2NXYD

Hiv-1 gp120 envelope glycoprotein(s334a) complexed with cd4 and antibody 17b
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
229
structure length
227
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 49
structure length 227
sequence length 229
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nxyD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nxyD01
1XF1A 2EXYC 5H94B 1RK0B 4KH2A 1I7RA 3W0WD 2FJHB 2UWEA 3HRPA 4JLRB 2VXVL 2DDQH 4IBLT 3DGGB 3O2DL 1XGYL 3GDBA 1R24B 4KKNA 5FOBB 2YS4A 3MRLA 4OJFH 1O0VA 1IQWH 1IGFL 4XAWH 4OZHA 5SWZA 4MNQB 1Z0NA 3IYLW 5FGCB 3LKOA 4M1DL 3CFKB 1Q9KA 4FQIH 4IRSA 3V0VA 4J3XA 3ROLB 2HFFA 2HT2C 5L2KD 5EUOE 3OJDA 4HSQA 1I1CA 3RWHB 4G43A 1FAKT 4F9LC 4TRPL 4ZSOA 5C1MB 4K23H 5C08B 1MCDA 1QSEE 5HHVL 3KNBA 25C8L 3QUZD 4QY8B 4OF0A 2D7MA 4KVCL 4PJEA 2XICA 1V3MA 2A2QT 2EO1A 3IETB 3U46B 2FBJH 1CD0A 3E6FB 3LZFH 4L3EE 3DROB 4DKEL 3JV6A 2X4NB 4XMKL 4EI6A 3V9FA 1NSNH 1LEIB 5IKCB 4M6NL 5HYSA 1S5IL 1X4ZA 4LNRB 4NHCL 4K3EL 1CBVL 2EIZA 2ED7A 3ARGA 1P6FA 1U93A 3QCTL 2NXZC 4Y16B 5FYJE 3MLXL 3R06A 3DSFH 5D1XB 3F5WA 4JFZH 5ERWA 2XT1B 4GRMA 2GJ6B 2G5BB 2C3XA 2JB5H 5GRUH 3R1GH 4YHPB 4ZAKC 5I74C 5TDPA 3IVKA 2OZ4A 4WO4C 5GJSH 1LGVA 2VDRH 1CYGA 1AQKH 1ZA3A 1JZ5A 4XCCH 2EZ0C 4P3DA 3VWJA 5GXBB 4KGLA 3LS5L 4Y4HD 4KMQA 5KOMC 1SY6H 2CR6A 3TZVA 1B9ZA 3P9MA 4BM7A 5DRWA 4RNRB 1VADA 1MREH 3AS2A 4IHOB 4XTRC 1UT9A 5F9WC 1ADQL 1T0MA 1FZOA 2YUXA 2I60H 4S1DD 4Y5XA 3K4AA 3HZMA 1RZKH 3GKWH 1HKLL 4M8QB 5C0BA 4N0UA 3BP5A 2VH5H 4PJ5B 1JGEB 1WICA 2EYSA 3MRMA 4FQLH 4UTBL 4WW1A 4YFEA 2IH1B 2VNCA 4J3VA 2YD4A 1UYWL 2BC4B 3FMGH 2X5PA 4BFIB 4OLEA 4J6RL 4PRPE 5D7SH 3FQRB 4HS6A 4JFHD 4OD2A 3MLVL 4XP6L 1VKXB 4LHUG 1BIIB 4ZS6D 3VFVA 3DRTA 2R2EB 2Y25A 3I02A 2RR3A 3V79C 3ALPA 1AGDA 1UVQA 4PLJD 4RGNC 2CR3A 4UNUA 4YLQT 3FFCB 1NCAL 1T04B 4GAJL 3N9GH 4P3CL 5D7KE 1N6QH 2ESVB 3FL7A 2PR4H 4FS0A 5ENWB 4KZEH 4RMVA 2N1KA 5F9OL 1X7QB 3DUSB 3ZTJG 3BGMB 1CS6A 4YHNB 4ELMA 2LU4A 3RP1A 4MS8D 5IFAH 4MA3A 1CXHA 2FEEL 3VFNB 5EO1B 3NIFF 3O9WD 1FAIH 1J9CT 1BQHA 3B5HA 1M1SA 2BDNH 2Q6WB 4EDXA 1F4XL 5EUOB 4QHLA 4M6OH 4O58H 1AHWA 3BN9C 3U9PL 4F8QA 2DLEA 3PP4L 1IAIH 2WW8A 2R2BB 5D9SB 3MYJB 4FFYL 5ITBL 3OX8B 4TNWK 2F58H 3RIAK 1P2CB 3TVMA 4X4MA 5AZEH 4HWEL 3N1PC 3WLWD 5K33A 2F53B 4LLQB 1NMAH 3HMWL 4K7PY 4QNPE 4L3EB 5I1EH 3QIWB 4DVBB 4ZOAA 1SEBB 3R8QA 3RVXC 1SBSH 3OKLA 4HHAB 1AD9A 4HDIB 4QOKD 2OYPA 1A6ZB 1U8KA 2LTQB 1DLHB 1JNHB 3FRUA 3PDDA 3ARVA 5D2NC 1KCKA 2XKNA 1S7UA 4L8BA 5D1ZC 5FO9A 1NDMB 2JK5A 1EJOL 1MRFL 4PG9B 2KL6A 4MGXA 5MERB 2BCKA 4RAVB 2O5YH 2Y36L 4ORZC 1P4BH 1BGXL 3G9AB 5CBAB 3NA4A 1KEML 3F7VA 3QDMB 4TN9A 1N59A 1YDPA 2BRQA 4LLVB 1B0RB 4HIEB 4P57B 2XXCB 1IMHC 2VDKL 3Q0HA 1I9RL 1SY6A 4OZGE 4RAUB 1N5YH 3SE3A 4LARH 1JF5A 1UXWB 3T0EA 1ZHKA 2GK0B 2IPUK 3C6SB 3EKCA 3BP4A 3NACH 5HHMD 1T5XB 5I0DA 5KW9H 4APQA 4HIJB 4ZUUA 4U33A 4LP5A 2GITB 3LIZL 3WIHH 1ERNA 5FM5O 1IFHH 4KHTL 4KROD 4UV4L 1F45A 4X4ZA 4ZUWB 5TF1H 2H2SC 4EIGB 3VWKA 4LRNH 4QRSA 3FO0H 2UUDH 4KV5F 5SWSD 5DK2A 2RCSH 5C9JB 1HDMA 2EH8H 2Z93B 3OB8A 1KIRA 1G7PA 1QFPA 1CICC 1YEJL 3U0PB 4F15C 4M62L 2G9HA 4PJ9B 4DUVA 5BZDB 3OKDB 5GSRA 2EDYA 3DVNB 3N85H 1CDUA 4TPRH 4CNIB 4JPKL 5D7IB 1A3QA 3MRDB 4U6YB 3QUKA 2AK4A 1MJ8L 2V7NA 2RJMA 4QF1A 4P5KA 1KUMA 3VFPB 4MJID 2Q86A 3QIUC 2DQCL 1KOAA 3FT2A 1JJUA 1YMHA 4FFZL 4HUVA 3OGOE 5E24E 3BGFB 3VFGL 2PCPA 4YFDB 5F6HI 1NEUA 4O02H 2VABA 3LKQB 5CJOL 2J8HA 3VH8G 1F42A 4JFEE 1OTUD 4IRZH 1TQCC 1BD2A 1C5CH 4KAQH 1PX4A 5IVZA 3LEVL 1KLGB 4UB0L 4HK0B 1G6RH 3CVHB 2JCCE 2XN9A 2IGFL 3EYOA 5D7IF 3STZB 1T03H 3D39D 3MBXH 5D93C 4KMTH 4ZTPH 1QYGH 3PIQA 1B4JL 5I66A 3CU7A 1TVDA 1G9ML 2QHRH 3PWVB 3HE7B 1HWGB 1A21A 1RJZB 4PY7B 5F1KC 2PO6A 4NKDB 5I18H 3PWLA 4AMKH 3MJ7A 4WNQA 3BYTA 4Z76A 2Z4QB 1PZ5B 2ZNWA 1BJ8A 4TSAL 1PSKL 2JB6B 1FVCB 2XZCH 1TCRA 2AEQH 2AJSL 2VXQH 2VDOL 1AO7E 2YPVL 3QFJD 4XPAH 2G5RA 1UM5H 3GMMB 4P2QE 1I8IB 1XAUA 3GHBL 2NNAB 3NIGF 2X4TB 3H3BC 1XF5B 3D3VE 4OZIB 2OQJA 2VUOA 1FZKA 4HUXB 4OF7A 5GS1A 1F97A 3QQ9D 2YD1A 4CU6A 1A4KB 1JHTB 1ZANL 1I1RA 3U83A 4QRRD 5AYUH 3CSYB 1OSPL 4MAYA 1HHKA 3SDDD 2G60L 2F54E 3O41A 5JHDD 1U8HA 1GGYA 2GT9A 5GGRA 3KPPA 2XV6B 4HLZG 4EZMA 4G8EA 1KPVB 3MOAL 4YHKL 4IIQB 4F9PA 3AB0B 4L9LA 4Y4HC 1LP9F 5I75C 5DJYA 1W72H 4B7IA 4LVNB 5C0RL 4N68A 1MNUL 4OTXH 1C5DA 5E9DB 1WV7T 5HGAB 4C55A 5TE7H 5IEHB 3RWFB 1OSZA 1IKNA 2QADB 5DD0L 2HFGH 3RL2B 4WHYG 5HHNA 3WIHA 4RGMB 3CZFA 1BBDH 4OZIF 4S1DC 4NFDA 1D5MB 2F5AH 3I9GH 3IXAB 5E8OB 1A0QH 1ZT1B 1MCPH 5C86A 4M9PA 3L3KA 5HJ3A 4Y19D 4Q6IB 4P23D 3VGAB 5CFHA 4GG6A 5DQ9A 5DEGB 4D3CL 4O51B 3MC0A 1T1YA 3GBNL 3T1FA 3P73A 1KTLA 3TT3H 1Q94B 3D25B 5B38G 1T22B 2PYEA 1VGEH 4ZS6C 4Y5VB 1GHFL 4S1SH 3V5DA 4DN3L 3QG6A 3DI2B 4PLJC 4QHKI 4X7DC 4KQ4L 4NBXB 1T6WA 1L9MA 1BF8A 2A9NL 5KG9A 4XWOD 4KJQD 3PF2A 4HBCH 4HFWB 1X5AA 2GFBA 2XKSA 3V6ZB 1VGKB 5EWIH 1KXQE 1TTFA 2BY0A 2JCCB 5ESVA 3W11D 4GMSH 5BO1L 3V6OA 3O9WC 1SHMA 5KOVC 2VDLL 4OB5H 2N7BA 2R1XB 2COQA 1A3RH 4GAGL 4JZOA 1IGYB 4YX2H 4G8GE 1BZ7B 1JPFB 3RWEB 5E2VH 1FPTL 1G6RA 5DSCB 1BVZA 5D96C 3QUXA 1KCLA 3O6ML 4YR6B 4YHIA 2D7QA 4BKLB 4HS8L 4CDGC 1R6VA 3WNOA 1X5JA 3MCKA 4JB9H 2SEBB 5K59E 3V5KA 3L7FA 4HFUH 1IAKB 2X4QB 1P53A 3MRGB 2EIEA 3WLWC 2HMID 2VXVH 4HGMA 3WS6A 2D7PA 1A9EA 4Z77A 4MJ4A 3TJHD 2DQFB 4TTDD 1XF2A 5EBWA 1WCBB 3MPCA 4EN3A 2H32H 2JCCF 1IKFH 3C08H 2YUZA 4X9HA 3O0RL 4WV1C 2PW1A 5DA4A 1YPZE 1LEGA 4D0BA 5LGHH 5JO5B 4BSWA 4P46A 1EIBA 1LO4H 1S5HA 2Y9RT 3D3VB 4OIBA 4XCFL 1V3LA 3BPOB 4OI9A 4HUWA 1MI5A 3RJQB 3SPVA 5IHZB 4UQ2B 3DUHA 1I3VA 2GKIA 1L0YA 4YBQD 4CJ1A 4DVRH 1U92B 4Y89A 2OTPA 2VLJD 1I1FB 5I1GL 3BE1H 2IQAB 5JDSA 4G6AD 1UKQA 2BOCB 1HNGA 1U8IA 5JXED 3S3SA 3TCLA 3F7PC 3K8MA 3REWA 2E9WA 1CF8L 1P7KB 4EVNA 5I30H 4OLWL 4N9GA 4RGNE 4ONFH 5FF6B 3CFBA 1DUZB 3WKNA 2DF3A 3BH8A 4M6NH 4Y4KB 2CUMA 5GGSY 2ICEB 4JANA 3PGCA 3KXFE 1YEEH 4WHDA 1KPUA 1KNOB 4G7VH 4UIMA 5D5ME 4LMQI 3U9UB 1P7QB 4G6KL 3QDJE 2D9CA 4K94C 4OBSA 3OBAA 4K8RC 2DI7A 2K9UA 1KJ2B 4JM2B 4UT9L 1MVUA 3ALXA 3SCMB 1J1PL 1I1AD 4LCUA 4KROC 1MHCA 3WFEH 2DLTA 1CE1L 4LEXL 1QFUH 1MAMH 1GVIA 1RJYB 1NLBL 1GGUA 3BT2L 2XIDA 1MHEA 5KZCB 1CFNA 4K7PX 1T1XB 4XBPB 5T5FH 1Q9OA 1GGIL 1MIMH 3MRFA 1JCKA 1I8LC 2HG5A 5EOTB 1YYML 5FKPA 5J1AA 5CCKH 1HNFA 2Z35A 3PV6B 1YEHL 4MD5A 1MRDH 2FBOJ 4CDHA 5SV4A 1CTNA 3IAQA 3MO1B 5CD3A 3VFWB 1MLBA 2OJEB 1IGIH 3ZO0A 2BSSA 1HKLH 1DUYA 5F7UA 1A14L 3MXWL 4ISVB 2CRYA 4YHYB 4CBPA 1BFSA 4MJ6A 1W2KT 5JPNA 4JM2F 3BEWB 1R5WB 2QSTA 1J5OL 3M45A 3NABL 3GJFB 3WN5C 4FMFA 5FUZL 1NPUA 3UYRH 4D9LH 2AEWA 5E5UB 4I77L 4XP6H 4G8FA 1WBZB 1KTRL 4PRAB 4X83A 1LE9B 2E6PA 5J56B 1OTUC 2DTSA 4JE4B 3L6FB 4WEUD 1E4XL 1F5WA 2H2PD 2EDLA 4ZYKB 5EFIA 4N0YL 1NCAH 3OKOB 3GSQA 4EEEA 2FGWH 3C9NA 5D1QC 4ODWB 4MMZC 1N3NA 1DQJA 2X05A 5EZJB 1FNEB 4RFNC 2HTKD 4AT6B 1U3JA 2IF7A 1I1YB 3PUCA 4FTVD 3W82A 5GGTL 1B4RA 5F9WB 1OQXA 3F7YA 2CQVA 4TVPH 1H5BC 3O2WL 2ITCA 5E6YA 2VRAA 2JIXB 1T3FA 5I8OH 2BMKA 1EV2E 2NY2D 1D5IH 3D2UB 2W59A 4Q9QH 2YKLL 2H32A 5E99L 4XNMA 4G3YL 5F6IC 1J11A 1IC5H 3PP4H 5FDWB 1JF6A 1C1EL 1XZ0A 3CK0L 5JZ7D 5DJCB 4I0CC 3CNKA 5FOJA 1SYSA 4YGVB 1RUPL 4JCLA 5A2FA 3TO2A 4RGNB 1FGVL 5DHYA 1JK8A 1EJ6A 4X5WB 5LWYH 1BAFH 4YPGA 3EGSA 4MCYB 4HLJA 4OCYH 4R96A 1AGEB 4HW6A 3ULUE 1Z3GH 1N0LA 4KXZH 1DQLL 1CLCA 5KANI 3QQ9C 4D0DA 4UINH 3KXFB 3O3AB 2A6KB 1D5BB 4X4XA 5GSVB 3SE9H 4JRYB 1T2XA 1ZHBA 1D6EB 5BW7A 3REVA 2EEAA 3SDDC 1R3HA 4HIXL 1WFOA 3MTRA 4U0RC 2WAHA 3AM8A 1MRFH 4RMUA 1Y18A 3H9ZA 3PQYD 1YEDA 1BOGA 4K3DL 4LVHB 3W0WE 2ATKA 2MSPA 2E7LA 4QHUA 3L9RB 1BGXH 5DD3H 4KRNA 2IMNA 1KEMH 3BPLB 3BUYB 4LLMB 3KDMA 1T21A 2JJTC 3H3PH 3CFEA 5H8DA 4MZ3A 3QO0A 4PJAA 3TWCL 1ORSB 5DD6B 1NMBL 2OSLB 3F65A 2E9BA 5CGYD 4MHHG 3A6CH 4G42B 4MDIA 3K2UH 4XNYH 2EH7L 3E8UL 4Z0XA 5EU3A 1I9RH 4MXVF 5L2KE 2JE8A 5TE6H 2CDEA 1JZ4A 4G9DA 4LHUB 4P23C 3X17A 1NCBL 1P4LA 4MWFA 4LK4A 1UM6L 5CP7B 2W92A 1U6AL 1T0PB 5IVOA 2BSRA 3RWDA 4HG4K 1CR9H 3RVWD 2HJFA 4HKXB 3OTTA 5GRXG 1B2WH 2IC2A 3TBYB 4UNVA 5F7MC 3SJVB 3MRPB 1A7OL 4Y2OA 4K8RL 4XWOC 1LO2L 4KJQC 43C9A 3C09B 4J7RA 3LRGA 1G7MA 3ULVD 1B3JA 2FATL 3MLWL 2CXKA 5ICXA 4KKLD 1A7QH 1DQDL 3W11C 4IM8A 1IM3A 1Y0LA 1NAKL 4X9GA 5JNYB 2AXFA 2R29L 3Q1SL 1MJ8H 2R23B 1CIUA 2VDNH 2Z31B 2DBJA 4Q9CA 3B5GA 4JFQB 3GMQA 2Y5TB 1QR1A 1IARB 4Z7QE 3DRQB 4GAYA 3BXNA 2BX5A 3G5YB 4EOWL 3GSUA 1MFEH 3MJ6A 4X6CE 3MLYL 3SGJA 4F7PB 3RWIA 2DIAA 5C09A 4XX1G 1RMFH 4Y5YA 2HMIC 2ADGA 4RCAA 2W0KA 3MRNB 3ZDYF 4TUOB 4OAWB 5BXFA 1REIA 3TJHC 3BKMH 2VDPL 3MLUH 1JGVL 1F3JA 4PGBB 4UB0H 5FYLL 5T1KD 2EIBA 3B8SA 2IGFH 5FHAL 1FNLA 4F15B 4L8SC 3QWOA 4LCCC 4O00A 1X5GA 5JUEL 2BVTA 4RFEB 4WFHD 1GC1C 1HINL 4YBQC 2OCFD 4KUZL 4LPUA 4U1GB 5GGSB 4Q97A 3HMXH 4JFFD 4XI5D 3HG1D 3P30L 4JFHE 5F71A 1CDIA 4DJMA 4OV6F 5DD1L 4G6AC 1T1ZB 4IOIA 4P9HC 4PJCB 5JXEC 5LXGH 2FJGB 4CUCA 1D9KD 3H42L 2NR6D 5DQJA 3LH2H 3S96A 1MWAL 3LPFA 4JFDD 5L9DL 2YPVH 1A6PA 5EIVA 3RNQA 1PVHA 2AJ3A 4ODXB 5E6ZA 3WL9A 3GHBH 4X7SL 2CK2A 1PEZA 1JF1A 4BZYA 3ULUF 4NRZA 1KJVB 2HRPL 2IPTL 2L4OA 1JPTH 4XNQB 4LVOB 3UTSD 3S97C 4PRDB 4PLKC 1NCCH 5D93B 5F8QC 5J6HB 5L2KB 1D3CA 1P84J 4RX4D 4XCNB 5IB2B 5DHXB 1N64L 4HGWA 3QWRD 1I1AC 1ZS8A 3BJ91 5HY9B 4PJCF 3C6LB 5ALCL 5E00A 4YHKH 3QUZB 4BZ2H 4MSWA 2R2CA 3EOTL 3VRJA 1LK2A 4H8WC 1DR9A 1MEXL 2B2XH 3S5LA 4E0RB 4OV5B 2BOBB 2OK0L 5MHSD 3T77B 1MNUH 3HE6D 3IKKA 4PJGA 4MMXC 4F3FA 4M00A 2W9DH 1UC6A 2BVYA 4U7SA 5IEKA 5E8NB 5E1AB 3MXVL 4PGEB 3QEQD 3OKKA 3ORJA 4LSPL 4QOKE 4JDVB 4DZBB 1FZJB 2VLKA 2RFXA 5D72H 3LDBC 5ILTH 4LLUB 3OWEA 1FL6B 3VH8B 2HVJA 5LVEA 4PRNA 1HOCB 2P5EA 5DC9B 2V2TB 5TDOA 4IMKC 1K3ZA 5DO2D 4U1LB 1IGCL 4DN3H 3L5IA 3QDGB 2H2PC 1NJ9A 4X6CB 5CZVL 4IOSD 2ZOKB 4KQ4H 4Y4HB 5I75B 4L29B 2FL5B 5DF0A 4DKFH 3KS0J 3G6AA 4PG2A 3DX8A 1U91B 3RQ3A 2HTKC 4U3HA 2NY0B 3C8KA 1A3LL 4LCIL 1U3HA 2OL3B 2Y72A 3RWJB 3CH1B 2DMKA 1DDHA 5KVMC 3ARBA 5M94B 1NCDL 5TPWL 2P7TA 2GJZB 3PHOB 2NY2C 4ZS7H 1IAOB 5HHME 4PJBA 4OZFH 4M61A 2CUIA 5GGVL 4I18B 2R1WA 4G9FA 4Z7QF 1MHHA 1YY8B 2J5LB 6FABL 1QBBA 5K9OB 2YD3A 3T0XA 5JZ7C 4GRLB 1A7RL 5EB9A 3V2AR 1QR4A 1AGFA 2WIIA 5LQBH 4L4TA 5SWSE 4A6YH 3MGAA 1CFBA 1JNLL 1O7SA 4RISH 1BEYL 3HMXA 1JZ7A 2CDFA 1P4IL 32C2A 2FSEA 1AC0A 4H26A 5FIEA 3L3DA 5IT2L 3KYOB 4JHZA 4XWGH 4I5BB 4Y2DA 4U7MA 3L7EB 3H2WA 4JPWH 3MNVB 1HHIB 3K80A 4S10A 4G6ML 4NO2A 3UJTH 4OD3H 2XPGA 4A2MA 2QQNL 3BIKA 1UJ3C 4MJIE 5LBSH 1TJHL 4BQ9A 2VZVA 5EOCL 4PV9A 4I2XE 2VYRE 3AAZA 3RGVB 4FQJH 2YK1L 3CPLB 2K3TA 3UJIL 4C56D 1CFSB 1XIWA 4WCYL 3R0MA 5D96B 5K9QI 1G0DA 3JWOH 4R7DB 3MZTA 3QI9B 1ONQA 3MV01 1YN7A 5J0BA 3QXDB 4Q9RH 5FEBA 1AGCB 5HHOB 4WHCA 4YE4L 3BKCL 5DRZA 2HJLB 3VXRA 1MRCL 1IGML 2BHYA 1AIFA 1J0YA 1WTLA 2A6DA 3UZVB 4JO4H 3IKCB 4LLYB 4WW2B 3B9DA 4ZDHB 5KBNC 1FFOA 3PWNA 5INCA 5CGYC 4C54A 3D39E 5TH2A 1QLFA 3RY6C 2BNQA 2C7UA 2ZSVA 5EZIH 4YFLI 3QH3B 4L3CB 3CDGB 4G6KH 1O5DT 5B38B 4OLZL 3OKEB 5JW5B 5CWSA 3UZEA 4OZ4B 2HH0H 3TNNB 1YZZA 3TBVB 2YD8A 3B3IA 2DTMH 4JRXD 4XZUB 1J1PH 1PG7X 1XCQB 2R69H 2YBRA 4O2CA 4MA7H 2JLLA 4GKOA 1A6AB 1INEL 3AREA 4LLDA 3BO8A 1OGAD 4K71B 4LBEA 4F8TA 3HCVB 4HX1A 3T3PE 3QFJE 5ID0B 5GHWL 3ULVC 3SQOH 4WW2F 4TUJA 3MRKB 4KKLC 1YEHH 3HTLX 3F6LA 4L5FL 3WIIH 1E6JH 4H8WL 2IPUG 1GH7A 5SWQA 2ZUQB 5F7EH 3QA3A 1AJ7H 1OL0A 5B39G 2AJVL 3EYSL 2LVCA 3OR7B 3UDWC 4QRRE 3LMJH 2IALB 1BECA 1J5OH 4NJAH 5HHMB 1OPGL 5JHDE 3HUJA 1ZXQA 5EU4A 1DBAH 1K8DB 3KYNA 4KUCD 5EU5A 4GBXD 4CRPA 3U4BH 1RIUH 4AK1A 2FZ3A 1SEQL 3R8BB 4KJWD 1QHOA 4OCRL 2FGZA 5FYJU 4N0YH 5T3ZL 5SWSB 5T5NF 4OZFA 3ZL4L 1F4AA 5CP3H 5IK3A 2MOVA 1IBGL 2V17H 3O6LH 3VGEA 1FL3A 3QAZB 4HUNB 1QVOB 2VUYA 1AGBB 1CGUA 4N8VG 1DN0B 2XTLA 3AMKA 4ZXBB 4FOMA 5EULV 1HH9B 3W39B 1KN2L 3HFML 3ULSA 4A6YA 2GAZA 2DM2A 3QPXL 4Y19E 5KVGH 4MJIB 3KPLB 3OAUL 3WDJA 4XI5C 1CDJA 2YKLH 4XXCA 5E99H 5EU7C 2CDGB 2C4FU 4G3YH 2VXTL 3Q6FA 3T8XA 4JDTL 3OF6D 3ESVF 3TIEB 2WBWB 4YJZL 2WV3A 1D9KC 5GJTL 2NR6C 5IVXB 4OM1L 2AVGA 4Z78A 2HWZL 3MFFA 3DETD 4JN1H 1CFVL 1QO3B 4GUPA 5IM7A 3IDYB 1G7QB 3FOMB 3QNXB 1ZE3C 1DBML 3QFDA 3GFUA 1B0GB 1ZVSA 2YRPA 2IJ0C 4K55A 4PGZA 4Z7VE 1SBBA 1SJXA 4K7PL 5GQBA 4WU5B 4WWID 3ZDZE 1E6OH 2R15A 4JFOB 1NANH 1A6TA 4RFNB 2QSVA 1DBBL 2BHUA 4XPHL 2ICWA 1S7SB 5KN5B 4I3RL 3KPQB 1H5BB 3NN8B 3V5HB 8CGTA 2LU3A 1F58H 3T65A 1N7MH 3FO9A 1EHXA 3GI8L 3SDCA 4NUGL 1ZTXH 3KPNA 4YGAB 1OP5H 3BRGC 2B4CH 5IVXF 3IDMB 3GKZA 5D7LD 2OTWA 4PJXF 4H0GA 2CIIB 1WT5A 3MBEB 3OXSB 1EEZA 3TO4D 1BOYA 4HUKB 2ZCHL 4HWZB 1MLCA 1OLLA 4NCC1 3HE6C 3AS1A 3EYUH 4O2EA 2AK1L 2WBJD 5E6ID 2P8PA 2PN5A 4XCYA 4Y1AB 1NGQH 4GKSA 4DGVH 1YC8A 5FV1L 4KU1A 3MSPA 2ERJB 2H1PH 3O4LB 3RUGA 1FYTD 4HV8B 5C3TA 4LCYA 3P3YA 4I8DA 4X4YA 1S8DA 2MQ3A 1MCHA 5JW4Q 1FV1A 1WWWX 5CMAA 1CD1A 3O8XA 2CO6B 2X9XA 1FCGA 1IC7L 4G80B 5I1LB 2KKQA 2KUTA 3QXVA 2DQDL 4KK6D 5LCVH 2R56L 3ARTA 3RWCA 2VLJE 3TV3L 5JOFA 3MRQB 4WVRA 5IB4A 5JHDB 5DO2C 2AJUL 3NPZB 2V2WA 4U1KA 1T0NA 4M1CD 4QRQA 1D5XB 4ZUTB 4R2GD 1H3UA 3VXMD 1TJGH 1EUUA 4MD4B 4DUXA 4PPTA 3VXSA 1DQDH 2R1YB 2IPKA 5E8PB 3INUH 1TVHA 2B39A 1PAMA 4HC1H 1KJ2L 4LAQL 5GRJL 4NQCA 1PDKA 5FKAB 4XX1E 5ITFA 4FQXB 3DJ9A 4JFPA 2IFFH 3RNKB 3VXQA 3SGDH 4Y19B 1JNNH 1QBLL 5FCUL 3U0TB 5GZOD 1HHHB 4MXQD 2EC9U 4XXDA 5CHNA 1CLOH 4UBDD 5HGDB 2P8LB 1MY5A 3TN0A 1PLGL 5J1SC 3MLYH 1NANI 2VR5A 4OI8A 2ARJB 3HKFA 1S7TA 3HNSL 5KS9A 3F6IA 4IMLB 4P5TD 2YD7A 4JKWA 1U8JA 3BPNC 3IDGB 1WBXB 3PXJA 4Z7NF 3DBXB 3P4NA 4GW5B 4Q9BA 4R7NB 5FYLH 4ODHL 3SDXE 3S34L 5GRZA 2CKNA 4LSVL 4ODTL 4DGIH 4HT1L 2YRLA 3GK8H 1IQDB 4AIZA 5DJAB 3O45A 1V3JA 1S7XB 3CVIH 4K3HA 5DRNA 3KVQA 4JDZB 1C5BH 5LGJB 1KT2A 5H2BB 1EZVY 3MV9D 1U36A 2CJUL 1QFHA 1A5FL 4KUZH 3WNKA 1NKRA 4BK5A 2R0KL 1WAAF 4RQQA 4JJ5A 3FONA 1ODAA 1XEDA 1OAYH 1EA9C 4KDTC 4CADB 1CE6A 1QQDB 1UZ6E 4KRLB 3MV7A 1HH6B 3RIFK 4M1GH 4FP8H 5C0EB 2DRUA 3OJDB 3LOWA 5IQ9B 1OB1A 5DQDL 3SKNA 3LPWA 5CEZL 3PL6B 4QRPE 1RZGA 4ZD3H 1TNNA 2OP4L 3GSRB 3IFNL 5H94A 1OT1A 1RK0A 2MHAB 4PJEB 2FJHA 5JMRA 4JHWH 4I48B 3HC4L 4X7SH 3ZDZF 4JLRA 3DGGA 3T0DA 4FTVE 3TA3D 1IEBB 3U7AA 4NQED 5FOBA 2DYPB 5BRZD 4LCCB 2HRPH 5DR5H 2JF1A 5BV7C 3VGDA 2D03L 1I7UB 1MAKA 2EEDA 5IG7B 4MNQA 5JIHA 3D0LB 1OARL 4NQDD 4X7TB 1RUKH 1Q8MA 1UQSB 1CZ8H 3S4SG 2AAVA 1NCTA 3ROLA 3ARGB 2BY2A 1KENH 4OF6A 2CO7B 4S11A 2M8XA 2VITB 3EOTH 3RWHA 1MEXH 4FN0A 4NZDA 5C08A 4QY8A 1YEIH 2BVUA 4PJEF 1MJJB 4P59H 2ZUWA 4I0PD 3IETA 3U46A 3SGDI 2OI9B 1KEGL 1MQKH 4P3DB 3C5SB 3E6FA 5A16B 4BQCA 1OWRM 3DROA 1NEZG 4OUUB 5HGHA 3SO5A 2AKRB 1TETL 3WKMH 5CIPB 2X4NA 3RBSA 1KIQA 1LEIA 4JKMA 4JPVL 4LNRA 1X3DA 4QXTB 1IAIM 1OT2A 3MGTB 3UTQB 4NJ9L 4Y0GA 2YUVA 5D6CB 5C0ND 1T0MB 1FZMB 4Y16A 4M7LH 5D1XA 2XWJB 4N0UB 2GJ6A 3PQYE 4GBXC 2G5BA 1IGCH 5JA8B 3WSQH 4KJWC 2XZAH 4HC1A 1UCTA 1AXTL 2VLRD 3ARQA 4DK6A 4YH6A 1YEGH 2R0LL 3MA7B 4NKOB 4HKJA 3B9VA 3JVGA 3EJYD 4OFYA 2FR4B 3SDXB 3HI5L 2M26A 4Y4FB 5F1SA 3SE8H 1B88A 3DRTB 4J3OC 4Z7UE 4XP1H 2WQ8A 1U8MA 4RNRA 2UZIL 3PNWA 1L7TL 1TZHB 5IJKA 1NH6A 4IHOA 1LQSR 1BF2A 3MLRL 2AV1B 3LDBB 4F7TB 1Z2KA 4NC1C 4M8QA 5GGVH 3EDKA 9CGTA 4MA3B 4GXUN 4PJ5A 1JGEA 4M93C 3OJ2C 4WUKH 3EYQD 2IH1A 2BC4A 2EDWA 4BFIA 5DDHB 4EDXB 4F2MB 3T0VA 4J4PA 5E8EB 3FQRA 2ZUUA 4FQPA 1RURH 2A73B 1J1OH 1AC6A 4OD1L 3SE4C 4AG4H 3BHBB 4HGKC 1BEYH 2J88H 3SDXF 3ULVE 1BIIA 2ITDB 4N90D 2X89A 2R2EA 3D6GA 4NM8H 3TYFB 2XWTB 3MNWB 4H0IA 4D9QD 2ESVA 2CGRL 4G6MH 1WCQA 4PGCB 3K7UA 4FTVB 3O6KL 1M6OA 3ZLQC 1X7QA 3DUSA 3UC0L 4M5ZL 4YHNA 1P7HL 2WBKA 4U1NB 5EOCJ 2BRRH 3VFNA 5EO1A 4JR9L 1UA6H 2YK1H 1AD9B 5HBBA 3DX7B 4CN1A 1RD6A 2E3VA 3TO4C 2Q8BH 4NUJB 5EUOA 2W9LA 4TOYH 3S36H 1GPOL 5HYJD 1TQBC 1JRHI 3CVHH 4BH7B 2VDQL 2LV4A 4JHBA 1S7UB 2R2BA 2WBJC 4FNLH 5SWZD 4NQXB 3MYJA 1MRCH 1T7VA 4UILH 3OX8A 5I19H 2BCKB 1ZHLB 1P2CA 4YDIH 4ZNCD 3TH4T 4LLQA 5DD5H 3QDHA 4JO3L 4L3EA 3GNMH 5B4MD 3QIWA 4DVBA 1QRKA 1SEBA 4G6JL 4GS7C 4WFHE 1EEQA 4OLZH 2AXGA 2VLLA 2YZ8A 1N59B 4HDIA 4PREB 4TQEH 4D9RD 1TPXC 1A6ZA 1NBVH 4JFFE 3HPLB 4WU7B 1KYOJ 3HG1E 3HZYB 3NH7L 1DLHA 1JNHA 4M1CC 1QLEL 5DVLA 5B3JF 1ZVYA 4PJ8C 3PQYB 5BV7L 1XF3A 1TCMA 3D0VB 5E4EB 1NDMA 3IAPA 4R2GC 5JR1L 4DZ8B 5DA0B 4JFDE 3VW3L 4ZUUB 3KLAB 2VR9A 2WUBH 5E2WH 2OTUB 5DHVB 1LNUB 4DTGH 3I3BA 1KACB 5CBAA 1T83C 3BDYL 1MFAL 5KVFH 2EECA 3UPAA 3BPCB 5CGMA 4WY7H 3UTSE 5GS2H 2AJVH 1KIRB 1GOHA 5IMOA 4JY6A 1ETZB 2B8OT 3QUMB 4LLVA 1Q72L 1B0RA 1FFPB 4HIEA 4FQ2H 3CLEH 1MJUL 5GZOC 3MA9L 3UPRB 4MXQC 5IF0B 4X6DE 4RAUA 1LO3L 4UBDC 3U1SL 3D1MC 2FHBA 3TZVD 1UXWA 4KTYA 5IIEA 3C6SA 4LRIA 4R97B 1T5XA 3ARUA 1RFDL 4RWYL 2XKUA 2D31A 1K8IA 4P5TC 4F57L 4LAJH 5I1JH 4PRHD 2GITA 3RVTC 5KVEH 5MHSE 4PRPA 1FNGB 4ZUWA 4LQFL 2GJJA 2PTTB 3BD4A 4ZO7A 3G5XB 3U4AA 1FBIH 3QEQE 5C9JA 3NCCB 2ZG2A 4HXAL 3U48A 1J1XH 3HC3L 5GS0L 3IDXH 3BVNB 2Z93A 3SKMB 2HYMA 4JFXB 4PUBH 1CG9B 2WZPD 3VD3A 2VKXA 3HFMH 4TSBL 4PJ9A 5BZDA 1L9NA 3OKDA 3WFCL 1TXKA 3V8CA 5KSAC 3DVNA 4CNIA 2Z0BA 2I24N 5D7IA 2NY1D 3THML 4KZDH 4WI7A 3MRDA 1U58B 1BQSA 4U6YA 2VXTH 2PETA 1ZEAH 4MXWL 3U7WL 4DOHE 1DL7H 1R5VB 3QUYC 1HHGB 2PKDA 4ACPA 5HVHB 1CXLA 1JGDB 2IBGA 4YUEL 4EXPX 2P42B 3NCYP 3KYMB 1PG7L 5HVFB 5J57B 1AD0B 1ZHNB 3LKQA 2OL3L 1DBMH 4R0LB 1ZSDA 3K2MC 1NUGA 3NFPB 1G84A 3TYGH 4TNWF 3RIAF 4LSQL 2HKHL 2BFVL 5C07D 1KLGA 4U1JA 4HK0A 1R0AH 4XPHH 1MIEH 3CVHA 4PGJA 2IG2H 4I3RH 5E4IA 3K3QA 2FO4B 5HI3D 3STZA 2K7QA 3JXAA 2JJSC 4MJ5B 4U1SA 4WTXA 2BHZA 1QBML 5I1KL 1FO0B 3MACL 3EZ8A 4JFFB 2EE6A 3TVMD 5I8KL 2APFA 2YZ1A 5HYFA 4WTZG 3HE7A 1N6UA 4HKBB 1RJZA 2HFEB 4PY7A 5I9QC 3BWAB 5GGQH 4NKDA 4MAYB 2AJXL 5GIRB 1HHKB 3T3MF 5J12C 3TNMB 2Z4QA 1CXKA 3DECA 4I0PC 4JFDB 5HDLA 1PZ5A 4ZO6A 4NWUL 5BS0B 4NGHL 3FB8B 2MMXA 1FVCA 3NA9L 1R5IB 2I5YH 2QQLL 4JG1L 1LD9B 4UI2A 4MX7B 2C4FT 2IADB 4GO6B 1EZVX 5DJ0B 4YXKL 3GMMA 2O5XH 4XHJD 2ICCA 3I50H 2NNAA 1ZAGA 3OR6B 1OAZL 1T20A 3UTSB 2X4TA 3IAGC 1XF5A 1I8KB 4OZIA 2X4UA 3OJMB 4HUXA 4KTDL 4KJYB 3RU8H 4C56E 5F7HA 5DJ6B 3UPCA 1A4KA 1JHTA 4X6DB 4R8WL 1URLA 3CSYA 5C3LD 1IM9B 4FXLA 3FB7B 2Q8AH 4F33A 4JKLA 3JV0A 3D85D 1KPVA 3KR3L 4C83B 4IIQA 3HE6B 4MA1B 3EJYC 2PYEB 4OCXH 4X7CC 2OR9L 5T1DL 3V95A 4FQ1L 1I85A 3E3QE 4LFHD 2XXMB 5C8JB 4ZTOL 1JIBA 5E9DA 5CJXC 3T0ED 5HGAA 5FFLA 5K9QG 4FZEH 4APQD 5IEHA 3CXDL 4LP4A 3RWFA 3RL2A 5HHXL 3MLTB 4JPIB 1D5MA 4UDUB 4YHZH 3DXAB 3IXAA 5E8OA 1QACA 4JRXE 1ES0B 1MJ7L 5FCUH 1ZLWH 1ZT1A 5ESVB 5CAYB 1TFHA 3PGDB 4X6DF 3WD5L 1WQVT 3EYQC 3GMRB 2X7LB 5IROC 1PLGH 4GG6F 4DOHB 1SM3L 5DEGA 3VD5A 4O51A 4N0RA 1OGAE 4LIQL 1YQ2A 1O7VA 1ZLWK 2EDJA 1Q94A 3D25A 4HBQA 4S1RL 1T22A 3UTTB 1JL8A 5T33H 3G6JE 4Y5VA 3IDUA 2MWCA 3MCKB 2VXUL 1A6VL 3JTSB 4JFEA 4OI7A 3CFDB 3HNTH 4M8VA 2FEEI 1LO0H 4FXGB 3A6BL 1CGYA 1H3TA 4HFWA 1ZT7A 2CRIA 5I1HH 5EBWB 3V6ZA 2DB8A 1VGKA 3KLHD 1HILB 2JCCA 1A5FH 1AKJA 4TSCL 3VXOA 2R0KH 3QXAB 2X4PB 2Q3AA 4X9FA 4OLUL 3E2HB 2R1XA 1QNZH 4CMHC 1IGYA 2QSCH 4RDQF 1BZ7A 1JPFA 3RWEA 4HJJL 3CLFH 3SPVB 1RK1B 4XVSH 5I15L 1UWGL 5DSCA 4ZG1A 2YPKB 2XN9D 4YR6A 4BKLA 1N4XL 1F6AB 3BUTA 1LVEA 4XPGH 5DFVD 3P0YL 5L88L 5J11C 2SEBA 5IHLB 3RZCA 1CT8B 1WJ3A 2OP4H 2KDGA 3RA7H 3PP3K 1G7JB 4MNGE 1IAKA 4QTIL 1CIDA 1U0QA 3BPNB 4DQOL 5C7XL 1VPOH 1YEFL 3MRGA 2VB5A 4YXHH 1G1YA 3JWDC 5E2TH 2DQFA 4HEPG 5B4MC 5IV2B 4TULH 1WCBA 2EC9T 2VTFA 2PO6D 3B8YA 3MR9B 4OIAA 3LVEA 4QGTA 4BQ8A 1F11B 1OARH 3FRPA 5D7JB 5JO5A 4NC1E 5ISZD 3DVIA 1CTOA 4PTUB 3D3VA 3QIBD 4LSRH 4ZO9A 2LE9A 2NY4B 4UQ2A 3VDAA 3ZZ1A 1EHLL 5SX5K 1W72B 3U0WL 2R39A 1QPPA 5JOEA 2C3HA 1U92A 3DMMB 1FFNB 3SKJL 3MQIA 3V4VL 1I1FA 4NWTH 4XVJL 4YZFF 1MVUB 2F54A 2X6MA 1D7FA 1G7LB 2IQAA 4DN4H 2DQGL 1P7KA 1JP5A 4LSUL 2DLFL 5AD0B 1M7DB 1MHEB 3DIFB 1TETH 5DMKB 4UT7H 4OCLC 4EXKA 1DUZA 4XC3H 1Q9OB 2GY7B 1QSVA 5CJBA 1CXFA 4JG0L 1RULH 3ZKXC 1T7YA 5FKPB 2ICEA 2Z35B 1HN1A 3QG7L 1ZKAA 1Y6KR 3DI3B 4I0KA 5F9AC 1IILE 1P7QA 2AQ3A 3TZVC 5D7LE 4RFOL 3FAXA 3HPJB 4OKVB 1KJ2A 5JPNB 3VI3E 4LOUD 3SCMA 3BAEH 2GIYA 4NKIL 1OGAB 4ONOA 4BK4A 3UJJH 3FQUB 1KCVL 5CINL 3RVVD 1RJYA 5D71H 3SDAD 2D3VA 1EFQA 1FC2D 3LY6A 3HI5H 2E27H 1T1XA 3CX2A 5E94B 1DZBA 2NY3B 4XBPA 5JW4M 3B2VL 1FYTE 5EFIB 1P84K 4NDMB 5TF0A 2UZIH 3GSQB 3CMOH 3PV6A 4K2UH 1AE6H 3PGFH 2ZUYA 3MO1A 2NY1C 4KQ3H 3VFWA 3FHQA 1H3GA 2OJEA 2BNRE 2O93L 5ID1B 1H8NA 2NLJB 4ISVA 3ZTJH 1KF9B 3F7YB 4O9HH 1V3KA 1INDH 1XGTB 2ITCB 1EBAA 3BEWA 3KPSB 1R5WA 1YECL 1FP5A 3VFSB 4RA0C 4PJHB 5JW3L 1WBZA 3KAAA 4PRAA 1JPSH 4ZAKA 5K93A 4XPFH 1LE9A 4JVUA 3VXME 1JHLL 3L6FA 1GSMA 1A1OB 4MNGB 4MZ2A 3WEXA 4ZYKA 3OKOA 1NGZB 1SYSB 4I3SL 1CGVA 4V1DB 1VCAA 2FX8L 4XVUD 1DBJH 4ODWA 1AHWC 5EZJA 1FNEA 5HI3C 3UXFA 4WTWA 4AT6A 5DHYB 4TVSa 1RV6X 1G9NC 2C3GA 1I1YA 2MCPH 4RIRB 4JKPH 5DT1H 4RMQA 3TVMC 1HIMH 2JIXA 4OFPA 2Z91B 3TPUB 1JHKL 2IMMA 2Y07L 1RUQL 4PJHF 2C1OB 1GPOH 4EN3D 3QJHB 4UAOC 5ADPH 1YNKH 5FYKL 5FDWA 4J3WA 4F37K 4YDJB 5DJCA 2UZXB 5C0FB 5J13C 1AR1D 4XVTH 4HMEA 3ULUH 4YGVA 1OLZA 3LHPH 1OCWL 2PF6A 1JMZA 1I3GL 4GKZB 4JREC 4HULB 4AM0B 1Q0XH 4X5WA 4YIQB 2ADFH 3EDFA 3MV9E 4MCYA 1P69B 2B7DT 3EDDA 1AGEA 1VFAB 1MFBL 1PYWB 4NP4H 5KSBB 1G6VK 5DGQA 1MPAH 3NH7H 3BKJL 3KXFA 5L2JB 3O3AA 2IH3B 2A6KA 1P6AB 1D5BA 5GSVA 4WI5A 5D5MA 5FA4B 3QDJA 2AV7B 1FNFA 3NPSB 1D6EA 5HGBB 2AS5M 5D6DC 5D7LB 1WFTA 4OLYL 2EICA 3GZKA 3RBGA 1X6NA 2HN7B 4JAMB 3HN3A 3ISWA 2BVEA 4FG6D 1IC4L 2X1OA 3QBTB 1HEZA 4S1QH 2O61A 3HB3D 1DP0A 3QCUH 2HJFB 2WBJB 5E6IB 3U7YH 2J3SA 3KYKL 2J1KA 3L9RA 7FABH 3SE3C 1JGLL 1MFAH 3T0EC 4PY8J 2APBA 4MDJB 1FDLH 3BUYA 4LLMA 4APQC 4NQEE 3HI6H 5BRZE 3Q6GL 1FYTB 1GGBL 4D2NA 1ORSA 5F21B 1MCOL 5DD6A 5KSBF 4U7KA 1RZKC 2F8VA 5I6XC 4GS7B 4NQDE 3P77B 4G42A 1MELA 5D4QA 5ICXB 3QRFM 1NGPH 4NN5B 1RIVH 1TPXB 3DHMA 2CSPA 4K3JH 4LHUA 4ODUB 5DFWH 1HK6A 2YRZA 1A6WH 4JQXA 4OGYH 4P2RD 3FN0H 3VI3F 5CP7A 5F44A 2P43B 1KB5B 3GMQB 2FX9L 2MKLC 4HKXA 5JW4R 2ZG1A 3T2NH 2B1HL 4R2GB 4XP9H 2EDKA 1EEUA 3TBYA 3VXMB 1IJ9A 3MRPA 2VXSL 1V5JA 3MRHB 5GS0H 2ADGB 5IBTH 5BXFB 2AW2A 1F3JB 5DUPL 1OAUL 2ZPKL 3KLHC 2C9AA 2XQBL 2JJWA 1KJMB 1A7NH 1AI1L 3QWOB 3MCLH 2R23A 2MCG1 3U7WH 2Z31A 1MCLA 1QA9A 5INDB 1NUNB 3LS4H 4JFQA 2VLRE 5AZ2H 4NKMA 2Y5TA 3BISA 1CLZH 3DRQA 5DFVC 5BVJB 3V0WH 3G5YA 4GSDH 4GW1B 4P5TB 4U6TA 2OL3H 1X5IA 4F7PA 2GW5A 1IRAY 3BKYL 4EBQH 3ROOB 4HXBL 4Z5RB 5IVNA 4TUOA 1F4YH 2DQHH 4UTAL 4PGBA 1CGWA 1BFVL 4GLRH 2PO6C 4O5LH 1ZLSL 2GTWB 2AJ3B 3ARDD 1BWWA 1U8PB 5EA0H 3QIBC 1IE5A 2NMSA 4RFEA 4GKNA 1V8HA 5I1CH 5BMFH 4OJFL 3OKMB 1IQWL 5GGSA 3TJEH 4WFGD 4XAWL 4UU9B 4YQXL 2IQ9L 1NMCB 1NQBA 2FCBA 3WBDA 4FQIL 1NAMH 5LAXB 1KSRA 3ARFB 1T1ZA 4JVPA 2HVKB 4PJCA 5GS1C 4N90E 1UEYA 4NWUH 3RDTD 2FJGA 5AG8A 5AWNH 4MSWB 3HI1B 3BMWA 3VRJB 1LK2B 3W0WA 4M9OA 4D9QE 4HLZH 4L8CB 4K23L 1R3JB 5JLZB 3TA3B 4ODXA 1RSFA 1P1ZB 4YXKH 5F8RC 1PY4A 4GXVL 2DMBA 2FBJL 3WJJA 1ULVA 3FTGB 1MCWW 3LZFL 3OKKB 2ZJSH 1KJVA 4L9LC 3ZE1F 2J8OA 3MNZB 4FA8A 5JQ6H 4XP5H 2UWEE 4NQDB 4XNQA 5LGKA 4WHYH 4PRDA 1KPRB 2VLKB 3TF7C 1NSNL 5J6HA 2RFXB 4NQUA 5L2KA 4XCNA 1PD6A 5IB2A 3KJ4C 5AUMB 5HYJE 4LOUC 3E6HB 5HXMA 3GM8A 1IKNC 4N0CD 4YK4B 4KPHL 5HY9A 1I8MB 2VJXA 3C6LA 5SWZE 5A3ID 3QUZA 3RVVC 4GRWE 4RMRA 1XR8B 4JFZL 3SDAC 3BEVB 1ZGLM 1OD9A 4PRIB 1QFWH 5T1DH 4E0RA 4OV5A 1XCTB 2JB5L 5GRUL 1F2QA 3R1GL 3PWPD 2BOBA 4YC2B 5AEAA 5H35B 5J6GB 4ZTOH 3T77A 5GJSL 5MENB 2VDRL 2V9TA 5DJ8B 5E8NA 4ZSOE 3G6AB 5E1AA 4XC1H 4PGEA 3CUPB 4NZRH 2F8XC 2P44B 1X5KA 4D9RE 1G1CA 4JDVA 3EO9H 4DZBA 1NCWH 1SY6L 1MJ7H 5I1AB 1FZJA 2WLZA 2A77H 1JZ2A 3K81A 4PJFE 4LLUA 2BVQB 1A1MB 1MREL 2A74B 2IAND 1FL6A 1SM3H 3VH8A 3BRFA 3L3IB 4Z7WB 4LIQH 1MSPA 2I60L 1EMTH 3GBMH 1RZKL 3GKWL 4WHTB 1JYWA 1HOCA 3V6OC 4YHOH 2F5BH 5E95B 4FQLL 3QDGA 4X6CA 2ZOKA 3FMGL 4Y4HA 4L29A 2FL5A 3AUVA 4ZNEA 5JPMB 4XVUC 1L6XA 3QUXC 1EFXD 3SO3C 1U91A 4MAUH 3NMEA 2OL3A 2FSEB 3LPGA 4H26B 1U41A 3L3DB 3O3DB 1FSKB 5F7LB 3RWJA 3CH1A 5C09D 4JZJB 3WFBL 1N6QL 5F1NB 3WS6C 2PR4L 3PHOA 5TDNB 2A6JB 2IBZY 4KZEL 1VDGA 4HJJH 1IAOA 4X6BA 4Z7WF 3RTQD 4EN3C 1N0XH 3HHRB 3ARRA 3K1DA 4I18A 4PRHE 4U4BA 3WO4C 5AG9A 5IFAL 1IEAA 4PV9B 4WUUD 3LB6D 1YY8A 4P3WA 1FAIL 5K9OA 2EDBA 4GRLA 1MH5A 3HAEG 4JCMA 2BDNL 3O2VL 5EIIB 3EFDH 2VQ1B 3LD8B 4NZTH 2N56A 4M6OL 4O58L 1FJ1B 2LAGB 3KJ6L 2D0FA 1IAIL 2P8MA 1G7HB 4I5BA 2B20A 4P9MH 5EU6B 3L7EA 2F58L 1T1WB 3MNVA 4D94A 1HHIA 3IDNB 4LVEA 5E70A 1NMAL 1JVKA 1QFWI 3T08A 3ZE0F 1YQVH 5I1EL 5T1MB 1OP3H 4BZ1H 2R0ZH 2AXJA 4OGXL 2NXYD 1YNTA 4G7YH 1SBSL 3NIDE 3IJHA 5CWSB 3CPLA 3V4VH 3VG9C 5HYJB 1CFSA 4KC3B 4XH2B 4FG6C 4ALAL 4R7DA 4ELME 3VJ6A 2CK0L 3HB3C 4TTGA 2XWBB 2FECI 2R2HB 4JHAH 1AGCA 1F00I 1ZLSH 4NCDA 2HJLA 5C07E 5EZLB 1WFNA 1FO0L 3IKCA 4LLYA 4WW2A 4JG0H 4ZDHA 2O5YL 2APTA 2DIBA 4LDOB 1P4BL 1J0ZA 1HXYB 3QG7H 5ECJE 1A4JA 1J0IA 4N5EC 3O4OC 3QH3A 2YD5A 4L3CA 3TP4A 3CDGA 3IDIB 2XTJB 3QP3A 5B38A 3OKEA 5JW5A 5DEZA 3GIZH 4PJFB 4OZ4A 5DUBB 1S7WA 4UMGA 3TBVA 3GEWB 4XZUA 1BLNB 4H5SB 1XCQA 4P4KD 1NLDH 5ACLA 2EDRA 5C2BH 2NXZD 3KPTA 2R8SH 1N5YL 5KVDH 1MCRA 1A6AA 3WLBB 4LARL 4WWKD 3KYNB 5B8CC 4R3SB 3NACL 1OY3B 1ZOXA 5KW9L 3HCVA 1PEWA 2DQIH 5ID0A 3B2VH 2E5EA 2XRAL 3B9EA 3WIHL 4OZFB 1IFHL 1GZPB 5TF1L 2EZ0D 1RJLB 4LRNL 3FO0L 4YFLF 4WGVB 2RCSL 5DRXA 4R4BB 2IEPA 2JJVA 5I17B 2EH8L 4PJFF 5ACZB 3OR7A 2P4AB 4DAGH 1YECH 3BDBA 5DMIH 3QQ3B 2V5SA 1W0WB 4KI1A 1YNLH 4PRHB 1K8DA 3Q6FB 3T8XB 1A02N 2VZTA 1MCIA 1JHLH 1MCJA 5A2KH 1NBQA 2I07A 5SWSA 2EXWD 3T0EE 2R4RH 4O02L 1TZGH 2VR4A 4OF3A 5EPMA 1DFBH 3MRIB 4ZFGH 3ARDC 4XP4H 3LN5B 1AGBA 3L5HA 1I8LA 1DN0A 1ZMYA 2LQRA 3HC0B 4IRZL 4Z0BH 3WHXB 1ZLVK 1C5CL 1HH9A 3W39A 3S6CA 1E4WH 5F7YC 1LK3H 4U2ZA 2BSTB 1S7RA 3MZGB 4MJIA 4ODBD 1KXTB 3KPLA 1T03L 1IGTB 2CDGA 3F12B 1AQDB 1L0QA 3RKDD 4Y2DD 1H0DA 3MBXL 3STLB 3WN5A 4KMTL 4ZTPL 5IOPB 1QYGL 3IJYB 5FYKH 3TIEA 3ZE2F 3RDTC 1G7IA 5IVXA 4M3JA 1FG9C 2PNDA 1F3DH 1QO3A 2NY6B 3FQXB 1G7QA 1CXEA 5I18L 4AMKL 4P4RB 5BW7C 1B0GA 3GMLB 3C60D 1J87A 3L5XH 3AM8C 4WU5A 2P8PB 5IR1B 1MFBH 2XZCL 2Z8RA 2AEQL 4QTHB 2VXQL 2E7LC 3QEHA 3D39A 1S7SA 4XPAL 3H9SD 5KN5A 2LU7A 3KPQA 3CFIC 5EO9A 1E4KA 1H5BA 3S3JA 1UM5L 3ZDXF 1EDQA 4FABH 3NN8A 3VXRD 5HPMB 3B6SB 5IUSA 3O8XB 3P11L 4OSUH 3QULA 2XN9E 1KIPB 4UOJA 1J05B 3JUZA 5A3IC 2WWKT 3IDMA 4N1CA 1A47A 2AERT 3ME0A 3QEUB 2CIIA 1YUHB 3OXSA 3MOBL 2BNQD 1VSCA 3HLAB 2BERA 3FJTA 5AYUL 3L3OB 3ZYJA 4HWZA 3JV5A 3DLQR 1NFDE 4QEGA 3RKPA 5CJ5A 5B22A 1GC1H 4Y1AA 2XZQH 1LWRA 3VGBA 2GQHA 1MCOH 4KI5D 4OKDA 4JREB 4JFYB 5T1LD 3VXSB 4J3UA 1W72L 3IF1B 4K9EH 3RUGF 4HV8A 5ISZE 2AXHA 3AU1B 1EERB 4X98B 3GJEB 4OTXL 5F9DC 1UKTA 1JN6B 4P9HH 5TE7L 2APWA 4G80A 5I1LA 3NFSL 2HFGL 3ZKND 1PG7W 1BBDL 2YN3A 5ITFB 4AEEA 2F5AL 3HR5B 3I9GL 2WM0A 1A0QL 3MRQA 3H7LA 3SDDA 2FX9H 4C4KT 1GYAA 5DI8B 1MCPL 5JHDA 1T66D 2AQ2A 4XXDB 1UH3A 4WI4A 3DTXB 1EGJH 5CIPH 3QHTC 4NM4L 1D5XA 5CUSH 3MFGB 4ZUTA 3RAJL 2VOTA 3O3EB 2R4SL 4X9BA 3QHFH 3GUTB 2NY5L 2ZOLA 3TT3L 1U8JB 3NZ8B 4PIRF 4MD4A 1KYOK 1VGEL 5BVPH 3MREA 2JJTA 2R1YA 2EYRB 1D5ZA 3T4YB 3SGJC 5E8PA 3DSNA 1AI1H 2ENYA 4AENB 1RAMA 4X0KB 2B0SH 4Y5YC 4H20L 5FKAA 3MROB 2ZKHL 3LRHA 4HBCL 4FQXA 2H8PB 2VISA 2XYCA 3GMOB 3RTQC 4X8JB 3RNKA 4Y19A 1CDYA 2QQKH 5EWIL 3WJLA 2OX5A 4KDWA 3LB6C 3ARYA 4K3GA 1HHHA 4XGZA 5DEFB 5I16B 1DLFH 4RQQB 5HGDA 2P8LA 4NN7C 3FONB 1A3RL 4RGOH 4YX2L 3IGAB 5E2VL 2A0LD 2ARJA 1TMCB 2DICA 4IMLA 4MQXD 4GG8B 1OM3L 2H26B 3IDGA 1WBXA 4LPWA 3DBXA 4GW5A 4R7NA 5F3HB 2BVOB 4I4WB 5I8CB 1WF5A 4HFUL 1IQDA 2QEJA 5DJAA 1S7XA 5FGRA 3UTPD 3DV6A 4JDZA 5LGJA 1BZ9B 1VHPA 5H2BA 4ZFZB 4QWWC 2MFNA 2DLIA 3VG0H 3QWQB 1F8TH 4QHNB 2NXYC 2Z92B 4YEFA 1IKFL 3C08L 5JXAH 1I9IH 4YQXH 3U6RB 2IQ9H 1L4IA 5LGHL 5IWLC 4L8DB 4CADA 1QQDA 1LO4L 2BXZA 1HH6A 1F2XK 5C0EA 1MFNA 1EHAA 4WJ5A 5IQ9A 1JFQH 2C26A 1J88A 4G6FB 1A6UL 4DVRL 3AY4A 3PL6A 1X44A 3GSRA 4KY1H 4CVXB 4ZQKB 3QXWA 2MHAA 1NFDB 4I48A 3BE1L 4GXVH 2WANA 3AMLA 1DE4A 5CGTA 6CGTA 1IEBA 5I30L 2DYPA 3C5ZB 2IBZX 4LCCA 4NOBA 4ONFL 2C5DC 2P5WD 4CVUA 1Z0MA 5HGHB 5ISZB 1H3VA 4OCNC 3QIBB 1KIQB 1I7UA 1UH2A 5IG7A 2VERN 4IRJD 3D0LA 4X7TA 1FIEA 4U6XB 1UQSA 2I9TA 4KPHH 4P4KC 4J3TA 3Q48A 1YEEL 3MRCB 2VLJA 3N0PB 4G7VL 4MLSA 2VITA 4WWKC 3AFLA 3IRPX 1FFRA 3PV7A 5JXEA 3UO1H 4W6XB 1PBYA 5F7DB 1NFDF 1MJJA 1CL7H 3CFCH 5DK0B 3SGKC 3WFEL 3G5VB 2XA8H 3ZHLA 2AI0H 1QFUL 1MAML 3C5SA 3KLDA 5A16A 4HKJB 2QHLA 1S9KC 1FQ9C 4OUUA 2AKRA 3PABB 1Q0YH 3L5WB 1S7QB 5CIPA 5T5FL 5FGBC 4PJ7E 4FMKA 1MIML 1U8MB 4LCWD 3PNWB 4QXTA 1UB5B 3MGTA 3UTQA 5CCKL 1WEJH 4CMMB 5D6CA 1NC2D 1MRDL 4K7FB 1FZMA 5A43C 5EUKB 3N1MC 5DHVH 1IGIL 1U3HC 2DL2A 2XWJA 2CRZA 3WMSA 1WFUA 4PBVC 1EO8L 5CLTA 4LF3A 3GIVA 4S2SB 1GL4B 5JORB 3SDAB 1VFUA 2EXWC 5IQ7L 3MA7A 3UYRL 2WLYA 3QUMH 4D9LL 4NKOA 2QV2A 1RIHL 2FR4A 3SDXA 5MI0C 2P46B 4KGJA 4Y4FA 2RIKA 3TN0D 5A2JH 4HMCA 1DSFL 3WFBH 1TZHA 2FGWL 1G9MC 3VU2A 4AL8H 1KB5L 4J12A 1L7IH 1M6OB 1PKQE 2AV1A 4HAFA 4F7TA 2FB4H 4P2RE 1WITA 3RKDC 4Y2DC 4EUPG 3C2AH 5BOZG 3ULVH 4TVPL 5HDBF 2GUOB 4AEHH 5I8OL 5DDHA 3G5ZB 4F2MA 1D5IL 3O2VH 1NC4B 5E8EA 3RIFF 4Q9QL 2FRGP 1SJVA 2A73A 2AJZB 3EYVA 3BHBA 4UV7H 1EAJA 1IC5L 3CSBA 3KJ6H 3FFDB 3C60C 2ITDA 1QSEB 3TYFA 3JWNC 3SO3B 2XWTA 3MNWA 3MV7D 4L1DA 2AJYH 4PGCA 1RZFL 4FTVA 1TJIH 2YUWA 3W9EB 3U36A 4WEMB 4QGYA 1A64A 1IL1B 2PW2B 4R4FL 5F6HJ 4WI6A 4NQSB 5LWYL 1BAFL 1CDHA 1M05B 4U1NA 4OGXH 4LSSH 2AXGB 1CL7I 2VLLB 4QXUH 4OCYL 2VSDA 3VE0B 1W8NA 3DX7A 4YNYB 1Z3GL 4ALAH 2H9GB 5GISH 1RPQA 2CK0H 4UINL 4NUJA 5EUOF 3SE9L 4MCZB 5IHUL 4BH7A 1XF3B 3GJFK 3PJSA 4MNQD 4NQXA 4LKCB 1JUFB 1HHJB 1ZHLA 4KI5C 1FO0H 5LKNA 4PRBB 2NTFB 5ICZB 4OM0H 2FEDD 4DKDC 4PJDE 2A83B 5KSVB 4NNXB 4TUKH 3AREC 5DD3L 3NGBB 4PYHA 3H3PL 2P48B 4PJ7B 3ZKNC 4PREA 4WFGE 5IMOB 3O6FD 4JY6B 2DJUA 3HPLA 1LDSA 4WU7A 3HZYA 3A6CL 4TNVK 2YR3A 3K2UL 4XNYL 1T66C 3OAZK 1ND0B 5C0GA 5EO0B 1ZVHA 5TE6L 3PQYA 1WGOA 3D0VA 4OQTH 1BQLH 5IIEB 4DZ8A 3WFZA 3RZWA 4K8RD 4UUJB 2XRAH 2D31B 1K8IB 1KIUA 3KLAA 4PRPB 1CR9L 4WI3A 3S8WA 2OTUA 4UT6H 5DHVA 5FV2A 3DVGB 3VDCA 3U30B 4Y16D 1VERA 2OJZH 1LNUA 5D1XD 3QQ4A 4MVBD 1B2WL 2V7HB 3GSXA 3DNKA 4NFBA 3BPCA 3NCEB 2A9MH 4PJ7F 3E1F1 1RZ7H 2EDDA 1YYLH 1ETZA 3QUMA 1BQUA 4EIZC 3G6DL 3HAEB 5I71B 1FFPA 1A7QL 1PKQB 4PJAE 3UPRA 5IF0A 5C92A 1GOFA 3R0NA 1BJ1H 1CGSL 1BM3L 2VDNL 3WS3B 2A0LC 4OFKA 15C8H 4MQXC 2ZCKH 3K4ZA 3PWPE 4QO1A 3EHBD 2BNUB 1FNGA 5FYLD 4XXCC 3LKNB 2PTTA 1OAQH 3ZYIA 3G5XA 4Q74A 3PWJB 4FQHB 1MFEL 2AABH 1IVLA 1EVUA 1Z5LB 1ZSDB 4G8IB 3DURA 1RMFL 3BVNA 1F90H 2DWDB 3SKMA 4JFXA 1CG9A 3BKML 3MLUL 4U1JB 5D1QD 3EDJA 1SYVB 4UNTA 2IANE 2B1AH 5F7FA 5CSGA 3MYZA 1U58A 2ZUSA 4HMDA 2X89D 4U1SB 3FO2B 2FLRT 3JWOC 1DQMH 1J18A 3FFCD 4JY4A 4QHKJ 1R5VA 3VFMB 5HGGS 1HHGA 5FUCC 2ESVD 1JGDA 1K5NB 4GH7B 1WTGT 3KYMA 3L1OH 3MJ8B 5AAWA 1J8HD 2OMBA 1AD0A 3HMXL 1ZHNA 2BP3A 3CSPA 1K2DB 4R0LA 3F58H 3QHZL 4NN6C 1YC7A 3SDCC 5T1KA 1XGPB 1MCWM 5LXGL 1VEMA 3NFPA 2Y6SC 4LSTH 3B43A 3CZJA 3LH2L 3GO1H 4CVWA 4PJDB 5C09E 2NCMA 5EG6C 2E6QA 4QNPF 5C0AD 2FO4A 4IRJC 4MJ5A 2Z9TA 1T20B 3P11H 4QCIB 1FO0A 2LAAA 2J4WH 2FIKB 4WUUE 2GTZB 2X4UB 4JFFA 2D4DA 5T3XL 1JPTL 2F53D 4X80H 4YDLC 4ZOCA 3MOBH 1NCCL 4HKBA 4OZGB 2HFEA 3QIWD 3BWAA 3RDTB 4RBPH 5GIRA 1PJ9A 3TNMA 4F33B 4XBEH 4R9HA 4JFDA 2HT3C 1K9TA 5BS0A 5B39A 2HA1A 3FB8A 4BZ2L 3RHWK 1R5IA 3ZKQD 2B2XL 1LD9A 4RBPK 4XB7A 1S7VA 4MX7A 2IADA 4OQTA 4PB0H 2Q1EA 1B6UA 2DQJH 5DJ0A 1U95B 3OV6A 3OSKA 5IB1B 2J6EH 3OR6A 2W9DL 5LJYH 3UTSA 3NFSH 4HIHB 1I8KA 1FH5H 4RX4A 1DQQB 4Y88A 4ZOEA 4KJYA 1U8OA 5DJ6A 3MJ9H 4MB4A 3X11A 4X6DA 4OZGF 5DZOA 5D72L 2O5ZL 5ILTL 3A0OA 1YEKH 1IM9A 3BIBX 3QDMD 1GGCL 3FB7A 4NM4H 4N8VA 4LASH 3RAJH 2R4SH 4M4RA 3S36X 2NX5D 4JZNB 3QCVH 2NY5H 2RAMA 3PWPB 4C83A 3MLSH 5MP6H 3IDJB 3HE6A 1JI1A 4UIKL 3EOBB 1INQB 3QSKB 3CDFA 3TC9A 3TN0C 2J2ZA 5C8JA 3D69B 4JFEB 4CU8A 3D9AH 4H20H 4DKFL 4XMPL 4L4VD 2ZKHH 1E28A 3MLTA 1ZT7B 4JPIA 2DOCA 4UDUA 3AGVA 3DXAA 4PJGE 5FM5M 2IANB 2ZSWB 1ES0A 5L0QC 3VXTB 1AKJB 3PGDA 3UZQA 3EUUA 4PP1D 3VXOB 5ESAB 2E7CA 3GMRA 2X7LA 3VXNB 2FNBA 4KK9C 4ZS7L 1HSBB 4ORGB 5C0CD 1QTYT 1OM3H 2L7JA 3UTTA 2JJUA 5ALBH 5F9JB 4HWBH 4EI5B 3LN4B 4Q0XH 1WZLA 3S9DB 4KK8D 5ICYB 3RZCB 5CEXB 3JTSA 3ES6B 5TGBB 3CFDA 1MF2H 5LQBL 2HKFH 3T04D 3FT4B 1TZIB 3QRGH 4XAKD 1QLRB 4A6YL 4B5EA 4FXGA 4RISL 4YHMH 3FOLB 4JO1H 1FE8H 1J12A 4NHUA 1AO7B 4ZOBA 5A1AA 1HILA 4XWGL 3P4MB 2GCYB 3QXAA 2X4PA 4JPWL 4P2QB 1Q1JH 2IAMD 3RTQB 3UJTL 4OD3L 4PLOB 4WUUB 2DM7A 1RK1A 4MQTB 5LBSL 5E1HB 1CWVA 1OW0A 1V7MH 2YPKA 2IWGA 1F6AA 1A6UH 5EC2B 1BHGA 4FQJL 5D2LE 2Q20A 4YBLB 1CT8A 1TTGA 4PJBE 4W68A 1G7JA 3JWOL 2F54B 2X4RB 1MOEA 2FEDC 4HH9B 4AJ0A 5AAMA 4Q9RL 4D0CB 4X5LA 1CLYL 1TITA 5IV2A 3B9KD 3N1GC 5HHPB 4NKQB 3MR9A 3W81A 1F11A 3O6FC 4JO4L 5D7JA 2NYYD 2X70B 4PTUA 3UAJC 5GPRA 3WDIA 5EZIL 4C56A 3QJFB 1W72A 2X10A 4U6VH 2GK2A 1JZ8A 3HS0B 3C8DA 1MY7A 4KDTA 4PLKD 1VEPA 3DMMA 1FFNA 2J6EA 3IU3B 2HH0L 3VA2C 3G04B 2DTML 3KWWB 1G7LA 3RPIB 2R69L 5K9JH 4Y16C 1KJ3H 4E42A 4M03A 4U6HB 4MA7L 1VA9A 4YXLH 5D1XC 3MJ9A 4MVBC 3NFNB 1R3KB 5AD0A 1M7DA 5BJTB 3DIFA 2VDMH 3L3JB 5DMKA 5IGXH 5L7XL 5GS2D 1RZJH 3H9SE 4A2LA 1KGCD 3SQOL 4UQ3B 3ZT5A 4GMTH 3WUZA 4Y8AA 3VXRE 3WIIL 1E6JL 4GJTB 1QRND 4LLWA 5F7EL 1YJDL 2X9WA 3AC0A 4KTEL 1AJ7L 3HPJA 3OJVC 3KYAA 1EO8H 4RMTA 5E9DD 4PYGA 4HKZB 2BNQE 5CSZB 2NXZB 3OKYA 4OKVA 3LMJL 4R26H 5D2NE 4G8GB 5IJKC 4F7MB 2QADD 3EHBC 3QEGH 5T3ZD 2Y7QB 1OGAA 4BSVB 4NJAL 4NOFA 5IQ7H 3FQUA 1DBAL 1UEMA 2DL9A 4ZAKB 1RIHH 5I74B 3G6JA 4WO4B 4KI5E 3U4BL 1RIUL 1PGRB 5E94A 4NT6B 1NBZB 1GAFL 3WEXB 4HK3N 4NDMA 5I2IB 4M7KL 1DSFH 1N5AB 3VMOA 2NY7H 4JO2L 4QRPD 4F58H 1KB5H 2V17L 3O6LL 4U1IB 3U2SB 4HWBA 4BQ6A 1RU9L 2F19H 1JNJA 1T7WA 3T4AA 3FT3B 5ID1A 3EFFB 3GSVB 2ZP0T 2NLJA 1ACZA 1YPZB 1GRWA 5C6TL 1XGTA 2FJFB 3KPSA 5FHBH 4DEPC 3VFSA 5KVGL 1NKOA 4PJHA 2XQYK 2EKSB 2D7TH 3IXTB 5D2LB 2UV3A 5CEYB 1H3PL 5K59F 1A1OA 4MNGA 1LDPH 5E08H 1NGZA 5DURB 3VFUB 1NL0H 4JN1L 2XY1A 3OAYK 5SX4H 4V1DA 1RZFH 3S4SA 1SVCP 1XH3B 3N1QC 4R4FH 1IT9H 1F4WH 4RIRA 4PP2B 1YPZF 1E6OL 1K6QH 2QBWA 3EJZD 3VFRB 2Z91A 3TPUA 3ECBB 3OF6A 1M7IB 3BFOA 3TPKA 2C1OA 3QIWC 5D5MB 3LKSB 1XR9B 3QDJB 5IHUH 3QJHA 2WNGA 3M17B 1F58L 1ITCA 1N7ML 1NEZA 2UYLB 5D2LF 2VZUA 1ZTXL 4YDJA 4AH2B 2B4CL 3SBWC 3VFOB 5C0FA 5D8JH 4NZJA 1HEZB 2O61B 3W9DB 4DGYH 3CDCA 2DQEH 3UTPE 4GKZA 4X7FC 4AM0A 3EYUL 3MV8D 4YIQA 3GMPB 1FIGH 3MRRB 2XNAB 5M95B 4JY5H 3H9SB 1VFAA 1NGQL 4DGVL 1PYWA 5KSBA 3V4PH 1KG0A 1NCUA 5FO8B 2H1PL 5L2JA 2X4OB 2IH3A 4LHQB 1HCVA 1HE7A 5D5MF 5FA4A 1PFCA 2K1MA 2PXYD 2AV7A 5HGBA 5FUCE 5D7LA 2D4FA 4JGMA 2NTSP 3EIFA 2HN7A 4GW4B 3TO4A 4JAMA 4Y4KD 5LCVL 5D2NB 2FX7H 3H6JA 5JMOC 1UWXK 3M8OH 2WBJA 3QR2A 5D1ZB 2A1WL 5E6IA 5JIKA 1P7QD 1UB6B 1P9MA 4MDJA 5CJQH 4POYA 5T1LB 5ANME 1FGNH 1NDGB 2P5WE 5FO7B 4JM2D 1FYTA 3O11B 4J3SA 4EUPB 4ETYA 3SCMD 4N1HB 1YMMD 1H9VA 4H1LG 1TJGL 3G6DH 1WZMA 2D7OA 3P77A 5IMMB 2OMNA 3L3HB 3FQWB 4PP1C 5KZCD 3INUL 1NBYB 2CLVB 4ODUA 4HC1L 1CGSH 4OT1L 4RMSA 1XF4B 5ADOH 4LPCA 1BM3H 3MX0A 3PHQB 1VFMA 5SX4I 1QA9B 1KB5A 2IFFL 1JNNL 1HI6A 4NKMB 1F6FB 4JM4L 1CLOL 4KK8C 5I73C 1WC7A 5CBEA 5AYQA 3VXMA 3EBAA 3TH2T 3MRHA 3BGFC 3ESUF 4IS6B 4LCWE 2L7UA 4HD9A 2X4SB 4UDTB 3HZKB 4DGIL 4OCSH 1KJMA 1CICB 3GK8L 2IAMC 3GRWH 1QFWM 4KKBD 3WXWL 3CVIL 3B2UD 2YPLD 5INDA 1WBYB 1C5BL 3V4UH 3UBXG 4ONGH 4GKNB 5BVJA 2D0HA 5CEZD 3QIUB 4GW1A 4P5TA 3M07A 3GGWB 1OAYL 3QHZH 3WNMA 2R0WH 3ROOA 4M1GL 1CGXA 4FP8L 4Z5RA 2JIXD 1WVZA 3W0WB 3D2UD 1T2QH 4GQ9L 1TQCB 2JKXA 3B9KC 3JV4B 3VXUD 2QR0B 5KS9E 4OIIH 4ZD3L 1ZGLB 2GTWA 2ZCLH 3MRBB 4GXUM 3MGOA 4JHWL 1U8PA 2NYYC 2Y5EA 5IMKB 3ZSSA 1MFCH 4U1MA 3BYYA 1MHPL 5T3XH 2EIDA 4JRWA 4KVNL 5DR5L 3OKMA 1OP9A 2J8UE 5BZWB 1SJHB 4UU9A 5E7BA 5HDQH 1RUKL 1CZ8L 2OXHA 4Y8DC 1QUNA 5CILH 5LAXA 3JUYA 3ARFA 2HVKA 1KENL 1PKOA 3HI1A 3NCJL 3OB0K 3MV7E 4KHXH 4JRYD 4QT5A 1DVFD 1E4JA 4L8CA 5FM8A 1R3JA 4Z8FL 1UG9A 5JLZA 2ZUVA 4M7ZC 3TA3A 3G9VA 4K07A 1YEIL 1P1ZA 1QSFD 5BRZA 4P59L 4QRUB 4NNPH 2P5WB 3MOQA 4LPVA 1MQKL 4IIQC 3AB0C 3FTGA 2YXMA 3MNZA 2JJSA 5FYJL 4NQDA 4CU7A 3WKML 1I85C 1KPRA 1JRHL 2BK8A 1FORH 2O5ZH 5DJZB 5AUMA 1V05A 1GGCH 3E6HA 4XRCB 2QADC 4V2CB 3JWDH 5IFJB 4YDLB 4BSJA 3RL1B 2CIKA 1I8MA 1XGUB 4M7LL 4MNQE 5IB3B 2C4XA 1OTSC 1XR8A 5JIIA 2X1PA 3BEVA 4EDWH 4UIKH 4ZPTB 5FA3B 4PRIA 4DWHA 1XCTA 1Z9SA 4RZCA 3WSQL 2XZAL 5TQ0L 5H35A 5J6GA 4I1NB 4Q6IC 3VGAC 1JPGB 5MENA 1YEGL 3DO3A 2NZ9D 5DJ8A 3SEPA 4XMPH 5TE4H 2VN4A 3CUPA 1KN4H 4Y5VC 3SE8L 5I1AA 3I75B 5F97E 2DAVA 3SJVD 4XP1L 2BVQA 1A1MA 2VLMD 2A74A 5D70H 1C12B 5IESL 3L3IA 4Z7WA 4X6BB 4LGSB 5DWUH 2VLRA 3BW9B 2GSGB 4O2FB 4WHTA 5HYEA 2L0DA 1IEAB 2OZ4H 1CDCA 1QSZA 3GRWA 4WUKL 1MH5B 4NNYB 4X6CF 3QNZA 1ED3B 2Z31D 1N8ZB 2EDEA 1RURL 5JPMA 1J1OL 2G75B 4AG4L 1BMGA 2DI8A 2J88L 2W0LA 2P8MB 4WTZA 5DJXB 3O3DA 4NM8L 1NAMB 3DVFA 3EJZC 4JZJA 5F1NA 1F6LL 5H37G 5TDNA 2A6JA 3O9WB 4Q7DA 5IROA 1MCSA 2J8UB 2BRRL 4MQSB 1YNTB 3GHEH 4P49A 2W60A 3K1KC 2WK2A 3IJHB 1UA6L 4XNXH 5FYLE 3SGEI 4YDVB 3VJ6B 4ODSH 3I6KA 5EIIA 4C58B 3NIFE 2Q8BL 2VQ1A 4TOYL 2VL5B 3S36L 2FHCA 5IMLB 2EDFA 3HZVB 2ICWJ 3CVHL 1FJ1A 4XNZC 1CLYH 4NO0D 2EDXA 4FNLL 1G7HA 2GYSA 4UILL 5EU6A 3GBLA 1FN4B 4CGTA 3BOVA 5I19L 1FLRL 1T1WA 2Q7YB 3WNPA 2YHGA 3IDNA 3P4LA 4YDIL 3SDYH 4JQVC 1KCRH 1S3KH 1NGWA 2MPAH 5DD5L 1KCSH 4WV1B 3FB6A 3OPZH 3W5NA 1A4JB 3GNML 3IU4H 3IRZA 3FFCE 2PXYC 4QOKB 5EN2A 5T1MA 2ESVE 2J8UF 1RY7B 2P24B 3MUHL 4YHLH 3MUZ1 2DBLH 2QTEA 4FFWD 4TQEL 4Y4KC 5HVWA 1BIHA 1J8HE 1S7WB 3OZ9H 1NBVL 5HYJA 4XH2A 2W0FB 3I6LD 3BSZH 1U8QB 4NQVB 2X44D 2XWBA 2R2HA 3B4NA 2QSQA 1G9NH 2H3NA 4DK3A 1A2YB 4OGAC 3QO1B 4BFEA 2DD8H 3QB7C 5EZLA 4NYLA 1Z9MA 5GZND 4JM2C 4DCQB 5L7XH 1VESA 3SCMC 2R9HD 3NTCH 5C0AE 2P45B 2WUBL 5E2WL 5KAQG 5J89A 3C6LD 1HXYA 4DTGL 2CMRH 5I76B 4ERSH 3LEXA 3O6FB 4G5ZH 4N8CH 1Y6MR 5DRXB 5KVFL 4XMLH 3IDIA 1YJDH 5F89B 2F53E 1AFVL 4WY7L 4KTEH 4O4YH 4PR5B 3X3FH 4PJFA 5DUBA 3S35H 1WZ1H 1BLNA 1JZ6A 4H5SA 2V2XA 4FQ2L 3BN3B 3CLEL 5IB5A 5IP4A 4L4JA 3IFOB 3OGCB 3WLBA 3V6BR 4R3SA 4YHYC 3LV3B 4KROB 5GS0D 3X12B 4KRPD 5FDYA 5I1JL 1GAFH 4M7JH 4X5XA 5C9KA 5KVEL 2I07B 2XFXB 4M7KH 2E7HA 1HQ4B 4JO2H 1GZPA 4QLRA 4HIIB 1RJLA 2BSED 1FBIL 5EPMB 1BWMA 1LHZA 2EYTB 1RU9H 4P2YA 4MQ7B 4R4BA 5FECB 1J1XL 3QNYB 5I17A 3IDXL 3EYFB 3QDGD 4KKBC 3B2UC 3K8LA 4BUGA 4PUBL 5C6TH 5ACZA 4QXGH 4KV5E 3FZUD 1I9JH 2W9EH 3A67H 5JHLH 3VD9A 3QDME 1S7RB 3QQ3A 1W0WA 3O3BB 4KZDL 2NY0D 2NX5E 5F1OB 3P0VH 3I84A 4PRHA 4AZ8A 1WK0A 3GSNH 3JTTB 3FQNA 1ZEAL 4I2XB 3MUJA 1H0DB 3W2DH 5IW3A 3WN5B 3LQAH 3FB5B 1DL7L 1H3PH 2VQTA 3CD4A 1WISA 1G7IB 3SOBH 1RVFH 5E5RB 2CD0A 5E5MB 4HPOH 2FH8A 4PD4J 1ORQB 3BZDA 3MRIA 4L4VE 3LN5A 1KULA 3HC0A 1FNSH 3UYOD 2A6IB 3WHXA 5D1QB 4GRLD 2CKBB 3FAWA 3T0BA 4P2CG 3TYGL 2H41A 3D5OF 1RJCA 3P4OB 3QEHB 2BSTA 3D39B 5HI5D 1MIEL 1R0AL 1QKZL 3VXPB 4QYOA 2P49B 4BJLA 2IG2L 3VI4E 2ID5A 5CKAA 5EO9B 1IGTA 3F12A 1AQDA 3IT8D 5C0CE 4DEPB 1MWAB 3QULB 2W91A 4YAQB 4NC2B 3STLA 5IOPA 3IJYA 1JYXA 1J8HB 3M1BB 1JBJA 5D7IE 1T4KB 4LU5H 5F6IB 2OM5A 3WHE1 3WNNA 1NFKA 4XNUL 3BZ4B 3FQXA 3QT2A 1DVFC 4XAKE 5GGQL 3TESA 3LEYH 4P4RA 4N8PA 3GMLA 3RGVD 5C07A 1KFAH 4CAGA 4HPYL 3QFJB 5IR1A 5C0AB 3ZSTA 3QI9D 4LVHC 2I5YL 4QTHA 5E8DH 4MD0B 3OG6B 5HHOD 1NCNA 1T80A 2F15A 3BPLC 3H7BB 2O5XL 4B50A 5HPMA 3I50L 5EC1B 3B6SA 4M43H 1DQTA 5LG1A 5EOQH 1KIPA 4MLIA 4GAFB 4LLAA 1UWEH 2BNRD 4QRRB 4J8RB 1J05A 4Z95H 4E5XA 3DWTA 3RU8L 3QEUA 3NIGE 3SDDB 1YUHA 4POUB 2A1WH 3HLAA 4U0RB 3L3OA 4PJ8D 4ENED 5GRVK 2BZDA 4JQXC 2Q8AL 3T3PF 5CSBA 2NZ9C 4M5YH 3WE6B 1OGTB 2ZOLB 4JFYA 4FFVD 4MB3A 4ZFOA 4OCXL 3IF1A 3MREB 1D5ZB 4B41A 3AU1A 4X98A 3GJEA 4HZLB 3ALWA 1AP2A 1JN6A 4FZEL 1M7XA 1LP9E 3NCYS 4OT1H 3FQTB 3C09C 5KJRH 5CP3A 2VISB 4YHZL 3HR5A 5D6DA 4P23B 5JQHC 4NFCA 2YEZB 4JM4H 5DI8A 2WP3T 3D85A 1EAPA 2NX5B 4XGZB 4OZIE 3DTXA 5TQ2H 1DBKH 2Z31C 2N4IA 3O3EA 1KTDB 5E2UH 2ORBL 3GUTA 3SKUD 3RVTD 3NZ8A 3T1WA 3X13B 5T33L 1KGCE 3X3GH 2EYRA 3GSNA 3H0TB 3T4YA 4L4VB 3PDOA 2VQUA 4BFBD 1JGUH 4Z7VB 4AENA 4X0KA 3HNTL 1LO0L 1QRNE 3WXWH 3DV6B 4LL9A 3MROA 2W07A 2HLFD 2H8PA 2UY7A 5E9DE 5I1HL 3GMOA 4FZ8H 4X8JA 1QZ1A 5KSAD 1Q9LA 4XPBH 5T3ZE 3RFZC 5DC4B 1U8LB 5DEFA 5I16A 5F3BB 2WWMD 1QNZL 5C0CB 2DWEB 2UUDK 2QSCL 4ZXBD 5IW1B 3IGAA 1IZKA 3KPRD 1OAKH 1IAII 3ULUC 3FO1B 3CLFL 3QUYD 4F7CB 2DQTH 4HF5H 4XVSL 5I73B 4GG8A 3KGRA 5F96H 3TGXA 4WJ5B 5F72S 3NAAH 2H26A 4U1GC 2EDQA 4XPGL 5F3HA 4GQ9H 5HYQB 2BVOA 2YC1A 2I9LB 4I4WA 5F1IB 5I8CA 3WXVH 3RA7L 1UACH 2V9RA 1KBGH 1HSAB 4Z7VF 2E6JA 1VPOL 4YXHL 1DE4B 5E2TL 1BZ9A 1HZHL 3C5JB 4L8SB 2IAMB 4ZFZA 1MHPH 4TULL 4KVNH 1NGYB 4QHNA 2Z92A 3VI4F 3ILPA 4FFWC 3U6RA 2CLZB 5GRWA 3EO0B 1DEEB 2I9TB 2VAJA 4L8DA 4LDLB 3WJJC 4LSRL 1Y6NR 1DANU 2VLJB 1B0WA 1II4E 4LVOC 1GIGH 5FUOL 3NCJH 3DYMA 4H1LB 3B83A 3MODH 5GGUB 1FRGL 5C71A 5GZNC 4Z8FH 4CVXA 4NWTL 4ZQKA 2R9HC 1NFDA 1RHFA 1OVZA 4YPJA 1KB9J 3C6LC 3B9KB 3QUZC 3RI5K 3UCRA 4DN4L 1MCNA 4HCRH 3MBED 3C5ZA 5FYJH 5ISZA 4UT7L 1FYHB 3QIBA 4R4ND 1JRHH 1BFOB 4XC3L 3SY0A 4NRXB 4P2OD 4CL7A 1LP9B 4AQOA 4ESKA 4U6XA 1RULL 4NZUH 4OLVH 4Y1AD 3MRCA 3NCFB 2WMPA 1FLTX 5F88B 1RUMH 3O4LD 1XT5A 3T09A 1I1AB 4E41D 1D6VH 4HJGB 4R90H 4LF3B 3GIVB 5GS0C 5HPOA 5TQ0H 4KRPC 3DX6B 3G08B 5F7DA 3BAEL 2AEPH