2QQKH

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
219
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTISGYGIHWVRQAPGKGLEWVAYIYPDSGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREDFRNRRRLWYVMDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
total genus 41
structure length 219
sequence length 231
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqkH01
2ADJB 1K3ZA 3GIVA 2X4NA 2DQIH 5J89A 2F5BH 3NPZB 3TNMB 4LHUD 2VJXA 1CE1L 3KDMA 5C07A 4OUOA 4OLWL 3D0LA 4PREA 2QL1A 1S7WA 2F58H 3D18B 4DOHE 1DBJH 5K9QI 1ZWIB 1UB6B 1RFDH 4QKXB 4HUWB 2NY2B 5FGCE 1YZZA 1MCIA 2VLRB 5C2BH 1QKZH 5J6HA 2VKXA 1DUYB 4EUPH 2VZVA 2Z31D 5D6DA 1MELA 1UH4A 4NZRH 3MGTB 3S96A 2ICEB 4PJ5E 12E8L 4Z78A 3PP3K 5C09B 4Y88A 4GBXB 4KZDL 1E28A 1BFSA 3BXNB 2HVKB 1AR1C 3C2AH 5HHQB 2VLJE 1WSST 4PRHE 4N0RA 3MJ6A 3U9UA 4U7SA 5CZXD 3LRSB 1TCMA 2CLVA 4NJAH 5EU6B 4MA1B 1JTPA 4Z7OE 3WFDH 5L2KD 4P48A 4JPVL 4FABH 3WV0A 1DZBA 2ZJSL 2D7QA 4P2RB 4R97B 4TPRL 3SJVA 4NNXA 1TJIL 4DOHB 1P1ZA 2A73A 4JFEA 3GJEA 4PJCA 1W72L 2HFTA 3LZFH 4R4NC 4MJ2A 3BPNB 2QQLH 3SE8L 1I1FA 2J8OA 3CDGA 8CGTA 1ZA6B 4Y4KC 3LKRB 5CZVL 4M62H 1D9KC 3C6LB 2HN7B 2XZQH 3TPKA 5BRZE 1MHCB 1EMTH 4ISVA 3QPQD 1G7PA 1V7NL 4NSKB 1I7UB 2Q8AH 4FFZH 3T3PE 2AJVH 3MXWH 2QSCH 2WBJA 5B22A 1C5CH 2R1XA 1KCUL 4LBEB 2IANE 1INDH 3EJYC 4PJHF 5LCVH 3QDGB 3V5KB 4QXWA 1T03H 3EGSA 5TH2A 3DSFL 3G08A 4G6KL 4JRWA 4WI2A 4QRTA 4PR5B 4KH2A 5C0GB 1MRCH 4G7VH 4I18C 5JA8B 3K4AA 4ODWB 4I3GA 2W59A 4ZMAT 3QA3B 5E99L 1UB5A 4JFXA 3CSYA 2R8SL 3QEQA 3R0NA 3B43A 4R6UA 4NRXA 4Y5YB 5KSVA 2R0ZH 1S7XA 4AEHL 3LCYA 2X10A 5EG6C 5GGVY 4GKZB 3MYJB 4H25A 4Z7QF 2ARWA 1OD9A 4C54A 3ARBC 2EDRA 4K9EL 3QUKB 2AJXL 1XAUA 3GSNA 1W8NA 1CDHA 4HC1H 4YGVA 1UG9A 3BGFC 4UMGA 4OZIF 4M9PA 4RGMB 4PGEA 5ITBH 2PTTB 3A0OA 1ADQH 4AG4L 3O6FA 5GS1C 4CDGC 1P2CA 4X7TA 3TA3D 1FNHA 2NX5D 3KLSA 1Z9OA 4M5ZH 4XXCA 3UTPE 3MLRL 5HI4C 5F9OL 4YX2L 3LIZL 1G9MH 4NFBA 3PWVA 3GJFH 1QRKA 4YXHL 4NPYA 1H8OA 3LN9A 3P30L 3KYKH 2DKMA 2DQTH 3BI9X 4PRIA 5FV1L 2G2RA 2BNUB 1KG0A 2CGRL 2CKBA 3RWHB 4X6BA 3DRTB 5D7KE 2FX9H 4JZOB 2GSGA 4EEEA 1QSFB 2HA1A 5CD5D 4CMMB 3DO7A 5E8EB 1J1OH 3C87A 1YMMD 2EXYD 3BD5A 4XWGH 5E8PA 1U8JB 1XF3A 3IJYA 2WAHA 2XKNB 4PJDF 1JPGB 5I9QB 4M93B 3BQUA 3QFJD 1G9MC 5EWIH 3VCLB 4QRUB 2CDFA 3CFBB 3UTZB 2YUWA 3GSUA 2FBJL 5DSCA 1NAMA 4ZPVA 1BVKB 2FRGP 1EFXA 3THML 3WO3B 1JI2A 4OD3L 5KSBE 1BQHA 1NUGA 1JGUH 1K2DB 2O5YH 5GRUH 5FKPB 4Y4FD 3ZKNC 4HQQH 1WFNA 1RY7B 4PRNB 4M61A 1OCWH 1YJDC 3ZHDA 2JB6B 3OXRA 4JFQA 4P0DA 4JAMA 5T1KA 3TGXA 1RZKC 1AQDB 1VGEH 4ZDHB 5AAWA 2BSTB 3SE4C 1UM5L 3E6FB 5DJ2A 2OTUA 5K9JH 5DA4A 1PAMA 1EXUB 2NW2B 1S5HA 5CJ8A 4D3CH 3O6MH 3P4NB 4U1IA 3SDXB 1OGAB 1CFTB 2HLFC 4HLJA 4PG2C 1C5BL 4HWEH 4L1DA 4PRDB 5GGRY 4ZYKB 1H8NA 1J8HB 1KUMA 2DN7A 4ZXBD 5BXFB 2X89A 1MFDH 5GRXG 1S9YB 5ANMB 3QWRA 4MD0A 5DRXA 1A1NB 4AEIH 5JW4M 2VDOL 3CD4A 3RIAF 2AV7B 5C0RL 3WMSA 4GSDH 5DD3L 4QHUB 3SQOL 5FYJU 3V4VL 3X3GL 1WBZB 3W2DL 1DANT 3V95A 3O3BB 2R2CA 4WHCA 1VENA 2EDJA 1JK8B 4XNZC 2VDPL 1HHGA 3P3YA 3FO0H 1VFMA 2P45B 4FFZL 2J8HA 4OBSA 5E5RB 2A74B 1XGUA 4Y4FC 3GB7B 5GSRB 4PB0H 3K4ZA 1FHGA 1M1SA 2VO5A 5CUSL 3EDKA 4HD9A 3KR3L 2P4AB 3HUJE 15C8H 5IB5B 2DWEB 3CCHA 5BMFL 1FNAA 1JRHL 4IIQB 2CLZA 4AENB 2EE9A 3WIHA 4JVPA 4PJBF 1TPXC 2KPNA 3DTXB 1AC0A 1CLOH 4XCCL 3FB8A 5BQ7A 2EDOA 4Q6IC 3DX7A 3QJHA 4WGWB 1PZ5A 4RDQG 3SDAD 3RVTD 4MYWB 1K4DA 4PJ7B 3FQRB 5I1AB 1AIFA 1EHLH 5HGAA 3CVIL 4WUUA 2G60L 3QQNA 1FQ9C 1G9NC 3BP4B 5I1DA 3WIHL 4Y5VA 1NUDA 1R3IH 3HN3A 1OAYL 3RGVD 5EUKA 3ULSB 2DQHH 2DDQH 1BD2D 1J0KA 4NQSA 1IKNC 3ULVE 1J86A 3CXHJ 4XP1L 5H94B 1DEEA 1DQLH 1BAFL 1A22B 2A6JB 5IK3A 1AR2A 1AFVL 3CXHK 4LVNC 4R4ND 5DHVH 5EU6E 3ARYA 5C86A 4GXUN 1NANH 3WNNA 4AM0B 1NCUA 4LPYA 1CE1H 5ESAB 5DQ9B 3DBXA 4KI5C 3BP6B 3IJHA 2A6KB 4U2YA 4BFGA 4WJ5B 3G6AB 2HVJB 2Z93B 4X6DA 4F8QA 2XQBH 3BKYL 3WUZA 1C12A 2H41A 4OIIH 2R0LL 2EYTA 4IOIB 1B0WA 1RZ7L 4OZ4A 4WEBH 3VFWA 5FUOL 5KS9F 5KVGH 3QXVA 3I75B 3UC0L 1CDYA 4LDOB 3RKDC 4DN4L 4W70A 5F88B 2WSKA 4HJJL 5GJSL 3BDXA 3QZWG 3B9KB 5GGQL 1HEZB 2NY7L 3D25A 4WTWA 3PDOB 4K3EH 1XGPA 3OKNB 4OB5H 3MLTA 4ZFGL 3O0RL 4PB0L 4G3YH 4W81A 4NKOA 4I0PA 5IHZB 1MRFL 3QIUB 1WAAE 1JWSB 1ZTXL 1UKQA 4BFEA 3HNSL 3NCEB 3BH8B 2M26A 2Z8RA 2JCCF 3VU2A 1KJ2A 3MA9L 3W11D 5I75B 1SYVB 3TIDB 3NIFE 3ZDXF 1EGJH 1RJLB 2OXHA 1SQ2N 2LTQC 2R29H 5GISL 4L3CA 3P77A 4ZFOA 1LWRA 5D6DC 3H9ZA 1D5MB 4P2RD 1DQTA 3D85B 1DUZA 2J8UE 2V17L 1LILA 2VDNL 5TPWH 3HG1D 2EH8L 4FQXD 2HRLA 2CK0L 3MV9B 5BV7C 3E2HC 3FFCB 1BGXH 5C71A 1KCLA 3U36B 1GGBH 1HK6A 3O2DH 1JNLH 2FH8A 4EI5B 3GM0A 5D8JH 5K9OB 4M3JA 1GZQA 4QTIL 5DJXB 1Q72L 4ZXBB 4CDHA 4HWNA 1I1YB 1DQQB 4P3CH 1F02I 3VRJA 5I17B 2C7UA 4U6VH 4W4NA 1PG7L 5JTWA 4W68A 4F7PB 4U1MB 1DSFL 4NWUH 1U91A 2VLRA 3MPCA 2BK8A 2YK1L 5DEFB 2DICA 3MLSL 2JK5B 1RQ5A 4PJ9B 5DR5H 3UAJC 3TPUA 2W38A 4JQVC 2V7HA 5FHBL 3MRRB 2D7OA 4LSRH 3OSKA 1NGPH 1VSCA 2YPKA 2Y9RT 3HCVB 4PJFF 3B9AA 4HIHB 5ELIA 4YLQT 3O9WD 4IRZH 2J5LB 3R1GL 1X5ZA 2X4RB 1YMME 1OT2A 1S7VA 3O3DA 4JPVH 4FABL 4J12A 3L7FA 5L8KB 4G7YL 4Z95H 5ANME 1I8IB 1TENA 4I2XA 1UFUA 3EO9L 1Y0LB 4ZQKA 1Y6KR 5KG9B 4J3TA 3MR9B 3N85H 1P69B 4NIKB 4DW2L 1BWWA 5ALBH 4R97C 1S9WB 2VLJD 4OM1H 4E0RB 1IGIH 1PY9A 1I1FB 3CDGB 2FX9L 2Y23A 4S0TD 3I02B 4UZGA 5FV2A 3WUWA 3MUGA 5ICXB 1KB5H 4KXZH 4PLNC 2DQHL 2XG4A 3DPBA 3IXAB 4WFGE 1I8MA 1ZHKA 2CUMA 4HC1L 1G7PB 2B1AH 3P11H 4NSKA 2IPUG 3HAEB 1D9KB 5JR1L 5F1NB 1MQKH 4MAYC 2WBJB 3CU1A 1YN6A 1IGCL 1RZFL 3EYUH 5E03A 5E6YA 1N0LA 1S7UA 3RZCC 1KB5A 3OAYH 3G08B 3RX7A 1MREL 4MQXD 2X41A 3ETBF 4KJYB 2EH8H 3RAJH 5F7WC 1EAPA 5IMMA 3VFMB 2GW5A 1A7RH 4IEFB 4OT1L 4YHKH 4QRRD 1BVLB 1J18A 1N3NB 4LOUD 5CSZA 2KBGA 1ZHNA 2JCCE 5JQ6L 4DGVL 2I5YH 2X4TB 1HKLH 3WN5B 5MI0B 4PJGA 4LVEA 1HHIA 3EZ8A 4N5ED 3HI1B 4XZUA 4J6RL 3SKMA 1D5BA 4P2RE 2OP4H 4NM4H 4XC3L 1PSKH 1QNZH 2DYPA 3X3FL 4L5FH 4PD4K 3OJDB 3TH2T 5H2BA 2E7HA 3B9KD 4K8RD 2H32B 3N1MC 3O0RH 4Q9RH 5GGSB 1FYTD 3M17A 1JHLL 4JFOA 4WHTA 5D7JC 3W2DH 4DUXA 3CUPB 4YHNA 2J4WH 3M07A 3VD4A 2N1KA 4XHQA 3CVHL 5J6GB 4NUGL 3ARFA 1QBML 3SJVE 1ZMYA 4R7DA 3MRCA 4UQ2B 5HVFB 3CFDB 3UTPD 1ZVSA 1V3MA 3KLHC 4JFPB 1WIOA 2H9GA 4X6BB 3ZE0F 3ESUF 4NQVB 4QLRA 1XCTA 4WI5A 5ACZA 3EHBC 3IRPX 4RA3A 3RL2B 4CMMA 5E9DE 2N4IA 5DJAA 5FA3A 3QUZB 4IMKA 1NAMH 2VIRB 3MRLB 5IFAH 1DQLL 2Y5EA 2W9EH 4ONGH 4PJ7E 2ESVE 1FL5A 4ZODA 3BUYB 5TE7H 2BFVH 1EHAA 1TZGL 2VL5A 4OGYH 2YN5A 4PYGA 3IKCA 5TGBA 1JPSH 1BP3B 5TF1H 1NGZA 3B9VA 3PP3H 4MD4B 3NAAH 2ATPB 4J3SA 4XP1H 1NAMB 2H1PH 1AO7D 4U2ZA 4ZPVB 1I1RA 1N5YH 3D1MC 4OD2B 4JFDD 4DW2H 4NWTL 5H35B 1J0JA 4IOFC 4MB5A 3D0VB 4HBCH 5J1TC 4WI9A 1HXYB 3AMLA 4HT1H 5F3HB 1R3IL 5A2FA 4OKDA 3CFKA 3T8XB 3WHXA 4Y5YA 2ZOLA 4R0LA 1J87A 4M3KB 2PNDA 3BH9B 4QF1B 3ZSTA 1I7RA 2V2XA 4GW1B 2Q8BH 3EYVB 1LP9A 4H25B 5HDQL 3TN0D 5IFAL 1BM3L 2VN7A 4K7FA 5D1ZB 4FQ1L 3VA6A 3FQWA 4WUKL 1CIUA 3MMEB 5E2VH 1QO3A 4K23L 2P5WB 2AK4E 3QEUB 4A6YA 3B9DA 5TDNB 2ZUTA 3GZKA 1ONQA 1SBBA 1IT9L 2VN4A 2YN3A 3R1GH 4OFVA 5HHMD 1CFTA 1U8OB 4PRDA 4RFOL 5DJ8A 2R1YA 5CILL 3NCYS 5E5UB 4X9FA 2V2TA 5EOQH 3L6FB 4GJTB 4H20L 4U1NB 4U6VL 1P4IH 5D4QA 1SEBB 3C08L 4L4TA 5DVOA 1L7TL 2BNUA 5KTEL 5JHLL 5E2WH 2H2PC 3HC4H 2OS7A 4FFWC 5D8JL 1QBLH 1H5BB 3HTLX 4U49A 1K8IA 2NY2C 3C6LD 1M7DA 1TZIB 2R4RL 1AXIB 3RUGE 1HHGB 3VFNB 5EBGA 4U0RC 5F3BB 5ETUB 5C6TL 4UT9L 2WNGA 5F1IA 5GS0C 3TT1H 4Y5VC 1C16B 1TVHA 1P4LB 4WI4A 5MP6H 3GMNB 4LGPB 2DQDL 4K94H 3JWDC 3MRBA 5DD0H 3HR5B 4UAOC 1T2JA 1JE6A 2CK0H 2NLJA 5D1QA 4LOUC 4Y4HA 4LEXH 1UH2A 3IFNL 4WHDA 5C0EA 5L2KE 2A83B 5CGYC 2YD3A 4C56D 2XRAL 3UAJD 1X4XA 4R96A 1S9VA 1W72B 1DQDL 2PCPA 4Q9QH 2DAVA 4JDZB 1ETZA 1FLRH 4X8XA 4RRPA 3GJFK 3NOIA 2PW1B 3NCFB 1AGFB 4S0SD 4OGXH 5J1AB 2F19H 5JIHA 5IMOB 2VXQL 4R8WL 2NY3C 4I0KA 4CNIB 2R4RH 4UUJB 3N50A 3OXRB 5F96H 4JFQB 1T5WB 3VFPB 4PPTA 1KTDA 1YEHL 2D0FA 3L3HA 4KJQD 3RDTB 3OJMB 1IGIL 1T5XA 3HB3D 2E7LC 4J2XA 1BQLL 4TVPD 3DYOA 3MV8D 2WLYA 1NCCL 1U2CA 5A2KH 1QRND 4U1IB 1NH6A 4LCIL 1FNFA 1T89C 4PJGF 3QNYA 5GGTH 5K59E 5DK2A 1R0AL 4JZJA 3FRUA 1KB9J 4HKZA 4RWYH 2VITA 1UT9A 3QFJE 5D72H 4XNYH 4RGNC 1P7QB 5FCUH 3UDWA 3DOSA 3MACH 1IC4H 4TUOB 1IGTA 5F9JB 2UY6A 4Y16C 2A1WL 3P30H 1MPAH 3MA7A 5LGJB 3GRWA 3MNWB 3PWPB 1AI1L 3CVHB 4UT7L 4TRPL 3GBLA 1CGXA 2XKSA 4ZOAA 1IRAY 4XPBL 3UJJL 4CKVX 3S35H 4NBYB 2A74A 5HYIA 1WJ3A 1PG7X 2DLFL 4G8GB 1PKQB 1M71A 1JPSL 1G7HB 1KXTB 5F6HI 1Z9MA 5ITBL 3F7RA 5KJRH 1A6TB 3VD5A 1LO4L 1TCRB 2NY2D 4F80A 1UM4L 5C0BB 1N5YL 5FO8A 4RMRA 1U92B 4KVNH 3U4EA 1FORL 5EU3B 1RIUL 4HAGA 5DFTA 4M5ZL 4NCC1 2AQ3A 4JM2D 1AXSB 1U3JA 5BQ7B 2P8PB 1KIPB 1UKSA 3ARGB 5F1SA 3TH3T 2KL6A 1P6AB 3DX7B 1T0MA 4QHMA 4AY0A 3C5ZA 1JIBA 2EO1A 1KTRL 4NN7B 2X4PA 2Y7QB 1NAML 2DWDB 3DUUB 1GHFL 3QDGE 1IGJA 4ZAKD 1RJLA 5E2TL 5HHOE 1JPST 1RIHL 2APVA 3VWKD 2BJMH 3ULUL 4K3GA 2AEWA 3HPLA 3BP4A 5I1DB 1AQKL 1G6VK 3C09C 2UVEA 4YC2B 3TN0C 4HW6A 5I9QC 3LRGA 2H26B 2NY6B 1KN4L 3DWTA 1A6WH 2ERJB 3CFJB 4UDTA 1EA9C 3F65A 1FFNA 4KMTL 1JZ8A 1MFBH 4HFWB 2XPGB 3FFCA 4KTEH 3ZYIA 1NUNB 2VMFA 3U36A 1ZVYA 1H0DA 2FIKB 5T1LB 2Z0BA 1HQRB 4V1DE 1R24B 1YNTA 5E6IA 5F7EL 3RWJB 1GZQB 5SWZA 1A6ZB 4OCXH 5DJDA 3MRDA 2YPLE 4BSVA 3S35X 2EDKA 2W60B 3EO1B 2EYTB 4BH7A 5EOTB 3FFCD 1IM9A 4U1GC 1BVZA 4ZFOL 1PJ9A 3SGEI 4UIKL 3VXSE 5BS0A 4J4PC 4LIQL 5F7DA 1BIIB 3JTSA 5EBLB 1WZ1H 3KDMB 5C07B 1QSED 3R06B 4ELMB 2FL5A 3QHTC 5GRYA 1SJEA 3FQTA 1RK1B 4NQED 2C3VB 4HIHA 1NGYA 4OCNC 4HUWA 35C8L 1JP5A 3MREA 3WDIA 3QPXL 4X4ME 2WANA 1S7VB 4O9HH 4J8RA 3C5ZD 3DMMB 2R56H 1BD2E 1B4RA 1UM4H 1YEDA 5FK9B 1I7ZA 1Y0LA 5I1IL 4Z78B 3T2OA 1KJ2B 1HOCB 3HLAA 4HPOL 3H3PH 1ROWA 4PJEB 3I2CL 2GJ6A 3F12A 3VE0A 5MENE 3P77B 1ED3B 2OR8A 2CLVB 5EU6A 1CD1A 3G6JF 1WK0A 4QRSA 3KPMB 5I73B 3KXFE 1YUHA 3ROOA 1PW3A 3RVVC 4CUCA 3U82B 2OR7A 3EO9H 3GMPA 4BZ2H 3B6SA 4AMKH 4TQEH 3MV9A 1ZLWK 5C70A 4GUPA 1ZLVK 4U1LA 2NY4B 3MRIB 1OAKL 4HX1B 4U1JB 3SGKA 5HTSA 5HYJD 5K9KB 4MA7H 1PD6A 2C5DC 4OZGA 4WY7H 3TJEL 3CSPA 3MLSH 3LKRA 4D0DA 2YD8A 1KEMH 1JHKH 2KKQA 4XHJC 5B4MD 1MHCA 2C7UB 3L5HA 1QLRA 5JW5A 4G43B 3UXFA 4F7PA 4RMUA 2XFXA 1BFVH 5FIEA 4YX2H 5KVMC 5EZOH 4L29A 5C08B 4LBEA 4GAYA 1MH5B 1NFDE 4K3JH 3LKNA 4KRPD 2DI9A 5BJTA 3G04B 4O58H 3T0XA 2DTMH 3KPSB 1H15A 4M6ML 4TYUA 4XC1L 4KROC 2QR0A 1G6RB 1Q9LA 3OZ9L 3MLRH 3MBED 3QUYB 2X4SB 4Y1AB 3EDDA 5TF1L 3W0WA 2AXFB 3LVEA 1J12A 4M6NL 5F1OB 4P2OA 4WHTB 4X80H 1I9RH 4Z7WE 1HH9A 5E4EC 4RMQA 3QI9C 3IFNH 1J1XH 3WL9B 2AJZA 2GY7B 1ES0A 4PRHD 2Z4QA 2NY5H 3GRWL 1ZA3A 1OGAD 1MNUH 1ZVSB 4MMZC 2OL3L 1JHTB 4LU5L 3BX7C 2JJTA 4RCAA 4MMXC 4PGEB 3T2QA 2H9GB 4IJ3B 1YMHA 3RWIA 1LO0L 4L3EB 1SJHB 4WU5A 4U05A 3WUWB 3TV3H 2NX5E 1RZJC 5ITFB 1ZHKB 1FL5B 5B38G 1XR9A 3UTSA 3D5OF 5HI4D 3LS4L 2W0LA 2FB4L 3BD4A 2JCCB 1RUQL 1T04A 4ODUB 5ESQA 5GS0H 3T2PA 4LSPL 4FQHB 5HY9B 1FCCA 1LDPL 4HDIB 3ZT7A 4RA0C 3ES6A 1CFBA 2X7LB 2FX7H 4IHOA 1CL7H 4F2MA 5FOBB 5FAAA 2VR5A 1MCPH 3NFPA 1EEUA 4TVPE 4JDTL 1CDCA 4E42A 1FL3B 3VXUE 1MHPL 5F7FA 3GHBL 1F2QA 2ITCB 3F62A 1T3FB 1JGLL 2JJWA 3CFKB 4XPTH 1JPGA 3K2MC 2WWMC 4JFDB 5C6PB 3BQUB 5M95B 3GJFB 3DHJA 1MFNA 3PJSA 5C0AE 3DUSB 3WFHB 4QRUA 5L9DH 3UMTA 1BM3H 1FO0H 4GT7A 3TA3B 3PWUA 5DJ0A 2DYPB 2XA8L 3RIAK 3VG9C 3MMEA 4BSJA 2ZPKL 1QO3B 3K8KA 3PGCB 3RNQA 3F5WA 5F6HJ 4RGNE 3VFRB 3QO0A 4NN6C 1BFOA 3M17B 4N8CL 5D7LB 3TN0A 1S8DB 1EJOH 4D9QD 4YHNB 5FHAH 1K85A 5D1XB 5EBWB 2QSTA 1D6VL 4QXUL 2R39A 2OJZL 5SX4I 4KRPB 4BH8B 1J8KA 5BZWA 4PRBB 2X09A 4FXGA 4CVXB 2AGJL 1HHJA 1S5HB 1E6JL 3SDXA 4M48L 3S3PA 2OZ4A 5IF0A 3VMPA 3SHSA 3BZEA 1LO5A 2ESVD 1UQSB 3ZDZE 3KYMB 4QHKI 5D2LF 1NGXB 2FNBA 4KZEH 5DURB 3X13B 4L9DA 3UTQB 5D7LE 3FT3A 1ORSA 4KKAD 3QIUC 1D5XB 5E4IA 5AEAA 4QYOA 4XVJL 4MA7L 1YQVL 4OCXL 5DXWA 3BKML 2V2WA 1CU4H 4YHMH 4NN5C 4J4PD 5TE4L 4DCQB 5L9DL 4YFLI 5IEKA 1OAUL 5LQBH 4Z7QE 4JVWA 3K1KC 3RZCD 1B6DA 2HT3C 4UNTA 3UTSD 3D0VA 4LSPH 2VQ1B 5HGHB 5I1GL 3X3GH 2V5MA 3EFFB 5J3HC 4Z77B 1UXSB 5E2JA 2R2BA 2B0SL 1U8KB 4QTHA 1KPRA 4HMCA 5FYJL 5L2KB 5F96L 5DA0B 4HPOH 4AYFA 3KYAA 3MRQA 1MWAB 1T6WA 2DM4A 3DV4B 3MOQA 2BCKA 4NNYA 4EI5C 1G7JB 3DTXA 4PRHA 5TDNA 2Y07H 4NDMB 4R2GC 2IH1A 4ZXBC 2XQBL 3BKYH 4MAYB 3W82A 1ACZA 1A0QL 4U31A 1A3LL 2R9HD 4X99B 1NCDL 5JNYA 4WTXA 2BZDA 3LPGA 2HJFA 2ZUVA 1OOAA 1KIQA 3HE7D 2QQKH 2IAND 3W0WD 5DK2B 3QI9D 1OSZB 3VXSD 4U6YA 2ZP0T 3HRZB 4EUPG 3FRUB 3WDJA 1EK3A 5EIVA 4PJ9C 3PV6A 3EYUL 3JBG7 2CXKA 1S7RA 3SKOA 4HKBA 4KTDL 3BKJL 1YEJH 2C4FT 1B0GB 1R3HB 1LE5B 3JTTB 4NO3B 4RMTA 3Q5OA 4JN1H 4OLEA 3MZGB 4NQSB 4OCRL 3KLAB 3VXRD 5KN5A 3EYOB 2YWZA 4UDUB 4JQIH 4YPJA 1K6QH 4YZFF 3K7UA 3TBWA 3EAKA 3IDGA 4JY5L 4LVNB 3IFOB 4C83B 1M71B 1UJTA 3QQ4B 3HC3H 3DXAB 5ESAA 4KQ3H 3MV7D 3WLWC 4F8TA 3ZZ1A 4PJ5B 4AQOA 4CBPA 1G7QA 3MLVL 3SCMD 2YA1A 3PABA 4JGJA 3BE1H 1CI5A 2F5BL 5C0EB 1XCQA 3VXTA 1NSNL 1DP0A 5BOZG 3WD5L 2ZCLH 1CK0L 5KVGL 2X1PA 4EN3A 1XIWB 1DTUA 4JDZA 4L4TE 5IQ7L 4N8VG 5CEXB 1REIA 1P5VA 5E5MB 4U33A 5EU4A 2YBRB 1YY8A 1KB9K 2R0LH 4BM7A 2ED9A 5DS8A 4OGZA 3CX5K 4JM2B 4G42A 5EO0A 5I30L 1TVDA 3LV3B 5KVFH 3ARGD 5FYKL 4DJMA 3SGDI 3HUJA 3TWCH 3PGDA 4X6DE 3T0AA 1FFRA 1AY1L 1FVDA 1OP3K 1ITCA 4R3SA 5IBTH 4NKDA 4L8DB 2VLJB 3MODL 4KI5F 4UDTB 3O9WB 3VXNB 1MIML 4ONOA 2ICWB 1ZVHA 1JNLL 3RWGA 1IAOA 3FRPA 2FIKA 5T1LA 1JL8A 2HKHL 1BOYA 1D3CA 1CLZH 4JKPH 5DMJB 3U0PA 1DUYA 4UOJA 3G5YB 3ABZA 5LBSL 4LEXL 2GQHA 3S5LA 1DN0B 2EDFA 2ICEA 4X0KA 3IB4A 4JM4H 4W6YB 4F7TA 1LK3H 4NYLB 1RURH 3GUTA 4X6EB 3TVMD 3BZ4B 4ODSH 1U8HA 3MJ9H 1FV1A 4G7VL 5DK3A 4U3CA 2HTLC 5HDLA 1I1CA 5C7XH 1X5FA 2ADIB 4ZUTB 2HLAB 2GSIA 2J6EH 3L3OA 5E6ID 5IKCA 1DE4A 5K9OA 3BIKA 3IT8D 3LY6A 1A6TA 4P23D 1QBMH 5DRWA 2NR6D 4P2RA 5CD5C 5GIRB 3VRJB 5C0BA 3MFFA 5I17A 5FO8B 3FAXA 4H8WC 1K5NA 2C3VA 4JFEB 5GRUL 1YEGH 2HJLB 4ENED 3OB8A 2JLLA 4XPAH 3DSFH 4JKMA 4XH2B 1TMCB 3MREB 4H1LG 2X4UA 4OLZL 5FXCH 4JG1L 1BBDH 1NBYA 4EXKA 1FLTX 3QULA 2IAMD 5K33A 3VXRB 1A6WL 1CICC 3R0MA 1T0MB 5EZLB 1I7ZB 1F8TL 4BQBA 5IHUL 5JORA 3DUUA 4ZAKA 5FF6B 5BO1L 1VPOH 2GJ6B 1QLFB 5IW3A 4K7PH 2FZ3A 1P7HL 1U93B 1FLRL 4D2NA 1X4ZA 2VZ3A 3EGSB 5TH2B 5HHPB 1N7MH 4AT6B 1QYGH 1KGCE 2VDOH 3C2AL 5C0GA 4ZTOL 1YQVH 1I8IA 3GMPB 4E41A 3QA3A 1FZKA 4LFHD 3PIQB 2EE6A 4ZQKB 2WW8A 3UTTE 5KG9A 5IB4A 2DMCA 4P99A 1JNJA 1ZT4B 1IAIM 1LE9B 1SYSA 4MJ6A 4J3XA 1IAIL 1MI5A 4ONFL 2NPLX 1CXHA 1N6UA 3RL1B 3BHBA 4H1LB 4JRXA 5I8OH 3GEWB 3VW3L 4HZAA 2DJUA 3BN3B 1XF4A 1V3JA 2F54E 3EBAA 5I71B 3F7VB 5J0BA 1GPOH 3LHPH 4KJWC 4XAKD 1Z3GH 3EO1A 1WICA 3O6LL 5E8DH 1E4JA 3GO1H 2HJKB 5KSAD 2BNRB 5E56A 3QRGH 5F9WB 3SKNA 4OI8A 4XCFH 3WIFB 2XTJD 1NC2A 3VFMA 3FL7A 4OZHA 3RGVA 3BRFA 2ATKB 5JUEH 2QR0B 1MLBB 3SKJH 5CSZB 5E08L 4NQDE 1CK0H 4JGUA 3EOYG 2NY0D 1Q9WA 3HS0B 4XNXH 4XPFL 4M02A 1E27B 3HMXA 2AP2A 3VXQB 1SM3H 3QIBA 1U8QA 1HYSD 5DYOB 4WENB 1T6VN 1HOCA 3HC3L 3HLAB 1A02N 4WNQB 4XXCC 2MCG1 1VCAA 4ETQA 3UTTA 3FQNA 2BC4A 4BJLA 4U1HA 5JHDD 2F5AH 4JQIL 3T0ED 5GGSA 4I48A 1QNZL 4I0PC 2DL9A 1P4BH 2F53A 2W91A 2GEEA 3GSUB 4D9LL 1YEIH 5BVPL 1TQCC 3JVGA 4G6FD 3GMOB 3T3PF 3OHXB 4OLUL 1UXWB 2N7AA 4O9HL 2EE2A 4M5YH 3MCKA 4G9FB 4Y4HD 5D1QD 5CP3A 3K46A 2XTLA 5GS2H 5T5FL 3FB6B 3PGFL 4FHBD 43CAB 3V6FA 2UVFA 4F2MB 2AKRA 5DFVC 3SY0B 2BFVL 3MRLA 3CFCH 1OF2B 5EU7C 1KLFA 4HUMB 4M43H 2IBGA 1FL3A 4PRPE 3B5HA 2DQCL 2NX5B 2FH6A 5ISZD 1KEGH 3V2AR 2YXMA 2NMSA 4WO4D 3TBYA 3IKCB 5TGBB 4P2YA 4PGCA 3BEVA 1XGTB 4YDIH 3RIFK 5BW7A 2WIIB 3RRQA 1KYOK 5DC9B 1OCWL 4F37F 4OD2A 4PUBH 1QZ1A 3AVEA 4YC2C 4NBZB 1A1NA 1G6RA 1ZE3C 1I7TB 1C7SA 3VFRA 5GZNC 1FN4B 5GJTH 5JZ7D 3T0EC 4PJFA 5SX4H 3KPLA 5DUMH 5FM5O 1AE6H 1V05A 3BPCA 4XCNB 1U8MB 4YK4B 2VR4A 2E6JA 4G6JL 4TUJA 1L4IA 2VWEC 1QSFD 4LKXB 3HC4L 5GGSY 2CDEA 3V8OA 2F53D 3BO8A 4D94A 4GMTL 4JFFB 3U79A 4JFFE 5E94B 4XVJH 5I19H 4AJ0A 1NAKL 5JHDA 3TO2A 1F3JB 2IH3B 2B2XL 4OFYD 1EHXA 2IANB 4GLRH 4JPKH 3DUHA 2BRRH 1UQSA 3U7YL 4D8PA 3GMQB 2J88L 5C3LD 4M1GH 3BYTA 4JR9H 1NGXA 4ZD3L 4MNQB 1A3QA 3W11C 4EI5D 3SDYH 5DFWH 2A9MH 4LNVA 1V8HA 5I76B 3VDAA 3GKWH 1SY6A 3LPWA 1KCRH 1MLCB 1A21A 4DFHA 1G1CA 1JGEB 4YNYA 1CGYA 3T0WA 5H37H 5CJ5A 3MTRA 4HKJA 4W6XB 3OKLB 4UTAH 1KJMB 5F3BA 5HGAB 1JNNL 5DURD 5KSAA 5DUBA 2EICA 4I2XE 1BZQK 5D1ZD 5DK0A 1HNGA 1HYRC 4MSWA 4WW1A 3GMNA 2G60H 2Z8VC 2R2BB 3HHRB 4JCLA 1WTGT 4NC1E 1YNLL 4NQXA 4LVOC 1C7TA 2EC9U 1BZ9A 2DLTA 5HJ3B 5IGXL 2NLJB 2CDGB 5D1QB 1FL6B 3TA3A 5T3XD 3ARDD 2CJUL 3QUXA 5IOPA 1QFHA 1VA9A 1WFTA 4G7YH 3VWKB 4N0FA 4FG6D 2M2DA 4EJ1C 5JOPD 1JGVL 2IH1B 3HMXH 4KRLB 2NXYB 1J0ZA 3GSXA 3P9LB 4UV4L 1PYWA 1JNHA 3DBXB 1R3LA 3S7GA 1OSPL 2BRRL 3BP6A 4RISL 3BPLC 1AGFA 2MKWA 4MQTB 5JXEA 3HZKA 1MHHB 4ZOBA 3RGHA 3Q2CA 1JHLH 3RWDB 1F3DH 3KG5A 3WKNA 4F57L 5DGRA 1HXMA 1EJ6A 2OQJA 2ZSVA 3QEQD 4QGYA 2AQ2A 3MXVH 4NQDB 4HKBB 3UYRH 4QRRB 1F4AA 2EEBA 3UDWC 1FCGA 4ODVL 1BMGA 1KN4H 1D6EA 2MMXA 3SE9L 1DLHA 5HHOA 5SWZE 1BEYH 1SJVA 3GIZL 3VFGL 3KYMA 4HFUH 2CIKB 5D7LD 3IAGC 2YPLA 4Y2DA 4M62L 4LGSB 3UTQA 2NZIA 2OJEB 3MLZH 3OKNA 1X5IA 1T1ZB 3VD9A 2VITB 5INCB 2DBJA 3QQ4A 1A1OB 5C0AD 4HG4J 1FJ1A 4PP1C 3BH8A 1Q0YL 5F9JA 4HS3A 4APQD 4KDTC 1QR1A 3CAFA 3MLUH 3QR2A 1NQBA 1QQDA 5IW6B 1XF2A 5LGJA 1GIGL 2FJHB 2V5TA 3VXTB 3HZMA 5HGBA 3UBXA 2RBLA 3OR6A 4AEFA 3VH8B 3EJJX 1KENL 1R3KA 2VKWA 1S78C 2R1WA 4HIXL 1NDGA 3SJVD 4KZDH 4UB0L 1PKQA 1NMCB 1OPGH 2JIXA 1MQKL 5CJBA 1B4JH 3RUGF 1HIMH 4GXUM 1MREH 2NZ9D 2YD9A 3QQ9D 5DS8B 2EKSB 4BKLB 1XF5A 3MV8B 3C8KA 4AH2B 5IJVA 1RJZA 4Y8DC 2CO7B 2A6DB 5IJKA 4YHLL 4PV8B 4WTZA 4ZS6C 2ADFL 1OM3H 1RFDL 1P4IL 1JPTH 5B8CC 2FD6L 4JREB 2A0LD 4R3SB 5D7SH 3ARGC 3OAUH 1J11A 3GBNL 4FQJH 3O9WA 4ENEC 2KZWA 3OQ3B 3DNKA 2DWDA 2F5AL 4U6YB 5FYKH 2YOCA 4EVNB 3BD3A 2NR6C 1MCKA 5EZIL 2DIJA 1P7KA 4B53A 2FATL 2HWZH 4M8QB 3I6GB 1M7IA 3MOBH 4YBQD 1JPFA 1M6OB 4YUEL 1G7MA 3LEVH 3KPSE 4LAJH 4P2QD 1NGQL 1JMXA 4GG6E 2DM7A 2VXSL 3N9GL 1F6FB 1NFIA 4JHZA 4WFHD 5IT2H 4LLAA 4LASL 4YDVA 5F71A 4XNMA 3H9SB 4LCUB 2YSSA 3L5XL 3O6KH 1NSNH 2VAJA 4UDUA 1IQDA 4XP5L 4KK5D 1AP2B 1MSPA 2D2OA 3MCLH 4EN3D 2LU3A 2EC9T 3QUXC 1DSFH 1L9NA 5GGVH 5JOPE 5CMAB 1U3HB 5F44A 1I1AB 1AD9A 5D2LA 3CFIC 3L3JB 2DBLL 2IBBA 4MHHG 3RNKA 1G7QB 1CGVA 2JIXD 4EIGB 3MRDB 2XNAB 3NAAL 4O02L 5EOCL 1UENA 1RK0B 4DKDC 2ED8A 3HG1A 5CFHA 4LEOA 5BS0E 3R8BB 1F4YL 5EU5A 3CZFB 5LWYL 1HHKB 3QULB 3VXRA 5C9JB 5TE7L 1YY8B 3WJJA 3Q48A 4LSTH 3TFKC 2YD5A 4NHCL 4JPIA 3ECBB 2ICES 3RUGA 1SJEB 1AKJD 3PV7A 4ETYA 1F90L 4H8WL 1CS6A 1YN6B 1IEHA 5FO7A 4LLQA 1S7UB 1KB5B 3HI5H 4N90E 1V7MH 2AW2A 5DD5H 4CN1A 3VXMD 4F7EA 1B0RB 1QA9B 5HHOD 2WWKT 2QTEA 1TETH 4YDKH 2ZKHH 1YA5A 2AXJA 3HE7A 3TYGH 5AD0A 3VGBA 3KPOA 4NBXB 5IVXA 1Q1JL 4MCYA 4ZTPL 1CBVH 3AS1A 5JHLH 1IAOB 4XVTH 3BEWB 4XBPB 3TP4A 1CF8L 4WV1A 4X6FA 4ZFZB 1T03L 4OD3H 1UZ6F 2CD0A 4MXQD 4U1SB 3O41B 5FFLA 5JXED 1D5ZB 4FXLA 3TA3C 3U7WH 4YK4C 4JG0L 3S5LB 3SE9H 3NZ8A 1DBAL 4DAGH 4LLMB 5E2WL 2VAAA 1Q9OA 2X4QA 3VWJB 2P5EE 3GMMA 2G9HA 3LEXA 1QG3A 4OLZH 1MWAL 5DQJB 3B6SB 2CLRA 4OQTA 4OD1H 2E8ZA 1EUTA 5H2BB 1DBKH 3T0VA 2H32A 2CIIB 3TJHC 3ARDA 1R5IA 1Y18B 5HDBF 4JFOB 5IBUG 4D0DB 1A6VH 1A7QL 5IKCB 4ZUWB 2YRPA 4UV7H 2HTKC 4NGHH 3PQYD 5J6GA 1JFQL 4PJ8D 4LCYA 2VTFA 3SDDA 1WV7T 2FHFA 2ZJSH 4BYHA 3MFFB 2NY3B 4J4PA 4XNQA 1ZWIA 1MLBA 1F5WA 4O51A 5CJXA 1DBMH 1G84A 4WDIB 3D3VB 4G5ZH 3G6DL 5KSUB 3ARBB 4Q6IA 1OP3H 1IC5H 4NQVA 5ACZB 2ADFH 1LK3L 1FORH 5DJAB 3RVUC 2AJUL 2E9BA 1UM6L 2XTJE 4OZHF 4PJBA 5EZLA 3KLDA 1FAIL 1YEKL 2ESVA 1EDQA 3KPSA 1G1YA 3TLRA 1WBYB 2BVOB 1C5DA 2FZ3B 4B5EA 5F21B 1DQJA 2IPKA 1IBGL 2J2ZA 4CW1A 5HYSB 4TNWF 2NY6D 2ATPA 3N85L 4M7ZC 2B20A 4HUXB 1YJDL 4LPCA 2FECI 4HWBL 4PLJD 3OPZH 1I8LC 4N1EA 1U6AL 3OKDB 3LOWA 4NNXB 1F11B 4XPHL 1CD9B 1Z5LB 5D72L 2R8SH 1AJ7L 4R0LB 5JA9A 1HI6B 4K3HA 2PYFA 5IQ9A 1AO7B 3SY0A 1TVBA 3NN8A 3F7QA 5ACMA 1XF4B 4I77H 4OV5A 4CADA 3B5TA 3UTSB 2R2HA 4MJ5A 4S1RH 1WCQA 1NMAH 4NRZB 1ZHBA 2R23B 4H88L 4LKCA 3DURA 4LSDA 4PTUA 1MEXH 1ZSDB 1A5FL 4OKVA 1TNNA 2BVTA 4HHAB 3CXDH 3CH8A 3FMGL 1X5AA 3ES6B 4OFPA 2X7LA 4IHOB 3SKNB 5AZ2L 5IHBA 3RFZC 3KPTA 4OF5A 2COQA 5KAQF 3G6JE 3CNKA 3N06B 3MUY1 2XN9A 4P3DB 4QTIH 3ZE2F 3CSYB 3V79C 4Z5RB 3FO2B 5GHWH 1JZ2A 1DLFL 3IAQA 2V5RA 1U3ZA 2ZUYA 1KC5H 4I0CC 3NCCB 2OP4L 4EDXB 1A6AB 2W0FA 1BGXL 2FCBA 2C26A 4YDIL 1W0WA 4RAHA 1H3WM 1DL7L 3DUSA 4G6AD 1HKLL 3GBML 2VDLH 5EZJB 4KVCH 3VFNA 1RIHH 1H3TA 2XXMB 2E6PA 1MJ7L 3KS0H 5E1HB 1UWXH 5I8KL 3L5WB 4FP8L 2BSSA 4AEIL 2P5ED 2ZG2A 3RNQB 4CN4A 1C16A 2CRMA 4OQTH 3VRLF 1LEGA 3AM8A 3FQNB 1XH3A 3R8QA 3QFDA 3HPJB 3O3UN 1CXFA 1EGJL 4S2SB 1N0XL 2X6MA 1I8KA 3WIIH 4P57B 5J56B 3RWFB 3T0EA 4PJXF 1QACA 4P2OD 3MLZL 5I76A 4PRIB 2AEQL 2PO6D 4JANA 4KRPC 5I6XC 1WITA 3BGMB 3DX8B 1HWHB 3BW9A 1VACA 3AU1B 1KCVH 2AQ1A 3RWHA 3PHSA 5HSFA 1WISA 3FQUB 4B7IA 4LCCA 3WLBA 2X70A 4Q9BA 3S35L 3GK8H 1FZMB 4PRPD 1S78D 3T2NL 3L95A 3UC0H 3VFPA 3IXTB 4FFYL 4OZHE 5I1LB 1TFHA 5EC1B 2A1WH 2I25N 4KK5C 1YPZE 2Q1EA 2AEPH 1WWCA 4WEBL 4QYOB 3HNVH 1R5WB 2WBKA 3STZA 1OAZL 1SVZA 5HVWA 3O8XA 1AD0A 5GS2D 2EC8A 3KXFA 4N0FB 1HN1A 3H9HB 4YXKH 5D1QC 3MV9E 5HGDB 2ZUXA 2DMKA 1HDMB 5FYLE 4HBCL 3LN4A 5HYQB 1JPTL 3MV9D 1EUUA 1PY4A 2OSLA 4J1UA 4IS6A 4XCFL 3VXUA 3U0WL 1VERA 1OB1B 2P47B 4W4OA 4YXLL 5I73C 4QTHB 2NCMA 4M9OA 3MA7B 2CDEB 3DROA 3ISWA 4XI5D 4PGZA 2GJ6E 3RWCB 4X4ZA 4HJGA 1FAKT 3D2UA 2GJ6D 1MJUH 3ZSSA 1G7HA 3C9NB 5IVXF 2X1XR 1FGNL 1TDQA 4JZJC 2HJFB 5SWSB 1MJ7H 4EN3C 1U8LB 1RUKH 3KJ6L 5DRXB 1T7VA 1J1XL 1J0IA 4H26A 2JTDA 2ICCA 3T4AA 2P42B 5CWSB 3QBTB 4KKAC 2ADGB 2DI7A 1B3JA 3O2WL 3MBXL 4YNYB 1WBZA 4XNUH 5DTFB 4QRRE 4OLUH 3T65A 2WLZA 5GGTA 4KKNA 4K7PL 5I18L 2DTSA 4PY7B 5KW9H 1LEIA 5KN5B 1MRDH 3ZTNL 1X5KA 3C60C 4LMQE 4HS6A 5GGRB 3SE3C 4LDLB 1MRCL 1UJ3B 1A6UH 4N1HB 3D85D 2EKSA 5J13B 5IJVB 4I3RL 1LQSR 5FYLL 4IIQA 2XPGA 5I1CH 4P5KB 4KMTH 1RMFH 1II4E 4GBXD 4TTGA 5E2TH 3MJ8A 1FC2D 1D9KD 2CPCA 2ICWI 4V2BA 1ZT7A 2EYRA 3QQ9C 5T1MA 3X3FH 5TQ2L 4IJ3C 4LNRA 2ZUQC 4M1CD 1IAII 4MGXA 1QSEE 5IM7B 4PJHB 3JV6B 2AI0L 2BX5A 1FNEB 4RFEB 3WHE0 4BSVB 1LO3L 5AZEH 1V3KA 2GI7A 1UCBH 3HZKB 2EDLA 4Y5XC 4LARL 3RWEB 5HYJB 1XZ0A 5BCAA 2W60A 4M7JH 2YZ1A 4BH7B 5EO1A 5T1LD 1P7KB 1AC6A 4ZG1A 1JPFB 2GFBA 2VYRE 3PGDB 1H3GA 4Y0GA 4H0IA 4JRXE 3OX8A 1S3KH 1Z3GL 1IGMH 4GOSA 3H3PL 4L8DA 2BNQB 4YDVB 3FQTB 1T1WA 3A67L 3CFEA 3HZYA 1EX0A 4MCZA 3MV7B 3QIWA 3RWGB 3NABH 5HI5D 3DLQR 4XPGL 4EOWL 1KLUB 1YNLH 3LSOA 5FHAL 3GKZA 3C5SB 5CMAA 4E41E 4GG6B 4AM0A 4LHUA 3GI8H 2DM2A 3SBWA 4UTBH 4XXDB 5TFSL 3S98A 4UTAL 3RJQB 3AY4C 3FOLB 1U8NB 2A9ML 2HVJA 2Z93A 3QUYD 4UIMB 3UJTL 4YDLB 1KACB 3VH8A 3G6JB 3SGJC 4LEOB 3GNMH 4GG8A 1IC5L 4RGND 4R0LC 3FAWA 2O5XL 1OGTA 2ADIA 1QPPA 4P46A 1VKXA 1DVFD 2F58L 4PJ8B 1CR9H 1MAJA 5ADPH 3T1FB 5KAQG 1VDGA 5C0CB 2QQNH 5EO9A 5JQHC 2AVGA 1RJZB 2J7LA 3HNTH 4HXBH 1K5NB 4PP2A 4ODBD 1VFOA 1AGDB 2R0WL 4PV8A 4AMKL 2HMID 5I16A 3GI9L 4OZGB 4HWUA 2V7NA 4UAOB 3VMOA 5T33H 3DO3A 2A2QT 4PJDB 3D18A 5GS0L 2DD8L 2QQQA 5IBLC 2VLKD 2Z35A 3WXVH 3FTGB 4GO6B 4Y4FB 1CICD 1QRNA 4Z7WB 1SYVA 5T3ZD 4TSCL 4QRPA 2RCSH 1M7IB 2VQTA 3VFSA 3ESVF 2VL4A 1AGCA 3EKCA 5EFIB 1CT8A 3MGTA 4UI2A 3VXRE 4WI3A 5AUMA 2OL3B 1MNUL 1H15B 2ITDA 1JGDB 3LEXB 4N9OB 3ZKSD 5IB4B 2E9IA 3ZYOA 3A6OA 3OKKA 4FQCL 4XNMB 3BXNA 3H9SA 4LCUA 3WXWL 3VFUA 3ZKMD 4UT9H 3TIEA 2VH5H 4EI6B 3TH4T 4C4KO 1K9TA 4L4VE 4GXVL 5DUPL 3VMNA 4I5BA 1FG2A 5L8JB 1EO8H 2DQCH 3EOTH 4P5MB 1N59B 3SDXF 5IP4A 1P1ZB 5HGGS 3F6LA 3P11L 1CGTA 4PJCB 3V7MA 4JRYA 1JN6A 4G6KH 2EO9A 2LFGA 4X6CE 5HHXL 5KSUA 3IU3A 4L8CA 5FUZH 3RWIB 2PXYA 2HJKA 3CLEH 2BNRA 1HHKA 4YFDB 2FLBT 3UJJH 4HIJB 4YHZH 4Q58C 4ODVH 5B3NA 2OCFD 3L5IA 2H6PA 5EWIL 5IBLD 3OB0H 1KPUB 3CMOL 4G8GD 5MEQA 4PBVC 1NBZA 2C1PA 5D7JB 3MLPA 1G7IA 1ITBB 3CXDL 1RZ7H 5CHNA 1RAMA 4LLQB 2FR4B 4RQQB 1RHFA 5FKAB 4F7EB 3AGVA 1OAQH 1T1YB 4IRZL 4ODWA 1CXIA 5E08H 3NFPB 3UJTH 4I2XB 4GKSA 4ZSOB 3MNVA 1F45A 5HPMA 1JZ4A 5GGTL 4E42B 4LLYB 1MJJA 3OKEA 4RBPK 1QFWH 2ITCA 4GBXC 1ND0A 4YUEH 4O2EB 2X42A 2ZCKH 4JO2H 5DO2D 5FB8B 2EH7L 2P49B 5GRJH 4PGDA 4JFHE 3SDAB 5B21A 2NXZB 4FTVD 3PJSB 3K0WA 2GUOB 2F53B 1TVBB 3NN8B 2H1PL 3HI6L 2IQ9L 1NMCC 1FYTB 4J7RA 3HAEA 4DTGL 1P9MC 3WEXB 4LKCB 1WGOA 4N0CD 5KS9B 5C2BL 2LQRA 4JPWL 4HLZH 4OKVB 1R5IB 1Y18A 5C92A 5LJYH 2H2PD 3TN0B 5C0JA 5KJRL 4ONHA 1OTTD 5CKAA 3HAEH 3LKSB 4LLUA 5IESL 4KHTL 4S1QH 1FAIH 3CK0L 4XNQB 3N1PC 2VH5L 4O51B 5DQDH 4CVXA 1N4XL 1VGKB 2X4TA 4IMLB 3U2SB 3ULVC 4Z7WF 2QHLA 1FFOB 2GSGB 3QNZB 3DVGB 2DQUL 4JB9L 4R4FH 3PQYB 4DUVA 4PJAE 3FFDA 3BRDA 2BERA 2WIIA 2NY0C 3WN5C 5D9SB 2VRAA 3WJJC 2L4OA 5K59F 4HJ0D 4KK9D 3QAZB 3IDUA 3V5DA 2D7PA 3IJSA 4U6XB 1BOGA 3W9EB 1CIDA 4K8RC 2W0PA 3O3EB 1BECA 2AXHA 3BPCB 3FN0H 4CW1B 5HYSA 4TSBH 5IEKB 4PJIB 2EDEA 4J6RH 1QUNA 3ARFD 5J13C 3IS0X 4KKBC 2JKXA 4X9GA 1I85C 3X14B 2DQGH 3C60D 2FECL 2FX8L 2AJVL 1N5AA 4GSDL 1MEXL 1W72H 3LZFL 4L8BB 4BQ8A 1JWUB 4MJID 3EFFA 2FYYB 2NY5C 3ARRA 2I9TA 3FQUA 2VXVH 4Q74A 1IT9H 2F54D 3J7HA 3RAJL 2BVPA 1MFDL 2PYFB 3QHZH 3U0TA 3BP7B 1CFNB 3QUZA 1I3GH 5CZKA 4PJXA 3BKJH 5E8OA 3L95B 3QG7H 5C09E 4OV5B 4LRIC 5F7NC 1MWAA 4YQXH 3I3DA 4MJ5B 4G8GE 4O2CA 3SO3C 1NJ9A 2IEPA 4JM4L 2WINB 4MHHI 4FNLH 1A4JB 4LLWB 5DQDL 3BWAA 3S4SB 3ILPA 2DQEH 3STZB 1WZMA 1TNMA 3D6GA 1A8JH 2Q7YA 3HKFA 1IQWH 1TZHA 3WKMH 5DJZA 1DBBH 3U9PL 1F58H 3TZVA 2EDXA 1E0OB 3T09A 4RX4A 2CMRL 5IBTL 1E4XH 3I85A 4HEPG 1IKFL 3SKOB 4QHUA 2K7PA 4URTB 4IRSB 1UH3A 1YEKH 3H0TB 4OLWH 4OSUH 1JK8A 1RHHA 2FHCA 3FT2A 5CSGA 4X4YA 5C0ND 5J57B 4OLYH 4HF5H 3L5XH 3O6KL 1QEWA 4LCCC 1FNSL 3QUXB 2A77L 5IOPB 4PJ9D 1BJ1H 2DBLH 1YECL 5HVGB 1U3HC 3RWCA 2IPUK 4L3AA 1XGYL 1XGUB 3NIGE 3HE6A 3UYOD 2R2EA 5JOEA 4PY8I 4XB8A 1HINH 1UVQA 3NIFF 3ZDXE 1JVKA 1I8KB 1WQVT 3MO1A 1CLYH 4HIIB 1FZJA 5CINL 1F6AB 4NWUL 4EN3B 1DBKL 2HRPH 1KTLA 3KHQA 4MQXC 25C8H 4YHOL 3QCVL 5KSBB 1HCFX 3FB8B 2E7LA 2QLVB 3BW9B 4WV1C 2GHWB 2C3HA 3WLBB 4S1SH 5TQ0L 1JWMB 2MSPA 1RIVL 4BQCA 2R69L 2FO4B 1NCAH 3BUTA 5ESVA 3QCTH 1AGBA 4YHZL 3LV3A 5E8DL 5CEYA 4B7LA 5IB2A 2ZOKB 4PV9A 3RZWA 3FO9A 4AG4H 3TBTB 3LQAC 1N0XH 2A9NH 4NQEA 2AJSH 1RSFA 4MA8H 2DOCA 1FVDB 4LHQB 4Z76B 3Q3GB 1INEL 1FJ1B 4M4RA 1UWXK 4F9PC 3NABL 1BREA 1IAIH 2ICWA 2HMIC 1MQ8A 4Y16A 1A9BB 4X7SH 5H94A 3OXSB 3WNPA 3F8UB 4P5TB 4P5KA 1RUPH 2V6HA 1S9VB 1W72A 5CJXC 1OD7A 3QH3A 4LPUA 3W39A 2JIXB 4FQPA 4JY4B 1DN0A 1NMBH 4GW4B 2Y5TB 4JHBA 1Q9KB 1EVUA 3FFCE 4X6EA 1MIEH 4C59B 2B1AL 5IV2A 1Q8MA 3TEUA 5DGQA 4A6YL 1MVFA 4I8DA 4WWKA 3V4PH 1NCDH 3BQUC 2VWEE 5IBUB 3T08A 2WQRA 2HLAA 1QVOA 5CJQH 2ERJC 1ZT1A 3MBEC 2Y07L 4KV5F 3TNMA 3C9NA 5ICYB 5E9DD 4F7CB 2XY2A 5J8OA 3L1OL 4JDVB 2MCPL 4BQ9A 4DFIA 3MRHB 3HZYB 2R4SL 4D9LH 1SM3L 2NY7H 1GSMA 3D25B 4HIEB 1KLUA 3CMGA 2PF6A 1JBJA 1JV5A 2ORBH 3IU4H 2H3NA 4X9HA 5J6HB 2ZUWA 3T4AB 3RX5A 4U1KB 3S96B 3U7AA 3QCUH 2VC2L 3T65B 5TE6L 4NRYA 3I84A 2UYLA 3QXTA 3TBSA 3DX6A 3JV4A 2HFEB 5EU7E 2EEAA 4ZFOB 5DR5L 1J0YA 2HT4C 4Z7VB 5T5NG 2QV2A 4UT6H 1EHNA 3CX2A 3DJ9A 5F70A 3IDXH 4YBQC 3L3JA 2YEZB 1U6AH 3KS0J 2ZG3A 1I9RL 3D3VD 1FZKB 3K4DA 2AK4B 2H2SC 1IGFH 5HYJE 3LDBB 3D3VE 1LE9A 3RBSA 5EDXA 1DCLA 1QOKA 2DLGA 3HA0A 5I16B 3KPRE 4MA8L 1IM3A 1HZHH 2GCYA 4Y1AE 3OV6A 3CGTA 5DWUL 4MS8D 4YDJB 5C0IA 3PL6D 3L9RA 4WI6A 5DMYA 3UPCA 1T2QL 2EECA 2XA8H 4X6CA 1KN2H 2GITB 5DHYA 3MRGB 8FABB 5FO7B 4YQXL 3OGOE 5ID0A 1PDKA 1X3DA 1KT2A 1OQXA 3D0LB 5CUSH 3S34H 1MY5A 1ZGLP 32C2B 5GZOC 3DVNA 2H26A 4HS8H 2E27L 1JGDA 1UADC 4LCWE 5E99H 1FFNB 5EN2A 1A6VL 3VFVB 3TIEB 2CR3A 1T66D 4JG0H 4K2UL 4PJ5D 1LD9B 3G5VA 2J12B 3KYOB 3EIFA 3IDMA 1VPOL 2CR6A 1LDPH 3PWJA 2MOVA 5FHBH 2X40A 1FFQA 3IKKA 1SMOA 3S97C 4RFNC 3VXQA 5JXEC 4HCRH 1Q94A 2LE9A 3OKOA 2VISA 2X4QB 1IVLA 4RWHA 3P0VH 1CTNA 4OAWB 2FX7L 4TNWK 1VEMA 1S9WA 2QADD 3BAEH 4J3VA 4E0RA 4GRLD 5HHQA 4A2LA 3NCMA 4AIZA 4KPHL 5BS0B 1QBAA 1GVIA 2AEQH 3LQMA 5B39B 1CGSH 3PHQB 1GGIH 3T1FA 5J06A 1NLDH 2YD6A 4JO1L 5F1NA 1JTTA 2NNAA 2G2RB 2Y25A 1FNGA 4NKIL 4XCEA 2LU7A 2FR4A 4YHYC 4WI7A 3C6LA 1MCOH 1NCWL 1E4KC 3AAZB 3A6CH 4KQ4L 1F4WL 5C0NC 4K9EC 5HPMB 5HXMA 3CPLA 1QRNE 2BVUA 1QRNB 4Z7WA 5C6TH 1ZHLA 4YAQA 4BUHA 3X17A 1JGUL 1T2XA 2P5WE 2B8OT 4O2EA 3TBYB 5FB8A 2IADB 4QRPB 4C56B 1ED3A 4H5SA 2VXVL 4YR6B 3V5KA 1MJ8H 3QDGA 4G6FB 2DLFH 4GRWE 1HHIB 4NJ9L 1AGCB 2HFGH 3ROOB 3C60B 4PR5A 4BA8A 1EHLL 4BZ1L 2PXYC 4HCRL 1T7ZA 3IDIA 2UZXB 4QXTA 4ZFGH 1BQHB 3OJDA 1IGYA 5KS9A 1A7PH 3O6FC 3OMZA 5GGQH 5GS1A 3MRIA 4HX1A 4TSBL 3JWOH 1JZ5A 4WUUE 4JLRB 1IE5A 2IALA 1U8MA 3NH7L 1CLYL 1T22A 1WIPA 2E27H 3BIBX 4NCDA 2ENYA 1R0AH 4XTRD 3RTQB 4UQ2A 25C8L 4KHXH 2BSTA 4V1DB 5GRVL 3TO2B 3QXWA 3WYRA 2PTTA 2VB5A 2DQUH 4XAKE 3BVNB 3P4NA 5D93B 4B41A 1G9ML 3UZEA 3LKNB 1CG9A 1UC6A 4DN3L 3GMQA 1W0YT 1QBBA 1LP9F 1S9YA 3BUYA 4L9LB 2BVEA 4KROD 4YH6A 4Z18A 4YHPA 2FJFB 3FO2A 4P3WA 3TO4D 5KZCB 2YZ8A 1U8IA 2BP3A 1UZ6E 3C5ZC 3V6OA 2D4DA 2W0FB 2E5EA 1DQDH 1OP5K 1HH9B 4NJ9H 3SDXE 1H3PL 5MI0C 3DO7B 4TVSa 5M94B 4DGIL 3ORJA 4K3DH 5GSVA 5I8CA 3MRMB 5DD5L 2IQ9H 1GH7A 1E4XL 1QFUL 1MJJB 3IDXL 4RX4D 5E8PB 1JWUA 4TRPH 2RGSA 3IJYB 4KK8C 1FP5A 1ND0B 5L7XL 2G5BA 3T8XA 4N5UA 1PVHA 1XH3B 2D3VA 3Q1SH 4GKNA 2I9TB 3QHFH 3QPXH 3PWNA 1IC7H 1G7LA 1MCOL 1X44A 3NVQA 2EDQA 5CZXC 1UM5H 4KK6C 5HJ3A 3RY4A 2ZNXA 2R29L 5GISH 4KUZL 1I9IH 4FQLH 1FYTA 2QJDA 2V9TA 2NTFB 3L3DA 4OI9A 3WEXA 1IZJA 1X5JA 3CIQA 2EDHA 4OZFG 3MJ7B 5EPMA 2KQNA 5E1AA 1MCEA 3FOMB 3N0PB 2R15A 4CU8A 3BMVA 3BN9C 3SBWC 2R4SH 1TZHB 5DJZB 1TJHH 3HRPA 3M1BB 3GI9H 1K8DA 3O4LB 1WLHA 1NKRA 4OTXL 5E00B 2NY4D 2VDMH 4I13B 1WFUA 5DJ2B 4GRLA 2VABB 3MOAH 3QYCA 4QRRA 5CBEB 4J3UA 1A4KB 2QQNL 5IB1B 1IMHC 3O3AB 1JGVH 5FUCE 1LP9E 2VLMD 3RA7L 1OY3B 4XPAL 4PJAA 2GK2A 4KK9C 4HJ0C 4CVUA 3LKOA 4YFLF 3M8OH 3MJ9A 4ELKA 2OL3H 3ARTA 5ETUA 5ANMA 4J23A 5IW1B 2PETA 1GAFL 3TVMB 4OZGE 3MNZB 1EFQA 4NO2B 3MRBB 5TF0A 1ZGLM 4MX7B 5F72S 5DQ9A 1OLZA 3K1DA 1ZLUH 4G9FD 4Y4HB 3MO1B 4X6DB 7FABH 1OM3L 1XF2B 4HIIA 5EC2B 3ZDYF 5SV4A 3OR6B 3V0VB 3DROB 5ISZB 5JW4Q 1X5HA 4GQ9H 5T3ZH 2H45A 5BZWB 3V0WL 5EA0H 5LGKA 1CCZA 3ZE2E 1WVZA 2CH8A 3EOAA 2BVPB 1X5GA 1LO5B 3U4BH 1EO5A 4XB7A 5ESVB 1XF5B 2FWOB 3S88L 2PYED 4U4BA 5B38A 1Q0XL 4XCYB 5IB2B 4M7KH 2A6DA 3QPQC 2Z31A 2EH7H 2GTZB 5DVMA 5CGYD 3ZLQC 4NQEE 4NKOB 4I0PB 5AZEL 2YPVH 2W9LA 4Y4KD 3TNNA 3GGWA 1A2YB 3TJEH 3L3IA 4R90H 5E95B 4N68A 5C07D 3TIDA 1UZ8B 1UWEH 3LH2L 1VEOA 3I3EA 4L3CB 3RIFF 4UINL 3VG0L 4OD1L 4F58L 5ICZA 1XGYH 4Y5VB 2BHYA 1P7QA 4ALAH 2FATH 2HWZL 4LCWD 2MCPH 4M1DH 3CMOH 4G8EB 3E1F1 1WF5A 5EORL 3H0TA 1A3RL 4OF6A 5L6YL 5IVZB 3MC0A 3GMRA 4FFWD 3WFCL 5JPMA 1U2HA 3OKMB 2VQUA 4DUWA 3AXLA 3PWPA 5EIQA 1T7WA 4WWKB 5MHSD 4FQXA 4G8GA 1BPVA 3H3KA 4LNRB 3LD8B 2JELH 1S9XA 4OIAA 5JNYB 1KTKE 3JVGC 4JDVA 3JV6A 2O5ZL 2BNRD 2EIEA 1VHPA 3BOVA 5E9DA 4U1MA 4JJ5B 1G0DA 1YC8A 4GXVH 3WDHA 3HG1B 3RY6A 4IOIA 4YHIB 5DHVA 1FVEB 5GGUB 4LU5H 5DD0L 2OYPA 1A3LH 5I8KH 4MNHB 3VRIB 4FRWA 4I3SH 4Z7UF 2X4PB 3RVWD 2UYLB 5F9DC 2WIMA 3TBSB 2E7CA 2ZOKA 4JFZL 3ZTJG 1HHHB 1JNNH 3PL6B 5DI8B 4U6TA 3GDBA 1QHPA 3H8NA 3MLTB 3PWPD 3CX5J 2B0SH 5A2JH 4KKBD 4KGLA 2X4RA 1QA9A 2WUBH 1N6VA 2JELL 3AB0B 3WNOA 5ALBL 4PJ5A 1I3UA 4K3EL 4PIRF 4Y16B 4HKXA 1XCQB 4KTEL 2NYYC 3BEWA 3I6LD 4ZUVB 1H0DB 4KAQH 3NMEA 2IFFL 3SDYL 1FPTL 2ZG1A 1MHEA 3WXVL 1D5ZA 3HUJF 3KPNA 4RAUB 2DL2A 5D7IE 5ICXA 2Y72A 3NZ8B 5FEBA 4PG2A 2D7MA 3VGHA 4KUCF 4IRJB 4YHOH 1JTOA 3S6CA 2YD2A 2YRZA 4K2UH 1AHWA 4W6WB 4XNZB 4XP9H 2HP4A 4P2CG 1XGQA 4Y5XA 2APXA 4OCSL 4X5XA 5F7DB 4YIQA 3SE4A 2LV4A 3SO3B 2XQYK 3JTSB 4LMQI 4EDWH 4QY8A 3W5MA 3IFPA 1TQBC 3C5JA 1YECH 2JB5L 4FZ8H 1G9NH 4GQ9L 5T3ZL 3D3VA 3SKUD 2GJZB 1JF6A 4X5LA 1K6QL 3UJIL 4CRPA 4PLKD 5JR1H 2EYSB 5F1KC 12E8H 2CK2A 3EZJB 3G5YA 3IAPA 4PJ9A 2CUIA 4BSWB 1CT8B 3GHEL 1IAKB 1R5VA 4P9ML 2NQCA 1HIML 4L1HA 3DX9A 2CMRH 4IRSC 2ZPKH 3HCVA 4P2OC 4OM1L 2VDRH 4EBQL 1BBJB 4HMEA 5DVNA 5T3XE 2HFEA 1RI8A 4L8SB 4QRSB 1JF1A 4GW5B 2AEIT 1QFPA 2YEZA 4PY8J 4KMLB 5IHLB 3OKDA 4IDLA 2GK0A 3FT4A 3MOAL 1OAQL 3OGCB 4DK6A 4TULL 4JRYB 3QDME 1UCBL 4LPXA 1HI6A 1XCTB 1TTFA 4G6AC 5I0DA 4XPTL 1NGWB 3E6HB 2WM0A 4AL8H 4JO3L 1G6RL 2IGFL 3QUZD 4ZO8A 1D9KA 2EXWC 4G43A 4RAVA 3JWDL 4ZAKB 2MHAB 2J4WL 4Z7UE 3DURB 4PTUB 1QLFA 1QFWI 3G9VA 3NTCH 4NM8L 3RU8H 1BIHA 5CHNB 4BFIA 4PJCF 2VXQH 1PG7H 1CFVH 2FEDD 4NC0B 4HHAA 5CIPB 4OJFL 5EBMA 3L1OH 3TT3L 3C60A 1DANU 4RISH 4ODSL 5C0RH 2F8OA 3DVNB 1PX4A 3H2WA 3PIQA 4QXTB 5EN2B 5DJYA 4O00A 4Y16D 3VFVA 3E3QC 1SYSB 3KGRA 1RZ8A 5T1KD 2ZOLB 3G5VB 3AMKA 4DWHA 1MCQA 4KXZI 1W0WB 3RL1A 3IDMB 2V2XB 4NJAL 3WL9A 3TJHD 3VGEA 1HQ4B 3ZTJH 1N4XH 4UOW1 4NHCH 3OKOB 2VISB 3RTQA 1ZA3B 4D9RE 2VDLL 2MTPA 1BJMA 4JFEE 5DDHB 3AUVA 5FDYA 4A6YB 4UNUA 1MCJA 3V7AE 1NC4B 5ACLA 3S37H 4JKPL 3RTQC 4LSVL 4M6NH 5ID1A 4ORGA 1S7SA 1FFPA 3TM6A 5DJCB 4AIZB 1ZS8A 2MPAL 4PGJA 4FZEL 5B39A 4YEEA 4UT7H 2X1OA 5D93C 3VGAB 2GJJA 2NNAB 4YHPB 3CFDA 3W0WE 2C4FU 2HH0L 1FNGB 4LVHC 5JIPA 4OF7A 4XCEB 1I1AC 2PYEE 3E2HB 2P1YA 4OCSH 1WCBB 1URLA 2P8MB 3U7YH 1TZIA 3C8DA 3VXUD 1HSAA 1J8HD 3QIBB 3MRMA 4R4BA 5B8CA 5D5MF 4UNVA 3QDJD 3LB6D 1QFWL 4GFTB 5C0DA 2PO6B 5LAXB 1RUML 1JGLH 4XNYL 4KROB 4M00A 1BOGB 3CSBA 4QO1A 2UZYB 5GRZA 1R5WA 2KQMA 1TTGA 2EIDA 3HR5A 3WFHA 4FQIH 5JDSB 1G9EA 1HSBB 4N0YL 4XMPH 5IROC 3HR6A 5IEHB 1V5JA 5E4EB 2QADC 3W9DA 4L3ED 5DJ0B 1EEQA 3IDNA 4HT1L 4GRWF 3FONA 1MAMH 3MLWL 3L3DB 1KJVA 3O6FD 4OCRH 5H35A 3PGCA 3DVFA 3NACH 3TZVD 5CIPH 1ERNA 4YDLC 4WCYH 1CLCA 1NEZG 1ETZB 1NPUA 5HVHB 2WUBL 3LN5B 5A3ID 4IS6B 3FOMA 1OB1A 4EOWH 4QF1A 1NLBL 5ENWB 2MPAH 3PUCA 2OMNA 4EQ3A 1T22B 2CSPA 4JHAH 3T1WA 5FGRA 1LP9B 3ULUF 2XWTB 3W5NA 4OCLC 5D2NE 4O5LH 5F9AC 5E00A 4O2CB 4LVOB 1FZOB 4G8FB 2FJGA 3D2UB 3RHWK 5AG8A 4ONGL 4DGYH 4KQ4H 4NT6B 1MVUA 1OTUD 2F9BT 4U0QB 3KNBA 3QG7L 1U8OA 4LDEB 3WSQH 3NCJL 2C3GA 3QNYB 3VWJC 1QFUH 4P4KC 3VXPB 1RUPL 5F7HA 2MQ3A 3BP5B 4K3DL 4NKIH 3TZVB 3ULUD 2V17H 1WAAF 4K07A 3ULVF 3H9SE 5ISZE 2X44D 1WFOA 5FO9A 3H9SD 4KDVA 4PRPB 2V2WB 3AB0C 3MV01 1ZLSL 1S7TA 2BOBB 2FO1A 3FT2B 2B5IC 4X4YB 4LHUG 3DHMA 5EC2A 2G75A 4GLRI 4Z7VE 5DLMH 2NY1D 3VG9B 5E94A 4DK3A 3HNSH 4AEEA 4JFED 2ARJA 4Z8FH 4G9FE 1H3VA 3UYRL 4CVZB 4QRPD 1BWMA 1NC4D 1YNKL 2H8PA 2IH3A 4NN6B 1CICA 1HH6B 1U8KA 1KPRB 5L2KA 1NGQH 1L6ZA 3UP1A 2HT3D 3CZJA 3SQOH 3MJGX 2IMNA 4MNQA 2A83A 2Z31B 5I2IA 3DV4A 1F4XL 6FABH 5KBNC 3MJ8B 5FUOH 1RV6X 4MAYA 2P8PA 4K71B 1Z9SA 3SO5A 1BLNA 3KPRB 4QHMB 2O5XH 4NFDA 4RFEA 4KI5D 4CNIA 1AGBB 1QHOA 5CEYB 4HKJB 5EO1B 2D7TH 1KXQE 1ZANL 2I60H 3NFNB 3FO9B 1ORQA 3PV6B 3RVVD 2P46B 5ICZB 4MXQC 3AS0A 4KHTH 3IGAA 4TTDC 3QEHA 1F4YH 2AK1H 1VADB 4KJPD 5I1IH 4NWTH 5C08D 4JM2F 4XPBH 5DZOA 1OAXL 2J6EA 3OKMA 3FZUD 1T1WB 3EYOA 1S7QA 1JRHI 3A67H 4NHUA 1GOGA 4GG6A 4NUJB 4JQXA 3QUMH 3DXAA 3NA9H 4MX7A 3QIWD 1MFCL 3SDAC 1BHGA 2DQFB 3VI4E 1A64A 2Y5TA 1A6ZA 2HT4D 4PBWD 1A7QH 1CDIA 1I9JH 2BSED 4DKAA 4DZ8B 1EPFA 3ARPA 4JO2L 3FQXB 1AKJB 1FH5H 5GRVK 4YEFA 1YDPB 4Z0BL 5CAYB 5I75C 5FYLH 3FKUS 4P46B 1VKXB 4JO4L 4LSUH 4QWWD 1FSKC 5KVDL 5LCVL 3TCLB 3WFEL 4PJ8A 4XBGA 3QSKB 5EBLA 1J05B 2PXYD 2YKLH 4LRNL 4UU9A 5HHOB 5C0CA 4DAGL 3GK8L 4FFVD 2CIKA 5EO0B 1U92A 3JWOL 5KANI 4XMKL 3CLEL 5E0QA 1KJ2H 4A2MA 5SWQB 4YO0B 4HIEA 4GRMB 2OJEA 4OFDA 4NQCE 4HH9A 1NCCH 5GJTL 5IIEB 4TNVK 3AC0A 3FCTA 2F8XC 3WFBL 4RZCB 3UCRA 4P49A 3KPQB 2MWCA 4NKDB 3C6SA 2BHUA 5DD1L 1IZKA 3C5ZB 1LVEA 3DMMD 4EZMA 5A2LH 2I07A 3S37L 5I6XB 4JFZH 3RBGA 3JV4B 1ZGLB 3V6ZB 1X7QA 2UZIL 4FQQB 3HPLB 1VEPA 3H6JA 3WO4C 2QHRL 4HIXH 3MCG1 1KEGL 1S5IH 5K9QG 4C56E 1W2KT 1VFAB 1BD2B 4CMHB 1XIWD 2NY5L 5JPMB 3BT2H 1J5OL 2AK4A 1UACL 3SPVA 4S1QL 5FM4A 3QDMA 4FQCH 1KB5L 3E0GA 3SGDH 3MGOA 2DF3A 3B5GA 4K3JL 4RDQF 1H8SA 1IM3B 4X5XB 5C0FB 2ZSWA 1VESA 2GCYB 4QY8B 2J5LC 4HK3N 4YDJA 5C0IB 3U0WH 3ZYJA 2UUDK 3QNXB 5DJDB 1B88A 4JJ5A 3O45A 2Q3AA 4ZUSB 3V9FA 4GS7C 2QSQA 1EEZA 3D2UD 4NC2B 4XT1C 2E8YA 4LGRB 3V52H 1FVEA 4G80A 4JO3H 4QHKJ 1UWGL 3K74B 1DVFA 5BJTB 1IAKA 4MNHA 4UBDC 4NO0A 4GMSL 4ELMA 3DX9B 5LG1A 1GGCL 3QCVH 3VXMB 3QG6B 2NXYC 2VZTA 3RX8A 4Q6YA 3QUYA 1N6QL 2X4SA 4Y1AA 1KELH 2ZCHH 2B4CL 4PJEE 1CGWA 3U9UB 2C3XA 4RQQA 2OZ4L 3BPNC 1E6OH 2ZCHL 3T2NH 4N0UA 4YWGL 4GAJL 1U3HA 4Y4KB 3KXFD 4GG6F 1GOFA 1CQKA 4XVSL 2AJZB 3WS3B 4RIRA 3S5LG 3RPKA 2AEPL 3RNKB 4GKSB 4ZSOA 2VE6A 3K2UL 4E9LA 5BRZB 3HMWL 3U1SH 3OKEB 4MXWL 3VXOB 1CXEA 4OZFH 4QHNA 3ZKXC 3PHOA 4WFFD 5F9OH 4MVBD 1F58L 4R26L 2Q6WB 4QOKB 1CFSB 3QJFB 4OSUL 4JGMA 3KJ4C 4RAUA 3BHBB 4H1LA 2RR3A 4LRIA 4MNGB 3B8YA 3PHQA 1S3KL 4JPIB 4I18B 3MRFB 4K7PY 3RVTC 1TZGH 1Q72H 4ZNCD 1TJGL 2JJSA 5JPNA 3WE6A 4GUPB 3EOTL 4U1LB 1U0QA 4MD5B 3VI4F 4V2CB 1L9MA 5HY9A 1IQWL 5K9KA 4ZAKC 2BHZA 1UCTA 4N1CA 4JE4B 5FOBA 1T4KB 3AREC 3BT2L 3LKSA 4LLUB 1KXVC 1S7WB 1LNUA 5GS3A 4X7FC 4JZNA 4NGHL 4M1GL 1OWWA 1I3VA 4MCYB 3BDYL 1XR8A 4HZLB 3ZHLA 1A0QH 1QLRB 5JW5B 3UPRB 4HC1A 4JKWA 4NRXB 2VSDA 4LARH 3PWPE 4DKFL 3SOBL 1Q9WB 3TT3H 1NEZB 4NP4H 3VFGH 3BMWA 1HQ4A 1C5CL 4ODTL 1MFBL 2WBJC 5C0AA 3PWUB 3IF1A 1T7XA 1YQ2A 3BISA 5HHMB 2J8UF 1OQOA 3O4LD 1DBAH 3GMMB 5DDHA 3HE6C 2R69H 1CL7L 3F5WB 4H88H 4JRYE 3MXVL 2W0KA 2YUVA 4JG1H 4APQB 1IL1B 2YPLD 2AXFA 4OCWL 4KJPC 4Y2DD 4JJHA 3S8WA 5D7LA 1RZKL 5DHXB 3O2DA 3MUJA 3JZ7A 1BEYL 3JXAA 5L2JB 3D39E 5DEGA 5GJSH 5D1XA 2UWEE 2I5YL 5A1AA 1GHFH 1G0YR 5CKGA 3LD8C 3SJVB 2IGFH 3OHXA 2VDQL 3BDYH 4X9IA 2O93L 1OAKH 4L8BA 4Z7UB 4MB4A 5DJ6A 5HD8C 3MCKB 1V7ML 5A40E 4KTYA 4WO4B 3H3BC 1DEDA 3CK0H 3AFLA 1ZA6A 3OBAA 2EDWA 4Z7OF 3U0TB 2KH2B 5H37G 3QRGL 5C0BE 5J12C 1IGCH 1INQA 2ESVB 4TPRH 5IVOA 2W65B 1XR9B 3IDJA 3B2VL 1I3RB 3N1QC 1YPZF 4RAVB 4Y89A 2JCCA 4L9LC 3QIBC 4ERSL 3LQAH 3BIAX 1RUKL 1U8IB 4I9WD 4LHJB 2LU4A 3OJVC 1X4YA 3REWB 5AYUL 4WW2C 3UBXI 3ZHKA 5KSAC 3BN9D 3D69A 4FTVA 4M6MH 3O4OB 4U3XA 1MJUL 3ZYZA 2EIBA 2DDQL 3QEQB 1I7TA 3MACL 1IGML 3EJZC 3EFDL 3TWCL 3KPLB 5DO2C 5ENWA 4JKKA 4GKZA 4TUJB 3MLYL 5IT2L 2HT2C 2JB5H 1MAKA 2XWTA 5DEZA 3B8SA 4RMVA 3D39A 1H9VA 1DBJL 3QUKA 2IJ0C 5LXGH 3VG0H 15C8L 4ZDHA 2GY5A 2H32H 2R2HB 1I3GL 2EDYA 4O2FB 4YGVB 2GIYA 3DGCR 4IRJC 2K1MA 3QO0B 1J1OL 1EXUA 2XWJA 5D96C 1P2CB 4X7TB 1OTUC 5A16A 1ZXQA 3KNBB 3R4DA 4HGKC 1C08A 1CL7I 1U58B 1S8DA 4XP9L 2X9XA 3BE1L 4OTXH 5ALCH 4BZ2L 5EBWA 4TSAL 4AQ1B 2XOTA 4LCIH 4NPYB 1MWAH 4BH8A 1BX2B 4OLXL 5DMKA 1LDSA 4H1LH 1KG0B 4JY5H 1N2RB 1R3HA 3UZQA 2NY4C 3JTTA 4Q9QL 1WCBA 3U7WL 5IF0B 3BZEB 3INUL 4PJAB 2J1KA 2FGZA 5F6IB 5IR1B 1CVSC 5DZLA 3V6OC 2XV6B 2P5EA 1AQKH 1KJMA 4ELKB 1FIGH 4OV6F 1ORSB 2B5IB 4U1GB 2EIZA 3TBWB 3IDGB 1F90H 4H8WH 2N7BA 4MSWB 1IC7L 2YMXL 1BJ1J 3VA2C 4BK5A 2P24A 5K93A 3F6IA 3VCLA 3UPAA 4DCQA 1IKNA 3MV7E 4F33B 3V6OE 3RWFA 2CLZB 3ZKMC 1GAFH 4AENA 4YBLC 1I4FB 2VDNH 4LSSL 4NO5A 2XN9D 2UWEA 5ISZA 1B90A 2DIBA 1FE8L 5J11C 1XGRB 1S5IL 5IB3B 5M7QA 4HQQL 3GSXB 2XIDA 5GS0D 4GW4A 5I1EL 3EOAB 4ZO9A 2JJSC 2DTML 5BO1H 3KPPB 3PQYE 5D6CB 1MF2H 5IWLA 4G42B 3GSNL 5JW3H 4Y7MA 1S9KC 2D31B 2D9QB 4GS7B 1U95A 1CD0A 4PJ7F 2GTZA 1NCAL 3HUJB 4DN4H 1AI1H 1G7JA 2UWEF 4ODXB 4PRHB 5H8DA 4QRQB 4UILL 1QVOB 1JYVA 4NT6A 1D6EB 5CP3H 3S37X 3S3SA 5ICYA 2ZCKL 3K2UH 1P4BL 1FBIH 4P46D 3DGGA 4Y19E 3LPFA 5E2UL 3BP5A 3ULVH 1CU4L 5HDQH 1NMAL 1JV5B 5C08E 4OQ1A 3U0PB 3S34L 3U30C 1HDMA 3LQZB 4NUJA 4IRJD 3VI3E 3HNVL 2EEDA 3QP3A 5JUEL 1W0VB 3E3QE 4NKQB 1QTYT 1UWEL 3EDJA 5IVZA 5I66A 4F7TB 5DRZB 1I9JL 3GUTB 4NRYB 2IG2H 5TDPA 3WJLC 2OI9C 3KLAA 3CDYA 1FV1B 2BY0A 4QNPF 4WHYG 5MEND 4OLYL 2ILLA 3B9KC 4X83A 2CGRH 2R1WB 3RP1A 3TCLA 3OAUL 4PLOB 5FA4B 4DVRH 3V4UL 2XT1B 5HHXH 1KCVL 4KKCC 3OF6A 1FSKB 1VFBB 1KLGB 3PXJA 4MB3A 1FNLA 2O61A 4R7NA 4JN2A 4H26B 1A14H 5GGUA 4N8VB 2VDKH 5KSBF 5DD6A 1RZGA 5EU4B 4RZCA 2F15A 3VRIA 5DTFA 4Z0XB 2EKJA 1IEBA 2IG2L 3LS5H 1SEQL 4XWOC 1CZ8L 4NUGH 4PJ7A 4X6CB 5HD8D 2OLDA 4Z6AT 3OG4B 2HFFA 2CKBL 4HWBA 5DHYB 8FABA 3NFNA 1HHHA 2B2XH 1JZ6A 3MSPA 4OJFH 4PD4J 1D5MA 1NAKH 2AJ3B 3IGAB 4Q9RL 5EUKB 3GIZH 4MA3B 3D85A 1DUZB 1KT2B 2BVYA 3BAEL 2GYSA 3MRPB 3U46B 3HB3C 4JM2C 3P9MA 4TVPH 4LF3A 5IFJA 4XBEH 5DRNA 5CGTA 1PGRB 3FB7A 3QDMB 4MJ6B 5FDWB 1UEMA 1F3RB 1P6FA 3MQIA 4FXKA 3IS1X 3B83A 1CDJA 4M7LL 2K3TA 4KKCD 5LQBL 2YS4A 2DQFA 1NCBH 3D9AH 1PLGL 2A6KA 3STLA 5JW3L 2JJTC 4NYLA 3BZ4A 1AHWB 1AKJA 5EUOE 1HNFA 5C09D 5EUOB 5TJWK 4NQCB 5CCKL 1YEFH 5BVJA 5BW7C 3CZFA 2ADJA 4Y5XB 1KCKA 5DD3H 4OIIL 3TESA 2GSIB 5J9PB 3L3OB 5IGXH 3MLYH 4P23A 3VGAC 4LQ1A 4DGYL 2IWGA 2VERN 4JCMA 4AZ8A 1CQYA 3ZE0E 5DMGC 4F37K 4F3FB 1FRGL 3CFEB 3EFDH 4GH7B 3BYYA 5DWUH 4N90D 1HEZA 3VFTA 4ZOCA 3LSOB 1A47A 2AAVA 2X4UB 1BAFH 3OL2A 1QKZL 5L7XH 3OZ9H 4LHUB 1NBYB 1MCSA 1FGNH 3FCTB 2AJYL 3MODH 2NTSP 3KPQA 4RIRB 4XXDA 2VE6B 5BRZA 1F2XK 3QQ3A 5ADOL 1SY6L 2HKHH 3UTTB 1H3PH 4NZUH 1MFAL 4WV1B 4R26H 4XP5H 4QOKA 4FQIL 4L8SA 4MXVE 3O8XD 1JF1B 4GW5A 1YEEH 2VXTH 3O11A 5IMKA 3V0AC 5D5MB 3D48R 1F42A 2FBOJ 4KKLC 1RUMH 4E41B 3TBVB 4OIBA 3KAAA 4PTTB 2GK0B 4OZIA 5C6WH 1J9CT 1IGYB 3CC5B 5D71H 1BQSA 3UTOA 3JSSA 3ARDB 3QEGL 4R2GD 1EAJA 2HTLD 3V52L 2DIAA 3QUYC 1MCPL 3V6FB 3SKJL 4EI5A 5C0FA 2AKRB 4JRXB 1ZEAL 3MLVH 4KJYA 5IG7A 4TUKL 1DN2A 1OF2A 1I1YA 2FGWL 2CO6B 3SDDB 5LXGL 1JZ3A 1IEAA 4GMSH 2XYCA 3I9GH 2Z35B 1BVLA 1XR8B 4EKXA 2ZCLL 4OFYA 5ERWA 1OW0A 4BFIB 2YHGA 3MUZ1 3U4BL 4P4RA 1NEZA 5L88L 1CG9B