4OZGB

D2 protein complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
188
structure length
181
Chain Sequence
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
total genus 36
structure length 181
sequence length 188
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozgB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ozgB01
3X11A 5GHWH 2VQ1A 1T0MA 2X1QA 2D31B 1QBBA 4LMQE 1QEWA 5BJTB 1Z6JT 1OSPH 4UV4H 5EUOF 1T1ZA 2YN5A 3DX9B 4BKLB 1NFDF 3VH8G 5SX5K 2JJTA 1MCBA 5I1LA 2XZCL 1PW3A 4G3YH 4NQTA 2QBWA 2GCYA 4KVNH 2NY1D 3EFFB 2OM5A 1GPOH 3DECA 1F42A 3DX9A 1S78D 4WJ5A 4GW4B 3SEPA 3MLVH 4IMKC 5JW5A 4ZUVA 3ZDXE 4DKDC 3O0RH 3B83A 5AD0B 5SX4H 1CTOA 1F5WA 4J8RA 4QTHA 1P4BL 5E08H 5AEAA 4O58H 4KRNA 2BSED 5JW5B 4JPVH 5I1GL 1U8KA 4M93C 3SQOL 3MODL 2ARJQ 3LDBB 4M1CC 3U9UA 5I1DA 4TVPD 3ZL4L 4XVSH 4U1LB 2AJZB 4HK0A 3Q6FA 1I7RA 3GO1L 1IAIH 5C0BD 3SDXA 3FT4B 2OL3H 3VI4F 5DWUH 3S8WA 2UVFA 1KIPB 3DARA 4NFDA 1U41A 5CZXC 4HEPG 3ROOA 1OTTD 4HEME 3QUMA 4APQB 3L3GB 3DETC 1Q9OB 3BHBB 3PHQB 1JHLL 1J1OH 1BQHB 3UPRA 4DGIL 1D5XA 4YNYB 5I1JH 3U7AA 5BCAA 1H3PH 5D2LA 2P5EB 4PJEF 1TCRB 4FQ2H 3NA9H 3O11B 3TO2B 4DKFL 4UIMB 4Y5VB 3T0EE 1H3VA 3QSKB 3HE6A 3DI2B 5DUPH 5D7IB 1JNNH 5TPWL 1H3PL 2LAAA 2J6EH 2R2CA 1GVIA 5J6HB 3MOAH 4OIIH 4YXHH 1LE9B 4H1LG 1CICC 5K9OA 1YMHB 4RBPH 1VB9A 1KGCD 3FAXA 3P73B 5IHZA 5IBTH 5AD0A 4JB9L 1JV5B 4N0UA 2A6KA 4N5EC 2VLJE 3SE9H 3SGDI 3TYFA 3BKML 5CBAA 5E7BA 3CDCA 3V6FA 2RB8A 3PP4H 1MCCA 4M4PA 1F2QA 3S35H 2BVOA 2ATPB 4OLXL 1C8PA 1V5JA 1WICA 3T2NH 3MBEB 3O2WH 1MVUA 43C9B 1P4LA 1A7RL 4S2SA 4AEEA 5D8JL 1QLRB 1A3RH 3VD9A 2F54B 2AJVH 2EIDA 4HWBA 3LB6D 3TPUB 3CZJA 1CDUA 4LSTH 1KT2A 3A6BH 3FB7A 5EBGA 2LU7A 4YXHL 4PTTA 4RFNC 2QQLH 4ODVL 1Y0LA 4UTBH 5K93A 4NO5B 3U0PB 4P9HC 5CP7B 1ACZA 1I3UA 4UILL 1C7SA 3S37X 4M7KL 2DD8L 4XC1L 1FNAA 1CN4A 2VQUA 5J9PB 1GXEA 1T2JA 3MPCA 4NN5C 2YEZA 3FMGH 2XKNB 3HE6C 1DLFH 4RCAA 1T21A 5CILH 2P43B 4OB5L 2J8UF 4ODHH 3TCLB 5JQ6H 4OV5A 2JE8A 4LVHB 3CDFA 3CSPA 5SWQB 3Q2CA 1RUMH 2FEDD 3SDCC 4HX1A 4XBEL 4YPJA 4UILH 2D7TH 5L2KD 3D3VB 4ZOCA 5DJ2B 1QNZL 3HAEA 2FX8H 4MYWB 4Y2OA 4Z0XB 5EFIB 5I1JL 1DJSA 2NY1C 5CJ5A 3D6GA 3OKOA 1HILB 1K6QL 4FQHB 3T4AA 1NUGA 4ZS7L 2PTUA 4HMCA 1GAFH 5DQDL 1J18A 5JQ6L 4KDTC 3TCXA 3OKKB 2WUBH 2O93L 1KENH 3TNNB 3BUYA 3ARGA 3FL7A 2CD0A 3NAAH 1P84K 5DXWA 3VFSB 4NZDA 4X83A 4ACPA 1SMAA 1F97A 4GKOA 1JUFB 2W0PA 3DUHA 3REWA 1YNLL 1FBIL 4PRNA 1X4YA 1IGFH 4PRPD 4RIRB 1CFVL 2F74B 2KDGA 4JJHA 2FO1A 3B2VL 3T1FB 3K1KC 3PV6B 4UIMA 4GJTB 4N1CA 2BOBB 4WTXA 3ZE2E 5GIRA 1RZKH 3PXHA 4XCEA 3NGBB 1FNGB 2VLJA 4JM4L 5HYQB 4MX7B 1WISA 3UP1A 1TZHB 5C71A 1EA9C 4X6CF 3S4SA 3PGFL 1MJUH 4M7LH 5IBLD 3MLRH 4GRLB 2MWCA 3LKNB 2Y5EA 2VDNH 3SDCA 4R4FH 3CGTA 5E4EB 1F11B 4WFHD 1FG2A 1ACYH 3MLUL 5LVEA 5DFVC 4J3UA 3I75B 4JZNA 1HH6A 3UYRL 4I77H 3OJDB 4ELMB 4M43L 1NCDH 3D3VA 1GHFL 1EH9A 3HPJB 5F7YC 5DS8B 5HYQA 1DBBH 2GJJA 2UYLB 3RPIB 2XRAL 3O8XC 1VENA 4ISVA 2RFXB 1MJJB 4F37K 4JHWL 2L4OA 4HF5H 1D5XB 2QSTA 2FB4L 1MRDH 4LLWA 4C83B 4YBLB 5J06A 3WMSA 1FFNB 3C5ZB 2WP3O 4B53A 4U6XA 5KSBB 3QIWA 3H0TA 1EGJH 3GFUA 5FDWA 3QISA 1UQSB 5I0ZA 3MV9B 3RWIA 2PW1B 3BH8A 4Z7NF 3L5IA 3IDXH 4KUZL 3BGMA 3BKJL 2FH8A 3SE3A 3NABL 1KIRB 1XGQA 1QFHA 1M05B 1YQVH 3QO0A 3CH8A 4Z8FH 4XNMB 4NQDD 3B9KA 3MRCB 3DPBA 1SBSL 5T1LB 5FYLL 1J0ZA 4K3GA 1MFEH 3PWVB 1DQQB 2CRYA 4MNGB 3VXQA 1S7RB 5JMRA 2UWEA 3BSZH 4Z76A 1R3IL 2VDKL 5F1SA 1NCAH 3CXDH 3GSNL 1MIMH 5DA0B 3TYFB 2CQVA 5D5MF 3GGWB 3RIAF 2IADB 4P2OB 3DRTA 1AXSB 1K5NA 4MQSB 4JFFE 5A2JH 4P3DB 1R3IH 3R4DA 2VISB 4JRWA 1YPZB 4KDVA 5IW1A 1JPSH 2Z93B 3EHBD 3TVMB 3V4UL 3M8OH 1FO0A 5CP3H 2R0ZL 4ZFGH 1HKLH 1JWUA 3DMMD 1QSEB 4MXWH 4I9WE 1BX2A 4Z9KB 5DLML 4G5ZL 2J8UE 2NY2B 5F1KC 5LAXA 1IAOA 3QNZB 5I8EB 3CPLA 1BIHA 5HDBE 2X44D 4HPYH 4OFIA 1SQ2N 3MRKB 3NTCL 1UH4A 1JZ6A 4UI2A 1MJ7L 4K8RH 1IM9D 2R2BB 1TZHA 2AEQL 4OJFH 4FFZH 2EXYD 4OF5A 4W4NA 5DRZA 1MCFA 1FO0H 3O6MH 4KKLD 3MCG1 5M95B 1NL0L 2AABH 1T0MB 4ZFFB 1A5FL 5CZXD 4MD5A 4F9LA 4F33A 1KJVB 4Y4FA 2H1PH 3QAZC 2CDEB 3V5KB 3KPOB 5L2KA 2J5LC 3L6FA 4M7ZB 5JMOC 2E6QA 3GK8L 1YNTA 3VI3E 2WQ8A 4FN0A 4CW1A 5D1ZC 4PRBB 1KFAH 3MR9A 3STBA 4FQXD 5D7LD 4U1IB 3OAYK 1YY8A 3N50A 3FN0L 3LZFH 3S9DB 1D9KC 4LL9A 3PIQB 3F62A 3N85L 4GBXA 3I50H 1W72A 4LCUA 2P45B 2AKRA 4K2UH 3SDYH 2CKNA 5ALBL 1NLDL 3MMEA 4NUGL 5GGTH 1VGKB 3NN8B 5ITBH 4G8EB 1BVKB 2ERJB 3CFBB 4AY0A 2H26B 4WHTB 4QF1B 1FJ1B 4CGTA 1I3RB 4JO4H 4Z7WE 1QRNE 3KDMA 1YPZE 4OD1L 4JY5L 5EZIH 2ZSWA 1TITA 4LHQB 3ROOB 1U6AH 5CMAA 3U0TA 1UA6H 1OP9A 4XWOC 1A7OH 4OSUH 4EZMA 4M3JA 4QRRD 2K7QA 1W8NA 3V52L 1F4YL 1DQDH 3UBXA 3L3JA 3K8LA 3GIVB 4WI5A 4LRIC 4BH8A 2AGJL 2PO6C 2VABA 2GUOA 5GPRA 4WENB 5GRXG 1BOYA 3C9NB 4Y16B 4NO2A 4OGYH 1ADQL 4JFZH 3QCUH 4WU5A 3VXRD 1P53A 1UXSA 1EMTH 4LSPH 1YZZA 4BH8B 4PJXB 5D1ZB 5CEZE 1PGRB 3MV8B 1NGQL 4OZFB 2VWEE 4F9LC 1N2RA 5KS9E 4CL7A 5GS0H 5I1KL 3L9RA 4G43B 1JTPA 1VFUA 1UZ6F 1ZHLA 3A6CL 1JGDA 1U2CA 4G6FB 1Q0YL 5BS0B 1T3FB 2NR6C 4XBPB 4CVXB 3U1SH 3MV7D 5DMKA 3NIFE 1WAAE 1LO3L 5HVFB 1DP0A 1RUAH 2DM7A 5CGMA 1OLLA 5DO2D 1TTUA 1RJLA 2EXYC 4PS4H 3O6LL 5FHAL 3QHFL 3QNZA 1R3HA 1HCFX 2GITA 4M6NH 5KOMC 1NBQA 5KVMC 1IC4L 3VXME 1RULH 3DJ9A 2F19L 3ARBC 5C2BH 4R0LA 2SEBA 5F1OB 3BH8B 5B8CC 2BJMH 3MBEA 1J5OL 3I6LD 1V3MA 4W6YB 1T03H 4BYHA 3HMXA 4X7TB 3ZE0F 1BM3L 2BNQB 1M71B 3GMQA 4IRJC 4PY7A 1VFAB 5L2KB 3DYMA 1T5WA 3T65B 4EI5B 1I9RH 3BDXA 3QUXA 4WI9A 2YA1A 1KNOA 3C5JB 1FVDA 4JM2B 4WV1A 4OIAA 2BNQA 1RURH 2VLLA 4HZAA 1NBZB 3V7MA 5E6IB 4I2XB 1VFMA 3VFNA 1KG0B 3FB8A 4W6XB 2AEWA 2R8SH 5TGBA 3EYOA 4P4RA 1SYSB 5I76B 4EXPX 4XRCA 1K6QH 4X0KA 1MCJA 1VADB 4OIIL 1I8KB 2FECL 1DBJH 1PEZA 2RCSH 3AS1A 3QCUL 3BXNA 3VRIA 1B0RB 4U1NA 2YRPA 4K71B 2UY7A 4LRNH 1MREL 4J6RH 1FVCA 3JUYA 3VFNB 3CVHB 1GHFH 4ELKA 3RIFK 3TYGH 1DUYA 3B5GA 4PV9A 3INUH 4BFIA 3U2SB 3CJJA 1ZTXL 4JG0L 4JPWL 4OM0H 5F96H 4J8RB 2AJSL 5B3NA 3UXFA 1F3DH 2PYEE 3P9MB 1WSST 1TQCB 1NGWA 4PJFB 4RIRA 4QTIL 2JJWA 5MEND 2Z9TA 2DJUA 2VXQL 1I7ZA 4UQ3A 5INCA 2X1PA 5F7DB 3VWJC 1YNTB 2OTUA 5IFAH 2FEDC 3SDCD 5ANMA 4ZXBA 4JN2B 3MNVA 3VGEA 3ZSTA 1SJEB 5K9KB 2B2XL 5I1DB 4KK5D 3I85A 1H5BB 2FJHA 4NT6A 1BD2B 4FQIL 3V6FB 4XXCC 1IKNC 3QUYD 4P59L 1WC7A 3MMEB 4G6JL 4XP4H 4Y89A 4OZHA 4UT6H 5GJTL 5GGVY 2YPVH 3ES6B 4PRIE 4PP1D 5E00A 2OTUB 1RZFH 1EAPA 1AD0A 2FNBA 1GGCH 3O4LA 1OLZA 4EUPB 5DS8A 2NY4C 4OLWH 3S97C 4OKVB 3JWOL 4HKJB 5IF0A 2Y6SD 1HNFA 1KULA 2QJDA 4QT5A 4TULH 5F9OH 3QDGB 3VFSA 1T1ZB 1UADC 4JO2H 4MAYD 3F7QA 3UTZA 5F8QC 3O11A 4MXQC 2WLYA 3O9WA 4Y5YA 3CSGA 5BO1L 1J1XH 4LASL 3U2SA 2VSDA 3O8XA 2BSSA 3V6ZB 5EULV 4OLVH 4YDKL 1MJUL 2IQ9L 8FABA 3S4SB 1BVZA 3DO3A 3G5YB 4RAVB 2C3WA 1GC1C 1LO5A 1UB6B 2NY1B 5EPMB 5ALCH 1KTKE 3RTQD 5IOPB 4OUUA 4CU6A 2NY5L 1T7XA 3PWJB 1KLGA 1OTUD 4KUCD 1OP5K 4URTB 2AK4B 2AXGA 3UTZB 4ZXBB 4JPIB 1Z5LB 4XNUL 1LO2H 4NO3A 3WUWB 3PWPD 2N4IA 4WY7H 4JRXA 3RAJH 1PSKH 3LS5L 5HBBA 3ZE1F 3ALPA 3V8OA 1QR1B 3PNWB 5E94B 1H5BC 4K9EC 1CL7H 4OZFH 4LIQE 4KKNA 3WV0A 1EVUA 4PV8A 2H6PB 4U1JA 2A77H 4P2YA 3VXSA 3OX8A 3T1FA 4N8VG 2V2TB 1T6WA 5ADPL 3SCMA 5FO8B 1BZ9B 2H8PB 3JWDH 43C9A 1LDPL 1MJ8L 3L5XH 1EEYA 5EBWA 3V8CA 1MCOH 2DQTH 2IFFL 5AZ2L 3ULUF 2Z92B 4CVZB 4MDIB 1SVZA 2A83B 1BMGA 3IDIA 3ARFD 3VXOA 3OAUL 2NZIA 1JIBA 5DA4A 5FFLA 3VE0B 5K59E 1U8MB 1INDL 2HRPL 4YDJA 3MGTA 4M48L 4Q2ZA 2ZCLL 4WUUD 2DQUH 1A7NH 2DBJA 4G8GD 5CD5D 1R5VA 3FQTA 3RDTA 1MCPL 5DEGB 1OD7A 4AIZA 1MFCH 1UZ8A 4AL8H 2VLKD 5IJVB 2NMSA 4EVNB 3LOWA 4LLWB 6FABH 4QRQA 3EJZC 5C0JA 1F13A 1WITA 2W92A 4JM2D 4WWID 3GIZH 3L7EA 1OCWH 3TJEL 1QG3A 3EDFA 3X13B 3U48A 3UZVB 1YEEH 5FCSH 3TNMB 2A0LC 5JTWA 4Y5VC 1QPXA 3DX8B 5KN5B 2QR0A 3CVHA 3HC3H 5HVGB 2MCPH 4DZBA 3K46A 3CC5A 2XYCA 3HE7D 3MO1A 3WJJC 4IRZL 3SKOB 1MCLA 1PY9A 4D0CB 5KW9H 2I9TA 1G9NC 1S7QA 3AY4C 1N5YL 1F8TL 3VCLB 3GMPB 4KI5D 4K8RL 2PTVA 2Z8WC 4HIJA 1S7UA 2VDML 2BNRA 1DQJB 1IE5A 2XWJA 1G6RH 1YEJH 3HFMH 4FXKA 3P2TA 2MMXA 4LPCA 2DQCH 4IRJB 1X5YA 4ODWB 1OGAA 5E5RB 2ZKHL 4XCNB 3RVVD 3C8DA 2A9NH 5D2LE 4HUWA 2YZ8A 1SEQH 4Y8DC 3VFVA 4CADB 5B8CB 4YHNB 3WL9A 4G8GE 1UKQA 5I75C 3DVGB 4JO1L 5DUML 2QHRH 3WIFA 5TFSL 3AMKA 3VG9B 1W0WB 4L8BA 3GI8H 2HJFA 3PNWA 4PJ5E 2DDQL 1N5AA 4JRYE 3D5OF 1NEZA 5EOQL 1G6VK 5FA4A 3RDTB 4YO0B 2FZ3B 3L6FB 5HDOA 1FCGA 1IC7H 5F70A 4WO4A 3MSPA 4C56D 2BDNL 5EN2B 1KXQE 1QFUH 4Z7WF 3SE3C 2XWBB 1RUQL 5EORH 4U6TA 4Z7QE 5MEOA 3QUYC 3RZCA 3GRWL 5IVNA 1NL0H 4X5XB 3U0WH 4EQ3A 1HHKB 4ORGA 4CVZA 1Q72L 3OJMB 4CN1A 3MRGA 3LKRA 4YXLH 4LCWD 5BRZE 3MROA 1U8OB 5JXED 3QG6B 1IT9H 2PXYD 4KY1H 5EU4A 4KWUA 4WUUA 1WFNA 4XWOD 4EI6B 3E2HB 2VIRA 4MWFA 1EHXA 3LN5B 3ORJA 2X7LA 1G7IA 4MAYC 4M61B 2VH5L 3VWKA 4HH9A 4PG2A 3BISA 2GK2A 3MZGB 4U0RC 1FSKB 1H3TA 4HT1H 5BVJA 2OR9H 1G7IB 3F12A 4RNRB 5IWLA 3MREB 1M05A 3LEYH 3U1SL 4AH2A 4OQTH 5JHLL 5HPOA 3W82A 5CIPA 3QG6A 3HMXL 4LCIH 2PTTB 4XXCA 3V7AE 3KPLB 3BIKB 4RMWA 1TENA 2IPTL 3Q3GA 4XVTH 1YN6A 5E8EB 1JF1A 1CXIA 2R0KL 2DLFL 4BKLA 2X4RA 4HH9B 5JIPA 1A1OB 5GGRA 3QIUD 3NABH 3WDIA 5SV4A 2IGFH 4HUXA 2DBLL 3C5SA 4KJQD 4OQTA 1RHHA 4GXUM 4EKXA 4OLEA 4KHXH 3E3QE 2CIIA 4MNQB 2X10A 5HVHB 3QEHA 4PP2A 3SE9L 1A7OL 4PJ5A 4OTXL 4GG8A 4WCYH 3MODH 5DDHB 4ZAKA 4R90H 5F7EH 4NCC2 1F58L 4U1KA 3KPQB 5IT2H 2P24B 5HYSG 4KHXL 3GSOB 2VO5A 3O2WL 4XAKD 3O41B 5IKCA 4YR6B 3HC4H 2HFEB 1PY4A 2XNAA 1DANT 5D1XB 4O2EB 5JHDA 4NCC1 5LWYH 2VXTH 3MROB 3D85A 3OG4B 2XOTA 1FZKB 2EO9A 1YQ2A 3M1BB 2I26N 4FA8A 3BN9D 4P4RB 4YHIB 4KJWD 4YDKH 3SE4A 1CDYA 4MHHI 1Y18A 3TVMC 1OAQH 1IILE 3B6SB 4XP9L 4Z7NE 4BFEA 1NEUA 1KB5L 4J4PD 1QTYT 3BE1H 2ICWA 2FIKB 5HHQB 2DQJL 1CGUA 3KHOA 4PY7B 3SOBL 3W9EB 3IRZA 1PAMA 4IDJH 1O0VA 3QUXC 1U8HB 1RZFL 1YDPA 3GM0A 3KAAA 2V7HA 1UVQA 3CFDA 4MZ2A 4QRTB 4FFYL 3FQNA 5EWIL 1WBXA 2FX9L 5C0AA 3NIGE 3OGCA 2N7AA 5DJCB 2VDLL 3RRQA 3EOTL 3ARSA 1KTDB 5ITFB 5T1KA 3DRQB 2EDHA 3QULB 2BVYA 4DVRL 4C4KO 5IW6B 4N8CL 3T3ME 3SDDC 3V5HB 5HPMA 5IQ9B 4CVXA 5CD5C 1QRKA 5CBEA 4WNQB 3DBXA 4WU7A 4N90D 3SE8L 1T7WA 1DBBL 2IPKB 3D0LA 4UINH 3FFCB 2FL5A 4OZ4A 4OZFG 4YUEH 4Z7UE 1K8DA 4OZIF 4LSVL 5GRUL 2HKHH 3OKEA 4RX4A 1QHPA 4WTZA 1KB9J 4DK6A 4LVOC 4I18A 2LU4A 2DQHL 4YHLL 2MNUA 2P1YA 3MOBH 1A7PH 4WTZG 4JY4B 5EOTA 1KOAA 3MYJA 4NC1E 1XZ0A 2HKFL 4MD0A 3ZE2F 3ZYOA 3U9UB 2DQDL 3TIDB 1AKJD 3VH8A 4XBEH 4S11A 4Y2DD 1RULL 2F54D 4PTTB 2CLZB 1VGKA 2YUWA 3NA4A 2CGRL 4DAGL 4JDTL 1FNGA 5DVLA 2E27H 4PJCA 5J3HD 4ENED 3ARPA 4KK9D 2JELL 3NFPB 2C1OB 4QRRE 1AP2B 3LS4H 1VGEH 1I8MA 1BEYL 3MV8E 4U1SB 1T7YA 3O45A 2IPKA 2A77L 2ZG2A 3HHRB 2AJ3B 4MS8D 1UWGH 2EEBA 4ZUVB 3QXUA 3JTSA 1XGRA 3S3JA 4U6VH 2HG5B 2X1XR 1U8HA 3ROLA 4IMKA 1RVFH 4MQXC 5F89A 1JBJA 1CXKA 2CMRL 1AI1L 1FG2B 3DXAD 1WBYB 1CGYA 1INEL 8FABB 1FRGH 4X8JB 5EU5B 3EAKA 2BVPA 1NQBA 3QUZC 4GMTL 4TNVK 2ZNXA 4G7YL 4HBQA 2R56L 5DQ9B 1WBYA 4D9QE 5TGBB 4G6MH 2X4SA 3TBVB 1OF2A 1IKFH 1U92B 2MFNA 1RIUL 1IAIM 1NJ9B 2B4CH 3HAEB 4U6YB 4Z0XA 4GRWE 1HHIA 2CO7B 4JM2A 2XV6B 5E24E 1RZGB 4BSVA 2GJ6A 5EUOE 3JXAA 3KNBB 2GYSA 4RMUA 3SQOH 3VFTA 3BQUB 4PJ9A 1HNGA 4L4VB 5GGTA 3ES6A 3BAEL 2R1WB 2APXA 2AEIT 2FWOA 4N0YH 1ZLUH 1G1CA 3LN4A 5EBLA 2E7LA 2D9QB 3DGCR 3VXTA 4EI5D 1VCAA 2CUMA 1UXWA 3QT2A 2CKBH 1OF2B 1CQKA 4XI5D 1GZPB 1S7XA 2DMBA 3IU3A 2H2SD 3T0VA 4YHYC 1B4JL 2YWYA 5DTFB 2D0HA 5HYEA 3T0BA 1E4KC 1YEKL 4GRLA 4JAMB 1QPPA 3S96A 3ARRA 3F58L 4I13B 3IDIB 2JLLA 4ZTOH 1T20B 2IQAB 5E8PB 4V2BA 3EDKA 3JWDL 4ZSOA 4MQTB 2DLTA 4LSUL 1BREA 4D94A 1A6PA 4QRPA 3QHZH 3WDJA 2A9ML 1CLZL 4FZEH 4L4JA 3WIHH 3L3KB 4QWWD 4YHKL 2VRAA 5T5FH 3FO2A 2UUDK 3C09C 1BIIA 3FQUA 3FT4A 2BOBA 4KAQL 2E9IA 4JHWH 3U36B 2WK2A 1QSEE 3GSNA 2PW1A 1KJ2H 1X5HA 3MRPB 1CFQA 4PUBL 4HBCL 4UUJA 1DBMH 4K9EL 5IK3A 1E28A 2VN7A 1NAKL 4JB9H 4JFHE 1MI5A 1HINH 1TJHH 2YRLA 1HE7A 5T1MA 3QO0B 4ZTOL 5SWSD 1SJEA 2YHGA 3O6KH 4DN3L 1UB5B 4P3WA 2OK0H 4WFGD 2XZAL 4HKBA 5IHLB 5DD1H 1A7PL 3LRGA 5C86A 5C3TA 4PD4J 4G8IB 2DLHA 2EDEA 2JIXB 3ARZA 4DGVL 3L5JA 3PHOB 5ADPH 5FYLH 1N64L 5JZ7C 4DAGH 3T0ED 5E8DL 1B0RA 1KIUA 2D9CA 3OMZA 2J8UA 2V7NA 1LP9F 5I1EL 3L3IB 3QIWC 1UJ3B 2VZTA 5JOFB 1IGJA 4OI9A 2EDLA 3EZ8A 1S7XB 1DR9A 4Y4FD 5H37H 3QQ9D 5F7DA 4BFIB 4Q9BA 2R29H 1A1NA 3SKJH 4WW2A 1UM6H 1P84J 2FX7H 4KK8D 3LKRB 4CRPA 4YHNA 1S5IL 1JZ8A 1HHIB 2XN9E 1AI1H 2W65B 1GC1L 1T5XA 2VE6A 4GOSA 3FQTB 4ONGH 1CG9B 1I7UB 3ZDYF 2E8ZA 3K3QA 4M02A 3ECBB 3DSFH 1YA5A 4PG9B 4OGZA 5CS7A 2EXWC 1ZLWH 1QBML 5DEZA 2R1YA 4H20L 2UY6A 3VFPA 3BZ4A 1AXSA 3L3IA 3MJGX 4UBDC 3ARWA 1E4XL 5I6XB 5DVOA 3I6GA 3LDBC 3LHPL 4E41A 2F5AL 5EO9A 3HMXH 1J8HB 1T03L 3TBWB 5GGVH 3VFUA 3R1GL 3ARDC 4NZRL 4K07A 1U8PA 5I66A 3GMOA 5EIQA 4Q6YA 3LRHA 1I7TB 2R9HC 5IBUG 4Y4HD 2X1OA 5HGBB 1YPZA 2FGWH 5IW1B 5TDPA 4M4RA 4H26B 2DKSA 2BHZA 5C0EB 3MRNB 1MI5E 3LN5A 5DJ6B 2HMIC 4X98B 3RWJB 4NCDA 3W81A 3LHPH 4HFWB 4MJ4A 3IFNL 3PQYD 4ZOEA 1RFDH 1IM3B 2Q86A 4E42A 2NXZD 3QRGH 1JL8A 2KZWA 3Q0HA 5CGYC 3MLWL 2J3SA 3BGFC 1MUJA 1ZT1B 4FHBD 3RNKB 2BNRD 2W0KA 5C0GB 4XPBH 4FTVD 5DRZB 3DSNA 4YFEA 3D18B 5CJBA 1DBKH 1QLFB 5T5FL 5IW3A 3L3JB 2ZUSA 2PTTA 2QR0B 4WFFE 1FFOA 3QG7L 1ZT7A 4PRPE 5B39A 5D72H 3LMJH 4LHJB 2BERA 2FIRT 3AUVA 5BV7L 3EBAA 1F02I 1A3LL 3CSYA 2Z31B 4LSRL 1B4RA 3OR6B 5C0DB 3T2NL 1N59B 3D3VE 1JNLL 4TUJA 4HKXA 2VABB 3QDJA 2EC9U 3DX8A 4LCCC 5EC2B 2H9GA 4OI7A 3ZDYE 1OWRM 3SDAB 1A0QL 3W39A 4RWYH 3OZ9L 4IJ3C 2DMKA 3O6LH 3U79A 2H6PA 4U1JB 4J1UA 4JY5H 1HH9B 3VXOB 3QDMA 4M6MH 4HDIB 2DQFA 3OB8A 5C2BL 5HYJA 1FJ1A 4GQPH 4TSAH 3T0EB 2NY0C 1PYWB 5IB5B 4MNQE 4NKDB 3WXVL 2D7NA 2CDEA 1TZGH 1SBSH 3VFOB 2I60H 3FO9A 5IMMA 2FR4A 2YMXH 2XWBA 3MRQB 1NC2A 2YA2A 1MCSA 1NAML 4FFWC 5DMGC 5IB5A 4WDIA 3HI5H 1QO3A 4C4KT 4KJWC 3VXSD 3EUUA 3R06A 3S35L 2AK4D 4F7TA 5BZWB 1CF8H 4RFOH 4R4BA 4U6XB 2ZCKH 3IXTB 1EZVY 5F7WC 3G9AB 5D1XC 4GG8B 2DTML 1IGTA 1TTFA 2P5WA 1C5BH 2HJFB 5H8DA 3UC0H 2WBJD 2AJVL 3QWOA 3V6BR 1U93B 3O6FD 1AY1L 4X6CE 5EU4B 2H41A 2B7DT 2VC2L 5EWIH 3O41A 3IVKA 4Z7OF 2IGFL 1LD9B 1YJDC 1RURL 5DEFA 1W0VA 1EFXA 1WWBX 2XKUA 4PJ5B 3TT3L 1NLDH 3BHBA 5KTEH 3V5KA 1A1NB 5SWSA 3QPXL 4KVCH 4J3SA 1AXTH 2XTJD 3L5HA 3MLSH 1D5ZB 3IS1X 2NPLX 1I1RA 1CFNB 1DN0B 2O26U 2P8MB 4OF6A 3VD7A 1GZQB 3FRUB 4GBXD 4KKCC 1WZMA 4L4TB 4OLUL 4HS8H 3QCVH 3W5NA 1Q9OA 1MCNA 5GRUH 2ZUTA 1A6UH 4W6WB 1A6VL 2R1XA 3K8MA 5E4EC 4F58H 2GJ6D 3QEQA 2X7LB 3S7GA 3VG0L 3U0WL 3BPNC 5JA9A 4JFEB 4ZOBA 1A7QL 1KJMB 3QPQC 2H3NB 1LE9A 3DO7A 2Q76A 5DYOB 4WJ5B 4J2XA 2VDKH 1WJ3A 4JRYB 2ADFH 2YBRA 1NDGA 3UMTA 3IDJB 4KK9C 3P4OA 4GRWB 4K9EH 3VD3A 4LBEA 2EC9T 1K2DA 5IEKA 2VLJD 5BRZA 2ZCHL 1CD9B 2QEJA 4YBHA 3T3PE 3MRRA 4PRIA 3MLZL 3KLSA 4Y4HA 1XGYH 3MUGA 1QLRA 1JI1A 1NANH 3FFCA 5EPMA 4F7MA 3KJ6L 3OG6B 3X3GH 1WCBB 1AGCB 2YN3A 3P77B 1KPUA 1ORSB 2QHLA 1EGJL 3RI5K 2ZG1A 2ZPKH 4DGVH 1KYOJ 5D70L 2IH1B 1EO7A 2BVUA 2KKQA 3QAZB 4U1GB 2FBOJ 1IKNA 4PRHE 4XVUD 3O2DL 1ORQA 5IB3A 2MHAA 4BQ8A 4HKZA 3T77B 3SO5A 5DGQA 4H5SB 4GS7B 5TQ2L 4R4FL 5SWSB 1FVDB 5DJYB 2VERN 3DROA 1FGNL 5DURB 4OCWL 2EE2A 2NY4B 1KPVA 3Q6FB 1E4KA 3JVGC 1MFEL 1RZGA 4QHMB 4BSVB 1AE6L 3IXTA 4DN4L 1MCHA 1WIUA 5IHUL 1HZHH 1Y0LB 3UBXI 2G60L 5CHNA 2FO4B 4NHUB 4BQBA 5AZ2H 4OKDA 4LGRB 5DT1H 4NQED 2HJLB 2GSIA 1ED3A 1I1YA 3H9YA 2A6IA 2XN9D 1N6QH 1T7ZA 1ZSDA 5FM4A 4HAFA 2AVGA 1UKTA 1CIDA 2H32A 3ARGC 3TH3T 2BY1A 3TNNA 1M71A 4BZ2H 43CAA 3SDDA 5F6IB 1XF1A 2PR4L 4G9FA 1RIHL 5H37G 3UX9B 3W0WB 1Q9WA 4JY6B 1A1MA 4P2RE 4QRRA 2NXYD 2ADIB 5D2NA 4PB9H 3F7VA 4G5ZH 5E2WL 3CDGB 5KSBE 2H2PD 2MQ3A 1RK0A 1OARL 5EO1A 4I5BB 5F1IA 3FO0H 5IHUH 1CDIA 5ENWB 2XQBH 3RWEB 2PR4H 5K33A 3A67H 2GSIB 4L1DA 2OMBA 3TO4D 2D03H 4Y1AA 1B0GB 4X7EC 3HS0B 1R5WB 5IMOB 4HK3N 3KPRA 4Q9CA 1FL6A 3BH9B 3OPZL 4LCCB 3HE6B 1KCVH 4XNXH 3KPSD 4GAJH 3U36A 1FL3B 2H3NA 3HS0A 2DKMA 1FV1B 2PYFA 3TESA 2XACC 5IGXH 3BQUD 4IDJL 4JQVC 4YFLF 4CMMA 4MJIA 3N06B 4KTEH 3B3IA 1OD9A 2BNQE 2UYLA 3MGAA 3QCVL 1BF2A 3UPAA 5ISZE 2WINA 4KZDL 3VH8B 2J12B 5IEHB 5A43C 1L7TL 4XNXL 2WBWB 1LEIA 3DV4A 4U6HB 2D7OA 3H9SB 3IXAB 4WTWA 5AYUL 4CMHB 1TJGH 4HUUA 3H3BC 4I0PC 2NTFA 3ZSSA 5EBWB 4JHZA 1YEDB 1CGVA 3MV7A 3WE6A 2WP3T 5K9KA 3L3DB 3B2VH 1Z2KA 3QG7H 1GZPA 4HCRL 25C8L 3C6LA 1NGXB 2QLVB 5DJZB 2PYFB 4HZLB 2EKSA 3OGCB 3TF7C 3P40A 1MIEL 5E5UB 3SGEH 4KI1A 4TRPL 2DICA 1QBAA 1QR1A 4JY6A 3BI9X 1HKFA 4UIKH 1UCTA 3EO9L 5DRWB 4L8BB 4HLZG 1AD0B 3RPKA 3SO3B 3VMOA 1XF4A 3V4VL 5CJXC 1MLCA 4PJ9B 3RY6C 1GAFL 5DQDH 5JOPD 1QVOA 5HJ3B 2ITCB 4WHYH 2BVEA 3PDOB 4GKZB 4NRZB 4CDHA 3QCTL 4H26A 1DZBA 3ARGD 3P0GB 1BJMA 2D0GA 5KVGL 3TBYA 5GJSL 1A6WL 1N4XL 4S1DC 3B9DA 1J0JA 3QUMH 4MA7L 4X5XA 5B21A 3K2UL 3LRSA 4NO0A 5HI5C 15C8H 3WJLC 1FGVL 5IB1A 3BEVB 3DURA 4HWBL 2PCPA 2V2XB 2XWTB 3HB3D 3S5LG 4P23B 4ZS6C 4DN3H 1JWMB 1IAMA 2YUZA 4FNLH 3K4AA 2PKDA 4JZJC 2FRGP 1DEEB 4F2MB 4U0QB 4F7MB 1H8OA 2ZCKL 4DKFH 1GGCL 4R7DB 1VFOA 5JXEA 2CR6A 1DBAH 1ROWA 5I8KL 1ZHNA 2APFA 2VXTL 4WI6A 5IUSA 5KVGH 5KW9L 1FZMA 3IJYA 4HIHB 5D1QC 1JTTA 4PG9A 1MFAL 5FXCH 4BUHA 1RZ7L 2ESVD 1CXHA 2VC2H 4RAUA 1BF8A 3O4LE 3CFKA 4I4WA 3BH9A 5LCVH 3VXUA 2XZQH 5E8NA 1UC6A 1T7VA 3D39E 3IDUA 4FQJH 3MRIA 3G6DL 3EYUH 3VRJB 3UBXB 2X4SB 5LXGL 4Q2ZB 3HUJF 5FYKD 4A2LA 3RY5A 2VUOA 5I1CH 1DBKL 1W72L 1MIEH 3SGJC 1JGUL 1U8PB 3V2AR 3W9DA 3JWNC 1CIUA 4DVBA 2FSEB 5CGYD 4MDIA 3NZHH 4NQSB 5E5MB 5FK9B 1DBAL 2PW2B 1IGML 1WEJL 1MI5B 1MNUL 5HDBF 1LMKA 4M62L 1C16B 4LNVA 2A6DB 4WW2F 1QRNA 4NQEA 3BUTA 5KSVA 1I1CA 4FQQA 5CD3A 1BZ9A 2H8PA 3E6FA 5F7LB 1KIRA 1KACB 5I9QC 3WLBA 2Y6SC 3ULVD 1XGPB 1I3VA 3WKNA 3NMEA 5KN5A 4GBXC 12E8H 3TIEB 3F12B 4RNRA 4DEPB 4HJGB 3X3FL 1FNSL 1GH7A 2NY2D 5DRWA 2ED9A 3A0OA 1NMAH 1ZE3C 1MREH 1ZHKB 3RKDD 3FMGL 4M61A 5EZJA 5I8CB 1BD2E 5JOEA 1UWXK 2AV7A 3VRLE 4PJDF 3KHQA 3TN0A 2NNAA 3NFNB 5E4IA 1WCQA 1FFOB 1J9CT 3A6OA 1TVBB 3WNPA 2HVKA 4ZTPL 4LLDB 1S3KH 2VLMD 5C08E 1AFVH 3K4ZA 4TVPE 4AT6B 2R8SL 1ZGLP 2BX5A 1A3RL 1ULVA 4KMLB 1EMTL 3EJYD 3L3GA 1DLHB 2DKUA 1FYHB 1B2WH 2WINB 4N0UE 1CFNA 5E6IA 4FFYH 2X4PA 2KQNA 4LKCA 1IAOB 1QUNA 1JGEB 3NACL 5IVXB 3EIFA 4NQDB 3VA2C 4O5LL 1RZJC 2IJ0C 3VXSB 2Y4SA 2Q8BH 3N1QC 2XZCH 1IGTB 4J3VA 4X9GA 3C87A 3LKPA 3I02B 3HZMA 3Q5OA 4C83A 1J1PH 1CLYL 1W8OA 5E99L 3ULVL 3BZEA 4PJGE 3U9PH 1JYWA 3CAFA 5BV7B 3KLHC 4KJPC 1ZKAA 5BOZG 2DM2A 4G8GB 4JPWH 4ETQA 5E1AB 4HULB 3O6FC 2V6HA 3K80A 3KXFE 1DQLL 3VDCA 1A0QH 3LKOB 5MEPB 5KG9B 3QUZB 4GKSA 4KJYB 3CFCH 4XBGB 5DQJA 3ARFB 4EN3B 3QQ3A 1YN6B 2Q7YB 3SHSA 5E70A 3GRWH 3RX8A 4HXBH 1N3NA 4FZ8H 1E4WH 1YN7A 2V5SA 5GGQL 4JPKL 3FRUA 1X5AA 2W9EL 1FN4A 3O8XD 3R0MA 1AHWB 4LCUB 5C07B 5F7EL 4HH8A 5F1NB 4YXLL 3DX7A 4P23D 5D1XA 5J13B 4H1LH 1FBIH 1P6AB 1QLFA 1SYVB 5F3BA 4X98A 2BRRL 4CN6A 4LLQA 2R23B 3TBSA 5HXMA 4QHUA 2EEDA 4ZQKA 5J56B 1TPXB 3TV3L 3BWAB 3T1WA 1B6DA 4AEHL 4KMQA 2BSTA 4X8XA 2I07A 3N1MC 3Q1SL 1TNNA 4XAWH 4MWFB 4GUPB 1SYVA 5E56A 3D0VA 5T1DL 1SM3H 1HSAA 5F21B 4YXKL 4JQIL 3QWOB 3OL2A 1YEFL 2ZSWB 4CJ0A 6FABL 5I66B 1G7PA 1A1OA 1B90A 5TH2B 1FFPB 5DR5L 4MSWA 1AIFA 4AQOA 1MQ8A 1R3LA 3J8F7 4ZDHB 2J4WL 2JJTC 4XCNA 2EYTB 2BVOB 1GSMA 3QIUC 3WIIL 1LO4L 1FZJB 3S36L 4E41B 3CLEH 2GJZA 4ODHL 1G9NL 1FNHA 4W81A 1C5CL 2WUCH 5IFJA 3ARYA 3W11C 1KCSH 3SDDB 2F53B 1QFWL 5IMMB 1OAKL 5DC9B 2ICWI 3EGSA 2A1WH 3T0EA 1LNUB 1MCOL 1D6VH 5ADOH 1SJXA 2JJVA 3ARBA 3QDGD 5AZEH 5IW6A 4XBGA 4I1NB 4JRYA 1OAUL 1A2YA 4PRBA 3RY6A 4TNWF 4OZIA 2ATKA 4WCYL 1HH9A 3OKYA 3CU1A 4OZHE 4HGMA 2PO6D 1KEGH 4S0TD 2VZ1A 3PWJA 1YEKH 3OXSB 3GDBA 5HHOA 5IB3B 4NNYB 5DLMH 4JFPB 3IDGA 2R56H 4E0RB 3TT1H 3MRFB 4K3EL 1F4YH 4RFEA 5EUOA 1XZ0B 3NPZB 1CI5A 2NY7L 3HAEG 1LWRA 1B9ZA 3S96B 5C09E 3DWTA 3WFHB 1MHEA 4FTVA 1I9JH 2EIEA 1I3GH 3D9AH 4JRXD 2EDTA 4XPTH 2WWMD 3MUGB 5D2NB 3NH7H 1QNZH 1SHMA 3DVNA 4L3CB 1ZGLA 5IMLB 4HUUB 4BK5A 3IAQA 4QRSB 5ACZA 1MJ8H 3L5XL 2DQHH 4YHLH 4H0IA 4N1HB 5EZOH 1PZ5B 4R8WH 3LB6C 3DXAE 5HHVL 1ZWIB 1T89A 5E6ZA 4FQCH 1J1XL 4K55A 4LASH 2DQEH 1KTDA 4Y4KB 1MEXL 2MHAB 4L9DA 1KC5H 5DD6B 5F6HI 1FVCB 5H94B 3VXRE 3GMMA 1WBXB 1WIOA 4Z7UF 5C0AB 4Z7VA 1DQTA 4CDGC 3O3DA 3JV4A 5F44A 3C2AL 4GMSL 3MRJA 1T0NB 4PJCE 4Y5VA 3REWB 4ZXBD 1VDGA 4GQ9L 3VRIB 3HZYB 4P2RA 3GNML 1RHFA 5E8PA 2WWKT 4KI5F 2UZXB 5KZCB 4GAFB 4UT6L 2D31A 1ZS8B 4Y5XC 2GT9B 2JCCA 5I1CL 1U91B 2BRRH 2R4SL 4XNQB 4QGYA 4DK3A 2HFFB 5L0QB 1PLGH 4LARH 3CSBA 1IZKA 1KPUB 1ORSA 4NN7C 4UQ3B 5INCB 4XHJD 1UACL 3G5YA 3W0WA 5DMKB 4PGEB 1T20A 2FECI 5CEZH 3MRPA 1NGWB 1T2QH 3RQ3A 3QFJB 1IAII 1YUHA 2P4AB 3HLAA 5ALCL 5FUCE 4J12A 3MA7B 4XPGH 2R0LH 4FRWA 2VTFA 5HGAA 3FAWA 2DLFH 2VXUL 2CLZA 4XTRD 2BFVL 1XF3A 3UAJD 3H8NA 4P5TD 4Z18A 5DD3L 3EYVA 1R0AL 4GW1A 4YEEA 1LK2B 1FFNA 3C5ZA 4NHCH 1UKSA 3KPSB 1J0KA 2IBZX 5DJ8B 3OWEA 2C3VA 5MENA 3PWPA 1NFIB 4WEUD 1G0DA 4MJ5A 5D6DC 3EOYG 1BFSA 1BQHG 3TFKD 4G7VH 4P4KB 2YD3A 2VJXA 3WE6B 5BV7H 3IFOA 3QUYB 4OB5H 4S1DD 4PRID 3FHAA 4N0CD 1DL7L 1FLTX 3CLFL 2Y06L 2DWEB 4KC3B 4GXUN 5E6YA 3RTQA 3BPOC 1FDLH 2AK4E 3DV4B 1YMME 5AG8A 3ABZA 3U82B 5E9DA 3QUXD 5TDNB 2XWTA 4X80L 3X12A 1QR4A 4RX4D 4QO1A 5KZCD 1HDMB 1X5LA 3HI6H 4RBPK 5B3JE 2ZJSH 3RHWK 4FABL 4WW1A 1XAUA 4Y2DB 4FFZL 1VFBB 3PG2A 1UM6L 2ZP0T 2EIZB 1HIML 4DOHB 4KQ4L 5FKAB 1KN4L 1TTGA 5HI3C 5ID1B 4HUVB 3MUZ1 4MGXA 3F6LA 4HK3J 1RZ7H 3RIAK 3OKMB 4BSWA 5DSCB 3WDHA 1FL5B 1N7ML 5GRVK 1K4CB 2DQIL 3TIEA 4K7PX 2VMFA 3DI3B 4JFFD 3GI9L 4ZUWA 3PL6B 3JV6B 4WWKA 5I6XC 1A4KA 3F65A 3DUSA 1NMBL 4YDIL 1AO7E 4BSJA 2EZ0C 4XPHH 2F8OA 4HC1H 1Q8MA 3F7VB 2VH5H 1XIWA 5IWLC 2K7PA 3T8XB 4NZUH 2EYSB 2Y1VA 5E1HB 1DEDA 2DQIH 3G6AB 1OGAB 1JGUH 2G2RA 3CH1A 1S7TA 4D0BB 3MYJB 4Z7VF 5BZDB 1ZV5A 2OJZH 1MRCL 2NZ9C 3W9DB 4L8SA 1MIML 2P5EE 4IHOB 1KN4H 5DUPL 3MLRL 1QD0A 4JGUA 5DD3H 1V7MH 2JK5B 5LAXB 3RVWC 2RGSA 4IRSB 1RPQA 3MLTB 1CE1H 3DIFA 1YQVL 4XNZB 1A21A 4P2RD 1UJ3C 5EZLB 1FL3A 2DB8A 1NCCH 1VKXB 1U3HD 3L1OH 1EJOL 4LPYA 5DJ2A 3IYLW 5FKPA 3QB7C 5F7MC 3FFCD 4QHMA 4EEEA 5DMIH 3QDJD 2GIYA 3PWUB 4NN5B 3QXDB 1RIVH 1IGCL 3GBMH 1I1AC 1NAKH 2QSCL 3QI9A 4TUKL 4PGJA 1DE4B 1CDJA 5I18L 4BH7B 3GSUB 4LOUC 1I7TA 5C0JB 5D8JH 5DJ0A 3MJ9L 2YUXA 2YUVA 2COQA 2YC1A 2CKBB 5D7IE 1X5ZA 4PJAE 1MFAH 5L8JB 1RJYA 3GI8L 3O0RL 2IBGA 4QF1A 4WUKH 1MUJB 2QV2A 1Q9WB 1UCBH 2XXCB 3ELAT 1BJ8A 5HHMB 3VXPB 3UTPD 4Q97A 5HHOE 3NZ8A 4NRXB 1WAAF 3C6SB 2ZWLT 1P7QD 3MBEC 1XIWC 1A6WH 4GBXB 3DV6A 4L4TD 5BVPL 5ICXA 4K7PH 2VOTA 5HHPA 2IH3B 4EDWL 5FDYA 1E6OL 2XNAB 4P46B 1ACYL 2V5RA 4PJDE 4UQ2B 3ME0A 1B0GA 2PETA 1HYSC 3HE7A 1GGYA 2LAGB 4NRZA 5GS0C 3TBTB 2Z31C 4MXVE 4HFWA 2IC2A 4V1DE 2X42A 4HIHA 4TRPH 2WAHA 3F7YB 1X6NA 4ZXBC 3BZEB 1RHHB 4LKCB 5CWSB 3N1PC 1UJ3A 4N5ED 1DVFB 5FEBA 1AXIB 5T3XH 3TBWA 4TPRH 3WNOA 4UOJA 3RTQC 3W9EA 1A3QA 2UZIH 1O5DT 4H25A 4M9OA 3MRKA 4TSCH 1JWMA 1OTUC 5ETUB 2Q3AA 1BLNA 5C07D 1IC1A 2GITB 4NWUH 3C5SB 3GMPA 4NQUA 5F9JB 4RMVA 2XKSA 4DJMA 4HFUL 4QOKA 1P9MA 4TSCL 4OJFL 3VDBA 2IAND 3K7UA 4X7SH 2A2QT 4PTUA 2IPTH 1E28B 3MA9H 4LK4A 1BM3H 3KPRE 4GKSB 4RGMB 2HH0H 3E6HB 4QHKI 1EBPA 4QXGL 5T3XL 5I0DA 1EZVX 3K8KA 1GGIH 3CMGA 5C0CB 2N56A 5EO0B 4WWKC 1W2KT 4J3XA 5EC1A 3NOIA 5GZNC 2HMID 4PJHB 4P2QE 1V7NL 4JHAL 4ALAL 3EYQC 5E03A 2GAZB 1YYLL 1J8HE 5I73B 1S7SA 3HE7C 1AD9B 3VGFA 4HS8L 1RUKH 4NJAH 3IFLL 4ELME 1T6VN 4K3EH 5I15L 1P7QA 4KGJA 1WZ1H 3GJFK 2I25N 3BGAA 3DRTB 3O2DH 4UT7L 2YD7A 1T1YA 5JORB 2OP4L 5GS2D 1DBJL 3QIWD 2BNRB 5AUMB 1OP3H 2J88L 4XWGH 3AXLA 2N1KA 3UC0L 3V0AC 3EFDL 1IL1B 1DQQA 3VXQB 4RDQF 1YNKH 5DMYA 4KJYA 3UAJC 1F90L 3BVNB 4O4YL 3I6GB 1HHKA 3H42H 5I19L 4KRPC 5HI4C 3RVVC 1MRDL 2IF7A 3CFKB 4YFDB 2YPVL 1NFKA 1G7HB 2AABL 3RGVA 1MAJA 2ADGB 4M8QB 5FYKU 4G7YH 4X9IA 2XQYK 5I2IA 1XGUA 3D0VB 4HC1A 4PJ8A 4X7DC 1OAKH 3ZT6A 1AGDB 1S9XB 3HC0A 3BP4A 4P46D 1R24A 5EUKA 4UBDD 3DUUB 3RGVD 1CICD 2CLRB 1FO0B 1P2CA 1NGZA 3WS6C 3TBSB 1ZMYA 3CVHH 4YWGL 2GUOB 5AZEL 1S9XA 2GQHA 4UMGA 3QEHB 3QIBA 4OT1L 1ZA6A 4ZSOE 4DFHA 2YXFA 1BVLA 1D5ZA 1J1PL 2F8VA 3WS3A 1WBZB 1J8HD 3QPXH 5MHSE 5CJOL 1NSNL 2NY0D 1KYOK 3MX0A 4PD4K 3SOBH 3RVTC 1LEGB 2R9HD 4QRUA 1WLHA 3WLBB 1BP3B 5D7JD 4UB0H 2FD6L 2ITDA 2V5YA 3U7YL 1JFQH 1J87A 1MI5D 2Y9RT 3RFZC 3NBNA 4ZUSA 5J89A 4XNZC 1RQ5A 1WCBA 2W0FB 3TO4C 1JZ5A 3IVKB 3GZKA 4XNQA 3QQNA 2NTSP 5CEZL 2XKNA 3INUL 4MA3A 4PJAF 1EJ6A 2VLRE 4FXGA 4PB0L 1AP2A 2EDKA 2HJLA 4GLRI 1VPOH 4LLQB 2KBGA 4G9FE 3HE6D 3NACH 1XGRB 5CINH 5F6IC 3TBVA 3M45A 2ZG3A 1IAIL 5D2NE 8CGTA 1SVCP 4TQEL 2BMKA 3B9EA 4PJ8C 4WY7L 4NC1C 3ARGB 3GMQB 3KPMA 2HN7B 3HE7B 5DD0L 3MV11 5L7XL 2X4PB 3LQAH 4R4NC 3VDAA 2YRZA 4XCYA 4PJEB 4XNMA 3KPSE 4PGCB 3OHXA 4QRSA 3S98A 4LLDA 1U91A 3V0WH 1A6ZB 2EDNA 2E9BA 2W38A 4PJCF 4HIXL 3ZDZF 4RGOH 4N0FA 4RA0C 4GS7C 3EDEA 3X11B 2HTLC 5IB4A 3QULA 1D6EB 2RJMA 2J7LA 1JPSL 2OCFD 1D5BB 1ED3B 3G5VB 1A6ZA 3VU2A 3TZVB 4N0YL 4ODSL 4Z7WA 4FTVE 1AGEB 1RJZB 2BNRE 2BJML 1J5OH 2J6EL 5H94A 5DDHA 4ZAKB 1JGLL 4X4ME 1MCKA 3TZVA 4C59B 3VXUD 3D2UA 1UYWH 4I18B 5HGAB 5HHOD 4NZJA 4XC3H 3TYGL 4PLKC 1I4FB 2Y36L 3G04A 3UJJH 1H15B 1I75A 1OGAD 4JZOB 4PRPB 1ERNA 4OCRL 4N0FB 3WLWD 1FN4B 3TIDA 4P2QB 1XGYL 4IRZH 3OKMA 3SJVB 1C1EH 1A2YB 3VGBA 2IH1A 3GMRA 3OJDA 4OLZH 1HWGB 3BKCL 1NFDA 4RMQA 5DMJB 1BAFL 2ADJA 1SJVA 3ZTNL 4FZEL 4PREA 4ZYKA 3ULSA 3JWOC 2PCPB 2V2XA 4NQVB 5KS9A 3MGOA 2HT2C 1CK0H 4PJAB 3C2AH 4GMSH 4KKLC 4PR5B 4MAYB 2ZSVA 1BQUA 3ULUC 2VDQH 4Z78A 3L3DA 4XP5L 5KS9B 4O2FA 1PG7H 1S7TB 4D0BA 4RFEB 4P5TB 5EUOB 5J1SC 2F58L 2DL2A 3BP5A 3D2UD 2W0FA 3FO1A 2KPNA 5IM7A 4KQ3H 4K3JL 4PJIA 5L0QC 1X5GA 1N64H 1AE6H 4LSQH 4K2UL 2VDRH 3OAZK 2H32B 5E2VL 2VKXA 3QFJD 4EUPA 1BFVH 1F4WH 3QUXB 1TZIA 4I18C 1OSZB 2VLRD 4GAYA 3H3KA 3W0WD 1QSZA 3QEGH 1LO3H 4MJIB 4V2CB 2WANA 4HWNA 4LDOB 3MC0A 2KQMA 5ID0A 2FJGB 3MNZB 3HR5B 4ZG1A 3SGDH 2GJ6B 1IMHC 5D7IA 3TZVC 3F8UB 3WO4B 3RL2A 2LTQC 4CMHC 4AIZB 3IGAB 1WV7T 4Z7WB 5HDQL 4XPHL 3PGFH 3ZDXF 4XH2A 4ENEC 5J13C 4EOWH 1KPVB 2CUHA 1AGDA 1JZ2A 5DJDA 1Q0XH 1LO0H 2H1PL 5IV2B 4MLIA 1OGTA 3IAGC 1AQDB 1VADA 5BRZD 5JOFA 3X12B 4HKBB 4OZHB 4JFZL 2MPAH 7FABL 3O6KL 1TNMA 1OM3H 1KFAL 2XT1B 2GY5A 2YR3A 3ARFC 4PGCA 3RWDB 1RI8A 5CUSH 5I71B 5L2KE 4DW2L 3M17B 1J86A 1R5IA 1NDGB 2R1WA 1GOFA 2K9UA 5HHOB 3T0WA 4HJGA 4MA8H 1FPTL 4O02H 4B0MM 1S9KC 5C09B 1S5HA 1G7QB 5TFSH 2C1OA 5J3HC 3GJEA 5EZJB 5I8CA 5D1QA 4LCCA 2A38A 4F7EB 3ARQA 3WD5H 4J3TA 3WLWC 2BZDA 1U3HC 1ZLWK 3WXWL 1H8NA 4JN1H 2FJHB 1U8KB 4ALAH 5CEYA 4LCWE 3VWKB 4JRXB 4OD3H 5DURD 5DD5L 3G6JA 2HFFA 2HTLD 4JO4L 4PRDB 2Z91A 5KAQG 3TC9A 2MTPA 4H1LA 3UBXG 3EYQD 3IU3B 1T22B 5T1MB 3F7RA 5F9WB 4ODXB 4JFED 3O3BA 4UNVA 3QEQD 3LQAC 2MSPA 2X6MA 4PJGF 4H1LB 1A64A 5FA4B 5IVXE 35C8L 1RK1B 4LEXL 5FUZL 2JB5H 3IFOB 1EV2E 3H3PL 3STZA 5LQBL 3GSQA 3VI3F 1OAXH 4XMKH 4XMPH 1KCKA 2HH0L 4MS8C 3L3KA 3HRPA 3R8BB 5IB2A 3ZKMC 3BPOB 3NTCH 1QP1A 2BNUB 1VACA 4JDZB 5FKAA 2PNDA 4OKVA 2EDDA 5LCVL 2VDLH 4N68A 5TDPB 2R2EA 3UJTL 1S78C 4HZLA 3RL1B 5F9AC 3H9HB 2ICES 2BOCA 3WJJA 3IDXL 5C0CE 4LSSH 4QOKD 5FOJA 1WFTA 3FB6B 4QGTA 1JHKH 2WWKO 4QYOB 2D3VA 1KB9K 1TVDA 2A9MH 1XGPA 2YPLD 4XRCB 2CDGB 5SWZA 2P5WB 2IADA 1PEWA 2J8UB 4U1MB 4NWTH 2ADFL 2VLKE 2I9LA 1OB1A 1A02N 5GSVB 2J88H 4I77L 3KPPA 2GI7A 4XMPL 4O58L 4GRWH 3QXAA 5TE6L 4HWEH 1TVHB 3KYNA 2JIXA 3P0VL 4Q9RL 1M7DB 3MO1B 4OQTL 5JHLH 4B50A 2I9LB 3EHBC 3NIFF 3MJ7A 3ESVF 1AXTL 4DZ8B 1NCBL 4R26H 3JWOH 1FV1A 1YMHA 3NZ8B 3MA9L 1OHQA 3QWQB 4HIJB 1S7UB 3KPSA 1KV3A 4G6KH 3WFZA 4Y16D 4X7CC 5AYQA 4GG6E 3VFVB 5MP6L 1WVZA 3QIUA 4LDLB 3TT1L 1KLUA 2HT3D 2GFBA 2ZKHH 4JO3L 4PJBA 3LPWA 4Z7UA 4PJFA 1W0WA 2Q6WA 4U1HA 2BSRB 5GGVL 5A2LH 2EDOA 3OKDA 4RAUB 3DHMA 3DX6A 3G6JE 3P4MB 3VWJD 4D8PA 3ILPA 3DIFB 1C5BL 3W39B 3EYUL 3UTTB 3LMJL 4F57L 5FO9A 4CU7A 1H3GA 4R7DA 3OGOE 1S7VA 1IC5L 1C12A 3HPJA 2NX5A 4OF0A 5M7QA 2OTPA 5DEGA 4OGYL 2OL3L 2R2BA 4K23L 4PJ8D 3BRGC 1FPTH 5JOPE 4XMLL 5D1ZD 4GMTH 1UEMA 1HQ4B 1G0YR 1YEGL 2APTA 3LS5H 1GC1H 1I9RL 4L29B 1DDHB 4U31A 5D7IF 1PKOA 3CZFB 4DVRH 1D5IH 2VXSH 5D4QA 2RHEA 1H3UA 4QTIH 2BK8A 2IG2H 3LRSB 4NO0B 1I8LA 4NO0D 3TGXA 3RWJA 4LSDA 3PV7A 5AYUH 3QIWB 5FB8A 3O3UN 4LU5L 3BP6B 2ZZUT 1U95A 1N0LA 2YWZA 3RVXD 3K4DA 5F96L 2DM4A 3S88H 1S7VB 3F7PC 1YDPB 1BVKA 2PUQT 5FAAA 4PJ8B 4F7CB 3SPVB 4RFNB 1SEQL 1IGJB 1EO8L 3CLEL 4HCRA 2FIKA 3PIQA 5HHQA 4Y4FB 5HI5D 3BO8B 3S88L 3QEUA 3GBNH 1SY6H 2VXVH 1U3YA 2MJWA 4LF3A 5INDA 2OQJB 2B8OT 4HKXB 3FOLA 4I48B 3NCJL 3CFBA 2IG2L 5EO9B 1XIWB 3CSYB 1RZ8A 3LSOA 3C60A 4MCZB 5GXBB 3GUTA 2HN7A 2GSGA 2HVJA 1CDGA 3QWRD 4LEOB 4U1MA 4FOMA 5D5MA 1G7LB 3LEXA 1TFHA 5L2JB 1Q9LB 3Q1SH 2X4NB 3MREA 3UYOD 5AAWA 5TE4H 4OF3A 5GGSB 1ZA6B 1SY6A 4G6AC 4I3GA 1EAJA 4W4OA 3HG1B 3L3HB 4J4PC 5J1AB 2P8LA 1CDHA 3MLWH 5I16B 5TH2A 2R0KH 43CAB 1JPTH 5K9JL 3QDMB 4YEFA 1FSKC 2QQNL 5DJ0B 3DUUA 1YECH 4UU9B 5IBUB 4ZMAT 5CSGA 1MAML 5FHBH 4ODTL 4UDTA 1BWWA 4DTGL 3WS6A 4PV8B 1BZ7B 1HEZA 3WIFB 4PJCB 1E6JL 4K3DH 3BQUA 1ZK9A 4Y0GA 4IOIB 3MJ9A 3FQXB 4HS3A 3DGGA 4GFTB 4MD0B 4AMKL 4YK4B 5KVDH 1A6UL 4J6RL 5TF1L 4Y1AB 1IAKA 1BHGA 3BGFB 4GKNB 3WHE1 1TIUA 3PUCA 1NBYB 3AU1A 5TQ2H 5IFJB 1AO7D 3MZTA 4R7NA 4HUXB 2ID5A 2AXHA 2PN5A 5IKCB 5FYKL 1B2WL 2WW8A 3MLYH 3WHXA 4N8CH 5IVZB 3QO1A 5M94B 5GRJH 5L7XH 3UTTE 1JYNA 3OKLB 5L88L 1KN2H 2HVKB 4E0RA 2IMNA 5HHMD 5L9DH 3FOLB 1LD9A 1MHHB 3Q48A 4NRYA 5GRVL 4JANA 1BFTA 4G8FB 1P5VA 5A2IH 2P5WD 1KBGL 1AQKL 4P2RB 3MBXH 4MQ7B 4NM8H 4X6DA 5TE7L 3VW3L 2CK2A 5T3ZD 3QNYA 2ICEB 4B41A 5E8EA 5A3IC 3SN6N 1RFDL 3PWVA 4MNGA 1OWWA 3P9WB 4MD4B 4S10A 4H20H 4M1DH 4GAGH 4M8QA 2JJSC 1ZHBA 1KJMA 3L95A 2DQGL 4OLZL 5F71A 4D3CL 5I17B 4P2OA 1B4JH 1CD1A 1JGEA 1HKLL 4PV9B 1CE1L 2C9AA 3P4NB 4LVEA 1QFWH 4OLYL 3E0GA 4Q58C 4YPGA 2FYYA 4HG4J 3QBTB 5ACMA 4YGVA 4RZCA 2X05A 2HRPH 2JIXD 2X5PA 4JREB 1FH5L 2YD4A 1LEIB 5C6TL 5DD1L 4Y16C 5JW3L 2ZUWA 3CX2A 1PX3A 2R2HB 1R6VA 1MY7A 3MLUH 4LHUG 1FAIH 2X2YA 4X0KB 4IOSD 2XFXB 1A4JB 3KLHD 1AD9A 1LDPH 5HGGS 3NFSL 3BD3A 1PKQA 2BFVH 1DBML 5E9DE 3KR3L 3ULUH 3QA3B 1X4XA 3QJFB 3QUKA 1CLOL 3SCMD 3MRLB 4CN4A 1DQMH 3FO1B 1URLA 2E7BA 4P0DA 5EOCH 5T3ZE 2MKLC 4Q6IB 3ZKXC 3GNMH 1V3LA 3FQUB 3D0LB 3HLAB 3LPFA 3C6LC 4KROB 3O9WD 1XF4B 4XP1L 5C09D 4PR5A 3BD4A 2BHUA 3UCRA 4OFPA 1U8LA 5DJAA 1G6RB 4XCYB 5EOCL 3IDMB 5CIPH 2FGZA 4KPHH 2NY5H 2YA0A 4OZGE 1HXYA 1C1EL 2IBZY 3OXSA 3LKSB 1NAMH 2HTKC 2HFGH 3RWGB 2QHRL 2IWGA 3GB7B 2NW3B 4NKIH 1QFOA 5HHNB 1CZ8L 2R0ZH 5TF0A 4OV6F 2A0LD 1LO0L 2AEQH 5HHVH 3OKKA 5HHXL 4JM2C 2AI0L 3EOBA 5KSAA 3IDYC 1NKOA 4R2GC 3QIBB 4ESKA 4M43H 2B1HL 3MRDA 2J2ZA 2DQTL 3TWCH 1JUFA 2W65A 2G9HA 4F3FB 5C9JB 2OTWB 3DETD 4Y16A 3Q5YA 5C0IB 1KUMA 2ORBL 4F7PB 3ARBD 4WFEE 3HFML 3IAPA 3RA7H 3QFDA 2Q8BL 4OZFA 3TT3H 3RY4A 2ILLA 3VXMA 4QNPE 4U3HA 3BW9B 1Z9SA 3PJSA 1PFCA 3HN3A 3HCVA 4Z5RB 3VD4A 1P4LB 5HD8C 1DEEA 4XPTL 4LGPB 4F2MA 3WFBL 4KY1L 4BFBD 1T66C 1EEZB 2VL5B 5GGRY 2B0SH 3V4VH 5KSUB 1E4XH 3O9WB 1R3JB 5FUCC 3GBML 4P3CH 3ZTNH 1RK0B 3UEZA 1CF8L 4HJJH 1YEIH 5KVEH 2X4UA 3MCLH 1MVUB 1TETH 5LQBH 4R96B 2I24N 3ARXA 4MZ3A 1LK2A 3HAEH 3SJVE 1K3IA 1MEXH 4I4WB 4LRIA 3LKQB 1L7TH 2HG5A 2FLBT 4JFPA 4RISH 5CSBA 2BDNH 3V9FA 1CFQB 5F3HA 1LEKA 4PRAA 4KZEH 4NYLA 2NXYB 1GOHA 3PL6A 4U7MA 5D71H 4MNQD 5C0RH 2X9YA 1LEKB 4G8FA 4Z7UB 3C6LD 5EB9A 1FZOA 5TDNA 1FNEB 4LCYA 4E5XB 3R8QA 2WSKA 2D03L 5EH1A 4OCSL 4V1DA 2AI0H 4YAQA 1AKJA 3QXWA 1VFBA 2Y7QB 5BXFA 1AO7A 3KJ6H 4G42A 3X3GL 5EU5A 2GK0A 4GT7A 5JUEL 2HTKD 1LDSA 4PBVC 2BVTA 3VXPA 4YHZH 1JGVH 4AJ0A 2IMMA 3GSRA 2C3VB 2YD1A 1OP5H 3D1MC 5GZOD 1S7WB 4IMLB 2VL4A 3HCVB 1ITCA 3LKOA 5MEPA 4HX1B 2C7UA 4YDVA 2CDFB 1JPTL 5K9JH 3FQRB 1HHHB 2BSSB 3V6ZA 1S9VB 4D0DA 1R3KB 1TCRA 2CK0H 3OAZH 3X13A 2H45A 1BQSA 1JWSB 5J8OA 4UT7H 1F2XK 4LEXH 5FUZH 3RX5A 1KCLA 3FQRA 4RRPA 2R2HA 1XCQA 3BDBA 1R5IB 1HXMA 3OR6A 1RV6X 5C0DA 1ZHKA 1X44A 2BXZA 1YNKL 1TLKA 1A14L 2HLAA 2BNQD 1VHPA 1XR8B 5KOVC 1FIGH 1Q9KA 3UTSA 1CVSC 3L7FA 3SGKA 3AXLB 3IF1A 5F88B 1F11A 2XG4A 4UTAL 4X6FA 3N0PB 5J7CC 3MV7B 2NNAB 1YUHB 4NQXA 1CR9L 3BMVA 4JN2A 4XZUB 3V6OC 2GHWB 2R0WL 1A7NL 3MCKA 4C56B 3O3BB 4KK6C 1NMAL 3LV3B 3WXVH 1V8HA 1P9MC 2AEPL 1LO4H 3LCYA 3O6FB 4KV5E 2VKWA 4DVBB 3VXUE 3HNTH 1MCWM 5CKAA 2W59A 4WI7A 4NZRH 1I1AD 4UT9H 5ANMB 3GSUA 5JPNA 4EBQL 1GGIL 3RVXC 4ETQB 4L1HA 2A73A 1MQKH 1INQB 2X41A 4OZGF 5DHVH 3E6FB 3RPIA 3QXDA 2Z93A 3AREC 5KSVB 3THMH 2O61A 1LO2L 3O3EB 2O5ZH 5DYOA 3B43A 1WEJH 4CW1B 1NC4D 3MCKB 4IMLA 1CGWA 2W9EH 4NQSA 3H7BA 2W91A 4LHUA 5A1AA 2RR3A 1RZJL 2X70B 2DWDA 4OLXH 4PJ5D 1PX4A 5JDJA 2W1NA 2AJUL 4HWZA 1HWHB 4JFDD 3CZFA 1CLZH 3WIHL 1OGTB 3SE4C 3RWIB 2O5ZL 2E3VA 2OLDA 1KENL 4QXUH 1UQSA 1M7XA 1DQLH 3SKOA 4P2OD 1FYTE 4FFVD 3X3FH 4L4TA 3FCTB 4TSAL 3RGHA 3GHBL 1G7PB 3HPLB 1ZAGA 5GZOC 3BGMB 1TVBA 1U58B 2OL3A 4LMQI 4PJ7E 1JRHH 2FLRT 3F7YA 4OD2B 5DZLA 4A6YA 1UWGL 2NX5E 2XRAH 3F5WA 5ITBL 1J11A 4K94C 1L0XA 4YDLC 2CIKB 2R2EB 2CKBL 1LHZA 2Z31D 1ZLVK 1XR9B 1NEZG 5JXAH 4MDJA 5MI0C 4I8DA 2YBRB 4PJDB 1EHLH 1JNLH 3MXWL 3HC4L 1ZGLB 1A9BA 4P46A 5IMKA 2NYYC 1MFBL 4U33A 5TPWH 2FL5B 4OZ4B 5DRNB 3EO1A 4WUUB 1ZGLM 2WIIB 2V17L 1WQVT 4DOHE 1J0IA 2DJSA 2Y5TB 1M7DA 2B4CL 3FONB 3K74B 3SE8H 3P77A 5I1LB 3I6LE 2G5BA 1LNUA 3S3SA 3IB4A 4KAQH 1YJDH 4IRJA 3QI9D 4KPHL 3OSKA 5TE4L 2VDOL 4OFYA 1CD1B 2CK0L 3FHQA 3VJ6B 4DUXA 3DMMB 3P9LA 3LKNA 4BZYA 2EIBA 1S8DA 3QEQE 5C0AE 2FEEL 2F53A 5MHSD 2GSGB 3ARDB 3NGBC 2VLKA 4OZGB 1BVLB 4IRJD 3H9HA 2O5XL 5DK0B 1PLGL 4LARL 1A6TA 3MR9B 2E8YA 3BN3B 4HMDA 1OT1A 3MLYL 2VDOH 3BPCA 1T3FA 5D5ME 1CGXA 1Y6KR 2Z8VC 3HUJB 5CINL 3QPQD 3FTGA 1NGYB 3IU4H 2Q3ZA 4JGMA 3KPRB 3QQ4B 4QXTB 2QKIA 3GSXA 4E42B 4GG6A 4H5SA 4N8VB 3KJ4C 4WHCA 1N6UA 1MHHA 4NRYB 1HCVA 1OAZH 4XC1H 2I07B 3QFJA 4N5UA 2QQKL 4LCWA 1KC5L 1BQLH 2LV4A 1GGBL 4S1SH 3P0YH 3OR7A 2F58H 1QLEL 1E6JH 4XP9H 3R06B 2UWEB 4JFEE 2FH6A 1CT8A 3RWCA 3OB0H 4Z7OE 4O2CA 3MV9D 5FYJE 1AHWC 5B39B 5H35B 2VDRL 2CH8A 5KVDL 4GRMB 1KPRB 4PGZA 4KV5F 3V79C 5L2JA 4AG4L 1YEDA 2L7JA 4EJ1C 1DQJA 1P7QB 1AIFB 3ARED 3MACL 1FYTD 1HXYB 4DCQB 5D7KD 3BRDA 1TETL 1KG0A 2DQFB 2DQCL 5D1QD 3NN8A 3O3DB 1B6UA 4PGDA 1YC8A 1INEH 3EOBB 3A67L 3ZYIA 2Y36H 3KS0J 4UDTB 1K5NB 5K9OB 3RWEA 5DJCA 1IGFL 2EXWD 4TQEH 1S8DB 4MA1C 5DHYA 1NLBL 3QEQB 3ILQC 1UJTA 4U6VL 1KELL 1HDMA 5I16A 3KS0H 4XB8A 2YXMA 4P2OC 5EU7C 3MRMB 1FE8L 1R5WA 4N1EA 1C5DB 4XVSL 1WTLA 3RWHA 4LVOB 5BW7A 1RJZA 3AS3A 5L8LB 5F7KC 2FD6H 3VGGA 3RU8H 1PKQB 3SCMC 4JQXA 4FXGB 4OCSH 5D9SA 4B7LA 3FO9B 3V0VA 3I3EA 2APWA 4O51B 2QADC 3JSSA 4N8PA 2R0LL 1JGLH 1LP9E 5F7NC 4HUNB 2HT4C 1QA9B 1DDHA 1FLRH 4WEBH 4M1CD 2DYPA 5MERA 4HJ0C 1EHLL 4OI8A 4NZUL 3DVFA 4HK0B 3RUGE 1KSRA 7CGTA 4OFKA 3RI5F 3VWKD 3SJVA 5HPMB 3PWNA 1P1ZA 1SJHB 1CLCA 1MWAH 4ORZC 3HR5A 1KIPA 4JFOB 3FO0L 1Q72H 4RISL 2GY7B 4YBLC 4N0RA 1BBDL 2YOCA 2A74A 3RHWF 3FN0H 4KKBD 2Y23A 2M26A 2ZUUA 3SDXB 4NPYA 1JZ7A 2P8PA 3U0PA 4DEPC 5T5NG 1HIMH 1I9IH 1OQOA 2V7HB 1CBVH 3G6DH 1T04B 3O2DA 5EU3A 4QHLA 4NBXB 4APQA 3OAYH 3DVNB 1J7VR 4JCLA 4E41E 4Y19E 3FOMB 1BAFH 4ZPVB 4FABH 4K7FB 4PY8J 3V6OA 5CJQH 4X4XB 1MFCL 5CJ8A 4Y4FC 1OAYL 4MB3A 2NW3A 3UPRB 2HVJB 2APBA 3OHXB 4MMXC 4NT6B 3K2MC 1EGJA 3Q6GH 3TJHD 3SGEI 2AS5M 3LH2L 4OCLC 3BX7C 4G9FB 1BGXL 3BYYA 3OJVC 3ISWA 4Z7VB 5ESAA 5BO1H 4IOIA 1BD2D 5GS1B 4OAWA 2NCMA 4CJ1A 4OCMC 5JIIA 3JTTB 5AG9A 1ZVSB 3CK0L 1WWCA 4XPAH 1BZQK 4MD4A 3IFPB 3QIBD 1UGNA 1K4DB 4ETYA 4ELKB 1X5KA 5ACLA 5T1DH 5IF0B 3HTLX 4F7EA 1AH1A 4RGMC 3GMMB 4M7KH 2JB6B 5C3LD 4UDUB 5JXEC 4H8WL 5FYJU 1A6TB 4Q74A 3UTPE 1JTOA 5ABDE 1ZVHA 3T77A 4KDTA 2F5AH 4EQ2A 1EEZA 3J7HA 4GRWF 4U4BA 2FR4B 1VEOA 3ALXA 3FZUD 2F54A 2VITA 1HYRC 5C0BA 5I30L 4FQJL 1WFOA 4Y4KD 3QXTA 4XBPA 4NGHL 4L4VD 5FK9A 5GS3A 5I74C 3VXTB 3WHXB 4Z5RA 2YC1B 5FYKE 2DIAA 2VITB 4EUPH 2XZZA 3TM6A 3QUYA 3RZCC 4M93B 1NLBH 5D7KE 3SDCB 3UJTH 1O7SA 3QDJE 1OL0A 3FFCE 3OX8B 1H3XA 1AFVL 3G5XA 3RL1A 5J9PA 4H25B 2RAMA 5GS1C 4YDVB 1MOEA 2BSRA 1FNSH 4HKJA 1NH6A 3BE1L 4NQCB 5EIIA 1VKXA 5JR1H 5DEFB 4X7TA 1R5VB 3VXRB 4YHOH 4FQLH 1JWSA 4JG1L 1EJOH 4P5TA 3MXWH 2A73B 4HWEL 4RGNB 3ARUA 4ZNCD 5J6GA 2V7NB 1J05A 1RMFL 2C7UB 2Y7QA 3CX5J 2E27L 5JLZA 2NY4D 1D9KB 4KTDL 4S0SD 1U8JB 2IAMA 5E8OA 2VR9A 1XT5A 1JN6B 5KSAD 4KUZH 2DWEA 2IANE 4XZUA 3C09B 4HV8A 3MRBB 1AKJB 1PD6A 1I8KA 3WNKA 3EYFA 3NFNA 4NQVA 4HIIB 3O3AB 4JDVB 1UXWB 2CSPA 2HFGL 4GW5A 2XY1A 4U6HA 3MLZH 5SX4I 4D2NA 5HDLA 5KVEL 5EBMA 1KLUB 1ZXQA 4JPIA 4YX2L 1RIHH 2I60L 3WIHA 5C6WH 5ILTL 4MNGE 2WUBL 5BS0D 1WGOA 4C56E 3TPUA 3RKDC 5HDQH 4UOW1 4OUUB 5HI3D 5EBMB 4YC2C 4ERSH 3U6RA 3AM8C 4L8SB 2W0LA 5C0BE 5EOTB 1GGBH 4WHDA 3B9KC 4LLUA 3VG0H 1TVHA 1EFXD 4JAMA 1C12B 1VESA 3MLTA 5E8DH 2Z0BA 5DJAB 5GGSA 2PW2A 3H9ZA 4QHKJ 5GGTL 3BQUC 4PLNC 3GRWA 5DJDB 1JYVA 4JKPH 1L0YA 1CICA 3VFPB 4EI5C 3H7BB 4HLZH 5C0IA 2QSQA 3ZE0E 2NY3D 4XVJL 1NCWH 4WEMB 3DNKA 3EYSL 3QDME 1T4KA 4M6AA 4O02L 5CEXA 3LEYL 4P9MH 2P46B 1IRAY 3WUWG 4DQOL 4RWYL 2ZOKB 5I1KH 3AREA 5TF1H 2CDGA 4X7SL 5SWZB 3NCYP 4D8PB 1UCBL 4EN3D 3C08H 1RIUH 4JVPA 1Z9MA 3AB0B 2IPUK 2DAVA 4P5KA 5ICYB 3SPVA 5HTSA 4QHNB 3BMWA 1O7VA 4FQPA 4OFDA 2VE6B 3MXVL 3QXAB 4GSDL 3BP6A 3OF6A 2VUYA 3RZCD 2IH3A 5FYJH 4ZFZB 1KN2L 2DTMH 3U7WH 3E2HC 3B5TA 4DZ8A 4JPVL 4XGZB 5E2TL 1PQZA 5C2UB 3G9VA 3O8XB 3HG1D 2GTWA 2LU3A 5I1AA 1CQYA 3HI5L 1B0WA 2X70A 3BWUC 1A9BB 4L3EA 2H32H 5FGCE 4WVRA 1S7QB 35C8H 2HLAB 4U49A 5DFWH 5KJRH 1QSEA 3BDYL 3TP4A 3ULUL 2OR9L 1Q0XL 5C0GA 4MX7A 1IC4H 3LN4B 5EBLB 4LBEB 4LIQH 3GKWH 4DZBB 2QQQA 1C5CH 2WUCL 4AMKH 3CPLB 2HT4D 5FO9B 3ARVA 4P5TC 1FZMB 1L0QA 5JPMB 5JPNB 1AR1C 4DFIA 5HYSA 3VXNB 4GH7B 1NGYA 4PJ7F 4CADA 1QKZH 5B8CA 4JG0H 2BHYA 1Z3GH 1C08A 1OW0C 1I8IB 1FGVH 4NIKB 4MCYA 2A6JB 2CLVA 4JHBA 2I27N 4TNWK 1J0YA 4X9FA 5IB2B 3HG1A 2VZSA 4UUJB 2Y72A 1G9MC 1L6ZA 2XQBL 5CZKA 3TJHC 2YD2A 4RGNE 4NKMA 3IU4L 3SKMB 3TA3B 1U8MA 4XXDB 1RK1A 1MHEB 4FTVB 5GRYA 3VFOA 5SWZE 1ZLUK 2DTSA 4R90L 3VRLF 4GQ9H 1FIGL 4JKLA 3KWWA 2WNGA 5B38A 2VAJA 3GEWB 2XA8L 1FP5A 4HQQL 5F7HA 5ILTH 3QUZA 1FORH 1IGIL 2X4OB 5HVWA 2WQRA 4J3OC 2DIBA 4P2QA 5AUMA 4PJHA 4LCWB 1DVFD 2AKRB 4BZ1L 1T1YB 4RRPG 4YHML 3C8HA 5DFVD 4JCMA 2H2SC 1LP9B 4M8VA 3BIBX 1WZ1L 5I1HH 4B5EA 1JZ4A 1Q9KB 4CBPA 1HOCB 1S9VA 4WI4A 3MRLA 5FM8A 2NXZB 2VXQH 1WZKA 3H0TB 5FDWB 3WN5C 1E27B 4NNXB 1MRFL 5IJVA 3DGGB 4M6OH 1BECA 2FJFA 4I2XE 3WUZA 3BPCB 4NJ9H 3FQWA 4ORGB 1I1FA 2YD8A 2OI9C 1JNHB 4R3SB 3ULVH 5GISL 5I2IB 1BQLL 3MOBL 1U93A 3QEGL 2X4NA 1J1OL 5ESQA 4LLAA 1FZJA 2ZPKL 2Y07H 3HPLA 2W9DH 3RWGA 1RZ8B 1D5IL 3C60B 3GUTB 1NBVH 2DJ4A 5D2NC 1RY7B 1IEBA 2IAMD 4U1NB 4ZO8A 1UWEH 1EFXB 1IQDA 4YPGB 2H26A 2WWMC 3MNZA 5LGKA 5JIKA 2CRIA 4G6AD 5D96B 5DHXB 4LKXA 5L6YL 4YWGH 3MFFB 2NQCA 3UYPA 5D71L 2EDYA 5D1ZA 1YECL 3VFGL 1UXSB 2E5EA 5KSBF 5LBSH 4HS3B 5J6HA 5ELIA 1LVEA 1IGYA 2ZJSL 5L6YH 4CKVX 2YPLA 4OZGA 3I6KA 3OXRA 2DLGA 3BPLB 1P4IH 3GHEL 4Q9QH 5DF0A 3C6LB 5JIHA 1YEEL 2P7TB 1AC6A 2DMCA 5D6CA 4K71C 1F6FB 4D9QD 3B6SA 3BKYH 2E6PA 5BQ7B 5FYKH 1E4XI 3DBXB 1NC2B 5EDXA 4HWBH 4NC2B 5BVPH 2DQUL 3M8OL 1K8DB 3B4NA 3UZQA 1T89C 1R3HB 4NWTL 2VDMH 3DOSA 4FG6C 1S9YB 4AZ8A 4YR6A 3N85H 3WFHA 2MQCA 4K94H 5I74B 5KSAC 3TO4A 3JTSB 3FQNB 1PG7L 4NO2B 3VFWB 3CXHJ 4NBZB 2HFTA 1A3LH 4I2XA 4Z77A 4M7LT 1F58H 4OBRA 2VLLB 3IFPA 3LH2H 1NDMA 3U4EB 4MQ7A 3G5VA 1ZT4B 4WUUE 1L6XA 3T0XA 4HKZB 1LK3L 1ZT7B 1CBVL 3UROR 3BJLA 4UU9A 5F8RC 4F15C 5C92A 1PBYA 3CUPA 1IKFL 3SQBA 2OZ4A 1DN2A 1FFQA 4FXLA 2HJKA 3X14B 2HAZA 4PGDB 5CBEB 3C9NA 3VMNA 1VERA 2NY3C 1RUQH 4N9OB 2GCYB 4X6BA 5FECB 3MCLL 2WBJC 3ARBB 3U83A 3FB5B 3NIDE 4BQCA 1FYTA 3AB0C 1ZA3A 5CBAB 4M48H 4EXKA 5JLZB 1MF2H 4P49A 5GRWA 3S37H 1A4KB 2XA3A 5DZOA 5B4MC 1JN6A 3ULSB 2BOCB 3E1F1 4OCYL 1EUTA 1NCCL 4M7JL 2BVQA 3IDGB 1A1MB 3QJFA 1RU9H 3LEVH 5E8NB 5BV7C 1HZHL 5DD5H 3HZMB 3I02A 4AG4H 5C0NC 4LPUA 5DHYB 3T2QA 3V5DB 3P9MA 5FO7B 1U8QA 2ESVE 2L7UA 4QTHB 3U30C 1JPFA 4PS4L 4Z8FL 1VFAA 4I0PD 4P2CG 4O2EA 4QOKE 3CXHK 3V0WL 5IROC 3O9WC 2QKIB 3STZB 1D7FA 5K9QG 1HHGB 5KVFH 3S5LB 4GXVL 3BP7B 3QO1B 3TO4B 3JBG7 4OGXH 2V9QA 4YK4C 4EDXB 5I8OL 1AGCA 3DXAB 3ZT7A 4RDQG 2P5EA 3NZHL 4LVHC 1TJIL 1FE8H 3K1DA 4LSSL 4P5MB 5LKNA 1UZ6E 2Z91B 3D39D 3FRPG 3RKPA 5MENB 3IRPX 5I17A 3NCBB 5I19H 4U1LA 3ZHDA 2ARJB 3QQ9C 1NMCB 3T2OA 4JDZA 3THML 3EYVB 4XVTL 3NFSH 5ID0B 4NPYB 3NCEB 4XAKE 1MH5B 2XN9B 5DRXB 2C5DC 4L4VA 4Y19B 3C8KA 3TN0B 4ZAKD 4L9LB 3FN9A 3B9AA 3OJ2C 2LE9A 1E6OH 1MCPH 1CLYH 1CLOH 5EU7E 5MEQB 4QT5B 1UFUA 2ZUXA 5IESH 2YKLH 5TQ0L 2E7MA 4PGBA 1KCSL 3X17A 3O4LB 2B1AL 5J11C 4BFGA 1N4XH 2DD8H 4L9LC 2ARJA 1RUAL 3GJEB 4WUKL 3UDWC 1ZVSA 4YGAB 3U4BL 1JK8A 5C09A 2GK0B 1QFPA 1HSBB 4DKEL 4XP6H 3GSVB 4OM0L 5DFTA 5DRXA 3CDGA 4PBWD 3GSNH 2O5XH 4PY8I 3RUGB 5E6ID 3GMLB 1GJIA 1DSFL 3C60C 3FB5A 1YEHL 5CEYB 4LLMA 4XX1E 3JZ7A 4GLRH 4MAUH 3BP7A 4UIKL 3QEUB 2NX5B 3D25A 1QBMH 3AC0A 4J3WA 3IDNA 5C0ND 1CD0A 2OI9B 3PV6A 3NFPA 3IF1B 1KJ3H 3ZKND 5HYJD 3SGKC 3ETBF 2J8HA 2JTDA 3WBDA 4LLYA 3RWFA 3GSWB 4RWHA 4YZFF 2NXZC 3KYKL 4DUWA 3ZYJA 5HVHC 5D1QB 4PJBB 4GW5B 5FB8B 3ZKQD 1FAIL 4BELD 5HSFA 5JPMA 1YJDL 4HHAA 3QH3A 5AAMA 1L9NA 1IZJA 5IQ7L 4KGLA 4OZHF 5F1NA 3VFTB 3T3PF 5CILL 3VE0A 4UB0L 4JZJB 1VSCA 4G6FD 2F8XC 1MNUH 1UA6L 1GIGL 1S7WA 5JQHC 2PO6B 2R0WH 5T3XE 2M1KA 3RL2B 4XPGL 3LV3A 3ROLB 1I9EA 1WWAX 1EEYB