4OZGB

D2 protein complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
181
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 181
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozgB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ozgB01
2EC9U 1OTUC 1U92A 1CI5A 2GEEA 4L3CB 4PJBA 4C55A 3RBSA 2DQDL 1LD9A 3NBNA 3OJVC 4YBQD 1UZ6E 5IB1A 4KQ4L 4Z8FL 5D93C 5SWSE 3QPXH 4RMWA 3QWRA 4X8JA 4P5MA 1AD0B 1FN4B 4YLQT 3P73A 1M7IB 3N85L 4LVOB 3FT2B 3ZSSA 4EI6B 1YNKL 2I5YL 3KPOB 5EU6B 1SJXA 3ILPB 4LCCA 2ARJQ 3T2PA 1G9NH 5C7XH 1E6OH 1OCWL 2A6IA 4MAYA 1FPTL 3VXSD 2D2OA 2R4SL 3N06B 5DURD 1A2YB 2ICEA 4K23H 5IR1B 2FECI 3WIFA 2PF6A 5D5MA 3FQRB 1C16B 3BPCB 1XF5B 5DYOA 3VXSE 2EICA 1Q0YH 1FH5L 1U3JA 3OR6A 5KBNC 1VKXB 1EEUA 4DZ8B 2VDQL 3ALWA 4N9GA 4NQDA 1OGTA 1EO8H 4L3EB 4WUKH 5IHBA 1H0DA 1ERNA 2AK4B 1QBLH 1PZ5B 5CGMA 5HY9A 2OTWB 4QT5A 4PRPD 4GXVH 4X5LA 4CBPA 1VERA 3ARUA 3F65A 5IHUH 1YC7A 3ULUH 1OTUD 3ZZ1A 1FNGB 3IYLW 2R15A 3G5VB 1FHGA 4PRPE 1F13A 4ODXB 4J7RA 3LKOA 5AUMB 1UADC 1IM9B 3U1SH 4I13B 1A7PL 1G7QB 1SY6H 3ZE1F 3I6GB 1C5BL 3VWJC 2BNUA 3GBNL 5CWSA 1Q0XL 1DBKL 5I1AB 2IAMC 3EFDH 3QXVA 3RNQA 1PG7H 5CJXA 4ODVL 5KZCB 1B88A 4LMQI 1T1YA 4U1NB 5IQ9A 5HVWA 3RNKB 4NO5A 1N5YL 2P4AB 3MJ8A 4K7PL 1HCVA 1T89A 4WI4A 1OSPH 2ZNXA 4JREC 4JVPA 3ULVL 1NSNL 1INQA 3LKRB 3MV8D 4KQ3H 3BAEH 1S7RB 4DTGH 1RVFH 2DQIL 1LNUB 1ZV5A 3D25A 4JZJC 4H0IA 1HQ4A 5DD5H 1DBJH 2BY0A 1CK0H 3NFNA 2VXUL 3MV8E 2ZG3A 5A2FA 1AQDB 3GKWL 4YE4L 5GGTH 3RDTC 3PQYA 1MSPA 2GCYA 1VFAA 1ZS8A 1NQBA 2SEBB 3W2DL 1ZVSA 5KVFH 2PKDA 3C5JB 5EU5B 1F4HA 2MKLC 4MSWA 1F3RB 2QBWA 3PWLA 4EDWH 4LCCC 5E8EB 3LEVL 1T21B 4LHUA 3VJ6B 2AXFB 2DQTL 3KXFD 4MAYC 4HZLB 1RIUH 4U1IA 2QSQA 1D9KB 3B9EA 4KDTA 1ZTXH 4JFZH 1F6LL 1BBJA 2A38A 4FXKB 2N7BA 1AGEB 3VWJD 1F2XK 5E1HB 3KXFE 4GKSB 3G5XB 3DECA 2V5MA 4ZUUA 1QRNA 4LLUA 1EVUA 1T5XB 1PFCA 1YEIH 1PY9A 1EHAA 1QO3A 4HK3N 1P7HL 3NN8B 3VW3L 5GRUL 4WO4D 4GG6E 1P1ZB 2XWJA 3LPWA 5DD6A 2L0DA 4KVNL 4PY7A 5IFHH 4MWFB 2YZ1A 3OPZH 1LGVA 1QSED 5JIHA 4LAJH 2I9LB 2PYFA 1Q94A 3CFJA 1SVCP 4PV8A 5I18H 3QIBD 1K8IA 3BESR 2HT4C 1QSEE 1EFXA 1YMMA 3NOIA 1CU4L 1NUDA 5DMGC 2XTJB 5L0QB 3S88H 3RDTD 4K7FA 3DUUA 3HCVA 2R2HB 5A2IH 5BQ7A 2GJJA 4V1DA 1JHTB 1BEYH 3KPRB 3TIEA 3V52L 1L7TL 2DF3A 3ZYZA 5MP6L 1QFWL 2FRGP 4K2UL 1SMOA 1YNTB 4HIIA 4S0TD 3A67H 4JJ5B 2V5RA 1SJEA 5I1IH 5GRYA 1T89C 1VFOA 3VRLF 1VHPA 3WNLA 1R5IB 4Y2DC 2B20A 4HC1H 2X1OA 2YA2A 1LP9B 4OFDA 2OCFD 4UUJA 1G6RA 4AT6A 4L9LC 1TCRA 3PF2A 5KSVA 4JRXD 3DX8A 1H3PL 3U4EA 3ULSA 5HBBA 3DURA 2D31B 4LKXB 4RQQA 4OLUL 5DUBA 1EFQA 1RUQL 1RJZB 2IPUG 4FQ1H 4NWTH 1KIQA 2O61A 4W81A 1JZ8A 3S9DB 4JRXE 4FG6C 1WGOA 3B8YA 3MRKA 1MI5A 2KL6A 4U4BA 2BY3A 3SO3C 1E4JA 1S7WB 5CINL 3T3ME 5L7XL 3IU3A 1YDPA 4JN1H 3BOVA 4J23A 3GMPA 1XCTA 3M17A 1MIEH 4DUVA 2HT4D 3VFSB 2PTTA 4R9HA 1INEL 5DMGD 4BFBD 3KLSA 3P77A 3GM8A 4HGKC 3MRGA 1J5OH 1T2QH 4U1MB 3CSPA 5L88L 1RUML 5EU7E 2F19L 1FP5A 5I15H 1OW0C 3HI5H 5GZOC 4F15C 4DZBA 1WIUA 5GS1B 1HHKB 1WAAE 3U36B 5BV7C 4PJ5A 1CD8A 2R69H 2PXYA 3DGGB 2G9HA 4DKAA 4F80A 3AROA 2CMRH 4O2EB 2IEPA 2GFBB 4TOYL 3SGKC 4GS7C 3WHE1 4Y2DD 1OP5H 4UDUB 2G60H 3TVMD 2ESVA 2VZSA 1K4DA 1L0XA 4N0RA 2JIXA 1A6TB 1R5WB 5J1SC 3F6LA 3EYOA 4JHAH 5JQ6L 2G5RA 4YFLI 3BYYA 2EE9A 4CDHA 3MOBH 4DFIA 3AXLA 4EI5D 5C0FB 4M7KL 1HKFA 1UM5L 1ZGLB 4LPYA 1EXUA 2LU7A 3N1QC 2EECA 5IB5B 3HZKA 4JDVB 1PG7W 5ANMA 5I0ZA 1U8NB 4FG6D 1LO2H 3QQ3A 5FB8B 1CIDA 1GGYA 5E6ZA 1EX0A 1R3HB 5C0IA 1WIOA 3FN9A 3L3GB 3STLA 1KTRL 3FOLB 3MRRA 4UILH 2W59A 3BKML 4I2XA 2HMIC 2WWKT 3GSNH 3GSRB 3HG1B 3H3PL 4PREA 1X6NA 4HFWB 3EYQD 3QIUA 4JQVC 4WHDA 1RU9H 4XP6L 1QBAA 1JK8A 1BF8A 3EKCA 1WZMA 1AJ7L 3BO8B 1N0XH 3D48R 1QRND 4IMKA 5MEQA 1LEKB 2VDLH 3UBXG 3UO1H 1U91B 2CO7B 4IMLA 1N4XL 3KYOB 3K8LA 2EIZA 3STBA 4DQOH 1QACA 1K3ZA 2XZZA 5BV7H 1T2XA 1QLFB 2P8MB 2NY5L 4MJ4A 3SY0B 3TWCL 3TNNA 4HFUL 1ONQA 3HE7B 1OAUH 1FZMA 1IGJB 3BIBX 4M1DL 5JQHC 3RWEB 2YPLB 3S96B 1LDPL 5D96C 4QXTB 2CDGA 1EFXD 4W70A 1OP3H 1A64A 3VMPA 4Z78B 2IQAB 1H9VA 1Y18A 2Y1VA 4NRZA 5C07D 3WFHB 4DW2H 4FQLH 5IVXE 4V1DD 2P48B 2X1WL 3RKPA 1K2DB 4Z7VF 4M7ZC 4AIZA 5DK0A 2BOCB 4L8CA 4ZDHB 3B8SA 1QG3A 1JZ7A 1NFDE 3BQUA 3RL2B 1RZFH 4PJGF 5D1QD 5C07E 3T77A 2OTUB 2PXYC 2HMID 4QHLB 4FTVB 4JM2D 4JY5L 2BSSB 3STZB 2Y9RT 4YDLB 3UBXB 4YHZH 3IS1X 2E27L 3QG7L 4GW1A 3AFLA 4C59B 1IEHA 1QOKA 4P5TB 3IDYC 3ZDZE 3C6LA 2ILLA 5M7QA 3BKCL 3GHBL 1W2KT 3QR2A 2D9CA 4A2MA 2GY7B 2QSCL 3UMTA 4FZ8L 4BZYA 2VH5L 1G6RH 1OF2A 4X0KA 1T20A 3GSWA 3ARBA 1MCIA 4HBCH 3OG6B 5DRZB 3V0WH 4MXQD 3C9NB 2H2PC 2VAAA 3MLSL 5JMOC 4KMLB 4K3JL 1XCQB 3R1GL 5DK3A 4JY6B 2VB5A 1MI5D 4NZDA 5KJRH 2BNRA 2WWMD 1CICD 1TQCB 5FOJA 1MIML 5L2KD 1C5DA 1FFNA 2QADC 2IALB 5EFIA 4C83A 2Y36H 5E95B 3MV7D 3CDFA 5MEPB 43C9A 1A7QH 3QFDB 4JDZB 4WGWB 5L2KE 4UV7H 1OSZA 3MBXL 4HJJH 2W91A 3B2UC 5HHOB 5EO9B 3MV7E 4Y16A 5H2BB 2MCPH 2CXGA 1B2WL 4GBXD 4IMKC 43CAB 3QNYA 2P49B 4LBEA 3PJSA 1FL5B 3UZQA 3VE0B 1NPUA 3SDDA 3W0WA 1S7QB 2V5SA 2Q76B 5T3ZD 3F12A 3U9PL 3BIAX 3DVGB 3LKPB 3F62A 3IFOA 1YY9D 4HG4J 1FFOB 5IMKA 3DNKA 4MA7L 4FQ2H 3X3GH 4PPTA 3CXHK 4Z7WE 2DN7A 2F8XC 4HS6A 5T3ZE 3A6CH 4RWYH 5E9DB 3DTXB 2DL9A 4P23B 4XCEB 2G5BA 3WEXA 4P4KD 1BZ7A 5E8NA 4OSUH 4ODSL 1EGJL 1MREL 4H26A 4HGWB 1IZKA 1OPGH 3OKKB 4P46D 4Y1AD 1KEML 1HOCB 4LLYA 4N0UA 4K94L 4M6MH 1I9IH 1LHZA 1F42A 4L4JA 2VC2L 4G8IA 4JB9L 5JR1H 3OXRB 4GG8B 5C6TL 4FXGA 3WS3B 4Z7OF 5SWZB 2HJKA 1D5MB 5MHSD 5DJDA 3KR3H 2ZJSH 3BPLB 1J05A 4JRYE 5ESAB 2R1YB 5DUPL 5L9DH 4Y89A 3C6LC 4JY4A 1RJYA 4XBEH 5HDOA 1WCBB 4PP2B 5C09B 3LH2L 3U0WH 1BX2B 1XF3A 2OK0H 4L5FH 2JE8A 3T1FB 5JOFA 3IJHB 4JKWA 3V5KA 1UH4A 3VD5A 3M45A 3IFNH 4MYWB 1JGVH 4NQEB 5FYLE 1UJ3A 4HPYH 4WFED 3QH3B 4H8WL 1JYXA 5SX4H 1AFVH 5BOPA 3PDDA 2YSSA 5DVMA 1A1OB 1FZJB 3T0BA 1TNMA 4P99A 2BFVL 1NMBH 1DE4B 3B5GA 1Q1JL 4WFEE 1C08A 2NY2C 3TZVD 3H9SA 4G8FB 1T6VN 4MCYB 4UQ3A 2GK2A 1NJ9A 5DDHB 2UUDK 4XPFH 1FL3A 4Y16C 5ENWB 2OTPA 4EOWH 4NYLB 5CCKH 1NAML 2DJSA 3U83A 3VWKA 3QG6B 4XVJL 3NTCH 1ZLWK 3TPUB 4AIXA 3SDDC 5JHDD 2QQNL 1MFAL 2X4OB 3WS6C 3MUZ1 1YECH 4MX7B 3QDJD 1HQRA 1UFUA 1TFHA 2QV2A 5K33A 4HWUA 4LASL 5EOQL 5JHDE 3AS1A 1VACA 4FFZH 2UZIL 4PB0H 3OJMB 4I5BA 3WD5L 3K74B 3QDJE 5F7UA 2GIYA 2Z91A 4BH7A 3TGXA 1A1NB 1S7UA 1U2CA 5I8OL 5D72L 2E9WA 4PG2A 3IDNB 1UEMA 4K7PY 2HTKC 4WNQB 3D2UD 3KLAB 3AB0C 3QXAA 5TFSH 2GI7A 5IOPB 3PL6A 4MLIA 3IDGB 5C1MB 3HC4H 4Q9QL 3D3VA 4GJTB 4QRUA 4R3SA 3LSOB 3MJGX 4JHWH 4K3GA 5D1ZB 1XGPB 3EOAA 1I75A 1UENA 5F96L 4X4ME 4BKLB 5JPNA 4YEFA 1TJHH 4HHAB 1N6VA 3Q6FA 1R24B 3U6RB 3BP6B 4FA8A 3F7YB 2ZSVA 1KN2L 1W72A 1YN6B 3O6MH 3L7FA 1P4BH 2DKMA 4G8GB 3ZTNH 2H2SC 1NDGB 4Y19A 5EBGA 4LVEA 3BKJH 1CDCA 5JXED 3MYZA 1KB5H 4I48B 2VMFA 4W4OA 5A40E 4MDJB 3WHXB 5IB4B 4OB5L 1D6EA 1DQML 2E6QA 1NCCH 1IQDA 2WINA 1U93B 4CVUA 4N1CA 1ZHBB 1FAIL 2XZCH 2HVKA 3QP3A 4L3CA 1NMAL 5MENA 5I73B 4G80B 1QNZL 1KB9J 3QRGL 1UYWL 4LPUA 2HTKD 3CVHL 1FN4A 5JLZA 1M7IA 3I75B 3FT2A 4EI6A 1WBZB 3FQWB 4YX2H 4OTXL 1EHNA 5I6XB 5EU6A 3ILPA 5C6PB 2GSGA 3VWKC 4HDIB 3T0EC 1YEDB 4KROD 5JO5A 1NGZA 5IR1A 2J12B 2VLRD 3SE8L 3FQXB 3BPCA 3CLEL 1XF5A 4R2GB 2OR8A 4LSVH 2CUMA 3RL1A 4CJ1A 2Y7QB 3MO1A 5CFHA 1VKXA 4RFOH 4DZ8A 1DCLA 2VLRE 3NCCB 5F9AC 2AK4A 4PG2C 3QXTA 1C1EL 3L9RB 1JGLH 3WNOA 5HDBF 2OTWA 3O3EB 8FABB 3PL6C 1UKQA 2J6EL 4UBDC 3MSPA 4ORZC 1BF2A 3FTGB 4E0RB 1FNGA 2ZCHH 5KN5B 3TT3L 3C09C 1SEQL 3G5VA 4AENB 5H37H 1IKNA 4ODXA 5AUMA 1PEWA 1G7QA 2X09A 3EO0B 1GIGL 1NANH 3I6GA 1NKRA 4S11A 3H8NA 4YHMH 3UJIL 1H3GA 1NFIB 4JFYB 1RUAL 4PTTB 5I1AA 4XXCA 4PUBL 4MS8D 5F6HI 1LMKA 4HXAL 1RUPH 4QF1A 1E4XH 2CLVB 4FQIH 4U1NA 1JYVA 3T0ED 3RNKA 3R0MA 3R0NA 1JGUL 3GSOB 4NRYB 4XH2B 1DQJB 4ZO8A 2ATPB 2DBLL 4NUGL 4TPRH 2E3VA 5CJOH 1LNUA 2P5EA 3M1BB 3T0EE 4CGTA 2ADGB 2YPKA 4XCYB 3P4LA 1MWAL 3NFPB 5HHPA 2CPCA 1J1XH 2DQHH 2R0KL 1AQDA 2VAJA 4ERSH 1A02N 3GMLB 5HHXH 4OCMC 2R29H 4M6NH 4LVOC 2SEBA 5FKPB 2XZAH 3C5JA 4TVPH 4YHLH 4OLZL 3VFNB 5E8EA 5IB3B 2L7JA 4OD1L 4YEEA 2AXFA 2EDQA 3WFDL 2AJYL 1FJ1B 1CLOH 1EAPB 3S8WA 1IC4H 3O2DA 5L8JB 4FNLH 2XA8H 5FKAB 5DVOA 5DD3H 4FXKA 4HS3B 2ID5A 3VFVB 2AEQH 1AGEA 5C2UB 5K9OB 4JPWL 3CMOH 4Z76B 2OR9L 4Z0XB 4E42B 3G5XA 2VL5B 2BXZA 3DOSA 1MLCB 5IKCA 2IQ9H 5CEZL 2XRAL 2CRZA 1T5XA 1AH1A 1W72H 3H9ZA 4NHUA 5F21B 1P1ZA 5J13B 4K9EL 3D9AH 3ESUF 4TTGA 4PJIA 1XEDA 4MWFA 1MRFH 1WVZA 3GK8L 3S34L 4LFHG 4JFHE 5D7JB 2AJZA 2I9LA 2VDNL 2CUHA 3I84A 3MLTA 5E6IB 1M7DB 1QFHA 2WUCL 1LO5B 4JFQB 5DJZB 1I85A 4KZDL 1IKNC 3TM6A 2M2DA 2GTZA 5EN2B 2VXVH 5DMJB 5A3ID 1V05A 4NUJB 2FWOB 2VYRE 4XMLL 4S1DD 5AZ2L 4ONFH 4GMTH 2R2HA 5TE4L 1MQKL 4TSCL 4ZS6C 3KPRA 2DLIA 4Z5RB 1DSFH 3AVEA 3PWNB 1YNTA 1JPSH 3MZGB 3KHQA 5IHZB 2O5YH 4XNXL 4LDLB 1G9ML 5T5NF 2BK8A 1WC7B 1TVDA 3AU1B 4G43B 3QO1B 2BHYA 2WIMA 1R5IA 2DQFB 2Y5TA 1WFTA 4XCCL 3ZKNC 2DRUA 1NCNA 4JKPH 5IJKA 1NGWB 2BXYA 3RY4A 1N26A 5CBAB 4U1JB 1EAJA 4LLMA 2VERN 4LKXA 2D31A 3H9HB 4GKOA 4L3ED 2AK4D 5I30H 1JWUB 2FATH 5LBSH 4PRAB 1KENL 4DN3L 3QDMB 2VZOA 3ZTJG 4L3EE 2OMBA 2B8OT 1S7WA 1I8MB 1X44A 5DR5L 2AS5M 1SJVA 3IAPA 2VJXA 1I3RA 1OAQH 4KHTL 5TE7L 5GGUA 5CS7A 2WQRA 1K4CB 5IFJB 1RJCA 3WIHA 3EO9H 4JFXB 1D9KC 1IM9D 5EZJB 4ZAKB 4NZRL 3GJFB 4KJYA 4XWGL 3MV9A 1NEUA 1JBJA 3BISA 1D5BB 1A7OL 5EUOF 4KUCF 4LSRL 3GIZL 1F4XL 4PRDB 5DQJB 3QDHA 4AM0B 1NAKL 5KZCD 5GS1A 3U36A 5BJTB 1EA9C 4OCSL 1DDHB 1I9RH 2LVEA 1SQ2N 2GFBA 12E8L 2PO6B 1F11A 3ZKND 3CFEB 1KCUL 3C5ZD 2VR4A 2R0LL 5HD8C 2VXSL 4OGXL 1ITBB 6CGTA 4U7MA 1I85C 5DFTA 4UI2A 3UYRH 5BS0D 1JZ3A 1JF1B 4PJ9D 3K80A 5C0FA 1BAFL 2XTJC 1DUZB 1BFOB 2FGWH 3JV6B 4MNGB 4B50A 1ZGLA 4JQIL 2RB8A 1CFVH 5DXWA 2CRYA 1R3IH 4RFNB 5HHMB 5IB5A 4JDVA 2W92A 1OL0A 1U8NA 3MZTA 5DA0B 1R3HA 5BS0E 4LGRB 5ALBL 3ZE0F 2DLHA 3OR7B 2GAZA 3L3GA 3DIFA 4X7TB 3F7VA 3SEPA 5SWQA 4L9DA 3HG1A 3SE4A 1D9KD 3EJYD 3QCTH 1WEJL 3NACL 1QVOA 4HFWA 1V8HA 5DMYA 2COQA 3MCLL 3RP1A 5IJKC 4O51A 1P4LB 1JTOA 3EJZD 5JHLH 4G7YH 1LEKA 2IH3B 1ZLVK 4GQPH 2OZ4L 2NZIA 4RMUA 5F7MC 5EIQA 5L2JB 5B38G 4H20L 3KYOA 1I7UA 3DLQR 3UC0L 1WBXA 4Z7NF 4XWOC 5HYEA 4Z95L 4IS6B 4OM1H 2AJ3A 4HSQA 2P8MA 2HFTA 1CR9L 4C56A 4TQEH 2GW5A 3NCJL 5FYKD 1L0QA 3QZWA 3SY0A 3VFWB 4YFEA 5TF1H 5HD8D 1D6VH 3HE7A 5AG9A 4N5UA 4BK5A 3H2WA 3KWWB 3RWEA 5FYKH 5C3LD 3S96A 4PY8I 1KPVA 4QXTA 5C2BH 4Z78A 1JCKA 5DLMH 5FYKE 2IQAA 1WT5A 3G04B 3Q1SL 4ALAH 5TJWK 4WWID 3WFHA 1G7PB 3NIDF 2FH6A 3KPRD 1K2DA 4RIRB 2ZPKL 1T0PB 2BOCA 4H0GA 5GS1C 1YJDC 2JJWA 3HMWH 3DRTB 3RL2A 2HKHH 2OTUA 3O4LB 3WO4C 5ALCH 1GC1C 1S7TB 4JPKL 3TH4T 3INUH 2EDNA 4QHLA 2BSSA 3STZA 3IFLH 3LKSB 2WM0A 5D7IF 5D6DA 5EBLB 1O0VA 4NC0B 1K9TA 4G42B 4R26L 4P5TA 4Q2ZA 5B38B 1J12A 5A2LH 5GGVL 5EIVA 4FQJL 5LGHL 3LD8B 3MRCA 4W6WB 3V6ZA 4PJHE 3F7RA 5J3HC 4KKAC 4OZIE 3BZFB 5AD0B 1LP9E 2OSLB 3MLYH 1L9MA 5DI8B 5DRZA 3HNTH 2OM5A 3C9NA 3VG9B 3I9GH 3WNMA 1XCQA 3IDXH 4OQTA 4XNYH 4JY6A 3D18B 3VGDA 3L95A 5FM8A 4M48L 3V6FB 1BFSA 2IALA 3EYFA 1KEGH 2OI9B 1MJ7H 4B7LA 5TQ2H 4TSAL 5DZNA 5MEPA 3EFFB 4X6FA 5C0CB 3VI4E 3QEQB 4ZPVB 5EOCH 3WIHH 2W9DL 1NGQH 3IXAB 1WISA 4LSUL 5EZLB 5H2BA 1JN6B 4XBPB 5HJ3B 43CAA 1HXMB 3QJHB 1V3KA 1OQOA 3I2CH 4HMEA 4GAJH 1FL5A 4NQCB 1LK3L 5KW9H 1RZJC 2GUOB 3RIFF 4LSQL 3WFZA 4LCWB 3LKPA 5HYJA 5BVJB 1YJDH 3EDJA 4XPAL 1CE1L 2YOCA 4O02H 1KSRA 4X4XB 1FFOA 3GMMB 4IBLT 3Q5OA 2Z0BA 4OLWH 4HK0A 3T3PF 2F74B 3ZE1E 1BIIB 1GC1H 3MNZA 1UB6B 1H3TA 3S97C 4TSBH 3KYNB 1NANI 1MNUL 2Z31B 3HE7C 4MHHI 4NT6B 3QHZH 3P4NB 5E9DA 2EXYD 3DTXA 1VEOA 5J3HD 2NXZB 5HYSG 3O45B 3WLBB 4NKIL 4X6DF 2I24N 2LQRA 2YD2A 3DHJA 4F9PA 5F89B 5B21A 1WT5C 1YEKH 1F90L 3PWPB 2UUDH 1E4XI 1NAMB 4PJ8A 1WZLA 4HEME 5FV2A 4HGWA 4AYFA 5GISH 2A6KB 4F8QA 2AXHA 3OKKA 3ETBF 4HIEB 3ZE2F 1F6AB 5INCA 1HOCA 4S2SA 4MXVF 5JW5B 1DJSA 3K4DA 2FEDC 2H45A 4OJFL 4U6VH 1AO7A 4NBZB 3KS0J 4GG8A 3L1OL 4NPYA 3VFUB 1C12B 2AJSH 3WS3A 5EU3B 4E5XA 1D5MA 4HGMA 4MQXC 4YDLC 3Q3GA 5D6DC 3PUCA 3TC9A 3BSZH 1S7XB 1T7VA 4RMVA 1TTGA 2R1YA 4P5TC 4JCMA 4F33B 1BVZA 4O5LH 1MJ8L 1NBVL 1WCBA 1CG9B 1JWSA 1XIWA 2Q3ZA 3FRUA 1FO0L 3UTTB 1KTLB 1T1ZB 1GGBH 1J0HA 1DVFD 5KSAD 4S10A 1T03L 1VEMA 3E6HB 3T1FA 4QXGH 3IJHA 5TDNA 3T1WA 2BJMH 2H8PB 1CDJA 1QFOA 2DLGA 3P4OB 4U3CA 1RZJH 5MI0B 1F3JA 1S3KL 1TQCC 5E94A 3QH3A 1IAIL 5DJ2B 3BUYB 3FJTA 1F4WH 1HHHB 2FD6L 5T1LD 3EYUH 2YPLD 2R2BB 4YR6B 3RPIB 1A1OA 1FZJA 5KTEL 1EEQA 3CMGA 4O9HH 4N0CC 4LRNH 2HKFH 3O6FB 4R4BB 1SMAA 4G8FA 5CD3A 5E56A 4MCYA 2YPLE 5DDHA 4ZYKB 3EOYG 2JCCF 5ENWA 3TT1L 5D1XB 2YKLH 3ES6A 2FEDD 3MRBB 4NQXB 3GNMH 3TPUA 4P2YA 2X4OA 3QEUA 2Y06H 4DUXA 1MCBA 4Z7VA 4JPVL 4FTVD 5I1JH 2B1AL 4MX7A 3WXWL 3RVWD 2A2QT 4MQXD 5D9SA 5HPOA 3ARVA 3NAAL 4KTDL 4PJGA 1FIGH 4P5TD 1JUFB 1OAKL 3C60B 3LHPL 1IEBB 4ZUVB 4ZNEA 4DN4H 1FLRH 3MFFB 1A0QH 4FTVE 3TCLB 3C2AL 3ILQD 3CVHB 4OCNC 4P23C 5D7IB 4GO6B 2DMKA 1A1NA 4GSDL 4F9PC 3IDNA 5I8KH 5E2UH 1T7YA 1M6OB 4YIQB 1CFQB 3KLAA 1BQHG 2J7LA 2K3TA 5IOPA 4NSKA 5D7SL 3IDGA 2DTMH 2ZCLH 1JHLL 5E8OA 1F8TL 4PFEA 3VDAA 3LSOA 1FZOB 4I77L 2VDOH 3AS0A 2DDQH 1A6VH 4OQTH 1XGPA 3PABB 2NX5B 3LIZL 3O3BB 1GCFA 2IGFH 1MAJA 4FQQB 2XTLA 1AGDB 4N0CD 4XC1L 2BERA 5E03A 1R24A 2OP4L 3BP6A 3BPLC 1MVUA 5HHOD 4YWGH 1CDGA 4X7SH 3J7HA 1YN6A 2DKSA 2NY7L 4OFPA 4Z0BH 1MHHA 4G8GA 4J3WA 3EOTH 3V4VL 4AY0A 4LLWB 4APQB 5E8DL 3HR5A 1CLYH 5HHOE 2PW2B 3CLFL 3T65B 5ID1B 3MLZL 1L9NA 1J86A 3WHXA 5IB4A 4DGVH 3UAJD 4UT7H 2ICCA 3MLRL 1HYSC 5ITFB 3JVGC 2ZUUA 2RGSA 4OLVH 1ZHBA 3MRDB 3HUJE 1BJ8A 2EE6A 4U0RB 1BQHB 4G3YH 4X7DC 4DGYL 4P23D 2BSRB 4G80A 3N9GL 2AP2A 2VLJB 1T83A 1DN2A 5C0DA 1T22B 3VXUB 3TIDB 3P11L 5AAMA 5JA8B 4NKOB 4HKJA 3I75A 2XPGB 1WBZA 3OHXB 4QNPF 3UPAA 3FQWA 5BVPL 2VQ1B 4JM4H 1Z3GH 1FE8H 4HDIA 3JV0A 1YEDA 2CIIA 4OLXL 5E4EB 1UJTA 3IVKB 1FFPA 3EDKA 1RHHB 1NMCB 5SWZD 5D70L 5J11B 1MWAB 3KPPB 5LWYL 3FQXA 3E2HC 4FZEL 4NJ9L 1ZEAH 1EERB 4LEXH 1ZT1A 2Y7QA 5JNYB 1D5IL 1LO0L 2DQCH 2ZP0T 3N1MC 2W0KA 1IGCH 1BQLL 5SWZE 5DMIH 5C09D 35C8H 3VFRB 4OIIL 3LPFA 3LKQB 2NW3B 3PGFL 4U0QB 1JGEB 1PLGH 5B22A 4PLOB 3M8OL 4NQED 5C09E 2Q7YB 2W38A 2NR6C 1CGVA 5KN5A 4ZUWB 4PBVC 5D1ZC 4AENA 2ATKB 4ZFOL 4NQEE 1AE6L 3KVQA 1XF2B 4N5EC 5ID0B 1QFUL 3WFBL 1NFIA 4JFYA 4HKZA 4PTTA 1JNJA 4HXBL 2CLRB 2VR5A 4D8PB 5E2VL 1TJGL 4ZD3L 1AI1H 5GS0L 4DKEH 2FLRT 1U8LB 3CFBB 4Z6AT 3KS0H 1WBYB 4UIKL 5ESVA 2FYYB 5I1GH 3IJSB 4OT1L 3SKOB 4F58L 4OZFA 4NRYA 1EO5A 4RNRB 3SKMB 3S5LG 1ZLUK 1DQJA 5D7LE 1A3RL 2ATPA 4U31A 4ONOA 1ZKAA 4M1CC 1FGNL 2EEDA 5EZIL 4BFIA 5ADOH 1E4WL 3QCVH 1GH7A 5GSRA 4XP4L 1B0WA 4XCYA 2VTFA 3NFPA 2DQDH 1NBQA 5I73C 1AGFB 4KQ4H 4P2QB 4Z8FH 3ZKMD 4YGVB 1DQQB 1P7QB 3NA9L 1T83C 3MLWL 4LLAA 3G9VA 4CVZB 3MJ6A 2A6DB 2A74A 4L3AA 2EYTB 3OJ2C 1AQKL 3N85H 2APWA 4X4YA 3D0LA 1YNKH 2I5YH 1D5ZB 5DQDL 2ZUQB 5I6XC 1TVBB 3VFNA 5IB3A 4FFWD 3BYTA 1OCWH 1FPTH 3HRZB 1EAPA 2R4SH 1KIRB 3BN9C 3PGCA 2BY1A 5D1ZD 5DVKA 3SDXE 4LCIL 1N6QH 1KV3A 4HS3A 1RY7B 3VFVA 3BGMB 4R2GC 5CGTA 4E42A 4PV9A 2VL5A 1FH5H 4ZPTB 1Y6MR 3S5LB 2VDQH 5CILL 5IBTL 3FQTB 4HAGA 2ZCKL 4N68A 2HJLB 4HUWA 2EDRA 3EDDA 1YEFL 5GPRA 3RVUC 3H7LA 3UZVB 2XN9B 2HH0L 3VGEA 4KK8D 2D7MA 4PJCF 5ISZD 1M7DA 4PJXF 3REWB 5DJZA 4EN3D 2ZUYA 4YPGA 3DVIA 1A7PH 2EDEA 4Q9BA 5CJ8A 1EVTC 1C5BH 4NUJA 4MZ3A 3RIAK 1DQLL 3GBNH 1Q0XH 1DBKH 4RWHA 4D3CL 5ISZE 1IGIL 2N56A 3HA0A 4PRBA 4Z18A 3GSQB 4ODVH 4Z5RA 3AMLA 1X5FA 15C8L 3ULVD 4PJFE 2C5DC 4WW2A 4A2LA 5IHZA 5CP7B 1N5YH 5DO2C 3PNWB 2HWZL 4K7PH 3RWJB 2DLTA 4KRLB 4AQ1B 2UV3A 1CN4A 1NSNH 4G43A 3QO1A 4YXKL 3ULVE 2BCKB 2DQIH 4YK4B 4HUXB 4R2GD 5IMOB 3WNPA 4NO2B 1ZAGA 3DSNA 2VXUH 3L6FA 5CBAA 4U1JA 4Q0XL 5HDQL 4QO1A 1MLBB 1RK1A 3GKWH 4YE4H 5IW6A 2XXCB 2C4FT 2QR0B 2Q8BL 5CSGA 3L5JA 4JFFB 3BHBB 1AGBA 1NBZA 2HVJA 1EBPA 1NCDL 3IKKA 4UTAL 3W2DH 1KPUB 3GSXB 4RGNB 3QCUL 3LEVH 1G0DA 4MCZB 4S0SD 4X9GA 1I8MA 2FX7L 2DQTH 4BSVB 5GGVY 1K4CA 4XC3L 2HFFA 2HN7A 25C8L 1ES0B 4JFXA 5EZJA 5ADPL 5D2NB 2EKSB 4ZAKA 1O7SA 3GJFA 4H1LG 4R0LB 1P7KB 2MJWA 4NN6B 1G1YA 1D5BA 3RIFK 3MQIA 1KBGL 1KXQE 1Z2KA 4C57C 5E8PB 1ZE3C 3IFPB 1UZ6F 4PYHA 3K7UA 5CAYB 2ZOLB 3OWEA 3VW3H 2V5TA 4F37F 5GRUH 1RJLB 5DJXA 3S37L 5I1CL 4Q58C 4KVNH 1YYLL 5DC9B 5C0AB 3DI3B 4UQ2B 2MPAL 3BJ91 1J9CT 2AK1L 3DX6B 3CFEA 5D7JC 4M7LT 1QBML 2CRIA 5F88B 2A0LD 5E6IC 2X1XR 1CU4H 1MFDL 3E1F1 1BFOA 3JV6A 4PLJD 4O2CA 3TYFB 1LVEA 2FBJL 4WTXA 3T4AB 3G6AB 3W5MA 4YXHL 4WU5A 4L4VB 3V52H 1L7TH 5MP6H 1QFWH 4K2UH 4L4TB 1OWRM 3OB8A 5C0EB 4H1LB 2YD1A 4X7TA 3JV4B 4JN2B 2PTVA 4ENEC 5TDOA 2XY2A 3W39A 4GT7A 1PYWA 3O3AA 4BSWA 2D0FA 5DZOA 4Y4KB 2YEZA 2CDFB 1LE5B 3QDAA 5DSCA 3FL7A 4XMKL 1R5VB 1T04B 3QUXB 4YGAB 4HWEL 2QHRL 1IC1A 1P4LA 2VLKD 1FNHA 2QL1A 1CT8B 5JXAL 1H3PH 4XPHL 3CSGA 4V2CB 2BVOB 3E0GA 1F58L 4OLUH 3I3DA 1RUQH 2JJSC 4GQ9L 2VLKE 4S1QL 1DANT 3MA7B 4IS6A 1YEHL 1WZ1L 5LXGL 5FECB 1U95B 5T3ZL 5D7JD 4R7NB 2DD8L 5CINH 4AZ8A 1BJ1H 5L7XH 2LE9A 5E6ID 1CGSL 4EUPG 4NNXB 3I02A 1INEH 3D39B 3U4BL 3U7WL 4RA0C 1F5WA 3KNBB 4YDVB 4ZAKC 4KZEL 3G04A 5DJYB 3GI9L 5I1LB 5L88H 1RUMH 2F19H 4PJCB 4PJXB 1G7PA 3B4NA 3QFJD 1QA9B 4RIRA 2VZ3A 5DEZA 3CX2A 2E8YA 3TCXA 1MJUL 2LTQB 3ZHDA 2P7TB 3FQUB 2NY5C 5CJQL 1UG9A 3ZDXF 4TOYH 2DYPB 2QSTA 3QFJE 1GHFL 1MCNA 1BD2D 4CKVX 5EWIL 5EBLA 4FN0A 4G42A 5KVEL 3QDGB 1RZ7L 5B38A 1J7VR 4WI8A 1EGJA 4YBLB 2OYPA 5JQ6H 4OFYA 1BD2E 4MJ2A 2V2XA 1I1YB 4QHKI 4M7KH 4LFHD 5AD0A 1UM5H 5D6CB 1YPZE 4KKBD 2B0SL 3B9AA 3MRPA 1AKJA 4RFNC 4LIQE 3RWGB 5FYLL 1RK0B 4EUPB 3QDMD 1HIML 5GS3A 5CZVL 1QSFB 3VRJB 4JO4L 3D18A 4WEBL 5J7CC 3TN0B 3BWAB 3EUUA 4GG6F 5E00A 3V6FA 2YD8A 5GS2D 5C0BD 3H3PH 1FORL 3QDME 3ARFD 1A6WL 3UROR 5C0CA 4XP6H 3QEQA 5GS2H 4BZ2L 2XYCA 1AJ7H 4ONGL 1FO0B 5C0BE 3IXAA 3QQ4B 2RHEA 5EZLA 3GJFH 4E41A 3C6SA 1JN6A 3OKOB 3CC5A 4RGOL 5HJ3A 3JTTB 1FYHB 4CN6A 1X4XA 1CQKA 5KS9E 1JNNL 2RIKA 1EJOL 5BRZB 4NQCA 1NEZG 1N4XH 3BXNB 5BW7A 5EUOA 1UZ8B 7FABL 1AC0A 1UWEL 2YHGA 4NO0A 2DWEB 4LCWA 4M4RA 1X9QA 4OF6A 4R96B 5KVGL 2NY1B 5TDPB 4G6FB 4XI5C 3L5IA 1DLFL 2PO6D 3GMMA 2JK5B 3VXRD 1SYVB 2F74A 2NY5H 1ZSDB 3TWCH 4HFUH 1UB6A 3VMNA 3KYNA 2Z31A 4M1DH 1WWAX 1RZGB 4PB9L 1H3WM 4PJAB 1LDPH 3HRPA 4KI1A 3VXRE 2DOCA 4GXUM 2K7PA 1KJ2L 2E9JA 3ZTJH 3QXDB 1EHLL 2UWEA 1F6AA 4MJ5B 4X5WA 1GPOL 1OHQA 1J10A 5INDB 5JW5A 2F53B 4MNGE 1SJHB 3HAEG 2P47B 3V5HB 4QTIL 4PD4J 5DURB 4ONHA 1IQWL 5GZNC 4JY5H 1EZVY 1K6QL 3GRWL 1C12A 1Q38A 5BO1L 2E27H 3QG7H 3T3MF 1IMHC 1NEZB 1S7XA 2HTLC 1IGFL 1WTLA 4KHXL 3SGJA 4F33A 2EIEA 3BKCH 3GHBH 1I3GL 2QSCH 3LD8C 1CG9A 1YEEL 4LGSB 3CH8A 3V7AE 1X5KA 4FZ8H 2VH5H 4JJHA 5EULV 3UTTA 1KTLA 1T1ZA 5IUSA 3CXHJ 3FOMA 3IGAA 5HHVL 3KYMB 3MFGB 3RVUD 4K94C 4CU8A 4PRPB 1Z9SA 3MLSH 4OCXL 2H8PA 1ITCA 3DUHA 3P4OA 3VG9C 4K3JH 3R1GH 1WAAF 1MIMH 3KPSD 4QOKA 4DVBB 9CGTA 5BZDB 2OI9C 4FHBD 1EEZB 2R2BA 4U1KB 3RPIA 3LRSA 5GIRB 4BM7A 3OGOE 3ZT7A 1HWGB 4X6BB 3KPSE 2WSKA 3PP4L 3MBXH 3EO1B 3ECBA 3HAEB 3O6FA 4URTB 3L5WB 3PWUB 4YHNB 1B2WH 1OWWA 4ZYKA 1FC2D 4UB0L 4LK4A 5D1XA 4BUGA 3MRBA 1ZT4A 3V4PL 4QWWC 5DJCB 4HIHB 5H35A 4NQXA 3UPCA 5BW7C 3O4LD 4OZ4A 3QJFB 3U9PH 4L1DA 4H8WC 3MV8B 1KC5L 4XAWL 1QQDA 4QRPA 4I0KA 4TULL 4MA7H 2A9NL 2DM3A 3CUPA 2AXGB 2HFEA 1YN7A 4LSPL 1ZA3B 2HTLD 5DD1L 5I1DB 4F7MB 3O4LE 2DIBA 2Z31C 4ZUVA 1IEBA 2E9BA 4ZOAA 3MFFA 3TCLA 4OFYD 3CVHA 2NXZC 5D7IA 4YH6A 4HCRA 4Q9RL 1U8JB 4ODSH 1EGJH 1MREH 5I9QB 1X5JA 1B4RA 4YIQA 3SCMD 1MCSA 4GXUN 4KJWD 5E24E 4MQ7B 4UOW0 1IAKA 1A7BA 4K8RD 1KEMH 4X8XA 4G8EB 3RAJL 4K94H 2LVCA 3KXFB 2ZOKB 3P0GB 2I9TB 1FZOA 4GAYB 4HUMB 4I18A 2VC2H 4JB9H 5ERWA 5C6TH 1S7VB 3PABA 4OF0A 2YD7A 3K1DA 1KJMB 2R8SL 5CHNB 3O3BA 2FJFB 4FQQA 1S9XA 3CSYB 3O8XD 4JO1L 3C8KB 3HE6A 4LAQL 4GG6B 2HJFB 1U8HB 5DUPH 2IFGA 3MRJB 4NM4L 3MUY1 1ZANL 1X4YA 2APVA 3D85D 3IKCA 4QXWA 3LH2H 4LLWA 2HLFC 1I1FB 4OKVB 4WO4B 4DVRL 2J6EA 4APQA 5FDWA 2ENSA 2FNBA 1KCLA 4WJ5A 5IVXF 1RHFA 1KIPA 1I3VA 2CUIA 4JLRB 4P2RA 3X14A 4N90D 2P43B 5FYJD 2V2WA 4NP4L 2YC1B 5MI0C 4OF3A 4JO2L 3GBML 4Y0GA 4ZFOB 4P4RB 1NFDF 5EUKB 5ITFA 1KF9B 1A6ZB 4H8WH 5EPMA 2Z31D 5C3TA 3MRDA 3SPVB 4UOJA 4UAOC 3BPNB 5FYJE 2BSRA 2BFVH 2ZKHL 1Q1JH 1W8NA 1T0NB 4JFEA 3PWPD 1T22A 4WVRA 3ZDZF 2V7NA 3MYJB 3TIDA 1G6VK 4FFVC 3O6FC 4JM2F 3G5YB 1F3DJ 2XPGA 3NPSB 1JI2A 1B0GA 1AXTL 2J8UB 1E4KA 5FO9B 5CEXB 5I16B 4X6DA 1NAMH 5D1XC 1PAMA 4K07A 4X6CA 1HH9B 4XVJH 5HHQA 3PWPE 2G2RA 2QQNH 1MFAH 4NQUA 4S1RL 3PP3K 3IVKA 4MNQD 2O5ZL 3MOAL 1RHHA 1OGAB 1MWAA 2VO5A 3KPPA 2W9EL 3RUGE 3ARGB 4LASH 5EOQH 4FQPA 5JW3L 5H94A 3P2TA 4EJ1C 2Z93B 3C60C 1ZGLM 2UZIH 3WD5H 1S9WB 4MNQE 1IAOB 1U3ZA 2XNAA 4PRIB 5I8OH 1QFWI 5TE6H 5D72H 3V79C 3LKQA 2NW3A 4MJID 1ZHLA 1LK2B 2CKBL 4ZQKB 1JGEA 3MNWB 4G5ZL 5F1KC 2X4NB 1FZKB 4Q9QH 3O11A 4PBXA 5FA4B 1ZHKB 3K0WA 4MJIE 1VPOL 1B0RB 2C7UB 5DRXB 4ZUWA 5F96H 1GL4B 1XF2A 4MA3B 2VZ1A 1AXSB 4OGAC 4F37K 4Z7WF 5E1AA 5ID0A 2EXWC 3HE6C 1KN2H 5K9QG 1UACL 3O6FD 4XZUB 4BQBA 1JPFA 2CLRA 4D8PA 4KGLA 5A1AA 3RVTD 4XAKD 4AK1A 2GITA 1WBYA 4APQC 3DMMD 4KGJA 1KYOJ 1KLGB 3IJSA 3SKOA 2DTSA 3F6IA 3SKMA 4RNRA 4U1HB 4OB5H 3TNMB 2JCCA 4ZFFB 1WJ3A 1X5HA 1DQMH 3TVMB 3RHWF 1C7SA 3MR9B 4XAKE 4YHYC 4XRCB 4XPGL 4HX1B 3OAZH 3U30B 2ARJB 1FAIH 3U0TA 3C60D 4LQFL 3HMXL 4ZS7L 3GB7B 4U0RC 1N7ML 1NMAH 5J89A 4XVUD 4OUUB 4N0FA 5DGQA 4EI5B 4P2QA 2R2EB 4PP1C 1QNZH 5HHNA 4YGVA 1O5DT 3WUWA 1HN1A 1DQQA 1P7QA 1UYWH 3QRGH 2A73A 3FO0L 3WNNA 3MCG1 4NZUL 2D7TL 4CVZA 1OM3L 3CVHH 3MXWL 3SQOL 3VGFA 3FT3A 2OJEB 3P9WB 4OTXH 1AXIB 1D5ZA 3RZCA 3BD5A 3AAZB 1NCAL 2NY3B 2N7AA 1P2CB 1PX3A 3HRZA 3O3DB 1KIRA 3WV0A 5E4EC 5JW4R 2NX5D 1NMCC 5F9OL 4HUUB 3U7YL 1ZLSL 2EXWD 3BGMA 3CLEH 4QHKJ 2YXMA 2J2ZA 3V0VB 2NX5E 4Y5XB 4ZPTA 5F3HB 1S9KC 2NY4B 4F57L 1AHWB 3I50L 3QUZD 3RGVB 1C1EH 1OAZL 1J0JA 1AD9B 3DARA 3S4SB 3QEGL 2J6EH 4UU9B 5KANG 2XN9A 2C1OB 3AREB 1CGWA 4MD5A 5F8RC 2E6JA 3FFDA 4QHNB 1MCPL 4PGCB 3MMEB 5IVXB 1ZGLP 3TT3H 4BZ1L 1MCHA 3QIWA 1SEQH 3REWA 4LPVA 1U58B 2LABA 4PP1D 4HJGB 3K81A 3LRHA 2VLJD 1GIGH 1NFDB 4U2YA 5C07B 3K46A 3UJIH 3VXUD 4L29B 4PBWD 2EDDA 1RUAH 3WDIA 2YD4A 1VSCA 4PUBH 1LWRA 2DQJL 4HXAH 5F1SA 4K9EC 1A6UL 4WI6A 5FF6B 2VLJE 3QHFL 5D1QB 3V6OA 2MCG1 3VXUE 3T0AA 5CP7A 4Q6IB 1JGUH 3GGWA 3PNWA 2NNAB 3IDIB 1MH5B 4OQ1A 2DBLH 4NUGH 3HR6A 5IESL 2BCKA 2D7NA 2QHLA 2GSIB 4HKXB 5IMOA 1PKOA 1ZWIA 2FDBP 4NO2A 2AV1B 4H88L 1MWAH 4F7EB 2CLZB 2EIDA 4ELKB 3GSUB 2KDGA 4J12A 4Y5VB 2R0KH 4X5XA 1G7MB 4MNHB 5EC2B 2AEPL 2P5WA 4IIQB 4OFVA 1NL0L 1P6AB 4JFFA 3GBLA 3OXSB 3GSXA 1CICB 1G9MC 4OLZH 1IGML 2ZUQC 1TIUA 4OD1H 3WFDH 2AJYH 1KTKE 3MV7B 3TA3B 2V17L 5IBLD 2VOTA 3RWCA 1ES0A 1WWBX 1IRAY 5D2NA 2EKSA 2E7BA 1BBDL 3JWDL 1P7KA 5CEZD 3MUJA 4JPWH 1NDMB 1ORQB 2OR9H 1BFVL 2FJHA 4H25B 2OZ4A 1MRCL 3QNZB 4GBXB 1U8OB 4PJ7E 5CEZH 2XRAH 3KHOA 2EE3A 4UIMB 1JJUA 5JMRA 2ZOLA 4Z7WB 5CEZE 1UM6H 2AJUL 4CNIA 4K9EH 4LDEB 2EH7L 3OKMB 5KSUB 5JUEL 5C0AA 3GK8H 4UQ2A 3S34H 2C9AA 2E7CA 2VDNH 2RFXB 4IM8A 1HCFX 5F88A 1XGUB 3WXVL 2Y6SC 2WUCH 3TJEL 2EH8L 1DUYA 3QIWC 3RI5K 4DCQB 4P4KB 3LV3B 1FYTA 2FB4L 1J8HE 1H5BB 3VRIB 5J57B 3BZEB 4R4NC 4XMLH 5EORL 5AZ2H 5BCAA 3T4AA 3RWDB 5TE4H 3VXQB 2E7LA 1HXYA 1MQKH 1RI8A 4IRZL 4P46B 4TSCH 1BECA 4L4VA 1FDLL 4L4TA 4M61A 1KJVB 1QBLL 4JRYB 5C0EA 3IDUA 2ADJB 4H1LA 3Q2CA 3V6OC 3JV4A 2XWBB 4JN2A 1BZQK 4XNXH 3RWIB 1OLLA 4TUOA 1K8DB 1G9MH 5IBUG 3DI2B 3SDAB 4Y4KA 2CDFA 1LE5A 5IEHB 3SJVB 1FQ9C 4LCYA 1GGCL 3G6DL 2ICWJ 4XCCH 1MFEL 4YK4C 2BRRL 5CSZB 1FNEB 1T04A 3QUXA 1FVEB 5ACZA 3DPBA 3TBTB 2I25N 1FGVL 3OKEB 4TTDD 5A43C 1KLUB 4OZHB 1JHKL 1CDIA 3DX9B 1XGRA 5E2JA 3CXDL 2H9GB 3OL2A 4XPTL 1OTSC 1KENH 3MA7A 4DN3H 4XNMB 3FB6A 2XN9D 4J8RB 5FECA 1U95A 5HI4D 4RGNC 3QRFM 5DR5H 1OP5K 2Y6SD 4XNQA 4KHTH 5TE7H 1UXWB 2B2XL 3FO9B 3QULB 4J1UB 2VZTA 4NNXA 5I71B 1LO3L 2ADIB 1NCBL 4NZRH 5D2NC 3KNBA 4XWGH 4ODWA 4R4ND 1HILB 5JDSA 2FEEL 5DJYA 3TZVB 1A7OH 1UA6L 4LQ1A 4NN6C 3BIKB 2VXQL 4PJCA 4LSRH 3GIZH 4PJXA 1F4XH 4TYUA 4X9HA 1FNLA 3HLAB 1AGCA 5IBUB 1NAKH 3UPRB 5FCUL 4PRHE 5DVLA 2Q3AA 2P7TA 1DBAL 4OCSH 1CBVL 4LOUC 5CD5C 4GMSL 12E8H 5CKGA 3CCHB 5CP3A 2CSPA 3G08A 2XKNB 5CBEB 3SBWA 1KOAA 2X4UB 5T1MB 1KCUH 1TTUA 2DJUA 5FOBB 3WE6B 2R0LH 2VXSH 4OGXH 2HG5B 5DJ0B 3VXOA 1Z0MA 1KJ2B 4M7LL 1I1YA 4HUKB 1BAFH 1L0YA 5D6CA 4JQIH 3PWJB 5EDXA 4U6YB 4XB7A 3IAGC 3KPLA 5IVZA 2PN5A 3T8XB 1RK0A 4EUPA 1UC6A 5ALBH 1QSFA 4RGND 3T0DA 2O93L 4TNVK 4GRLB 3QWOB 3IDJB 3TN0A 1TZHA 3BWAA 1SBSL 1CE6A 1WEJH 3NACH 5DK2B 5HVFB 4Y4KC 3D69B 4KKCC 4RGNE 2ENYA 3MCLH 1OAXL 1OP3K 2FCBA 1AIFB 1FO0A 3QUXC 2VKWA 1G0YR 3OKNB 3LQMA 1IC7L 5GJTL 2VRAA 3TH2T 5HGBA 3BH8A 1L4IA 3JTTA 2PYED 1YNLL 2OZ4H 1AY1L 3H0TB 1MHCB 5BRZA 3CFCL 4H20H 3BXNA 1UCBL 1ULVA 4LOUD 5CD5D 1UZ8A 2VSCA 4WI2A 3UC0H 3HZMB 1HHIB 5HGGS 3MRFA 4Z95H 1A7NL 3MJ9L 4PLKD 4BUHA 5TDPA 2Q6WB 2A6JB 1CR9H 5SWSA 5I66B 1CD9B 3O41A 2PYEE 3TV3L 1SYVA 3VFGL 3NCJH 1OT2A 3N50A 1HHJB 4YHKL 1M05A 1MUJB 1VDGA 4JFPA 2ZSWB 3L3KB 1UXSB 1IARB 4ZXBB 3R06B 1GOHA 3DVFA 1CIUA 3Q1SH 4P5KB 1HK6A 1U3HB 2EZ0C 3ELAT 5J1AB 3IF1B 4O58L 4Q97A 3WJLA 4QRRD 3WJJC 3L3IB 4L4VD 5I75B 2ZPKH 2DQEL 2CQVA 4EQ3A 4BYHA 5AG8A 1GZPA 1VB9A 1VFBB 3CFDB 2LTQC 1SJHA 3VXSA 1NUFA 4M62L 4YXLL 1RIVL 1CDHA 4KROB 3MRMB 4QRRE 4JPKH 2VLRB 4H1LH 4UTBL 2CO6B 5I76A 3SBWC 3RZWA 4QCIB 4R26H 5B3JE 1NC2D 1NEZA 4RDQF 3RWHB 2KQMA 4F2MB 5GGVH 4NDMB 4XNZB 4FQJH 1QFWM 5LGHH 2X42A 1JV5B 3NVQA 4YBLC 1T1XB 3U4AA 5C08E 3MBEB 1IFHL 1KT2B 1MCRA 3KYMA 3BT2L 1CXFA 4PRPA 4I8DA 3MRLA 4PIRF 4KK6D 3T4YB 1SY6A 3KLHC 3TN0C 1JRHL 4M48H 5CZKA 4DVBA 3DYPA 3RY5A 4Q6YA 3S3SA 5BZDA 4TSAH 1EEZA 2EEBA 3D39D 4U1KA 3H7BA 4AH2B 4X6BA 2EZ0D 2W9DH 1G9EA 1CLCA 1VA9A 3EO1A 1G0XA 2EE2A 1JZ4A 4KMTL 1NFKA 4LSUH 3L5WA 3OB0H 1J8KA 5D2LE 3EYSL 3PWUA 2DIAA 4YUEL 4YHNA 4U6XB 3D39E 2GY5A 1WCQA 2WAHA 3LAFA 1LK3H 4LSQH 1TVHB 3QJFA 3E8UL 1JPGB 2DYPD 4XPAH 1CE1H 3MV8A 1MHEA 2NY1C 1HZHL 1QR4A 2AKRB 4UV4L 3QXUA 3RTQB 2AXGA 2XOTA 1ZA3A 4F7MA 4D9RD 5GGTA 2VDPL 1MNUH 3QDGD 5CP3H 1NUNB 2R9HC 2YD3A 4YBQC 1U8MA 3WL9B 3QWQB 4NKIH 2A83B 1U8QB 4LLDB 1F90H 4D9RE 3QDGE 3QSKB 2I27N 4IDJL 3WJLC 2NW2A 4D9LL 4NQSB 3KLHD 3CK0L 1H8NA 3KXFA 2ZOKA 3PP3H 5IFAL 4GAYA 4OJFH 4EUPH 7CGTA 2FZ3B 3HFML 3L1OH 5KG9B 1KJMA 3TP4A 2FJFA 3MUHL 3VWJA 1RQ5A 3CSYA 3P9LB 3IETB 5E08L 4GG6A 2EO1A 1U8HA 1XF1A 3DX7B 1N6UA 4HK3J 1CFSB 3QNXA 4PJEE 3LN9A 1MJ8H 1NBVH 2CKBB 3HPJA 5C70A 4ISVA 4X9FA 1MCKA 2AI0L 1FO0H 3PWVB 4FQCL 4OKVA 4HMCA 3U48A 4WO4A 4JFDB 1T03H 2UVEA 1CD0A 4JLRA 4KK5D 3PDGA 2B4CL 1QSEA 3GFUA 1J0YA 2YK1L 1S3KH 4P4RA 4U6HB 4TUKL 4RDQG 5EUKA 3W9EA 1A6ZA 1IAIH 3MRHB 4KV5E 5K9JL 5JOEA 2VXTL 2MHAB 4J4PA 2FD6H 3QIBA 2GJZB 2OL3L 2J88L 2R9HD 5IIEB 2WBJB 3ARRA 3NIGF 3NZ8B 2WANA 4WENB 2EYRA 2VQTA 3FZUC 3RDTA 5KTEH 1T0NA 3GMOB 5JIIA 1T1WA 2DMBA 2DLEA 1BQUA 2F54B 1RZ8B 3MYJA 1K3IA 1HI6B 1PVHA 1CXLA 4PJAE 3G5YA 4PJHF 5J4MA 5FO9A 3TT1H 1QKZL 5CEXA 4OZIF 1LP9F 2F53D 2Y23A 3PDOA 5F1IB 5BZWA 4HC1A 1R0AL 4JFOA 4JPVH 2B1AH 3WXWH 2GJ6E 1MQ8A 4IOIA 3QT2A 1X5LA 5DJ8A 1BQSA 3V95A 5FYJU 1QLRB 2F53E 3NAAH 1A4JB 4KTDH 3RFZC 3LRGA 1OAKH 5F6IC 5J9PB 3LHPH 2Z93A 5HPMB 4JRXA 1TITA 3C2AH 5IG7A 2Z9TA 1OD9A 3QUML 3VI4F 3PGDB 1UQSA 4GSDH 3SGEH 1HYRC 2YUZA 3GMRB 3PV6B 1FLTX 4WIQA 5I9QC 5JORB 3CH1A 1A9EA 3MNWA 4XBGB 3QISA 4UMGA 5D7SH 1FZKA 1G7HA 1JHLH 1P84J 2PW1A 1F8TH 4X99B 1FNSL 5FA4A 1ZHKA 1HDMA 4I77H 1QR1A 2C7UA 4GAGL 1VADA 3LIZH 3OKYA 3FZUD 4FABL 4MA3A 1WAAA 3UTSB 4XC1H 3MRIA 5IP4A 2OP4H 1CFTB 2BZDA 2X10A 1U42A 2NY7H 1R3LA 3NCYS 4PRNB 3BVNB 5C92A 5F7DB 3V4VH 3FFCD 4OSUL 3HAEH 3HZYA 4GW5B 3H3BC 4RZCB 4NFDA 4WO4C 5E8DH 3CLFH 4UT6L 3MLZH 4YFDB 5ETUA 4MMZC 4U1HA 5HYFA 4Y2DA 3TNMA 4ZFFA 5DS8B 3FFCE 5IGXL 3TVMA 4OIAA 3MR9A 3RWFB 3MLRH 3C5ZB 4XRCA 4QY8B 2ARJA 4F7CB 1NLBL 4L9LA 3RU8L 4DKDC 1I9JL 4J4PC 3TLRA 4RAVA 2MSPA 3QIBC 3NGBB 3ZYJA 4DGYH 4OGYL 2ZG2A 5BS0B 2XQYG 4PJ9B 4EI5A 4YPJA 1E27B 1ZT7B 3N9GH 4X98B 1BWWA 3S37X 1UB5B 2YPVL 3BP5B 5I1EL 5E7BA 3GSVB 3ZDXE 3DBXA 5GS0C 3P11H 4HG4K 5ICZB 3K1KC 4P9HL 5AZEL 3GHEL 3GSNA 3NPSC 5BVPH 1XGTA 4Y4HD 4QXUL 1Q9OB 1MCLA 3AAZA 4KFZC 1EK3A 1D5XA 1P2CA 1OP9A 4OLXH 3O3DA 2Q1EA 3VH8A 3WCYA 4KKNA 3O9WB 1LQSR 4BQ9A 5D70H 5LWYH 3OMZA 3VFMB 4QRTB 2HYMA 4FZEH 5LAXB 4NJ9H 3DVNB 3ARGC 1OW0A 4KU1A 4NJAL 2NMSA 4NM8L 5ACMA 2YN5A 1D5IH 1LO0H 3V0VA 4ELME 4NKMB 3Q6GL 1Z5LA 1BQLH 4NO3B 4Y5XA 4NGHL 5IQ7L 4PGJA 2P44B 3EAKA 4OIIH 3UTOA 2IH1B 4DUWA 1AHWA 1TXKA 3PGFH 2CJUL 3SGKA 4XPFL 3THML 3NMEA 1AD9A 4ODHL 3S4SA 3M8OH 5EBWB 1T6WA 3AREA 2P42B 4QHNA 4PGCA 4J4PD 5IVXA 5EU7C 1I8IA 3V5DB 3EHBC 3BW9B 4Y8AA 3UTZB 3TF7C 3GUTB 3BFOA 1V3LA 2ZUTA 5DRWA 1U58A 5J6GB 1AE6H 4HJGA 5EU4B 2VZUA 5GGSB 3BD4A 1NFDA 4YO0B 5C07A 5KVDL 1QFUH 5GS0D 4L29A 3FO1B 3WFBH 1JGDB 1KJ3L 4HXBH 4ZOCA 5E2VH 2YBRA 1TJGH 3AY4A 1WFUA 4K71C 4EQ2A 3OF6D 4ZD3H 5FF6A 5GS0H 3FB7B 3A6BL 4UIKH 5D1QA 4PGDB 5EOTA 4P59L 1MELA 4Q6IA 4OT1H 5HGAB 4F58H 1FBIL 5A16B 4JM2A 2NNAA 3IDIA 4JQVA 4PJHB 1A3RH 2J8UE 2EDTA 1CF8L 1OGAD 4JHBA 1CXHA 4OZIB 4Z7UE 3TVMC 1FGNH 5EZIH 3ARGD 5JW4M 1E4WH 1OB1B 2GSIA 4HKXA 2BRQA 3U30C 3UJJL 4XP4H 4G9FB 2AV1A 2FR4B 4LRIC 2QTEA 4F7EA 2CLZA 4ELKA 3GSUA 4L1HA 1OGAE 4Y5VA 4PRID 3B9KD 4EI5C 5EC2A 3NA9H 2DI8A 4HT1L 1OTTD 1IL1A 3JWOL 4IIQA 3LS4L 4XHJC 2A9ML 2KQNA 5JOPD 1AQKH 4HUNB 4BK4A 4PRIE 5DQDH 3B83A 5L2KA 1CICA 2BNQE 4H5SA 4M5YL 2IMMA 2NY3C 2RCSL 5GSVA 3VFOA 3EHBD 2Q86B 5JOPE 3MV7A 2BVQB 1GZQB 1N2RB 3TA3A 5TPWL 4HKBB 2JJTA 4WU7B 3EYQC 4LCIH 2A77L 2CXKA 1DQDL 3HUJF 1NDMA 5HYQA 1ORQA 4NOFA 1HSAA 4H25A 2HLAA 3MROA 1BIHA 4GBXA 4Q9CA 2ZUVA 5CILH 5IBTH 4Y5XC 4P49A 2ZCKH 3B2VL 3MLUL 4UIMA 2AJVL 4Z7WA 4HV8B 4GW4A 1AHWC 1YA5A 5CGYD 3U2SB 2JB5L 1YEFH 1JYWA 3OKMA 1I7TB 5FM5M 2AAVA 2HH0H 3DROA 4NIKB 3L3HB 3AREC 2RFXA 3D5OF 4ETQA 2QSVA 3H9YA 1K5NB 4OV6F 4DCQA 4WGVB 2ITCB 4P4KA 3LV3A 4LPCA 2IAND 4LIQL 3VRIA 3BZEA 4XHJD 4C58B 1DQLH 3VGBA 4D3CH 1IGIH 4CADB 3RWDA 1VENA 3WFCL 3VXQA 1YY8B 2YRPA 4P46A 4Y1AA 2EKJA 3U79A 1UWGL 3KPNB 3LPGA 3AY4C 5GRVK 15C8H 2IANE 1KJVA 5F7EL 2OBGA 5MEOB 4JRYA 2NY3D 2ADJA 5D1QC 1HE7A 2XWBA 4R6UA 4Q6IC 4ZSOE 2HWZH 1K8DA 4JM2C 1N8ZB 5JPMA 3FCTB 4IJ3B 4YXKH 3SQBA 5IEHA 1T4KB 5ELIA 5DGRA 2VE6A 3O0RL 2IG2L 1VGEL 1FVEA 4KUZL 4Q0XH 5HDQH 2B5IB 3M07A 4B41A 4MA1B 4FQXD 5EG6C 1EUUA 4Y5VC 2NY4D 1DVFB 2VDML 5IJVB 5KSAB 3B9DA 1WQVT 1H8OA 2Q8BH 3VGHA 4IIQC 3RGVD 2X6MA 4MXQC 1NCDH 4UTAH 2H9GA 1TJIL 4YNYA 3O2VL 1S9VB 1S8DB 1Z9OA 2WWMC 1CICC 3QCUH 3ARED 4RMQA 5F97E 2VISB 3RJQB 4YQXL 2YWZA 5T1LB 2FX7H 5C0RL 4WDIB 1QLEL 5IW3A 1UXWA 3FO9A 3TA3C 4J1UA 4XC3H 2V2TB 25C8H 4HIJB 2DQGL 5ADPH 2ADIA 2JJTC 1UEYA 2XWTB 3KJ6L 5F7NC 1U92B 1A5FL 3TZVA 1JE6A 3EYVB 1KBGH 3C5SB 4LSDA 2D3VA 3REVA 4GBXC 3DYMA 1J1PL 3H6JA 2Y5EA 5IW1B 5JHDA 1CVSC 3S37H 4ZOEA 5I1CH 1BZ9A 1IAII 2E6PA 1YY9C 3QDJA 1YYLH 2MPAH 2R1WB 5CBEA 3AC0A 2X4UA 1EEYA 1QBMH 4P3CL 5FOBA 3WE6A 2PNDA 5T1KD 5J12B 5DJ0A 1IC4L 3V2AR 4M8QA 4K3HA 4JZNB 3SDXF 5D5MB 4MJ6A 1MFDH 2Z4QA 4P4KC 2QEJA 5IV2A 1F2QA 2H32A 2FBJH 2Z8VC 3PWJA 1G7IB 3D2UA 3V9FA 4U6YA 4WTWA 4X4MA 3R4DA 4YXHH 4NQDB 4P46C 3T8XA 2NXYB 1OGTB 2MQ3A 3CDGA 3GRWA 3QWOA 4GRLA 1W0WB 2C1PB 1KACB 4QT5B 3TA3D 4RRPA 5DFWH 1FV1A 3SDAC 2RQ8A 1KTDA 2IC2A 2PETA 1MCEA 5JA9A 1TTFA 4XMKH 3SGEI 3LN4B 1KB5A 1RUKL 3MX0A 4HWEH 1AIFA 2QHRH 4JDTH 3ISWA 5JXAH 5JXEA 4XPHH 1BP3B 2EO9A 2BNUB 2VWEE 3H0TA 5CWSB 2AJXL 1F58H 1MHCA 1A7RL 3HUJB 4GQ9H 3WS6A 4S1QH 3HZMA 1HHIA 1YEHH 1WZ1H 5IF0A 2Q6WA 5LXGH 4PJFF 5T3ZH 4NO5B 4W6XB 2DD8H 2WLYA 1AP2B 3IU4L 1MUJA 5C0NC 4OCWL 2BMKB 4DAGL 4NQVA 1A1MA 4M43L 4GKZB 1UXSA 2R0WL 4ZO6A 3ROOA 4ZXBA 3U7WH 3U4BH 5I71C 3R06A 3ULVF 3D25B 3MRQB 4KZEH 2VDRL 4P5KA 2DM7A 3GI9H 1EUTA 3TZVC 3NFNB 1Q9KA 5J1AA 1KNOB 2JELL 3LN5A 2B39A 4WI9A 3GMQB 2ZUWA 1JFQL 3EDEA 1MJUH 4JRYD 1VFBA 2DI9A 5FA3B 3CFDA 1FIEA 2GCYB 4NZJA 4L8BB 4K8RL 5CJQH 2JLLA 4WRLA 1A6AB 2LV4A 1UH3A 4MSWB 2NYYD 3SDAD 1GHFH 2O5XL 1HEZA 2VLRA 3PWLB 3QUYD 1YUHB 4Q7DA 3WLWD 4M00A 5JIKA 3SJVD 1I7ZA 1QYGL 4EKXA 2OX5A 5I1KL 2H26B 5KVEH 4U1IB 1RZ7H 2XV6B 4F2MA 3MCKB 5E7FA 1JV5A 1PQZB 4NFCA 1JNHB 1T1XA 1A8JH 2FX8L 3RVXC 5FYLD 4RBPK 1Q72L 3SJVE 4F9LC 2D03L 2B0SH 4ZUUB 1KT2A 4LLUB 5FYLH 3OX8B 3T2QA 2W60B 1HIMH 5TQ0L 1RULL 1UM4L 5CZVH 4BFGA 3KPMA 4JO4H 4WEBH 4X6EB 3UXFA 4PTUB 3T4YA 4GRLC 5DJ6A 1FL6A 1RURL 3MV11 5C0ND 1PKQE 5FYJL 1VGKB 4OZHE 3ARZA 1MCFA 2FHBA 1QP1A 2JB6B 1JZ6A 4IOSD 2Y4SA 3BKYL 1FORH 3ZMRA 1U8PB 1A6WH 1Q94B 4PV8B 3P3YA 4BZ2H 1RZKL 4OCYL 2IPUK 4ONGH 1XGQB 3OAUL 5D7LB 2Z92A 4RGOH 2IADB 5JXEC 2Z8SA 3DUUB 1JNNH 2H3NB 2CK0L 1EJOH 2VABA 3T0EA 2HFGL 3BP7A 5T1DL 2MQCA 7FABH 2EDFA 3TIEB 4U05A 1UWEH 1Z0NA 5KVGH 1JPGA 4POZD 1BHGA 4N9OB 4HIIB 1DLFH 4ZFGH 2OL3B 2Y72A 2AKRA 3BMVA 4OV5A 3S3JA 1KLFA 1B4JL 1X6LA 2EDYA 1BVKB 5I17B 2BSTB 2X1PA 4PB9H 1MPAL 1VFMA 3RVXD 4LSTL 4ZXBC 4TNWF 4EBQL 32C2A 1CGUA 5HI3C 1U8QA 3O2DL 4LLDA 4QHMB 3DV6A 1U3HC 1F4YL 3EDFA 3CVIL 4EXPX 1DN0B 1TCRB 4IRSD 1KJ2H 5KSVB 1BLNA 3SDXB 3ULSB 3DURB 1EHLH 1H15A 2H32H 3HC0A 5I75C 2DBJA 4GRLD 2CH8A 4QTIH 2O61B 5F8QC 1IQWH 2FZ3A 4KROC 3PV7A 3NH7L 1K6QH 3GRWH 5KG9A 1URLA 3VCLB 5BO1H 2BVEA 4LDOB 3IU3B 1YDPB 3W9DA 3P9LA 3QUMB 3IETA 3OJDB 1IGFH 3DX7A 4KHXH 3BJLA 1EIBA 4XNZC 1I3GH 1YEEH 4LKCB 1Q8MA 5CUSL 3PWVA 1M7XA 5HHVH 1Z9MA 3DUSB 3MODL 2ARWA 4OCXH 3DV4A 2FL5A 4DGIL 5D71L 4PJ5B 2PXYB 2G9HB 4XB8A 3JTSB 3MRHA 5ISZB 3BD3A 4OI7A 2K7QA 2HRPL 2MHAA 5EC1B 1A4KB 2GJZA 4EN3B 4N1HB 5IIEA 1FG2B 4ZXBD 2JJUA 2ESVB 4PJFB 2JIXB 5HI3D 5TH2B 4DWHA 1U3HD 3GMOA 3PP4H 1AD0A 4M9OA 4J3XA 1RZ8A 1HI6A 4MS8C 3AXLB 3KPOA 4UB0H 1WFNA 3VXMD 3V4PH 5F1IA 1CTNA 1YPZF 3DGCR 3BEWB 1LO4L 1F45A 1Q9WB 1A2YA 3HZVB 4LF3B 1GYAA 5C0IB 4KAQL 1KC5H 3FQRA 3HMXA 1C16A 2H6PB 4XAWH 4TULH 3STLB 3QI9D 4UZGA 2A9NH 5FV1L 3VXME 4HH9B 4LSPH 1Z9LA 5DD1H 5J9PA 2E5EA 5B39G 3ARTA 2DQUL 3QQNA 1U41A 5HPMA 3QIUB 1WUNT 4JG0L 4L3EA 3PGDA 2W9LA 3MBED 4I3GA 5GRZA 1B9ZA 1PZ5A 4OCLC 4RX4D 3LQAL 3GMRA 3PV6A 4OD2B 5JORA 2YD5A 5K59E 4XBGA 4ZFZB 5SV3A 2X41A 5KS9F 3BI9X 3RAJH 4X99A 3P0VL 4I1NB 4JVWA 5K9QI 2HP4A 3I3EA 2D4FA 1WV7T 2F8OA 3OZ9L 1IM9A 1MFNA 1S5HB 2R8SH 4LMQE 3OKLB 4XMPL 1S5IL 3TBVB 4JO1H 1FZMB 4LAQH 1BM3L 3PHOB 4O00A 4NM4H 1KGCD 4P2OB 1YEGL 2FO4B 1ZANH 4PRNA 5F7DA 4HWBL 3GJEB 2Y25A 5GHWL 2WUBL 4NRZB 4DVRH 1UKTA 5FHBL 1NC4D 5B39B 1KGCE 3LKRA 4YDIL 2EC9T 4OBRA 2GYSA 1FVDB 3WKML 1S7RA 4NP4H 1UCTA 3BQUB 3FQNB 4JO2H 3GBMH 3RTQD 3T77B 3C5ZA 1V7ML 4QY8A 3BE1L 3CJJA 4OIBA 4Y2OA 4K3DL 2WBJC 5BS0A 4GW1B 2IPTL 4PJ9A 4PJDE 1E27A 4XCNB 3H3KA 2ZKHH 5A3IC 3BH9B 3C6LB 4S1DC 2KPNA 4OF5A 5ILTL 3WDJA 3BP5A 4DKFL 1QHOA 4XXDB 2VL4A 3VA2C 5ICZA 5EU5A 4G6ML 4XVSL 1ZHNB 1AXTH 4X9BA 1T21A 1NCUA 3VJ6A 1T20B 3GSWB 1Q9OA 3ARBB 2MKWA 3G5ZB 5DWUL 2D7OA 1F6FB 4HZLA 2VAAB 2XKSA 4S1RH 1IT9L 1D9KA 5DF0A 2O5ZH 3MOAH 1S9YB 2BNRB 1FCCA 2LU3A 1C5DB 1CFNB 3RBGA 4UINL 5HGHB 2W9EH 3Q48A 5L6YL 5M94B 1DZBA 1MCWM 5LAXA 5EFIB 4GKSA 5JW3H 3BP4B 2VLKB 3LDBB 2C3WA 4KRPB 1CGXA 4NO3A 5KANI 1HNFA 4JFHD 2XG5A 1OSZB 3NN8A 4JFDD 3NFSL 3EBAA 2CKBH 3D1MC 1L7IL 1WZKA 4G5ZH 4YHOL 4O4YL 3QNYB 4LBEB 5EBWA 3MC0A 3QPQC 4JFDE 3E6FB 1PY4A 4YAQB 1VPOH 3DXAE 2Y06L 3IFOB 3V5DA 3UTZA 2AQ3A 5SV4A 1LEIB 2WBJD 2Z35B 3ARDD 2ADFL 5J6GA 1NBYB 3R8QA 4KPHL 4YO0A 2M1KA 1P9MC 1UACH 1PG7X 1IBGL 1II4E 1JHTA 2F54D 3QFJB 2N1KA 3WEXB 2EDHA 3CFIC 5E8NB 5FM5O 1IAIM 5DEFB 3LCYA 1J0KA 4JJ5A 5EZOL 2F54E 3X11B 1PJ9A 5A16A 1FRGL 1RV6X 2DJ4A 4XT1C 4N0UB 1BD2B 2Y07L 4OZGE 4OZIA 1LP9A 4OLYH 1YPZB 3WNKA 4X7CC 3C5ZC 3MLVL 4HIXL 4WHTB 4XPGH 5F9DC 4LQFH 3HMXH 4FXGB 4ZS7H 3T04D 2FR4A 1N7MH 5FGCE 3NGBC 2HJKB 2CD0A 4AEIL 1HINL 4PJ9C 5BMFL 1O7VA 1PDKA 3TBSB 1RJZA 3FO0H 2BHUA 5E2TL 4NZUH 2D7TH 5DT1L 3IB4A 4XCFL 1OM3H 5FUCC 3MXWH 3SQOH 1KELL 1XF3B 4AMKL 3QPQD 2BDNL 5JOFB 1NCAH 2R39A 5CEYB 1IVLA 5C0BB 5AWNL 2Q86A 1N2RA 3VFSA 3EJYC 4HKBA 3ARFB 3E3QC 3O9WC 1UJ3B 1INDL 4WU7A 5EO0B 5KS9B 5F9OH 1A6PA 3U7YH 3UTSD 1ZLSH 4U1MA 4X9IA 3S98A 4AEHL 1T7WA 1RAMA 3T2NL 2YSSB 1U9KA 4JVUA 3EJZC 3V7AG 4FFYL 1HHKA 2XXMB 3LOWA 1X7QB 3UTSE 1C08B 4F57H 1T66D 1P5VA 3DGGA 3H9SB 4GRMB 4HV8A 4O2EA 3I50H 2IMNA 3U2SA 4JKMA 3QEHB 5SX4I 1FL3B 5A2KH 3C08L 1OAZH 4M9PA 3QEGH 3VXRB 4BH8B 4A6YL 4UDUA 2J8OA 4M5ZL 1MCDA 1A6TA 2YWYA 1R5WA 1MCPH 1I9EA 2APXA 1X3DA 3JWDC 5TF0A 4BZ1H 1E0OB 4JZOB 3ZL4L 3GMNB 1K5NA 3EW3B 2ITCA 5HVHB 1GOGA 5L0QC 3RUGF 2ZWLT 1W0YT 5F1NB 4X7EC 5DMKB 4BH7B 2Z91B 5FB8A 2DQJH 5IMLB 3FMGL 1S7UB 2CKNA 1A6UH 6FABL 4QRSB 4WUUD 1X5YA 3QHFH 4BELD 3FOLA 4G6AD 1DTUA 5FUCE 3VI3E 4PGEB 3GSRA 5I8EB 1RPQA 3O9WD 3BPOB 4LPTA 3J8F7 3FCTA 4ZNCD 5GGQL 5IESH 4MZ2A 2C3HA 4R3SB 4WUUE 2VUYA 3BO8A 1IGYB 3QBTB 4JRWA 4M6OL 3IRPX 4X7FC 4H88H 3E3QE 1U91A 2ZSVB 1DVFA 5KSAA 2AEPH 4CAGA 1KIUA 3L7FB 1NL0H 1R3KB 3P9MB 1QLFA 4Y19B 1VFUA 5FO8B 4UNUA 1BOGB 4G6KL 1IGMH 1J11A 3KPSB 5FCSH 3OTTA 4NKQB 1T80A 1IGJA 5T1LA 4CMHB 2V17H 1BWMA 2YPLA 5ICYB 2V2TA 4D0CB 3HNVL 1IQDB 2WINB 4HIJA 5KSBE 4WI3A 3BUTA 2XWTA 1BBDH 3JWDH 3MXVL 2HVKB 5J56B 2P8PB 4JE4B 1IC5L 1BFVH 2BVUA 2KZWA 3MPCA 3EYVA 1MRCH 5MENB 3C5SA 1KFAL 3LS5L 4LARL 4NC1E 2EDJA 4ZDHA 5DHXB 3MJ9A 3V4UL 1C5CL 4YHPB 5IW1A 4GKNB 3TEUA 2AJUH 2EYSB 5JLZB 3SE9L 1MCJA 2EH7H 3NIGE 3FN0L 4FTVA 2WW8A 4HPOL 5JUEH 3UBXA 2GSGB 1CVRA 3W82A 4TNWK 2R1WA 4X80L 5EA0L 1QEWB 2J4WL 4P9ML 5JO5B 1NGZB 3WXVH 4G9FD 3TJEH 2EH8H 2RBLA 2P8LB 2EXYC 4JZNA 4P57B 1N6QL 4ODTL 2FB4H 3GDBA 2Q87A 4RMRA 1RMFL 4ODBD 3RL1B 2KZ1B 3MO1B 5EORH 2X89D 3SCMB 1G7IA 4CN1A 4G9FE 4IRZH 2J3SA 1M4KA 1MCQA 1FDLH 4I4WB 2UVFA 1QBBA 3ULUD 1W0WA 2C1PA 2X1QA 3SO5A 2QQLL 1G1CA 3RRQA 3QFDA 4JDZA 5LJYH 3NCFB 3K2UL 4YC2B 4IJ3C 3O8XB 5E99L 1HH6B 1GGCH 3G6DH 3TYGL 3ULUE 1MFEH 5HHOA 5EO9A 2BRRH 3LN4A 4I9WD 4KI5C 4RBPH 3X12B 4ZTPL 3D85B 2B5IC 4XP1L 3TO2B 4MA1C 5I2IB 1YEJL 3VE0A 4N8VG 1FGVH 1DVFC 5KSAC 1S7QA 3LQZB 3HUJA 4J3OC 2Q76A 4I9WE 1JHKH 3DVGA 3WHE0 3CXDH 4XPTH 1U6AL 2OMNA 4QF1B 3O6KL 4AIOA 1ZXQA 1AP2A 2BVYA 2DLFL 2IFFL 2BMKA 2LAAA 3KGRA 3HNSL 2B2XH 4GKZA 5EB9A 1WWCA 4P23A 4ZMAT 4XCEA 4PLNC 1LO3H 3UJTL 1NCBH 5IVNA 5F6HJ 2P5EB 3ET9F 3HC3L 2F58L 3MRQA 2YPKB 5DEGB 5MERB 5D7KD 1UA6H 3ARQA 2M8XA 1D3CA 2VXQH 5HHPB 1KNOA 2AXJA 3JUYA 3H42L 3MA9L 3GMQA 4F3FB 3RUGB 5DJAB 3UEZA 5FCUH 1U36A 5FA3A 5D7KE 1JYNA 5KOVC 1H8SA 4L8BA 2PR4L 1DBAH 3OXRA 1CBVH 2C3GA 2X9YA 4MNQB 2F5BL 1A6AA 4GMSH 5SWZA 5ESQB 3RVWC 1YUHA 2BVPB 5E0QA 4JKLA 5ESAA 4N8VB 3GI8L 4C54A 2L4OA 4KI5D 2H26A 3O6LL 5J12C 2JTDA 3MCKA 4PP2A 3ILQC 1PQZA 5C09A 1JNHA 1BX2A 3GJFK 4M7LH 1ACZA 5AAWA 2IAMD 4MJIB 3G6JE 4KI5E 3CDCA 5IB2B 4I3SL 5IKCB 3ME0A 3OX8A 4PJ7F 2W60A 4NQEA 2XZQL 4ZUTB 2FSEB 2NXYC 5HYSB 3UTPD 2C3VB 3JVGA 4HJ0C 4NHUB 4X6EA 4PTUA 3OV6A 3FT4B 5F93C 4PJIB 1VGKA 1SBSH 8CGTA 2JB6A 2XG4A 3MUGB 4TVSa 4U1GB 4OFIA 1DE4A 4YDJB 1U8PA 2AJZB 3UTPE 1OAXH 3MLTB 4IOFC 2CRMA 1MEXL 1XGQA 5DZLA 2E7HA 3HHRB 5D7LA 2GTZB 1IC7H 5GJTH 3NPZB 2IADA 4NYLA 3EZJB 2O26U 1JMXA 1YNLH 3QG6A 2H3NA 2KKQA 1AY1H 3QWRD 3DMMB 1B3JA 3CFCH 1UCBH 4PJBE 1UKSA 5LGKA 5EO1B 1A7NH 3MJ9H 5CJXC 3UAJC 5CJ5A 2OL3A 4NRXB 3TV3H 4Z7QE 3VFGH 4YHKH 4MAYD 1DBML 4GH7B 1BVKA 5I17A 2BSTA 2W0FB 4N0YL 4MA8L 2Y5TB 1DLHB 1NGXB 2GHWB 2IBZX 5IK3B 4QHMA 4WNQA 4WWKB 4F7TB 1DN0A 1DFBL 4O58H 1PD6A 2JKXA 3JXAA 4LLMB 4CW1B 3R8BB 5D5ME 3SDXA 4NQDD 2NXYD 4HJ0D 2DQEH 1CL7L 4NCC1 3MGOB 5T3XL 4YXLH 4M62H 1RIVH 5D1ZA 1X4ZA 4YBHA 4BKLA 4NQDE 1JPTL 4UTBH 1CWVA 4HHAA 3VCLA 2G75B 3U6RA 2HA1A 4IOFD 1I3RB 3F7YA 5SX5H 5GGUB 3QUMA 3OJDA 2P1YA 4D9QD 2FJGB 4KDTC 3VDBA 1NDGA 4KJYB 5C8JB 3MV9B 4FP8L 4LKCA 4I48A 4U3XA 1JF6A 4XTRC 1IFHH 4FS0A 3QUZB 2DKUA 2Z8WC 4D9QE 3DUSA 5FUZL 3BT2H 1NCWL 5LCVL 4MDJA 5HI5C 1V7NL 1YQ2A 4JPIB 3BEVB 4LNRB 1U93A 4YHIB 3WO4B 3IS0X 1JRHH 3JTSA 2WV3A 3QHTC 5ISZA 3IDMB 5DUML 5EC1A 1ADQL 1A4KA 4DFHA 4EN3A 1FG2A 1F11B 5DQ9B 4PJFA 2NY0B 5TH2A 4M8VA 5AYUL 4KMTH 3MJ7B 3EYSH 4YUEH 2C26A 3QZWG 1AC6A 2WWKO 4R7DB 3PQYD 3VG0L 2B4CC 4KVCL 1SHMA 3BEWA 1QUNA 4KTEL 5F44A 4TUJB 1Q9WA 3HZVA 4LF3A 3E8UH 3S6CA 1TPXB 4XP5L 1HZHH 2GAZB 1GAFL 2H6PA 4LHUD 3DIFB 4NCC2 3PQYE 4UV4H 4HH9A 3F7VB 3KYKL 5SWQB 2VDPH 1JIBA 2AV7B 4W6YB 5E5MB 1QVOB 1XAUA 4NC2B 3N1FC 3SOBL 3ZKMC 4O2FB 4XTRD 4O51B 5CLWA 3B43A 1HNGA 3L9RA 5GZOD 4OD2A 5HI5D 4CMMB 5D8JL 3LMJL 3O3EA 8FABA 1OAYL 4IDJH 4ZFZA 3ABZA 1KCRL 3V6BR 1EMTL 4D9LH 3CK0H 3FTGA 1I7UB 4FFWC 4E0RA 1WITA 5IFAH 1QRNE 1WBXB 3HFMH 2AJ3B 4PJ7B 4EEEA 1JWMB 3F58L 2R0ZL 4C56B 1S5HA 3DWTA 3EO0A 3QZWB 3OKLA 3SKUD 5E2WL 3TBVA 5E08H 4RAHA 3PHOA 2VIRB 3WFEL 3UZEA 1KPVB 1YMMD 4P2OA 2FO4A 5D7LD 2CLVA 3GJEA 2AI0H 4FQCH 4WCYL 3ZO0A 4XGZB 2IJ0C 3GSOA 4PS4L 3HPLB 4XH2A 3EOBB 1FC1A 5B39A 1YMME 2AQ1A 2B4CH 1FVDA 1J8HB 4PY8J 2NPLX 2YK1H 3FQNA 4OM0L 3M1BA 3I6LD 4TUKH 2ADGA 5K9JH 4U6TA 4KK8C 4V1DE 2VXTH 4V2BA 2OL3H 2J88H 4EN3C 1MCCA 2I60L 4XCNA 1XMWA 4EDXB 3BH9A 3I6LE 4N8PA 4Q2ZB 3GMLA 5B3JF 2FH8A 3NZHL 5ITBL 3MRCB 3PIQB 3V6ZB 4XXDA 1JNLL 5FKPA 4NBYB 3LZFL 3X3FL 1ZHNA 1QKZH 2X2YA 5F72S 3ULVC 3IJYB 1FJ1A 3G5ZA 1R0AH 2GKIA 1G7JB 4GOSA 4ODUB 2XQBL 3RJDA <