2NXYD

Hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
229
structure length
227
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 49
structure length 227
sequence length 229
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nxyD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nxyD01
4F9LA 5JIKA 1BHGA 2APVA 2DLIA 2B39A 2VDKH 5DI8A 4PJAE 1U8MA 3MCLL 2P4AB 1CGVA 4RFNB 3S4SA 1UWEH 2Q3AA 1QSED 5CJ5A 3LS5L 1RHFA 3HI5H 1H8NA 4QTHB 1ZWIA 3AMLA 3T77A 5FOBB 5JW5B 3V7MA 3VD3A 4ZXBB 1DSFL 4G7VH 4FTVD 4GMTL 4KU1A 3JWDL 4IMKA 1NEZG 4PJ5B 2E27H 4NM8L 4XVJH 4Y5XB 5ICYB 5E2UL 2NQCA 2QSVA 4FS0A 4K7FA 4ETQA 1IGTB 4EDXA 5DEGA 1L9MA 3RGVD 3D0VA 1CR9L 4RMTA 5DQ9B 1UT9A 5JXAH 4NQDD 1IARB 4MAYD 4R2GB 1FFOA 1E28A 1VKXB 3KPNB 5FYKE 4MXWL 2JJSC 3F58L 1QRNB 2DKMA 2M1KA 4AH2A 3UPRA 4J8RA 4L3AA 4OZ4B 4XCFH 2F53B 2B8OT 4FFVD 1FZJA 3QIUD 4NQSB 1NCNA 4L8BA 3G6AA 2DQFA 4AEHL 5FGCB 1DBML 5ESQA 3SQOH 4LSSH 5EBWA 4AEFA 1AC0A 1WCBB 1I85A 4XXDA 3TPUB 1YJDC 5CP7A 4S1DD 1QSEA 3HCVB 1OB1B 1F11A 1UWXH 5CJ8A 1XGTA 5KOVC 4LCCA 5BZWA 1AJ7H 4JVUA 4EXKA 2XTLA 1Y18A 4OJFL 4FTVA 5AUMA 5E8NA 2AEQL 5J06A 3L3KA 4XMKH 5CFHA 1V3KA 1OSPH 1NGWA 4XWOD 4G8EA 2YZ1A 3CAFA 4XPAL 2PTTA 4XP6L 4N0YH 4WVRA 5T3XD 25C8H 3ME0A 3RJQB 1FLRH 3GMLB 2ARWA 4ONFH 4U1LB 4DUWA 3RGVA 2DJ4A 2ZOLB 3KPSB 4DKEH 4M7JL 1MJ8H 4O00A 1AHWC 1FV1A 3T0EB 3BPCB 2VXUH 3VXQB 4KK6D 1EBAA 1AXTL 4X4YB 4K3DL 4ZFZB 1T7XA 1K6QH 5IESL 4OAWA 3KLHC 5SWSD 1U8IA 2FGWL 1FL3A 3NGBC 1RUMH 1WWWX 4NFCA 3TBTB 3TJHC 4Y2DB 4EKXA 1B0RA 1FZOB 2YSSB 5E70A 1NAKH 2IAMC 1R3JB 5LAXA 1CE6A 4K23L 1I9JH 5JOFA 5TF1H 3W39A 3CMOL 5JORA 3RAJL 4KMLB 1HXYB 5DFWH 4ELKA 1RMFH 3K4AA 3NPSB 1EAJA 2N56A 1NFDA 2W9EH 1KTKE 1NDMB 1JUFA 2ARJB 4HIXL 1CVRA 4PJBA 1WFNA 1SMOA 2FBJL 3X14A 3S5LA 3FZUC 1OAUL 3V4PL 3VCLA 4NKQB 4KJPD 2AK1L 5MEPA 3RWFB 2AV7B 2HKFH 1IGIH 4PJ7E 4Q6IA 4L3EE 1CGXA 3MACH 4F57L 4NQTA 2DM3A 3BSZH 3G08A 5CJBA 5E8DL 1QLEL 5JUEH 3QXUA 2ID5A 3IFNL 3VXOA 2WLYA 3OX8A 4BELD 4NC0B 2DQIL 4M1CC 4ZD3H 4ZUSA 4ELMA 1KCUH 1MQKH 3O3AB 3V95A 3VI4E 2DM7A 2DWDB 4YPGB 4V2BA 1F45A 3GSRB 2BSSA 4S1SL 1QRKA 2OR7A 3ZE1E 1TQCC 5I17A 2B1AL 4QGYA 4D8PA 3QNZB 4G42A 1ZGLB 1MFDH 2WW8A 4EBQH 5I1HL 4Z77B 3B8SA 4YEEA 1YUHA 5I1CH 3HAEA 1GZPB 2HFFA 4F9LC 2C1OA 4LEXH 3VXNA 4PJ8D 4DJMA 1DFBL 1BVLB 3A6BL 5BXFA 1KCVL 4TUJA 3QQ4A 4PRAA 5J12C 3O6KH 2YN5A 3MV7B 3MV8D 3EYVB 2IPKB 3UXFA 4LVHC 5E5RB 5DD6A 5EU4A 1XGPA 4TTDD 4QT5B 4X9GA 5IW1B 1ITBB 4L8CA 3CH1A 3IAPA 1T2QL 5IBTL 2YUXA 3H42H 4I48A 2AJUL 3L3OA 3G5ZA 4IMKC 4OIIL 3BESR 1KN4H 4XAWH 4Z7UE 5GRVL 15C8H 2V2WB 2BHZA 2BZDA 1UFUA 4OCYH 5DUBA 4UILL 4AMKH 3U1SH 3MLWH 1T4KB 4RQQB 2JJUA 4IOFC 1JRHI 3DSNA 4MB4A 3FJTA 4F7TB 43CAA 1N6QH 4KJQC 4YDKL 2FH8A 5J3HD 3KYKH 1TQBC 1MCOH 2E6QA 4J4PC 3FRPG 4YUEH 1AO7A 1FCGA 3H8NA 5F7WC 3W82A 2COQA 3CDGB 4JJ5B 1JPTH 4JFZL 3LMJH 3CZFA 3H6JA 4PJ8A 1XF3B 8CGTA 2H8PB 3HRZA 3RBSA 1C7SA 5GGTL 4FRWA 1IKNA 3C5ZD 4LRIA 4ZOCA 2NXZD 3MV8A 3LQAL 4RFOL 5CP3H 2ZKHH 3OB0K 1VPOH 1NFIB 4FXGB 4MA7L 2H6PB 1X5KA 4LCCC 3A6CH 3CVHH 1D6EB 2NNAA 4HLZG 5GISL 1IILE 3BH9A 4G6FD 2YD2A 5DJZB 1ERNA 1VGEL 2NLJA 4J6RL 4LSTL 3PHOA 4X7FC 1M7IB 2HP4A 2H26B 1LO0H 3X3FH 3NFSH 1JHTB 4TNWF 4OF3A 5KSAB 2BOCA 2VXTL 3F12B 4WCYH 4OF7A 3MRPB 3VI3E 3HRPA 1MCPL 2AJZB 3PXJA 1NFKA 1DCLA 1D5XA 1PKQE 4E0RB 3QIWB 4F58H 3PG2A 1I7UA 2IGFL 2ZSWA 2IBGA 3LEYL 1BVKB 1SM3L 2XWTB 3PWUA 3X3GH 3ZKXB 4HUXA 4FFVC 1LNUA 4KUCD 1A7PL 1G7PA 1V8HA 1C5CL 1OTTC 3GI9L 3NTCH 2HT2C 4BZYA 4AT6A 4X7TB 2QR0A 5H94B 1AKJB 1S7TA 1MY5A 3SDXA 5I9QB 2DL9A 3RKDD 3VXMB 3VGEA 2VH5H 2UZXB 2OL3L 4D0CB 1DBBH 4Q74A 4OIBA 2NX5E 4UT6H 3CU1A 5KBNC 4KK8D 1MVFA 3RHWK 2P44B 4OQTH 1S9YB 2VIRB 2CD0A 3ZYIA 1C1EH 4Z7WB 5CCKL 4XWOC 1G9NC 5D6DA 4HCRH 1QACA 4LSQL 4WTZA 1G7LB 4Q6IC 3HR5B 5HYSG 3VA2C 1IM3B 1JHKH 3WE6A 4IOIA 2Q8AL 2WWMC 3QP3A 5IT2H 3RVTD 4HZLB 2HWZL 5FAAA 1BOGA 2DBJA 2ITCA 1UA6L 2OI9B 2HT3C 3CX2A 5HHVL 3G6JA 4NKOA 4XP5L 5ITBL 1NAMA 2FIKB 4Y4KC 3TF7C 3MPCA 4G7YL 3JWNC 1SVCP 2CK0L 2E6PA 1U8KB 1FORL 5GS3A 4NYLA 5E6ID 2X4OB 5J6HA 3QA3A 4ORGB 3DI2B 3K46A 4N0UE 3NCFB 3NCCB 4KTYA 4JG1H 4UINL 1WJ3A 2I9LB 5DJXA 4TVSa 2YA2A 4HF5L 3OXRA 1VFBB 1WIPA 3STLA 4OLZH 5KSBB 2VZUA 4ODWB 1F3DH 4H1LA 4UB0L 1JF6A 1QSFB 3FRUA 4U0QB 4EJ1C 4ODSH 2CDGA 2ZG3A 4XHJD 4U1SB 4PD4K 4X5WA 1G7IB 2ADIB 2JB6A 1F3DJ 4OZFB 5IEHB 3HB3D 4PJCA 2PN5A 2J8UF 2VLME 3HC0A 4KRPD 2IQ9H 5HY9A 3T1FB 3MC0A 3VRLE 1CL7H 2VN7A 1FE8L 2AAVA 4LRNH 3I75A 3VGAC 1ES0B 5GRUL 3WO4C 3X12B 3V5KB 3W2DH 3WLWC 3RPIA 4PRIA 1JTOA 1I9RL 4QXTB 1EFXA 3C6SB 3MYJB 2HTKD 3KDMB 3KPOA 1MH5A 1REIA 1U8NA 1A21A 4RGNC 4NBXB 2DLFH 4Y8AA 3MLXH 1VESA 4KTEL 4F80A 3KNBB 5BV7H 3QDJE 1ZT1B 4NZRH 4LPCA 3FMGL 3GJFA 5K9OB 3R06B 2E6JA 4PJ8C 1NCTA 1GSMA 1DBKH 4OCLC 1IKNC 3HMWL 4D9RE 4LRIC 2AJYH 2BNQD 1UM6L 4JFDD 1RZKH 1INQA 3QR2A 5BCAA 3MJ7B 5D70H 4PGBA 1XT5A 1MAML 3ZKMD 1RURH 3ZHKA 1LDPH 3OQ3B 4L1HA 3HLAB 1LK3L 2X4UB 4HMEA 4E41B 3BD4A 3WFHA 2VLRB 1JZ2A 3C5JA 1PFCA 4X6DA 5DJYA 2C3XA 3VFMA 4YWGL 1J0HA 2QEJA 4IRZH 1ND0A 5GGUB 4ZUWB 2BOBB 3VFNA 1LEIB 4O4YH 2HN7A 3PWNA 1QFWI 1C5BH 4O5LL 1F5WA 4FQQA 3PGDA 4K9EC 5SX4I 2DQUL 3DNKA 3F7VB 3RTQD 1DN2A 1NGZA 5GRZA 3CLFL 4YDIL 3QEQD 1B88A 5HHOE 3HC4L 43C9B 4PR5B 2ZCKH 4TRPH 1N59B 5IW6A 5EIIB 5ITFA 3HZYB 4M5YH 4PJDF 2HTLC 1TDQA 3SBWA 4CGTA 3BP6A 4DFHA 2F9BT 3HZVA 5JZ7D 1LO2H 1MQ8A 3L3DB 5C0BB 5TJWK 5I75B 2P24A 1CXKA 2DB8A 4HW6A 2A6KB 4F8TA 4PGJA 4F2MB 4XNMA 3SKMA 4HJGA 3FFCD 4PJFA 2VZOA 4WUUE 4E9LA 1ZVSB 5D6DC 1JBJA 2CR3A 3QIBD 5FKAA 4YDVA 4JREB 1JPFB 4HGKC 3ARYA 5CILH 4P2YA 5FUOH 2JELL 2FX8H 1MJUL 1R5IA 3MRQA 4WUKH 3OB0H 1MI5B 3LS4H 1UENA 5EZIL 3G6DH 3IFOB 3RTQA 5DEFB 4IMLA 2AJ3B 3OR6A 3QEQA 4XMLH 3B3IA 1MFBL 4AQ1B 4JO2L 1AP2A 3L3GA 3QXAB 3B9KB 1WWCA 2X4QB 1DUZA 1QO3A 2P8PA 1UM5L 3D3VB 1KFAL 3OG6B 4KPHH 5C0AD 5KS9A 1KTDA 3BIKA 3EFFA 1NL0L 3BZFA 1W72L 3D0LB 5BJTA 4O51B 5D7KD 4M7LL 3GSUA 5L88H 3L5XL 3CDYA 5D8JH 1FNEA 1MUJB 3FFDB 2FX7L 2ICEB 2R0WH 1Q9OA 2EYRA 4P4RA 3SDYH 2VR5A 3FFCA 4QHKJ 5K33A 4JKPL 5J6GB 1JYNA 4DK6A 2D0FA 2Y4SA 1QG3A 2MCPL 3QIBA 4DQOL 4KI5E 4L4VE 4I0KA 5F7YC 1K2DA 3LN5B 5E8OB 1QKZH 1JYWA 4PJGE 3PNWA 4OIAA 5EZLB 2IALA 3TZVA 5IB1B 2NY1D 4WIQA 1VADB 2GSGB 3DO7A 2GUOA 1XGYH 2Q3ZA 2FLRT 2FATH 2LU7A 2DAVA 2F8OA 2UWEF 3DYMA 1P69B 4Z7VB 3UJIH 3TYGH 2RCSH 2ORBL 2EH7L 4HIHA 2FHFA 4XNYL 4Z7QF 4JY4B 5C0AA 4HMCA 4X5LA 1T83A 5FYJU 5JHDD 1JP5A 1B2WL 2APBA 1KCRL 4LIQH 1PSKH 4I2XB 2J3SA 2BMKA 1CI5A 3EYFA 1JVKA 5ESVA 3LKQA 1A6TA 2FHBA 4TNVK 4XPTL 1GOGA 5FO8B 4JM2B 1NPUA 5DMKA 1N5AB 3SKOA 4OGYL 4OCXH 2UZYB 2WBJD 1DANU 4NO2B 1HOCA 4J2XA 2YR3A 4FQXD 3OKOB 4MXVE 4IM8A 2R2EA 4QYOA 5H2BB 1D9KA 1UXSA 2YD3A 4PLKD 3BEWA 4OCNC 3KXFE 5DI8B 1UQSA 4M62L 1T66D 4BK4A 2UZIH 4YDJB 1JYXA 1U8MB 3BYYA 4MDIA 1FO0L 2JIXA 2QQKH 3OKMB 3S4SB 1WLHA 2Y1VA 1NBZA 4YHNA 3ETBF 4LSVL 5HI5D 4NQCD 1FIGH 2IJ0C 4JFEE 1ZWIB 3T77B 4OZIA 4P2RD 4G6JL 4JFHD 4W6YB 5HD8D 1XZ0B 2L7UA 5IB4B 2IAND 1RI8A 5JHDA 4HEME 1I8LC 4PD4J 4ETQB 2VMFA 2R0KH 1IAIM 2CH8A 4EDXB 2OJZH 5KJRH 5F1KC 3D0VB 1PX4A 5JTWA 4GXUM 3BQUA 3GNML 4F37F 2PO6C 3GHBH 3RWGB 4JO4H 4LHUD 5E9DD 3LD8C 1TJGL 1S9VA 4HIIB 2WBJA 2NYYD 2GI7A 1X5XA 4AH2B 2JJWA 2ZJSH 3BKCH 4J8RB 3IRZA 2DN7A 1ETZA 1D5IL 3QFDA 3SOBL 5EH1A 1FZJB 1M05A 1A7NL 4V1DD 1IAIL 1F90L 2HVKA 2VQ1A 5IUSA 4L8BB 3G6AB 3K81A 1OD9A 3OBAA 2AK4D 2NW3A 3MUGA 3QDGE 1BLNA 3UC0L 5LG1A 5EBWB 5DVOA 2R1XA 3GSNA 4XCNA 2NY5L 3RZWA 4XXDB 5E03A 1QSEB 4CJ1A 1XGTB 5KG9A 3QHTC 5BZWB 3DPBA 3MUHL 5A40E 5IQ7L 1I1YA 2I5YL 3I6GB 2IH3A 1GGCL 4FTVB 2D9QB 5E8NB 3L3KB 3RTQC 1FP5A 4G8EB 4XB8A 2PTTB 1KNOA 2G9HB 3SGDI 2VDLL 3QXWA 4NKMB 5GGSY 1MHEA 3V6BR 3SPVA 3HNTH 1D5ZB 4ZFOA 5IVNA 3RGVB 3AXLA 4NUJA 2VXVH 1HYSC 4C59B 3LQZB 2YS4A 4NQDB 4GRLC 2WANA 4MAYB 1T7WA 4MA8L 1GGBL 1FV1B 3L6FB 4LHUA 5E9DA 5FGSA 4LSRL 2O93L 2R4SL 3IDYC 4LSDA 4PTUA 3UYRL 4XX1G 3MRRB 2P5ED 4OAWB 5DXWA 1YEGL 1U8IB 5GGQH 1FL3B 3QIUB 1JTPA 5DHYA 1G0XA 4BUGA 5DRXA 3NIGE 4OUOA 3VMPA 2WBKA 4WY7H 4ZOBA 1B0RB 1T1XA 3NABL 5BS0D 3QIBC 3O3BA 1O7SA 4M4RA 5FYJE 1CE6B 1DQTA 4PP2A 4RAVB 5GGRA 3ZLQC 4N1HB 5JOFB 1KTLB 3W39B 1P4IL 2X1WL 3OGCA 4WFGD 4OZHE 3TZVC 4ELKB 4ENED 1J8HD 1RZJC 3WKML 3WXWH 2APXA 1A47A 1EXUA 3GRWH 1MAKA 4J7RA 3U4EA 1H15A 3O2VH 4PJBB 3MLZL 3X14B 2CRMA 1EMTH 4RNRA 3S5LB 1S7XB 2OM5A 1TLKA 1RU9L 4F8QA 5MEPB 3VG9C 4AL8H 4ZFFA 1VFAA 3G08B 2B4CL 3PWPD 1YPZE 3VXOB 1LEGA 1ORQA 3OX8B 4ZUSB 4ELMB 1T1YA 4JKMA 1Y0LB 5ISZE 2OYPA 2G75A 4DZ8A 4FZEL 3BO8A 1IC5H 1TFHA 3U0WH 1UJ3A 1Q1JH 3IU4L 4OF5A 2X1OA 5SWSB 5EC1B 5I17B 4D8PB 2ZSVB 4GW5B 2IFFH 1WCQA 5E00B 3DXAD 1UCTA 3HAEB 2HFFB 1D9KC 2C1OB 3VXNB 1YEKH 5C0IA 1IGCH 2OX5A 3MRMA 4PRAB 2FJFA 2KBGA 4QNPE 4JPIB 3FO9B 1EPFA 1UZ8A 5C0DA 3RA7H 5D93C 1ZAGA 1CDUA 2OR9H 3G9AB 3VD4A 5DD6B 5EU4B 1J1PL 2RHEA 5FUCE 4L8CB 1T22B 2H32H 3X13B 5F3BB 3RY4A 1RIUH 4I48B 1ZLUK 3EHBD 3L3OB 3PWPA 1HWHB 1YECH 1I7ZA 3MOQA 3QI9D 3FQUA 3JVGA 2P5WE 5DUBB 1KT2A 3PHSA 3BQUC 1OAKL 3S36X 4A6YL 2B0SH 4KDTC 4YC2C 4MXQC 3EZJB 5HTSA 5ILTL 2R1YB 2R0ZL 2NY6D 1MCWM 1KN2H 3F7YB 1AGDB 4PJXE 4PRHD 3UP1A 3HI6H 2YKLH 2XQYK 4HH8A 4XMPL 1ZEAL 1HH9A 3EKCA 3FCTB 1ZVYA 2CXKA 5C0CE 3T3MF 3BP5A 3CZFB 5DJ2A 4O9HL 4PJ8B 4PLKC 4OLYH 1EZVX 4P9HC 1BFOA 4TQEL 2D7NA 1T66C 1AGFA 3G5VA 3MLUL 2Y06H 1P4LA 4FFYH 1OP3H 2ICWJ 3S9DB 4QHUA 3MV8B 2OK0L 4OZFH 1CT8A 4XAKE 1P9MC 3MO1A 4OV6F 3QWOA 4LPYA 2V7HA 3RUGA 3CX5K 4KVCL 5AYUL 2YC1A 3BKML 5KN5A 1YY9D 2BDNL 4N5ED 5E99L 3EIFA 1KB9K 1JN6A 4JZJA 2NLJB 1K4DA 3MTRA 4OFIA 3QI9A 1OT1A 1TVDA 3BDYH 3S36H 3E3QC 2D0HA 5B22A 1S7RB 2BOCB 1MWAA 1G7QA 4J1UA 35C8H 3U6RB 5J11C 1H5BB 4X98A 1CXLA 3PGFL 2ADFH 4WFFE 5HPMA 4E5XA 1QR4A 3HN3A 1I7UB 1WFUA 2ZSWB 5DUML 2P7TA 4RX4A 1PJ9A 3JUYA 3PWUB 4OM0H 4QKXB 3QQNA 4X4MA 1G7PB 4AK1A 2XZAL 4HV8A 3OKNA 3C5ZB 1T89C 3IGAA 2NXZB 1TTGA 1F4YH 1G7MA 2OMBA 5EZOL 5BVJB 5TPWH 1YNTA 3R1GL 4MJ5A 5T33H 1NGXA 4DTGH 4UOJA 5FYKD 1DANT 1VA9A 4OFDA 3UAJC 1FPTL 3N0PB 2G2RB 4X6CF 5ADPL 1LO4L 4G6FB 3HE6A 1ED3B 2H2PD 2JKXA 5EU6A 1HI6A 4C83A 3CJJA 1WFTA 3WE6B 4W70A 1MFAL 4ZUVA 4IOIB 3DX6A 2MWCA 3QH3A 4Z18A 4PJAA 3U2SA 5C6TH 1BOGB 4OV5A 2ITCB 1OL0A 1DQLH 1Q38A 3EYOA 4J3TA 4NKOB 3K8LA 3L5IA 1OY3B 4QXUH 3HA0A 1NAMB 5K9QI 4UQ3B 3VH8G 3DRTA 3EYUH 2WNGA 2VDPL 3VG0H 3FHQA 4NYLB 5DK0B 4P3DB 3K2MC 5J6HB 1HHIA 3MBED 1KENH 5FA3A 1TPXC 3KPRD 5DJXB 4JPKH 4KMQA 5F9DC 5IWLC 3OXRB 1IT9L 5DRZB 3STLB 1DBAL 1MREH 4H1LB 2I9TB 3WJJC 2CMRL 4M02A 5JIPA 3GMOA 1CF8H 2CDGB 4G3YH 3LKRA 3F5WA 1OP5H 1J1OH 4I3RH 1E4KC 1P84K 1FZMA 4Y19E 3U4BL 4PJCB 4XX1E 1KIRA 4BQ6A 4JDVB 2QL1A 3KYMA 2WM0A 4YPJA 3I75B 3P40A 5LGJA 1HKLH 4LKCA 3CC5A 1D6VL 3ZE2E 2ARJQ 2YK1L 3GM0A 3OPZL 3JVGC 2EE2A 1X5HA 4KKBD 5EA0L 1C5DA 2B7DT 2EXWD 4YIQA 4TUOB 3VFGH 1XCTA 3RPIB 1UYWH 3KPMA 1HHKB 5IF0A 2A9ML 1R5WA 5DR5L 2O5XH 2BFVL 3KPOB 5E6IB 4N8CL 1U8NB 4ZS7H 3KPRA 1CFQA 5I73C 5DVMA 1VFOA 4Y1AE 1OAYL 4NJAL 4NQED 4EQ2A 2J88H 3GJFB 5GJTL 3CCHA 3GHEL 5B8CA 1KCSH 4AM0A 1A5FH 3TT1L 1DVFA 2R9HC 5CEZH 2X10A 6FABL 2OCFD 5CGYD 1I3GH 1INQB 3CH8A 5D2LA 3C08L 1A4KB 3DUUA 4PGBB 2VWEE 4KRPB 3EUUA 3QJFA 3GIVA 3MLSL 5CJOL 5C9KA 3WFHB 3BUTA 1NMCB 2FEEI 3C5JB 2EZ0C 4X6DB 1OGTA 2WQRA 1MRDH 1WT5A 3VFMB 3DSFL 5EUOF 5IHUH 1IQWH 3ULSB 1DQJA 3QEHB 1ND0B 4YXHH 5C8JB 3VFNB 2HN7B 4KROC 2E8YA 4FXKB 1AR1D 3E8UH 1E4WH 5FA4A 5T1KD 3KPPA 4WEBL 4UV7H 5TE6H 3A67L 3PGDB 4FQQB 5F7UA 5HHPB 4RMQA 2QQNL 4TVPL 2QJDA 1EERB 4PG9A 5I1DB 4Q58C 4F7PA 3JBG7 1NGZB 1NBYA 1VB9A 4POZC 2JB5L 3MGOA 1CLCA 2YD4A 1FFRA 4PJEF 1BFVH 4PJ7A 1E4JA 4NQEA 5ITFB 4OGXL 4LBEA 4X7CC 4XNZB 3VA6A 1IC4H 3PP4H 3T0AA 3C6LD 1OSZA 4N0RA 1OTUD 3KPLA 4YO0A 3DHMA 3BP6B 3LB6D 4HZAA 3MRNA 5DO2D 3WFBL 2YPKA 5ENWA 2BNQB 4JFDB 2GJ6A 1TETL 4LL9A 3O0RH 3DVNA 5EU7C 4FNLL 1SEQH 4XNMB 1I9EA 3FO0L 3LHPH 4PJFB 4NJ9H 2MFNA 3HE6C 4P3CL 4DWHA 1SJHA 1TTUA 3BGFC 5CZVH 2J6EL 2W60B 5FKAB 4YDVB 2NTFA 3BUYA 2CKBL 5D2NA 4YHOH 3EO9L 1GAFH 3SE8L 1R5IB 3INUL 5AZ2H 5IJVA 3RTQB 4L5FL 1U8OA 2Q7YA 5BMFL 1P53A 4IMLB 3OR6B 3QEQB 3HMXL 3BPOC 3B3IB 3RDTD 5IR1B 5LKNA 4N9OB 1AP2B 3L3GB 4K94H 4F7MA 4FQLH 3VWKD 1DUZB 3E6HA 2P8PB 2NZIA 4K8RL 3CX5J 3C6LA 3BIKB 4OFPA 3ARUA 5BJTB 3DUHA 2EYTA 2FECI 1WISA 3GSUB 1JWSA 4AEIH 5I1GH 1ZK9A 1KB9J 5DD0L 4XBGA 3T4AA 1OAZH 5HVGB 2IADA 5JHLH 4OKDA 2H3NA 1PLGH 3RNQA 1F6AB 5L9DH 5E4EC 4I5BA 3IDXH 2R23A 3FFCB 1IEBA 1S3KL 3OJDA 4KUZL 5FECB 3GM8A 4YE4L 3QIBB 5EC2A 5GS0L 3ULVL 1ZLVK 1EGJA 3CGTA 1E6JL 3HPJA 3PNWB 3I9GL 4K07A 2MQ3A 3DV6B 1Y6KR 2PYEA 4OF6A 4QCIA 4UT7H 2PR4H 3IF1B 4X9HA 1MFCH 4L9LB 4X6FA 4PLOB 1IM9D 2IWGA 1BQHG 1FBIL 5F7KC 3RDTA 4UNVA 3NPZB 4MJIE 3VG9B 4S1QL 1HIML 4LFHD 1QVOB 5D7IA 1OAQH 3THML 2ZCHL 3OGOE 1CDGA 5C0AB 2X05A 3P9MB 3QZWA 2VDMH 3WUZA 4OI9A 1IVLA 2BMKB 3OB8A 3EYFB 3TWCH 1D3CA 1HINH 1CD8A 5I30L 3LKQB 3MLYL 5B39A 1A6TB 2IC2A 4FQ2H 5HHXL 5DTFB 4KQ4L 4JDZA 5DMKB 4Y5VA 5B8CC 5KANI 3NMEA 1GVIA 1UWEL 1DQDH 3AAZB 4MD5A 1DVFC 3HI5L 3O9WA 5DWUH 1J5OH 4XWGL 5I66A 2D31A 4QYOB 4LAQH 3TO2B 5BVPL 1UXSB 4OCSL 1MRFH 3BEWB 4R0LC 4R97C 3O2WH 1R0AL 1UQSB 2A6IA 2NY1B 4MDIB 3ARPA 3DIFB 1WT5C 5T5FL 3U0TA 3V8CA 1G9NH 4K3JL 1CFVL 5JXAL 4YHNB 2HRPH 5BOPA 2EYSA 2P43B 3CFEA 3TVMC 1BP3B 1NCBL 5T3XH 1IM9A 2VDQL 1BQSA 5EO9A 1NUNB 5SV3A 5I1KL 4FP8H 4JY6B 5I19L 2OP4H 4ORZC 2FJGA 1C8PA 4P59H 4KKLD 3VFWA 3S88L 1NQBA 3P0YH 5JHDB 2XWBA 4QRTA 3TFKD 2C7UA 1EJ6A 3H9SD 4QOKE 1IGMH 5EN2A 1P84J 5EB9A 1LE5B 4ODVH 4LSSL 2L7JA 3O8XD 5D6CB 2IMNA 4OB5H 1RUKL 2WBJB 5F88A 3TBVB 4A2LA 3AB0C 4L8SB 4WO4A 3NA9H 4FQXB 3NCJH 4HS6B 4GXVL 1ETZB 3HAEH 4QRPA 1LK2A 2HFGL 3V6OA 5HYEA 3QFDB 5JIIA 1M1SA 1OSPL 2NY3D 2P45B 2HVKB 25C8L 3O6LL 3UTSE 4N0UA 2NW3B 5TDOA 3QDJD 2R1XB 4XCNB 2X4PA 2ITDA 3ZSTA 4NQCB 4XCEA 4KGLA 4U1NA 2IH3B 4GSDH 2CO7B 2GT9A 4P2RB 3BPNB 4YAQA 1K6QL 2IANB 2I27N 3C87A 1BJ1J 4B7IA 1MHEB 3Q6GH 4YFDB 3H9SA 3NVQA 3AXLB 4NUJB 4YNYB 5F70A 1CFBA 1FRGH 5HGBA 3PGCA 1OTUC 5INCA 2HLFC 4LHUB 5E9DB 4TVPE 3RWCA 2EDJA 1I9JL 5DO2C 5TF1L 1AH1A 1PX3A 4PTUB 2J8UE 5FCUH 1CLZH 4DN4L 1A6UH 3WSQH 3P9WB 3OF6D 1MHHB 5I6XC 2EDWA 2F15A 2ZG1A 4V1DB 3UTQA 4OZGB 2MNUA 5K9JL 4QXGH 4H8WC 5HHOD 2HKFL 1IGIL 2AK4B 1BEYL 1FNSH 1T1XB 3BT2L 3ROLB 3MYZA 3ZL4H 3BSZL 1UCBL 3O3BB 4NNYA 5JUEL 1PVHA 4PP2B 1AXSB 1ZA6A 1TJIH 3H0TB 3V8OA 2IPUK 1WAAF 3OGCB 4ZD3L 2QADC 5D71L 1KJVA 3TO4C 3SCMD 1VSCA 2F5BH 1FNLA 3RP1A 2X4RA 4TNVF 3SDDA 2WBWB 1H15B 1YEHL 2D2OA 2ATPA 4WTXA 3SDCA 1IZJA 4Y4HC 4YHLL 4ZFFB 3BN3B 1VFAB 3NN8A 5FYLE 4EBQL 4QXWA 3IDMB 4ZAKC 2HH0H 1T1YB 1A7RH 4M61B 4R26H 3GO1H 5FUZH 2VC2H 2NY4D 2G75B 4DZ8B 5C0JA 3BO8B 3O6KL 4CMHB 4NNXA 4NDMA 2WV3A 1UJ3B 3FAXA 2P5EB 3GKZA 3OF6A 1F58L 1HCFX 4BQ8A 3HG1E 4LASL 1U58A 2DS4A 3T09A 3JTTA 1B0WA 3O9WC 4OTXH 5DDHA 1Q0YH 5DVNA 1Q9WA 1NLBH 1ADQL 3DJ9A 5BS0B 4CN6A 2VISB 5C0IB 4I1NB 4R7NA 4LP4A 2XTJC 5GGVH 1J8HB 3SCMA 1UZ8B 4AMKL 4L29A 4J3XA 2NW2A 3WHXA 4KY1H 4CW1B 1N6QL 4JO3H 2D7QA 3EJYD 4PJDE 2CGRL 2QTEA 1T7VA 3QXTA 5IM7A 4YUEL 3MA7B 3LKPA 3PWPB 4K7PX 1TZGH 1I7ZB 5GGTA 2X4NB 1YC7A 3FRPA 4KI5D 4L4VD 5HVHC 1KT2B 1NAMH 2GAZA 4JDTL 2BHUA 5GPRA 1MPAH 2UUDK 3WFDH 4KKCD 3MRKA 5MEND 1ZTXH 3AGVA 1NCWH 4N0FA 5DURD 1YN7B 4H25A 4NZTL 5GHWH 4HXAH 3DRQB 4YXKH 2OLDA 4WO4C 4UIMA 4UNTA 3CVHL 1R3KA 3BPLC 3DXAB 3V6OC 2IH1A 4H1LH 3UTTD 3VFOA 5DJ2B 5SWQA 3P3YA 4X99A 1U6AL 4PTTA 3C8KA 2OQJA 1BFOB 4IDJL 2DQGH 4YHYC 3I02A 1P4LB 4W4NA 4QHUB 2WUCH 2AEWA 3S3SA 2MOVA 2VZVA 3O6FD 1CT8B 1KJMA 2D7MA 2R0LL 3MO1B 4WCYL 3QWOB 4D2NA 3BMWA 2V7HB 3RUGB 4B50A 3DTXA 4YHKH 4ONGH 4DKFH 2YC1B 2PCPA 5KN5B 3ULUL 5E2JA 5LVEA 4FQJH 4GKNB 2Q8BH 5D1ZD 4XT1C 2BJML 5D7LD 4LSPH 1HSAB 1JN6B 4JZJB 1K4DB 3X3GL 4JRXA 1FCCA 4QF1A 3QI9B 3TFKC 1G6RA 1PDKA 3NTCL 3D9AH 3KR3L 3LEVH 3KXFD 3STZA 3D2UA 1MWAB 1G7QB 5MENA 4CNIA 1TITA 1FNGA 4X98B 3T2QA 5HGDA 2EH8L 2VH5L 2NY6B 5GS1A 1DBBL 5HI4C 5JDJA 3UROR 5HPMB 4E5XB 1X3DA 4YHZH 4PRHB 4JFED 1MHPL 2A77L 5A2FA 1FN4A 3C60D 4BZ2H 3GJFH 3UTTA 4QO1A 2X41A 1HKFA 5HPOA 1J12A 1AY1L 3OKNB 3ARBD 4JHWH 4MSWA 5HBBA 1RHHA 5CSGA 4YBHA 3IGAB 4GQPH 5J7CC 1MF2H 1G7MB 3O6FA 4AG4L 5E2VL 1YNTB 4PV8B 2XRAH 2PUQT 3UTZB 1NDGA 3MUY1 1DLFH 1LQSR 3C5SA 2XA8L 4Z7QE 1F2QA 5D1ZA 5D7LA 3MNVB 5EU5A 3U7YL 3SDDC 1RZ7H 3LEXA 4JN2A 1UB6A 3SDCC 1HI6B 4C83B 5DS8A 4ZUVB 3KXFA 2I26N 3DX6B 2QBWA 3QH3B 5C07E 4PJAB 3U2SB 3MRGA 4OV5B 2ED7A 2DLHA 4YBLB 3BPOB 2MCG1 1T5XA 5I74B 4XXCA 4UMGA 4X6EA 1X44A 2ZUXA 4PY8J 2MJWA 2GFBB 4ZODA 5FA3B 1JGVL 5FHBH 5JR1L 2O5ZH 2EIZA 3ARBA 1CL7L 4NP4H 4LRNL 5D96C 4PRPA 1EO8L 2QV2A 3QG7H 4JM2F 5ADOL 1AXIB 1RZFH 5IBLC 2R39A 1BX2A 1V7MH 3B9DA 2H2SD 1JE6A 3D18B 3LKRB 5I8CA 5EDXA 1BAFH 3ABZA 4IRSD 4PJIA 4V2CB 1MELA 4Z7OF 4NHCH 5I2IA 4DZBA 1ITCA 4H88H 4TUKH 5IMOB 1KIRB 1UH3A 3KYMB 1KPRA 4W6XB 5L6YL 4HJJL 4HUVB 2VQTA 2DLFL 3CC5B 4HH9A 4FQIH 4LCYA 1ACYH 5EWIH 3C09B 1UG9A 3M07A 3QFJD 2DQTH 4M1GH 2NY4C 1C5DB 1JF5A 3VFTB 1DBKL 4RMWA 4YIQB 3ZDZF 5IVXA 1XCTB 2X4SA 3KPMB 3TCLB 1NC2A 3F7QA 3P73A 1RZKL 5IF0B 2V9RA 4OLXL 1R5WB 1RUAH 5CUSH 1N7MH 5D70L 1CDYA 3FO1B 4C56E 5T1DH 3MBEB 3IKCB 3FQXA 4TPRH 1RURL 3KPRB 1LDPL 4Z78B 1O7VA 5E7FA 1T0NA 3NZHL 5JPNA 4CDHA 3L3JA 3OKYA 3CCHB 4PGDA 2L4OA 3TNMA 3RVUC 5IB2A 3BYTA 4I4WA 1L0XA 5IMKA 5B8CB 1G7HB 2W9DL 4AM0B 5JXED 4UQ2A 4HDIA 5C71A 2Y6SC 1QTYT 4IRSA 5D2LB 3CFKA 3DUUB 1R3IL 2GY5A 5C9JA 3RWHA 2DJSA 5FCSH 3QJFB 3GIVB 3T65A 4PGCA 1RZJH 1WITA 4HFUL 1JGUH 1OGTB 3QHFH 3WEXB 4FQCH 1VFMA 3QFJA 3BRGC 1DQJB 4JN1H 5GSVA 4I3GA 2GHWB 3ARDD 5GJSH 1UZ6F 2DJUA 1N4XH 4P46D 5FA4B 3KPPB 3FONB 2A38A 5F96H 4PG9B 1ZT7A 3L95A 5HI3D 5C6PB 4F7PB 5BZDA 3MGOB 2CLVB 2FO4B 4KHXL 1VERA 3I85A 4WWKC 2Q86A 4PJ7B 1R5VA 4NQEB 5ICXA 3HHRB 1PW3A 1T2JA 1OSZB 5IW3A 3KPLB 4P9ML 5JXEA 3IJSA 2DBLH 1YYLH 5F1NA 1RK0A 2C3WA 3TT3H 4L4TA 4FFZH 3N1MC 1VDGA 5F71A 4WUKL 2VN4A 3DVNB 3LS4L 4NWTH 3G6DL 2AGJH 4M9PA 4TSBH 2FYYA 1ZHLA 32C2A 4TTGA 2O5YH 3OR7B 1GGTA 1A6WL 4RISH 5F7EL 3JWOC 4PUBH 1VEOA 1Q72H 1UEMA 3EYQC 3DROA 1T5WA 3RI5K 1W72A 2Z93A 3NAAH 4KPHL 2NTFB 3BUYB 5TGBA 5IGXH 5D2NB 2XQBL 3ARDA 3CVIH 3VE0B 3MCKA 4CVWA 4CRPA 4P46A 1JPSH 5T1KB 3OKDB 1NFDF 3FOMA 4MA3A 2AJSL 2HLAA 4MNGE 4PJBF 1HNFA 2Q7YB 4RFEA 4XAKD 2CIKA 4MD0A 1HE7A 1T20A 2VJXA 4XXCC 3VFVA 4F7MB 3SDYL 3U36B 1I1AD 1WC7A 4M7KL 5L2KE 5C2BL 3P9LA 1CYGA 4AZ8A 3KLAA 1NBVH 1JNNH 2P48B 3C6LB 3Q48A 4ELMF 4PB9H 1EVTC 5I8EA 1N0LA 1I4FB 4BZ1H 1I8MA 1F8TH 1KACB 1JWSB 3OZ9H 3NH7H 3QUXA 1KXQE 4XBGB 3T4AB 2IADB 4DGYL 3FO2A 2X09A 3EO1A 1R3LA 2H3NB 4U6YA 3I3DA 5HGHA 2FATL 5D7SL 3WL9A 1IEBB 3NCEB 4PB0L 2VDRL 5D1QD 3TYGL 3VRIA 3AY4C 2NY2D 3GSNH 5EC2B 3FN3A 4ZS6D 2YZ8A 5D9SB 4XNUH 3HPJB 1NGPH 5LGKA 4GKZB 4OD2B 5IHZA 1EJOH 4QCIB 1JMZA 4WGVB 5JW4M 3BH8B 4XBEH 3W0WA 3IU3A 4R9HA 2J1KA 5FF6A 3RDTB 3T3ME 2QQLL 3QPQD 2ZUVA 1WQVT 4MD4B 4CADB 3VWKB 4DUVA 3JV6A 2XXCB 5I18L 4POYA 2BY1A 3QZWB 3O4LD 2VXQL 1CLYL 1OARL 5CJQL 1ZV5A 4EEEA 5CEYA 2DQDL 2QSQA 5JOEA 1FO0A 4NZUL 1XR9A 4MA1C 1JZ5A 5DJ6A 4OD1L 2YMXH 2UZIL 2EICA 1JZ4A 5B39B 4Z8FH 4PJHE 3ALPA 4U6VH 5DFVC 3IDJA 3ES6A 3QO0A 4Y5VB 4ZNEE 1HQRA 3MQIA 5I76A 3QUYA 1FIGL 3O9WB 4JVPA 2ED9A 4FFWD 5I66B 2D31B 1H3WM 5D1QA 3CZJA 1CCZA 4JQVA 3ZO0A 4LPWA 4PLNC 2VLJE 4KGJA 3P4NA 4ZSOE 1MLBA 2PETA 1YEFH 4N0CC 2CIIB 4PJ9D 3V0WH 2A6IB 4XPFH 5JO5B 5KJRL 2JCCA 1ZLSL 2A1WL 3U0TB 1FFPA 4NSKB 3QXDA 4OFYD 3CFEB 4FZ8H 2N7BA 3IFPA 3MJ9L 1IM9B 5EO9B 4LCWE 5KVGH 3VRJA 3BE1L 5KW9H 5EBMB 2ZJSL 2AXHA 2Y36L 3QXVA 5FO9A 2FJGB 3HI1B 4KMTH 5EOQH 1AQKL 4QY8A 2LVCA 3O4LA 3VFWB 4Y19D 5JQHC 2XWBB 5CLWA 4QRTB 2AQ2A 2H45A 3B5TA 3FB8A 5B4MD 3OL2A 5FM5O 4UIKL 5EN2B 5LCVH 3SO3B 4GAYB 1ZSDA 5IVOA 2GEEA 4NWUH 4G8GE 4QHMB 1YEJL 5I1LA 4X6CE 1RZIB 5F88B 5IROA 2HJKB 3M1BB 3TN0A 3G5XA 1YNLH 4YBQC 4BH7A 1QNZH 3O11A 1TCMA 1BM3H 1AFVH 2YD5A 4YQXH 1LK2B 4JKWA 5ALBH 4DKAA 4ZNCD 5DLMH 7FABH 4JM4H 1BBJB 3GBNH 3HKFA 3SKUD 3RIAF 4N0UB 4EDWL 3SDXF 2RFXA 2OXHA 5GSRB 4ZQKA 1WV7T 5C86A 1P4BL 2X4PB 2VITB 2ITDB 3BN9D 4OLUL 4DW2L 2HFEA 4ODTH 5FOBA 2A0LC 3WFEH 1K8DA 2HAZA 4ZXBA 3N1QC 2GT9B 1T3FB 2OMNA 4H26A 4PJ5A 1U3HD 3LQMA 1A0QH 1I1CA 1N2RA 5BO1H 3VXRE 1IGTA 1NLDH 3H9SB 2IG2H 2VXSL 4WY7L 2XN9E 3S96B 2IBZX 4URTB 3O8XB 1VKXA 3PGCB 3KPNA 4S1RH 5INCB 3GSOA 3MRCA 2DQCL 3G6JF 1BD2E 4NM4H 2FHCA 4HT1H 1IC7L 4QHNB 5C0RL 3QUXC 4K2UH 2V5TA 4XPHH 5FV2A 3WXWL 2F53A 4KUCF 2NY3B 1GL4B 3G5YA 4NBYB 1JHLH 1X5IA 4ZYKA 5ID0A 4AL8L 4WW1A 4LNRA 4ZOAA 3QDJB 4NNYB 4U7SA 3TPUA 4NGHL 2MQCA 2VL5B 2OS7A 3D39E 3ILQC 1ZA6B 2VLLA 4QHLA 5C08E 5DD5H 4R7DA 1LO5A 1KJVB 5DRWB 4K71B 2X4RB 1Q1JL 3PQYE 5CKAA 4PJCF 4PV9A 4KQ3H 2ATPB 2DM2A 4G9FE 1YYMH 3V4VL 2XWJB 4P2OD 4U1LA 4XTRD 2ZOLA 1MWAH 4Z6AT 4WU7A 3VD7A 1QRNE 1B6DA 1F97A 1JWUB 3ZKQD 4G6KL 3T0EA 2AI0H 1UKQA 1RFDH 1S78C 4ZTOL 1HQ4B 3F6IA 4YK4B 4NZDA 1JRHL 3T4YA 3RU8L 4HJ0D 1IFHL 5AG8A 4HKJA 2OR9L 1SHMA 1KLUA 5FGCE 3U30B 3QUYC 5GGRY 2EDOA 4TNWK 3TV3L 1JWMB 5EUOE 5HHOB 1FZOA 2YSSA 1Q9WB 4NT6B 3EDFA 3T2NH 1YECL 3JUZA 4R7NB 4XNXH 3SE9L 3RVXC 3SCMB 3MCG1 1KIUA 2EDTA 4GT7A 2NW2B 4W68A 3WHXB 2X9XA 3LDBC 5D1XD 2R29H 4PJEE 3KPSE 4YZFF 4OUUA 3RWFA 2AV7A 4M93B 2XZQL 1J11A 1RUQL 4OM1L 5IM7B 3LSOB 2DMCA 3LKPB 4X6DF 1C16B 3HI6L 4LIQE 4OZFG 3K3QA 4I0CC 4OLYL 2PYFA 2NY4B 4ZUTA 3PJSB 4OT1H 2GAZB 4FFYL 3MXWH 5I71B 5MP6L 4N0FB 3IT8D 2EDBA 5DRNA 1KF9B 3BAEH 3FB5A 4MJ2A 5IROC 5AAMA 3SJVE 4EI5D 5CZXC 3QNZA 1BZ9A 3TN0C 3CXHJ 4UIMB 1MFEH 1R3KB 4X8JA 1MFNA 1KSRA 5LBSH 1UEYA 4MJID 1GZPA 3VFOB 4XP4L 5SWQB 4PTTB 3C8KB 3S37L 2X42A 3PV6A 2IPKA 12E8H 4RFNC 1KJMB 3U83A 5D1XA 1UB5A 2IPTH 4OD3L 3K8KA 3UMTA 2PCPB 1L7IH 4ZXBC 2CDFB 4PJFF 1QUNA 3UJTH 3GJEA 4DGVH 3ILPB 4Y5XC 4YDLC 4HIJA 4W81A 5B4MC 4L4VB 3MBXH 3QDMD 1S7VB 4NRZB 2X89D 3AFLA 1T4KA 1J9CT 1V05A 2KUTA 3B5HA 4PJGB 3STZB 1WZLA 3F62A 4F7TA 5MENB 4R2GC 4CNIB 2OL3B 3RIFF 3V79C 5DURB 4MNQD 4OCRH 4BJLA 4Z7NF 1S7SA 2UY7A 3OAYK 2P46B 5GS1B 4DTGL 4NC2B 3D87B 5D5ME 3CDGA 2WUBL 1FN4B 3FQTB 4XC3L 3RFZC 2BRRH 4L9DA 4J12A 3UTTB 5DD3L 1E4XI 3FOLA 5KS9F 3MV7E 1XF3A 2H8PA 2QSCH 2ENYA 4JY5H 1IKFH 4F15B 4MSWB 4KHTH 3BKJH 1A9BA 4LLQA 4HLJA 3O6FB 4QOKD 4QEGA 2Q87A 5F7DA 4DFIA 5IV2B 1WZ1H 4XCCH 4FXGA 5C6TL 1NDGB 1I9IH 1QFUL 1DQLL 3C5SB 4LOUD 5DGRA 5J0BA 1PG7X 4QXUL 5IK3B 4JO1H 5D1ZB 5D7LB 1DL7H 1OGAE 5DJZA 5EU5B 2VKXA 3LEXB 5F8RC 4JN2B 4XVSL 3RY5A 3VG0L 1UB6B 1A4JB 4UTBL 1M7IA 4QWWD 2AJVH 3QDMA 1JHTA 2X89A 4G5ZH 1CFNA 3KXFB 4JPKL 5TQ2H 3UTSD 3MRPA 3EYSL 4MZ3A 4OSUH 5FOJA 5JDSB 3DGGA 4E42A 3MRGB 3O3UN 4MNQA 3TBYA 2BXZA 4GKOA 1MREL 4NZJA 3T0EC 5IJKA 3MOBH 1T5XB 5FDWA 1MCHA 3MFGB 4JFEB 1OM3H 3RX8A 5E5MB 2XWTA 2GIYA 4X6EB 3C60B 4NBZB 4I3RL 3DETC 3VFRA 4PRNA 3TH2T 4M03A 1YJDL 4PIRF 3CFBB 2BVUA 1FL5A 3ARBB 4X7TA 4D9LL 5H94A 1AKJA 4WEUD 3MNWB 1HKLL 3H9ZA 4PY7B 2MHAB 2C3VA 4RWHA 4P4KD 1BX2B 3U0PB 1PG7H 3AMKA 4BFEA 4DVRH 2VIRA 3NPSC 1QFWM 4TVPD 4MVBC 5I8CB 5K93A 4Z7WA 4PJIB 4DZBB 5FK9A 3BDXA 3U79A 4EN3D 1MCEA 1Q8MA 3CUPA 2DRUA 3TEUA 1KPRB 2O5XL 4RAHA 1G7LA 1FAKT 4XTRC 4O02H 5TFSH 4G6AC 1ZANL 1NGYA 5J1SC 1EAPA 1NANH 4MYWB 4ZUUA 3REWA 4HH9B 1QR1A 4JANA 4LCYB 1I7TA 2J88L 4MNHA 1EV2E 1AD9A 1RJCA 3K1DA 5JW3L 5E2WL 1QFWL 5IFAL 4OZIF 2HVJA 2FIKA 4U6TA 2YPVL 4NCDA 2X4SB 1ZHBB 5IBUB 3WIHA 3P73B 3S7GA 1HCVA 1T04B 5CAYB 3IFLH 5FB8B 1RJLB 4GAGH 3RQ3A 3V7AG 4ORGA 2YRLA 2XIDA 4JFFD 3LZFL 2I9LA 3LCYA 1GGIH 3UBXA 3VXME 4JPVL 1VFBA 4ZG1A 3MXVL 4H20L 1JCKA 1C08A 4MA1B 4OGAC 5KSBA 1T0NB 5JPNB 4ODWA 1WIOA 5BOZG 3L3JB 3GZKA 1S9XA 4MZ2A 1QSFA 1H3XA 1FLTX 4PGDB 4EIZC 5IB2B 3ZYJA 5IMKB 1IQWL 1JZ7A 1OTSD 4LPTA 4UQ2B 4X80L 4HDIB 1J1XH 1M7DA 1ROWA 1G7IA 4H8WH 1RZ8A 2ADIA 4IRSB 4UV7L 2X4TA 3CFKB 4KKAC 3WFCL 3ZT6A 4EN3A 5C9JB 1RIVH 3RWHB 1QQDA 5EU3A 1K4CB 3O4OB 4GBXD 1OPGH 3HG1D 3T65B 5EOCH 4XP9L 1XAUA 4PGCB 4K8RD 3BRFA 2Y07H 4X4ZA 4PG2C 2F19H 5ACLA 3V6FA 2F54E 5HDBF 3QFJB 1DQMH 3DMMD 4GQ9L 4NN6C 3PP4L 5GSVB 5I1JH 5FV1L 3MYJA 3RVVD 5E08L 1ZT7B 3L95B 3S4SG 1P7KA 5J56B 4X83A 3RY6A 4JFFA 3MCLH 4CU7A 2Y7QA 1CL7I 4KZEL 2ZUWA 3LHPL 4NJ9L 1WAAE 5GS0D 3ULVD 5ICXB 4EUPA 2CKBA 2NR6D 1FG2A 3LPGA 3QULA 1UWXK 3Q1SL 5CZVL 3IDUA 2R56L 4KK5D 1DSFH 4NC1E 1Q94A 3STBA 4GMTH 3QNYB 1H3UA 1RK0B 1U3JA 2DYPD 4NM8H 1KELL 1QBMH 3MJ7A 1BZ7A 2FCBA 2CRYA 3N9GH 1EEUA 4GBXA 1ZHLB 2XV6B 3HLAA 2X4UA 4E41A 3V4UH 4F3FA 4Z0BH 1GIGL 4PP1D 2CLRA 5J8OA 4HK3J 3DROB 3F58H 5DHVA 1T5WB 1W72B 2Z93B 2ZUSA 3DMMA 3Q6FA 5GGUA 5TGBB 4LLYB 4ZUWA 1N6VA 3S97C 3QQ3A 3ARDB 2NY0D 5KSAC 3MCKB 4FABH 3HTLX 4P46B 2HT4D 3MLRL 3BHBB 3FOMB 4MA3B 5I1GL 2P8LA 2HLAB 4M6MH 4G8IB 1OAZL 4D0BA 2EXYD 5IJKC 4AEHH 1DBMH 3MGTA 2CRIA 5AD0B 2CIKB 2E9JA 4MD0B 3DO3A 3VFVB 5B3JF 1WC7B 3ZKXC 2Y72A 1GXEA 2C9AA 2EEBA 1IBGL 1EEYA 1OAXL 4OJFH 2J4WL 5I8EB 5C0GA 4QTIH 4C54A 3QRGL 4F33A 3UZEA 1CGSH 2DYPA 2CUHA 5I9QC 1YDPA 4G8FA 2PTUA 4JFOB 5TQ0L 4XP6H 2A6KA 3O3DB 2HMID 4PBVC 3FO2B 3EO1B 2VLRE 1R3LB 4U6YB 3ET9F 5F9OH 4F2MA 1NUDA 1U8LA 3WL9B 4M7JH 4KVNH 5TDNB 3JZ7A 5ANMA 3VRIB 3NFNB 3ZSSA 4F37K 5JQ6L 1INDL 1AXTH 1FFQA 3CK0L 4U1JA 2DI8A 2VDML 4K3DH 4UOW1 5J9PA 4PRDB 3TWCL 4JGJA 1HINL 4Z76A 1MI5A 2FGWH 2OI9C 3R4DA 5DEFA 2AJ3A 2Z31D 3IU3B 1NMBL 3AS0A 3S6CA 5KSVB 4YFLI 3ZT7A 3EDJA 3B9KA 2YUVA 4K23H 3N1FC 1I1AB 3MUZ1 2V5RA 4LLVB 1XF2A 3CMOH 3RAJH 3W5NA 2QQQA 5C0BE 3S5LG 3ARFD 3GSWA 3D0LA 1BZQK 4O51A 5C0ND 1JV5A 1FO0B 4U1GB 4HIXH 1XR9B 4ESKA 5JMRA 1SJXA 1LHZA 3LPFA 3V4PH 1QHOA 1MUJA 2AK1H 2ILLA 3FFDA 3QO0B 4IEFB 3CD4A 5C07D 3LKNB 4F57H 5I76B 2D03L 5E8DH 3HNVL 3QUZD 3IFNH 4RGOH 5J6GA 4RRPG 5H37H 1HYRC 3WDHA 5D1QB 2OP4L 2NY2B 3D5OF 5E8OA 4I8DA 3P4NB 1MLBB 4S1SH 4QRRE 1T0MA 5EZLA 2HKHL 1VADA 2JCCB 3BP7A 2J12B 4XPBL 2B1AH 3HAEG 2AP2A 4QHKI 2P8MA 1FFPB 3QQ9C 1RK1A 2Y5TB 3RUGF 5HSFA 4N5UA 2Z31A 1KCLA 5I1HH 1U8PB 5DMGC 4JG0L 4Z7VA 3VRJB 3D3VE 3LIZH 5DK3A 1DFBH 2ERJB 3A6BH 5F1SA 1KCVH 1LDSA 4GMSL 3WJLA 5F7MC 3O4LB 5BRZD 3ARFA 2BK8A 8FABA 4B41A 1ZSDB 2BXYA 3KJ6L 4Q9RH 1N5AA 4JR9L 5FHAL 1T2QH 5HHMD 5IBTH 1MCIA 4TSAL 5I1LB 2FEDD 1U3YA 2AJUH 4OIIH 5E95B 3QUZA 1T03L 3G5XB 3GMNA 4BH7B 5F6HJ 3O11B 4CVZB 2FX9H 2JE8A 3BGAA 3FT3A 5CIPB 2VERN 1SBSL 1KIQA 2Z4QB 3ZHDA 4LNVA 4C56D 2DD8L 4M6OH 4PJ9B 4YDJA 4Y8DC 4AQOA 3V7AE 4YDKH 2RFXB 1EUTA 3OXSB 4ZQKB 4DVBA 3E1F1 3OKMA 2V7NA 1V5JA 1YA5A 2HFEB 4JFZH 3MRFB 1G9ML 1K8DB 4EVNA 5FCUL 3K2UH 1CLZL 1OW0C 3MRBB 5JA9A 4H26B 1AGCB 4I2XE 1XZ0A 3WSQL 1T80A 2UYLA 5GGTH 5IB4A 5BRZA 4YDLB 4Y19B 1N2RB 2XG4A 4P2QD 1N3NA 4RFOH 2MKWA 4G43B 4MHHG 4QXGL 5GS0C 4NKDA 1GHFL 4MA7H 4PJAF 2NR6C 3KJ4C 3UTPE 4BFGA 3RWGA 3V52L 3SE3C 4HIIA 3GSOB 3MRCB 1TJIL 4Z7OE 3M8OL 1FDLL 1RUPL 5I75C 4FMKA 1VGEH 4J6RH 4LSTH 4BQ9A 2B20A 4AIOA 1Z3GH 2K7PA 2XYCA 3G5YB 2VXTH 1VFUA 4J3VA 4RAUB 3P0VL 5DC4B 4ZYKB 3AU1A 5ID0B 3TCXA 4WW1B 4LNRB 1UACH 2BERA 5GZOD 4JJHA 1U8HB 4JREC 4K9EL 2I25N 3SKNB 3ZDZE 2VLLB 4PPTA 3TM6A 4QHLB 1ACZA 5I15L 2IGFH 6CGTA 4R26L 5HYJD 1I8KA 3LEYH 3GO1L 1SM3H 4R7DB 3TIEA 3I6GA 1LO5B 1IAKB 4RWYL 3LH2L 1A7PH 3B9EA 1C5CH 2GITB 3GI9H 4DK3A 4PV9B 4YJZL 2ICCA 1U3HB 1A6VL 2A83B 3GI8L 2G9HA 2E7LC 2H41A 1G6RH 4NKMA 4P2QA 4OLWL 1ADQA 5F9AC 1D5ZA 4U4BA 3B9KC 3V2AR 4GRWB 2E5EA 1DBJL 4WU7B 3LQZA 4NQDA 4MAYA 2OZ4L 3AS3A 3ARGD 3W11C 3L6FA 4JRYD 2LU3A 1KEMH 1E6OL 2YWZA 3MRRA 3T4YB 3F7PC 2VDNL 4JFXB 2HMIC 4LSQH 4HKJB 4HGWA 1KLUB 3QIUA 3T08A 3ULUD 4D9QD 3NCYS 4JO3L 2RR3A 2W1NA 2EC8A 2P47B 4PYHA 3WNKA 1QSEE 4OKVA 2HWZH 4HBCL 4N90E 5KOMC 3ZHLA 5CD3B 4RAVA 5HHVH 1UZ6E 5L2KD 4LP5A 1KTLA 1GYAA 2NZ9D 5HYJA 4G7YH 4A6YB 2CK0H 4BFIA 3JWOH 4C4KT 4Z95L 5D2LF 5FM4A 1CDBA 2D4FA 4H1LG 5IFHL 4M1DL 1S7XA 2LFGA 4OUUB 5GHWL 2YBRB 4YXKL 4GUPA 4JB9L 4P2OB 1ODAA 4TOYL 4XVUC 4UB0H 1JPGB 1OQOA 3WJLC 1X4XA 5ICZA 3N50A 3RVWD 3ARGA 3ARFC 1Y0LA 4JRYA 4P0DA 5IKCA 2PYFB 4ZUTB 4EOWL 5J13B 1CS6A 2JK5B 1QBBA 2DQGL 3VXSE 2C4FU 1ZOXA 4U49A 4JM2C 1KC5H 5SWSA 4UBDC 1FE8H 4C57C 5EC1A 5DRNB 1A9EA 2EDYA 3FB5B 2ZSVA 5CZKA 4QRSA 1BZ9B 3QUZC 4GW5A 5IFJA 1J0KA 5E00A 5GRUH 3ZKND 3K4DA 4X8JB 1OWRM 4PJ7F 2Q8BL 3VJ6B 5EULV 1NFDE 3WNLA 1I9RH 2O61A 4JPIA 1DUYA 3NIFF 1F2XK 4PJBE 1PEWA 2R1WA 3D9AL 3FO9A 3LEVL 3PV6B 2LABA 1JI1A 3MREB 4M4PA 4BSWB 5D1XB 5EORL 1UB5B 2FDBP 4KTEH 3PABB 2DTML 1T22A 3ZE1F 3X13A 5F3BA 1MIML 3FMGH 1TJHH 4X7SH 4ELME 3GJEB 4YHZL 1E4XH 1X5LA 4HS3A 4OFKA 1HK6A 1SEBB 3HMWH 1U8JB 4BZ2L 4HIJB 5F7LB 4NN6B 4Y16D 3ARSA 4X6BB 1UM6H 4L3CA 3QAZB 4K94C 5K9QG 2VLJD 2X9YA 5IG7B 1TXKA 2WINA 4GLRI 4HKBA 3SY0A 2FL5A 3HFML 3WHE0 1LK3H 4UZGA 1S7SB 4XI5C 2R1YA 3UTOA 3RWEB 3F7YA 3LPWA 1AGDA 1I3UA 3DYPA 1DLFL 2OJEA 3AM8A 4YWGH 1ZGLP 4LCWD 1XIWD 4KXZI 2WIMA 1MVUA 4Y4FD 3FCTA 4MJIB 3D85D 5ETUA 4MX7B 3FOLB 1KJ2B 2ESVD 5DSCA 1RZ7L 4HWBL 5F1OB 3P11H 3DVIA 5CBEA 3SDAD 1A9BB 2VZ1A 1FVCA 4LLQB 5M94B 3CLFH 1I85C 4YDIH 4ACPA 4ZTPL 5F7DB 4PJHA 5MEOB 1ZT4A 3TNNB 5GS2H 2E7BA 4MCZA 4NO0D 4TULL 2YPLD 2X2YA 4U2ZA 5J57B 4KZDH 1FAIL 2ICWI 1CDJA 2XA3A 2FR4A 3QDMB 3RGVC 5HVFB 4ZSOA 1S7RA 2O5ZL 3S3PA 3VH8B 1CFNB 4KRMB 4NRYB 3U6RA 2D0GA 1ZLWK 4LPXA 1H5BA 4MAYC 4RGNE 3DGGB 3JV4A 4E42B 4MNQB 1AO7E 1BWMA 3QG7L 3TBYB 3ZT5A 1EHLL 2VL4A 3H7LA 5FDWB 5D7IF 4CMMA 1XIWA 4Y4FA 3D85A 3VFRB 4PRNB 5C7XL 4U1MB 2ESVA 2JELH 5EO1B 3QIUC 3F7RA 2XY1A 2ADGB 2IPUG 3UPCA 3C5ZA 2N1KA 1FL5B 3H3PL 3SDAA 3VXRD 2DWEA 5BVJA 1SQ2N 5LWYH 5DZLA 4QOKB 4FQIL 1JNLL 4S1DC 4LARL 4JO2H 2XN9D 2XZZA 4OGZA 1V7NL 2C3VB 2J8OA 3NIDF 4O58H 5DT1L 2DQTL 4M1GL 2H1PH 4NO0A 4IRJD 3IAGC 1OP9A 1BD2D 2G2RA 2NXYD 2YPLA 4GO6B 4HHAA 3IS1X 5DJCA 3CXDH 1ED3A 1WBZB 3MLTA 1EHAA 5FK9B 1NL0H 1W72H 3RBGA 1YN6B 1N7ML 3CUPB 3E2HB 2CQVA 3IDGA 4M7LH 4WENB 1T21B 4NN7C 4I77L 3L5XH 1T6WA 1NGYB 2FEEL 1EAPB 4ZUUB 3NCYP 3REWB 4GW4A 3QBTB 2FX7H 1F00I 1CQKA 4JANB 3UTSB 1QR1B 3T8XA 1GZQA 4ZFGL 1I7TB 4UV4L 5FM8A 4JQIH 4MNHB 4KK6C 1AD9B 1AE6L 3D39D 4J3UA 5LXGH 3TBWA 3W5MA 2EDHA 3I3BA 5HGAA 2HVJB 2MCPH 2X40A 2XZCH 4M00A 5A2KH 3NACL 4DQOH 3L9RB 4UQ3A 5C08D 3I6KA 5DA4A 5DK0A 1WSST 1G1CA 4P3DA 3WO3B 3PQYD 3SDXE 1G6VK 3ULUC 2EDEA 1H8OA 4NNPL 3RKPA 2AABL 3UBXB 4G9FD 3VXRA 4KDWA 1QBAA 5DRZA 1C08B 5SWZE 3VXPA 1RZJL 4P5TD 2I9TA 1S9XB 1JGUL 2B2XL 3QHFL 2XN9A 4FQCL 4ZO8A 5CMAA 1H9VA 4P4KB 2ORBH 1BF2A 1M7DB 2EH7H 2YD1A 3EJZD 4IRJA 4XNYH 3MSPA 5GJSL 1RZ8B 2G60L 4N8VA 4LLUA 3L7EB 2VKWA 2J8UB 2DDQH 2X4TB 1B2WH 1KCRH 4ZO9A 4LSUH 2F74A 4JDVA 4EN3B 5KAQF 5DJDB 1QQDB 5EU3B 4KJPC 4RMVA 1S8DA 2Y5EA 3LN4A 1I8IB 5ESAA 4XPTH 2V2TA 5D7JD 5AWNH 2DQEL 3JTSB 4OGYH 1P6FA 3G6JE 3VFUA 3RWJA 3V6FB 2ICES 2M26A 3F6LA 4Y89A 1CIUA 3HPLA 5DVLA 5EIVA 1ZKAA 4MQXD 4TUOA 2DBLL 1YYLL 3WN5A 4GKSB 5HJ3B 4PYGA 1XF1A 1HHKA 4PREA 2LVEA 4BA8A 1P7KB 4MGXA 5E6IA 1VENA 4M62H 3PQYA 4JFFB 1J10A 1JL8A 3AM8C 2Y7QB 1FO0H 3VRLF 4RISL 2G5RA 4EUPB 5GGSA 1UXWA 2Z92A 3NCBB 3BKYH 3KYOA 2CKBB 4M48L 4P5TA 5KZCD 1FG2B 4KWUA 3QULB 3X11A 1Q94B 1RY7B 4G6JH 2FECL 4PJCE 1WWBX 2GTZB 3ROOA 5BW7A 3L5WB 3NZ8A 4KJWD 4BFBD 1BZ7B 1A4KA 4TTDC 1XH3B 2EO1A 2YA1A 4HS8L 4KK9D 4GBXB 4MS8D 2FLBT 3HG1B 2AKRB 3GNMH 3SJVD 5EIQA 4F3FB 5D7JA 1IAMA 4R8WL 2CLRB 1TJGH 3VW3H 1HEZA 5DHVB 1GCFA 4I9WE 3ULSA 3DMMB 5GZND 4PRIE 3Q6FB 3QEHA 1WEJL 2AJXH 1K8IB 5C8JA 3QQ3B 3HUJE 4FXKA 1D5IH 3MJ6A 4BZ1L 3BVNB 3HZMB 3SOBH 1MRCL 1H5BC 3MX0A 5HHPA 5I1AB 2P8LB 5I1DA 5J3HC 4J3SA 1Y6MR 4D0BB 5MHSE 4HK3N 4H0IA 2YEZB 3MGTB 4P9HL 3UC0H 1NBQA 2I07A 1XIWC 2KQMA 3U46B 1KBGL 1ZE3C 4DAGL 1MNUL 5KANG 1JI2A 5IQ7H 3KJ4B 4GS7B 2GCYA 1EEYB 1HXMA 2I5YH 3U82B 5F7FA 5C0GB 3C5ZC 1I3RA 4KFZC 1AIFB 1U41A 4XNUL 4F33B 2BNQA 5FYJL 2VNCA 1W0YT 1NGPL 2DYPB 2NXZC 3SDAC 1BREA 1YDPB 4G8FB 4H0HB 4JFDA 4M6NL 4XB7A 4YZFE 1TZIB 2C4FT 4WI2A 1EJOL 2VDLH 1CICD 1DQQA 4XBEL 4LHUG 1CLOL 4X6DE 2FO1A 1U8LB 3SJVA 4D0DB 5SX5H 4ZFOL 2FB4L 5ANMB 1GGBH 1KV3A 2V9QA 4LSRH 4TSCL 2R4SH 4WJ5A 5GQBA 2W60A 3PDDA 1BQHB 3UYRH 4U1JB 2W38A 4YX2L 2NY0B 5C09D 2J5LB 3U7WH 5J9PB 3QPXL 4G9DA 4Z76B 4AIZB 1HNGA 3L7FA 2HJLA 2G5BA 4XNQA 1CGWA 3VXTB 5IR1A 3NABH 4UU9B 2VZSA 1XF2B 1OGAD 5DD1H 4OF8A 3GSWB 4APQD 2GJZB 3WKMH 3K1KC 1JV5B 1YEFL 3HE7D 3S35L 3V0WL 5E4IA 1ZLWH 3RKDC 5FGBA 1T6VN 4DGIL 3MJ9A 1RU9H 4PJFE 1CICA 1F6AA 4KK8C 3BGMA 2B4CH 4YXLL 5KVGL 3L1OH 2NXYC 1YMMD 5JA8B 2A6JA 5FECA 5F93C 5D5MA 1CU4L 2RBLA 4KMTL 5EOQL 1LGVA 1ORSB 4KH2A 4PFEA 3QCUH 3G04B 3IU4H 1T0MB 5C09A 3DV6A 4Z7NE 3BP7B 3QEQE 3IF1A 1P2CB 3RVTC 2P8MB 4L9LA 4MJ6A 1RK1B 5T5NG 3GK8L 2Z31B 3J8F7 3CLEL 2EECA 5KS9E 4GRWH 1QVOA 3WUWA 4U6XA 1BM3L 1AFVL 1BBDL 1E0OB 3IAQA 3P9MA 5E6IC 3DX8A 1B3JA 1OGAA 4HPYL 4ODHH 5DMIH 1BF8A 3ARFB 1KGCE 5DLML 7FABL 4APQA 2GJJA 3Q3GA 5DQDL 8FABB 5I0DA 5MI0B 1OP3K 3HE7A 3GBNL 1J1PH 3GBMH 3SGEH 3D25A 5DTFA 1HHJA 3FFCE 2DMKA 2BP3A 5C07B 4OCWL 3AAZA 4XHJC 1J7VR 3MLVH 3QUZB 1URLA 3GMNB 4L1DA 1YMMA 5TE7L 3HB3C 3TO2A 4KRPC 3FT3B 4OI8A 5HYQA 1KIQB 3MFFA 3WIFA 1A0QL 2N4IA 1Z9OA 1OAKH 1EIBA 4G6MH 5KVMC 1NMCC 5D7JC 1CG9A 3DIFA 4DVBB 5ILTH 3PUCA 2R0ZH 2XNAB 3MV9E 3QJHB 2V7NB 2VO5A 3CFCL 1TMCB 2ZUYA 2FSEB 3QUML 1OLLA 4OFVA 4XMPH 1ZEAH 5CWSB 4EVNB 4JY6A 4P5KB 1NCDL 4HT1L 1A8JH 4O9HH 2HTKC 3IETA 3O6ML 4LHJB 4Q0XL 3V0AC 2ENSA 4TQEH 2UYLB 5D7KE 3BW9A 5BRZB 3MLUH 1U8QB 3SKJH 1N3NB 2OK0H 4NPYB 4POUB 1FQ9C 4IDLA 1LE5A 4H5SA 2F5AL 2UVEA 1FH5L 4NKDB 4XNZC 4KVCH 4FG6D 5AYUH 4GG8A 1CK0L 4R4FL 5D6CA 3BKMH 3SBWC 5HHMB 2ZOKA 4WNQA 1CD0A 3X17A 3C9NB 2F54D 2FRGP 3TBVA 4N9GB 5IIEB 2BDNH 4L8SA 4FQXA 5DD5L 1FIEA 4HS6A 1QZ1A 4O2EA 2VSCA 3QWRD 4TN9A 3ZKMC 3MRDA 3D69B 5FXCH 2XKNB 1N0XH 3O2DL 4ALAL 4C56B 5FKPA 1LE9B 4RDQF 4BYHA 1WUNT 3AU1B 4JZNB 1SYVA 2R4RL 1WWAX 3PGFH 1FYTD 2BVTA 4OZIE 2VLKD 4NQCA 1BQLL 1I8KB 3TIEB 1N64L 2AI0L 1RFDL 1NMAL 1NCAL 4RSVA 4P2RA 5JHDE 4PJIF 2FBOJ 3CFIC 2XZAH 2ZCLL 3ZTNL 4WV1B 2IANA 4P2QB 2EKSA 5EZOH 5I8OL 3CPLA 2LAAA 1U0QA 3R1GH 4YNYA 4KTDL 2YD9A 4YLQT 1QBLH 1U93B 1CZ8L 3ISWA 3VFSB 3PV7A 4Z9KB 4LU5H 3T2NL 4MMZC 1FPTH 2F54A 5EBLB 1JZ6A 1LO4H 5JZ7C 5IVXF 1OT2A 4XNXL 1OP5K 2CXGA 4PGEA 5A3ID 3MODL 5FGBC 3QEUA 3QEGL 5KVDL 2HRLA 2QLVB 1MHHA 4HGWB 1CBVL 1T1WB 3VWJD 1JIBA 1MFAH 2R29L 4V1DA 3N85H 4OZGA 4S10A 5AZEL 5HDBE 2AK4A 5IHLB 4OKVB 2AXFA 5DC0A 3ROLA 2DL2A 4NUGL 1CXFA 1FYTA 1AXSA 2VLKA 5T3ZL 4XHQA 3H0TA 1XGUA 5CKGA 1A7QH 4UTAH 1UKTA 2CLZA 5HYJB 3S34L 4BFIB 2YOCA 2VDPH 3TYFA 1JFQL 2VYRE 4WW2A 4L9LC 3BFOA 3MXWL 3E3QE 3O45A 3IDIB 2BNRE 3CVHB 3QCTL 1IT9H 4GUPB 3B6SA 4HAFA 4NN7B 1MFEL 3IDMA 3QUKB 5ICZB 4N1EA 5LBSL 1T83C 3ARGB 4M61A 4ZMAT 4HPOL 3VMNA 4JRYB 5IKCB 5KVFL 1RAMA 3FT4A 3U4BH 2P5EA 4MHHI 3CU7A 3B9AA 3U9PL 12E8L 1IEAB 3MLPA 1FSKB 1A9EB 2EEAA 4MNGB 4QRSB 2IPTL 2YXFA 3T04D 5IFJB 1D6VH 3RL2A 4KAQH 4DN3L 4NN5B 3OPZH 4K3EH 5BS0A 4DEPB 2B5IB 4DGVL 2VISA 1FG9C 3HZKB 4NO3A 2AEPH 5L2KB 5T1MA 2FNBA 2RQ8A 5L7XL 3QG6B 2O61B 5M95B 2A74A 1DUYB 3I50L 2NY1C 3MBXL 4P99A 3ZZ1A 1J8HA 2A9MH 2R1WB 5E5UB 4GLRH 2BFVH 4N8CH 4UDTB 3BIBX 3IVKA 4CW1A 3UDWA 4WTWA 1Z2KA 2IBBA 5DMYA 3T0XA 2Q7NA 1OAYH 4KXZH 2V9TA 1KG0A 1FGNL 4X0KA 3MA7A 2DQJH 3OTTA 3GHEH 4HS3B 3MRIA 5E2TH 3IJYA 1EK3A 3TT1H 2X4NA 4L3CB 6FABH 5GXBB 2WP3O 4HSQA 1S7QA 3C08H 3UX9B 4QRRD 1G7JA 3R8BB 3WIHH 2BHYA 3BKJL 2WINB 4HKBB 2BY3A 2FL5B 1YN7A 3SY0B 3MLSH 3DRQA 2WBJC 5CJOH 2IMMA 1WIUA 4JCLA 4L8SC 4FQXC 2OJEB 4HFWB 3DSFH 3MRJA 4YHIA 3DXAA 1MVUB 3D3VD 2LE9A 3GKWL 1RVFH 5ETUB 3UO1H 2B1HL 4LVOB 4JFYA 5DSCB 2NY7L 3A0OA 4WEBH 2V17H 1EX0A 1OLZA 1JPST 3GFUA 2BSED 5CBEB 3OWEA 1FVCB 3KWWB 3KLHD 3EOTL 2JB5H 5HI5C 4PJHB 1ZT4B 4YHPA 3PWPE 5JW4R 1L4IA 2MKLC 4MCZB 4OGXH 4GKNA 3BPNC 4X5XB 1CGUA 4R4BB 5HD8C 2IAMD 4LQFH 4D94A 3LY6A 2DKUA 1HSAA 5AG9A 3OMZA 4Y16B 3ARED 2FR4B 5CINL 2VLJB 4ZSOB 1A3RH 3KPQA 5B21A 4PS4L 4FNLH 5CJXA 1ZMYA 3DBXB 1SY6A 4NKIL 3JV4B 5CHNA 5H8DA 3FZUD 3FQWA 3FO0H 2NYYC 5LGHH 1CD9B 1Z9SA 4PRHA 4DVRL 1D5MB 4GG6A 4CMMB 4LCWB 1XIWB 4Y4FB 3AS1A 4EUPH 4HK0B 3D85B 2CKBH 4M1CD 1AHWA 2ESVB 2P49B 1KB5L 3EO9H 5B38A 1UWGL 3OAZH 1QYGL 4YEFA 4DCQB 2GKIA 4I18B 1GH7A 2GQHA 3INUH 4RZCA 3RUGE 3SDAB 5K59F 2ZPKL 2O26U 4L5FH 1X5GA 2DWEB 5BMFH 1LP9A 4XH2B 1I3VA 3DWTA 4PV8A 3UTZA 4JFPB 3O41A 2LTQB 4YGAB 3BOVA 2C26A 4NO0B 5LJYH 4LCIH 4K8RH 3EOAA 2YPLB 4HHAB 3MNVA 4JZOB 5DJCB 2J7LA 3MLTB 5DHVH 5I0ZA 3IFLL 3W81A 1CD1B 4GAGL 2VSDA 3IDGB 3W9DB 3AREA 1KJ2L 3P0GB 1YNKL 3H7BA 1B6UA 5DD0H 5E1HB 1GGIL 4WWID 1J05A 2JCCF 5C1MB 4GW4B 4RA0C 1KXTB 1H3PL 1DZBA 1BOYA 3T8XB 1GZQB 2FZ3B 5LQBL 4CMHC 4EI6B 1S3KH 3TBWB 4KUZH 5HGAB 4P23D 1UJ3C 4H8WL 1MCDA 5GS0H 3ULVH 3I6KB 1PQZB 2D7TH 2GFBA 2AEIT 5JIHA 3I9GH 1W0VA 5L8JB 1A3LL 1EGJL 2VRAA 3MROA 1G0DA 3RPKA 3KS0H 5DK2B 4AJ0A 3VXRB 4IOFD 5EU7E 3VXPB 1MEXL 4KJQD 1AD0B 1FBIH 2XN9B 5CMAB 4PY8I 4NCC1 4S1QH 1HIMH 3CNKA 4J4PD 5IB5A 3EAKA 3THMH 3KS0J 4ENEC 2ZCHH 3D18A 1ZA3A 4IRJB 1Z9LA 5EU6E 1BD2B 4N8VB 2NXYB 4LLUB 4RIRB 5B39G 4UT9H 3UDWC 1DN0A 3F8UB 5IMOA 4WI4A 5I1IL 2F74B 1P7HL 4FQ1L 4YFLF 4DOHE 3DYOA 1S8DB 3I2CL 5I30H 4HUVA 3LN4B 3MLYH 5ESAB 5T3ZE 5HHXH 2V2TB 3HNSL 1R3HA 4KQ4H 1F6LL 1X6NA 3GMQA 3VFUB 3RWJB 3V6ZA 4N90D 3V9FA 2FD6L 3HPLB 2A6DA 4XWGH 3VFTA 3D39B 3ZKSD 4P23A 3BEVA 2WQ8A 3WN5B 2ZWLT 3QHZH 3V5DB 5C08B 3TCLA 5BVPH 5MERA 4OCSH 3FN0L 1QBML 3OKEB 4PREB 1LO3L 3FO1A 5DZOA 1R0AH 3PQYB 3MBEA 3WCYA 3IKCA 1MCKA 3GMPB 4D3CH 3N9GL 3JXAA 5T5FH 4G9FB 4Z78A 4K3JH 1RD6A 1TNMA 4AY0A 1CFVH 3V4UL 4LFHG 1WVZA 1SBBA 3FTGB 4HXBL 4L3ED 4WDIA 4Z0BL 5GGSB 5JNYA 1NCBH 1UM4H 1UXWB 2QKIA 2VDQH 2Z92B 3J7HA 3KYOB 4P5TB 5I1KH 1NKRA 3ZE2F 3X11B 1XF5A 1G7HA 2VAJA 5I19H 1OCWL 4J4PA 3CSPA 4RGMB 3ROOB 2DLTA 4X8XA 3WXVH 4FABL 3NZ8B 4OF0A 3S88H 2J2ZA 3VXSD 1OF2A 4M6ML 1OTTD 3EFDL 2HT2D 1GOHA 5E7BA 3PDOA 1QP1A 5EO0B 2H9GB 4ODXB 5I1EL 1TVHA 3EHBC 3B9VA 5D7JB 5BQ7A 2A73A 1FC2D 4JZJC 3WEXA 5EUOB 1RUKH 1HEZB 1G1YA 3QI9C 4JHAL 5KAQG 4XGZB 4QRUA 1YEIL 5E6YA 1MSPA 4GXVH 1CE1L 2PF6A 4QTIL 2HFGH 1CGSL 1CXEA 1E27A 3FONA 5CJXC 1FVDB 1IGFL 5L2JA 3KPRE 3O6LH 2NY6C 1EZVY 4HC1A 1X4YA 3UJJL 3K8MA 5F9OL 2CLVA 2FO4A 4PJEB 2I07B 3EW3B 5KVEH 2WWMD 1LD9A 4GRWF 4KVNL 4ZPTB 4L3EA 1TENA 4MDJB 4QLRA 5KZCB 4M7ZC 5KSUA 3C2AL 2MPAH 3EDEA 3R0MA 2GCYB 3ELAT 1HXMB 2HT3D 2APTA 4NOFA 3UYPA 1HZHL 1I3RB 5D2LE 5INDA 3S98A 4U2YA 5E6ZA 4Y4KD 3ESVF 5F72S 5E8EB 2W0LA 5F44A 3VXSA 3A6OA 1DQQB 3DLQR 1K3IA 3UYOD 3OR7A 4GXUN 1YY9C 3SJVB 4N5EC 1J0ZA 1IEHA 2BVOA 1CQYA 4WJ5B 5DYOB 2ADJB 4KRLB 1GC1L 1CWVA 4M6AA 3AREC 1KUMA 5FYLL 4DN4H 4FMFA 3VE0A 1C12B 1RULL 5T1KA 3OKDA 4G9DB 5H37G 1MCQA 3L5JA 2HG5A 1F4XL 1Z0NA 1B4JH 3L7FB 2HJLB 2G5BB 4XNQB 5K9JH 1CDIA 1SYSB 2XPGB 3V5HA 4YBLC 1NGQL 4IHOA 4NQEE 1BEYH 2Z8VC 5I74C 3BT2H 5ELIA 3RIAK 3BMVA 1UCBH 1P6AB 3PDGA 3U36A 5CEXA 4RGOL 1BGXL 4UAOB 4U0RB 4JKLA 3NIFE 5D71H 1PAMA 2GJ6E 4Z7UA 2YUZA 2A9NL 1I4FA 3WLWD 4AIXA 4RRPA 5ABDE 1F4WL 4Y4KA 3VU2A 1YEHH 4QRQA 2AXJA 1FGVL 4YHLH 1CICB 4RGND 3WS6A 1AO7D 3BGMB 3DOSA 4JPWH 2A6JB 2H2PC 1YY8B 5D2NE 3FT2A 3LIZL 4GH7B 5D5MB 4JE4B 2R2BB 5D9SA 1INEH 1YEEL 5C09B 4GKZA 4OD2A 4YHMH 1F58H 4LASH 5CD5D 3QO1B 3MA9L 3C09C 3BH8A 3C8HA 3MOAL 4MJ6B 3WIIH 4Q9RL 5IP4A 4U3CA 4P23C 1ADQH 2WIIB 1IGYB 2NX5D 3HC3L 4MD4A 3VWKA 4CADA 1N5YL 3WUWB 4U6XB 4XPGL 1QFHA 2MMXA 4XRCB 4BKLA 4Q6YA 1A02N 2FX9L 3DX8B 3MBEC 1OGAB 5EUKB 4APQB 3Q3GB 3CDCA 2VDKL 4ERSH 1K85A 3HE7B 4M6OL 3D25B 3PP3H 1HHJB 2CGRH 4HMDA 5M7QA 4UNUA 1MOEA 1B0GA 1PKQA 4WI3A 1YMMB 1JGDB 2WZPD 2HTLD 4G7VL 4HQQH 3K2UL 4X7EC 1EO5A 3MJ8A 4HWEH 4XZUA 5DJ0A 2E27L 4XVJL 5HYQB 2PYEE 4JDTH 3MFFB 3WIFB 2BSRB 2CIIA 1KEGH 5JO5A 4Q2ZB 1NEZA 1PD6A 1CG9B 2BSTA 4XBPB 4NZTH 5A2IH 3EBAA 3RX5A 4NSKA 4KKBC 5SWZD 2AV1A 2M2DA 2ZUUA 5D7IE 2PW2A 2EXWC 5AEAA 1A6AA 2NX5A 5EBMA 2KDGA 1U6AH 3HI1A 3IETB 3GJFK 2DLEA 3VDBA 1AI1H 4XCFL 4IDJH 3BW9B 5IMMB 4ISVB 1Z3GL 3GUTB 2VLMD 2R0LH 4MLIA 3NIDE 4GAYA 4H5SB 1J0IA 2AVGA 3SQOL 1UACL 4GG8B 4QHMA 2ZOKB 4WNQB 1RZIA 2XXMB 3ULUH 2RAMA 2HJKA 1A1NB 2XOTA 3M1BA 1G9EA 2BJMH 4HWNA 3VGHA 1AJ7L 5CGYC 4O2EB 5E8PA 4Y5YB 4XMKL 2Z35A 4ZO7A 5HYFA 3VDAA 3KR3H 2XTJE 3MRDB 5E94A 4N0YL 3WNMA 1BBJA 2F8VA 5FKPB 1G6RL 5FO7B 1BFSA 1FLRL 4Q97A 3LV3A 4ONFL 2OZ4A 5GSRA 1SYVB 4DKEL 2C1PA 2EH8H 1L6ZA 3DX9B 5IMLA 2VITA 5SWZA 1MJ8L 4OBRA 5D2NC 1MHPH 2A77H 3BD3A 3OHXB 2VXUL 1UH2A 1AR1C 2OBGA 4D9RD 3MRHB 1MCNA 1KEML 1T3FA 4Z7WF 1U91B 1AY1H 1DR9A 4ODBD 2MQ0A 4WHCA 2H32B 4X7DC 5F7NC 2ED8A 1A7OH 2EKSB 1RUML 2BVQA 4AG4H 3CPLB 5E2VH 3C2SA 1P5VA 3S96A 1PZ5B 1NCCH 1NAKL 3C6LC 3O8XA 3WFZA 1QPXA 2XA8H 3LB6C 3T3PF 3UEZA 2ZUTA 4I9WD 2F54B 4QRPE 2UVFA 4PRID 3V6OE 4QHNA 1WBXB 3U7YH 1EFXD 2XFXA 3MR9B 4PGEB 5JLZB 1RMFL 2YHGA 5F6IB 3QEUB 2X70B 4XC1H 3JWOL 2W9EL 3ZTJH 3P77A 4R96B 3WS6C 4AEEA 4JLRB 5MHSD 2MTPA 1I1FA 4C58B 2ICWB 3QDHA 3BXNA 3ECBB 3MACL 2AXFB 5KSBF 5EPMA 3QDJA 3RIFK 1FYTB 1ONQB 1FNHA 2VL5A 1ZHKB 1M6OB 4M5ZH 3CSYB 2VLKB 4WU5B 1XGUB 5DQJA 1KCUL 2CLZB 4ZOEA 1KIPB 1MQKL 4S2SB 4RDQG 2X44D 5DRWA 3TYFB 4WW2B 3S3JA 1AGEA 1JGVH 1KC5L 4LHQB 5JR1H 4MQSB 3H9SE 3O45B 2OTWB 3RDTC 3DUSA 2WK2A 2XWJA 3LRHA 4U05A 1EO8H 3B6SB 1VCAA 1YQVH 3VWKC 3PWVB 1MFDL 5ADOH 1DLHA 4CL7A 2BCKB 5I1CL 4WUUD 1JWUA 2E9WA 4LEXL