3FO9A 4GW1A 4MNGA 5DD6A 3HI1A 3RWEA 5CBEA 1WZMA 5I0ZA 4GW5B 4JEGB 4L8SC 5FIEA 4YHLH 5ITFB 3NTCL 4KFZC 3CFDB 2R4SL 2OX5A 3FQRB 5JOFA 4QRPE 5LKNA 2ENSA 3MRRB 2EDQA 4YDKL 5BZWA 4PJHE 5DK2B 4M7ZC 4LU5L 5D8JL 2I5YL 3U1SH 3Q5YA 1FHGA 5ADPH 1JGLH 3V0VA 5ISZE 4HG4K 4GRMB 2AXGA 3VWJD 2VDOL 2WUBH 4D8PA 4X5XA 4UAOB 3GBLA 2VLJB 2VN7A 3SKMA 4HPOH 1NFIB 4KRPC 3MROA 3SE4A 3QT2A 3MA9L 4OIBA 1NGZB 1A0QL 1IGIH 4JFEB 4MJ5B 3EDDA 5I1CH 5SWZA 3B6SA 4J7RA 1HHKA 4NPYB 5HHOB 4RMSA 1GHFL 4G43A 3STLA 1QRND 2DQUL 3LS5H 5C07B 3P30H 1Z3GH 1VFOA 2NY0D 4IJ3B 4X6CB 4S1DC 5F7LB 3BIAX 1KTRL 4X7FC 4XWOC 3TA3A 4HWZB 3HKFA 3IKCB 1YNKL 2Y5TB 3QEGH 3CX5K 2VAJA 1U8MA 5EU4A 3UBXI 5HYJB 1GOHA 3FHQA 1DANU 3GSVB 4OZFH 4H0IA 3T08A 1W0VA 1U95B 5IW6A 1ZS8A 5ICZA 4HWBL 1CBVH 2FBJL 2OZ4L 4ZMAT 4P99A 3AB0B 3C8KB 3OXSB 1G1CA 2BOCA 3N0PB 4JO2H 4YPGB 3PIQB 1WBXB 2BZDA 1A6ZB 5TPWL 1ULVA 3MCKA 1R5IA 1UZ8B 4NP4L 1EJ6A 5DJXA 4KKNA 2E8ZA 4Q97A 1C08A 3ZHDA 4PRID 3WLBA 1DJSA 5MEOA 5KG9A 3D85D 5KSAA 4YX2H 5KVDH 4MXWH 1ZVYA 1QNZL 3WE6A 4PRDA 3CK0H 3MBXH 4ODSL 2H3NB 3RDTB 5EG6C 5SWSD 4Y4HA 1I8IA 3SGEH 4OCRH 3ILPA 4YDIH 4PGJA 4YXLL 1UVQA 2FYYB 3RWIA 3I6KA 4NQUA 2V5TA 1GOGA 4V1DB 1SVCP 1TZHB 1F5WA 4LCCB 4KRNA 4U6TA 4OLZH 2WW8A 4PRAA 1CIDA 1E4JA 1JWMB 2DQEL 2ATPB 1D7FA 2X1WL 5GXBB 3RU8L 5JW4N 4L8CA 2P5EA 4I3GA 4AEEA 2A6JB 3HZVB 1UQSA 1YEFH 1VGKB 3SBWC 1E27A 1LO4L 1P2CB 4Y1AB 4GAYB 4MXVF 4TQEL 5C3LD 1WT5A 3KPTA 5SWZD 4NUJA 2C3VB 3OXRA 1I1AB 2EKJA 1OTUD 4KAQL 5AYUH 3CSGA 3GO1H 1U8QB 1K2DB 2DQTH 3GHBH 4MNHB 2HFEA 4QTIL 5EIVA 5KVFL 1BFVH 4NQDA 4I0KA 4X5LA 3JBG7 4NRZA 3UZQA 4KJPD 3QUYA 4ELMB 5D1ZC 1G7QB 2NNAB 4H1LB 4WFED 3TBSA 5IF0A 1F90L 2VR4A 4XVUC 1WICA 1NEZB 3QRGL 5IR1A 3ARGA 4TVPE 3BSZH 4HIIA 5EBLA 4YO0A 3ARDB 4Y4KB 1DBAH 1FNGA 4M4PA 2NY5C 5I15H 4U31A 1AO7D 5F7DB 1JK8A 4UDTA 5F1KC 1KCSH 1X9QA 4X80H 4IDJH 4H25B 5L8LB 4LSVL 4RIRA 4F7MA 2CK0H 4HGWA 1UG9A 4ZO7A 4JFFB 4HLJA 4OT1H 5EZJB 3TWCL 2Z4QA 2WIIA 3GSWB 4W4OA 4HF5H 5JPNB 1A9BB 5KSAD 4RGOH 4MA1B 2EDFA 1MCNA 2ZOLB 1G9ML 4D0BA 2CIIA 3LN4A 9CGTA 5CEXB 3BZ4B 4K9EL 1JPGA 1S7VA 4QXWA 3WFHB 1F6LL 1DQJA 4KKAC 4LQFH 1I1FA 1CDUA 2CLRB 4UUJB 5GGUB 1KV3A 3OKMB 4OF3A 4WFGE 5I8EA 1Z5LA 2P8MA 1MJJA 1UKTA 3RTQB 4CVXA 3GMOB 4NFCA 4YH6A 1XGYL 4QLRA 4U0RC 2BY1A 4PJDF 3WJLA 2BERA 2NX5B 2J8UF 3HCVA 2VXTL 3KDMB 3PNWA 1OVZA 3BAEH 1YY8A 3DUHA 4R4FL 3IYLW 3GKWL 4OAWB 4AEIH 4OUOA 3QDJB 2X4OA 5IG7B 2DM3A 2CUHA 5TE6H 3EDFA 3U0PA 3H6JA 3KHOA 3FN0H 1GOFA 1M6OA 5HPOA 2VSCA 3L1OL 4IRZL 2EDOA 2VYRE 3S35H 1KYOK 2G75A 5GHWH 4K7FA 3DETD 4XP9L 5SX4H 3Q2CA 1F6AA 5BVPH 2VKWA 4E0RA 3KPRE 3WHXA 3QNXB 2EDXA 1AQDB 1P5VA 2FH6A 4U7KA 1IGJA 5JMOC 3MRPA 1NAMH 3HNSL 4PIRF 1I85A 3ARGD 5A1AA 5TDPB 3T0EE 1EDQA 2EXYD 4DFHA 3CAFA 5FAAA 4E41E 4XC1L 1K4DB 4X5WA 1VERA 5DYOA 3GI9L 1RHFA 4LF3B 1U8IB 1WZ1L 3C60B 4HX1A 4OFPA 3WNOA 3NFNA 3QDGE 2YXFA 4F3FB 1X3DA 2AGJH 4MCZB 3QDGD 3DHJA 1GGIL 3VCLA 4YAQA 2CLVB 5BZDB 3ESVF 3FOMA 2X70A 1T1ZA 4YJZL 5BV7C 4Y4FD 35C8H 4JREC 3V5HB 1G1YA 5CSZB 4WUUE 3CDGA 1ZLUK 2HJKA 3T4AA 5CINH 1C8PA 3BEWA 1I9IL 3OAUH 3R06B 4PG2A 1T5XA 2RIKA 3SDDD 1HH6B 5I1EH 3GK8H 4WU7A 2BNRA 5CCKL 4PS4L 4K3GA 1OQXA 3DTXB 3LH2H 3VFTB 2IPTL 4FZ8H 4U05A 4J3TA 4S1SL 1EHNA 3O4LD 5CLWA 2VZSA 4GRLA 2ZCLL 4I18C 3ZL4L 1MAML 3S96A 3HPLA 4ZPVA 2GAZB 3TFKC 2ID5A 3OKOB 4YEEA 1FVDB 1J8HD 3FZUD 2FGWH 4GBXB 1FPTL 5GQBA 3QUXA 4L4TB 4JLRB 1Q1JL 3VWKC 5AZEH 2MMXA 4LPWA 4M5YH 4DVBA 1OT2A 3L5WA 3ULSA 3GMMB 4HBQA 3KPOB 4X7TA 2HG5A 3LRSA 1V8HA 1MWAH 1R3IL 4F7PB 2CIKA 3ZKXC 3ILQD 2H32H 4YHKL 2AJXH 5EBMA 2X42A 2XTLA 2JF1A 2HFFB 3VXSD 4KJWC 5TH2B 1WBZB 3J7HA 5DJYB 3QUZA 1FC2D 4LHUG 2HFGH 4F7TB 4W4NA 2OP4H 3V0AC 4BELD 1INDL 4O5LH 3UJJH 4OQ1A 3PP3K 4HH8A 1FC1A 2KUTA 1OL0A 1T21A 4ZFFB 3TN0C 3TPUB 3TO2B 1KTDA 3AREB 3V6OC 4Z76B 1F13A 1HIMH 3F12B 3WDJA 3C5ZB 2VXSH 4AZ8A 1A6UH 3EOTL 2QSCH 4LLQA 3LKOB 3MJ9A 3T4YB 1J0YA 1CI5A 1BOYA 4EN3C 1PX3A 2QKIA 1HQ4B 4ZSOE 5AZ2H 1EAPA 1CE1L 2UWEE 5C0AE 4EQ3A 1G7HB 2P7TB 3JV4A 5JHDD 5LQBH 4HUVB 3E6HA 1R3LB 3P2TA 3T2QA 2IQ9L 5LGHL 3L95B 4NSKA 4NQCB 5L2JA 4XNYH 5J11B 2ADJB 2D7OA 2XXCB 2IMNA 1T2QL 4GRLD 4NFBA 4JY6A 1G7PA 4GQ9H 2WWKO 5HGBB 4OZHE 3VFNB 4ZUSA 4NO0D 3BDXA 3PQYE 2AQ1A 2OI9C 4M7LT 1T5WA 2W0KA 2YR3A 4WJ5A 3R1GL 3UTSD 5MENE 1SY6A 43CAB 1ZVSB 5MERB 5GJSL 4J3WA 1WTGT 2AP2A 1MFBL 1QR4A 1KCVH 3CFKB 4ETQA 3DI3B 4M48L 2JJVA 4OZIF 2IBZY 3L3KA 4PG9A 3ZE0E 4BUGA 1ZHLB 1J11A 4Y5YA 1ZLVK 4WGVB 3MGTA 4DTGH 2O61A 4EVNB 4U49A 2MPAH 3S3SA 5DQJB 4YHLL 5I1IH 3C5SB 4KUZL 4XPFH 4JRXE 3QUZD 3TO4C 4WFFE 3HRZB 4U6YB 3MPCA 3NZ8B 4EDXA 2CXKA 5FCSH 4MQTB 2R0KH 2CK2A 4J3VA 3T3ME 4M8QA 2NY2C 5D71L 2X4SB 5GS0C 1ZLWH 1VSCA 1E6OH 1G7IA 1Q0XH 2VWEE 2WP3O 3EO9H 4HKJA 2DLHA 1VENA 2AAVA 5MEQA 2AW2A 3SGDI 1KELL 4UT9H 3MGAA 1JV5B 4MWFB 4CNIA 1I9JL 2DM2A 1A8JH 3SE3C 3ZDYF 1S5IH 4Y89A 1SMOA 3MRLA 4RCAA 4C59B 3KJ6L 3TZVA 2HT2C 3U7WH 4WW2C 1XR9B 1IGIL 4N9GB 2J6EH 2YC1B 3VFOB 4ZS7H 4ZYKA 5I1CL 4JFDA 4NOBA 5F97E 3MNVA 2PXYC 1A2YA 1KNOB 1T2JA 1EJOH 2AEQH 3D3VB 3RL1B 3Q1SH 3LS5L 3H9SB 1AGDB 4ZDHB 2DBLH 5LGJA 5DT1H 2D4DA 3ZE1E 2EO9A 5DMIH 2B5IB 4RA0C 5F7WC 5DRNB 4JVPA 4P2OC 4JKPH 4JFHD 1TCRA 3SGJC 1AD9B 3KLHC 4L29A 3VXME 3F7YA 1PQZB 4NWTH 1CBVL 4FFVD 4XHJD 2ZSVB 4N0UE 4JO2L 1NCAH 4O2EB 3QULB 3ZYOA 3RGVC 3CSYB 3EOAB 4LHUB 2BSRA 3O45A 2Z8RA 5HJ3B 3HNVL 1G6VK 2B20A 5ICXB 4HUUA 4L5FH 4K71B 3VXTB 1TITA 2GSIA 4I4WB 4Y8AA 1NCBH 1UXWB 3OB0H 4MYWB 4M93B 4YX2L 3QHFH 2AKRB 3BRDA 2E7HA 4JHAL 1T66D 4ZUUA 3KPSA 3LKNB 3DIFB 3CK0L 3TCXA 5CP3A 4ZPTA 2QSTA 1N0XH 3MRDA 1PZ5A 1IAII 5H35B 4RZCA 3U9UB 3V2AR 1QHPA 4XAKD 1K5NA 1HI6B 4YDIL 3LKPB 1XGQB 4Z7UE 1YEHL 3DV6B 4HIJB 2XZZA 4KRPD 1GZPB 4YHPB 1UB6A 2XNAA 5FUOH 1RD6A 4Y2DD 3FRPG 3VXOA 1NANI 4HHAB 3GI8L 3QIUB 1CE6B 3GM8A 5B39G 7CGTA 3EO0A 5J1AB 1JYXA 3SDXB 3O6ML 2VDNH 1AQKH 1YEFL 4OI9A 5DI8A 4S1DD 4LSSL 5C0NC 4U1NB 3QXAA 4XWOD 5ADOL 1FFQA 1B90A 1L4IA 1I9RH 4JFDD 4FQXA 4S1QL 4YGVB 4JGMA 2VOTA 4F9PA 4YFLF 1V3KA 4MLIA 2E9WA 2WMPA 4XBGB 1ZEAL 5IBLC 4GLRH 2IG2H 3JWNC 4FQQB 4ZNEE 3ZHKA 1BFVL 4W6YB 3V4VH 2BJML 4ZFOB 2OL3H 3OKEA 5ESAB 2FLRT 1HDMB 1IAKB 3QP3A 1A4JB 4BQ6A 1UACH 4PJ5E 3VGAC 4EUPH 3O41A 2V2XB 5CJQH 2ORBL 3BSZL 2QQKL 2FO4A 3QI9C 4HWNA 4HXBH 1ZLSL 1DBAL 1DBBH 3QO0B 2F5AH 5I15L 1A1OB 3BGMA 1T89C 5JIIA 1UA6H 3MV7E 4IDJL 4R96A 1AIFB 1JWUA 1Q9LB 1A47A 3MXVH 1OPGH 3NIGF 5K9OB 1N59A 5GGTH 2CK0L 3H7BA 2VZOA 2UVEA 5F9WC 3VRJB 2FJHB 2BX5A 4M4RA 3CVIH 4RGOL 4G8IA 4Z7OF 3L3DA 5IHBA 1A6VL 1EHLL 5EO9A 4P4KC 5H2BB 5FB8B 3U36A 4JDVB 2X4UA 4K94C 3CMOH 5F72S 2A6DA 3B9KA 2J8HA 4OKDA 3NIFE 3RKDC 1XT5A 3FB6A 4S1RH 1F4HA 4JJHA 3O2DH 4LCYB 4NBXB 3TP4A 1NGXB 4PRHB 1XH3B 2J88H 5GJTH 1LP9B 1EV2E 2UWEF 3ZO0A 1L0YA 4PGEB 1U3YA 4POUB 1LE5A 4TSBH 2R23A 2GSGA 4FQPA 2WQRA 3VI4E 4DUXA 2LAGB 3VE0B 5DVKA 1EAJA 5EA0H 3OMZA 1KEGH 4FXGA 1EMTH 2W65B 3BKJH 4ERSH 4PJFA 2H1PH 4AEIL 3EUUA 3WO3B 3MRQB 2WINA 3HAEA 2V17H 4FTVA 2O26U 2HWZH 4HZLA 1ZA3B 1YJDH 5TE6L 3N9GH 4LMQE 5D1ZD 5EIIA 3HUJA 5CLTA 3FN0L 2QJDA 3OJVC 3HI6L 4LVNB 4XVUD 2OK0H 1IAOB 2R1XA 5GHWL 4JDZA 4PJCA 4RDQF 1UCBH 3EW3B 4NQSA 4Z7VA 4I2XB 2VABB 1PEZA 4P57B 4J4PC 1ACZA 4TOYL 4UB0H 3X12B 1NAML 4JFZH 4D9RE 1ZT4A 3VD4A 4NN7C 4PJHB 5FGRA 4LPCA 1INEH 1RUAH 4WI2A 4X6DE 3RL2A 4HGMA 4HK3J 1KN2H 1P7QA 3BP7B 1XZ0A 5ISZB 1U91B 3CU7A 4I0PC 3PV6A 3RAJH 4AH2A 1OCWL 1MRDH 4JRYA 4H26B 4MGXA 1DBMH 4O2FB 1GZQB 3BKYL 5JXEC 3DHMA 4NO2B 3KVQA 1T0PB 3E8UH 4NZDA 3EOBB 5CD3B 1MHHA 1RJLA 1IFHH 3T3MF 4KKAD 4M7JL 4ZUWA 1EEQA 4KTEH 2E7LA 35C8L 2BNQE 2ADFH 4HV8B 5HVHC 2MQ0A 2DAVA 1QRNB 2NXYC 2QV2A 3PWVB 4XMKL 5CINL 3VFMA 5B39B 3OAUL 2XTJE 2NY0B 2VDML 1FN4B 1I1RA 4LCIH 4OUUB 3GUTA 1ZGLM 1U93A 1RI8A 3GK8L 4QHNB 1HXYB 1F4AA 3K2UH 2PTVA 4NCC1 4DGIL 2B1AH 1FJ1A 4JDTH 3VWKA 4ZOCA 2C4XA 4DUWA 3UTPD 2XWTB 4H20L 1U2CA 2KPNA 4CU6A 5CEZL 3GKZA 3MUJA 5E6IC 4J3UA 1N6VA 4YQXH 5DHVA 1F3JA 1QO3A 4JQIH 3W0WA 3GGWB 4G8EB 1NCCL 3QEQA 1ADQH 1TZIB 4M5YL 5DJ0A 4PRIB 2FR4A 4AIZA 1ETZB 4JFYB 4K23H 1DEEA 3OV6A 5T1DH 3D85B 5C0IA 2Z8VC 1KCRH 2B0SL 3RUGB 2X4QA 4DGYL 2ZUVA 2J3SA 3MNZA 1YUHB 4KRMB 1MFDL 5SWSB 3OJMB 5HPMA 5TFSL 1YYMH 2R0WH 1KJ2A 2VLLB 1DANT 4Z78A 3IDUA 1KTLA 1JYVA 3QFDB 1EZVX 4EUPA 4KK8C 3H3KA 3U6RA 4BSVA 3BPNC 2PR4H 1BZ7B 3MACH 1JN6B 3H9YA 1UWXK 3WS3A 3RHWK 5C0DA 3D0LB 3BWAA 5D6CA 5B4MC 3SDYL 2QQNH 4H5SA 4R97C 4J3SA 4P2QD 5ALBL 2HYMA 3GMLA 3EJYC 2BMKA 2VXSL 1AXIB 5E8DH 1A6UL 1JI1A 1CL7H 4Z7UF 2AERT 1XGPA 1A7PH 1XF1A 2XKNB 5F1NA 2X9YA 1TTFA 4EI6B 1CXEA 4BH8B 1WITA 2BOBA 2CJUL 3HE6B 1UB5B 4FOMA 1F45A 4MJIA 1NBZA 3O11B 1JZ4A 4YIQA 3Q5TA 3PHOB 1YEKH 4DVRL 1CXLA 4JN1L 5KS9A 4LRNH 2X41A 3L5XH 3TFKD 5C9JA 1Q94A 3M45A 4HCRH 1TFHA 4LSPL 1CG9B 2NY5L 1TVBA 2XG4A 5D5ME 3VWKD 2HH0H 4AENB 2EIBA 3TNNB 4OB5H 1H0DB 1FV1A 3BGFC 1AO7B 2BVQA 4ZOBA 1DBKH 3LEXA 4AEHH 3FQUB 2PW1B 2QADC 5CBAB 3QEQD 3TIDB 3PHQB 5D7SH 1S8DB 4WWKA 5I1GH 4KJWD 4Q6IC 1N64H 2ZUQB 1R3JA 3M1BA 4OZFG 4K94H 3IJYB 4P5TC 4LASH 5DJ6A 3TO4A 4BZYA 1KCVL 5MEPB 3ZSSA 4OLEA 3SDCB 5E8OA 2FATH 1BBDH 5FOJA 1A1MB 1MHEA 3OB8A 5D6DA 5E6ZA 5C0BE 1B0GB 4JO3L 4ODXA 1JGEA 3IDYC 5L9DH 2MPAL 3TN0D 3ULVC 1S9XB 1A6PA 4X4XA 3LIZH 3UTOA 3MLTB 4GAFB 2R0KL 3REWA 5I1KL 2DQDH 3EFFA 1PYWB 3SE3A 1BVKA 1IJ9A 2IFFL 2FDBP 4ZXBC 3JVGA 4J23A 5DJAB 4HS8L 4EN3D 1RIUL 5ID1B 4HKBA 4WW2A 1FGNH 1YEIL 1A6WH 1CU4H 1MQKH 4YR6B 1IC4H 3BHBA 3TH4T 4URTB 2VC2L 3LD8B 4QOKE 5IOPA 2PXYA 3OQ3B 4UT9L 1A6AB 5E5MB 4D2NA 5T3XE 3NIFF 3QUKB 1M4KA 5CUSL 1QLFA 1YC7A 4HWUA 4QRRE 1S5IL 1VA9A 5FO8B 2JCCE 4OF6A 2K1MA 2G2RB 4U1LA 3VFUA 2DBJA 1EO5A 4RRPG 3T77A 3U7WL 1HZHL 3MZTA 3N1GC 2J6EL 1CIUA 5D7IB 4P2OA 3WFDL 5CJOL 1FNHA 1K3IA 2LU3A 5DVMA 4YBLB 3BW9B 1DUZB 4GRWH 4JKWA 1QBMH 4F57L 2C9AA 3B3IB 4XTRC 1EJOL 2AEQL 2XA8H 3P9MA 3VI4F 5ICYB 3Q1SL 2AEPL 3O3EA 1T80A 3WN5A 4G6JH 4P4RA 5DT1L 1TJGH 5EU6A 4D9QD 2YPLA 4JM4H 1FL3A 1E4XH 2DM7A 2X4TA 4LCUB 1FZOB 2UY7A 5E00A 5L7XH 3W9DB 5E94B 2RCSL 3AAZA 1I8KA 2YS4A 3BPOC 4E41B 3QG7H 4FXLA 4L4VE 4P2RA 4NWTL 5BV7L 4BM7A 4BJLA 5E7FA 5IHZA 3QDGB 1NCAL 2C1PA 3IJSA 3HC0A 5IFHH 3WDHA 2XZCH 2ICWA 3BQUA 4WW1B 1YMMA 2IGFH 1S7SA 3BKML 4Y4FB 2DYPA 5TGBB 1I7RA 4L5FL 5FO7A 3QFJA 3RJQB 3TO4D 3AY4A 3U2SB 2N4IA 2FBOJ 5IGXH 3X13A 1NUNB 4WUUB 4X6DF 2XZAH 4DK3A 3SDDB 1PG7X 3VDCA 2NY2D 3QHFL 5I66B 4N1EA 4GUPA 3G6AA 1X5YA 1IM9D 1EEZA 4RNRA 1N0XL 3CZFA 1RJZA 1NL0H 1S9WA 3HFML 4XNXH 1ORQA 2DWEA 1CFQA 5D96B 5T1LA 1A6TA 1BD2D 3O4LB 4L9LC 2DDQH 2H6PA 1I9EA 3UTTE 5DJ2A 1X4XA 1F4YH 1NGYA 3HZMB 2C26A 4AJ0A 5IB1B 1J8HB 1JWSA 5L0QB 3L5HA 1ZT1A 4APQB 1OGAD 3QXWA 2PXYD 3KYMA 4NUGL 2VDNL 3GFUA 2GW5A 3TBVB 3RIFK 4JO1L 1YPZA 4KQ3L 1L6XA 4PJBB 1W72A 3B2VL 5HGDA 4XCFH 2AJUH 1U8NA 4HK3N 2C1OA 3KLHD 3G5ZA 5DQ9A 3VXSB 2APVA 1WWAX 5IFJA 4D94A 4XH2A 5JNYB 3QI9A 4O58H 5EU6D 3BXNB 1KEMH 3V4VL 2QR0B 4OZFB 1KJ2L 2MHAB 5FDWA 1QPPA 3H9HB 4WU5A 3RGVD 3U30C 3V79C 2ESVE 1RUKH 4BFGA 1IGTA 3HTLX 4G8GA 3BD5A 3PWJA 2FHBA 4JFOB 1YEDA 1ZE3C 4XNMA 1OARL 4NHUB 4HS6A 4LCWA 4P2RD 2XWJA 1UJ3B 4HXBL 4KUCD 3U48A 3UDWA 4M6NH 4P46D 5FO9A 4G5ZH 4L3EE 1VEOA 4X6BB 5EO1B 4KI5F 3L3HA 1P53A 2DYPD 5GGVH 2WK2A 5KW9L 2ZOKA 3MUGA 5D7LE 3PWNB 3QFJD 2XPGB 3KYKH 3ZKMC 5GGTL 3AFLA 3S34L 4M00A 2MQ3A 5IQ7H 3GIVB 1FVEA 1D5BB 1C7SA 3FFDA 4MNGE 4ZSOB 5A16B 1K9TA 5JHDB 2E6PA 5HYEA 4NC1E 4M3JA 3M07A 1WC7B 5D7JB 5HHPB 5T1LD 3NACL 2CUIA 1AP2B 3PWPD 1NC2D 4QHLB 3T3PE 2F53D 3ZKSD 5IJVB 1WQVT 5C0ND 4AM0A 2J88L 1Y6KR 5GJTL 4H88H 2VLRE 1PKQB 1U8LB 3B8YA 3MFFA 2OLDA 1RIVH 4NO0B 4YWGH 3ES6B 2D7MA 4LHQB 4OZHB 2FJFA 4PTTA 1M71B 4MA3A 3SO3B 1O5DT 4LLUA 3VJ6A 1RJYA 3UTSB 1EMTL 3BKJL 4ERSL 1IT9H 2H1PL 5IBLD 1SM3L 2V17L 5D5MF 1JMZA 2IWGA 4WO4A 3ULVH 3P4NB 1Q9KB 2OK0L 4JJ5A 4MQXC 4JZJC 1MCKA 1T20A 5GS0L 2VO5A 4NNYA 1NSNH 4I0PA 4LAQL 3TESA 3I3EA 1Q72L 4PLKC 3CFEA 3R0NA 3MRKA 2ZNWA 2VNCA 4OLWH 5GGRA 1U0QA 2BSTA 4E5XA 1KPVA 1SEBB 4KI1A 1INEL 2OCFD 3P0YL 4LCWD 2GQHA 1KN2L 3KNBB 1MVUB 3DUUA 3B5GA 1VKXA 3QIBA 1KIUA 2F8VA 4P4KD 4G6KH 4OLYH 1DBML 1XF5B 5IB5A 2ILLA 3P9WB 1R0AL 1L0QA 1BGXL 3MBEA 4KV5E 2XFXA 1BHGA 1VCAA 1IFHL 5E9DA 5I8OH 3RKDD 2EYTB 4KTEL 2BVEA 2ADFL 1SJEB 5E2WL 3CVHH 3I85A 2GFBB 1MFEL 5GS1B 4RFEA 1MLBB 4K7PY 1NGWA 3MJ8B 3UJTH 4DOHE 5F3HB 2FX9L 4XNUH 5EFIB 5FF6A 2Y23A 1G84A 1A7RL 5KAQG 1Q9OA 2MCPH 2VDQH 3NVQA 3K2UL 2X4PA 3FQNB 3IXAB 1RURL 5HYQA 5F9OH 4OQTH 3VXMB 4X6FA 4U3HA 2P5EE 4HS3B 4MDJA 3CXDH 4MS8C 2Z8WC 4NZJA 4YQXL 4L8SB 1DEDA 4JQIL 3GBNL 1XGTA 4A6YA 5ITBH 5JHLL 1ZHKA 5E2VH 2JJTC 3W82A 2RR3A 2I07B 2AV7B 5KVEL 3Q6GL 5T1DL 3OR7B 1GGYA 3HMXH 4J4PD 1DQMH 3IAGC 4M7ZB 1NLDH 2O93L 5DWUH 4QHMA 3DX7A 3WXWL 4EZMA 4YXHH 2GUOA 4NQDE 4CVZA 5KSVA 4YHIB 4DJMA 1NAMB 1YYML 1HWHB 3SJVE 4I0PD 5D72L 1T4KA 1BX2B 3AS2A 3DRTA 3LSOB 3ZYZA 5EUOA 4NDMB 5JXED 3ALPA 4MD0A 3WIHA 3L7FB 4Y2DB 3FB8B 1CFNB 3MACL 4FFZL 2G5BB 5I17A 3BZEB 3UXFA 1PG7L 2AJZB 3RIAK 2QQNL 2NXYD 4JPIA 2ZUSA 1UM4L 3RZCD 4IRJC 3L9RA 1NC4A 3KPPB 5DTFB 5J9PB 4OCNC 5E2TH 3H0TA 5E8DL 1S7WA 4HXAH 1CL7L 4BFBD 1JNHA 1A7PL 1U8JB 3PP4H 2PO6C 1DZBA 1N3NA 1YA5A 4OCYH 1W72L 3ZMRA 3IJHB 1QYGL 4M1GL 2FHCA 3I50H 2M8XA 2BNUA 1YEKL 3SGEI 2HT4C 1U8PB 2B1HH 2DI9A 5E6ID 5K93A 1EEYA 3L5XL 4HCRL 1QFWM 3P9LA 5EU3B 1DLHB 3TYGH 1OSZA 4PJ5B 3CDYA 2HH0L 5DJZB 4HC1A 5DS8B 3FT2B 4QY8A 2LV4A 5I73C 3Q6FB 5BXFB 4P5TA 1DBKL 1HQRB 4MVBC 5H94A 5J6GB 4JGUA 4AEHL 4P49A 1B0WA 4FG6C 2MWCA 3WDIA 3MV7B 3V6FA 2FECI 2AJ3B 1MJ8H 3G9AB 1MWAB 4GO6B 5I1GL 4WV1A 3ROLB 3RPIA 3VXUD 4K94L 1CXKA 5ABDE 2H32B 1SYSB 4UAOC 1R5WA 4U2YA 4MB3A 4KK8D 4PREA 4XNQA 3KYOA 1E28B 3ULUC 5HHXH 1EGJH 1LD9B 4ZXBA 1FFOA 3CFIC 2H9GA 1MJUL 4NIKB 1YNLH 1FLRL 2Y07L 5B4MD 1WV7T 1B6DA 3K1DA 5L9DL 1OP3K 3QJFA 4XGZA 4I8DA 4MZ2A 1N5YL 3UPCA 3IFOB 1MNUL 3EJYD 2HJFA 1YEEH 2GJ6E 3MA7A 1BFOB 2O5ZH 1KLFA 4CDGC 5C0GB 5T3ZE 5B3NA 1WSST 2ICCA 1OF2B 3TGXA 3O6FA 1CVSC 1EBAA 1QQDB 1FGNL 3VFPA 1CS6A 1CU4L 1MQKL 4XWGH 1IC4L 2HTLC 2A77H 3L3GA 3F58H 5D1ZB 4QF1A 4OLVH 4YBQC 4YDVB 5F96H 3T3PF 1WF5A 3LEYL 1CFTA 1GC1C 1P84K 1BQHG 4PJDA 2W91A 5HYIA 3BUYA 3LEVL 3MRCB 4KDVA 1QBML 2BNRE 3CFBB 3B2UC 4F7CA 3O0RH 3C6SA 1RUQL 3OF6A 1XCTA 3LMJL 1ZXQA 2W9EH 3V6ZA 5FM4A 1DDHB 1TJGL 1LK3H 4RMQA 2QADD 4NN5B 3LS4L 1UXSB 1F42A 2XRAL 5L7XL 2GT9A 2Y7QA 1UM6H 4XBPA 3RDTC 1NKOA 3QA3A 3V0WH 5EN2B 2V2WB 1A7QL 1UADC 3GB7A 3QG7L 5F7EL 1F2QA 4JY4B 1P4LB 5J3HD 3H9ZA 4QHKI 1NMAH 2R2HA 1CGSL 2IH3A 2XWBA 3G6JA 3MMEA 3NA9H 4NNPL 4XXCA 5FGCE 1C12B 2VISB 4HIEA 1I8LC 1ND0B 1RZGA 3CUPB 1X5XA 2IGFL 4X4MA 5CGYC 1I3VA 2ITCB 5C0FB 4DZBB 5JO5A 4LCCC 1AI1L 3WFBH 1P5UA 3ULVD 3ARFA 5DRWA 3SKOA 2BNQB 3HLAB 5EZOL 5IGXL 4D0DB 4JHWL 5F89B 3AMKA 3ECBA 1U8KA 4XMPH 3G5XA 4L9LA 5I1JH 2BVUA 4PJEA 4U0RB 1AGCB 4ZXBD 1I3RA 1HHJB 2FB4H 3MLZL 5DMKB 4U6VH 2IANA 3SOBL 3JZ7A 2DJUA 2Z31C 1NL0L 4OD3L 4S2SB 4IRSA 1WISA 3QB7C 4KV5F 4JFPA 5K9QI 2VQ1A 3QHZH 5I1DB 1CN4A 5HI3C 3O8XC 1T83C 4KY1L 1ZWIB 4NZUH 5DC9B 5GGSY 5CGMA 3HG1A 5I1AA 1WEJH 4U1JA 3L7EA 5CKAA 4IMKC 3MRIA 3BI9X 4PRPA 3IFLL 2BC4B 2DRUA 1NFDB 1BZ9B 4XTRD 5D2LA 5C09E 1W8NA 1SBSL 4JY5H 4JKKA 4Y4KC 1FSKC 4IIQC 5L6YH 1JNNH 4LVEA 4LEOB 4G42B 3RIFF 4JO4H 5I8KL 3LB6C 1S7RB 5I8EB 3I9GL 4YFEA 1A02N 1MIEL 1SJVA 1RMFH 3O9WB 4O58L 3UTZA 3GRWH 1KEML 1YECL 1X7QA 2L0DA 1CF8L 4UT7L 3NPZB 1B2WH 5CZXC 1LNUA 3HMWH 3CC5A 3KLSA 1RUKL 2BSSA 2NW2B 3S8WA 3DV4A 1AKJB 3R8QA 5I8CB 5IB2A 4JREB 3BT2H 3WIHL 1OHQA 7FABL 4HG4J 4DN4L 2DQCH 1AGBA 4M6NL 4P2QB 4G5ZL 5DC0A 3GNML 4RWHA 3IXTB 1I7TB 1YNTA 3VFSB 5GGVL 3GDBA 1RZIB 1I75A 4NM4L 1FAKT 4OZGE 5FHBH 5K59E 4I18B 3NOIA 1HYSC 1J86A 3WHE0 5C2BH 3F62A 5FEBA 2P4AB 1BAFH 3EO1B 2IAND 5C86A 5ERWB 2VR5A 2ZKHH 5DVNA 5CWSA 1MIEH 4ZD3L 3CX5J 1W0YT 3VRIA 2FX7L 2X7LA 4U7SA 4WDIA 2FWOA 1S7XB 1BQHB 1DE4A 5AD0A 2VERN 2HFTA 1FVCB 4OLUH 3HG1D 2F54D 1M7DA 4NO3B 5IFAL 1ZLWK 3ZKXB 3S4SA 3S97C 2NY4C 3I6GB 5EOQL 5J1TC 4MCYB 3QQ3B 3QH3B 1X5JA 3MX0A 3S37H 3MLRH 1MH5B 4FZEH 4FP8H 3MLYL 4NHCH 3FT4B 3C60C 2V5MA 3QXDB 1EIBA 1X4ZA 2ZSWB 1UGNA 3VA2C 3ULVL 4LMQI 2BCKA 5E8NA 2R9HC 1AE6H 3DURB 1QLRB 2OL3B 3TN0B 3WIFA 3GSXA 3LN9A 4JR9H 2IALA 3UBXA 3QJHA 1AFVH 1V5JA 1AH1A 3IDIA 3KYAA 3D18A 3GJEA 1CDJA 5ACLA 4ISVA 5EZLB 5BRZA 2NY7H 3RRQA 3FQXA 4OZIA 3E3QC 1FP5A 5LG1A 5CEZE 4OLWL 4EN3B 3ZKMD 3MYJB 4HMEA 2D0GA 3BJLA 3HE7A 1CD9B 1IILE 1ORSB 1TQBC 2L7JA 3DMMA 2BVPA 3SDAA 1HE7A 1JUFA 5IW1B 2A73A 2V7NB 4GXVH 4QOKB 2Z8SA 1NJ9A 4J8RA 3BH8A 4G6KL 1TLKA 4PV9B 5CP7A 4QRRB 3TNMB 2V9RA 2JCCB 1XMWA 3KPMA 2R0ZL 4Z5RB 5DHXB 3KPSE 3OB0K 4EJ1C 5IP4A 4O51A 4NQXB 4ZUVA 4FABL 2BVOA 3ALXA 1WZKA 2WWMC 5E4EC 4JKMA 4WTZA 4R7DB 4JM2D 4GKNB 1OW0A 3SPVA 1XIWD 2VQTA 2D9QB 2IC2A 3VXRD 3MLVL 3AGVA 2DLFH 2ZUXA 2MCPL 2VDQL 3MLXL 4QXTB 3NCJL 3ZSTA 4RFNC 3QDMD 1SEQH 5CMAB 3BP4A 3TBWB 2JJTA 3FRUB 2ZCHH 3OGCB 5JW4Q 4AT6A 4RGNC 2XACC 1OT1A 2BHZA 4L4VB 1NKRA 4C56D 3TBYA 3WXVH 4LSUL 3QG6A 3OKDA 4UQ3A 3PL6C 3FN9A 4P23C 5ITBL 4D0CA 2IADA 4I48B 4LSRH 3AREC 1D5MA 5IESH 2AEIT 3AS1A 2JIXA 3HMXL 3LY6A 1DQML 2NY2B 4NYLA 4PLKD 3P0VH 5FYLE 5J8OA 2EEAA 3T2NL 3D5OF 3GMQB 1YEGL 3C9NB 3PGCB 1J0KA 1MCEA 1IM9B 1A7OH 4ZFZB 4R26H 4HKXB 3HC3L 1BD2B 2OM5A 4RAVB 3W39B 2HRPL 1NLBH 4H1LH 2OMBA 1DQQB 4CDHA 2P44B 4RBPK 1YDPA 2CKBA 4MAYC 4IRJA 1MFNA 4RISH 2F58H 8CGTA 4UIMB 4FQ2H 3F7VA 4XPTH 2XN9E 2R56L 1T1WA 3TCLA 5DSCB 1OGAB 2I24N 2YMXH 3NCYP 4P2YA 3VW3L 3QBTB 1AGFB 5IQ9B 2NW3B 5JOPD 2DI7A 1K4CA 4HJGB 3QQ9C 4MDIB 1JL8A 1FZJB 2Z92A 4NZRH 3EYVB 4HXAL 2X4NA 4TRPH 3RIAF 4P0DA 3BOVA 3TIEA 2H26A 3EYSL 3PP4L 1AR1C 1KYOJ 4BSWA 3OR6B 4OCYL 5IJKA 3GHEL 5DMYA 4GW5A 5ITFA 3D39D 3CFDA 2YD9A 5IB3B 4RQQB 3FQRA 4KMQA 2YBRB 1VEPA 3EAKA 3RGVB 4MS8D 3MQIA 5K33A 3MRRA 4UQ2B 5DLML 4Q74A 1I3GH 1OB1B 5DK2A 4Z0XB 2BDNH 3TV3H 2KH2B 4XB7A 4UT6H 5GRXG 2M1KA 4TSCL 1S7QB 4GRMA 4P46B 2GCYB 5F8QC 1T04B 3CNKA 5TQ2L 3WIIH 4NJAH 3BP6B 3DX9B 2VITB 2VLJA 4PV8A 2YWYA 1BFSA 5BOPA 4FTVE 1NFIA 2EKSB 3MLSH 3NIDE 1MJ8L 5D70H 1NGZA 4JFEA 4MJ5A 2LU4A 2VJXA 2GJZB 2JIXD 3LHPL 1U3ZA 4NPYA 1EHAA 1OAXL 5HHOA 1CCZA 4Y5VC 3IFPB 4KDTC 2VAAB 4PJCE 3TH2T 4RWYH 2DQHH 5C07A 3WFEH 4Z7VE 4GLRI 4X6CA 4KVCH 4KJQC 4QGYA 1EGJL 3IETB 4JRWA 1MI5D 4HWZA 3IKCA 1G6RH 1YNLL 3PWPB 2Y5TA 1NC2B 3LKQB 2EH8L 2F53B 3ZDZE 5HYJA 5I18H 3GSVA 4IRJD 2CXGA 4RAUB 1R24B 1U95A 3RI5K 1J9CT 4UV4L 2W59A 5BQ7B 2O5ZL 1CZ8L 2D03H 2VLRB 3C8KA 3OXSA 4PJGF 2RB8A 4YPGA 3CSPA 3PIQA 2LQRA 2PO6D 2FHFA 4JRYE 1WBXA 5BJTB 3P11L 1A6ZA 3SKUD 1MCRA 3SKMB 2I9TB 3Q3GB 4OJFL 1UZ8A 4RMWA 5HHNB 2CGRH 3QNZB 3IS0X 5I2IB 3LPGA 4G9FD 2HT4D 3F58L 2CDEB 4ZQKB 5F96L 1CT8B 1RIHL 1TJIH 5E08L 4P3CL 4MD5B 5D2NC 4QNPF 5IT2H 3HB3C 1WJ3A 2YN5A 3QAZB 3S36H 2LU7A 3CCHB 2QHRH 2HMIC 2CPCA 4LFHD 2NLJB 4F8QA 2APTA 2Y25A 4NRYB 3WSQH 2H3NA 3FO1B 3OHXB 3RDTA 3TM6A 2D3VA 1T22B 4X9FA 4MVBD 4POZC 4PP1C 1PW3A 2W9EL 4ODVH 2FYYA 1LK3L 4FG6D 5AEAA 1GGBH 1I8LA 4V1DA 2EYSB 1TZHA 4C55A 4HK0B 1UM6L 1F3DH 5F9WB 4F9LC 4LCCA 2H2SC 4JQVA 4EI5C 4KC3B 3V0WL 4WTWA 5HVFB 1JWMA 3W0WE 2YD8A 2ATPA 4P4KB 5EOCL 5HI5C 5DF0A 1NAKH 2A6JA 3HZVA 1VGKA 3ULUD 3B5HA 2BRQA 2OJZH 4RX4D 5MP6H 1RJCA 1P2CA 4Y1AA 4JFED 4GAYA 1UKSA 2YUWA 3UP1A 3WFBL 3QIUC 5DR5L 2C3VA 4UTBL 2EDWA 4HBCH 1F4WL 4LNRB 3S88H 1I1AA 2PTTB 1A14H 2X9XA 4LEXH 1U8QA 1K2DA 4ZTOH 2CO6B 4MNHA 1KBGL 5I1JL 1T83A 4JPWH 4H0HB 4K3DL 3REVB 2FB4L 3DSNA 4XPBH 4ELMA 1G7QA 2W9DL 5ENWB 5HYJD 2NNAA 4H1LA 2NTSP 4AIXA 4IMKA 4TUOB 3KWWB 3PHSA 4TNWK 5FKPB 3DLQR 2HTLD 1NEZA 3BH9B 4UIKH 3QHZL 4YBQD 3ARDA 1NANH 1C5BH 4Y4KA 4NZUL 3D2UB 5JLZB 3LPWA 2GIYA 1LK2B 1T1YB 5F7DA 1WEJL 4NT6B 5T5NG 1CDHA 1VDGA 4H25A 1FE8H 1HILB 3U0WH 3B2UD 2YD7A 2W60B 4JFFA 5EZJA 3GSWA 4BSJA 5JPNA 1A9BA 4NKDB 2EC9U 1JHKH 3MOAH 2AABL 2ZOLA 4GRWB 3RWHB 4MJIE 5L6YL 1FG2B 2PYED 1JFQH 3HS0B 1P9MA 4CVUA 2MSPA 5C6PB 5CEXA 3BZ4A 5KS9E 4NQDB 3RDTD 4JO4L 3WFHA 4MHHG 5J06A 3SJVB 2CLRA 4UUJA 5GGUA 3OKMA 4XPGL 1U58B 4U3XA 3QIWB 3C2AH 5LWYH 3NFSL 3RTQA 5HY9B 4V1DD 3GMOA 4PJIE 5CGYD 3DXAE 3O3AB 4R2GB 3IGAB 3MRJB 5HVHB 2NX5A 1IEAB 1HYRC 3KDMA 2R1YB 1JCKA 4OBSA 1RZFL 5IMLB 5TF1L 1OP5H 2W92A 3RZCB 4DEPB 1L7IL 3JTSB 4OAWA 5GS2H 4CN4A 1MIMH 3QDJA 5IG7A 4M5ZL 4WHDA 4PLJC 2V2TB 5I0DA 2YKLL 4PY8I 1M7IB 2Z31D 3V5DB 5DRXB 4JAMB 2AVGA 4ODHL 1WWCA 4XP5H 5EU7C 5DEGB 5HI3D 3O8XD 2VRAA 3IDGB 2K3TA 4Z95H 3QNXA 5E6IB 1AQDA 2XT1B 4OM1L 4LVNC 4X7CC 1KG0B 3W9EB 5TDPA 4CN1A 1WGOA 5GSVB 1K4DA 3O3UN 4X7SH 4Y4KD 4LLDB 1FNAA 1YN7B 4LF3A 1U8IA 3X11B 3C60A 2AJVL 4R0LA 2X6MA 2ZG3A 5INCA 4ZNCD 4F3FA 3PDGA 4MCZA 4YUEH 4Q0XL 4ZS6C 1KGCD 4DKFH 2APWA 2CLVA 5BZDA 3S37L 3LB6D 4MXQC 3VXUB 3ULUL 1BJ1J 4UINH 4FP8L 5AWNH 3SKNB 1P4IL 4NHCL 5HDBE 4NKMB 5BO1H 5CSZA 5DUPH 3ELAT 4XCYB 3BPNB 5CZXD 1CDGA 3R06A 1PSKH 4U6XB 1HH6A 3SE9H 1AE6L 1PD6A 1JPTL 2ARWA 2FRGP 4RSVA 4PJFF 4LLMB 4K7PX 1K6QH 2YPLE 1R3KB 1OM3H 4JR9L 1KENH 1AFVL 4IBLT 3FAWA 3PWLB 3DTXA 3VFTA 1CK0H 3ZTJG 3HUJF 4CKVX 4DKAA 2NY7L 3CU1A 5BMFL 4JG0H 5SWQB 1H8SA 3O4OC 2VH5L 2GJ6B 2NX5D 3VXNB 2GAZA 2ZUUA 2VDLH 3OKOA 3MGOB 4OD2B 4Z7VF 1FVDA 1FRGL 4Z7QE 4GBXA 5ECJE 1YMME 1GC1L 5IBTH 4L4TA 4JLRA 4PJ7E 3QDJD 3ZDZF 5FUZH 3GMMA 2R2EB 1DSFH 3KPOA 1ACYH 5IM7B 4HFWB 3IRPX 5FUCE 4F7PA 2A9ML 2D7NA 2MKLC 3LDBC 4K8RH 4ZAKC 2VXQL 5HHME 3O6KL 2HFFA 4PR5B 5TH2A 3IT8D 4P5MB 3EYUL 4WCYH 1J0JA 1WBZA 5DJYA 4GAGL 3MRGB 5EZIH 4WNQB 2NY4D 4F7TA 2FL5B 3O2WH 4KPHH 2DLFL 3KG5A 1T6WA 1MVFA 3QXTA 1J1OH 1SEQL 4I9WD 3S96B 4GSDL 3C60D 4ZFFA 3OG4B 5FGSA 2ZCHL 3TPUA 5B22A 3TO2A 3AREA 4Z76A 2Z35B 2Z93B 3F12A 1R6VA 2R9HD 1X6NA 3O3BB 2IBGA 3C5ZA 1A1NB 4HULB 3BYTA 3WXVL 4FA8A 3IDYB 1CFSB 1KT2B 3LKOA 4N8CH 3T4YA 4UILH 1HXMB 1HQ4A 4WI9A 3VFRB 4LSRL 3BYYA 2VXVH 1G7HA 3P0VL 2P7TA 1IKFL 4X6EB 4FHBD 5DD3H 4HUVA 1R3LA 2Q3ZA 2FEDC 3L95A 1E4XI 1T7XA 3IS1X 4LARH 2DKSA 1FYTD 4G8GE 1NLBL 1ZA6B 2ADJA 3HE6C 2B2XL 3U7AA 4PJ8C 4WHYG 1MAKA 2B8OT 4NC0B 4FQ2L 4WWID 1ZHNB 3H3PH 5HGBA 2OYPA 3OG6B 3QCUH 4K2UL 4GFTB 3VFNA 4MB4A 2YMXL 2CRIA 1AJ7L 4G3YH 4QO1A 2WWMD 43CAA 1L7TH 1ZVSA 1BBJA 5C09B 2IJ0C 4HMDA 3MV8D 3CVHB 3BD4A 3CFKA 4TRPL 1CLZH 4PJAE 1ZHLA 2YXMA 5I76B 1LO2H 1JIBA 4Q9RL 4BQ8A 5GISH 2P5WD 1TETL 3QPXH 4EVNA 5DQJA 3MLPA 2EH7H 3C5SA 4RGND 2NY6C 2Q3AA 5CFHA 2BRRL 3HRZA 4U6YA 1QBLH 3SDCC 3RX7A 4PYGA 2XQBL 3EYFB 5D1XC 2LVCA 2X4SA 3CLEL 4HUMB 4QXGH 5DZOA 3ARBB 3PL6D 4P23D 1D9KC 1N5AB 4NJ9H 4UT6L 3UC0H 3ARED 2R4RL 4Z0BH 3WIIL 3EFDL 1CGYA 1JV5A 1F4XH 4MWFA 3HPJB 3HR5B 5F1OB 3FTGB 4HIXH 1HHGB 1OAUL 4BZ2H 1NCDL 3LRGA 1XR9A 4N9GA 2YC1A 3VFOA 4MZ3A 4LRIC 2ED7A 3LD8C 4M6MH 3A67H 1KJVB 1OTTC 4MAYD 4OIIL 1KNOA 2EIZB 1B4JH 4OZGB 2CDGB 3D3VA 4XAWL 4DCQB 3RL1A 1FORL 3BDYL 3H9SA 4ZDHA 2ZG1A 1JHTB 4Q6YA 5LXGH 4NQCD 4GAJL 3JV0A 3B4NA 1E4WL 1NBVH 4KKBC 5DRNA 2E9JA 3INUH 5I18L 1AD9A 3QQ9D 4YBLC 3EHBC 5DUMH 1UWGL 5DJCB 4ONGH 1PQZA 4N1HB 1RQ5A 2H2PC 2ZSVA 4XZUA 2D03L 5D7KD 4YHNB 3GSNA 4O2EA 3QULA 4PJXB 1AR1D 3CSYA 1L6ZA 2W9LA 2KDGA 3EOAA 3DX6B 4LHUA 4KTYA 4YPJA 3K80A 5HJ3A 5EWIH 5ICXA 4DKEH 3RI5F 1FNSH 3FMGL 2CGRL 5E9DE 3VXTA 3IVKB 2IFGA 2PYFB 4I4WA 3U30B 3IDNB 1UXWA 2YK1L 4HDIB 4LGPB 1S3KL 2HKFH 5IT2L 5CILL 4WW2F 2AKRA 2NYYC 3S36L 5M7QA 3DVIA 1S5HB 2WBWB 3LKNA 3DIFA 3PE9A 3T1WA 3K3QA 4PP2B 3S3JA 5H35A 1J12A 2W07A 4FMKA 3U9UA 1MJ7H 2YN3A 1K8DB 4LLWB 1HI6A 4FQ1L 2VDKH 1QSFE 3LKPA 1XGQA 3SDDC 4ODVL 5C0CE 3DV6A 1GAFH 4HIJA 3NABL 1GZPA 4YHPA 1DVFC 3UPAA 1TVDA 3WNMA 4F37K 4HHAA 2HP4A 3QIUA 4OV6F 1CE6A 5B38G 4WIQA 4OF7A 5J1AA 1R3HB 4MHHI 1S9VB 2OR7A 3SDXA 1Y0LB 2ICES 3MV11 4P59L 2OJZL 1KOAA 4KJQD 2X05A 2Q1EA 4U1NA 5MP6L 2X4RB 4M3KB 4ENEC 1A7NL 1MCJA 4G6MH 4L8DB 2Y4SA 2J4WL 2EXWD 5L0QC 4LPUA 1YN6B 4APQC 4HBCL 4YGVA 5GRUH 3RVUC 4KUCF 1KC5H 1A14L 2OR9H 4XBGA 4FFWC 1II4E 5DO2C 4ZTOL 2DTSA 4JM2B 3MRDB 4FQQA 2Q6WB 1IAIL 1XIWB 2A9NL 4ZFOA 3QWOB 2NTFB 1JPSL 3VXRB 5ESAA 3NAAH 1HDMA 3T65B 1IAKA 4X9HA 1A4JA 4HWBA 3QDMB 2OZ4A 3U4EB 2V2XA 4X9IA 4PGDB 1RZ7H 3CGTA 2YZ1A 4N1CA 4N90E 1GGTA 2E6JA 3X3GH 1RVFL 3QO0A 1A1OA 3GSOB 3HB3D 4C56B 4BZ1H 4M9OA 4LHUD 4JZJB 4TULH 4CGTA 1RUMH 5EB9A 3SY0B 2HMID 1AIFA 1Q9LA 4O02H 5K9OA 1WAAA 1TNMA 3U0WL 3ZYIA 5TE7H 1FIGH 3VRJA 1KPRB 4POZD 4PP1D 2ED9A 2FJHA 2E7CA 2ZP0T 1JI2A 3MOAL 1IQWL 5GS3A 5H2BA 5FB8A 4O2CB 1JFQL 1WFTA 2AJSL 2OTWB 1MLCB 2H2SD 3LV3B 4EI5D 43C9B 4PPTA 4I3RH 2Q8BH 5KJRL 1YPZF 4GMSH 2MQCA 3DYMA 4MXVE 4XNZB 5HI5D 1FBIH 4LCYA 3C2AL 1GH7A 2WQ8A 1NGXA 4D3CH 5LWYL 4FQCL 4PRHA 1LEKB 1XH3A 1JF5A 1LP9A 4TVPH 1MFAH 5DFTA 5D7JC 2F15A 1B9ZA 2N7BA 4PGEA 2XN9B 1YEJH 5IVXB 4CL7A 2E9BA 3VE0A 1C1EL 3CD4A 3UX9B 1CICB 2W65A