2QQKH

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
219
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISGYGIHWVRQAPGKGLEWVAYIYPDSGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREDFRNRRRLWYVMDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 219
sequence length 231
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqkH01
1B4RA 2FATH 4PJHA 5C0GA 1LD9A 1VPOH 5D2LE 5C0ND 3CDYA 2R56L 2N7BA 3GK8H 4EDXA 4V2BA 3IU3A 4JGJA 4JEGB 4PJGE 4NKQB 3JWNC 1UC6A 5EU4B 3GJEB 4LSUL 4LDOB 1SM3H 4Y2DD 3SCMD 1A64A 4JVWA 4F7CB 3QDAA 3ARDA 3LB6D 3HI5L 4M5ZL 3B9AA 4WDIB 2R69H 2AJYH 3NIDF 3W0WE 4RZCA 3CPLA 2OZ4A 5MEOA 3EO1B 2XTJD 1B88A 2LE9A 1IAOB 4GAYB 4LNRA 4NGHL 4A6YA 3MMEB 2BXYA 3O0RL 4WWID 4ZSOB 1UA6L 1VADA 1RZJC 1F3DJ 4WENB 2WNGA 1SYSB 4AM0A 2W91A 3DX6B 3HB3D 4IIQB 5ACZA 4OT1H 4LHQB 2DS4A 3FRPA 3F58H 3LS4L 4P3DA 2VXSL 2O5ZL 4MD5A 3WD5H 1Q9KB 5CWSB 5J1AB 1NGYB 1AC0A 1UACL 3MOBH 1TCRB 1P4IH 5T1KD 2D7TH 2P43B 5ISZB 5IB4B 3MLZH 5B3JE 5E6IC 35C8L 5C8JB 5K93A 3DRQB 3C08H 3S9DB 2JCCA 4NQSB 1JHLH 4H26B 1EEZA 2L7JA 3E6HB 5C0EA 4L3AA 5HHOA 2WIMA 2AXHA 1XGRA 1FN4A 2YUXA 3T4YB 3ZKND 1HH6B 3BIBX 3HAEB 3QR2A 4FQXA 5DQ9A 3A6CL 3B2VH 2NW2A 3X11B 4HKJA 4OJFH 1KPRB 4GMTH 1KTLB 4L8BA 5F96H 4N0YH 1T83C 1QR4A 5E5UB 4I18C 4HJJH 3BN3B 4FQCL 2NR6C 5SWZD 3GM0A 2CKNA 3OKLB 3E3QE 1QSFB 3BAEH 2C3HA 2AJ3A 1ZS8A 5I1KL 2YBRA 1Y6NR 1DANT 1T03H 4NDMA 2WZPD 1J0YA 5EU6D 1BAFH 2YMXL 2IH1A 4DVRL 3LN5A 3FFCE 3VXME 3MFFA 3VXRA 1MPAL 3I6LE 1I1AD 2FJHA 2YA0A 3ZL4L 5I15L 5JOFB 1ZT4B 4U6XA 4GBXA 5I75C 1ZGLB 6CGTA 3PWNA 3IDXL 5DUPH 5C2BL 2A6JA 3ZE2E 1MCNA 3A67H 2GT9B 5TQ2H 1I9JL 4F33A 2DQHH 5BVJB 3GMRB 2IWGA 4KJPD 4YJZL 5TE7L 4PV9B 5M95B 4PRAB 4WI8A 5DTFB 2XNAA 2RFXB 3BWAA 2BSSA 1IEHA 4Z7QF 4LASL 4FTVE 3S35H 1X44A 4Y5XC 1QHOA 1B0GB 4AJ0A 1V8HA 2MCG1 3PE9A 3HC3L 3QNYB 4ETQB 3OAYH 1CR9H 4ODVH 1BVLA 1FFNB 2UWEA 2FO4B 2Y7QB 4PY8J 1DLHA 1KB9J 1RUKL 1OWWA 4M3KB 4YH6A 5KSBE 4K3HA 2Z8SA 3CVHL 1U2HA 1EO5A 5FHBH 1BREA 3PGFL 4R4BA 5J9PB 2X4TA 4JPKL 5I8KL 4ONFH 1FNEA 4HJ0D 4HWBL 5DRXA 1HHKB 3T3PE 4JFEB 5HDLA 3ZKXC 3X3FL 1BOGA 2Q8BH 4WUUA 2MCPL 1IGML 4AMKL 1CQYA 2X70B 2OSLB 4UQ2A 4QY8B 4OLZH 5K59F 2VDMH 5J6GB 2VLJB 4OUUA 3V6BR 4KZDL 2ZOKA 3GB7B 1LO5B 5C0AB 4LU5L 5T3XL 1MAML 4X83A 3C5SB 3DWTA 3CDGB 1FLRH 1WWCA 4X7TB 3SOBL 2UV3A 5C09D 4E41A 2OJZL 2YD5A 3MRKB 1JI1A 3NZHH 4OFYA 4Y19D 2Y06L 3EYSH 2MMXA 4OKVA 4APQC 3H2WA 5CEZD 4XGZA 1S7UB 5T3XE 1SJXA 5IUSA 4U1HA 4XC3H 3UTSD 4P4KD 5D7LE 4Z5RB 3QEGH 1KSRA 2P24A 4OZFB 5D7JA 3INUL 2B5IB 3BMWA 3BW9A 5C0RH 2W65B 1MHPH 4K8RH 3TIEA 3H3PL 1IT9L 3ALWA 4NO5B 1R0AL 4MNGA 2G9HB 2JJWA 4JKPL 5J06A 3VFTB 3O3UN 2CLRA 5L2JB 2VXTL 2P42B 4K07A 2A2QT 4G8EA 4QWWD 2E7LC 4F8QA 2I27N 1U3ZA 2A83B 3OSKA 5F7YC 1C5CH 5ETUA 3A0OA 1NFIB 3SKNB 3TBTA 4HH9A 4Q6IC 1IGIL 3WHXB 2EH7H 1MRCL 3MV7B 2NY0C 2O5XH 2Y1VA 4LLQB 1KTRL 4S1SL 2FNBA 1U8LB 1GGCH 2RBLA 4K3GA 2V2TA 1QEWB 2EYSB 4Y1AE 2ITDB 3DVGB 4PGZA 5DS8B 1QVOA 4OZGB 5EOQH 4C57C 3VFPB 1UKTA 1Q72L 4KJYA 5FUCE 2GAZA 2N4IA 3F12A 3TVMB 3RL2A 1A4JB 1N5AB 5MHSD 4JGUA 1XF2B 2XN9B 4Y2DA 1DQDL 5C0BD 3QDGB 4ESKA 4JDTH 5I1HL 3DLQR 1RZ8B 3HTLX 5BS0D 5IW1B 2GTWA 4HUUB 1UH4A 3UEZA 3QQ3B 1EAPA 4ELKB 3C2SA 4UU9A 3JVGC 1A6WH 2EO1A 3MV8D 5D7SH 5GS3A 1RK1B 2AK4B 3VXQB 3MRMA 4X7FC 4NKMB 5DURD 1YEGH 1DBAL 4WW1B 5CGMA 5GS2D 4PJCF 5IR1A 5GGQL 2VXVL 1H3PL 4S0TD 5EO1A 4GAJL 4I0PA 2IANE 3JWDH 4BSVB 5I30L 1OAUH 2IPTH 1MH5A 3DMMC 1ZGLM 3QCUH 2Q6WA 5F8RC 3TWCL 1LK3H 1KXVC 2OTUA 2HN7A 3BPNB 1A6TA 1FO0H 4I3RH 3DO3A 5KSAC 1KUMA 4FFWC 2BNUB 2APFA 3TN0A 4O4YL 3CXHJ 3UAJC 3G6JE 4EQ3A 1PQZB 3V5HA 2VJXA 3OB0H 5INDA 3REWB 1NGQH 2BOCB 2I26N 1A6ZB 2YK1L 1TTUA 4HXAH 4LAQH 3I2CH 4YBHA 5E08L 3O45A 3ZDYF 5DUML 4D0DA 5F9JB 3G5ZA 2CUIA 1EEYB 5FO9B 5FO7B 1GVIA 2O26U 3U30C 1XEDA 3U4AA 3BVNA 2C3VA 5E8OB 5F97E 3OJDB 5EBLB 4F7EB 5H2BA 3P0VL 3KG5A 4P2QD 2FRGP 3HI1A 3HNTL 3L5XL 2A74B 5EC1B 4LHUB 4K23H 4JGMA 3B9VA 2HH0H 1Q0YL 2OXGA 3MOAH 5SWZB 5DVNA 1KJ2H 4HPOL 5EU6A 3Q1SH 1H3VA 4X8JA 2VTFA 1EVTC 3E1F1 1T2XA 4HMEA 3EBAA 1T6VN 5HHMD 3QQ4B 2R23A 1EX0A 4N0FB 1A02N 3HE6D 2FYYA 1UVQB 3DGGB 4LARL 1Q8MA 4OZ4A 3QWRA 5TDOB 1OQOA 4Y4FC 3TBWB 3RZCC 1RU9L 4HPYL 5GSVA 5B4MC 1MRDL 5MERA 2ED8A 2BC4B 5IMOB 1WVZA 5DZLA 2GEEA 4OB5L 3TZVA 1FC1A 4RMTA 5DD3L 3WIIL 3AC0A 4JN1L 5IBUG 3H8NA 5DI8B 5TDPA 3SKOB 1P53A 2FJFA 4L9DA 2HRPH 4XI5C 4L1HA 3WUZA 1M71B 2AEQH 4KTEL 4G6KL 4XNXH 2AEWA 4U1LA 4CNIB 3VXNA 2AGJL 3LPWA 4GMSH 4QXGH 1HCVA 1J8HE 1C1EL 1S5IH 5C9JA 2F5BH 4ZDHA 3NCMA 3VXPA 2PW2A 3SQBA 4NQCD 4XHQA 1CVRA 2D4FA 3BEVA 3MA7B 3QRGH 3NN8B 2BRRH 5CEXB 3GI8H 4GG8B 4UAOC 3CZFA 1S5HB 2N7AA 4NZTL 1T0MB 4XP5L 5J8OA 1DBBL 3WXVH 1INQB 3W11C 1MFBH 1HXYA 2M26A 3IJHB 2VL5A 1NAML 3FB7A 5JW3L 3IF1A 5L9DH 5HVWA 1BGXH 4JRXD 4NO3B 1IFHL 1YQ2A 2KBGA 4P46D 2X4RA 3I3DA 1NCBL 5EA0H 3V6FA 1DP0A 3P9LA 3CAFA 2EEDA 4I2XB 4NQXA 3HC4L 4M1GL 3AUVA 3IS1X 1U8QB 2V17L 4Y19A 1NGXB 2VQUA 4FQ1L 1YUHA 2A77L 1BBDH 1J7VR 3L3JB 1TJGL 5FK9A 5C09B 3MRHB 4GG6A 2FGWH 5IF0A 2ICES 4QXUH 1EDQA 5CJQL 5ID1B 4J12A 4C58B 2X89D 4TUOA 3VFVA 3MLUL 3OR7B 4MDJA 1QSEE 4CW1A 3Q2CA 3O6LH 4OD1H 1ZHNA 5F44A 3AS2A 3P73B 2X40A 3SO3C 3HLAA 2NXZD 5E94A 1PG7X 1KBGL 4L8SB 1IC5H 4FQLH 2E7HA 4IMLA 2Y36L 1ZEAH 3ZTJH 2MKLC 3H6JA 1MLCB 2X4OB 3WXWH 5IFJA 3DUUB 3LQAH 5DJYA 1MCPL 5E70A 5ICYA 3CFBB 1TZIA 1OTSC 3KYOB 2C3XA 5IK3B 3VGBA 4ENED 5IT2H 3STZA 1NFKA 3H9SA 3VWJA 5ANMB 2QSCL 4F15B 1ES0B 4GUPA 4Z78B 5IW6B 4CDGC 5ILTL 4PJHE 5HXMA 4Z7WE 2NY1C 1A7RL 1KEGH 2QHRL 2QADB 1U58A 2NNAB 3QULB 1P7HL 1ZHLA 2AXFB 2A9NH 3QDMD 1OB1B 4LHJB 3RWEA 1I3RB 1K6QH 4NRZA 1A7OH 3P4NB 1EZVY 1DQJB 3NCFB 4ZAKD 1IGCH 3TPUB 2FL5A 3E2HC 1CGWA 3U83A 3OTTA 5E8NB 4PRHB 1NSNH 1PD6A 5D8JL 2VQ1B 5BS0A 3T0BA 2EDTA 4A6YL 1T7ZA 4NN6B 5E03A 1KF9B 4P48A 2P5ED 3K8KA 5DJCA 2LV4A 2EXYD 1B2WH 1FGVL 1JCKA 3QPQD 2AJXH 3IDIA 1KJMA 3HMWL 3MV8A 4JQXC 1QOKA 1F4WH 4MD0A 1U8HB 2R2BB 2XZCL 4PYGA 2GFBA 4DK3A 4TVPH 1M7XA 1AJ7H 5TF0A 2AERT 4KI5C 1HNGA 4NN5B 5K9KB 3O41B 1KLGB 1H9VA 4F58H 4F2MA 1CFSB 1IEBA 2H9GA 5DRNA 1HYRC 3DYOA 4M93C 2PCPB 1U95A 1FE8L 1D6EB 4FQQB 1E27A 3QNZA 3KDMA 4R2GC 4F80A 2ZSWB 3SO5A 4FQ2L 3VFSA 2JCCE 4U1SB 1LK2A 5HHOE 4WCYL 2WBJA 4U1JB 4YBQC 3BFOA 4AZ8A 3UP1A 3WHE0 1MWAB 4ELMA 3K2MC 5IMKA 1C8PA 5HPMA 3ULUL 4GKOA 4HAFA 4OZHA 1UB5A 2EICA 5D2NB 4DK6A 4E5XA 4NUGH 4XPBH 3ZKSD 1OAYH 3GBMH 3O3EB 4JLRB 1OLLA 2ORBH 4ZXBD 3ULUE 3RPKA 3MXVL 1BF2A 3WSQL 4MVBC 4XPAL 4RGMC 1BFVH 4WFED 5FYJD 4ODWB 5IGXH 4WU5B 2HWZL 4AIZB 3BT2L 3MRCA 4XNZC 5IFHH 1MFEL 2HFEB 1H3XA 3VXRE 3I75A 4X8XA 3GGWA 1GPOL 1IEAB 4M3JA 3HS0B 1CLYL 4UIKH 4LVOB 3E6FA 3IFOA 4ZO8A 3VWKD 3HE6B 5DYOB 3U7YL 5DC9B 4KKAD 4ZS6C 4DKDC 3WO4B 5EO9B 5FO8A 1CYGA 1NFDB 4F7MB 4QRSA 3VDAA 2DQFA 4KRPD 4Q6YA 2FEDC 3MBEC 5IMMB 5EC2A 3F7VB 3SEPA 3BZ4A 4WV1C 1ULVA 1CD0A 1H5BB 4U1NB 4YXHL 2X09A 3VXTA 1DTUA 3TO4A 3B83A 1VFMA 3UBXB 3BUYB 1TQBC 4NFDA 2X6MA 4LBEA 5JIIA 1KFAL 4NQCA 1QD0A 1SJEA 7CGTA 4FABH 5E2VL 4TRPH 1VFOA 1NMBL 2QR0A 2UWEE 2WIIA 5KTEL 3TA3B 4ZFGH 1KNOA 4PV8B 5D1ZB 4J23A 4X7SL 3WLBB 2Y23A 2J8UB 1QFWM 2H8PB 4P2RB 4AL8L 4NKIH 3BIKA 1UYWL 2O93L 4PJCA 1FC2D 3IETB 2HTKD 4OI9A 3U6RB 4PR5A 4HW6A 3KNBB 4WUUE 4M1CC 4P46A 1G0DA 2PW1A 2BDNL 3HPJA 5SWQB 4JRXB 5DD1L 2YD7A 4WFFE 5I74C 1JN6A 4NQUA 3T77B 2CO7B 1C12A 1MOEA 1YY9C 2RAMA 4DFHA 1D5MA 4GXUN 3MQIA 4X4MA 4E41E 1IAIM 4PP2A 4YPJA 3PXHA 2VR5A 1F11B 1AH1A 2P8LB 5JLZA 5C08B 1UG9A 5CHNB 5CJOH 4Z18A 4QHNB 2OL3A 3CXDH 1YYML 1U91B 4BUHA 4NC0B 3FONB 3HZMB 2QV2A 5CS7A 1KTKE 3EOAA 4HEPG 3GNMH 3C5JA 5IHZA 3SE9L 2FECI 5I8CB 3VXSB 4R8WH 3VA2C 3LSOB 4ISVB 2V9RA 2ICEA 3O3BA 1G9NH 2X4UB 5D71L 4MNGE 2FEEI 3FTGB 2NYYD 5IVXB 3LKPA 1N26A 5L8JB 2KPNA 4U31A 1P9MA 4ODXA 1ZANH 3MXWL 4XMPH 1CGSL 2ATPB 3GSUA 3L3IA 2VABB 4OF8A 5DGQA 3JXAA 4OLYH 4D0CB 4IOIB 4JPVL 2J8HA 5EBWB 1RFDL 1N3NB 3U4BH 3MRIA 2EDYA 1VEPA 2J12B 3EJYC 2P46B 4OF0A 1IGFH 4GW1A 4LLVA 3FB5A 3OAYK 4YNYB 1H0DB 4G6JL 4LPYA 1FSKB 2R1WA 1UWEL 5AYUL 5CIPA 4JZNA 1M7DB 3PDOA 1T7YA 1WJ3A 5FEBA 4K7FB 5EWIL 1ED3A 3QDMA 1ZMYA 4TVPD 4HV8A 1CICD 1E28A 5DK3A 3EOBA 2BY0A 4NO0A 3CLFL 3OAUH 5GRUL 5GS1A 3UJTH 5DJ0B 4PJBF 4ZAKA 1NEUA 3BOVA 1QKZL 2YEZA 2K1MA 3RY6A 1N7ML 2GJ6B 3QH3B 3LKOB 1JRHL 4LDEB 4OIIL 5CSBA 4DGIH 4J8RA 4BFIA 1FO0A 5DDHB 4DUWA 2P5EA 4PJFB 4YQXH 2GTZA 4N1CA 2XTJE 1GRWA 2IMMA 3QUML 1KT2A 1HXMB 4FN0A 1T5XA 3NIFE 4OFVA 2IPUG 4J6RL 3T2QA 4RFOL 5DJ8A 3NCJL 1XIWB 5E5MB 2NY5L 1KN2H 3SDYH 3T8XB 2FSEB 3HE7B 4X4YA 4YO0A 5IBLD 1JIBA 3X17A 4P99A 5IEKA 3BXNB 5E00B 5FYLH 5KVFL 5DJAB 4PGEA 3ABZA 4G6AC 3LS5L 4I4WB 2ZCKL 1A4KA 1TNNA 2DTMH 5J0BA 2PXYA 1OPGL 2EIZA 5HHPB 5DC0A 2XACC 4BFGA 2JK5A 2DLTA 3V6OA 1CDCA 1UWGH 4JFPB 3JTSB 4I5BA 2ADIB 3T1FA 1SQ2N 2NZIA 4G6FD 3BE1L 1KJ2B 5GHWL 2ZPKH 5IW3A 3O4LD 4NRXB 3BKJH 4JHWH 3SPVA 3VFRA 3GO1L 3V9FA 2Z8VC 4LIQL 1AIFA 3U0WH 3PF2A 1U8OB 2F19L 4JZJC 5I73B 3QEQB 5BZDA 4L29A 2BX5A 2Q7NA 5ALCH 3PV7A 1G6RH 2RHEA 3VW3L 1DQML 3BRGC 3V7AG 1BEYL 4PUBL 2XXMB 4LIQE 4PJXF 5AWNL 1EXUB 2D7OA 4ZXBB 4CVZA 3B5TA 5EU6E 5FUZH 1U8NA 4W81A 3QI9B 4QXWA 1MI5A 3NCYS 2YD1A 1XGQA 3HI6L 1VDGA 3K4AA 4TSCH 1RZIB 5IESL 3WN5B 3RI5F 2VR4A 1NLBH 2AKRB 2R2EA 4P57A 5CKGA 3W5NA 3NA4A 1B0RB 5TDNA 3VWKA 3ZHKA 5FECA 3CJJA 5MP6L 4UB0L 5EZLA 4KK5D 1WZKA 1F4XH 4XH2A 4CN4A 5IOPA 4FA8A 3U0TB 1G9MC 3NZ8A 4YHNA 1YY8A 5E8EA 4K3EH 5SX5H 3FO2A 1WISA 3AREB 4TN9A 1RQ5A 2EECA 1K4DB 1T1XB 3OR6A 1HQ4B 1MCBA 3LDBB 1NGWB 3FQWB 3O6FD 4ORZC 1AD9A 5T1LA 5JPNA 4PRBB 5CEYB 1DZBA 1JF1A 1U8JB 5J57B 2RJMA 2BJMH 3PDGA 4WI7A 4O58H 5D9SB 3WUWB 3ARGA 3GMPB 4Q7DA 2X9WA 5JTWA 4M4RA 4F8TA 3UTQB 5K33A 4MA7L 1NBVL 1WV7T 1DANU 3NIDE 5JXED 3FQTB 3VFOB 4QHLB 1C5DB 3D39B 1JPTL 1NMAL 3LQZB 2CUHA 3MJ9H 5CUSH 4AG4H 4LCWA 2B5IC 3TC9A 1PW3A 1DEEA 4CBPA 5BRZD 3T0AA 1MJUH 2CKBH 5T3ZE 3QFDB 3O2DH 1MCRA 1Y18B 5I1LB 5HDQH 3FMGL 3QZWA 3BWUC 4K9EL 4ZO9A 4Z7VF 2WUCH 1G7MA 3DARA 4GSDL 1YNKH 1AHWA 3VXOB 1F3JB 2H26B 2K3TA 2VR9A 4YHKL 4JFHD 5ERWB 5CEZL 1TVHB 3FB6A 5AAMA 1N0XH 3TO2A 5IG7A 4GLRH 4HIJA 2MPAL 3QXUA 1OCWL 2WUBL 2CIKB 4KQ4H 1KIRA 5F72S 3V5KB 3HG1D 4P59H 2CD0A 3P4MB 4Y19E 4U1MA 5CEZE 4RCAA 4HG4K 2GKIA 2AEIT 3FQXB 4P9HH 1CGUA 4GG6E 2FATL 3UTSE 4QXTA 3QO1A 2R0KL 4W4OA 5BJTA 4YDJB 2FECL 2JE8A 1S9WA 1VPOL 2ZUWA 1A6PA 2GSIA 5A40E 5DLMH 1RJCA 4Z77A 3RDTD 3T04D 4PJDF 2EDLA 2QEJA 3GK8L 2FEEL 4HGWA 5I16A 1PZUB 2X4NA 3PGCB 1IM9D 5T1MB 3QEHB 4CVXB 2EXWD 3WS6C 5C0NC 1YJDH 1LD9B 3FN0L 3TVMC 4KK9C 4NZUH 1PJ9A 2QKIA 4EDXB 1I8LA 2AJYL 1FYTB 1FL3A 4X80H 2VE6A 1K9TA 3QJHA 3GI9H 1EUUA 2BMKA 2ZUYA 3LB6C 5E2UH 3RQ3A 5ALBH 2PTTA 1G7HB 2VLLA 3ARDB 4PREB 3GRWA 1DFBL 3WFEL 1CT8A 5MEOB 1AR1D 4OT1L 1OSZA 4X9HA 3RWHB 4BYHA 3TLRA 3F58L 5JORA 3WDJA 1QRNA 2XKSA 3PHQA 4DOHB 2ED7A 3MOBL 1P2CA 4YHYB 1P4IL 2WBKA 3MLZL 3KAAA 3BQUA 3VA6A 5MHSE 3IDJA 2Z8RA 1ZT7B 5DJ6A 3BPNC 2EEAA 3C08L 2VIRA 4AM0B 1MY7A 5C0BE 1JHLL 1FL6B 2P8MB 2A6DA 4S1RH 5FYLD 4Z7QE 4QNPF 3FB8B 3RAJH 1HYSD 1MVUA 4EN3D 4ALAH 4W6YB 5BS0E 3LN4B 5DMIH 5JZ7C 1OSPL 4ZPVA 1T89C 3MRBB 3KJ4B 3KPRD 4UT6H 5T1DL 3MV8E 2B20A 1DUYA 3HHRB 5F96L 4IRJA 4HGKC 4N0YL 1BLNA 8FABB 3RHWF 4HJJL 5I66B 4RBPH 1NDMA 4U1KA 4OLUL 3S7GA 1G7LB 1TQCB 2O61B 5F1IA 4Q0XH 5I1IH 4KV5E 5IM7B 3BAEL 4MAYD 3RTQD 4HKJB 2CUMA 3QG7H 1T03L 1A9BA 4E0RA 3LKNB 3PWJB 3KXFD 1BAFL 5DMYA 3CFDA 1DVFB 5GRWA 5JIHA 1I8KB 3NPSB 4EDWH 8CGTA 5K59E 1FZOA 2R0WH 5KS9B 2EYRB 3DROA 5EIQA 4NNPH 3R1GH 1YEFH 5DUPL 3O4LA 3DV6A 3EYVA 3A67L 2ESVB 5TQ2L 3WDHA 4X98A 5CJXA 2DQHL 1I85A 3MFFB 4G6FB 5I18H 1ZGLP 3MLTB 4OZHE 2R1YA 4U6XB 4OM1H 4P2QE 1BZ9A 4UINH 2MNUA 1NC2B 2A6JB 4IOSD 1HI6A 4RQQA 1UCTA 4UBDD 32C2B 4IOFD 2OK0H 1WEJH 4I77L 1ZSDB 2I9TB 1UXSB 3IVKA 3S35L 1A1OB 1DBKL 1DQQB 1MIML 2C4FT 3QNXA 3RPIA 1CR9L 5E8DL 3Q0HA 5HHME 3VFWB 4RMUA 1UM5H 3VXUA 2XNAB 3BWAB 2BSSB 3C5ZB 1WFTA 4P5TD 2JIXA 1EHAA 3C8KB 4HIEB 1VERA 1XCQB 2AAVA 5FHBL 4Z7OF 3BDYH 5F88B 3B4NA 3QUKB 4GXVH 4U6VH 3ZT7A 1P69B 1X5LA 1I7RA 3GKZA 4ONFL 3LKQA 2ADJA 2ID5A 4TULH 1HH9A 3D85A 2XG5A 2Q8BL 1RZGA 3AS1A 2H6PA 2MWCA 4KQ3H 1L0XA 4OLZL 4ZFFA 2VDML 3TNMB 4PJBA 2EZ0C 4LPCA 5HI4D 2LU3A 3RUGA 1FLRL 4X6CB 3S5LB 1WBXB 3HR5B 4MNHB 5BXFA 3SBWC 5AEAA 3O6FB 1NCCH 2YRLA 1J05B 4LPWA 4P4RA 3UTZB 5D6CA 3NZHL 1I9IL 1QLEL 4O2FA 3O8XA 1NC4D 3EYSL 4QHKI 4M5YH 4MJ6A 4XBPB 3FO9B 4NQCE 5ENWA 4H1LA 1VESA 1T1WA 4XC3L 3O3AA 3IYLW 5FV2A 4K9EC 1L0YA 3QFJD 3QEGL 5E99H 3W39A 3Q3GB 1EVUA 3FT2A 4N0RA 2CPCA 2GIYA 3MX0A 4RSVA 4EBQH 5IB2B 3HRZB 2J88H 3AAZA 5BRZA 5I2IB 3TBYB 1JZ6A 4UV7L 2G5RA 1J1OH 4PJCE 4YFLF 4JRXE 4HCRH 4UOJA 1U3HD 2P24B 4OFDA 1QFPA 4AQOA 2EYTB 2H2PD 4M7LH 5AAWA 1ADQA 3BW9B 4XCNA 4FS0A 1KGCD 4TPRL 1MHEA 3V6ZB 2PF6A 5DD6A 4ZUUA 5JOPD 4L8SC 1K8IA 2DF3A 5DMGD 1EA9C 2XZQL 5C9KA 1OGAD 3VFMB 3RNKA 4QWWC 3DIFB 4X4ME 4WGWB 4LLYB 1EGJA 2EH7L 3HG1B 1TLKA 2O5XL 1HKLH 2BNQA 2FO1A 1CU4L 5F1NB 15C8L 3SJVD 3ZDYE 4F15C 4I13B 1GOHA 4ZTPL 3DRTB 3RDTA 2GSGA 2X4QB 4HH9B 1IGJA 5I0DA 3OAZK 4OV5B 5EOQL 3KPLA 1LO3H 1PBYA 3WFDH 1J1XH 4YDVB 5HYQB 1F3DH 4XVUC 3EO0B 5EUOB 5JR1H 4JDTL 1QUNA 5C0FA 2AEPH 4PJXA 4JO1L 4IMKA 3C60D 4S1DD 2R0LH 1LDPL 4LSVH 2YD3A 4NN6C 2GAZB 4TTGA 3RL2B 1A6WL 5D7SL 3OGOE 1HSAB 2ILLA 4KDTA 3CU7A 4W70A 5KOVC 3TT3H 3FAXA 4PGCA 1YEGL 3G6AA 2GTWB 1B3JA 1Z5LB 5MI0B 1LNUA 5JW4N 4N8CH 1GGBH 3JWDL 4NFBA 4NN5C 2CDGB 3WIHA 3QDME 3DI2B 4AYFA 1OAUL 5C07B 4KJQC 5B22A 3QCUL 4Y2OA 3MRMB 1LK3L 4QKXB 5IWLA 1FO0L 4I3RL 1R5WB 2ADGA 5JQ6H 4JFOA 3SDAB 4LF3A 2B1AL 1GXEA 3G5VA 4CU8A 3QUZD 4Z76A 1D6VL 1QR1B 4QGYA 1NGQL 1JP5A 4YPGB 2YXMA 4O02L 4BSJA 1ETZA 3I2CL 2BVQB 2P5EE 5C7XH 3PHOA 1MLBB 1AGEA 3KPRA 3U9PH 3PXJA 1T21B 3TN0B 3BH8A 3HAEG 2IBZX 3VU2A 1L7TL 1Z6JT 1OGTA 2G2RA 3D25B 1QSVA 2J6EH 3LMJH 3AY4C 4OLWL 3L9RA 4LKXB 5DXWA 1OP3H 1A22B 2G5BA 4JJHA 4XPFH 3OXSA 4K23L 5D2NC 4GKNA 4S2SA 3RTQA 5IMLA 4EUPG 2HH0L 2NTFB 4D8PA 4P2CG 3MOAL 5DHYB 1RZJH 3EDDA 1WWAX 3Q1SL 3V5DA 2AJUH 4MAYB 5H2BB 1JI2A 4EI5A 1G6RA 4N8VA 1UEMA 2J5LB 2Z93B 2X7LB 3QXDB 5JO5A 5KVEH 3KXFB 2CK0H 5DVMA 5DEFA 3V6OE 3AU1A 1UENA 2Q76B 2UYLA 4ZNCD 3MNWB 3HZKA 2JJTA 5EZIH 4OD2A 2MQ3A 5GRYA 2XA8H 4LVOC 1XR8B 1MRFL 4N8PA 3PQYD 4WI2A 3HE6C 2YSSB 5CINH 1WK0A 1MHCA 5CMAA 5I8EB 5JOEA 3WO4C 1YMMB 2DAVA 1G1YA 5FYJL 3H7BA 1OOAA 3DGCR 4PJDA 2HRPL 3AXLA 2AEQL 4OZ4B 5DJZA 3LN9A 4GRMA 3ORJA 2AV7B 4YGVB 4XNXL 3OPZH 3S88H 1ONQB 3DTXA 1UT9A 1H5BC 1B90A 3BKYH 5GSVB 4GMSL 3HZYA 4PFEA 1S5IL 5FYJE 3D0VA 4LQFH 3C9NB 1KN4H 1BFOB 2F5BL 3CGTA 4YHLH 2VLKD 1D7FA 3V4PL 1MI5E 3W81A 5E9DD 5C71A 3DXAA 3GMLB 3QRGL 2BRRL 1CD1A 3PWPA 2NW3B 3GI8L 4LSPL 4Y5VA 2JTDA 5F7DA 3VXNB 1DBMH 1D5IH 1KJVA 4P5TB 4HUVB 3WXVL 3TA3C 1MVFA 3N0PB 4R90L 1MFBL 1ZWIA 4G8GD 4OD3H 5D1ZC 3RKDD 2HP4A 1FZMA 3PHSA 2Z35A 3MRGB 4Z95H 5L9DL 4Z0BH 4EI6A 1BGXL 3P4LA 4PRNA 2FWOB 4C56A 5ITFA 3MCKA 1I7UB 2IPKA 4WW2F 4QHMA 3PNWB 4X9FA 2VZ1A 2CLVB 2VL5B 2X4SB 1RY7B 2PN5A 4MNQB 4I3SH 3FB7B 3IF1B 5L6YH 1JVKA 3GMNB 5FOBB 1AGCA 1V3JA 2CKBB 3G6DH 1NC4A 4M7LT 5D5MF 2VB5A 4K8RC 2Q7YA 3GSVB 1BBDL 1RIUH 5DEGA 1UB6A 4XMKH 4ZNEA 2FGWL 4Y8AA 1MCHA 3QFJA 4QXUL 5D93B 4NC2B 3WIFB 2IFFL 2CXGA 3C6LD 3SDXB 4OUOA 2Y4SA 4NQXB 1ORQB 2NX5D 1U8MA 5FYJU 4KTDH 4OZFG 4AENA 4XP1H 5AD0B 5HGGS 3BZFA 4PRIA 1N59A 4BZ1H 5CLWA 3T2OA 4KAQL 3RGVD 1FNAA 4OD1L 1W72A 5LCVH 4LCCA 4N9GB 1FVEA 4NC1E 4CUCA 4JY5H 2H32H 3LRSB 1WBZA 1AQKH 3ARSA 3PV6A 4V2CB 1IC5L 1U3HB 1MCKA 4TUOB 4LCYA 4MA3A 1ZEAL 3WXWL 2QSQA 3LQAL 4PJ5D 1OGAA 4NJ9H 3UPRA 5GRJL 3NFPB 4M6OH 1H3TA 3MO1B 4DFIA 3CSGA 4JR9H 1IQDA 2W07A 3HLAB 5IT2L 5A43C 1YECH 5GZOD 4RMRA 4DUXA 1FSKC 1JK8B 4H25A 1SJHA 1MIEH 3LHPH 1Q9LB 4Z7UF 3LEVH 1OF2A 1R5IB 3PIQB 5J6HA 3OF6D 2G60L 4L4TA 1S7VB 5E56A 3T09A 2NY3B 2L7UA 4ENEC 1TZIB 3MRRA 4JKWA 1IL1A 2A9NL 4GRWB 4M8VA 5D1QB 5BQ7B 3SJVB 1DLFH 1BWWA 1K6QL 4XVTH 1A7OL 2XRAH 3ZTNL 4MX7B 5DRZA 3H9SB 4GFTB 3AMLA 4LLDA 4WWKB 4X7EC 1H3WM 5E2WH 1CL7H 1IGCL 5C0CA 2YPLA 2YPKA 1J87A 3S96B 1NSNL 1MCDA 3ALPA 1FNFA 1RVFH 4HQQH 1B9ZA 4U6HA 1VFAB 2IAMA 4U3XA 2XQYG 1A47A 1B2WL 1H3GA 3JWDC 2F53D 4JFYB 3C60B 1TPXB 4NQDB 3TV3L 1F4WL 2GCYA 1C08A 2FL5B 4G7VH 4XNUL 1UXWA 2XFXA 1AJ7L 1KB5A 5GGSA 4HS8L 3HMXA 4ODTH 3QG6A 2C3GA 2EXYC 3QPQC 3SDCD 1ZVYA 5HYFA 4OCSL 1JYXA 2QQNH 4Y4HA 3OL2A 4P5MA 4F58L 1XIWC 5F3BB 1G7PB 2WLZA 4X4ZA 2G75A 4CVUA 2WWKT 5FFLA 3QUYB 3HE7C 4OFKA 1QRNE 2EDFA 4MYWB 4DGYH 4ODSL 3ARZA 4N90D 1ZLSH 5FB8A 4QHUA 1N5YL 1EO7A 2ZOLB 5DRWA 1IQWL 3TCXA 3QUZA 5CGTA 4D9LH 4N5ED 1E4XI 5GSRA 5IV2A 4H20L 1PEZA 1R24A 2CIIA 2DBJA 3QUXB 1K4CB 1DSFL 1ZLWH 3WNKA 3S4SA 1JPST 5DVOA 1YMHB 5CJ8A 1FCGA 5JHLH 1XF3A 4DKFH 4PBXA 3K7UA 4H88H 2APWA 6FABH 1BBJA 1A2YA 1FGNH 3L3HA 5E6ID 5KVMC 1A9EB 4LEOB 4MQ7B 4XPBL 3SKJH 2VLRD 1AGDA 3GBML 5I73C 1YQVL 2HJLB 4LHUG 1JZ7A 3V8CA 1BD2A 4ELMB 4JFFD 3ULVC 1NH6A 5IMKB 5DZOA 4GXUM 4RRPA 3IFLH 1TDQA 4OCWH 1BFVL 1J0IA 4CMMA 4MXVF 1HHHB 3W9EA 4E5XB 5IFHL 5DQJA 1U3JA 4ZXBC 2FHCA 2D0FA 3X14B 2OTWA 3QI9C 4X0KA 4X5WA 4HXBH 2X1WL 5KN5A 4UIKL 3WN5C 1VB9A 4FFYH 1NLDL 5FIEA 4XCFH 1OTTD 3O4LE 4XCEA 3PQYA 3X13A 2OLDA 4NT6A 3RX8A 5GS0H 1RHHB 3MV9D 3U82B 3LRGA 4CMHB 4JFZH 1JZ5A 2A73B 5IB3A 4TOYH 4YHIB 2GJZA 4XCYA 1JGVH 3IFOB 4M61B 3AREC 3SGKA 1SEBA 1YPZF 3BN9C 5D7IF 1F58H 4K94H 5KSVA 5IJKA 3MZTA 1TFHA 2Y5TB 3LDBC 1BQHB 2CDFA 1MCIA 1A7PL 5E9DA 3U2SB 1LO2H 4NCC2 4BQBA 3FT3A 1PG7H 1T1ZB 3FO1A 1YNTB 1ND0A 1Q9WA 2FX8H 3OBAA 4ONOA 4ZFGL 2HFFA 3VXTB 3M1BB 1ZVSA 4KGJA 3VD9A 4X6DF 3VCLA 3BSZH 1PFCA 4JPIA 2UVFA 4G8GA 5DK2A 1MF2L 1IZKA 4NKIL 5T5NG 4LBEB 1X7QB 3EHBC 3T2NH 4HG4J 1I7ZA 4GRLB 3IFNH 4RBPK 4PRPD 5C86A 4XHJC 5FGCE 2PR4H 3VFUB 4M48H 5MEQA 2HTKC 4PJBE 3QXAA 3HNVH 2BSRA 5DEZA 4KUZL 1WIOA 5DT1H 5GJTH 1SY6H 1ZHBB 4J4PA 5CJOL 1VGEH 4HKXB 3CXDL 4Y5YB 1UFUA 5JUEH 3D9AH 3HNSH 2DJ4A 3GNML 4ACPA 2BNRD 4YDLB 1X5ZA 4PP2B 4R8WL 3RGVA 2NX5B 4O9HH 2CJUH 5TGBB 4JFQA 2FR4B 1ADQL 1MQ8A 1YN6B 3GHBH 1QSZA 3LEYH 5FUOL 5BRZE 1LE5A 5T33H 2A1WH 4JHZA 1C7SA 5KW9L 2VISA 1IC4H 2ICWA 3CMOH 4WNQA 4BFBD 3LOWA 2WW8A 4APQD 4ETYA 1M1SA 1ZANL 3KPQA 4OLYL 4HKBB 4JFHE 2IG2H 1EGJL 3QAZB 1BZQK 2V5TA 2NYYC 4JFDB 5IEHB 5EOCJ 1HHGB 4G7YH 1SVCP 4DCQA 4ODXB 1CLOH 4PJ5B 4W4NA 2CMRH 1I1YA 3DX8B 1KPUA 4PJAF 3CFEA 3MRIB 2BNQE 4OZIF 2NLJA 2OR9H 4FOMA 3OF6A 2ADFL 3F65A 2X1XR 3ARDC 4XXDA 4YIQA 2V9TA 3MLYH 4JO2L 3IXAA 1I1CA 3OAUL 1JWSA 3O9WD 3UJTL 4OAWA 1RIVH 2F54D 1S9XA 3KPSB 5MEND 2E27H 3LD8B 4JZNB 3DNKA 1A6AA 3L3KA 4LP4A 3MA9H 4MSWA 4P9MH 4YHYC 5DWUH 4M6ML 4DGIL 1E6OH 1VENA 2NY0D 1D5ZA 4JRYD 3OKYA 4PJXE 4NO0B 1I3VA 3CD4A 4JFXB 1YEHL 2VXQL 2R4SH 2F53A 1KTDA 2M2DA 1A3QA 1XR9B 3O11A 4M6AA 3CNKA 4PIRF 2DQGH 3PWLA 4RWYH 1A6UH 1S7QA 3KJ4C 3WIHL 1X5XA 4MA8H 1PKQA 4JDZA 1K3ZA 4UNVA 5B8CB 5ECJE 1T66D 1I9EA 2H2SD 3SDCB 3L3OB 4D0BB 4NKDA 5FYLL 3VGAB 1TQCC 1T5XB 1XF4B 2V5YA 3DV4B 1PZ5B 2VC2L 2DTML 5GRVK 1E4XL 4L8CB 3FT4B 2F5AH 4DKEH 1U3YA 5HY9A 5FYLE 1DVFC 1UWGL 3GEWB 4WW2B 3NPSC 4BH7A 2PKDA 4OI8A 1DE4A 1P7QD 4WUKH 1JBJA 3G04A 5FGBC 4JN2B 4F7TB 3SGEI 1WZMA 5D5MA 3OHXB 4QGTA 2PXYB 5EPMA 3KPRE 4JHWL 3BHBA 1RUPH 2V9QA 3MGAA 5LGHL 3U0WL 1KXTB 5KSAD 2NMSA 2X4PA 5F71A 1A6VH 1WT5C 5E6IA 3R8QA 2VLRA 3UAJD 2OQJA 3BD4A 1J0JA 2BSTB 1G6RL 1HILA 4DVBA 4YFLI 1YC8A 3T0WA 4LSTH 2VN4A 5IHUH 1HNFA 3CH1B 5GISH 1EERB 3MGTB 5DGRA 1G7QA 4Z7VE 5FUZL 5E5RB 2V7NB 3U7WH 1IGYB 1NCDL 2WINA 5DA0B 4QYOA 4TSCL 5FV1L 1T83A 4R96B 1JGEA 2OR7A 4C59B 4I18A 2VLMD 1G7IA 5E1AB 5BO1L 3FO0H 3L7FA 3C5ZC 1V7MH 4LCUB 1F4XL 5KG9A 3ZYIA 3CFJA 4HS6A 1Q9OA 4JJ5B 2VDQH 2ZSVB 4K3EL 3MV9A 1DBJH 3RIFF 5IVZA 3MJ6A 4U0QB 5ADPL 2VDNH 4Z7UA 4DAGH 4U2YA 3RWCA 3X3GL 4PJDE 2FZ3B 3RWJB 4L4VD 4LRIC 1CIDA 4XT1C 5F9AC 1ROWA 2BJML 3DUSA 2EE9A 3QWQB 1XGUB 2QSTA 1BVKA 3I6GA 3OKKA 4Y4FD 2B4CL 3O6FC 1AO7D 5B4MD 1BHGA 1QFUL 2XWJB 4JZOB 2NTSP 3PWPE 4UOW1 3KLAB 3IDGA 5CP3H 5HYJA 3E8UH 3MJ9L 5DFVD 5CUSL 4AG4L 2OYPA 3LZFH 5LJYH 2I9LA 4FMKA 4Y5XA 3ARGB 1MJUL 2CKBL 3UCRA 3U1SH 5JXEC 3O2DL 2Z31B 5HDQL 5BZWA 5FKAB 4PRPA 3QA3B 5M94B 3GMOB 2WUCL 4OCYH 1OP3K 4C56E 4UOW0 5GZNC 4N5UA 2OM5A 1WCQA 2P5WB 4LCWB 1N0XL 2IQAA 3TBSA 1R3HA 1QLRB 3BP6A 4KI5F 4PRDB 2IJ0C 3BZEA 2OP4H 4KQ4L 5F9OL 3G08A 3KR3L 2YZ8A 3K1DA 4OCXH 3N9GH 3W11D 4P59L 5AYQA 5F6IB 1AD0A 1OM3H 2OR8A 2H32B 3CU1A 3KPNB 5EU7E 1AHWB 1G9NC 1JPGB 4QNPE 2E5EA 2FH6A 3OKNA 4RAVB 4ZNEE 3TCLA 3GHEH 1IGTA 1EHNA 2VKXA 2AQ3A 5IG7B 3QFJE 5CD5C 1KXQE 4XBGA 2YUZA 5JW4R 2P7TB 3TJEH 2C4FU 4XP4H 2BNRA 5DLML 9CGTA 3TM6A 2C9AA 1FV1B 4FQIH 1MCQA 4U1MB 3JWOL 4PRIE 2FHFA 3EW3B 1LWRA 2XWBB 5L2KB 1FJ1A 1M4KA 3NCEB 3Q6FB 1CFTB 1ZTXH 1F97A 2DYPB 4NZUL 3S6CA 1JPFA 2GK0B 5JOPE 2EXWC 1SBSH 2X4NB 4NWUH 4X80L 2J4WH 2HJKB 1O7SA 1OGAE 1S3KH 4G6MH 4IS6A 1VGKA 3GI9L 5DA4A 2VMFA 2W38A 4JB9H 2J8OA 3NMEA 3R8BB 1IAKB 2V2WA 4BH8B 3ZMRA 4NOFA 2QKIB 5HI3C 3M8OL 4JHAH 2E7LA 1EEUA 5F7HA 2QLVB 1FL3B 4LAJH 1CFQA 4L4TE 4HDIB 4LSSH 5MI0C 1VEOA 4AEIH 4HFWA 4YHOH 1FFRA 2F54A 3QDJA 2DICA 5MENA 3GSNH 4Q6IA 1OTSD 3EZJB 4HLZH 2GUOA 3O9WB 3GSQA 1YPZA 5JW5A 4NM8H 2YPLE 5D7IA 4S1RL 3SDAC 3SY0B 1WCBA 3RAJL 4HLJA 2AQ1A 1Z0NA 1KB5L 3LEXB 2XZAH 4LLMA 4JREB 4MJID 4KKBD 4UT6L 5DJ6B 1EBPA 4QRQB 4EN3C 1YEIL 1R3LB 2A6DB 4S1QH 3TN0C 1AKJD 3AFLA 4X6DA 3F7RA 4PJIF 2JB5L 4RMSA 4LRNH 2BERA 4UNTA 4BSWB 3S97C 2CDEB 4WFHD 3QQ9C 1GC1H 4FP8H 3DSFL 3QEUA 1DUYB 3KGRA 1X6NA 1HN1A 2W9EH 4J3UA 5SWSB 4DN4H 3JUYA 1TJHL 4NNXA 1Y6KR 3JVGA 1BLNB 3DVNB 1KV3A 4KY1L 4ZOEA 3RL1B 1NDMB 3L95B 4G42B 4U1KB 5HHNA 4EDWL 4MAYC 3MGOA 4QRPD 2R0WL 2IADB 1FVDA 1JE6A 2J5LC 4PJEF 4KI5D 4CAGA 4PJ7F 2BVOB 2YKLH 4F9LC 3L7EB 5J7CC 2ED9A 3B6SA 43CAA 1XCTA 3DMMA 5HGHA 5KSAA 1WBYA 3EGSA 4UIMB 1TJIL 3NABH 4ZUVB 2CR3A 1CE6A 4OM1L 4R2GD 5FA3A 5FKPA 4UINL 4AQ1B 1NCWL 1T6WA 3UTTD 5DO2C 3EYVB 3RU8H 4G43A 3HAEH 3MJ7B 2FD6L 3N1GC 1B4JH 1BD2E 3FFCA 4NNYB 1HZHH 4L3ED 4YBQD 4ZOBA 3IGAB 3MRDA 4NP4L 5IJVB 4LLUA 3CUPA 2R1YB 1BZ9B 4IOFC 1UM5L 3V52H 5ACLA 2EDRA 1EFXD 4EUPH 5HVFB 1NMCB 1TTGA 5LKNA 4E9LA 1EUTA 2W0LA 3BDYL 4KKCC 3DECA 1D9KD 4L9LB 4TUJB 3VI4F 4U6VL 4GXVL 3ECBA 3CDCA 2VWEC 1BP3B 4P5TC 4MVBD 3PQYE 3VXUB 1TTFA 4TULL 3RVXC 4JQVC 5BMFH 5CBEB 1DDHA 3OX8A 2JIXB 3IKCA 5E7FA 2P1YA 3RWDA 4PJAB 3B9DA 4LK4A 3FOMB 5IQ9A 4QTHB 5I1GH 2BVYA 1JMZA 4UTBL 1GSMA 4HWZA 2PYED 4TVSa 3U46B 1HH9B 3D85B 4WVRA 3BKCL 1FG2A 2IGFH 5AG8A 1NCCL 3X12A 4QRRD 2YA2A 2VLKE 1MY5A 4M5YL 5IB5B 3RZCA 1AO7A 4KVCL 5E9DE 1T80A 3WUWG 4OGZA 5EU3A 5EULV 3MBED 1F42A 4MJ5B 5E99L 5JW4M 3GSXA 4GW4A 3RUGB 3LKRB 1BFTA 5E6YA 4EBQL 4ZUSB 5D93C 1A14H 4LKCB 4O2FB 1E4KC 4G8GE 3O8XB 2VDOH 4MJ6B 4F7PA 3UZVB 4UUJB 3GDBA 5GRVL 3W39B 2OJEA 4HCRL 4DKAA 4JO3H 1RZKC 5DMJB 4NO2B 4M7LL 4B53A 4P9HC 2VSDA 4UT9H 4L1DA 1LO0H 5TQ0H 3OGCA 3AAZB 1UADC 1U3HC 1ZAGA 1R5VB 2H2PC 1VSCA 4G8IA 2N1KA 3ME0A 1T22B 4L8DA 1F4YL 3IXTB 3T0EB 3BPCA 2MFNA 1CF8H 3EYFA 1MHEB 1KLUB 2XA3A 1YJDC 1X6LA 4H5SB 1K3IA 4M1CD 3AB0B 2NX5E 5T5FL 4G80A 1HQRB 5GGTH 3HR6A 3ARBB 3O4OB 3STBA 2V5SA 5ICZB 5TJWK 2NY3C 3KLHD 2C3WA 1YY9D 1LO3L 5HHVH 3WFDL 1H15A 5D1QC 2ARJA 3FQNA 4WWKC 4OZFH 5HGDA 1CL7I 1N8ZB 2AEPL 1ZHKB 4PP1C 4X6BB 1S7RB 2DOCA 3MRJB 3U4EA 5JDSB 1S7WA 1S7SA 4FQHA 1RIHH 1CXKA 5TPWH 5I19H 3NTCL 4WGVB 4XAKD 5B38B 1KIPA 1XF5B 4CKVX 3LQMA 3C60C 1TPXC 5FDWB 2R0ZL 4YWGL 4HK0A 2XWTA 1QLFB 4WHTB 4K71B 3UPCA 4PTTB 1VKXB 5K9JH 4JY6A 4N8CL 1AQDA 3ZDXF 3LAFA 3CC5A 3VRIB 1VACB 3HRPA 4NYLB 5AUMA 1Q94B 5J89A 1YN7A 2CGRH 1M7IA 3EJYD 4I0KA 4EJ1C 3QUYC 5HJ3B 5FYKH 4P5KB 3I6KB 3BP4A 2DDQH 3V0VB 4NQEB 5J56B 1OW0C 5FA4A 5HYSB 5C7XL 2H3NA 3QUXC 2DLIA 3U9PL 2F53E 4RISL 3QCVL 43C9A 5KSUA 4MJIB 2CLZA 4EQ2A 1YA5A 3UYPA 4NWTH 2EDEA 1AKJA 5A1AA 5GJSH 1PKQE 2Z4QA 2J6EL 2QQKL 1NKRA 3LMJL 4OCLC 5ISZD 3C8DA 3MRNA 1YC7A 4TSAH 3BH8B 1RZJL 1M6OA 4YC2B 3G6JA 4OM0H 5F93C 2AJUL 1OGTB 4IJ3B 2VO5A 5MEPB 4R4FH 3TIDB 1JPSL 1KIQA 4HZLA 4QRPA 2G5BB 4F37K 4HGMA 3OXSB 1NL0H 1UJ3B 3H9ZA 3NIGF 5EBMA 1BVZA 1J10A 2IALB 1DN2A 1WUNT 4M02A 5ICXB 2XXCB 5EZIL 1L4IA 3ARFB 5D5ME 4EI5B 4ZUTB 4M9OA 4N8VB 4GH7B 4G6AD 1MEXL 4ZMAT 5CINL 4DQOH 1VFBB 2IBZY 3HZKB 3WNOA 3NACH 3L3DA 1FCCA 2VLRE 4HMCA 4CMHC 2B2XH 4HBCL 3RZWA 4ZD3H 4JFFE 1YEKH 2DM4A 3S88L 3OPZL 2D31B 3BPLB 4L3EA 2YD2A 5I1AA 4OLVH 1MUJB 3ROOA 4I8DA 1RJYB 3QJFA 4LQFL 1DUZB 4YHLL 4PJ9A 2Y72A 3K4ZA 4X9BA 3IDMA 1U8KA 4LVNB 2EH8H 4P23B 2DQCH 4GW5A 4PB0H 2I07A 5GRXG 4FXKA 1P7KB 3KYNB 2PETA 4RGNB 4E42A 4OZGF 4TQEL 1EFXB 3MACH 1N64H 4KU1A 1DBML 5JPMB 4EXKA 2EDKA 3FOLA 3D0VB 3CSYA 4OD3L 3EOYG 4Z95L 4Z0BL 1FNGA 1QG3A 3DXAB 5A3ID 3RIFK 3MV9E 1QQDB 1Q38A 5FM5M 1P6AB 1HEZA 5CSZA 1A5FH 2GYSA 4Z7UE 1OTUD 5F7DB 1ZA6B 3F7YB 4GRLC 3RKDC 3PL6D 3AMKA 3VFNB 1NGZB 1CWVA 5H8DA 1YEDB 4NZJA 3JTTB 4CU6A 5BV7B 4I3SL 4AIOA 4HWUA 3QIWB 4QRRA 4BK4A 4Z8FL 2DQUH 3CLEH 3S5LG 3G6DL 1LEGA 2PYEB 2HVJA 2VAAA 5ITFB 2BVPB 4JY4A 3U36B 2E7BA 4XMKL 3P9WB 2UZIH 2MHAB 1QPXA 4JFED 5FM4A 4EZMA 3H9HB 1I7TB 4WV1A 4KTDL 1AGCB 1GGIL 4LPTA 3GMMB 1T20A 4XP1L 1CFVH 1BQUA 4R7NB 4Y5YC 5HYJE 4BZ1L 3N50A 3WS3B 2HTLD 4CRPA 4U3HA 2VLJD 2YD6A 5DEGB 1IBGH 1UB6B 2FHBA 3MLRH 4YDLC 5C0AD 4PJIA 4DJMA 5LCVL 1EBAA 4PTUA 4HUXA 1S7TA 3VJ6A 4JY5L 2D3VA 5B39B 2XPGA 2HT4C 4Z6AT 4PRPE 5A2LH 4WIQA 1AQKL 2R1XA 3H0TA 4WI3A 4CADB 1A3LH 1BIIB 1GZQB 2NXYB 4FXGA 3GSWB 5JHDB 4MWFB 1MCLA 2FDBP 4OIBA 3BD5A 3L6FB 3DYPA 3HUJA 1FL5A 1W72B 3QAZC 4NPYB 4LCCB 4NJ9L 1WWBX 2ZG1A 4JDVA 5I17A 2PYFA 4M6OL 3MLWH 4V1DA 2XTLA 4XVSL 4JR9L 3L3GB 1YECL 4P3CH 3DBXA 5F7LB 3D2UA 1NKOA 1XGPB 4PJ7A 3EDFA 4MA3B 1WICA 1XF1A 1MIEL 3FZUC 3AS3A 3LEVL 4PY7B 1UZ8A 2W0PA 3UPRB 3BI9X 4MAUH 3UZEA 2BNRE 2VDKH 1DLFL 4XVTL 4UQ3A 3OKMA 4QCIA 5HHXL 4H0HB 5E2WL 1CL7L 4H25B 4HF5H 7FABH 1OF2B 3CIQA 4ORGB 1LE9B 4LFHG 3LD8C 4HIHA 1RURH 2A0LC 3MRRB 3O2WH 1RVFL 2CO6B 1W8OA 3MV7D 2PO6B 3F6LA 2W59A 3BYYA 5J13B 4LLDB 2NY6D 3JSSA 1OHQA 2HVKB 3LH2H 4C83B 5C0CB 4OF3A 3GSNB 1DEDA 5EN2A 4G7VL 4B50A 4J1UB 4N0CC 4KRMB 5C6WH 4Z7WA 2WK2A 5KVDL 1F90L 1QFWH 1AY1H 1NCAL 4ODTL 1JWUB 4MCYB 1PX4A 1FH5H 4R4NC 5JDJA 5EU4A 1FZJB 2H45A 3GJEA 3TVMD 4HZAA 5F7FA 4KK9D 1V7NH 1NAKH 2XN9D 5B8CC 2GCYB 3QWOB 3QDGD 4QRTB 2AJZB 3SDCC 4DGYL 4F7CA 2F54E 2XFXB 4WDIA 1ZLSL 3QDJE 3VGAC 1GL4B 4G9FB 4LMQI 5MENE 1DL7L 3WKML 1R3JA 3MUY1 2Q20A 1IAOA 1YPZE 4GAYA 2O5YH 4LSUH 4D9LL 5T5NF 5D7IE 3MMEA 1IAIH 4JRYE 1P1ZB 2AK4D 2YS4A 4ZSOA 5KVGH 4WW2C 1O7VA 4M5ZH 5FB8B 3J7HA 3MOQA 1JHTB 1SYSA 5HGBB 3DX6A 1I8IA 3NA9L 3FRUB 1K2DB 4N5EC 4RIRB 5FM5O 4IRSD 4HKZB 3HKFA 5JHLL 4DKFL 2PXYC 1Q9KA 1W0VA 4H88L 5CWSA 4NGHH 3ROLB 1NGYA 3F6IA 1FGNL 2IBGA 1TCRA 2CIIB 5GIRB 2W9DH 4X6DE 1XH3A 1UA6H 5ISZA 3SKJL 5IB4A 2HMIC 2XQBL 2YXFA 4LGRB 4BZ2L 3UZQA 4NQSA 4H26A 5JZ7D 3MROB 4YHPB 2ZUSA 3E6HA 2O5ZH 5DMKB 3NBNA 3IFLL 3MRQB 1A2YB 3T4YA 1HH6A 3GBNH 3SGDH 1D5XB 2HT2D 2ATKB 35C8H 3BGMB 1KPRA 5D72H 1FORL 4HXBL 5HYIA 3AGVA 3HZVA 4FFYL 2J7LA 3QT2A 1J1PH 2Z0BA 3K8LA 1WTGT 3N1MC 4LHUD 5D1XD 5DQJB 1QSFA 4NSKB 4Z9KB 4EUPB 4JFZL 5CD3B 4YAQB 5GGRB 1QRKA 4F57H 1R3IL 2HLAB 3BEWB 4TOYL 5KN5B 3FFDB 1OTTC 1F3RB 3QXWA 4WO4A 3WYRA 4XP6H 1XFPA 1F4AA 1F58L 1MWAH 2ZCLH 4YE4L 4K94L 3OXRB 1TZHB 5JOFA 4NCC1 1ZGLA 1AI1H 1HOCB 5DC4B 2ZUTA 4LPXA 1MCJA 2GW5A 4TNVK 1KPVB 3RWGB 2GT9A 4XCYB 4DVRH 1SEBB 1I9RL 1LO2L 4JZJA 5BVJA 2GK2A 2BK8A 2FX8L 4EOWL 2VLME 1CXHA 4ZYKB 3L5JA 2YC1B 4JVUA 3ULSB 5DHVA 3TNNB 1ACZA 3BSZL 3BESR 3L5WA 4QOKD 2COQA 4PRAA 2HKFH 5DTFA 4MZ3A 1JNLH 3Q6GL 3QQNA 2RFXA 1P4LB 1NUFA 1RJZB 1I9JH 4MLIA 3RWIB 3FT3B 3IFNL 1U41A 4PJAE 2E7MA 1V05A 4ZOCA 4OZIE 3ARGC 1B0GA 3T2PA 3P11H 2Z31C 2PR4L 4ETQA 5B3JF 4PJ8B 1FFNA 4ZFOB 2FO4A 2ITCB 2Y7QA 3PL6B 4DGVL 4L4VE 2EE3A 2I24N 4LASH 2C1OB 3GIVA 3KYKL 2H1PH 3KLSA 4Q9BA 1D3CA 4NKOB 5DT1L 5F9WB 5J9PA 1SY6L 3EJZC 3HC3H 4EKXA 4NZDA 4PLOB 3P9MB 1AO7E 5LGKA 5F6IC 3GSOB 4N0UB 1VGEL 1U8PB 1HHKA 3M45A 2VZOA 1AHWC 5JUEL 1NGPL 3D9AL 1NBZB 5CKAA 4NBZB 3HNSL 3QP3A 2BSRB 2X70A 2OSLA 2XYCA 3CVHH 4QY8A 2EZ0D 3DX9B 3VI3F 3UO1L 3GB7A 5C0AA 5E8PB 5TH2B 2SEBB 1EHLL 3WL9A 5T33L 2A1WL 4JPKH 3CDGA 1IC4L 4X7TA 2J1KA 3CMOL 2MTPA 2DD8H 5GGTA 3MRKA 4J3OC 5LQBL 2DTSA 4AMKH 3KS0J 2ZUQB 1JNHB 2IG2L 3HN3A 3S37X 1FAIL 2P47B 3MJGX 4KROB 4LU5H 5DVLA 4U6YB 3BGAA 1XMWA 4OZFA 2ICWB 4KMQA 4G7YL 1F5WA 1CDJA 1CLOL 3PGDB 2Y06H 2CMRL 5TFSH 3WJLC 4NO5A 2G9HA 1LP9B 3MBXL 1CTNA 2LU4A 3VFTA 1BX2B 3MUHL 5JNYA 5L2JA 1NEZB 3INUH 4ODHL 3MLYL 2RR3A 3S34H 2A83A 3IJYB 1RIVL 4DZ8B 4HJGB 4QHKJ 3H3PH 3V0AC 1I1YB 1IKFH 1Z9MA 1MREH 2E27L 4B7IA 4HWEH 2CRYA 2YD8A 4P9ML 3SKNA 5DWUL 2EIDA 4Q9QH 1E6OL 3O9WC 4RNRB 3WHXA 2E7CA 5H94B 3UJJH 3MV7A 5IKCB 1NFDF 4LLQA 1S9XB 2R4SL 2YD4A 3W0WD 4WI5A 1U8LA 5L8LB 3I50H 1QEWA 2DQGL 3L3KB 1JNNL 1RUAH 2EYSA 2QADD 4MSWB 3ZHDA 2ITDA 2NY6B 4I48B 5DS8A 4MA8L 4OZGA 3VFPA 2JLLA 3WS6A 2E8ZA 3PWUB 1MHHB 1W0YT 5SX4I 1F6AA 1SYVB 1T04B 4XVUD 3TVMA 1N5AA 1A4JA 3NCCB 1KTDB 2DIBA 1XF2A 2XN9A 3JV6B 3MYZA 3IDNB 3QDGA 3O11B 4PB9H 4RAHA 2BHZA 4Y8DC 4PRHD 3PWLB 4LLWB 1QO3A 1RZ8A 1OAQH 5IW1A 4KPHH 4HUUA 3QQ3A 1Q72H 1T66C 3SCMA 5FF6B 4ZTOH 4ELKA 2H2SC 2FX9L 1CG9A 2J8UF 3TF7C 1CGXA 1RK1A 1CZ8H 1GGTA 2EDHA 4LMQE 3VXQA 4XMLH 4WUKL 4WW1A 2YUVA 4TSBH 5HHQB 4X6EB 2DMCA 1DQTA 2DBLL 4BSVA 3BDXA 1RUPL 4KJQD 1JGDA 5IB1B 1XGYL 3NFNB 3OJ2C 3QUMA 3N1FC 1A6VL 4IRSB 4BH7B 1DE4B 1W0WA 1PYWB 4LPUA 1OT2A 2AI0H 2BNUA 2VZTA 3CFKB 2VXVH 3RVUC 2R2HB 1JHKH 2DI8A 5T1KA 5KBNC 4GAJH 4WFHE 5ID0B 1T89A 3REWA 2BOCA 1A6ZA 4HS3B 5FGRA 4JKLA 3D3VB 1PX3A 5CAYB 5F9JA 2E9IA 2OQJB 1ZKAA 3VXMD 5GS0C 4QRPE 4O4YH 1EEYA 1MJ8H 4XX1G 3S3PA 3WEXB 5FO9A 5J4MA 5FO7A 2BVUA 4KI5E 4Y89A 1SBBA 5E8OA 2JELH 2ZG3A 3OJDA 4IHOB 3FO0L 4OKDA 3RY4A 5DUBB 1NMCC 5EC1A 2A74A 5E08H 1MQKH 4LHUA 5IVXF 4K94C 4UV4L 1F8TH 4L9LC 1BECA 4UDUB 1DBJL 5SWZA 2V2XB 2AV1B 2HKHH 5D1XB 5INCA 3UPAA 1CLCA 2FB4H 3P0VH 4DAGL 3UTTE 3QQ4A 4NN7B 4N0FA 1QBLL 4TUKH 4HS6B 1HHJA 4R6UA 1Q0YH 3GIZL 4L3EE 4EXPX 1LEIB 1UVQA 1BQHG 1I1AA 3DGGA 1WZLA 4LQ1A 3I02A 1FRGL 1FFPB 2Q3ZA 5F7NC 3ULVH 4WTZG 3MNVB 4Q2ZB 3TBWA 4JQIH 1OAZH 3RIAK 1U8IB 4ZQKA 3BO8B 3BISA 2F74B 1OAXH 2LAGB 5IMOA 4FMFA 1WC7B 3E8UL 5DI8A 5IFAH 1X4ZA 4LARH 3SKOA 3LZFL 3O2VH 1M71A 4WI9A 4QOKB 1RPQA 2E3VA 2E9JA 3O8XC 1ACYH 4HFUH 4CNIA 2XQYK 5DQDH 3IAQA 5DSCB 1MRDH 3L1OL 4OCYL 5A2JH 4PJFF 1NCTA 5DFVC 2KDGA 1CDYA 2OX5A 4XVJL 1L9NA 2BVTA 4UZGA 3OKEB 4X6FB 5FCSH 3NN8A 1V3LA 1X3DA 2Y6SC 5CEXA 4GG8A 2OP4L 5DD0H 4G6KH 4NUJB 3EFFA 1PKOA 1S5HA 3N9GL 4OCXL 3TA3D 3DPBA 3MODH 5D1ZD 2AGJH 4QRRE 4UDTB 1INQA 4MQXC 2OMBA 1OM3L 3IJHA 4P2RD 4MXWH 3GHEL 2IQAB 4NQTA 1A1MA 2D0HA 3GSRB 4HC1H 3T0EC 5D7LD 1AXSB 3BZEB 4NO3A 3TJEL 2JJSC 3WDIA 3RNQB 4XP4L 3OJMB 3CDFA 25C8H 1JF5A 3AB0C 5EOCH 1ORSA 3BH9B 3MV11 1CXEA 3TYFB 3SBWA 4KK8C 1IE5A 5FM8A 3ARBC 3OKNB 3QO0B 5JW3H 4I2XA 3O4OC 2F15A 4PJIE 1RJLB 2D03L 1QHPA 4K8RD 1U8QA 1ZTXL 3BP7A 1NGXA 1GYAA 1IFHH 4MCZB 3WNPA 3L3JA 5C09A 4QEGA 1QNZL 1CIUA 4HWNA 3HA0A 1UM6L 5C08D 4G9DB 3MRPB 1SBSL 3HUJE 4M1GH 3TYGH 5ID1A 1S3KL 3NAAL 4G6ML 3UTSA 4P4KA 4W68A 5CJ5A 4YUEL 4KRLB 1EJ6A 4V1DE 3ULVF 1K8DB 3K81A 4PJEE 1XGTB 4UNUA 4XZUB 3VXSD 3OR7A 4OGYH 1TJGH 2W92A 4Z0XB 1JPFB 4JHAL 4PJ7E 3P73A 4PG9B 2KZWA 1ZA3A 4IMKC 5FHAL 3LIZH 2X5PA 4K71C 4IS6B 3PABA 4S11A 2FH8A 4YHOL 4L8SA 4UILH 1EZVX 1GZPB 5D2LB 5JW4Q 3I84A 3VRJB 1MLCA 2X4OA 3DUUA 3CH8A 3CFBA 4NM8L 2Y25A 2GJJA 3KYOA 4PJGB 3FQUB 1CFBA 5IK3A 5HTSA 1CFQB 3RX5A 3WE6B 3N1PC 2KL6A 4HIXH 1NPUA 4FZ8L 5ANMA 1ES0A 2YPVL 2Y36H 1D5BB 4JE4B 3H42L 4XAKE 1FIGL 4YFEA 3UJIH 1A1NB 4F9PC 5HI5C 5JW5B 1TIUA 1PDKA 2AXFA 4MHHG 3W0WB 4PGBB 1OB1A 1E6JH 1I3RA 4QF1A 1WCBB 3FAWA 2W0FB 3EYOA 1DQJA 4KKBC 4YXLH 4LRNL 5EBGA 3F5WA 3VI4E 1JYVA 1F6LL 3TPUA 1O0VA 5ILTH 5ESQB 2FX7H 2IAND 2QHRH 4PRHA 1GC1L 2GJ6D 4FP8L 2CRMA 3DX7A 5E8NA 5C3LD 2VQ1A 1T3FB 3G5YB 4IBLT 2W9EL 2DQIH 5C0BA 1Y0LA 2A9MH 1FAKT 4J3SA 4YC2C 4IJ3C 2ZJSH 1FVCB 2OZ4H 1RHFA 1JRHI 2R2BA 3QIBD 3RY5A 3WFHB 5J12B 5JA8B 5JIKA 3B3IB 2VQTA 1NCNA 5HVGB 2Q3AA 5EU5A 1WFNA 1UJ3C 4A6YH 3RA7L 4ZSOE 3WFCH 1XIWD 3S8WA 5K9KA 4J3TA 3O41A 4RA3A 3HE7D 1A0QH 2VL4A 1KLGA 4U33A 1CFSA 3ARFC 3SQOH 4EI5C 4CGTA 1FVDB 1X9QA 2DMKA 2XZCH 2ERJC 4DEPB 3NABL 2PCPA 2Z92A 1BFSA 4FQQA 5JXAL 5ISZE 4F3FB 2ZSWA 3QBTB 1UQSB 4U1SA 1C5BH 3STLB 1IM3A 1B4JL 2HG5B 3WHE1 4DTGH 2AXGB 1YDPB 3U9UB 3K8MA 2ENSA 3F7PC 3M07A 2VAJA 1CE6B 3BPLC 4KJWD 5I8OL 2BY1A 5DK0B 1T4KA 1G7JB 3AY4A 4LVNC 4P23C 3FFCB 3VXMB 3BRFA 3ILQC 5D2NA 2X05A 3QEQD 3QIUB 4P49A 4LGPB 5HDBF 1AC6A 4LLUB 4RGNC 3NGBB 5C92A 4NHUA 3S3SA 3ULVD 4JLRA 4P2QA 1KOAA 2JB6B 2R8SL 1QSFE 5A16A 4KHXH 5BMFL 4HX1B 3ULUH 3OZ9H 1D9KC 2NY7L 4ODWA 4WU5A 3DO7A 4AIZA 1MFNA 4ONHB 4BQCA 3QI9D 2Q86B 12E8H 1IEAA 2YN5A 3HS0A 3W9DB 1YYLL 4X5XB 5HGAB 5BV7C 3DETC 1DQLL 3HE6A 2RCSH 5I76B 1T2QH 1WZ1L 3QIWC 4FTVB 5E4IA 4XNQA 2EDJA 3BT2H 2GI7A 3ILPB 3BIAX 3SKMB 4ZFZB 4F7MA 4UT7H 4YDKH 3D6GA 3ARED 3V79C 1A14L 1CLYH 2CRIA 3OAZH 4ZFOL 3BN9D 1IMHC 3F7VA 3D69B 4YXKH 1QA9B 1H5BA 2VDOL 1EAJA 4U1NA 3U7YH 5KSBB 1R3KA 4RDQG 1BJ1J 3GSXB 1IZJA 3CX2A 4Y4KD 4JO3L 1GIGL 3ZDXE 4RFNB 3UBXA 2B39A 3EIFA 3BUYA 5EFIA 3EKCA 1G9ML 1EMTL 1JMXA 5JMOC 3CVHB 1KEMH 2NXYC 3TA3A 1MAKA 3VGDA 5D1ZA 3U0PB 1FZKB 4GAFB 3WLBA 4O51A 2J8UA 1TMCB 3D39D 2H8PA 3EHBD 4P2RA 2VH5L 4LCCC 1KFAH 1Z9LA 1PSKH 4UAOB 3TT1H 4P2OD 1CF8L 4GQPH 1IC7H 3KYMA 5E2VH 3UC0H 3FCTB 5GGUB 4XHJD 3GJFB 1EPFA 4JFEE 3HPLB 3JV4B 4IRZL 3KNBA 3MJ8B 1RMFH 4X7SH 5GGTL 5D7LB 4JRXA 2UVEA 4KXZI 1X4YA 3IAGC 4AL8H 2VLJE 5KS9F 5HHVL 2DMBA 5F3HB 3T77A 5C0AE 4ODUA 3MRLB 4YX2L 4JKMA 5EZOL 2B0SH 1P5VA 4YR6A 3KLHC 2GITB 3MRFB 2P8LA 2BDNH 4BKLB 5C08A 5DD1H 2AJVH 5K9OA 1U0QA 4R9HA 1RIHL 4YDIL 1NBYB 5I19L 3ARPA 1OP9A 1H15B 1U91A 1UM4H 3I9GH 3VE0B 1CXFA 3FONA 5EZJB 2PO6C 2DWEB 5J13C 5I8CA 3VXSA 3NIGE 3BX7C 3GKWH 3HC0B 4ISVA 1S7XB 5D70L 1S9YB 1LVEA 2X89A 2X42A 2D9CA 3BP5B 2X4UA 3D0LB 4L3CB 4OBRA 4FQHB 3FTGA 5IVXA 4HD9A 2Z8WC 2BSED 1YYMH 1KIPB 2E9BA 2ATPA 3CVIH 2X44D 2VABA 4D0CA 3ARVA 4IOIA 5LGJB 3KPMB 1N3NA 1SHMA 4Y1AB 1FYTD 5D71H 2YZ1A 3VMPA 4YNYA 3IJSB 1AQDB 2DDQL 2QQLH 1H0DA 3R06B 2ARJQ 2YN3A 1CGSH 5AUMB 1ZT1A 4JPVH 1M7IB 4X99A 4D94A 3MV7E 4XWGH 1IAII 1M7DA 2PTUA 3ARDD 3I3BA 2VYRE 3H3BC 1GC1C 1HWHB 4K7FA 4XNMB 1WFUA 4BELD 3D18B 5CBAB 5DJ0A 5GJSL 4OZGE 5AYUH 4POYA 5FA4B 4X6CF 3LV3B 4IIQC 4XPHH 4R7DB 1JWMB 4TSAL 5C0DB 2GJ6A 3QH3A 2XN9E 3LKOA 4WI4A 4FZEL 4N68A 3QDGE 1Z3GH 4OV6F 4NQVB 4ZUWA 4OM0L 5DDHA 2IANB 2FJGB 4NRYB 1YEEL 1J5OL 1QKZH 1NL0L 1G6VK 1HXMA 2WM0A 3TH4T 4GAGH 2W60A 3SGDI 3GJFK 4OIIH 3LVEA 4RAUB 2AK4E 5IROC 3WNLA 1KCRH 4LNVA 3G6JB 3QIBB 5HHOD 1XIWA 5IIEB 2VN7A 1MELA 3T8XA 2FSEA 3HE7A 3VGGA 3ARXA 1VCAA 5KZCB 4JM2B 3P77B 4FQXD 2BY2A 2VDRL 5DJAA 3NFSH 4WHDA 4I4WA 3NACL 4J6RH 5HHPA 3NCJH 2B2XL 1DVFD 2MKWA 2IH3A 2NY5H 4ZD3L 1J86A 2B1HH 1LHZA 4OLVL 3JTSA 1KULA 3C09B 2ADIA 3L5IA 3WFBH 2VITB 2ZCKH 1FPTH 4G8FA 1T1YB 2X1PA 1KJ2A 4NRXA 2ESVD 2DQCL 4AH2B 2EC8A 4X4XB 1U8OA 3MACL 3IS0X 1UWXH 4O2EB 3QJFB 4WEBH 1NC2D 3ARWA 4PJ9B 3MLSH 3SE3C 5EUOF 3LY6A 1MSPA 5SWZE 4FXKB 5KAQG 1EXUA 4ZXBA 1CBVL 3IDYB 4K7PX 2VXUH 2CQVA 3QI9A 2BOBB 4Y16B 3CSYB 5A3IC 1RZIA 3DURB 3WN5A 1S78D 1JYWA 2AKRA 3C5ZD 4R0LB 2BXZA 5LAXA 1OTUC 4PJ8C 3ES6B 1B0RA 3PL6C 3CLEL 4KDWA 4HUWB 2Z91B 1J0ZA 2X9YA 4ZPTB 3U0TA 3F8UB 4PGDB 5AZ2L 5EG6C 4XXCA 3VH8B 1J8HB 2UZIL 3SDDB 4P3WA 3IFPB 1E4WL 2DWDB 4O2CB 3AREA 3VD3A 4JANB 5DR5L 1CFVL 3M17B 5GPRA 4DW2H 4S0SD 1K4DA 3QCTH 2VAAB 1JGLH 1NGWA 3FQWA 3GUTB 1IBGL 4HC1A 2K7QA 3UBXI 4H1LG 1U8JA 3B9KB 3T4AB 3OKDB 5F1SA 4R3SB 1BZ7B 2HTLC 4B0MM 5D9SA 5J3HD 1A3LL 3WUWA 4Q9CA 4L4JA 5I9QB 3GMPA 1WAAF 4Y4KB 3BJLA 3MCG1 1O5DT 3UTQA 2ZUQC 1OLZA 2V7HA 3MLVH 3EYUH 3FQTA 4QHLA 1NAMB 2XPGB 3C87A 1C5DA 3D39A 3EYQC 3MLWL 4KROC 3HFML 1IVLA 4OFYD 5C2UB 4FXGB 5EUKB 4WJ5B 3QFDA 1Y18A 5I1LA 4XC1H 5T3ZH 2P8PB 4P2OB 5E95B 5GZND 4U3CA 4MAUL 4JDVB 4M8QB 5D7JD 3G9VA 1F3JA 2H26A 2VDKL 5ERWA 3VXOA 1NMAH 4GKSA 2R39A 4XWOC 3D2UB 3PWVB 2CIKA 4I2XE 3PG2A 3KPPB 4HF5L 3V5KA 5H35B 4DZBB 3P4MA 1QSEB 2LVEA 1RURL 3O2WL 2EO9A 3FQXA 3D5OF 5C09E 5CD5D 2OBGA 4LPVA 4QT5B 4YDJA 4X5LA 2MPAH 1OCWH 1WTLA 1KYOK 1RZKH 5B38G 4CVWA 4HIHB 1S9VB 1QFWL 1AY1L 2VOTA 1HHIA 1M05B 1Q0XH 2YRPA 4M03A 2NY6C 3QB7C 1FH5L 5DJXB 1FFOB 5DJDB 1U92A 3PGCA 2R0KH 5T1MA 3QEHA 4CVXA 3U48A 3LKSB 1V7NL 4LFHD 1NAKL 3NOIA 5EOTB 2FIKA 5EN2B 3Q5OA 4PJHB 5C0GB 5E4EB 4Z7WB 3REVA 3ZYOA 5ABDE 1SM3L 1FYTA 3P30H 3DSNA 3WNNA 2GQHA 5C0IA 1BIHA 2O5YL 4POZD 3RBGA 2R69L 3IU3B 2MSPA 1H8OA 1IAIL 3FN0H 5HI3D 4W6WB 2ICCA 4GRWH 5KVGL 2M1KA 1G7HA 5ANME 2ICWJ 4PREA 5HYSG 2JKXA 5TE6H 3RWHA 1R3JB 3S98A 3I3EA 2WQRA 2ENYA 4RZCB 3CPLB 1JZ4A 5C07D 2W9DL 5CCKH 1CICA 4NZRH 4PG2A 3KWWA 2LFGA 3WD5L 3SDAD 4LNRB 1DFBH 4IRSC 3WFEH 4A6YB 1ZT7A 4JO4H 1I8IB 2XIDA 1FL6A 4HT1H 2P8MA 1DJSA 4X7CC 2D7TL 5LWYH 4I0PD 1VADB 3FB8A 4PRHE 1I3GH 3TFKC 1W0VB 3LN4A 5ACZB 3OB8A 4KVNH 3RJQB 4PS4H 3MRBA 3G5XA 3Q5YA 3GBNL 1XH3B 3SDXF 4P3DB 4MD5B 1KCLA 3JZ7A 5D72L 3TN0D 1OT1A 4FFVD 1T7WA 3T0VA 3B2VL 8FABA 4GG6F 5I66A 4OJFL 3UXFA 1J1PL 1OSPH 2JCCB 2V5RA 4GMTL 3T08A 2HT2C 1MCSA 2VERN 1G7LA 3QQ9D 5GS2H 1EEZB 1WF5A 2O61A 3JUZA 5C0EB 4AK1A 5IM7A 4N8VG 5HHOB 5T1DH 1JV5A 1XGRB 5HD8C 1FN4B 5F8QC 4F57L 3LKNA 3HZVB 1G0XA 3PWJA 4FQXB 5DQ9B 3LCYA 1XAUA 2NW2B 4H8WH 1Q1JH 4KRNA 4NJAH 1DVFA 5D1XC 4UTAH 1EV2E 3GFUA 1I8KA 4OLUH 4XP6L 3AM8C 4L8BB 3VI3E 1J18A 5KS9A 1MWAL 2EYRA 2ZCLL 5FGBA 1F00I 4J3XA 4NN7C 1AI1L 5EH1A 4WFGD 2ESVA 5F89A 2AJ3B 4IM8A 1ZS8B 2YBRB 2APTA 4WO4B 1AXIB 1WT5A 3WKNA 4NDMB 4IDJH 3UMTA 2XG4A 4GRWF 2UY6A 1KELH 3MLTA 3NH7H 2IH1B 3LN5B 3R0NA 1ZVHA 5D2NE 5DO2D 3VXRB 1YMMD 1NC2A 2HKFL 3RRQA 1JNLL 5IBTH 2FJHB 32C2A 5GXBB 2D9QB 4GBXB 1ZSDA 4JZJB 3PWNB 3QYCA 2I9TA 1UXSA 3QWRD 1A1OA 1DQQA 2D4DA 3PP4H 2W1NA 3P11L 5DHVB 4F33B 1IC1A 4JPWH 3TZVD 3L5WB 3VFWA 5C70A 3C5ZA 1MJ7H 4I77H 3C8KA 3EFDH 4KKCD 4HIEA 2H1PL 4ODVL 1XCQA 5IHBA 3VG0H 1DBKH 1MIMH 5F88A 5E0QA 3QUKA 3S36X 4HBQA 3RVXD 5E8DH 1QPPA 2WP3T 2JJUA 2YUWA 1NFDE 3P0GB 1FG9C 1CGVA 2MJWA 3GIVB 1BVLB 3B2UD 2UWEB 1DLHB 4A2MA 3C6SA 4LRIA 3TNMA 4KV5F 2A38A 3SN6N 3VDCA 4MNQD 4X6CA 5T3ZD 3S5LA 1WBXA 3HR5A 4MNHA 4LP5A 4R4BB 2DD8L 3UTZA 3O6FA 1J05A 5B39G 2ZUUA 2L0DA 2X4TB 5ITBH 2UZYB 1FNEB 1MCFA 4XBPA 5DRXB 3FO9A 1I8MA 2XI9A 5DZNA 4MZ2A 5I1CH 4DUVA 1BOGB 1CE1H 4WUUB 3FQRA 3Q3GA 3WL9B 4UQ2B 1CVSC 5IB2A 4OUUB 2ZOKB 1KC5H 3HRZA 2J8UE 1I9IH 1QLEH 5JXEA 5F70A 4P2RE 1B0WA 5TFSL 5I2IA 3TBYA 4ELMF 3V4UH 3BZDA 4E41B 4KMTH 1MCWW 5C0RL 2P44B 3RVWD 2HA1A 3ZDZF 1MHPL 2D7NA 4K8RL 4OKVB 4OZHF 4XCCH 4XGZB 2C5DC 3WO3B 2EYTA 4WY7H 4U1HB 3S34L 3V6ZA 5D7JB 1IKFL 1MREL 4UV7H 4CN1A 4HWEL 2EDXA 3J8F7 3VFMA 3TIEB 5JNYB 3DIFA 4Q9QL 4QTIH 2HFTA 1C5CL 2DJUA 4LLYA 4WTXA 1FIEA 3HG1A 4MNGB 1JZ8A 4LL9A 3UJJL 4OI7A 5C08E 2CLRB 4TPRH 4MMXC 4J7RA 5F1NA 2DLFH 4G8EB 3I50L 2AK1H 2OL3H 1RUAL 2XZQH 3DRTA 2NY3D 4EIGB 2X4QA 3OJVC 4HLZG 1CXLA 5D1QD 5ETUB 3VXSE 1HWGB 4OV5A 1GGCL 1ZXQA 4MD4A 2ZUXA 3AVEA 1BOYA 3H9SD 3VWJD 3TBTB 4WWKD 4YDVA 5HYQA 3PJSA 3ET9F 3MCLH 5IVXE 2QADC 1CU4H 4D3CH 15C8H 4PP1D 3ESUF 5KANI 3EO0A 4PB9L 5EUOA 4LDLB 1IM9A 4ZTPH 1OAQL 4KPHL 4JG0H 1NANH 5CZXD 3TJHD 3ZYJA 5CP7A 2V2TB 4ZTOL 1GOFA 1F6AB 4NQDD 1QVOB 3QPXH 1HSAA 1CZ8L 4KJYB 3MNZA 1P5UA 4XMLL 1IKNC 3F12B 4JO1H 4TSBL 1OL0A 1QO3B 2DQDH 5J12C 1Z5LA 1Z0MA 4Y2DB 4YHMH 1LDPH 3BRDA 5CIPH 1CD8A 3SCMB 5LG1A 1CG9B 3OWEA 2CDGA 1AR2A 1JGUH 2XKNA 1EAPB 3QUYD 2IMNA 2XICA 5C07A 1MCCA 2XTJB 1R6VA 4UU9B 4CJ1A 1R5WA 2AI0L 4DEPC 3SDAA 3NVQA 1QFHA 5I1JH 2IPTL 1JHKL 4MQTB 3KVQA 3S4SG 1QR1A 2GJ6E 4WHCA 1JGDB 4YPGA 4BK5A 5IR1B 3IRPX 4KK6D 4MGXA 4XRCA 3MR9A 3QUMB 3QUXD 5EO1B 4XP9H 2BVQA 4I0PB 4PJFE 3T65A 1MLBA 1W0WB 4EN3A 2B1AH 1T21A 1WAAA 4HXAL 3E3QC 4LAQL 2X10A 1MH5B 1MJ8L 3RWFA 5T1KB 2Q6WB 2OTUB 2HN7B 1D6VH 1A6TB 4LEXH 4PLKC 1KG0A 1BQLH 2JELL 3TH3T 3T1WA 4MXQD 4O02H 3D25A 4RRPG 3V5HB 4LKXA 5KJRH 1MQKL 2WBJD 5INDB 1UZ6F 3QIUC 4HH8A 1F8TL 2NTFA 2YWYA 1AFVH 3NGBC 4RGOH 3CZJA 2HKHL 4G5ZH 4MDIA 5DHYA 1WSST 3O45B 4JG1H 2FB4L 1L7TH 4D0DB 4MAYA 3G5ZB 2B8OT 4WEUD 2Z93A 4OLWH 1KJ2L 3SGJC 2X7LA 3QXDA 5E7BA 1INEH 3BVNB 3KXFA 2C3VB 4Z7VA 4TUKL 3CCHA 2Q76A 4F9LA 3HI1B 3MNWA 1A3RH 5INCB 2DM7A 1H8SA 5EORH 3ULVL 1XR8A 2DN7A 5EU6B 4JQIL 1OAZL 3S37H 2YSSA 4X8JB 5I8EA 1HHJB 1OAXL 1YMMA 3QEQE 1P84K 2VRAA 3DYMA 1I1AB 2R23B 5IFAL 5K9QG 2E6PA 3ULVE 1IAMA 3I02B 4XNYH 3O2VL 2FYYB 3TP4A 1MRFH 3T0DA 2AV7A 4YGVA 2D7PA 1ACYL 1ONQA 4HFUL 5DQDL 1S8DA 4ZQKB 4ODBD 2EKJA 3C9NA 1BFOA 3MZGB 5FYJH 3IT8D 1K85A 3OG4B 1T0PB 4U7SA 4RFNC 4QXGL 3GMLA 5MERB 4WFEE 2NW3A 3TZVB 1Y6MR 5DD0L 1XZ0A 5F1KC 5TDPB 3MODL 3TO4D 5F6HJ 4P5TA 2FJFB 2QBWA 5E2JA 4C4KO 4HUVA 4JQVA 1C7TA 4K2UH 3V4PH 3MRGA 2AW2A 4MXWL 4U1LB 1UH3A 4NM4H 2D2OA 3KS0H 5C9JB 4HC1L 4LOUC 4GRLD 1EO8H 4ZDHB 4LSPH 3VXPB 2PW2B 2QL1A 2FWOA 3EFFB 1I7UA 3BEVB 25C8L 4XBEH 5L8KB 3PNWA 5EOCL 4R90H 2CLVA 3CZFB 3MJ9A 2X4SA 4MNQA 2NZ9C 3GMNA 5FOBA 1A1MB 5EA0L 2CKBA 1HXYB 1F45A 2DKSA 3O2DA 3GSVA 1NUDA 2YD9A 5B21A 5F1OB 4CU7A 1ORSB 3K1KC 5L88H 4PD4K