2QQKH

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
219
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTISGYGIHWVRQAPGKGLEWVAYIYPDSGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREDFRNRRRLWYVMDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 219
sequence length 231
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqkH01
4LDOB 3HUJE 4ZTPL 3SJVD 1FH5L 1EEYA 3P0VH 5IFHH 5E2UL 1U8OB 3DVFA 1TTUA 5BV7B 1FGNH 2ICWI 3VXQB 3SEPA 4JDVA 1RK1B 3BRGC 3F7YA 4JFFE 5GRZA 2VE6B 1RIUL 5GJTH 2X1QA 4HH9A 3KPQA 3SOBL 3DVNB 4HS8H 5HPMB 4NFDA 3BN3B 1MQKL 3ESVF 2EC9U 4QOKE 5C2BH 2OBGA 3X13B 1UCBL 5ICXA 1FFPA 4PJFE 4OV6F 5GGTL 5JQ6L 4PLKC 5T1LB 4WFFE 2BRRH 4FNLH 2L7JA 3VH8G 3RVVD 2YSSB 2VXVL 1IGIH 2EIBA 4Y88A 2O5ZH 3BVNA 1C7TA 4KMLB 2Q20A 4JZJB 3ULVD 4HIJA 1LEKA 5TQ0L 3MRPA 4NKIL 5DJAB 3QIWA 1YDPA 1FCGA 5INDA 3GSVA 3MRIA 2MQ0A 3DETD 4DUWA 3BT2H 4FTVB 3BJLA 4Z95L 3U9UB 1OARH 5FKPA 3UEZA 4PR5A 3TT3L 4P0DA 2BHYA 1B0RA 5LBSL 3H6JA 4RMWA 3PL6D 4PJHB 3AU1B 1F6AA 3LOWA 4JHAH 3LKRB 4HJJH 5IMMA 1QFWM 4UTBL 1BECA 5LJYH 2CQVA 4KFZC 1A3LL 2W0LA 2H32H 4AIZA 4N9OB 2PYFA 1CG9A 1YYMH 1D9KD 4HKZA 2ZG1A 2A77L 3MLWH 3NA4A 1NAMA 4NZUH 4XP1L 5FA4A 1K4DB 2AJUH 4PJ5A 4MA1B 3PWNA 4Y5YA 4CDHA 1VGEL 1NCDH 5FK9A 5FHAL 1WAAA 4KVNH 4P4KA 3ARFD 1RJYB 1EAPA 5D71L 5FO7B 32C2B 4NNYB 2BNRE 3DTXB 1M6OA 1VPOH 3A67L 3DX9B 4X4XB 3GUTA 4L8SA 5E08L 2HWZL 1B90A 3I75A 3RPIA 4QRQA 4FN0A 2X9WA 1IM9D 1G6RH 4WRLA 5KG9A 2D3VA 2VAJA 3KXFD 3GMMB 1S5HA 2DTSA 3O6FB 2P4AB 2QSCL 5DJ8A 4QXGL 3OKOB 4LCUA 5JIKA 4FZ8H 3P4MB 1YMHA 3RVWD 2ZUXA 1NCUA 4YXKH 5MEPB 2HKFL 5EDXA 1Z3GL 1ZT1A 4KPHL 1FZKB 4WFGE 2W0FA 5EZIH 4P2OD 4YHOL 5EB9A 5TE4H 1HI6A 5ICYA 3SDAB 3GNML 5DFVC 1MRCL 4GUPB 3EYOA 4ZNEA 1AGEB 2YEZA 5FFLA 4XGZB 1NBQA 2OR9H 4QHMA 1QTYT 4FFYH 3RGVC 1L0QA 4OIBA 3QDHA 2AK4D 3ULUL 2CKNA 1WITA 3V0WH 4GW5B 4QNPF 4BFIB 5ACZA 5GRVK 5HDQH 5HGHA 3P0YL 4LFHG 1UT9A 3IDXL 4F7PA 1EO5A 1XGUB 3IGAA 4XWGH 1FNSH 3D39A 3QDGA 4PIRF 3HC3L 1YNLH 4JFQA 3T1FA 4HKBA 1FC2D 5KVGH 4YHZL 3NIGE 5DD3H 3OHXB 4XMKL 4ELMF 2DJSA 4Q6IA 1VFBB 1U3YA 3LKNB 4LKCA 3NOIA 3BRDA 4XXCA 1EFXB 3TNMA 2IH1B 3VG0H 1ZHNA 1RULL 4GFTB 1NANH 2AJVH 5CD3A 4LFHD 2FL5B 3SBWA 4KDVA 5ALBH 1G9MC 4C56D 4DGVH 5DMJB 3FN0L 4KUZL 5FAAA 1NQBA 2E8ZA 3VWKC 5FM4A 3C5SA 3PQYB 3PWVB 5I2IB 1JPGA 5ICZA 1LE9A 3OPZH 5F6HJ 1MIEL 1NGXA 3QEHA 2A6KB 1A5FH 1KOAA 3DSFH 3BYTA 5HYQA 5HHOA 1IEBA 5BZDB 4NO0B 1PW3A 4OZIA 2EDLA 1JGEA 4O4YH 5KOMC 1Q9LB 4Q97A 1WISA 1HQ4B 2OJEB 4XP9L 3B3IA 1FL5B 1TZGH 1QNZL 1RUAH 5T3XD 2YK1H 5CGMA 1Q9KB 3U0TB 5A16A 4L9DA 4PRAB 1H3PL 4FQ2H 1R0AH 3V5HB 1HHHB 5BQ7A 3BDYH 3QG7L 1YN6B 3IS1X 4MDIB 2W9DL 4KWUA 4X7EC 3AXLA 4OFDA 5CSZB 4ZFOA 3L95B 4C54A 5CD5C 3IAPA 1EPFA 4BKLA 1EJOL 4X6CB 3EYVA 5D70H 4NN6C 4DEPC 5F9JA 3KAAA 1OP3K 2GAZA 1C1EH 3FB6B 1KN2H 4D0BA 5LCVH 2ZSVB 4Q7DA 3S5LG 2JELH 2GJ6D 1FAIH 2VR9A 4L4VE 2AXFA 1V7MH 2AP2A 3UTTA 4NJ9L 2JB5L 4KRLB 5EUOB 1RZGA 4N5EC 4Z7WA 3UP1A 1PZUB 1CDIA 2XG5A 3QA3A 3MNVB 4OD2A 2BOBB 4L3CB 3OKEA 3VRIB 3QJFA 4CN4A 4P3DB 4KTEL 3Q1SH 3V7MA 5LKNA 1FN4A 4M7LH 1XGPA 3NZHH 1A6ZA 2HRPL 2X4OB 4XC3H 2OI9B 2F8XC 4Z5RB 3PP3H 2E7LA 2FECI 1II4E 2RIKA 4G43B 5KVFL 4U6YA 1RZIA 4LSVH 1K3ZA 3O8XB 4HUUA 4OLZH 4OZ4A 1JZ5A 3SJVE 2W92A 2RCSH 4M1GH 5IWLA 1U8JB 5JOEA 1KEGH 1UKSA 1RIHH 3L5XL 5K93A 1NCWH 4RQQB 1HINL 3RDTD 1N5YH 5CLWA 5I66A 4XNQB 1AIFB 2VC2L 1CLOL 1T21B 2C4FU 4IIQB 4LRNL 4I0PD 4NQSA 3PF2A 3O3BA 1FQ9C 3KJ4C 5GGSB 1RZ8B 4H88L 5KS9A 3IYLW 4ZPTA 3FRPA 4XP5H 2IMMA 1HHJB 2EIZA 4YIQA 1NGZB 4ZYKB 3F12B 3ULVE 1SJHB 3MNWA 4HXBL 5C09E 2DTMH 2OJZH 3FMGL 1DN2A 1J0KA 2VDMH 2VXQH 3QNZA 1UWXK 3W82A 3MODL 2J8UE 1G7PA 4PRHB 4MAYD 2A74B 1HEZB 1FL3B 4ODBD 1YEGH 4QXWA 2EC8A 2B1HL 3KPLA 1U3HA 3MLXL 3ZDYF 2EZ0D 3FQTB 2YMXH 1CFNA 1DBKH 1NFDE 4GRLC 4LEXL 5IW3A 4ZMAT 4Y2DA 3WUWB 3QZWG 3QI9C 1Q72L 4ZUSB 1BVZA 1L7IH 1QLFB 1S9XB 3KPRA 3BEWA 4O2EB 4PJGA 5CZXD 1IQDA 2X5PA 1NBVL 4KKNA 5I1AA 2CUMA 1SMAA 2VNCA 3IXAA 4OLXH 3QISA 4N1HB 4XAWL 1I1CA 1FZJA 1LDPL 1IC7H 5HI5C 2COQA 2J3SA 2ICES 1I75A 3RX7A 1MCIA 2VXUH 5GS2D 5LGHH 1W72B 3JTTB 5CJ8A 4PTTB 4PP1D 2VLKA 4DOHE 2AV7A 3SKOA 4OZGE 5I15H 3VXTB 1XZ0A 1GIGL 1H3XA 4X6DB 4G8EB 4G8GD 3MRHB 1XGQA 2QL1A 3D85A 1A6UH 1F3RB 1CCZA 1S7XA 4NOFA 4UT7H 3LV3B 3QNYB 3KXFE 3IF1B 2DWEB 5DMKA 4K9EC 5DTFB 3MREB 4ODUA 3EYSL 5INCB 4KDTC 2W07A 1S5IL 1BQUA 2GFBA 3S96B 3BX7C 5IMOB 4JFZH 2BSSB 1ZWIB 4HS6B 4M8VA 4WV1B 1RD6A 1A1NA 2XA8H 1P7HL 2FO4A 2XZAH 5MI0C 3ARTA 4QRUB 4O00A 5CP7B 4F33A 2XIDA 4B50A 2IAMA 5DJ0A 1AXTH 1YA5A 3QUZA 3DARA 4UMGA 4GJTB 2AK4E 3S8WA 3VI3F 3BQUA 3KYMB 3QWRA 3BZFA 3U4BL 3W0WD 4DAGH 2HLFC 2NX5B 3U30C 3PNWB 1CICA 1IL1B 7CGTA 4BUGA 5M7QA 4GQ9H 5TDPB 5E56A 3FCTA 3VCLA 1BZ7A 3KLAB 5ANME 3WLBB 1J8HD 4G9FA 1BJMA 1KPRB 4XH2B 4P23B 3MJ9A 1BFVL 1BEYH 2A73B 5ESVB 4QXTB 5E6ID 1UACL 3GMOA 4ODHH 1F11B 6FABL 5D6DA 1WEJH 1OY3B 1F4YH 5IB3B 5C7XL 4C56E 4IOIA 2DRUA 3IJHB 1YEJL 2BVOB 2IPTH 4GG6E 4MCYB 5I8EA 3LKPB 5JHDA 4TOYL 3GI8L 3GSRB 3CPLB 1K6QH 5K9JL 3NFNA 5EG6C 4FQHA 1MRFH 5KOVC 4DZ8A 1G9ML 4KTDL 2OZ4A 1FVEB 3GBNH 1GGCL 1E4KC 4OAWB 3SCMA 4P2CG 1FSKC 5C08A 5BVJB 4HHAA 4NKOB 3CFBB 5JPMA 4YWGH 2APBA 1FO0A 1QFWI 3T3PF 5HHXH 1FLTX 3TNNB 3F6IA 1NLBH 5L9DH 2BHZA 4LCWB 4CADB 4MCZA 5E2WH 5JIPA 4DZBA 1KJVB 1WCBA 2Z31C 4I3GA 3ZE1E 3HMWL 3QO1B 5ENWB 1WCQA 1ZHBB 1YUHB 2P7TB 4LIQE 2HG5B 5T3XE 3NZ8A 3HNTH 3BD4A 4Q9QH 5CJXA 5MERB 4U1NB 5FKAA 4NUJA 4OF5A 3O4LA 4K9EH 1HH6A 1CFVH 1ZT4A 4OJFH 4R4FH 4PGEA 1U8HA 2B1AL 1I3GH 1Y0LB 2BDNH 4YBLC 4R9HA 3RWJA 5EO1B 3WFDH 1WBXA 3B9KD 1GZPB 5GSVB 4M5YH 3QDMB 1YN7A 3M8OL 2IJ0C 5KSAB 1U8PA 2GT9A 1DANU 4QTHA 3K2UL 4HT1H 3ZL4L 2IQ9L 2GJ6E 4U6HB 2RAMA 2V9QA 3B5HA 1HE7A 1SEQH 1E0OB 4Z7VF 2HT2D 1BQSA 2NW3A 3QR2A 1AI1H 4NQCA 3CLFL 3K7UA 4RNRA 5ESQB 4C4KO 1BX2A 1RJZB 3OKKB 5F97E 3CFJB 5DS8A 3U36B 3VWJB 1DQQB 2GCYB 3S36L 1S7RB 1I7UA 2D7TL 5KZCD 3UBXB 1VSCA 1Q94A 4PJBF 1KCSH 2HT4D 3LPFA 3CFCH 2EDRA 2XN9B 2Y23A 1UEYA 1OAZL 3TO4A 4ELMB 1RUPL 4NN7C 5A2KH 3B5TA 4O51B 2WBKA 3RNKA 4KQ3H 1V8HA 2P5EB 3BO8A 3HR5A 5GGRB 2NY5L 5DUBA 1EK3A 1O7SA 5GRJL 3MPCA 4U1LA 4G7VL 2EEDA 3FFCA 1DLFH 1Z9OA 2ICWA 4DFIA 3LN5A 5M94B 4WI9A 4QRPA 3HAEG 4L29A 2AXJA 1U8NA 2EIEA 5DK2B 1FFNA 5E03A 3WN5B 5FCUL 1BF2A 2P5WA 3JTSA 1KBGH 4NQDD 5EBMB 1F4WL 1PEZA 4NRZA 2DQHL 4NIKB 5JDSA 2FWOA 4HWUA 2NXYB 3NN8A 4FQQB 2BNUA 3PGDB 4GW1A 5IROA 1I3RB 1I4FB 2DICA 4RMQA 1F5WA 1ULVA 2C3VA 4JFXB 5C07D 3FRUA 2EDQA 2ENSA 4K71C 4XNUH 5B38B 3BRFA 1CFQB 1MJUH 2Z4QB 1QG3A 4OCNC 1ADQH 5DQ9A 3SGEH 3ARZA 4M93C 3SGDI 4H1LH 3MRBA 1TNMA 5DMIL 3BKCL 1OD7A 1ZVYA 4EIGB 2E5EA 1QSZA 2R15A 1U8KB 4H26B 3GMNB 2N4IA 4JFEA 2AEIT 1MJ8L 5CEXA 2R2EB 2UWEF 5E8DH 1I9IH 1D5ZB 5JTWA 2J12B 3S37L 1ZLSL 5HVGB 1F6FB 4RFEB 5EOTB 4TTGA 4PLJD 3HUJF 3NGBB 1XGTA 4WHCA 4YK4B 1ONQB 4WO4D 4PS4L 1ZXQA 4LLWA 3P0GB 4G5ZL 3O41B 5FF6B 4N9GA 1J0ZA 2UZIL 2P42B 5JO5A 3HC4H 4OV5B 1FFRA 5DR5L 4NRXA 3WEXA 1U8QA 1HXYA 2P1YA 3P4NB 3BW9B 1FIGL 1FBIL 1XGYL 3QXUA 4JRYA 4XZUA 4IMLB 3JV6B 1T22B 5JOFB 4G8GE 3P9WB 1Z9LA 3WFBH 3D3VA 2VDQH 1JUFA 3ARDB 1M05A 3MRCA 2YBRA 4OTXL 3U79A 1T0MB 4CU6A 4GAGH 4Z7UE 2JCCE 1IRAY 1AD9B 5BS0D 4PJFF 5IHZA 1JN6B 5CBAA 2F54D 4MXWH 1B3JA 4HWBL 3MO1B 2ICCA 1OAYH 1KB5H 3CSPA 3GJFK 4FQ1L 4HJGA 3WNLA 4UIKL 4S11A 1T04B 2A9NL 4NQVA 5FHBH 2CRMA 5D4QA 3OGCB 3EOYG 4A6YH 5DD1H 2V2TA 3KYKL 4OFYD 3MXVH 5I16B 2ARJB 4MJID 4JZNA 5F6HI 1EH9A 4PGCB 4JPIB 1LEIA 1AQDB 4NZTL 4PBXA 1YMMA 2A6JB 2X1PA 3NTCL 1IC5H 3QIBA 4NCC1 4PY7B 4YFDB 4F7MA 2PUQT 1A7QH 3I6GB 4OZFH 5IVNA 4LSTH 3MLUH 3W0WE 5KAQF 3VXSA 1MHCA 4NKMA 4JG0H 3AY4C 4ZXBC 2NMSA 4IMKA 2BHUA 4KJYB 5C0GB 3CD4A 3E2HB 5I74B 1J8HE 3MBEB 3T1WA 4WI6A 3NFSH 5KVMC 4K7PX 4ODWA 4NHCL 2J4WH 3WDIA 1T89C 2NY4C 1XIWB 1FORL 4KKAC 1KN4H 5ILTL 4N0CD 4KXZH 3FT3A 1B6DA 2EYTB 2JK5A 4K3EH 4MDJB 4XNZB 1INDL 2J6EL 5K9KB 1PDKA 4PGBB 2E27H 3MGTA 5HYJD 5EWIL 4EUPH 5FUOL 1HSAB 4XCEB 1B0WA 4CW1B 3H7BB 3U0PA 4CVWA 2BNQD 3LD8B 3GSNA 2DQTL 1TMCB 2EE3A 2PXYC 5BW7C 4M5ZH 4OUUB 1MJJB 3ULVL 3SDDA 3VXQA 5D1QB 3WSQH 2WBWB 3ARGC 1T4KB 2VE6A 2CLRA 4KK6C 4AY0A 4G3YH 4LSQH 3W5NA 3TVMA 3TZVD 4MSWB 4ODXA 4K3DL 1ED3B 3MUJA 3SO3B 2QEJA 3H42H 2BY3A 3QUKB 4JEGB 1WTGT 5K9OB 3DGCR 5IVXE 3FJTA 4MQTB 2XNAB 5T1LA 1HSBB 1IGMH 1UM5H 4TSBL 3FONB 4Q2ZA 1T3FB 4Z76A 1FYTD 5LGKA 5B3JE 5AWNL 4CVZB 1S9VB 2QADB 3FT2B 2B39A 5GS1C 1R5IA 1J7VR 4BQ9A 1QBLH 2FIRT 2MKLC 2O5XL 5DI8B 1LNUB 2HVKB 5EU4B 3ARBD 2B5IB 4H20L 1A64A 4KK5D 4PJHA 4Q9CA 1TENA 4FQIH 4HUKB 1J05B 1G9NL 3LKRA 4LKXB 2Y06L 1KXTB 4LLDA 1DVFA 5F7NC 3UPRB 3RA7H 3VXRD 4FP8L 3WJJA 3SQBA 2EEAA 2A6IB 5D2NE 1C5CL 3LMJL 2BY2A 5GRUL 2WWMD 5IFAH 3BH8B 1A7RH 5IGXL 1JNNL 1QRNB 1RK0A 3NCBB 1K4DA 3AREC 4RX4A 5IIEB 4WCYH 1OW0C 3OJVC 3A6CH 5JW4M 3V2AR 4R3SA 2WM0A 3PV6B 1LO3L 4HDIB 1RJYA 4YDVB 3GJFA 5E2VH 2ICEB 1R3JB 3DTXA 4X4XA 3MX0A 3VFTA 3WO4B 2Z0BA 3EOBA 3RBSA 4WTXA 5DDHA 2AI0L 3G5YB 4JN1H 3HRZB 1GZQB 1KNOB 1M71B 4EXPX 1OTSC 4UT6L 3O6FA 3VXUD 1MCHA 3OKOA 4NC2B 4P59H 4Z7QE 2EKSA 2HMID 3TESA 1YY8B 4M43H 2X70B 4KRPB 2PCPA 5F21B 1CFTA 3SDCB 4JHWL 5IKCA 1KPVB 1Z0MA 4P57B 1N4XH 3LEYH 4UZGA 5D96C 1YECL 3HE6B 1QPPA 2JJSC 3EHBD 1JGLH 2CMRH 2JB6A 1DL7H 4GUPA 4NQDE 1PG7X 1RIVH 2EC9T 3MRFA 3UJJL 1EO8H 2VKXA 2YHGA 4GMSH 2WIMA 4YXLH 3C87A 4WFED 2A2QT 3RGHA 2OYPA 1YEEL 1OCWH 1OPGL 4YHLL 5C07E 2JE8A 4GW5A 1HILA 1M7DB 2CLZB 1YEIH 4ZAKC 4ETQB 5SWSD 3C08H 4OBSA 1XGUA 3ISWA 1TCRB 4XMLH 2X42A 4MB4A 4O58L 3S4SA 4XCYA 1RUKH 4OCSH 2ZUTA 3QBTB 4Y8AA 3EYQD 3OHXA 5KVEL 3RY6A 2YPKA 2Y25A 4UOW0 2AJYH 3VFVB 2QQKH 3HI6L 3R4DA 2R0ZH 3LKNA 1CXHA 2DKMA 3PXJA 1SY6H 5MEQB 1JWMB 4A2MA 2FX9H 2GK0B 5J9PB 2CK0H 3WIHL 5C0BD 3WXWL 1HYRC 1W2KT 3BIBX 2GSGB 5DZLA 3L3IB 3RWEB 4IJ3C 4TRPL 1ZT7B 3PWPD 4AIOA 3T8XA 2IFFL 5HI5D 4OLUL 1UM6L 3PWVA 5I2IA 1XCQB 4Z7VB 4D9QD 4MLSA 3OXSB 1WWAX 4RRPA 2A6KA 2PTTB 3TYGH 2OTWB 4FQLL 3DUUA 4C4KT 4UQ3A 1I8MA 1NEZG 3JV4B 4YZFE 4YDIL 1JF1B 4NO3B 4U1KA 5ERWA 5CHNA 1FLRH 2E7CA 4NPYA 5BS0E 3I6KA 4ZSOE 1Q9LA 2F54E 4UV7L 1L0XA 4PJBB 5TF1L 1W0VB 4ZOBA 1A7PH 4LU5L 4PRNA 4AL8L 1WFTA 4ALAH 1Q9KA 5HGAA 1BM3H 4MS8D 4K7FA 3ULVF 3FQXB 3L1OL 4XCNA 5F70A 1EMTH 3QPXH 4QO1A 3SE4C 3PGCB 3C60C 5F7UA 3B8YA 3BP6B 4O5LL 4MDIA 3VE0B 4MJIE 3O45A 15C8H 1Q0YH 3V52L 3L6FA 1ZANH 2Z92B 4PBVC 1I8IB 4X6CA 3GKZA 1WC7B 1NC2B 2VR5A 1NFDF 1AH1A 5ACLA 1RZ7L 3C8KB 2AEPL 1BWWA 1AHWC 1BJ1H 3QEUA 1NAKL 4XXDB 2DLTA 4I48B 5HXMA 4ONFH 1Y18A 4RGNB 3FFDB 3SDXA 5DC4B 4TPRH 4FABL 3BH9A 1S7UA 4MXQC 1DQJA 3WFHB 2VUYA 3MRDA 1R5WB 2FR4B 5DURD 3W2DH 3MNVA 1H3VA 3VRIA 4M6ML 4DGYH 1ZKAA 5FYKD 4TSCH 2V2XB 4OZGF 4XPHH 1G0XA 5KJRL 1JWSA 3EAKA 3SHSA 1H5BC 4WW1B 2VITA 1JGUH 4Y19A 5HYJE 3L7EB 2FX8H 5F9AC 5J1AA 5IM7B 5F9OL 3TPUB 2BNQE 4U1SB 3O3DB 3JBG7 4XVUD 5ISZA 4XMPL 2UWEB 4P5TA 1YNKL 3V9FA 3QQ3B 2Q76A 2XWBB 3QQNA 1OP9A 3HNVL 2IGFH 1U93A 2ZUQB 4HV8B 5L8LB 3RGVB 2P24A 5DJZA 3HUJB 4RQQA 5AZ2H 1Z6JT 1RZKH 1F90L 1TJHH 4PJXA 1MPAL 1AIFA 3RZCA 1T21A 1U42A 4UV4H 3EO9L 5D9SB 5D1XD 5FGBA 1KLUB 1NAMH 1LP9B 2IAND 2Z31D 4NDMB 4JFFB 5SX4H 4JQXA 1NGQH 4RWYH 4CU7A 3P9LA 2CO7B 1LO2H 5J3HC 4M6OL 4Y4FC 4GBXA 3MCLH 5ADPL 1ODAA 2ADGA 1FYTE 2Z8RA 1A1MA 4HC1A 1N0XH 3LAFA 2ITCB 4PJFB 2GQHA 1SJHA 2FD6H 3OKDB 2KKQA 5F7MC 1CF8H 2R2BB 3IXTA 4PRHA 4XC1L 2ADJA 1U91B 2VDRH 1FL3A 4Y8DC 2VXTH 1M7IB 5IJKC 2H6PA 3L5JA 1I85C 3ZDXE 4LF3A 1H8NA 5D1ZD 4NGHL 3GHEL 4WHYH 2ITDB 4U7KA 1TCMA 4IRSD 1DDHA 3PJSB 3X3FL 4NRYB 4EVNA 4N8VG 3TN0D 4GG6F 4U6XB 3S3SA 3JWOH 3CFEA 4PJEE 4L8BA 3VXRE 4JRXA 3MV11 3REVB 4Y16D 3SE9L 1J1PL 3T0BA 5F7EL 1A4JB 1VFOA 5F1NA 5IQ9B 2OXGA 3O9WD 4P2QD 1W72A 4PTTA 3OB8A 1JE6A 1X4XA 4WHTB 1TPXC 4F9LA 4LSRL 3RKDC 3VXTA 1P7QD 5HYSG 1KLFA 2X41A 3MV7B 4X6DA 4G8EA 4NM4L 5HVHB 3ZE1F 1MI5D 3HPJA 4OZFG 5C09A 2Q6WB 5HVFB 3T0EA 3QNYA 1S7TB 5DD5H 4NN6B 5AZEL 1FV1A 3MUGB 3WIIL 3VXUE 4IRJC 2BNRB 4HIEA 3OG6B 3THMH 3Q2CA 3MREA 1RVFL 5JUEL 3HE7B 1MLCB 4OLEA 3FQRB 3H9SA 4OCRL 4ONGH 5DJ2B 1SJEB 2DQGH 2ADIA 2AGJL 3TH2T 5GHWH 2WMPA 3KPSB 3X11B 1ZWIA 4WWID 1DLHB 4WV1A 4O02L 1ZGLB 3IKKA 2UVEA 2FBOJ 3U7YH 2NY3D 3QH3B 5I1JL 1I1AC 1QSEA 2HJKA 4WFEE 4BH7B 3PHSA 2E6QA 3KJ6L 4WVRA 2AJ3A 2ORBH 4EUPG 3WHXA 1IEAA 1KJ2A 4JQIH 5C6TH 3O6KH 2G9HB 5DO2D 3KPPB 1DSFL 3MJ8B 5ESAB 5A43C 5SWSE 3B9VA 3PNWA 2DMBA 3N0PB 2PETA 3TLRA 5GS0C 1EHLH 2JJTC 3D2UD 1ZLUK 1V7NL 1ZE3C 5TDPA 3CK0H 1XF2A 3KLAA 5C2BL 5CGYC 4LSSL 1JYVA 1G7MB 5L88L 1C5DB 3D69B 4LQ1A 2A73A 5ESVA 1GAFL 4JFDB 2R29H 1U95B 4FNLL 4PV9B 3L9RB 1IT9L 1XR9B 1K5NB 5BMFL 5GGQL 2C1OB 5C0BE 2DQEH 3MYJB 4QRSB 1NCBL 1R6VA 3MRGB 2E9BA 2BVOA 3S88L 4HX1B 1G9EA 4TTDD 3S3PA 4YAQA 1N59B 3GSRA 3PWPE 1AKJB 3IDJB 4G6AD 4QWWC 5E99L 5EO0A 5J1TC 3PWJA 1VKXA 3IRZA 1OAUL 3M1BB 3RY4A 2CR6A 4CDGC 4H5SA 3WL9B 1KTDA 4D9QE 1JPSL 4OAWA 4TULH 4EI5D 5JPNB 3ESUF 1CTNA 4AENA 5BVJA 4NKOA 4L8CA 3C8DA 4S1DC 4LCYA 1QLEH 3B6SB 3WJLC 3MRNB 5DHVB 3I3BA 3T09A 1D6EB 2E6JA 4M6NH 2N7AA 5E94B 4NQED 3V4VH 3F58H 1FNAA 5JXEA 1UKTA 2G5RA 1P2CB 1LDSA 2Q86B 3QO1A 1U58B 3QIUD 4I0KA 4OCMC 1ZHBA 2EXWC 1CXKA 2HG5A 4GRWH 3MMEB 5J7CC 4GRLB 4U1NA 3MLWL 2GY5A 4Z78B 1KEML 1I9EA 3QHTC 3O2WH 3HC0A 4JHZA 2YUVA 4PJCE 5ABDE 3SQOH 1NCDL 4HXAH 1AE6H 4N1EA 1HHKB 4KVNL 1PEWA 3QUXA 4PJ9A 2DBLL 4C56A 4GMTH 4ONHA 3HB3C 3I02B 4F8QA 2NNAA 1B6UA 3VGEA 1ZA6B 12E8H 4GSDH 2V7NB 4B5EA 1CGVA 3QDMA 2PW1A 5IUSA 4J1UB 1URLA 3ECBA 1F4XH 3O0RL 2Z93B 4ONOA 1EHNA 2NTFB 4YDKL 2C26A 5DMGD 2JIXB 2G2RA 2VDKH 4YXKL 3MGOA 3P9MB 1FE8H 3FN3A 4LASH 1PX3A 4J6RH 5E00B 1GHFL 2P46B 1RJZA 3CFJA 4XPFH 3L5WB 3PUCA 2X1WL 2I25N 4WTZG 5D6CB 5FYKE 3U36A 3VGHA 5GS0H 1S7RA 2CRIA 4JPVH 4P46C 3MJGX 4QRTB 3C5JB 4IDLA 2OR9L 4YHIA 3H0TB 2K9UA 4OT1H 2XN9A 4FFYL 3VMOA 1EXUB 1X4ZA 4ZUVB 2NXZB 5CJOH 4WW2F 4Z0XB 2CGRH 2VLLB 4Z7UF 5I1KH 5EORL 1A1OA 1FYHB 4JG1H 3QFJA 3VGFA 1IAIL 2XKSA 1YNLL 1D5XB 1NCCH 4Z8FH 3WIFA 1A4KA 4PG2A 5CEZD 5DD3L 2JJUA 3G04A 3P77B 1SVZA 3D9AH 2YD3A 4ZUTB 2PR4H 5D8JL 5C0DB 4IDJH 5A2IH 4KK6D 1RURL 3TM6A 5D2LB 3VFPA 2LU3A 1F58L 1XT5A 2IANE 3RPKA 3UC0L 4CMHB 5JW3H 3BGAA 4ZFGH 4AG4L 1S78C 5L0QB 2PYEA 4DGVL 5D7IA 3MNZB 4DVBB 5IB5A 1HNFA 4X8XA 2IADA 5EBMA 5LGJB 4X5WA 3BKJL 2HFTA 4FFVD 2X09A 1EZVY 1T83A 1ORSB 4KROC 4R2GC 4LDEB 4JPKH 5EU5A 5AYUL 4JO1H 3PGFL 4H0HB 1YQVH 4YR6B 4JFXA 1F00I 1FZOA 3DVGB 5HGBB 2EDBA 1CGSH 3IFNL 4ORZC 2Q8BL 2NYYD 2QJDA 1F4AA 5TQ2L 1ORQB 1MY5A 2F53D 4LPTA 3FOLB 4GG8B 1TJIH 3LZFL 3NFPA 4XPTL 5A2FA 1N3NB 5DJXB 4DUVA 1VFAB 1I3UA 5IEKA 5TDOB 4H26A 2XWJA 2RR3A 5CEYA 1MFEL 4UQ2B 3VXPB 3GMNA 1OVZA 1H0DB 3K2MC 4R96B 4WUKH 3L3HB 2Y4SA 4JFOA 1DANT 1RUAL 4JY4B 5MEND 1KCVH 1DE4B 4MWFB 1IC4L 3EJJX 1OGAD 3SKUD 3VXMA 3T3ME 3VH8B 3PL6B 3OWEA 3BDYL 3MRKA 3Q3GB 1XFPA 1RFDH 5F89A 2DM7A 4JO4L 3OAUH 1BF8A 4X4ZA 3IFOA 4QCIB 3O41A 1DN0B 3ARED 4P2QE 5D70L 1DQLH 2R56L 4OV5A 5IR1A 1MJ7H 1IAKA 1V05A 4P2RD 1D9KB 1T22A 1MEXH 4MNQA 3D18B 4R26H 4U3CA 1I9JL 5J56B 3TBTA 1FAIL 1MI5E 2LAAA 1V7ML 5B8CB 3AFLA 1T0MA 4BQ6A 4DOHB 4HCRL 3CFKB 2NLJB 2VTFA 4OZGB 2CDEB 1JTPA 4K3JH 1JN6A 2C5DC 3MJ9H 5IVXF 4E0RA 4OZHB 3BZEA 2J8HA 2VLJB 3MO1A 3ZMRA 5I8CB 3WS6A 5B3JF 3AM8A 4HUXB 3U4EA 1IM9B 2XQBL 3KXFB 5EO9B 5EZLA 5IBTL 5TGBB 3OGCA 1JI1A 4OUOA 1P84K 1XR8A 3OKMA 2Y5TB 3Q1SL 2ED8A 4EDXB 4M7LL 5I16A 3NZHL 4OFKA 4DCQB 4WWKB 1QBML 2OZ4H 4AT6A 3RWCB 2F19H 1LK2B 3O6MH 4PGCA 1KTLA 5ITFB 1AQDA 2MPAL 4WGVB 3UTQA 5KVDH 4XVJL 4P2OB 4LSVL 2A6JA 5CKGA 5GGUB 3NCJH 1NFIA 1NUNB 1FO0H 1P5VA 2B0SL 4H0GA 1ZLVK 1FGVH 1UJ3B 2VAAA 1SM3L 3KHOA 2R2HB 2XTJC 3S34L 1ZVSB 3IDYB 4Y4HC 2WUCL 4BFEA 1H8OA 5IOPA 4JR9L 1NCWL 4G8GA 4M8QA 2AK4B 1DQDL 4ZOAA 4NN7B 1DQML 1I9RH 1NJ9A 5C0GA 2CIIA 3RZWA 5AUMB 3FQWA 4OLYL 2ESVB 4UT9L 5ALCH 4HD9A 4TUJA 2JCCA 3QIWD 5F1SA 1BOYA 4QXUL 5HHMD 4MJ6A 3GHBL 4F9PC 1T7WA 2BXZA 3GIZH 2AABL 4Z0BH 1BLNB 1VFMA 3GGWB 4GAYB 5HHVL 4XHQA 5E5MA 4DN3H 4MDJA 3RVTD 1YEHH 1YEKL 5ANMB 2FLRT 5DZNA 3MRJB 5K9KA 5HI4C 4F58H 4OD1H 4HEPG 3SGJA 4M02A 5J12B 3ZHKA 3C5ZA 2D7OA 4LARH 3H7BA 5FYLD 2HKHL 3HRPA 1MFNA 4Z7QF 3DUSB 4OUUA 4GG6B 1YEGL 5GRXG 1IGYA 2I9LA 4LGSB 1P84J 1HHIA 3RWFB 1CE1L 4PJ5D 4LVOC 1T4KA 4NQEE 3TPKA 4BFGA 3DGGB 3V5DA 2WK2A 3BI9X 3RRQA 1U92B 3DO3A 3K8KA 1OSPH 4P4KD 2FZ3A 4WHYG 4G80B 4M93B 4LAQH 1ED3A 3QRGH 4JVUA 1FVDA 5DQDL 3QUKA 4J4PC 4BSVA 5C0CB 1XF1A 2HJLA 1X7QB 4NUGL 4PJDE 3QXVA 1PJ9A 4EN3A 1T3FA 4N8CL 2ZJSH 4RA3A 3L3GB 4D0CB 5E6IA 3DURB 4CVZA 2VZTA 3FT2A 4LCIH 4PB9H 4JJ5B 4NZRH 5I15L 4PJAE 2EDYA 5E4EB 5DI8A 4Z77A 5I0ZA 4WI8A 1J5OH 3MV9B 1VGKB 4M7KL 5I1IL 2XI9A 4P99A 3F7VA 4PREB 1MFDL 2AJXH 1Q38A 3PIQA 5D7SH 1T6WA 3CVIH 3SY0B 2WINB 5DWUL 4KK9D 1FVCB 4TUKH 1W0WB 2FSEA 2GJ6B 4L8DA 4M48H 4DQOH 3ROLA 4GLRI 4R97B 3QHFH 2ZUWA 3BH8A 3D39D 3QDGD 3L3OB 1QRNA 5I6XC 3CMGA 2VYRE 5ID1A 1I7ZA 1YEDA 1S3KL 1JNHA 3ALWA 4DN4H 2NTSP 3PV6A 4YZFF 4HDIA 2EH8L 3VXOA 4M61B 2IBZY 1A6VH 4OFIA 5D7JC 3O2DL 2I60L 1R3JA 3RTQA 2ZOLB 3ZHLA 4UBDD 4DAGL 3S5LB 1H8SA 2A0LC 3NIDF 4KKCC 3B9KA 4F80A 1KNOA 1M71A 5CJBA 3GB7B 3EW3B 5CZVL 5CEZE 2CO6B 2JKXA 3IDIB 2XYCA 5D7LB 3REWB 1YY8A 3OF6A 2FEDD 1JPFB 3GKWL 3SDCA 1KPVA 4N0YL 4P57A 5BV7C 3N06B 1P1ZB 4Y4KA 1S7QA 3BN9C 5DRNB 3T4AB 1ZTXH 3HE6A 5JIHA 1X4YA 4ZXBB 5TDNB 4XWOD 1FJ1A 3RDTB 4KMTH 2R69L 5CKAA 2CDGB 4I3RH 5LXGH 4I0PB 2NY4B 1QO3A 3PABA 4TSAH 3WV0A 5DYOB 2GSIB 5DF0A 2HLAA 5LWYH 4OQTL 4GKNA 3SDYH 4AH2A 3VDBA 1G6RA 3VRJB 3LEVH 1OTUD 5T33H 4JANB 2F53E 1AGFB 3DX7B 4C59B 5I73B 2OK0L 1TCRA 4GOSA 3G5VA 4DFHA 1EAJA 3I2CH 4JZJC 4MA3A 1NCTA 3PP3K 5DT1L 5IF0B 1JMZA 3HI5H 4FXGB 5FO9A 4JKPL 4JM4L 4OGYH 2DM2A 2I07B 3U1SH 2WWKT 3ZLQC 2EYRA 4MAYB 3OG4B 5MENE 1CLZL 4KZDL 1OGAE 1U2HA 1ZEAH 1JGDB 1MIML 2GK0A 2R0WL 5J9PA 5LQBH 3W9DA 5BO1H 1MFBL 4OF6A 2ATKA 4HIXH 3L3IA 1OAKL 4NYLB 1I3GL 4IHOB 3UTTD 4NZDA 4K2UL 4L9LB 3FKUS 3VI4F 1X5FA 4K94C 5EOQL 2NY0D 4P2RE 1JHTA 3BP7A 2YC1A 5K9QG 1IAIM 3JV4A 4WUUD 2OSLB 3TJHD 2EDNA 5E8NA 3EJZD 1CYGA 3UO1L 3QZWB 1OT2A 5EPMB 4ZTOH 1CDUA 1W8OA 4NKDB 3FO1A 4WW2B 4KVCL 3F8UB 5B22A 4Z7UB 3VU2A 2Z35A 4R90L 5TPWH 3NABL 4I3SH 4UOW1 4JM2C 4KDWA 1H15B 4PB0L 3FRPG 3J7HA 5FDWA 3BP6A 4JY5H 4GW4A 2HVJA 4E41A 1OAQH 4XNXH 4QTIH 4HIIA 2CUHA 1BVKB 5FYKL 5BV7H 4EBQL 3OXRB 4YEEA 1UZ8B 4F2MA 3ZDXF 1NC2A 1MQ8A 1ERNA 3SDAC 1QKZL 4NT6A 3ZKMD 4TVPH 2DF3A 4CVXA 5DSCB 3QB7C 3L7FB 4U1JB 2WBJC 4PJEF 5GZOC 1A6AA 1ES0A 3FFDA 3EOAB 1KB9K 3OZ9H 2W38A 1EERB 1NLDH 4G6JL 4U0RC 4W81A 5HHME 1QACA 2FR4A 5CGYD 3WLWC 1V3JA 2J1KA 1KBGL 1G7HB 2D31A 3BHBB 1U3HD 3VFWB 4LK4A 5D96B 2H2PD 4Y2DD 1KG0A 4R7NB 3L7EA 3HG1A 4OLWL 4QWWD 1FFOA 5FYLE 3KPRD 4I2XA 4XNUL 1E4WL 1Z0NA 2UWEA 5JHLL 1IM3A 4Y1AB 2CLVA 1AQKH 1CFSB 1R24B 5F7HA 4HV8A 2P48B 1ZHLA 3RGVA 3OL2A 4PJ5E 5FOBB 5BVPL 3KNBA 1HQRA 3SE8L 1WAAE 3FZUD 2VLKD 2BERA 2EECA 1UXWB 2HT3C 4N68A 3LB6D 3OR6B 1AY1L 4YBQD 1I9IL 4LSPH 5FOJA 5D9SA 4L3EB 1LP9A 3H8NA 3U6RA 1UFUA 5KTEH 3TT1H 3D85D 4NM8L 4PRIB 1T0NA 5A2JH 3KR3L 4Q6YA 3RQ3A 5I19L 4EKXA 3MA9H 5DEFB 5DRXB 1RZJH 2N56A 1MCWW 1OD9A 2Y36H 3NCFB 2ITCA 4OCWH 4HWZB 4DVRL 5IVXB 1DUZB 1P4IH 1I8KB 1SQ2N 1A2YB 2WQ8A 3P11H 3V4UH 2IALA 8FABA 1IAOB 4IJ3B 4YHPB 2UYLB 3LQAC 3QUMA 2V2WA 4WENB 2WSKA 2EDKA 4YO0B 3VWKA 1CDBA 4GAGL 1BIHA 2AQ1A 5LAXA 4ZNEE 3J8F7 3WFEL 3CSYB 1QUNA 3LDBB 4XVTH 1PKQB 1QD0A 5DRZB 5HD8C 1B4JH 2N1KA 2VXSH 3QUZD 3PJSA 4AIXA 3MLRH 2HFFB 4GRMB 4OCXL 4UNVA 1K8DB 4U6XA 1IGCH 4BFBD 1NSNL 4XP4H 5JR1H 3BQUD 2IH3B 2H32B 4F57H 1A7OL 3QWRD 5DD1L 4OB5H 3T4YA 4HUVB 1MCPL 5GIRB 2DJ4A 1CICD 3D39E 3QDGE 3VXNB 2FGWH 2DI9A 2YR3A 4H25A 4WI3A 4JDTH 1U0QA 3UYPA 5H37H 4PRBA 1SMOA 3GI9L 3P73B 3CCHA 4G9FD 4U6VL 2QKIA 5D2NB 2DWDB 2W0KA 4XCCL 3V79C 4V2BA 5I18L 3MV7A 1A0QL 1MF2H 3TO2A 4E42A 1YC7A 1Z9MA 2R1YA 3CDCA 5BJTA 1DBBL 2Q6WA 4BZ2L 2OI9C 3PHOB 1S7TA 3TCLA 4OKDA 5JHDD 3LKSA 1QSFB 3UZVB 4OF7A 3JUYA 3O8XC 1GGBL 4GKZB 2EDOA 3MRLB 2VDOH 1T66C 1SBSL 4PY8J 4PJCF 1SJEA 4X98B 5C08D 1S7SB 2SEBB 1DLHA 4K3EL 3RWDA 2LTQC 2R0LH 1CU4H 3WE6B 2RBLA 3G08A 1JNLL 3IFPB 4OZIE 3CUPB 3QH3A 1PSKH 1QQDA 5FB8B 2ZPKH 1EZVX 4IIQC 5CGTA 1WF5A 3BGFB 2F5AL 3UCRA 4BH7A 5JNYA 1CE6A 3A6BL 4MA8H 1GRWA 5T5FH 2AXHA 2HTKD 4PGDB 1IGJB 1JRHH 4BK5A 1H5BB 3SKJL 4D3CH 2NZ9C 3O4LD 4C58B 1UH2A 3H9HB 3NPSB 4KI5D 3VJ6A 2EXYD 5C07B 5IV2A 4WI2A 2DQFA 2C7UB 4LVHB 3HAEB 4HAGA 4ZQKA 4G42A 1FDLL 2MCPH 2Y7QA 3ARYA 3QFDB 5E2TH 3O3UN 2ZCHH 1RI8A 3ZE0E 1U95A 4NBZB 3L9RA 1K5NA 2C1OA 1XAUA 2EDDA 5E8PB 1EO7A 1JZ6A 3L5HA 5FGRA 5L8JB 4A2LA 5JDJA 1UENA 2AERT 1N59A 2F8VA 2FGZA 2OTUB 1SYVB 4KGLA 2OR7A 3UTTE 1YPZF 4NN5B 1QBLL 4U1HA 1OQOA 2ZWLT 2WLYA 3M1BA 4WY7L 3RL1B 4NQCD 4Z7WE 3MLPA 3DRTA 3DO7B 4WO4B 4OF8A 2WV3A 4NC1E 5H2BB 4QYOA 3SKMB 2YXMA 2NR6C 3GO1H 3MRNA 3HMXL 4HQQL 4WUUE 1S9YB 3FOMA 3RNQB 3E8UL 4GRWE 4FQIL 1VACA 3BZ4A 4WEMB 1MLBA 1JPTH 5DUMH 1FG2B 4MQSB 2KZ1B 3TO4D 3V4PL 5IW6B 1IQWH 5E2JA 4R4BB 1R3IH 3S7GA 4Z7OF 1CR9L 4UILH 3MRMA 1A22B 1QVOA 1L0YA 5L7XL 4OKVA 4AMKH 4RFOL 4GRLA 5BS0B 4FA8A 3Q6FA 4ZSOB 5IFAL 2J8OA 1EGJA 2F54B 1CK0H 4KRNA 3QI9A 3TBWA 4WCYL 1J0JA 4ODTH 1HHKA 3FFCD 2F58L 2EDHA 3WD5H 2VH5H 3WXVH 1AGDA 3KLHC 4M62L 4JO2H 4LPXA 3PWPA 2QV2A 1ZA6A 5F7YC 4MJIB 4M1DH 2LABA 2D4DA 2P5WD 4HWEH 3MFFA 1NGYB 1J18A 3CSGA 4J1UA 3QNXB 5GGVL 2Z93A 5KS9E 1DBAL 4P59L 4JAMB 2NTFA 3CH8A 3T3MF 4ZO9A 4UUJB 4LP4A 5IG7A 1P69B 4M43L 3QUYB 5C70A 4KAQH 1YEFL 2IF7A 1N4XL 3P9MA 1KXQE 5DQJA 5CEZL 4NP4L 1HYSD 4HC1H 1T5WA 1PYWB 4K8RC 3TJEL 3LQZA 1UXSB 4K07A 5GSRB 4QRTA 3VD3A 1FNEA 2XPGB 5FO8A 1JZ4A 1IZJA 1G7JA 4KDTA 1MREL 2IPUG 4YXLL 3IVKA 1OSZB 4P23C 2QQLH 4JFED 3HR6A 1QSVA 2MMXA 3VMNA 1OTTD 4PJ8C 1T1WB 2VQ1A 1J9CT 3B2VH 3KPRE 3EDEA 5H8DA 3TC9A 1Q8MA 3MROB 4PJGE 4M1CD 1ZHKA 2R0KL 4EXKA 1BQHA 4JKWA 2BZDA 3R1GH 2LAGB 2XKUA 3NA9H 3STLB 3U9PH 1MHPH 1QR1B 5E9DA 5F93C 3JV5A 2BNQB 4ZUTA 3EFDL 3JWDH 2YA0A 3TBVA 2R0ZL 5C0DA 2VLKE 4ZD3H 3GEWB 4X7SL 2EDJA 2NY6D 4JRYD 5D2LA 3QPQC 5FGCB 3B2UC 3LIZH 2J5LB 3TA3B 5I8OH 5E5RB 5IJVB 2O5YH 1KGCD 5EU7C 3D3VD 1U8IA 2DQUH 1W72H 1M7XA 2H8PB 4J4PD 5I1CH 2ZUYA 5JXEC 3V5KB 2DD8H 1SBBA 3TZVB 5EIVA 3O6LL 5F9DC 3MCKA 4RISH 2J6EA 1ORSA 2EDEA 4XBPA 4ZUWB 1IAII 2HFGH 1HIML 3DVGA 4WU7A 3TYGL 1S7WB 1FYTB 1ORQA 1T1YB 3G5ZA 3FOLA 4GG8A 3DX6A 3KLDA 3OJDB 1TLKA 4MNHB 4KKLD 3GRWL 3GMQB 3MLSH 1TVDA 4OSUL 3B4NA 1E4KA 4FQJH 4LMQE 4WGWB 1I7TB 5TDOA 3FQUA 1YMMD 5E1HB 4XRCB 5FYJL 2R8SL 1YJDH 3L3HA 1RHHB 3QIBD 1V3LA 3V6OC 4LLUB 4X6BB 5KSAC 1BM3L 1VESA 2KUTA 3EFFB 1TJGL 3QEQB 2FX7H 5HJ3A 4HKXA 5FA3B 3VXSD 3Q3GA 1A6TB 2WQRA 1RZFH 1UGNA 2R4SH 5HHNB 4R4ND 2QSVA 2IANA 2R2CA 2Z31A 2X6MA 3LS5H 3KDMA 3UXFA 1NBZB 2V6HA 3V95A 3DYPA 3HZKB 3FTGA 4PJEB 2CR3A 3VXRB 3ULSB 3IAQA 4G9FE 4YE4H 4OM1L 3A6OA 2OL3A 5ADOL 5IMLA 3GBLA 2IBZX 3VWJC 4R0LB 2PO6B 4H1LA 5D7JD 3T0VA 3RWIB 4HK0A 1UM4H 2FJHA 4J3OC 2VZ3A 1HH9B 1QRKA 4NO5B 3CFKA 4MA7L 3SGDH 3E6FB 2CDEA 5EC2A 2JTDA 4XCFH 5JHDE 3QCUL 4Y0GA 4PJDF 4OZHA 4N0UB 4RGOH 2VLJA 3QXDB 4X80H 4XP6H 2DQIL 1CL7L 3C2AH 3L3DA 5EO9A 5C08E 1R3LA 1UKQA 3VXUB 3S36X 1EBAA 3SDDD 5E8EA 2Y5TA 1JK8B 1WZ1H 2FBJL 4PJAF 5C0AB 4XBEL 5E1AA 3X3GH 1BVLB 3QWOB 3RWCA 4TVPD 25C8H 5ITFA 1CLYH 3U2SB 1G7QA 4KZEL 5EC1B 1QYGL 5GGUA 1OB1B 3FO0H 4YJZL 3WN5C 2ZG2A 1N7MH 3AS2A 4NNPH 3CZFA 1HDMB 1F8TL 1FNLA 3DMMC 4Y7MA 2AEQL 2ZUSA 3HPLB 5KN5A 1JBJA 5T1LD 1MHEB 2IGFL 3BAEL 3UJIL 4NJAH 3R0MA 5FYLL 3LRHA 2D03H 1MRDH 3O4LE 2CJUH 2NXYC 1MWAL 1RUMH 3VFMA 3TP4A 3NPZB 4MYWB 1KCRH 1TJHL 2CPCA 1KB5A 4KI5E 3SO5A 4DJMA 2EH7H 4UV4L 3MC0A 3DXAB 1NAML 1TZIA 1ZV5A 4YPGA 2MJWA 5SWSB 5DD0L 5JLZA 4A6YA 1ZSDA 4G8IB 1LGVA 2OQJB 5IK3B 4MD4A 1VADA 2XZQH 3MR9B 1BLNA 3GGWA 3AMLA 3I50L 2JF1A 4UTAL 4ZO6A 5FDYA 1AO7B 1BFOB 4GXVH 3TYFB 3LHPL 3QQ9D 5MEOB 4F37F 2QBWA 4FXKA 4GT7A 3VFGH 4JGUA 4ENED 1HZHL 1DEDA 1WT5C 2BVEA 3TV3H 1DVFD 5DXWA 4NQCE 1GOHA 2BMKB 3NGBC 1UVQB 4YK4C 1J1XL 4ODVL 4XAKD 2FEEL 2D9CA 3BFOA 4KROB 3IDGA 5T3ZH 2HRLA 3EDDA 4JKMA 4RX4D 3EBAA 4CMMA 3BZDA 1JZ2A 2BOCB 1NMAL 5DEZA 3IDMA 3TFKC 5HHPA 1MAMH 2W9LA 3JUZA 3S35H 3JWOL 4BSWA 2I5YL 4OM0L 1O5DT 2PW2A 1DBML 4JPWL 3ARDC 3X14A 1T7XA 5C0CA 1WSST 3KPMB 3Q6GH 5GZND 3CNKA 5T1MB 2DQDH 1RUQL 5GISL 3HCVB 1LD9B 3O6FD 3LKQA 5E0QA 3WIHA 4PYGA 1HXMA 4D0CA 4HFUH 5IQ7H 4YDJB 3BWAA 1BBDL 5IHUH 4JJ5A 5I17A 3FFCE 2AJSL 43C9B 3MLZL 2ZOKA 4U1GB 1GCFA 2OMNA 4D2NA 2R1WB 2BFVL 5H37G 5CINL 4IEFB 1R3KA 2CH8A 3H9YA 1NEZB 1MCOH 5DUPL 4PJCB 3EO1A 3MV9A 4QRRA 2P5WE 1VGKA 2ZCLH 2K7PA 4MNGE 5DD5L 3S4SG 2X9YA 3D25B 1UZ6E 3JZ7A 1O7VA 5C8JB 3VGBA 4XTRD 1LO5A 3O2VH 3O3AA 1J87A 1L7TH 3CVHA 4HIHB 5GS3A 2GUOB 4HZLA 3GSQB 4GXUM 5F6IC 3P30H 2AV1A 3IJYB 4GAJL 5L2KA 3L3OA 4U1IA 4M7ZC 3E2HC 4N90D 2B4CH 5I74C 3MBEC 4BELD 4ZTPH 1FH5H 5DURB 2IFGA 1U8MA 4K8RL 1K9TA 4WJ5A 3BPCB 4JFEE 2A83B 5DC0A 1XIWC 3PV7A 4M61A 5E2UH 3CFDB 4OF0A 2VWEE 2D0FA 4S1QL 1EFXD 3OKNA 4RRPG 2ZOLA 5C6TL 4XNZC 2A9ML 1P5UA 2D7NA 1WICA 2WUBL 1FNGB 3R06B 3SOBH 4WEUD 2V9RA 2DDQL 1XF4B 3CK0L 5BZWB 4NQTA 1QFUL 5D7LA 1MQKH 2OM5A 4X4YA 3LD8C 4DKFL 3EO0A 1UCBH 3D87B 3QP3A 3MBXL 4MJ2A 5GGTH 1YPZB 5JQ6H 4JRYE 5D1QC 3T4AA 4ZFOL 1FCCA 2VXVH 1B2WL 1ITBB 1KGCE 3AY4A 4ZXBA 3D3VE 1EFQA 4JFYA 1MELA 3G6JB 5TDNA 2FHFA 4Q58C 5TQ0H 4NKIH 2YD1A 2G60L 1T89A 4WDIB 2VDNL 1KIQA 3SO3C 1KUMA 3DI2B 2MHAB 4JDZA 5E5UB 4DTGL 5CZKA 2X1OA 5C0FB 4NO2B 5E7FA 3TT3H 4FFWC 5E6YA 4HG4K 5LBSH 4JANA 3V6FB 3CC5A 5EU6A 1DUYA 43CAB 4D0DA 4G6ML 4PY8I 4LEOA 3LPGA 2QHRH 4UTBH 1H9VA 2PXYA 3CDGB 5BW7A 3HFML 1A3LH 4F3FB 1YMME 4K3GA 5J6HB 1JZ7A 5CWSB 4LLYA 2APTA 5F7DA 1NGWA 2CK2A 1C8PA 1J10A 5DVOA 3P4LA 4LLQB 3FT4B 3ARGA 1D5BB 2A77H 2B5IC 1QEWB 4XP1H 2XY1A 5EFIB 5JORA 1CQYA 1C12A 4YFLF 3VXSE 1NDGA 4M9PA 1MCKA 1VGEH 4F7TA 2APXA 4IRSB 5FHAH 5KSBA 5D72H 2VERN 4M6AA 1MUJB 2AJZB 4IHOA 2CD0A 1QFPA 5JMOC 4J8RA 5D71H 2BC4A 4GMTL 1TTGA 3A67H 1FNHA 3IU4H 4Q9RL 5E08H 1RQ5A 1AGBA 4GSDL 4JY6A 1WAAF 4MQXC 5GS1A 1BJ1J 2QSCH 3D5OF 4I9WD 4QXGH 2H3NB 5C2UB 4HBQA 1JMXA 1ETZB 2CKBL 8CGTA 1GJIA 1Z3GH 2H1PL 3K4DA 3M17B 4KPHH 2C3WA 4P5MB 1K8IA 4N8VB 4Y19D 5EBLA 5F44A 4CJ0A 3WDJA 3WO4C 4LASL 4NKDA 4YHOH 4M7LT 4O2FA 2XTLA 3U82B 3ARQA 3IB4A 4ZPVB 5ISZD 3GNMH 2M8XA 1MRCH 4P5TD 4Y5XB 1MCCA 1XGRB 4HS3B 1INQB 2DS4A 3MLYL 2LQRA 3VFSA 5IEHA 4KRPC 4PRDA 1EEZB 1YY9C 4TVPE 2E7HA 3ULUH 3O4OB 5HYSB 4AZ8A 1OF2B 2MCG1 1AP2A 3P0YH 2BSED 3IDXH 4L5FL 4ZS7L 1E6OL 1CQKA 2GTZA 3AREA 4XPGL 3VD9A 5D5MB 1MSPA 3QO0B 2NY3B 3HC3H 3GSOB 1OW0A 3ARWA 5DGQA 2H2SD 5DSCA 4YHZH 3TIEA 4X5XA 3GMLA 3BKML 4XMKH 4DWHA 5AD0A 5EIIB 3BP5A 4IDJL 1NUFA 3X12B 1I3VA 1SJXA 1KIRB 1RULH 5JW3L 1T6VN 4HJ0D 4PRHD 3D2UB 3LN4A 4JE4B 5SWQB 3OV6A 3FN0H 4KUZH 2XWTB 1J11A 4HBCL 5F3BA 5DJCA 5CIPB 4PJHE 3VFWA 5FECB 4KK8C 5CJ5A 4UNUA 1MIEH 1AXIB 4EUPB 2JJSA 1KIPB 1WGOA 1A7NL 5EA0L 2ZP0T 4C55A 2YD5A 2C4XA 3VD4A 3BGMA 4L1HA 3N1PC 4Y1AA 4JRXD 1YQ2A 4XAKE 2E3VA 1U3ZA 2ATPB 4U3HA 4XP9H 4KJQD 5SWZB 1Q9WB 1QNZH 4GKSA 4X7TB 1UXWA 3OR6A 3I3DA 4ZAKA 1SVCP 1XCTA 1H3PH 2ED7A 2X4SB 2V5YA 2Y6SC 4KJPC 4L3EA 1N8ZB 4NSKB 4PJ7A 2X05A 3GIVA 1XF3A 3QG7H 2VISA 3OQ3B 4UDUB 4NQEB 4D8PB 4PRIA 2W9DH 2Y07L 5C09D 3UX9B 3T0ED 3EZ8A 4YNYB 2CUIA 3H2WA 3MRQB 1MH5B 1EJOH 3QIUB 4RAUA 4LP5A 2WANA 3BMVA 2XZZA 3O11B 5HGDA 3DV6B 4HWZA 2A6DB 2YA2A 1AGCB 4APQC 4F8TA 1OAXL 3H9SD 1I8KA 4PJDB 3V0VA 3TBSA 4S2SB 1A2YA 1IAOA 3STZA 4YXHH 3ES6B 2WW8A 3AS0A 2QSTA 2XFXB 4P5KB 1EV2E 1WBYA 1T2QH 3IJSA 4WEBH 4PJAB 4JFHD 4ODSL 3SKNA 3ZE0F 2ERJB 3BPLC 4W4NA 3P4OA 5EOCL 1RHFA 2VZSA 5DRZA 1QSED 3ZYZA 4K7PL 1ZA3B 3WNNA 3MA7A 4Y5VB 2W59A 4KKBC 2UUDH 4PTUA 3RWHB 5F1IB 1JTOA 2IH3A 1XF5A 4KTEH 4LQFH 3CU7A 3WFCH 4YGVB 3KG5A 1IFHH 4RGNC 2HRPH 1I7RB 3AB0B 5DJ6B 1A9EB 2OZ4L 4Z7WF 3VXNA 4LLVB 3CH1A 4J2XA 4M03A 4MQ7B 4WNQA 4Z7NF 4N90E 5KVFH 1FRGL 4H0IA 3DI3B 1TNNA 3NCJL 2QR0B 3B8SA 4MJ5B 2DWDA 4JM2B 4GRWF 5I1DA 3SE4A 3C60A 3WYRA 1C08A 2P8LB 3L5XH 3FQNB 4RZCA 2CXGA 3EUUA 5JMRA 1HINH 1N2RA 3WKML 1FL6A 2VC2H 5IMKB 1CLOH 1WBZA 3IETA 1S7VA 4JLRB 3RY5A 4LRNH 3MLTB 3DROB 2QQNL 1X5XA 4X6EB 5MP6H 3MRLA 4KHXL 1AHWA 5CJQH 2FCBA 5I76B 2Y1VA 4KHTL 3W9EB 3RFZC 1KELH 2WBJB 4H88H 1S7SA 4Z0BL 3C6LC 2ZUQC 5K33A 2GEEA 3KS0J 2NY2C 3T2NL 4X99B 3PWLB 5JZ7C 3NCEB 4OD1L 1J88A 3L3KB 5JXED 3T0DA 4HXBH 1BAFH 4U0RB 1LO0L 5EN2A 3FMGH 3ZHDA 2GITA 4LARL 1S9WA 3ZE2F 2BSTB 3ZTNL 3H3PH 3MODH 1G7LA 5IBLC 5I30L 2FYYA 3E3QE 2VABB 1AJ7L 3U4AA 2B1HH 4PV8B 2P49B 5CFHA 2AEWA 2D0GA 1H5BA 3MLXH 3PG2A 4LEXH 4U1MB 4MVBC 5I75B 2HJFA 5F7FA 1R5VA 5KANG 1MCFA 1Q72H 1RSFA 2X4NB 3LCYA 3QUXD 1DEEA 2C7UA 4PJ9D 2V7HB 3S6CA 4LAQL 3W39A 3QRGL 3CMOL 4X6CE 2F53B 4NHUB 3VFRB 4ZUUB 1PQZA 1NBVH 4RIRB 2LU7A 2FRGP 5A3IC 3QFDA 5TH2B 1KLGB 1CIUA 3QAZB 4XAWH 3QDMD 1LEGA 2Q8AH 1LDPH 3B9EA 3AROA 2BVQB 3BIKB 1ZVHA 4G7YH 2DLFL 5ETUA 2WP3O 3FO2A 4ZG1A 4LCIL 3ZT6A 4I18B 5MENB 1BBJA 4NZRL 3SDXE 2OTUA 1NBYA 5T3ZD 1Z5LB 1TDQA 2BCKA 4KJWD 1GIGH 2BY1A 5EUOE 2VDLL 5I71B 4Y4FA 3VFOA 5KSUA 3DO7A 1I1YB 1J5OL 2E7MA 1U8LA 1GPOL 4POUB 3GBMH 2RFXB 4I9WE 3KYOB 5EUKB 2ZKHL 2YKLL 1JHKL 3FO9B 2GTWA 1GGIL 1QLRB 2AJXL 3EYSH 4P2RB 4JFPA 5D7SL 3CVIL 2XN9D 3FB8B 1P4LB 4Y19E 1FG2A 5BRZB 4TUKL 1T80A 5HVHC 5IJKA 1I85A 3ZTJG 5ISZE 2X7LA 2V5SA 3QFJD 2P8PA 1PG7L 2ZG3A 3PHQA 3KHQA 2CDFA 5DD6A 3RX5A 4LLMA 3K1DA 4OI8A 3HE7C 4TUOB 2KPNA 1EEYB 4PJXE 4XI5D 2HTLC 4UDTA 3U4BH 5J11B 3MXWL 4JDVB 4MJ4A 3X17A 2DL2A 3LSOB 2PYED 4X7CC 4HH9B 5C0ND 3OTTA 1NGYA 4OCYL 2YPLA 5KW9L 4JAMA 4HCRA 1NGPL 3T2QA 4K3HA 5ICXB 1FFPB 4WUUA 1BFVH 1A7BA 1OGTB 1JHLL 1A9BA 1UACH 4HW6A 1ZTXL 3ZZ1A 5C7XH 4PRHE 3GMPB 4IRJA 3RUGA 4IS6A 2NY5C 4LBEA 4KMTL 4YH6A 4HUWA 4TOYH 3GI8H 4HFWA 3NMEA 1LEKB 4HIJB 5K9JH 3MRPB 2XPGA 5HI3D 3QIWB 2FH6A 1G9MH 3GK8L 5INDB 3JXAA 5HHMB 3PDOB 2IPKA 3OGOE 3GSVB 5IVZA 1LE5B 3MRIB 3QUMH 4G9DA 2LTQB 3HKFA 2ADFL 3SPVB 5LWYL 5FKPB 4PR5B 4PRPA 3ARRA 3VXMD 3LEVL 1B0RB 5CUSL 3IFLH 1I1AA 3VA2C 2L0DA 4JRXE 1PG7W 1F6AB 5CLTA 1Y6NR 4LOUC 2FJFA 1QR1A 4PUBL 3F65A 4OGYL 4CU8A 1PLGL 5B4MD 1MWAB 4QGTA 2M1KA 4AIZB 2XZCL 1I1FA 1CG9B 2YN5A 4HKZB 1S8DA 1ZEAL 1NAMB 5FA4B 3RAJL 5DFTA 4X6DE 2JJTA 4MNQD 1UQSB 1N64L 2HFEB 2KQNA 3PWNB 2YPVL 1MCQA 1NCAL 3ARDD 4HIXL 3LS4L 3V5KA 3T0EE 2W1NA 4P4KB 1N5AA 1EAPB 1T1ZB 1M6OB 3GUTB 3K74B 2PN5A 4L8SB 4ZUWA 2F8OA 3F62A 3T0WA 5EU3A 3RPIB 3TWCL 3M8OH 3H9SE 3Q5OA 4KI5F 1S5HB 4QHNB 4CGTA 2J88L 3K2UH 4AEHL 5DJ8B 1T1YA 3I84A 4LCUB 1ZK9A 2VZOA 2W65A 1N26A 4G6KH 4FQXC 2EDXA 3GMQA 4JFHE 4LCCC 4JKKA 5EOCJ 1QSEE 3CLFH 4LGRB 2APWA 1RHHA 3E6HA 4LLUA 3WJLA 5ICYB 3BD5A 4CJ1A 1BQLL 3S36H 2YEZB 4I3SL 2D7TH 1F6LL 2R4RL 4NQXA 4XHJD 1JF6A 4QHMB 5HHNA 3EKCA 1UC6A 1U6AL 3GSNL 1OAZH 1A14H 3DVIA 4IOFD 4KMQA 1RUPH 2NY1D 3ULSA 5ACZB 5I1GL 2AW2A 5HGHB 5EBGA 4V1DA 4F7PB 3I9GL 5KSVA 3IGAB 3OBAA 3D39B 3QDJB 3QDGB 4TVPL 3T1FB 4JFQB 4IRZL 4HKBB 4P3CL 3GDBA 1F2QA 1HH9A 4B7IA 4G7VH 4YX2H 4Q6IB 3LRSA 4MHHG 3E6FA 2NXZC 4LKCB 1Q0XH 2XRAL 3C5ZD 3OAZH 1HN1A 1U2CA 1ZHNB 4N0UA 4YEFA 5CBEA 1NLDL 1QHPA 4P9HC 1OT1A 5FCUH 1KENL 5CD3B 3OR7B 3ULUD 4ZS6C 2X4QA 1KC5H 1F4WH 4PJIA 2FATL 1B0GB 3GSXA 1JK8A 5C0AA 1IKFL 3C5SB 1EVTC 3KYNB 4B0MM 1JPGB 5ICZB 1MVUA 1KTKE 3U2SA 4FZEL 3QEHB 4HPYH 3MUZ1 5EC1A 3DBXA 4CMHC 1I8LC 3CXDL 4P46A 5L0QC 1UZ6F 5HYQB 1KYOK 1JV5A 5HHOB 2G5BA 1C7SA 1IEBB 4AM0A 3O2DA 5DMIH 5IW1A 3BKCH 3HPLA 3EZJB 3MV8A 4UINL 1T1XB 3TBYA 1MHEA 1E6JL 4EN3D 1GSMA 3RVUD 3ZT5A 4PJ8B 1E4JA 1UYWL 2QADD 1NDMB 1MJ8H 1CL7I 3LKOA 3MACL 3RVVC 1T5XA 3S37H 1ZLSH 5JQHC 4FRWA 3DXAA 1EGJH 3V7AG 3UTSA 5KTEL 5BQ7B 3BDXA 2OQJA 5IK3A 3QDME 3MR9A 3ULVC 3UTOA 2X4TB 3AXLB 1NMCB 4ZFOB 4UIMA 4E5XB 1BFOA 2IEPA 1CXLA 3TYFA 4BKLB 1FP5A 2UZIH 3EYVB 5F9JB 5DR5H 2W9EL 2Y36L 3QULA 4M3KB 4OFVA 2OLDA 2AKRA 2GAZB 2Q87A 3JVGC 5T3ZE 1FIGH 1FBIH 1XGYH 3MUHL 3QJHA 3ALXA 1QBBA 4YFLI 4D0BB 4NWUL 1CD9B 3PL6C 4W70A 4QGYA 1OM3H 2IPUK 1INEL 2AXFB 4OTXH 4OQTA 1QHOA 2IQAA 1UWGL 3UTTB 1QRND 1RZGB 1RMFL 5DC9B 1SYSA 1GC1C 4XVTL 3TH4T 4HWBH 5I1EL 4Z7WB 4FQ1H 2GYSA 2NY0B 1B4JL 2VXSL 5C0IA 5FEBA 2CSPA 2XN9E 3QA3B 4UIKH 1D9KC 5TFSL 4OD2B 3LY6A 3OKEB 2X4PA 3D0VB 1TVBA 5F88A 5JR1L 1F2XK 3RTQD 5F7LB 4GRWB 5B8CC 3KPMA 3QFJE 1A6ZB 5T1MA 3ARFC 4S0SD 4HGWA 4HZAA 4XX1G 4YQXL 4YDLB 4NZTH 4YDJA 4GXUN 1JZ3A 1RZIB 3F5WA 5BXFA 1SEBA 4HUUB 3NTCH 4RGMB 1G9NC 5FGSA 2E8YA 3OF6D 2FEEI 5FUCE 1BGXL 4ZDHA 3SDCD 4J3SA 2VLRB 4XNMA 4Y4KD 3K81A 2V17L 3HE6D 3RVWC 4C57C 4JVPA 3VW3L 2PYEE 4WWKC 5D7IE 2F5BL 1DP0A 5I66B 3BEVA 3TF7C 3UJTL 2LVEA 3DLQR 5C0JA 4P2OC 3ZKND 1ZS8A 2CKBB 4LHUB 4NHCH 1UJ3C 4MMXC 2R9HD 5ILTH 2K7QA 3IDYC 3ARXA 4HIHA 4ZPTB 3C9NB 3GSQA 1FFQA 4YIQB 2J6EH 1AD0A 5IB4A 4H8WC 4DKAA 1BZ9A 2BVTA 5EWIH 3MNWB 1A6WL 3S97C 5FUOH 2ZPKL 4POZC 3QNZB 4ELKA 5D7KD 2DQTH 4KK8D 3T65A 1G7PB 4G6FD 2O93L 1AC6A 3LH2H 3M45A 3ULVH 2D7PA 1WK0A 1JRHL 3VXME 3S9DB 1TQBC 1WVZA 5GGVY 1CFNB 1EDQA 5IB1B 4FMKA 4Y2DB 4F7EB 4W6YB 4KY1L 5J12C 1CDCA 4CUCA 5BZWA 2WP3T 3KPRB 1VB9A 4K3DH 2FB4L 4MNGA 3BEWB 3DMMB 4KI1A 1IQDB 5I1AB 4PLKD 3IXAB 3U7WL 2Z91B 2I9TA 1AR2A 1YPZA 5E2TL 4Y4HA 1CWVA 1KFAL 1FZJB 4TSBH 2EDFA 4MNQE 6CGTA 4DKEL 1IGFL 5AWNH 3G6JA 4GLRH 2X4RA 2VLKB 2OL3H 2VL5A 4YUEL 2AV7B 3SKOB 4YC2B 4U31A 4F9PA 1XZ0B 4HMCA 1XGQB 2O5XH 4I5BA 3D85B 1P9MC 1S7XB 5C0FA 4ISVA 1CXIA 4H20H 2H9GB 1JIBA 5DMKB 4UB0L 1EHAA 2GK2A 4OLVL 4ODUB 1T20A 1G9NH 4E41D 1RAMA 2Y06H 3DECA 1AFVH 2GFBB 3CDGA 4EIZC 3WUZA 1IQWL 2FDBP 4WU5A 5E4EC 4FP8H 1A1NB 5I9QB 1NC2D 1C5CH 2IC2A 4PJHF 4UILL 3LMJH 1BOGA 3B5GA 5GRUH 4F33B 5IGXH 1JNNH 2IAMB 1NKOA 3G5XA 5DJ0B 3EOTL 4XPBL 5C0RL 1E27B 3EYFA 5I1HL 3QUZB 2YUWA 3GSUA 5CMAB 3U46A 1HWGB 1LO3H 1LK3H 4J4PA 2VH5L 3S98A 3W5MA 3BQUB 1CGUA 2P43B 4W4OC 2BVPA 1CICB 4R97C 3MOBL 3UPCA 4PP2A 1KJMA 4UT6H 3BSZL 4I77L 2G75A 3FCTB 3VCLB 1TETL 2FO1A 5F96L 1BZ7B 4MD0B 2BP3A 4G9FB 1UEMA 4R7DA 4JN2A 4XPAH 4JHWH 4P5MA 1CT8A 1BD2A 3GZKA 3HG1D 3PWUA 2Q3AA 3GMOB 4WTWA 5I1LA 1YECH 2DQJL 3IDUA 4MX7A 5DFVD 5FXCH 3G6AB 5F8QC 4ZPVA 4IOIB 4HC1L 3GM0A 5GRYA 3ULUE 1EA9C 3QHZL 5I8EB 5JHDB 2YRZA 5E4IA 4P9HL 3INUL 1Z2KA 3NFNB 4FQHB 3RGVD 4DZ8B 4YHNA 1YEEH 2VRAA 1OPGH 1KJ3L 4YHLH 3SCMB 3LN9A 5C08B 2DMCA 4HHAB 1R3HB 2WIIA 3B2VL 5F6IB 3D0LB 2P45B 5T1KA 4MD5A 5FCSH 2ZUUA 5D5MA 3RDTC 4M7ZB 3MLVL 3UBXI 4L4TB 4MCZB 3R1GL 4DZBB 4I0PC 1CN4A 4U2YA 5D7JA 3HI6H 1RU9L 3RL2A 4ERSL 3GJEB 1FG9C 1WV7T 5FKAB 4AEEA 4O9HL 5GRWA 1MHHA 3WIHH 3WXWH 3O4LB 1HH6B 5I73C 1ZT4B 2DQUL 3Q5YA 4PGEB 3OMZA 1U8HB 4N1CA 2LVCA 3VWKD 2DD8L 1D5IL 4TRPH 1M4KA 3QXWA 2IFFH 3RWJB 3HNSL 1UM6H 1U8OA 5CIPA 1WBXB 4HSQA 3O3EB 4MAYC 1KTRL 2GKIA 2APVA 4R6UA 4BUHA 1RK1A 2HFGL 4GO6B 1YN7B 5IT2L 4FQLH 4QTHB 1TITA 2PTUA 3LEXB 3V7AE 1EVUA 3DVNA 4YDIH 5HPMA 5GGSY 5IVOA 3DOSA 1DQTA 3CXHK 3U48A 3X13A 1QRNE 4UV7H 4L9LC 4FQJL 5CZXC 5TF1H 3CVHH 4NQCB 5SWZA 4RNRB 4LU5H 4CL7A 2YSSA 4AL8H 3CGTA 5DS8B 1CBVL 1GC1L 1I7UB 3L1OH 3MV7D 4JZJA 1LWRA 1Q94B 4O5LH 4PP1C 5DJAA 5CD5D 1ZLUH 2C9AA 3NIGF 3UTPD 2K1MA 35C8L 3TO4B 1KJ2L 4FTVA 3U9UA 2VN7A 5T1DH 1RJLB 4EDWL 3HE7D 4WW2C 1HKLL 3RNKB 2A6DA 2Z8WC 3EYUL 1AGCA 3HR5B 2YZ1A 2VOTA 2AEPH 3AU1A 4X0KB 1JYWA 3KPSD 1NAKH 4S1RL 4U1LB 4X6CF 3N1GC 3FFCB 4XX1E 3AGVA 3LN5B 4HPOL 5TJWK 3HMXA 4N5ED 4FABH 1MCNA 4QRPB 4EI6B 4L29B 1U8NB 2FIKB 3QEGL 2P5WB 4M6MH 3JTSB 3SDXF 4LAJH 5JDSB 2FWOB 5KJRH 5FO7A 32C2A 4NNYA 3OAYH 5TE6L 3NN8B 2I24N 2BNUB 1T7ZA 3DX9A 3CXHJ 2C3VB 3FRUB 3RU8L 4K23H 2ED9A 5F9OH 2YD9A 4H8WL 2QR0A 5D7KE 3GMMA 4XMPH 5DQ9B 4JM2A 1YNKH 1OP5H 3MRBB 3P4MA 4NQUA 3HNVH 4JFDD 1WLHA 2VZUA 2P8LA 3F7PC 5MEPA 3C6SB 1FZKA 2D03L 1MRDL 2CJUL 2KL6A 5JA8B 2Y5EA 1F90H 5CEXB 1MPAH 5IMKA 3HZVB 3AC0A 3SDAA 1D6VL 3EO9H 3FAWA 1JF5A 1AGEA 2P47B 4XGZA 5C3LD 1XGTB 4P48A 2WBJA 3ALPA 4M6OH 4Q74A 5ADPH 4LLWB 4PJXF 2IG2L 2DI8A 3BPNC 3VGAB 4N9GB 2VIRB 1QP1A 5JO5B 5IBUB 4BFIA 4LGPB 1U8QB 1HXYB 2NY6B 4XZUB 3NIFE 4PJBE 1F3DJ 4CAGA 5LVEA 3D3VB 4XC1H 1JUFB 3MRCB 1M05B 3Q5TA 2YBRB 2GW5A 5AG9A 4GRLD 3N50A 1VFBA 1XEDA 5T3ZL 3RX8A 5GXBB 5CBAB 5IHZB 4NGHH 3GHEH 1EFXA 3QI9D 3NACL 2IH1A 4HJGB 1ZGLM 4E41E 3X3FH 1TZHB 2FL5A 2V7HA 4NQVB 3PP4L 5H94B 4LIQL 3G6DL 4ZUUA 4RIRA 5T3XL 3VFRA 2V2TB 1A21A 1KLGA 4JZNB 2B8OT 4LVEA 3PQYA 4F7CB 3SE9H 2WLZA 1Y6KR 1J1PH 3HN3A 4TQEL 2BVQA 5F7EH 3T2OA 1YMMB 3LDBC 4F7MB 1KACB 2MTPA 3DHJA 3R8QA 4LSRH 2VDPL 1JTTA 1MFCL 3LVEA 1X5HA 4NO0A 5BZDA 2FNBA 1HNGA 1BQHG 1MHCB 5L2JB 3U0WL 1HQ4A 2OJEA 1C16B 1FL5A 1UADC 2HT2C 3WIIH 1QFOA 3QYCA 4X7DC 3KYOA 2HAZA 3U0TA 3ZSTA 2UV3A 4APQB 4X6DF 4PRAA 3FO9A 5JUEH 1BJ8A 5D2NC 3V5HA 4ODWB 3GRWA 1HHHA 5J13B 1C5BH 1P4LA 2AGJH 5BRZA 3FT3B 1YN6A 3HG1E 4PBWD 2BJMH 5DK0B 2JK5B 4I2XE 2J8UF 4O02H 1BHGA 1CDJA 2HT4C 5CSZA 1Q9OB 1E4XL 2VJXA 3L95A 2UWEE 1UA6H 3OKLB 3BPLB 5I1JH 3MGTB 4OIIL 3FB6A 3FL7A 2B4CL 5E9DD 1ACYL 3U0PB 4TUOA 3WHE0 2ZSVA 3GSNB 3KJ6H 5I8KH 3UTZB 2HLFD 4JB9L 1KSRA 3SDDB 2B2XL 4LHQB 1LP9E 1DSFH 1UWEL 5EUOA 3LSOA 4X6FB 3HZYB 2CLRB 2HA1A 5DA0B 4HUNB 1V7NH 4X7FC 1RV6X 3DV4B 3TVMB 1CZ8L 2BOBA 4L3CA 4ODXB 3T2PA 3BGFC 4LSSH 2R39A 2EYSB 1MFAL 4P3DA 5L88H 1OGTA 4M00A 2EE9A 1WQVT 4PLOB 4RBPK 1GAFH 2X4OA 3RP1A 4J3WA 1IT9H 4Q2ZB 4DGIL 4Z76B 5BMFH 5GGQH 4Z5RA 4U7SA 4LNVA 4BK4A 4GAFB 5ELIA 1T7YA 1NCBH 2EEBA 3GMPA 4G43A 1Q1JL 3VFUB 2Q3ZA 4C83B 2EICA 3S88H 3O8XA 3LQMA 3NPSC 5GGRY 4JGMA 4LVHC 5E99H 1R5IB 4LPUA 1FC1A 1OAUH 5DLMH 2DM3A 1U8JA 1N6QL 2V5MA 3PDOA 1LE5A 2FLBT 3C6LB 1NC4B 1JPSH 4AEIL 4M7JH 1ND0B 4P2YA 1RY7B 3SPVA 3NAAL 2NY2B 4H1LG 4LRIC 4XNQA 1M1SA 2OP4L 4IIQA 1HWHB 5J1SC 1BREA 3VRLE 1JFQL 2QHRL 4LLDB 1NKRA 5GGSA 1JNJA 4NN5C 1DVFB 1RZ8A 4S10A 1MWAA 4PLJC 3QXTA 4YHKH 4WO4C 1ZLVH 2LU4A 1HHJA 1NGZA 2YUXA 3F12A 4QOKB 4ZYKA 3MV7E 1RK0B 1UQSA 1KEMH 2HFEA 3AVEA 3U83A 5ITBL 3DYMA 5B39B 5ID0B 4QLRA 4R3SB 5D72L 3UTPE 2DBLH 3GJFB 1T1ZA 4S1SL 1A3RL 2KDGA 2A74A 1X9QA 1HEZA 4WI4A 3IU4L 3VFTB 3L3JB 3SGKC 3EOBB 3N9GL 5IESL 5DDHB 2VLJD 3N85H 3FQTA 5GPRA 3CLEL 4QHNA 3KPSE 3WUWA 3O0RH 4EOWL 5IFJB 1PVHA 2DYPB 3N1QC 4YDKH 4ZUSA 2EKSB 1QLFA 1S9XA 4HMDA 2PCPB 4O2EA 5C6PB 1CFTB 4WWKD 5IKCB 3ZYIA 4BZ1L 4ZO7A 5F3HB 1GHFH 3EDKA 1K4CB 2JB6B 3H9ZA 4X9HA 4OI7A 3JTTA 3MRFB 2A1WH 3ZYOA 4J3TA 3QUYC 1JCKA 3MRHA 2LV4A 4UNTA 5TE7L 3BKYL 1T03H 1HILB 2ESVD 3MOAL 3LV3A 4POZD 3MOQA 3IF1A 2BRQA 5EORH 2DWEA 1IAIH 5DTFA 4WHDA 2RHEA 2KH2B 3QDJA 1LILA 1WUNT 4JFDE 3S4SB 4XCYB 4R8WH 5INCA 3HAEH 2YPKB 4J3VA 4KQ4L 3S96A 4D94A 5IMOA 1T2XA 1KCUL 4YHML 4HF5H 2BSSA 5D8JH 4K7PY 4HS6A 3QCTH 4N0CC 3DX8B 2JLLA 4JO3L 1RURH 1NL0L 2UZYB 4QRUA 2C4FT 1F58H 4QT5B 3UC0H 5I0DA 1YYLL 5CP7A 4DW2L 4AG4H 1KULA 1AR1C 1AXSB 3OR7A 1B88A 3BWUC 2C1PB 3BKJH 3P0VL 1B0GA 3T8XB 5IFHL 1FGNL 3KYNA 5AYUH 3BUYB 3KYMA 3PGFH 4LPWA 2NX5A 5D7IF 1IL1A 3IFNH 2Q8BH 2J5LC 3TA3C 3DUUB 5TQ2H 5GJTL 1F4HA 4UQ3B 1I8MB 4XPTH 1X5AA 3LZFH 4HS8L 1F02I 4U1KB 5ERWB 5C0CD 1DTUA 5CHNB 3WLBA 4NPYB 3BDBA 1T1XA 1KPRA 3I6KB 4HK3N 4XH2A 3TZVC 4LLAA 4P23A 2PTVA 2YOCA 1MFEH 4QXTA 2VMFA 4PJ8A 2BRRL 1NDMA 1F11A 4PRNB 1IGIL 5HGAB 1IC4H 5IB3A 4K7FB 3IJHA 2O5ZL 4XCNB 5T5NG 4Q0XH 5F9WB 4MCYA 3LKPA 3CPLA 2RGSA 2NW2B 3O45B 3MV9D 4QRRD 2X4TA 4JO4H 1FVEA 4E5XA 3HA0A 3L6FB 3BT2L 1OARL 3CFBA 2R56H 2WZPD 3ARBC 2OMBA 3ET9F 3GMRB 4KK5C 3TNNA 5DVLA 4JHAL 1I9JH 4LCWA 4CADA 1G1CA 3LPWA 3QEUB 4YXHL 1K2DB 4HJJL 4N0RA 3FAXA 1KJVA 1Y18B 4JGJA 4HCRH 1T2QL 4N0FB 5ENWA 3SDXB 4WEBL 1YUHA 4Q9BA 2P7TA 5L2KD 3BH9B 4BZYA 1S7UB 1DQJB 1YYML 2OX5A 4PD4K 5MERA 3MRDB 4NZUL 4ACPA 4GH7B 2XQBH 2AJUL 2WWMC 3KGRA 4OD3H 4R0LC 1XH3B 3KLSA 5IBTH 2PO6C 3D0VA 2WWKO 5FM8A 4LQFL 1Y0LA 4FQXB 3WFCL 1UH3A 1IFHL 1JWSB 5EO1A 4LCCB 1P6FA 1QBMH 5DFWH 1VPOL 2VITB 1GZPA 4Y19B 2MPAH 4LHJB 5GSVA 3V6OA 5J1AB 4XVJH 1G6RL 5KSAA 5E9DE 4EQ2A 5D7LD 1WWBX 3VGDA 3P40A 1CI5A 5ISZB 1MCDA 2B0SH 4P5TB 4U6HA 1TVHB 2GIYA 4U2ZA 1D3CA 1SM3H 4FZ8L 2Q76B 3S34H 5D2LE 2VLRA 3JSSA 1U93B 1J0YA 2HMIC 2P24B 3QSKB 5DJZB 2WUCH 5DVMA 1T0PB 2BVYA 4JR9H 4ZXBD 1X5KA 2CXKA 1DQDH 5EZIL 4PJXB 4L4VB 1DQMH 5ESQA 4DUXA 3RZCB 1YNTB 5TE4L 4OLYH 3QG6B 4UT9H 1N6UA 1FPTH 3OKKA 3VWJA 1DQQA 2NY4D 2GCYA 3EHBC 4QXUH 2CKBA 4KKAD 4LHUA 5MP6L 3UBXA 5CJQL 3GHBH 3P9LB 1KELL 2AABH 4NFCA 2NZIA 3DUHA 4HKJB 4GBXB 5HHVH 5IHLB 2ADGB 1YEKH 3C9NA 1CVRA 4NNXB 5EU6D 1A1MB 4ELMA 2JCCF 3V0WL 1RJCA 1JWUB 4FXLA 1ZLWH 5HDQL 2OTPA 4O51A 1BAFL 1NFKA 2P5EA 1IILE 2PXYD 4XWGL 2HKHH 1IC1A 1FNSL 2EDTA 4PD4J 5GGRA 3NCMA 3H3PL 3IXTB 5KVGL 1PKOA 2ADJB 2DKSA 1WWCA 3SJVB 3ARGD 2H6PB 3EYQC 4LF3B 4OBRA 1CE1H 4W68A 3F6LA 4X4ME 5IB1A 1CS6A 4FS0A 4F7EA 3VG0L 5DK2A 1DDHB 3WN5A 4EVNB 2AJVL 3ULUF 5ALBL 3CFEB 3DMMA 4L8BB 5TF0A 5DQDH 4JRXB 2Z91A 4NUGH 1CDGA 2Q8AL 3V8OA 4FQQA 3PGDA 4PPTA 5EIQA 4N8CH 1I3RA 3OPZL 1I4FA 4G7YL 5F1NB 3KPNB 4FOMA 5B38A 1A5FL 1CFQA 3V8CA 1HCFX 2Z4QA 3DSFL 4YFEA 1JRHI 1DCLA 2VB5A 4X9IA 4OZHE 3C09C 4MZ3A 4O4YL 2VLJE 3HPJB 4FFZH 5C09B 1IAMA 1U8KA 4HH8A 3T0EB 4M7KH 3GBML 1FV1B 1TZGL 2J8UB 3UMTA 5I1IH 2H9GA 2R2EA 2YK1L 4HIEB 3MZGB 4V2CB 1D5ZA 1MFDH 1WT5A 4RFEA 4FQ2L 1R0AL 5EOTA 3BPOB 4U1GC 4MS8C 3H9SB 1NFDB 5DWUH 3DSNA 5F7KC 2ADIB 3FB5B 5GGTA 1ONQA 2H45A 2AXGB 2DQCH 3TH3T 5FF6A 1G6VK 1C1EL 3P4NA 1QSEB