2NXYD

Hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
229
structure length
227
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 227
sequence length 229
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nxyD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nxyD01
3VFVB 4BQ9A 1CZ8H 1TCRB 3RRQA 1VFOA 5C0BE 3VRLF 4BSWA 3ILQC 3LDBB 2X4QA 4LCYA 3KPOA 3UEZA 2EIZB 1DQQA 5CUSH 1FFQA 1YEKH 1WBYA 1AJ7H 3P0GB 4Y2OA 3BP6B 5F9WC 4XPAL 4DK3A 5EC1B 1ADQL 4RWYH 2ERJC 5CP3H 5GPRA 4Z7VA 3WLWD 3NFNA 4WU7A 2CDFB 3DTXB 3EGSB 5LQBL 2FNBA 3CC5A 5E5RB 5BOPA 2NW3A 1YMME 4NQXB 1REIA 3UXFA 4EDXA 4NZUH 3SDYL 1LO3L 1VGEL 5C6TL 4HIHA 4Q9RH 3QRFM 1OL0A 1JV5B 3O6ML 4PD4J 4WEBL 2W0KA 4OCXH 1CCZA 1E4KA 3NABL 2FHBA 2ESVA 1TJGH 2CMRH 3SDXB 5DMGD 1HWGB 2FD6L 1UG9A 3HB3D 1EK3A 1XF2A 5I15H 1FLTX 1AHWC 1OP5K 1YEJL 4WHTA 5DJDA 1VEMA 2NY0C 3PWNA 3T77B 4WI9A 5TDPB 2JJTA 3PDDA 4PUBL 4HPYH 4L3ED 3HZYB 4UQ3A 5CD3A 3TJEH 1DBML 3L3DA 1G6RA 5I0DA 4TSCH 4NQEA 4WEBH 1I3GL 2PXYA 4CGTA 2CJUH 3VXSA 1IC4L 4V2BA 1U42A 3ARFB 5KJRH 2MMXA 2QSCH 3JBG7 4WGWB 1FYTE 3JTTB 1LVEA 5HYSA 4JZOB 4E41B 1A21A 4GMSH 3C09B 3SEPA 3UROR 5BRZA 1CFBA 4CVWA 2EKSB 1J0YA 4FQ2H 4JRXE 5DQDL 5ESAB 2P7TB 2EC9U 1I3GH 3C5JB 3HE6C 3T0BA 3GJEA 1R5WA 1OWRM 5D5MF 1U8KA 3MV7B 4M1DL 3ZYZA 3LD8C 5KSBE 1CK0L 5DD1H 4S1QL 5AEAA 4HD9A 2NMSA 2YD9A 3KR3L 1MHPH 1JBJA 4PRAB 2GAZA 4R26L 3GIZL 5T3XL 2GI7A 2PO6A 1P4IH 4L4TB 5DVOA 4HZAA 1OTUD 3WFBH 3DETC 3TJHC 4M5YH 3WNLA 1JFQL 4XVSL 1WUNT 2X4UB 2FL5A 3SGKA 5EO9A 3SGDI 4CRPA 5LJYH 5SWSB 3T0VA 5JTWA 1U3HD 2CKBL 4ZXBD 4JPKH 2BJMH 1JUFB 5GGRA 2W0FB 5CEXA 3ARBD 5JIPA 4F57H 3MLYL 4NQVB 4QRUA 5MEOA 4XMPH 4X4YA 5C9KA 5T3XH 5T1KA 3L5XH 4JO4L 5ADOL 2C4XA 2FO4B 1BQSA 2CDEA 2H9GA 1RJZA 2YEZA 1EGJL 3OHXA 1AI1L 3QHZH 4G9FB 4S10A 4PJEB 2HH0H 1KPVA 1P5VA 1T1ZB 3J8F7 3RGVC 4FABL 3FOMB 4G6KL 4HUUB 4UILL 2E9WA 2BHZA 3IU4H 3BKCL 1MI5D 4P57B 1FYTD 4R3SB 3BDBA 3MRMA 2YZ1A 4OZHF 5E9DE 5JW3H 3VXUE 3VXPA 3F6IA 4P59L 4XTRC 1B3JA 4X6CF 4KQ3L 4HWNA 2HKHH 2Q87A 2CR3A 4YGAB 4E5XA 4K3DH 4JZJC 3V95A 3QFJA 3LKRA 4AENA 4N1HB 5DSCA 1OF2A 4RFOL 3D3VA 3HN3A 3ROOB 3ZTJH 5J06A 3H7LA 1RZIB 1C16A 3G5ZA 4HWEL 4MJID 4PJGE 3GNMH 2PUQT 5GRYA 3VGFA 2UVFA 3C2AH 4DJMA 3PV6A 2DKUA 3U30B 3MA9L 1FFPB 4Z0BL 4Z7WF 2R1WA 4KK5C 3R0MA 3O2WL 2CRMA 1CBVL 3GBNL 4CVXB 3OKKA 1R3HA 1T83C 4OZGF 3VA6A 2ADFH 4RWHA 3KYOB 3MLXL 4RFOH 4J7RA 1B0RB 1C1EH 2EEBA 4FFVC 9CGTA 5EU5B 4HWEH 1A2YA 5IR1A 1CF8H 2VXQH 2HP4A 5MENE 1A6AB 4XP6H 2C7UB 1TNNA 3PGFH 1P9MA 4NO0D 3L3GA 1F4WL 4OGXL 3ES6B 4J3UA 4QHNA 3S34H 3N1PC 3AMLA 5D96C 4UZGA 3BN3B 3MBED 3L95A 4WUUD 1UXSA 5CP3A 1CDBA 3MOBH 3VWJB 1ZT4B 1JPTH 1BQLL 3EOBA 2VLJA 4CDGC 2EYSA 4BM7A 2IH1A 1U8HA 5J8OA 4JCMA 4FQJH 4LSTH 2V7NA 5HHPA 3DX7B 4JFQA 4X99B 3RWHB 5TDOB 4G80B 5IB4A 2MQ0A 5EIVA 5D72H 5DTFA 3KLAB 3CXHK 2G60L 1F4WH 2CXKA 1B4RA 3TA3A 5F7DB 1LHZA 2FEEI 4MB5A 3OKNB 5EBWA 3IDXH 1DQLL 5ESQA 3W82A 1IBGH 1RHHA 4M8QA 3PL6B 5IMMA 2VDMH 1RULL 1AGBA 3CFEB 4NN5C 3OPZL 4JQIL 1DBJL 2X4OB 5F6HI 1U8JA 2BNQD 4H1LB 2L7UA 3X14A 3QCUL 4MDIA 1Q1JH 3P4NA 1MFCH 5AUMA 1L0YA 2YR3A 1T22B 3EFFB 5L2KB 3W11D 5HYJD 5IOPA 4FFYL 3QEQB 2Q76B 3T2NH 4PLJC 1FFRA 5AYQA 4TVPH 3U48A 3NPSC 3QDGB 5T1LD 4U2ZA 3E6FA 4NUJA 1OAKH 1S7QB 3ZE0E 1RULH 4KUZH 3REVA 4URTB 1IEBA 1D6VH 1DBJH 4PJIE 4PP1D 4HS3A 5L88L 1VKXA 4PJCF 5E2TL 3QB7C 1X6LA 5JLZA 4HKJB 1FVCB 5C0DA 1VFMA 4RIRB 4O2EA 3PP3K 4MQTB 2C1PB 5GS2H 1KELL 1PLGL 1L7IL 1XF5A 3MV8B 2XFXA 3NACL 4QTIL 1QP1A 5HVHB 4IRSD 4D9LL 2OJZL 4X6BB 5CFHA 3BZEA 4MCYA 4KRPD 3QEGL 1B0GB 2NY2B 4I18A 1KBGH 1CL7H 2QHRH 4FQQB 5CP7B 2GJZB 1INDH 3OKEB 3LS5H 1S9XA 5DEFB 2AABL 4KVCH 3STZB 1VFUA 1U8OA 1LDPL 4G6MH 1PQZA 2YC1B 5DDHA 4XH2B 4GRWB 1LO2L 5C0JA 2A6IB 3QXAA 3HRZA 4ZOBA 4ELKA 2D4DA 2VIRB 2V2TB 1D5XB 2EDBA 2HAZA 4R96A 3UCRA 2W9EH 5T1DL 2NR6C 2NYYD 3QNZA 4ZTPH 1DEDA 2VZSA 2DQFB 1FBIL 4HC1L 3VJ6B 5EWIL 1NDMB 2X4PB 2F54D 4KDWA 1H9VA 5T3ZE 3S6CA 2Y23A 1BD2B 3T0WA 1LO2H 1ND0A 3DHJA 3HR5A 5IB1A 3QPQD 5L8LB 2X1QA 1ZXQA 5JPNB 1J05A 5IVXA 5J11C 3QQ4B 1UXWB 1IGML 1BGXH 1DQMH 3LY6A 1YN6B 3GSOB 4AIZB 3WFEH 1PFCA 2ICEA 1C7SA 4APQC 5GGVL 3RDTA 3SE9L 2GITA 2P46B 4G43B 2YN5A 3RWJB 4H8WC 4U6YA 3LKNB 3CH1A 4XCNB 2Z31D 1CICA 3FONB 3FQUB 5C1MB 2OR9H 2A0LD 4N8CH 4GXVH 1IGMH 2BERA 4XVJH 1BIHA 1QLRB 1WAAA 1JWMA 1TQCC 3KGRA 4X6DE 1WICA 2EC9T 5DUPL 4B7IA 3SKOA 1HH6A 4AQ1B 3EKCA 3G6DH 2D2OA 2AJZA 4U1LA 1ZA6B 5KSBF 1IM3A 1RFDH 4U7SA 3RWDA 1T4KB 4LARL 5MP6H 3DUUB 1A3RH 3AMKA 4U05A 1T0NB 2J8HA 3Q6FB 4QOKD 3DSNA 3TV3L 3VRJB 5CAYB 3QWOA 3KYMA 1QBLL 1DEEA 4ONHB 1CN4A 3IKKA 3A67L 5ADPL 4MJ5A 4U1SB 2V17L 3UX9B 4GBXB 3L9RA 1QEWB 4HFUL 1PZ5A 1F11A 3MXVH 4D9RD 5A16A 3P11L 1QSFB 1A64A 1O5DT 3HAEH 2VH5L 4YDLB 4Y19B 3NMEA 3KPMA 1NGZB 1R3KA 2Z35B 4OD1L 3GEWB 3B9KC 1AR1D 4IMKA 2EDRA 1IARB 4JGUA 4M93C 4X9HA 4R90H 3TV3H 4HAGA 3UBXA 3VFPA 3GIVB 5FGCE 1WIUA 3O4LD 4XNQA 2X4NB 4H0IA 5ADPH 5EBLB 2UYLB 1FNGB 3LHPL 1NFKA 3BFOA 4HMDA 2X1XR 1RZ8B 3BPCB 4EIGB 4OZIE 2DQTL 3QIUC 4WNQB 1A6TA 3V6OC 4R0LB 4V1DD 2CDGB 1VPOL 2EH8H 4XC3L 5DWUH 2FBJL 3W2DH 4WFGE 5EOTB 4D0CA 3WJJC 3PXJA 4OD1H 4Y4KD 3LQMA 4NUGL 1I8KA 3M45A 1RK1B 3CMGA 4S1RH 1AD0B 1Y0LB 1LP9F 3O8XD 5CILH 5L8JB 3B5HA 3MRNA 4U0RB 1LEKA 4ZMAT 1B2WH 1JZ4A 3MZTA 3G6AA 3DBXA 2X4QB 3W5NA 4PJ5A 4K94L 3F62A 4P23A 1VHPA 4EUPB 1DQQB 1VPOH 5IM7B 4AH2A 1PZUB 3MRKA 1WBYB 1AGDB 2ZCLL 3IDIB 4P46B 4BZ2L 4PJGF 2OLDA 3ELAT 5BV7L 1TTGA 2W38A 1HQ4A 1HXYA 3MOAH 3WUWA 1KCRL 3V0VA 3HE7C 5C0GA 32C2B 4MD4B 3ILPA 1NFIB 2IAMA 4EDXB 4P4RB 2VR9A 1FC2D 1CD0A 5HHOD 3WE6B 4YO0B 3U0TA 5TQ0L 3B2UD 3VFTA 1BQHB 1RIUH 4ZUTA 3FFCA 3G04B 2ZP0T 1MRDL 1QLEL 3SKJH 5FDWA 3WNKA 2ESVB 3ORJA 3FTGA 4OZFB 2FIKA 4CN1A 5DUBA 1XF2B 3BQUB 4IOFC 1CT8A 4NDMA 4PBXA 4G7VL 5IFHH 4HXBL 1LO4H 1WJ3A 4PRBB 2HVJA 3PWNB 1TTFA 1Z0MA 3VXMA 5IVZA 2FX7L 2VYRE 4Y1AB 1QBBA 4K3EL 1MRDH 5IUSA 4OIIL 1FORL 1QLEH 4U6HA 5F7HA 1WFNA 2VLRB 1PG7L 2YD1A 3S3PA 4CVUA 5GZNC 3CU7A 3FO1B 1N0XH 5CEYA 3VD4A 1RUPL 4KHTH 2ADGA 4UUJA 3LN9A 3ZYJA 5F3HA 4QY8A 4ZSOB 4JO3L 5AZ2H 3GSQB 3KPLA 1EEZA 3MFFB 1I7ZA 5KSVB 5CINH 1QTYT 2B39A 2H45A 3UJTH 3V7AG 2I07A 3WHXA 5CCKH 3WNPA 5CLTA 1DJSA 1R3IL 2C3VA 3H9HA 1U8KB 2VXTL 2WZPD 3TIEB 4EVNB 3RTQA 2UY7A 3TYGL 5CEZD 3DV6A 5FYKE 2GAZB 4YBLB 4Z77A 1A7QH 3C87A 3RL1B 3GUTB 5K9OA 2BMKA 3D0LA 4K7FB 4JO3H 3VH8G 1GVIA 4Y5VB 5DRWA 3DYOA 3QUMH 5DA0B 3O0RH 1NC4B 3EJZC 2ADJA 4RGNC 2FL5B 3G6JA 4J3WA 3CIQA 1J1XH 3ZE0F 1OLZA 5CJBA 1A4KA 3MZGB 5DR5L 3D2UA 4PJIF 1G9NL 5CIPB 4UV7L 5B3NA 1MRCL 3MLVH 4QRUB 4KMTL 4FQ1H 4R2GC 2BY2A 3TYGH 5C0EB 3DOSA 5HXMA 4WWID 3MNVA 3UP1A 5T1KB 4FP8L 1H3PL 2XACC 1AKJA 2F53D 5C2BL 2CDEB 1X4ZA 2H9GB 2EXYD 4CMHC 1SM3H 3OHXB 2EKJA 3AGVA 4M00A 3GSUB 1GZPA 1EHNA 3WS3A 2WP3O 3DURA 1IM9D 4JFOB 2YPLB 2BNUA 3KJ6H 2XWJB 5IHLB 2O5XL 2IALA 3OB0H 4UBDC 4QWWC 4KQ4H 4NKMA 1MRCH 4KHXH 4PG2A 3UPCA 3MRMB 2B1AL 5GJSH 1A02N 1IFHL 3SKNA 5EBMA 2DWEB 4FP8H 2DQCL 4P3DB 3WNMA 35C8L 1XGQA 2IPKB 3HAEA 4QRPE 4RDQF 2WBJB 1AFVH 2NZ9C 4OGAC 4I0PB 2Y06H 3S4SB 3QDMA 4AENB 5FIEA 2E8YA 1T20B 3OKMA 2O5XH 5D2NA 3D3VB 3KS0J 4LPTA 1P53A 1A6WL 1AC6A 1GZQB 3OAYH 1BX2A 5E2WH 1QFOA 1XCTA 1C16B 1UJ3C 1S78D 2GJ6D 3RWGA 3TBYA 3WKML 1MCQA 2VTFA 2B1AH 1NCUA 1C5BH 2F8OA 4HHAB 3GI9L 2JCCE 2DQCH 4JRWA 2R1WB 3MRIA 1AD9A 1AQKH 35C8H 4RMQA 4YNYA 4MA7L 4MB3A 4JO2H 3OKKB 1R3HB 3C6LA 1S7XB 1TFHA 4NHUA 4YDVB 4LHUB 4UOW0 3JWDL 1LE5B 4LLVB 3ZLQC 2NY3D 2R2HB 2R2BA 4PJ8B 3BEWB 1A2YB 3WKMH 1BFVL 3SBWA 5INDB 4CDHA 1N6UA 4OM1H 5J13C 2HKFL 4U1GB 3VA2C 4PRPE 3E8UH 4JFYB 3ARVA 5DQJA 4X7TA 3RIAK 1CLZH 1X5IA 1N3NB 4ONGL 1S3KH 3QIWD 3ULVF 3WLWC 2CRYA 2OM5A 3REWA 1RPQA 2BY1A 4KJPC 3L95B 3JWDH 4ZUUA 1I85A 3T1FA 5JA9A 4U4BA 3PWUA 2GY5A 3I9GH 4AEIL 5EA0H 5F89B 1SBSH 3GHBL 5DJXA 4JKLA 1U8HB 2BDNH 1K6QL 2PF6A 5IFJA 4WV1A 3L1OH 5HHPB 2V7NB 3HG1A 1U2CA 2FBOJ 5MERB 2X89D 4M61B 4OFIA 4L3EA 5IB4B 2ORBH 2YD8A 1IQWL 5ICXA 3T3PF 5DFTA 3UYRL 2OR8A 5E1HB 1J1OH 3KDMB 4PJXA 2WUCH 3RWIA 1CE1H 2F15A 2GSIA 3SGJA 3Q1SH 2R39A 1QR1A 4UB0H 3K74B 4M8QB 1MY5A 5BQ7A 5FAAA 5FV2A 5FO9A 2J1KA 2AJ3A 2VITB 1KJ2H 2VQUA 4CVZA 3ARUA 4N68A 1IC1A 2ITDA 4MDIB 4YHYB 3P4NB 4JN2A 4UAOC 4XCYA 3UYRH 3OAZH 2WLZA 1LNUA 4XHJD 1S9KC 4OZIF 1CU4L 1RK0B 5E6YA 2DM4A 3AS1A 3VXRE 4QHLA 2WQ8A 1JZ3A 1Q9OA 5C0RH 5A3ID 3E2HB 3Q6GL 4J3TA 3L7FB 4XRCA 4XNYL 4ENEC 2AVGA 5F7KC 4XMKL 4MZ2A 3CX2A 2NX5A 4NNPH 4POUB 4LVOB 4TUKH 3KPQB 1XF5B 3GBML 1J0JA 2MPAL 1U3HA 4ZXBA 4O2FA 1S9WA 2Y36H 5L7XH 3ARBA 4JHWH 4KJQC 4MCYB 1TJIL 4N0FA 1T21B 1F58L 4NO3B 1MCHA 4HUKB 5DJCA 4WUKL 2P8LA 2R0WL 2NY6B 4DUWA 5SX4H 5IEHB 1BAFH 3U2SB 2DJ4A 4N5EC 1IC7L 2V6HA 3IDJB 3AS2A 3LPFA 3LQAC 3QUMA 4Q9QH 2AJVH 1PQZB 2ZNXA 4JM2F 4GFTB 4NQDE 5GRJL 5C0JB 3K3QA 3HRZB 5E00A 4R8WH 1X6NA 4OT1H 1MI5A 1W0VA 1NBZA 4L3CB 3QUZC 5C0CE 1EHLH 3O3AA 4YWGH 3B9EA 4LVEA 1MCEA 1MJUL 2O93L 3QNZB 1W0YT 1A6VL 1KIUA 4BKLB 4FFZH 2P44B 4WW2B 3EYQD 4Q9CA 2DQEH 4U7KA 1X5JA 5DMIH 4WI8A 4XWOD 4FXGB 1SYVA 1G7QB 4KDTC 1ZLVH 1M7IB 1TPXB 2CKBB 4LCIH 4LLWA 4P2RE 5IVXB 4F15B 2KQNA 2KKQA 1D5MA 3EYVA 3MRFB 3ROLB 3MCLH 4MJIA 3U4BL 4M6ML 1I9JH 3U7WH 5LCVL 3U4EA 3RQ3A 5TE6L 4B7LA 5C71A 4TNWF 1GJIA 2VLKE 4JN1H 1RJYA 3MCKB 1MJ7L 5EZOH 1FVDB 1WBZB 3B8YA 5E6IB 2W1NA 3CH1B 4ETYA 4DUVA 1CDCA 1JRHI 4UDUB 4LMQI 5J0BA 4NP4H 4L5FL 4GRLB 4XNZB 4JZNB 3TNMB 2YXFA 3SE3A 3BD3A 3UTTD 3ZE2E 1NPUA 2IMNA 4M6MH 4YX2H 2L7JA 1JF1A 1I7TB 4JGMA 5EO1B 4OLUL 4ODWB 2OBGA 2P5WE 1RZJH 2AJZB 2X2YA 3RY5A 2XZQH 4U1LB 5I17A 1K9TA 1FZKB 3SQBA 3MBXH 5DC9B 1QHOA 5FYLH 2I9LB 4M43H 4HWBH 1Y18B 3C5SA 3RJQB 1T1XB 4N8VA 4UINH 3KYMB 3MBEA 1JPFB 3K4AA 4KGLA 4NSKB 1FAIL 4WUUA 4D8PA 4D2NA 2ZG2A 5A2KH 4LMQE 4OCYH 5C0CD 4I77L 1T7ZA 1A7BA 1LD9A 1OAZL 4XBPA 2R23A 4ALAH 3INUL 5ILTH 3OAUH 2CGRL 4PJFE 4LVNB 5I1LA 4LLMA 3K4ZA 1S7UB 4GS7B 4YUEH 3LKOB 5E8EA 2DS4A 1OGAB 5SWZB 4ZAKC 2APVA 2DMKA 2MHAA 4Q6IA 5HYSG 1MWAH 2JJSA 3OAZK 4Y5XB 3VI3E 3UBXB 5F70A 5HJ3B 5FM5M 4MNGE 3KPRD 4XNQB 1MFEH 1TCMA 5F7MC 2IEPA 5EC2A 3IRPX 3CJJA 3O9WD 3OXSB 4P2RD 2MKLC 4UU9A 1KTKE 4MGXA 2HJFA 3OF6D 5DUML 3D18A 4P4KB 1BZQK 2CGRH 2BNQA 4GQ9H 4Y16C 3MACH 4JQVC 3UDWC 1KCKA 4X6EA 3DVGB 3CDYA 3DRQA 3QWQB 2J6EA 1XCQA 5EUKA 3QG6A 4KK9C 1I7RA 1LGVA 1U91B 5D6DA 5HYJA 3SDAB 3F7VA 2UWEA 4KDVA 1H0DA 3LEXA 3MLTA 3FQRA 4RBPK 5CHNB 3OX8A 1DANU 2QADD 1IAII 1FQ9C 2KUTA 1IGIH 3MV9D 1MAML 2O5ZH 4LSSH 3BIAX 3QQ9D 4GAGH 3WN5B 2RR3A 3MRBB 4M62L 4UV4H 3MRHB 4XP5L 4JQXA 3F65A 3G6AB 3D9AL 5CKGA 2NY5H 4YXKL 3IFOA 4R4FL 4WJ5A 4NRXB 4OGZA 1KJ2A 5TFSL 3W11C 5LVEA 3ARED 4P23B 4P5KA 2X40A 3FT2A 1CGYA 4XWGL 4HKBA 4OCSL 5C08E 4PGEA 4PS4L 4TPRL 3O6LL 5CJQH 3P0YL 1ZLSH 4JVPA 3O2DL 3OZ9L 3KJ4C 3P30L 4PGCA 5EOQL 4IRSA 5ETUA 3UJJH 4MJ6B 3AROA 1PKQA 5C0GB 1YNKL 3NZ8A 4TQEL 1ZKAA 2HT4D 3IJHA 1RAMA 1NGXA 5L9DL 3D9AH 3T4AB 5AYUH 4Z9KB 4YXKH 3GMQB 1CDIA 3ARDD 3BYTA 3E1F1 5DD5L 4WO4D 3X13A 2DAVA 5D1XC 5DVLA 3PDOB 1QSVA 1D5ZA 3ZTNL 3P0YH 3ZYOA 4HJJH 4J23A 4Q6YA 2ZUWA 3O2DH 5J6GA 12E8H 1P6AB 4LCCB 2ZUSA 2DQGL 3L3HA 4X4XB 2YPVL 1RVFL 2FIKB 3QDJB 2A73B 2VZTA 2P5EB 4MNQE 4JJHA 4FNLH 5D9SA 3JV6B 2W9DL 1J1PH 2HVJB 5TE7H 3KHOA 2DTMH 3QH3B 5IK3B 1WFTA 4XP4L 2IPUG 3KPSD 5DK2A 1YUHA 3HZKA 4KV5F 2F54A 2NXZD 1OT1A 4Z95H 1CDJA 5FCSH 3TFKC 5A40E 4OKVA 4BFIA 5KVFL 4FXLA 2YPVH 1D9KA 1I8LC 2P24A 4ODSL 5CEZH 3FRUA 4GKZA 5KSAB 1S5HA 2D31B 3D85D 4POZC 3RP1A 2YD3A 1C5CH 4KTEH 3FN0L 4JR9L 1U8IA 2W92A 4RFNB 1WK0A 4HCRH 3UZQA 3KPLB 4KGJA 4X6FB 3SCMB 1S7VA 4F7TA 1P4LB 5HHMD 1N5AB 2H8PB 2XN9D 5E8PB 5IBLC 2VZ1A 1C12A 2VL5A 1NAML 4X5WA 2XY1A 4YK4C 3SO3B 4H26A 4QEGA 1DE4B 1BBDH 3RVWC 5KAQG 4P2QE 2Z31A 2C3VB 3V6ZA 3WEXB 1H3GA 2QQQA 5JUEH 1OOAA 1CI5A 2PYEA 4LLUA 3OGCB 2DQJH 5BMFH 3FN0H 1FLRL 1FV1B 4P2OC 3DRTA 2BMKB 1WZLA 3OKOB 5KSUA 3UTPE 1MIEL 5D7JC 1TIUA 2YD4A 2FGWL 2BSSB 5J7CC 4Y2DC 1I1YA 1MCWW 2VLMD 4WEUD 4WI7A 2AXJA 5I2IA 4GKSA 5C8JB 2YA2A 4HDIB 3PUCA 1SY6L 5DK0A 3HMWL 1S8DA 3EOTH 3MNVB 3PDGA 1FLRH 3WYRA 3OWEA 1N6QH 5TF0A 3QXUA 4QHMB 2JK5A 5IESH 2A6JA 4Y4HD 1KJMB 3O6FC 4FQCH 3PABB 2Y07L 1BM3L 1ES0A 4HWBA 1UM4H 3DURB 1A9BA 4XP1H 2BNUB 3V0WL 1BVLA 3GZKA 1HDMB 1N8ZA 3O4LA 3ZHDA 1BJ1J 1S7RA 3P77A 4Y8AA 1QFWI 2IPUK 4U33A 5EBMB 4OQTA 1WFOA 4H8WL 4M7JH 2W9LA 3EJYC 3QUXC 2GUOA 4U6TA 1LK2B 4V1DA 2X42A 3NCCB 4RZCB 5JQ6H 4Y4KA 5CWSA 1QFWM 1F6LL 1DN2A 1MWAA 5D2NB 5D2LE 1JTTA 3I3EA 3RNKB 2HTLC 3WMSA 4Z7UA 2GEEA 2VR5A 3C5ZC 4X4ZA 4F37F 1VADA 5C09D 3LN5A 3H9SE 2IQ9H 4GT7A 1AD9B 3M8OH 1XF4A 3R1GH 4MAYA 3C6LB 2JJUA 4W68A 3LKSA 2FLBT 3RVUD 4D3CH 1ZGLM 1KPUA 4LF3B 2OP4L 4DK6A 2X70A 3I3BA 3VW3L 2RBLA 2ED8A 2G5RA 3QO0A 4N0CC 3S36X 2R15A 4HS8L 1BFOB 3UJIL 5HHOA 4WDIA 4HK0A 5IV2B 4BH7A 2ZJSH 3RL2A 1NEUA 5AAWA 3TO4C 4WCYH 3EHBD 1CGTA 3P9LB 1A1MA 3ZE2F 1HI6B 5I9QB 5TQ2L 2IQAB 4NO5B 1CD8A 4HUXA 3SDCD 2YS4A 3TPUB 3VW3H 3PWUB 4JDTL 1GOFA 2ZCKL 3FCTB 2DBLL 1RJLA 3VG0H 1ZWIB 4JFED 3B2UC 5DJXB 2DI7A 3RVVC 3MXWH 2PW1B 4B41A 1FSKC 1JNNL 3HG1B 1E28B 4N0YL 2P42B 5HDQL 1XIWD 5GSVA 3ECBB 3X3FL 4X9IA 4KH2A 1O7VA 2PTTB 1KFAL 3RWIB 3JV5A 5BV7B 2J88H 1G9MC 3U6RA 2CLRA 4UIMB 3SHSA 4HGWA 5C7XH 4K2UL 4JVWA 5CLWA 2AJ3B 4M9PA 2Y72A 3AM8C 5HGAB 1EHXA 4N90D 1F3JB 2LFGA 3GHEL 2XA8L 4K7PL 5BZDB 3O41B 4R7NB 1HZHL 1IL1A 1H3WM 4HJGB 4JO1H 2I9TB 1URLA 1G6VK 1EO8L 2G75B 1S9VA 2EYTB 4Z8FL 1OGTA 5J9PA 3VG9B 4G8EA 3ZTJG 1A4JB 5C07E 1P6FA 2VSCA 1IGTA 3OJDA 4G6AC 1HHKB 4QHLB 2A83A 4M6NL 4FZ8L 4IDJL 4UOJA 3WD5L 2FHCA 3BGFC 2XA3A 5IBTH 1Q9OB 4G8FB 3ULUE 1X4XA 2CQVA 4NM4L 1F4HA 4GUPA 5D1QD 2HVKA 1NGYA 4KFZC 1CFNB 4XRCB 1JCKA 3TM6A 2HT3D 4HKXB 1OSPH 4K7PH 4HCRA 4QRRE 3TO2A 1DANT 2WUBL 4H5SA 2NX5B 1ORQB 4Z8FH 4K7PY 1T5XB 5T1MB 4S1DC 4YHIB 1HWHB 2EE6A 2FSEA 2ICWB 2Z8SA 4NWTL 4JM2C 4F9PA 3VRIB 1FVEA 4GAJL 4IDJH 5DQ9B 5BS0D 2EZ0D 4N0FB 1CFSB 1NLBL 3NIDE 1XGYH 3HR6A 4UMGA 5DJCB 5F9DC 3BE1H 2P8LB 3IXAB 2VB5A 4Z7QE 1J8HE 1ZHNB 2F53A 3IB4A 3D39E 1FPTH 2A77H 5ECJE 5HGGS 5IF0B 5ERWB 2SEBA 4FTVA 5FYJD 5BXFB 1IM9A 1KJVB 1QRKA 1KJ3H 3GI8L 3H0TA 1NBZB 5FF6A 4GAJH 5J3HD 5F7LB 3D1MC 2DIAA 5GGQL 1GL4B 2VUYA 2EXYC 4QRQB 1BFTA 2DICA 5F96L 4J6RL 4L4VD 4KKBC 3NGBC 4H25A 4HXAL 3JSSA 3K4DA 5SWQA 5D7LD 5JDSA 4OV5B 4LSPL 2EDLA 4F58L 5GS0C 2X1WL 2YD5A 2C9AA 3GB7A 3VCLB 3QI9B 4LLWB 3GI8H 3AY4A 2R0ZH 1H15B 1D5MB 3EYVB 1U92B 1FNAA 4JREB 4UT6H 2FR4B 2GJ6A 3QNYB 5JW5A 1FGNL 2OTUA 2DD8L 3KLDA 4NJAL 4K8RD 1NCWH 2IFFH 3IFLH 3VGBA 3D25A 3H9YA 3U4EB 4CW1B 1RD6A 3QQ3B 5D1ZA 4HXAH 2V2WB 1QO3A 1MNUH 3MRCB 3MYJA 3QNXB 4ZQKA 3WUWG 1G7PB 4W6YB 3DGGA 5E94B 4LKXA 1XR9A 4K3JH 1NMCC 3V4VL 4X7CC 5EUOE 3PQYE 1FGNH 1W0WA 2MSPA 4L9LB 2JJWA 2BRRH 3QXDA 5CGYD 4DTGH 4ZFFA 3CH8A 4QF1A 4G8GD 3D39D 4QXGL 3VWKB 1CG9B 3CMOH 2NY4D 2VXSL 1F4AA 3I85A 3QIWA 3C5SB 3WO4B 1UB5B 1OAUL 3ZT5A 5I8KH 4D8PB 4NRZA 5JHDD 5FHBL 5T33H 3O11B 5HY9B 2O61B 5E08H 1I4FA 4X5XA 2GCYA 1LD9B 4YDIH 4BK4A 1RY7B 5I1LB 4OBRA 1VESA 3KNBB 3SJVB 4HIXL 1J12A 1GPOH 2X89A 1R0AH 5GRVK 1JGLL 1V3MA 1UM6L 2YBRA 1SVZA 4ORZC 4IEFB 4UT9H 3RY6C 4X7FC 4KKAD 1JWUB 5JIHA 3VXOA 4WWKB 4F7CB 4WFFE 5CZVL 1B0WA 4YBQD 5D7KE 1VACB 1MLCA 5L2JB 1H8NA 3C8KA 4GW5B 3JWNC 4Y5YC 2CLVB 2J5LB 3CXDH 5KTEH 5GZOD 2GSGA 4X6EB 4ZFZB 5GRZA 4XT1C 1A1NB 3DIFA 4HLZG 1MH5A 4C4KO 4UNVA 4P2CG 2UWEB 3LEXB 4KU1A 3OX8B 4P5TC 5CJXC 3WIFB 4EQ2A 4AG4H 1YPZE 1ZVSB 2YD2A 4ZTOH 4JG0L 2R0KH 3TH4T 3UPRB 2EXWD 3IFOB 4WJ5B 4KROC 1Q0XH 3IJYB 2Q1EA 3ESVF 4JJ5A 1ODAA 4P5KB 3FT2B 3ZDXE 4KXZI 1RZFH 3UTSA 1KN2H 2Z91A 4P9ML 4HBCH 3HRPA 3FOLB 3KYNB 4QXUL 2FB4H 2ZNWA 3ARFD 3VD7A 5IVOA 3L6FA 5BW7A 2FJHB 1JNHA 2X4TB 2FECL 5ETUB 1PKQB 5JXEC 2PTVA 1CQKA 4E41D 3S3JA 1JHLL 1EEYA 2KQMA 4NCDA 3B83A 5DI8B 1Q94B 2X10A 4TRPH 4IS6B 2LTQC 3IJSA 3O45A 4LHQB 3UTZB 5F9WB 3RBSA 2BY3A 2WIMA 5I6XC 4XCCL 1XFPA 3SE4C 2BCKA 1CR9L 3T0EE 5DJ2B 4LQFL 3FO9B 3FAWA 5J6GB 4QXUH 4AT6A 1OPGL 3MV7D 3K2UH 5B38A 2GTWA 1ZT7B 5IQ9B 3HAEG 3O3EB 3VFRB 4IIQC 2H1PH 3LCYA 3CX5K 3BT2L 4FZEL 3TF7C 1SYSA 5DJAA 4L4TD 3Q5TA 4DQOH 3HZKB 1N2RA 2XV6B 1GHFL 5DEGB 3ULSB 5A2IH 1KN4H 5SWSD 2WBKA 1AHWB 3JV4A 5F1OB 4O51B 3V7AE 1DQTA 1F90H 1V3JA 4KI1A 3WFHA 1D9KB 2P24B 2GTZB 5D70H 3RUGB 3S96B 5I1AA 3PV7A 3ARZA 2DIBA 3V4UL 1NFDB 4LKCA 4LOUC 3SGEH 1GC1C 4JFFA 1FL6A 1NH6A 4G9FD 4X5WB 4LQ1A 4PJBB 5IT2L 4ZNEA 3ZKMD 1AGFA 1CLOL 1HXMA 3MUJA 3V6ZB 3W9DB 1JYVA 4NC1E 4QHKJ 1UWEH 1UQSA 1OP9A 4AM0B 4S1SL 4KJYA 3BPLB 1JNJA 2PYEB 4XNUL 4LLUB 5F72S 3UTTA 4OQ1A 3WHE1 2D4FA 1P4BL 3LQAL 1L0QA 5ISZB 3DRTB 4QYOB 5KSUB 2R4RH 1F2QA 3O2VH 3VFNB 4I5BA 3HE6B 2NY7H 3ME0A 2H3NB 3IDGB 1G7MA 3RPIA 1I1YB 3LD8B 3LV3B 5IT2H 1H5BA 2CPCA 1Q0YL 2HFGH 4M1GL 3BDYH 4PRIA 2NXYC 4UNUA 4AQOA 1Q9KA 3C6SA 3QUYA 4I2XA 2ED9A 4GKSB 4PGBA 4KY1L 4ZS6C 2R0LH 1KCUH 2YMXH 4OCWL 2QSVA 5IB2A 1C08B 5IWLA 2F9BT 4XXDA 5ESVA 1RUMH 3GKZA 1IZKA 3NBNA 1AGEA 1HYRC 3ZKXC 2B4CC 4PBVC 1A6UH 1ES0B 1NAKH 2OJEA 3WJLC 1Q0YH 1BVLB 1PG7W 4ELMB 2PETA 3KPRA 3WFCH 5D7IE 5GS1A 3P77B 2E7LA 2IG2H 3UAJD 2Q3ZA 3O9WA 4HAFA 4OZHA 1XR8B 3DXAB 1M7DB 4CADA 1WVZA 2OSLA 3QEHB 2AXGA 2GUOB 1KLUA 4N0UB 4P3CH 3ALPA 4BSVA 4L8DB 5FO7A 5AWNH 4XBEL 2CUIA 1AIFA 1FE8H 3QAZB 1IAKA 1BZ9A 2BVQA 3AUVA 4L29B 1UCBH 1G0DA 4G9DB 3NZHL 1EZVY 2VNCA 2XZAL 4YE4H 1BIIA 5DJZA 4JZJB 4DCQB 4O9HL 1YNTB 3AREA 1XF4B 1AO7B 4MAYB 2QADC 4MX7B 2AJUL 1EMTH 3LKSB 4OZGA 4GRWE 4HG4K 1CVRA 1I8MB 43CAA 4PJ7E 5IMLA 1S7WB 2RHEA 3LKQB 4I3SL 3T3MF 3EO0B 1OCWH 1UENA 4QNPF 4O00A 2R69H 3CVIH 2IPTH 1VFAB 3FFDB 5GGTL 2YD6A 2MNUA 3QO0B 3TBVA 3CX5J 2I60L 3PL6D 4U1KA 1OAYL 1V7ML 1MSPA 3WIIL 4DFHA 1RU9L 4ERSL 1U6AH 4IRJC 3VGEA 4FRWA 3GGWA 4BH7B 3V52H 4WO4A 2XY2A 1ZEAH 2C1OA 4NM8L 1CE6A 1A1MB 1CLCA 2W59A 3EJJX 5IKCA 3MLRL 5L2KD 3PGCA 2MJWA 3QEQD 4I3SH 1UFUA 2QV2A 3TNNA 1IKNA 3MLZL 3QDGD 2XRAL 2BNRB 1DBAL 4XAKE 3ARDC 3F12B 2FRGP 3OR7B 5DJ0A 5ICZA 1QPPA 2HG5A 4LPUA 3SGDH 1OAYH 3PF2A 1V7MH 3CFCL 1KIPB 4U1JB 1RU9H 2YK1H 3JUYA 4X7EC 1FZJA 2EDWA 5EU4B 2VDPL 5D96B 3VDBA 1FJ1B 4C54A 3LS4L 4ETQA 2VZUA 4WFHD 4ZYKB 2Q86A 4LNRA 3EYUH 3MV8D 5I8CA 1VA9A 5LGHL 1UB6A 1WWCA 1BVKA 1AXIB 2CLRB 5FGBC 2Z0BA 1MFDL 3MLZH 2XRAH 3D85A 1GIGL 2NY2D 3LSOB 1JPGA 1F4YL 2OL3L 2NXZC 1YMHA 3CFCH 3PWLB 3FQTA 3BP4A 3KYKL 5E1AB 5FCUL 2AK4E 1B6UA 2QTEA 2AJYH 1IL1B 1IT9H 2YRZA 2OMNA 3A6OA 1GAFL 4NBYB 4AL8L 4QGTA 5KOMC 4HS6A 1TENA 3OJDB 5LGHH 2H2PD 4Y8DC 2ICCA 4XB7A 2J3SA 3QXTA 5ID0A 3TCLA 3B6SA 2OYPA 1R6VA 5F44A 1GIGH 5DA4A 1NCAL 3I2CH 1MFBL 4ZG1A 1HKFA 3KYKH 4N8VG 3RZCA 4EN3A 4PJCA 3BKJL 1CGXA 4YHOL 4XZUB 1M05B 1OAXL 4K9EH 5FYJH 1YPZF 4AL8H 4NZRH 3NPSB 1BD2D 1WEJL 2FSEB 4ZFOA 1KXQE 1H3UA 1YQVH 3QO1B 1QG3A 1DCLA 4Z5RA 3T2QA 3P40A 5EZIH 4TULL 2DLHA 3BW9A 3ZDXF 1BVZA 1MHCB 3U7AA 4RGOH 1I9RH 2EDTA 3TN0C 1NJ9B 1MFBH 3CLEH 2VSDA 3EYSL 1WTGT 3MRGA 3FB6A 2VXUH 3RIFK 4YHOH 1LEIA 3CFBB 4FTVB 1LO5B 5FFLA 3U4AA 4YGVA 1ZLWH 4DZBB 4LSDA 4DAGH 1KTDA 1LE9B 1FGVL 3HHRB 1RUAH 3QPXL 3QR2A 4QXTA 3SQOH 5HI5D 2LQRA 2Z4QA 3A6BL 4K8RH 1ZVHA 2R8SL 3MNZB 4Y4HC 1FFOA 4ZUVB 2R9HD 2YSSB 5KS9B 5C0AB 4LVHC 4YC2C 3MLSL 3ZZ1A 3IKCB 5E8DL 2V5TA 5SWQB 4HG4J 5JDSB 5IHUL 1M71A 5KN5B 3WSQH 1FIGH 3ZDZE 4Z7VE 4U1HB 2ZG1A 5DD3H 3RWEA 3HI1A 1DLHA 3MROB 3HCVB 3X3GL 1UYWH 3BXNA 4D0DA 4GG6B 3MJ7B 4GBXD 5GQBA 1FNSL 5KVGL 5CBEA 3JWOC 3LKPB 2GK0A 5C09A 3PNWA 4A6YL 1NBQA 1QSFD 3DSFL 1W8OA 3PGDB 3T65A 1DUYA 4Y19D 3VXQA 5D1ZB 5I19L 3MYJB 4ZQKB 4Y4FC 5E8DH 1J88A 4DN3L 3I50L 3MR9A 3CFDA 2Y4SA 5J11B 2ESVE 2RQ8A 4ZFGL 5AD0B 4IBLT 1FRGL 1OLLA 2E7BA 3LEVH 4JGJA 2FJFB 2P48B 1E4XI 15C8L 1WT5A 4EKXA 2WLYA 4APQB 4M02A 1P2CA 4P49A 3CDCA 1U8MB 3DSFH 4HWZA 2V5YA 1JGUL 4ZFFB 5EPMA 4QF1B 5GISH 1OW0C 2XXMB 4G6JH 1CXEA 4RRPA 5L6YL 3GMMA 4NQEE 3RIAF 3VXSE 4DN3H 2XTJE 1DFBL 1C7TA 4X9BA 1QYGL 5I66B 4DZ8A 3SDCA 2HRPH 1TQCB 1CD1B 1DL7H 4OAWB 5T3ZL 2NNAA 1N6VA 1P5UA 3BDXA 1P1ZA 1N59A 2VDNL 4X8XA 4X5XB 5BRZE 4JFEA 2D7TH 2VKWA 1MVUA 2P4AB 4PRHB 4WY7H 2XQBL 1ZK9A 1X7QB 1FAKT 4JM4H 1XIWA 4FG6D 4PJHB 4NN7C 4LSUL 1F3DH 4I1NB 2I24N 5I30H 3PHOA 4P46D 3BH9A 3MJ9H 2GJJA 5KVMC 1E27B 2OX5A 3VXOB 4OLWH 5JW4M 3BSZL 4CU8A 1I3RB 2P49B 3MLWH 4CMMA 3QRGL 3BZ4B 1IAOA 3B9KB 4X7SH 5DHVB 4M93B 1KEML 1U8PB 4FQIL 2DDQL 2P8PA 2XZZA 5D7IF 1GGBL 3GMNB 4NQSB 2J7LA 3BWUC 2YUXA 3WHE0 5I1CL 1I9IH 4PJAB 1U58A 4I0KA 1K4CA 1LP9A 4YPGB 2J8OA 4LEXH 4RMSA 4JFDE 2B8OT 2HLFC 3BQUD 4PRDB 3UYOD 2DLIA 4JVUA 5D1QA 2D7QA 3DJ9A 3RA7H 3RAJH 1QQDA 3S36H 2UZIH 5TGBA 3WBDA 2DDQH 1S9YA 5TH2A 2FYYA 3ULVH 1HN1A 2V5RA 5F8QC 5FV1L 4Y1AD 3UTSB 4NKDA 3K8MA 4YAQA 1IEHA 4NKQB 1LQSR 3SO5A 1YEHL 3FZUD 3P9MA 4NHCL 1M1SA 5EIQA 2VLRD 2AEIT 4TUJB 2B0SL 1MLBA 2RCSH 1KNOA 1MPAH 3BRGC 3MUHL 4XVTL 1DSFL 2IBBA 5BS0A 2E9JA 1RUQL 4LBEA 4OB5L 1UEYA 4BQ8A 4GW4A 2P8MA 4PJ7F 4NPYA 4CJ0A 3O45B 4EI6A 4HX1A 4UTAH 3H42L 3WXWL 2XPGB 3SDDC 4JPWL 3QFJE 5KG9A 5IJKA 5FM4A 1INEL 1G9ML 2BCKB 5GIRA 2D03H 4OV6F 5B21A 3NTCL 1M4KA 4AT6B 4EI5C 1JN6B 1Z3GH 3JVGC 5HDBE 3BHBA 5T5FH 4LL9A 2JKXA 4KTDL 1RZ7H 2GTWB 3GJFK 1S5IH 5D8JL 3TBSB 3M17A 4JG1L 1KB9K 2FWOA 3QZWB 1F8TL 1ZE3C 3WFDL 3VXNA 4L4VA 4RFEA 4S2SA 1JHKL 5DJAB 1X4YA 3KXFB 4BQCA 5IEKA 1NC4D 3CDFA 1LILA 3QUKA 2VISA 4MZ3A 4QT5A 2FJGB 3BRDA 1OM3L 3HPLB 4LRIA 3BO8A 5E8OB 3JV4B 4L8SA 4X98B 4KTDH 1MCSA 4MNHA 1FNEA 4JG1H 3WFDH 5T1KD 2Y5TA 1ZAGA 4D0BB 4OI9A 3PP4H 2AQ3A 4JFFB 4JFZL 5C3LD 4NZTH 1KSRA 1G0XA 5JHLH 1Z5LA 2XWBB 1BMGA 3MRLB 2YPLD 5D5MB 1HXMB 3TH2T 4EXPX 3ULUC 1BHGA 1KACB 1ZA3B 1UQSB 3DX9A 1OSZB 4KJYB 4LGPB 3L3OA 3DVNB 3V2AR 2VLJE 1PEZA 5H94A 5F1IA 4ZO7A 1FO0L 1BWWA 1TETL 1RIHL 1VENA 5DHYB 5TF1L 4MA8L 5IFAH 5IB5B 4G8GA 1ACYH 2WBJD 4AYFA 1T3FA 4IRZL 3NIFE 4M9OA 4FQHB 3D0VA 4I0PD 1H5BB 3ZHLA 3VFGL 4M48H 4PRIB 2F5AH 3D3VD 3IDNA 3LPWA 4K23L 3C6SB 3QUYB 3H6JA 4G42A 3MJGX 3WL9A 5CGYC 5JHDA 4PGBB 1F4XL 3AFLA 1SVCP 3VFVA 1TCRA 2IJ0C 5EU6E 4O02L 1FO0H 3RU8L 3AB0C 3CDGB 2GKIA 5FECB 1RIHH 4RGNB 4RISH 5GS0L 4XXCA 2DRUA 1YECL 2EIZA 1FNHA 2J8UB 4DOHB 3MV11 5E95B 4N5UA 5KOVC 4J4PC 2APBA 4KK6D 2OJEB 3BP6A 4LHUD 4R2GB 1GSMA 2A1WL 3QCTH 4F8TA 4XC1L 2UV3A 2CDFA 1L6XA 3DTXA 4IOIB 4PJ8D 4LSVL 4CADB 2HTKC 2JJVA 3GRWA 4NQXA 4AZ8A 3JUZA 5I76A 1HKLH 4X6CB 1GGTA 5DJYA 3W0WB 3G5VB 3C9NB 1YECH 1J5OH 5FYKL 4KUCF 1JV5A 5FO7B 1H3XA 1AIFB 3DUSB 1KC5L 3MJ9A 3L3IB 1NMBL 4OF3A 1KTRL 5FXCH 1WIPA 5GGSY 3IGAB 5GZOC 5DJZB 4Z7NE 2ZOLB 2X4SB 4Z7WB 1KB5L 5GJTL 5HSFA 3C08H 3ZDZF 5TDPA 2F19L 4PB0L 1BJ8A 3HZYA 3WXVH 5EFIA 4TOYH 2HMID 1NCBL 4ISVB 1UJ3B 1GCFA 3ARFA 3V0AC 2FZ3B 4YHPB 5FOBB 2OZ4H 3JTTA 4LFHD 1KB9J 3MUGA 4F7MB 1X5FA 4NT6B 3H3PH 3RUGF 5FUCE 4Q7DA 3LB6C 1KB5H 2EKSA 3THML 1NFDF 3PWPD 5D7SL 2V9TA 1JNLH 1T6WA 5ESAA 3CCHB 4D9QE 2P7TA 1J9CT 2WWKO 4X0KA 4OD3H 4ESKA 1WZ1H 3MV7A 3EO1B 4KK8D 3ZKNC 5EU3A 3ZSTA 4HBQA 3BIKB 1B4JL 4I3RH 5J13B 2E6PA 4LCWB 5I1IL 4PRAA 2ARJB 2HG5B 3TO4A 5FB8B 3IFPB 4R7DB 3WS6C 4L4TA 2F5BH 3RJDA 1F45A 5HVGB 3U0WL 5LGJB 2C3HA 2X4UA 1ITBB 3QWRD 5B4MD 3WO3B 3SE8L 2RIKA 5SWSA 5I8CB 1UB6B 1WWAX 2BRQA 4G5ZL 1BVKB 4XCFL 4M7KH 2W0FA 1NUDA 4NQVA 1WAAE 4EOWH 1T03H 3DI3B 3GSXA 2BK8A 3NA4A 4BUHA 3KLHD 4DGYL 3BP4B 1I1FB 1BFSA 2YZ8A 4QHKI 3AS3A 5MEPB 1R5VA 4PR5A 3K2MC 4G9FA 1VFBB 2FH6A 5BVPH 3BP7B 4PJEA 4OZIA 1MHHB 1T1ZA 3EYFB 2BVOA 3TLRA 1EAPA 2W65A 2XYCA 3FOMA 3S3SA 4HUUA 4ELMF 4P57A 4C57C 3B6SB 1CXHA 2JB6B 1IE5A 4F3FA 4DKFL 4XNXH 4UAOB 4WI3A 4YHZH 5F93C 4UIKH 2AQ1A 5T3XD 4YHKL 3RZCB 4EN3B 4PJCB 1U3ZA 5FYJU 4C83A 2HT2D 2VDRL 4R4NC 4Z18A 2X1PA 3AS0A 4L9DA 4HLJA 5C0BB 4JFHD 3QIBA 4ZFOB 4JKPL 4HIEA 4GMTH 5E2VH 5E24E 1NGQH 3ROOA 1NL0L 2QQLH 4XVUD 1RMFL 1RZIA 4PTTA 4L8BA 5I1HL 4L1DA 4NNXA 3S37L 3NA9L 4TNWK 5A43C 3NFSH 3T0EC 3D87B 3FB6B 1KYOK 2IGFH 1NGPH 4XP9H 2OMBA 5H35B 3G9VA 4CVXA 4O58H 5LKNA 2Z92B 5B39B 1IGCL 4Q0XL 5E6ID 1YMMB 2EO1A 3KYOA 5AZEL 1P7KA 4NYLB 4GRLD 1B0RA 5I8EA 3IDUA 2CRIA 3HC4L 1RMFH 4ODHH 4ZO6A 1GC1L 1WWWX 5MI0C 1X5LA 4OLYL 2CD0A 4PJ5E 1IKFL 5ACMA 3IAGC 5MEQB 1A6AA 2XKSA 4OFYD 4RNRB 5HDBF 1YDPB 2N56A 2ZG3A 2C7UA 1A3LL 1I3UA 1GOGA 1WBXB 2VWEE 1IGCH 4MS8C 3ES6A 1J0ZA 3P2TA 2VZOA 2NPLX 3S35L 3RWEB 1HINH 4TVPE 3BXNB 1R5IB 3HC4H 2GK0B 3GMLB 5DD0L 2AEQL 2R29L 3T65B 3RI5K 1NDGB 3EYOA 1BOYA 1DUYB 1JGEA 1X5ZA 4X99A 3RWHA 4XPTL 3FFCE 5TDOA 4G80A 3WIHH 3MUZ1 5KBNC 5KAQF 3KLAA 5H2BB 1OGAD 3CFDB 5SWZD 3GMRB 3VWJC 4RAVB 2JTDA 4PPTA 5F7DA 3OKNA 3CLFL 4MSWB 3HNSL 4JRXB 3DROB 3F58L 1MRFL 1U93A 3PL6A 1NCDL 4Q9BA 4P48A 5I1DA 2B4CL 3BYYA 1UM5H 4P4KD 3CFEA 5EN2B 5J1AA 5KSBB 3VXME 1JIBA 2X4OA 3A0OA 3EO9H 4EUPH 5EO0B 4P2YA 5I1JH 4NWUL 4RGMC 5I74C 1KUMA 3FQXA 3HI6L 5B38G 4ODTL 3DV4B 5AG9A 3NH7L 1T22A 2EDOA 3EFFA 5L2KA 4TTDD 3SDAD 1BZ7A 4HJ0D 4OIBA 3QEQA 2Q76A 5FGSA 3VFOA 4ONOA 1QKZH 2EE3A 4R6UA 3QDGA 2OZ4A 2QR0B 5TE4H 1T1WB 25C8H 1QRNE 3NIFF 1NCCH 3S88L 2ZCHH 1NCDH 1S7QA 2B4CH 1NSNL 4I9WD 1BBJA 1K85A 1JWSB 5FOJA 4P23D 1TQBC 4NC2B 4G7YH 4U3XA 4HKJA 1FVCA 4RIRA 3PHOB 4HUVB 1PG7X 2C1PA 1KXVC 4PJ9C 3MO1B 2VDQL 1FCCA 3Q5YA 4M1CD 3MV8A 4KZDH 4JDVB 4U1MB 1F3RB 4OZFH 2ARWA 1U9KA 5IG7B 1DBBL 1XZ0B 2VQ1B 1E6JL 3N50A 3NAAH 1RJCA 4KI5D 4FQQA 4OFPA 1NSNH 1D5IL 2GJZA 1IAMA 4NQCD 4ZAKB 3OKEA 2P8PB 3TWCH 1D7FA 2OK0L 3EIFA 1PVHA 4XAWL 5DFVD 5DEFA 4FQXC 3STZA 1WQVT 4OLXL 3G6JE 3LRSB 5E7BA 2YC1A 5CD5D 4XH2A 3HZMB 5E9DB 4FFWC 3VXUB 3GSNH 1J18A 3D5OF 4X83A 1IGYB 4GO6B 4W70A 1FDLL 2H6PB 3QDJD 4GSDL 4Y16B 3OJMB 2VIRA 3W9EA 1D5XA 2P5ED 2V2TA 2AI0L 2UUDH 5F7NC 1ULVA 3BUTA 3O6KL 1MCFA 3QHFH 4KJWC 5DT1L 1I1AC 1QQDB 3EZJB 3NPZB 1JRHL 1KYOJ 3L3KB 3HFMH 5TH2B 2FYYB 3VJ6A 2FX9H 1HH9A 4XAWH 2X4PA 1TZGL 1MQKL 4NKDB 4PJGB 4YAQB 2QQKH 3MJ8B 5I8OL 4Z7NF 3P9MB 1BD2A 1CLYL 4YBHA 3TT3H 4H88L 1MLBB 2HLAB 5JPNA 1B88A 5BS0B 1Q72L 3QQ4A 5KSAD 1U95B 1NEZB 1KCVL 4GG6F 1YN6A 1OP5H 3VMPA 2P8MB 2OL3B 4NPYB 5DT1H 4UTBL 1HIML 3ZKSD 3D69B 4AIZA 3SCMD 3KJ4B 5A1AA 2WIIB 4G43A 3RWJA 1MQKH 3QDME 2ATKB 3LKNA 4DVRH 3V79C 5D2NE 1MJ8L 4XCNA 5JXEA 5MENB 3FONA 2ITCB 4PREA 3FQUA 5DC0A 3P4MB 5CIPH 5EOCL 4FXKB 1V5JA 4P3WA 4FS0A 3M17B 4HT1H 3JZ7A 3T1WA 1OTTD 3EDJA 1QLRA 4WTWA 2G2RB 2Q8AL 2ADIB 3VXNB 4MVBD 5D1XB 3FMGH 5D71L 3TVMC 3DWTA 5B8CC 4MB4A 3V5DA 4CNIB 5IEKB 1ZA6A 3RY4A 3IT8D 3AU1B 3RWCB 5CZXD 1PW3A 1T4KA 2VISB 3DUUA 1A7NL 4QT5B 5ACZB 3Q6FA 1EJ6A 5F7EL 1MJ8H 3O3DA 4IIQA 1BEYL 2GY7B 2AJXL 5IBUG 2R9HC 3O4OC 4MNHB 1GGCL 2VUOA 4HFWB 4U1SA 4GBXA 4U1NB 1QEWA 4KPHL 3ARGA 4Q58C 1QSFA 3GO1L 3HMXL 4DGVH 5AG8A 2Y5TB 2FATL 3QSKB 4Y19A 4YIQB 5E0QA 4UT7L 1NGZA 2VOTA 2Z35A 1ZMYA 2DQHL 2MCG1 3H8NA 1WAAF 4XB8A 3RFZC 1LWRA 2E27L 3ARYA 5F7EH 2DL2A 1DVFC 3A6CH 2XZCH 5I1KH 3GIVA 3V5HB 2R1XB 2FEDD 2X4NA 2X9XA 4K55A 3DMMC 5EBLA 2UYLA 3GJFB 4YDLC 1FNGA 3NCFB 5FDYA 4KPHH 5C70A 4OJFL 1RZ8A 3BPCA 3HG1E 3QCVL 4WNQA 3CPLB 4R0LA 4YK4B 4L3EE 4KKLC 1JPSL 2CDGA 1MF2L 1IAIH 5EOTA 3SOBH 4JFXB 5C0ND 1AY1H 3WIHA 1OD7A 3Q3GB 4P99A 4PJXE 1RK1A 5E4IA 4PRNA 4RA3A 4PJIB 2N4IA 1U0QA 2X05A 4G42B 1EXUA 3WL9B 4P2OB 4IJ3C 4MQ7A 4MXWL 4ONFL 4AIOA 5D7JB 4EDWH 4Y2DB 4GKNB 4YXLL 1V7NL 3KAAA 4EUPA 4EBQH 5IM7A 3C6LD 4C56A 2VC2H 4M5ZH 1AGDA 3L5JA 3IDIA 4YDKL 4P46A 5ALBH 3LQZB 3JWOL 2Q7YB 4U0RC 1MIMH 4X9FA 3I84A 4J2XA 1QBMH 4KZEH 1A1OA 3DECA 4JEGB 3S5LB 2UUDK 32C2A 2A38A 4MD4A 4X80L 3QEUB 1NFIA 1UWGL 5I76B 5DJYB 4P4RA 3O6FB 3WE6A 4YO0A 3N85L 1BQHA 3G04A 1T66D 4U6VL 4M4RA 5JMOC 2D3VA 2AK1L 2A2QT 4XPAH 1ADQH 4OZFA 4KVNL 5LQBH 3BQUA 4PLKD 4RMVA 3OKLB 4XI5C 3MFGB 4MD0A 4XPGL 4WU5B 1EFXB 4X80H 5ALCL 4M6OL 4PRBA 5CSZB 3SDYH 1IQDB 1LO3H 1EBAA 4U31A 3HG1D 1VGEH 5C6TH 4AEHL 5J4MA 1E4KC 1IGFL 2OI9C 1T89A 4WEMB 3O6MH 2VDOL 4Y1AA 1TVHB 1JHTB 2BC4B 3VFSB 1CGUA 5EFIB 1MCRA 3NABH 4H20L 5F9OL 2VLRA 3GSNA 3C5ZB 1MI5E 1A5FL 3RVTD 3FO1A 2HJLB 4OLVL 2FD6H 2YPKB 3MUGB 5FKPA 2JJTC 1WTLA 1KG0B 4OCMC 4XPGH 1YEJH 3N1GC 4ZSOA 4NZDA 2PXYC 3GSQA 1NLDL 1WF5A 3MFFA 5KSVA 2XTJC 4PUBH 4NGHL 2VE6B 4X6DB 1DBMH 4C59B 2XI9A 4X0KB 1N7ML 1IC4H 2Z8WC 3RPKA 2DI9A 2HN7B 3C2SA 5EU3B 3TIEA 4EVNA 4OIAA 4MJIE 2EE9A 2DM2A 1WSST 2H32B 1WZKA 1FL5B 3RL1A 3GUTA 1QSEA 3PWVB 3TO4B 5CS7A 3MGOB 2NZIA 4K7FA 4JHBA 4Y5VA 5GHWL 3O3BB 3F6LA 1NC4A 2NY1C 1QFWL 4HUNB 5DQDH 1YYML 2NX5D 3GK8L 3NCYP 2EEDA 4C4KT 1R3LA 4YBLC 4M1DH 1CK0H 4S1QH 1FSKB 5CIPA 3K46A 2PO6C 1NMAL 5FHAL 3KR3H 1QPXA 2OXGA 5C0EA 3GSXB 2EECA 1MELA 4R26H 1E6OL 3GIZH 2YUWA 4NJ9L 5FGCB 3SGKC 4Y0GA 1NANI 1YC7A 1YYLL 5GHWH 1R5VB 1JFQH 4XVSH 4PR5B 2J8UF 3GK8H 3GSUA 3PP3H 4OZIB 5IROA 3CVHL 2BVOB 2E7MA 1EAPB 2W65B 2YPLA 4JFOA 2XWJA 2BSED 4WUUE 1Z0NA 3V4PL 5KZCB 2CKBH 1EERB 2EIEA 1NMAH 3MLYH 1MCLA 4EEEA 4F3FB 4RRPG 2DWEA 3MMEA 2W91A 4JO4H 4P3DA 5ADOH 3X11B 1Y6MR 2IPKA 4C83B 5HD8C 4MMXC 2WBJA 1EGJH 4MA3B 1AI1H 3QIBB 1KLGB 4I0PA 4ZDHB 3G5YB 3S4SA 5I1EL 1T20A 4HIEB 4FABH 1XF3A 1PDKA 2J4WL 1GGIL 4G6KH 4UILH 3QI9D 4IMLA 1GZQA 4HQQL 3TEUA 3BKCH 4PTTB 4L8BB 5E70A 4NNXB 4J12A 3R8BB 3OKDB 2BNQE 4HHAA 4P59H 5FKAB 5IW1B 4KQ3H 4OSUL 1J0KA 2VZ3A 4JM2B 5HYJE 1S7XA 4YDVA 4LHUA 5IW6B 5I1EH 1VGKB 3BZFA 1P7KB 1GGIH 1LE5A 4LLVA 4WENB 4ZD3L 5I8EB 2R2HA 4PJ8A 2HWZL 3BEWA 5FUOL 4OCNC 2B1HL 3LIZL 5INDA 1FO0B 2KBGA 3MA9H 4HMCA 1KCSL 5C0IB 4Z0BH 3O2WH 5C9JB 4JFYA 3ULUL 4PGDB 2B5IC 2I27N 1CBVH 3VWKD 1N3NA 3GBNH 3NCMA 5HYFA 4XMLL 1YY8B 4MJ4A 1KT2A 1XH3A 3MLXH 4O2CA 5K93A 1IILE 2P47B 2VKXA 3VFUA 1PKQE 4MQXD 4Z6AT 3NGBB 5F89A 3TYFB 3CUPB 1CFVL 1P9MC 1DQJB 1EUUA 3EYOB 1JGEB 3FRPA 1QFUL 3SJVD 4JANB 5MERA 3P0VL 4M61A 2W07A 1HYSC 2D9QB 4OGXH 3P4LA 4MWFB 3KDMA 3CK0L 5GGSB 5EOCJ 4N0RA 4WWKD 5GS3A 1T0PB 1ADQA 4EJ1C 5DO2D 2DLFL 1BQLH 1U93B 1FFNB 5I1DB 5I18L 1CFVH 1II4E 2VITA 5J1AB 4W4OA 3TA3C 2JE8A 2ZSVA 1DDHB 2F54E 3PWPA 3TIDB 3C60A 3TZVA 1NMCB 3FQXB 3VGDA 3K8LA 2G60H 3T08A 4ZUSB 1BZ7B 3CK0H 3VFOB 1RK0A 2WQRA 1DQLH 2VDKL 3MNWA 4PJXF 3BN9C 1BBJB 3L7FA 3OPZH 4JQIH 1KB5B 3U79A 5BZWB 3R8QA 3QCUH 4LAJH 1SJEB 5HHXL 3I75B 1TNMA 3QWRA 2LVCA 3I6LD 3B9VA 3KPQA 4FFYH 1LK3L 1MCPL 3H9ZA 3ILQD 1A7OL 3MRDB 4JB9L 1T21A 4RMUA 5F3BA 4NO3A 3MGTB 1NKRA 2YWYA 4TTGA 5IEHA 3EDKA 3U2SA 5F7FA 4KUCD 3IDJA 5L88H 4JPVL 5E5MB 5E2TH 5CBAA 1H8SA 3PIQB 3HC3L 4MAUL 4OFDA 2EH7L 4QOKE 5LBSL 1UA6L 3IAPA 3FO0L 3FN3A 1KELH 1PLGH 1L7IH 1WV7T 4I18C 2V5MA 3NACH 2IFGA 4NKOA 4QRPB 1RUKL 3KS0H 4QTIH 3KLHC 2NY6C 4D9LH 4L3CA 2OJZH 3MC0A 4Z7OE 3W9EB 3QEGH 4D9RE 5DGRA 4XGZB 5FO8B 4JRYA 2AJSL 4M7LT 2CR6A 4BKLA 1E4WL 3KPNB 1HH9B 2AABH 4WW2A 5LBSH 3RHWK 1LDPH 4NIKB 3O4LE 3H9SA 2JCCB 4FXGA 1SMOA 4NOBA 1G7QA 4NFCA 1M7IA 3BESR 1HHGB 5FUCC 2CKBA 1D9KD 3MRFA 4KROB 1KEGL 1MAJA 1QLFB 3ROLA 4JY5L 5K9JL 2APWA 1ZTXL 1E4JA 5T1DH 4V1DE 2DWDB 1FBIH 4HC1H 5EWIH 2XTLA 3MCKA 1FVDA 1WBZA 5T5NF 1EGJA 3E6HB 5E6IA 3RIFF 4F15C 4NRYA 2X7LB 5KVDL 2ENSA 4POYA 3V6BR 3IXTB 2W0LA 4PREB 4UDUA 1DLFL 4PRPB 1YEEL 2ZPKL 4GRLA 4Z7UE 4JZNA 1JGVL 3TNMA 3T8XB 2PYED 2LTQB 1WIOA 2VDLL 5I6XB 1F6FB 3I6GB 3KYAA 3RDTC 5ISZD 1I7TA 1RSFA 5EO1A 4ODWA 3RWFA 3V5DB 3OR6A 4OFYA 4JDZB 3HE6D 1CICC 1FZKA 5TPWL 5GGVH 2EDKA 3SE9H 2I9LA 3N9GL 5HGDA 1Y18A 4XNZC 1T1XA 2E8ZA 2DIJA 5KVDH 5GGVY 1OTSD 3O3DB 1JPFA 4IIQB 1T7XA 4NSKA 3T0DA 2ZKHL 1ERNA 1I8IB 2COQA 1JGVH 5C2UB 1K2DA 4GW1B 3ARGB 2GFBA 3TJHD 5DGQA 5HHOE 5DUPH 3LEYL 3HNVL 1X5XA 4X4MA 3PHQA 1MCKA 1S7UA 4BZ1L 3LKOA 4LARH 4LASL 1OAQL 1OGAA 5FYLD 5SWZA 4Y5XA 1PY4A 5JZ7C 1QBLH 5HJ3A 3IAQA 5BO1L 1YEDB 4G6FB 5FUZL 5FK9B 3WDIA 1CYGA 3A67H 3IFNL 3OXSA 2V17H 3R06B 5EU7C 3DXAD 4HFUH 3U46B 1T2QL 3P11H 4JFPB 4P4KA 4IMKC 1TJHL 2VH5H 3VXRB 5EORL 2VAJA 4NCC2 3DVGA 5CMAB 5HGHA 3ARQA 1U91A 3KHQA 4WW1B 3SDAA 4OGYL 5HYEA 4MD5B 4PRNB 2BFVL 3I6KB 2Z8RA 1EXUB 5CHNA 4QRRA 1FZOB 3RBGA 4FN0A 4MQ7B 3WN5A 1JZ6A 3K80A 4XTRD 3MRBA 2R2EB 3MRHA 3LHPH 2C5DC 4KXZH 3LZFL 2DQTH 5KVEL 4NRXA 2NTFA 2A9ML 4WI5A 5EORH 4HJ0C 4XC3H 1U36A 1AO7D 2PCPB 2FBJH 2NXYB 4MAYD 4RMWA 5DYOB 4C56B 2H41A 5SX5K 2Y7QB 4NUGH 1HSAB 4OGYH 5IQ7L 2JB5L 5CEZE 1A1OB 3TC9A 4MJ6A 1UH3A 3N1MC 3NCJL 2KZWA 4KK5D 1TLKA 4P23C 3QBTB 4NQDB 4K7PX 3T4AA 1IC5L 1D5BB 4XPHL 4AIXA 5F7UA 3GMQA 4NQCA 2VWEC 4K94H 2A9MH 1KTLB 5F9JB 2ZCLH 4I3GA 3PDOA 4BZ2H 2NTSP 2XG4A 1P7QB 5BV7H 2IADB 4LCCA 4M3JA 7FABL 5IQ7H 4WI2A 3EFDL 2ID5A 2IAMC 4KI5C 2JB5H 4X4XA 1KCRH 3QDJA 2MTPA 2EC8A 2BNRD 2A73A 3BVNB 4U6XA 2P5EA 3NCJH 1N4XL 3B8SA 4MD0B 2BSRB 3JV6A 4M7LL 2F53E 5IGXL 3QH3A 2A6KB 5IK3A 4YHLL 1F00I 1TVBA 5CD5C 3IF1B 1ZVYA 1G7JB 4LSQL 5E2UL 5TQ0H 3DX6B 1Z2KA 3BAEL 1YEFL 3GSNB 1H3VA 1DTUA 3Q0HA 4AJ0A 7FABH 3EFDH 2VLKB 4DW2L 2P43B 3GSRB 1ZS8A 5FKPB 5KSAA 1F42A 2D31A 4G7VH 5C86A 2Y9RT 4TNVK 4HXBH 1BOGA 5IGXH 3PXHA 1ZSDB 4X6FA 3SCMA 1FIEA 5E2UH 2FX7H 2FX8L 2QBWA 2WW8A 3EOYG 1P4LA 1N5AA 2H8PA 5E8PA 4K3EH 4OIIH 1FORH 2UVEA 3UO1L 1JZ5A 1DE4A 3MTRA 4LRNL 2P5WB 1PG7H 4E0RB 2DJSA 3WEXA 4KMQA 3OBAA 2GJ6E 1HEZA 4IRJB 1RUPH 2R1YA 3OGCA 3QA3B 1QSEB 3MREA 5ABDE 1MUJB 1FV1A 3ZDYE 3OKOA 2PW2B 3RVXC 4TSAL 3AXLB 2BSSA 4HC1A 5DLML 1XGPB 4PLJD 3WNOA 2J2ZA 3RTQC 4DGIL 3UO1H 1R3LB 4PJFB 1R3IH 3UZVB 3OJ2C 2VXTH 3R4DA 2DKMA 5C92A 2FO1A 5C8JA 1T7WA 3ZE1E 4HDIA 3ZL4L 2DJUA 3BPOC 4M03A 5F88B 3IDYC 4QCIA 3OSKA 2C3WA 5CZXC 5ELIA 4MNGB 1EJOL 4QHMA 1A7PL 1ZHLB 5JOPD 1ZHBB 1K8DA 4HPOL 1QNZL 1KJMA 4FTVD 3NN8B 3IETA 3PABA 4MLIA 4YHML 3BEVA 4DGIH 4QRSB 4QHUA 1HDMA 2ATPB 5DR5H 3ZT7A 1G9NH 4UV7H 4JPIB 4H1LG 2WWMC 3F7RA 4KMTH 3QT2A 3MMEB 2WM0A 2X1OA 4N1EA 4RA0C 4ZOAA 1H3PH 2DQDL 5TJWK 5C0AD 1LK2A 4JAMB 5C2BH 2DBJA 3P73A 1HNFA 1QR4A 4MDJB 3BISA 3GKWL 4I8DA 2FEDC 3DYPA 4RZCA 3NVQA 4PG2C 5EULV 5HVWA 1XF3B 1AR2A 4P5MB 1F3DJ 3RNKA 4IMLB 1UZ8A 1T5WB 5C08B 5C0FB 1IFHH 1A0QL 3DO7A 1CFTB 4PLOB 1YY9C 2XQYG 4IM8A 1WZMA 2DQDH 4LSRL 5D1ZD 5D2NC 2F8VA 1W2KT 5F1NB 1OVZA 2X41A 5MHSD 3F7YB 4LF3A 5HHNB 2GT9B 3EOAA 3BZFB 4CJ1A 3TN0B 1DN0B 1A6WH 3KG5A 3DLQR 1RV6X 2D0GA 5DF0A 2R4SL 4APQD 1BFOA 3MLUL 2H26B 2AS5M 4Q97A 3C6LC 1L7TL 5IMOB 4BH8B 3GI9H 5IV2A 1CFQB 1KIRB 4MA7H 3UTSE 4MNQB 3P9LA 1EVTC 1UVQB 4X6DF 1HI6A 1PSKL 4TSBL 3L7EB 1KT2B 1XH3B 2IQAA 4NO5A 4O2CB 1ZLUK 3SBWC 4LHJB 1V8HA 3VFUB 1XEDA 2NQCA 3TPUA 1HHHB 3TCXA 3FCTA 3BUYB 4LVHB 4YC2B 1ZWIA 5TDNA 5K33A 1U8LB 1BFVH 1W72L 4PRHD 2PW1A 1WCBB 1L7TH 3JTSA 1E28A 2HKFH 4CU7A 1G9EA 3V8OA 2HRLA 3K8KA 3ECBA 3K7UA 4ONGH 5IHZB 1B9ZA 1LO0L 5ID1B 5DMGC 4ODVL 2PTTA 3HB3C 4BA8A 1L6ZA 1OARL 4UIMA 4WV1C 1OQXA 5I75C 4AEIH 4JHZA 2AP2A 3GHBH 4P2QB 2IH3B 4Y4FB 1BWMA 1K6QH 1QVOB 3B9KD 5HGAA 4C55A 1F02I 1F3JA 5BZDA 2ZSVB 3O41A 3PWPB 4R7NA 3C60B 4HJGA 2I9TA 3TZVB 1IQWH 2G75A 2EYTA 3BKML 3SGJC 1A4JA 4ODVH 3VGHA 4ZOCA 4LP5A 5DRZB 3QYCA 4S11A 1NGWA 1UADC 1HHKA 4OLZL 1OARH 1K5NA 3TBTA 3MNWB 4G8FA 3MRPB 5EG6C 4OKDA 3Q5OA 1RIVL 1CFNA 4HKXA 2MCPL 3UTSD 1ORQA 1RZKC 2WINB 1T5XA 4NFBA 5GRUL 4ZNEE 1HCVA 5T1MA 1AXTL 4YHIA 4GAYB 1GOHA 2ICWA 4DN4L 1CU4H 2I5YL 4W6WB 3ABZA 4RBPH 3MRJA 5C6WH 1N5YL 3VRIA 3UTTE 5DQ9A 1XGUB 1OTUC 1CFSA 5F3BB 3BH8B 5DEZA 3Q6GH 3IXAA 1MHEA 4HZLA 1ZHNA 3LPGA 3BD5A 4F9LA 5CBAB 1U3HC 4XNYH 4ZXBC 3LH2L 4JCLA 4XMKH 5IF0A 5ERWA 3ARBC 5BXFA 5GRUH 1KJVA 3GBMH 2MPAH 4I2XE 4NKOB 2I5YH 3AAZB 1G6RL 4OCLC 2AGJL 3U1SL 2EDXA 5K59E 1TJIH 2F74A 1F58H 1OY3B 3BGAA 5SV4A 4QRTB 4JRYB 4QRQA 4WUKH 2R0WH 4LPYA 5D2LB 3KXFD 1AE6L 1IC7H 3P3YA 4W81A 1L0XA 1E4XL 4IHOB 2X09A 4OV5A 4U3CA 4HV8B 3FAXA 3H9SB 3KPRE 2JIXA 4IOFD 5GRJH 5B3JE 2WWKT 3U9PL 5IMKB 2O26U 1J0HA 3VCLA 1UH2A 3QULB 3QI9A 1I1AA 1H15A 4OZHE 2FR4A 1U92A 2AGJH 2OTWB 4DFIA 3UC0L 3QNYA 1HE7A 4EUPG 3RGHA 5ICYB 4PJ7A 4PJDE 1Q8MA 1MJUH 4CW1A 1A6VH 1T04B 2UZXB 3QQ3A 1AE6H 3W39B 1Y6KR 4PV9B 2V2WA 3QNXA 3MRCA 4JFFD 1EZVX 2CK0L 4PB9L 5GZND 1DBKL 1ZGLB 1G7PA 4NRYB 1KGCD 3CVHB 5E94A 3MV9E 4GG8A 4UQ2B 2DMCA 5ACLA 4ZPTB 3EZ8A 3SDDB 4YR6B 1BQHG 3CSYB 3U4BH 4L9LA 2Q8BL 2IANA 1FL3B 2MOVA 4N9GA 3RWFB 5LWYL 2B20A 3OR6B 5LCVH 5TE6H 3VWKA 1CG9A 4OZGE 4EI5B 1MJ7H 4I0CC 5HGDB 5JORA 4OZFG 1OP3K 1UB5A 3SE3C 2Q3AA 3ETBF 1S7TA 2F58L 4PRID 4F33B 3QUYD 1WGOA 1MEXL 3QG7L 4L5FH 4LLDB 3O11A 1N64L 5HY9A 2O61A 1K2DB 5B8CA 2GFBB 4DVBB 4NN6C 2Q8BH 3EJZD 3X12B 4RGND 3OJVC 2HFEB 2N7BA 4OLUH 4WFED 3WO4C 1DUZB 3KNBA 2APXA 3SJVA 3PHQB 4YXHL 1NC2B 1V05A 3MBEC 3HPJA 5GGRY 3RI5F 5HVFB 3ZHKA 2AEPL 1ZV5A 1RURL 4MQXC 4BQBA 2BSTA 4XPBL 2VERN 2DQIL 2YKLL 4R2GD 5SV3A 4DEPC 1JWUA 2BVPB 4WWKA 1R3JA 4F7CA 1FAIH 5LGKA 1MEXH 2BY0A 2YHGA 5CZKA 1PY9A 1DQDL 1N64H 4OF5A 1G1YA 1CTNA 4I77H 1OAZH 5C07B 3INUH 1VACA 3U36B 5L2JA 4ODUB 4GW5A 4LLYB 3KPSE 3W0WD 2CLVA 4Q6IC 2JJSC 4ZFZA 2EDDA 5DMKB 3B2VL 4QWWD 2BVUA 1G7LB 5HGHB 1A1NA 2A9NL 2NW2B 4G8IA 4I13B 2YKLH 1U8QB 5FGRA 1TVDA 4QRRB 3WIFA 1ZVSA 4KRMB 1HCFX 4DKEL 5DUMH 2X5PA 3UPRA 2NZ9D 4OGAD 5J57B 1O0VA 4F7PB 4TVSa 4UDTA 3IJYA 4PP2A 2YUZA 2NTFB 5D6DC 4OTXL 5HHME 6FABL 2XN9E 1CZ8L 2PYFA 4LIQE 1Q9LB 2DTSA 3QDHA 3G9AB 1ACZA 3FOLA 3KYNA 1J8HB 4JQXC 4HGKC 2BX5A 2JCCF 5CUSL 1NCNA 1YEKL 3AB0B 2FJHA 2X4TA 3H3BC 1AJ7L 1MAMH 1B90A 1KLFA 3N1QC 4PP1C 4M62H 3X17A 4XP5H 4RWYL 5DI8A 1Q94A 4R4FH 4IS6A 4NQCB 3WNNA 5TFSH 3UTZA 6FABH 4XWGH 2VLME 4OCSH 4PS4H 4IRSC 3O6LH 4TPRH 4NZUL 5DJ2A 3FO9A 4HIJB 4KRPC 3OZ9H 4Q9RL 3KPTA 3P30H 5M95B 5EOQH 1ZT7A 5IQ9A 4OCXL 4U6XB 3O3EA 4LCWD 3VFRA 2FH8A 1YNKH 4TQEH 1TJGL 2CMRL 5L9DH 3WCYA 3S4SG 1TVBB 5JW4N 4LDOB 5I15L 4KJPD 5LG1A 5DD5H 2D7PA 5DEGA 3ULSA 3ZTNH 4FMKA 4YH6A 1AHWA 2YRLA 3DHMA 4HPYL 4O51A 2DQGH 1A9EA 1QD0A 3TJEL 4R97B 1HK6A 1RVFH 1ZS8B 2GTZA 2NYYC 4U1IA 4TSCL 2CO6B 3RUGA 3S96A 4MLSA 2CJUL 2DYPB 2W9DH 5KJRL 1BOGB 2QSCL 1MJJA 2LVEA 2E9IA 1NFDA 4LHUG 4XNMA 1CVSC 4XP4H 1LEGB 4DUXA 5EUOB 4GMSL 3QPQC 3PQYB 1D9KC 4PJBA 4FQ2L 3FB7B 1EH9A 3W9DA 3DPBA 3C8DA 5KVFH 2G9HB 2LU4A 4AM0A 4KAQL 4OF7A 4ODSH 1HEZB 4YFDB 4YFLI 4GRMB 2R1YB 5C09E 3MREB 4JR9H 5ISZA 5DD1L 4QYOA 2EDYA 3VFNA 2C3GA 3RZCD 4EN3D 3T4YB 1HILA 1MHPL 2Z31C 3HE6A 2H3NA 2LV4A 3IDGA 4DWHA 2A0LC 2FDBP 3LV3A 1FC1A 5C0BD 1NAMH 3BPLC 1P4IL 2CXGA 2BOBB 3B3IB 3WFBL 4M5YL 4MQSB 2XICA 2GYSA 2RGSA 4KAQH 3FRPG 3FB5A 3STLB 4QCIB 1C08A 4ENED 4JPKL 2BJML 4M8VA 1IEAB 4F57L 1MIEH 5C6PB 1OTSC 2FGWH 1K8DB 1PGRB 4RQQB 4XMPL 3LOWA 3IETB 4S0TD 3L5XL 1YMMD 3BEVB 4LFHG 3VDAA 4CKVX 4KJQD 1MCBA 4QHUB 1Q9WA 3GMPB 4ELMA 1HHJB 3TP4A 5JIIA 3QHZL 2WMPA 1EEQA 5F97E 3BIBX 2HH0L 4JFEE 3RKDD 3EDDA 1XR8A 1RZJC 3DXAA 1M7DA 2OQJB 1SY6H 4N5ED 4NO2B 3HMWH 5DZNA 1TTUA 2QSQA 1AR1C 5BJTA 3QEHA 3IU4L 4XCEB 4N0UA 3SKMB 1A3QA 1UKTA 4ODXB 4JFDA 3P73B 4L8DA 3RGVA 1XGTB 1CD9B 1YPZB 5JW3L 1U3YA 1Z9LA 5K59F 2Y07H 1BM3H 2O5YL 3QUZD 2XKUA 2V2XB 3V0WH 2HKHL 4L29A 1QOKA 2VN7A 4K3DL 1UZ8B 4G9DA 4JY6A 5I0ZA 2V7HB 3CFKB 2XG5A 1RZGA 4HKZB 3DO7B 4H8WH 4N90E 4JZJA 2BOCB 4DCQA 5B3JF 4Y4KC 3QAZC 3PJSA 1YNTA 2A6DB 2KDGA 1F6AB 2G5BB 2CIIB 1AO7A 3GNML 3C2AL 4MX7A 3O8XC 3OTTA 1I8MA 4RAUA 1KCLA 2O5YH 4PJDF 3ZKQD 1LP9E 1S7WA 5K9QG 3LKQA 3EOAB 5F21B 3EO0A 1NUFA 5DFWH 1FN4B 1JI2A 4JRXD 3K1KC 1VFAA 3FFDA 1AXSB 3T0EB 2ADFL 4MAYC 1NBVL 1T83A 1C1EL 43C9A 1YN7B 1CF8L 4L4JA 2VXQL 1G7HB 5HPOA 1KIQA 1GH7A 4XP6L 3VE0A 5MI0B 2OP4H 3PGFL 5BS0E 1JGDB 2NY5C 2BNRA 5A2FA 3HC0B 3S34L 3F12A 5LAXB 3HUJE 3OR7A 1T1YB 5TDNB 4HS8H 1TITA 4KRLB 5DHVH 5HYIA 1KIPA 4U1JA 3UJIH 1NBVH 3JTSB 3MOBL 4NBZB 1JPTL 5EU4A 4PY7A 3NFPA 5GRVL 1FJ1A 3EW3B 1WLHA 4J1UB 5E7FA 5FYJE 4ZYKA 1ONQB 4FQJL 3FN9A 3FKUS 4LSTL 5TQ2H 3S97C 5DMJB 3PHSA 5C3TA 4PV8B 3O2DA 4PJFF 5D72L 4JDTH 2ZCKH 2DBLH 3LSOA 3VH8B 4J8RB 3IDXL 4L4VE 3VI3F 1JNNH 3PWLA 5E1AA 3MYZA 4N0YH 5HDQH 4ZAKD 4AK1A 1EVUA 3MLPA 4HUWA 1IBGL 3SY0A 3X3FH 2VDML 5D7LE 5M94B 1ZHKB 4FMFA 5E9DD 3VXUD 1KFAH 1NGWB 3BMVA 4PG9B 1Q1JL 4IDLA 2X9YA 1MFCL 2B7DT 1K5NB 1WITA 3GM0A 3TBTB 4Z76B 1JZ8A 1A6ZB 4Y16D 3MRQB 3WFZA 4RGMB 4K2UH 3T2NL 3H7BB 4TVPL 5I74B 5FA4A 4KK9D 3GHEH 2XA8H 4PTUA 5DRNA 1JYWA 2CIKA 1HZHH 3OL2A 1OAKL 4XZUA 1M05A 1X5YA 1EO8H 4KUZL 4OUUA 5EU6A 4LDEB 1D6VL 5EZJB 5BCAA 3QO1A 3LRGA 1TMCB 2AXFA 3MRJB 4M6NH 4FZ8H 4HK3N 3WD5H 2EDQA 1HSBB 1MHCA 1YZZA 4NM4H 1TQBB 2Z93B 2FGZA 1NJ9A 1MHEB 4HZLB 1R24B 4G8GE 5D7IB 4PJ9B 3UBXG 1KBGL 4HH8A 2WUBH 3CFBA 1CL7L 2QHRL 4F9PC 2W0PA 1LO5A 3TT1L 3ISWA 1NAMA 1INDL 2XKNB 4DZBA 5MEND 3F7QA 2ICES 3LS5L 1FH5L 4LPVA 5JHDE 4NWTH 1L9MA 4KVCL 1LE9A 4XX1G 1BECA 4G6ML 4LPWA 2F74B 1SJHB 1NLBH 5GGUB 5JMRA 3MNZA 4FQXB 4MYWB 3EDEA 5D1XD 4ZUVA 3I3DA 2YSSA 5KS9A 5D93C 5C0AA 5DS8B 3B5TA 3IKCA 1VDGA 4ZOEA 2W9EL 3L3JA 2Q7NA 4UOW1 3TT1H 4ZTPL 5KN5A 2V9RA 2JIXB 4NQUA 4U1HA 1FH5H 3MROA 4M6AA 3HCVA 1FNFA 4LLAA 1I1AB 1HHIB 2QLVB 4G3YL 1JE6A 4GG6A 3MJ7A 1EPFA 3FT4B 3LKPA 5GGQH 1AQDB 3O81A 1SY6A 4PJ7B 2JELL 3QHTC 5F96H 3PGDA 4J6RH 3UTOA 1BGXL 1DQML 3EAKA 3TFKD 3KPPB 1QBAA 1IZJA 3AY4C 4LSPH 1S78C 3WFEL 1QA9A 4F58H 4JHAL 5AD0A 4POZD 1GGYA 4GG8B 3SDXE 2Q6WA 2FJFA 1YNLL 3PE9A 4G3YH 4X7DC 1ITCA 4WTZA 5D1ZC 2DD8H 3G5XB 4APQA 4XBGB 2IANB 4NJAH 1M6OA 1OD9A 2JELH 2OR9L 4N9GB 1U8MA 4N8CL 5IBLD 3P9WB 4HLZH 3RVWD 4GXVL 4XVJL 4KC3B 2HJKA 5JORB 2NY3C 2DI8A 3G6DL 5I66A 1S7TB 1J8KA 4JHAH 1RFDL 1ORSB 2M26A 3BP5A 1CD1A 5MP6L 4OAWA 3V4VH 4P2OD 1YNLH 1A3RL 3TVMB 4E41E 5B8CB 3P4OA 3CU1A 5D7JD 4Y2DD 4PRHA 4CL7A 1OB1B 3QIWC 1X7QA