4R8WH

Crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCKTSGYSFSTYGVSWVRQAPGQGPEWVGWISAYTGITDYAQKFQGRVTLTTDATTATAFLDLRSLRPDDTATYFCARDKVQGRVEVGSGGRHDYWGQGTLVIVSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title A potent broad-spectrum protective human monoclonal antibody crosslinking two haemagglutinin monomers of influenza A virus
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9))
molecule tags Immune system
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r8wH00
3ZTNH 5F71A 4AQOA 5CBAB 2MQ3A 3BP4B 3OMZA 3QJFA 3RA7H 3UPCA 4MDIB 3A0OA 3NCYP 2EDEA 2AXFB 4MLSA 3RUGA 1QSFB 1H3UA 2HMIC 3MRBB 1MELA 4PJBF 1IMHC 3V7AE 1BECA 4NQDA 3FAXA 2VTFA 4L8BA 4LF3B 4MJ6B 3LIZL 1NLDL 5GS1C 4H1LH 2YZ1A 1I8LC 3O6MH 3QWQB 1BHGA 3C5ZB 4NO0D 4HWEL 3HE7A 3TA3A 3JWOH 5MEPA 3QUKA 4Q58C 1SM3H 3EYOA 1AI1L 1MOEA 3SO3C 1TJGH 3SY0A 4I18C 5K9QI 5F3BA 3T4AB 5GSRA 1F4XL 5BS0A 4JVWA 4XNMB 1NGZA 2R0ZL 2F19H 2EDNA 3KXFE 4PRHE 5FYJD 4LDOB 5L6YL 3TIDA 2BNUB 3H7BB 1BF2A 2VDLL 1KLGA 1T89A 2GJZB 5C8JA 4M00A 3W11D 5D6CB 1YNLL 3V4UL 1DDHA 4PRPA 2EH8L 2JJUA 5IM7B 3U2SB 4PJXF 2A1WH 2DYPB 3GIZH 2Z0BA 1P7KB 3MLWL 1HH6B 4TVPL 1FORL 1JUFA 3K2UH 1YA5A 3ZKQD 3VMOA 3I3DA 1CXEA 3KWWA 4NQVA 4LFHD 2ADFL 2P8LA 5EU5A 2DTSA 4NC0B 5EO1B 2AI0H 5LQBH 3MUHL 2R2BB 3G5VA 4WI9A 2YUVA 3BESR 4PFEA 4RISH 5GJTL 2J5LB 5TDPA 4KDVA 1BVKB 4TVSa 1PG7H 3QUML 4QOKB 4Y8DC 3WLBA 4MWFB 1NBYA 1A7QH 2F8VA 5L2KB 4HBCL 4DKAA 2A2QT 2BSED 5I8OL 1X5FA 3ARQA 3KNBA 4I48B 1UZ6F 1RULL 2O5YL 4WFEE 2UVEA 4O02L 4TTDD 1EZVY 1BQHA 2G75B 1S9WA 5ACZA 4FABH 5KTEL 2NLJB 3MYJA 4PD4J 3FONB 2G5RA 2BHZA 5DXWA 4ZFGH 3BYYA 4JN2B 1GAFL 2FIRT 3UTSB 1VFMA 2YPLE 5IT2H 2UWEA 4WFHE 4U1KB 4I3GA 4NKOA 1IKNA 2FX9H 2PNDA 4O9HL 4DUVA 1AXIB 1X5LA 3L9RA 1AFVL 4YXHH 3V0AC 1XF1A 4IJ3C 2MCG1 3ALXA 3BX7C 1Z0MA 3CAFA 1Q72L 2QQLL 3OL2A 4DGVL 5JXEC 1IKFH 3B5HA 3RU8H 2VE6A 4GXVH 3R1GL 2VXVL 5BZWB 1MCEA 1QBAA 4J1UB 2J8UA 3VH8A 1Z2KA 1AQKL 2HFGH 3TP4A 4M48L 3MNZB 1SQ2N 2HT4D 1LK3L 5CZXD 2VJXA 2VLRB 1G7LA 1T21B 1BBJA 4OCRL 1A6UH 5A43C 5IMMB 2UV3A 5TPWL 1QRNB 3QUYC 1K4CA 3KLDA 5C0JA 5HYSG 2BJML 2IPUK 4HUXB 1JHKH 1P7QD 2CLZA 2UZYB 1L7TL 8FABA 2BDNH 3HI5L 4LPTA 1DVFC 3WKMH 1MWAA 3EYSH 4R0LB 2NXZC 3S98A 4PJHE 4DTGH 3IS0X 5D9SB 1FIEA 4D94A 5B38G 25C8L 3QCTH 2Z9TA 4IOSD 1JNHB 4ZUVA 3F62A 1T03L 3VRIB 4HJGA 4OCYL 1BLNB 3L6FA 4ZUTA 3AS2A 3CH1A 4OZIA 2J4WH 3FN0H 3PG2A 1EJOH 3KJ6L 2JCCB 3WIIH 3U6RB 1UQSA 1CGSH 1JTTA 2O5XH 4Q6IB 2IALA 3RAJL 3HTLX 1JWUA 2W91A 4ZO8A 2VDKH 3VRJA 5E1AA 4P0DA 5D2NA 4ODTL 5GRWA 4X7EC 5HHME 3FAWA 4F37F 3EDFA 1FIGL 3QNYA 3WEXB 1U8IA 2JK5A 3VG9B 1T1ZB 1O5DT 4N90D 1QOKA 5K9KB 1LE5B 1J5OH 5BVPH 1SYVB 4QRRA 5HHVH 5J9PB 5EO0B 3QIUC 3DSNA 4X99B 2ZUTA 2AVGA 4FQXD 4OLZH 1KYOK 5HI3C 1TETL 1A6PA 5FYJU 3QFDB 5J3HC 4OLWL 2BMKB 1QG3A 3QA3B 2F8OA 1U8OA 1AGCA 3O3BA 5DUPH 5KSBE 1LEIA 4UAOC 4UB0L 1I1AC 5E5MA 1DUYB 1IAOB 3P77B 1KIQA 3FRUA 3JVGA 3OBAA 1F3JB 1ZVYA 3LN5A 2PW2B 2QHRH 2HVJA 3ILQC 3QNZA 1VEPA 2FX7H 3CLEL 4YC2C 2ARJA 4XCEA 1L7IH 2X5PA 4HKJA 3CZFB 1OAUL 3T0VA 3G5YA 5DS8A 1UH4A 2CH8A 3BHBB 3S96B 3U7YL 2VDOL 3M1BA 3GMOB 4M4RA 4LSTH 1CLOL 4YHZL 2H32B 5T5NF 2G5BA 4RAVB 3PDOA 1YEJL 3AMKA 2RR3A 5FV1L 4L4TE 1D9KB 3ZL4L 1CXKA 4U1IB 3ZSTA 4EUPA 2B2XH 2SEBA 4NN5C 4GXUN 4W6WB 1YMMD 3PWPB 5EBLA 4PJ7E 5HYQB 1QPPA 2R2CA 2AJ3A 4K8RD 2DJSA 3S36X 5T3ZH 2MKWA 4K71B 1U93B 4OI8A 4X5WB 3TESA 5I1AA 1RUQH 5DI8A 1EMTH 2GKIA 3ARFA 2Y7QB 4M7LL 4KTDH 2AK4B 3A6OA 3LKPA 2XWJB 1YJDL 3KPPA 4K9EC 3C09B 3PWUA 4Z76B 4O51A 2X4SA 5CP7A 3WFEL 4PJ5E 4ZD3H 3N50A 3VFPA 1RUKL 3TIEA 2E8ZA 4I2XA 1MFDL 2DWEB 1YN6A 3IGAA 3B2UC 1AD0A 4GLRH 2PTTA 4H8WH 5DK0A 4PY8J 2YXMA 5DFVD 4RGOH 1XGYH 3HAEG 5CJQH 1V7NH 4LHUG 4MQXC 5I1EL 5C9KA 4UI2A 5KSAC 1D3CA 1HKLL 4P99A 3BKML 3L3HA 3K8LA 1ZE3C 4NQSA 3T0EA 3VFRB 4LKXA 3TFKC 3HMXL 5I74B 2EDWA 4GRWE 5I19H 1NJ9A 4NNXB 5BV7C 3H8NA 2ADGA 1UVQA 4OFIA 1F6FB 2GAZA 1NCCH 4LL9A 1FDLH 4UT6L 3F5WB 4EI5A 3QHFL 2H45A 1R5WB 2FO4B 1J1PH 4PP2A 1NDGA 1AO7A 1UGNA 5CILL 1GGCH 5HI5D 4FQQB 3K3QA 4HV8B 1HSAB 2VAJA 3RTQA 4LEOA 1LO5A 3MV7D 1CR9L 3ZKNC 3AGVA 1YEIH 3QUZA 3SGEI 3QIWA 4B7LA 1JF6A 1CG9B 1NMAL 1PZUB 4S1RH 5M94B 4XH2A 5C07A 5D7SH 3UO1H 3MLSH 3IETA 3QJHB 3WO4C 4ODUB 3KR3H 5D2LB 5IFHH 3I50L 2W0KA 2JTDA 1MCBA 2CUIA 2JCCF 2ICEB 4YEFA 3HUJB 5CBEB 3MCLL 4Y4HA 3CUPA 5KSUA 4FXKA 3L1OL 4JHAH 1PY9A 1DQDH 1XGQB 4HMEA 4RFOL 5HDOA 3O0RL 2ZOLB 5FA3A 2NY3D 3ZLQC 1V3MA 4HMCA 5GS1B 4KKNA 2I5YL 4X6FA 2VUOA 5JR1H 4MB5A 4DQOL 1CFQB 2HLFC 3SE3C 1HXMA 5JHDD 5JORA 4U1LB 4Z7NE 3SO3B 3ZKMD 1KBGH 1OHQA 1QFWH 1CWVA 2XWTB 1JWSA 4I18B 4UBDD 1SVZA 4JZOA 2Q86B 4NCC1 4P9MH 4HKXB 1KEML 2WINB 3LEVL 3FCTA 3EDKA 4H0HB 3H9SE 3VFOA 2B1HL 3DVNA 4OZGE 2QJDA 4GT7A 5IB5B 2J3SA 4M9PA 2BP3A 3JV4B 3VXUA 1N4XL 5JPNB 4AM0A 4DN3L 1CDGA 3QEHA 4YFLI 3ZE2E 1RK1A 5E2WH 5FO9A 3ZZ1A 1XF3B 1NGYB 3LRSA 1BQUA 4X6EA 3TBVA 3TT3L 1ZVSA 4G9FD 4L3EA 1W72H 3ZYJA 3MV9B 1ZLVK 3OAUH 4MXWL 2AK1L 5D93C 4UQ2A 2RFXA 3L3DB 1N5AA 1WAAA 4GKSB 4ORGB 4OZHE 3C2AH 2NQCA 4UNTA 3FO0H 3K1DA 1G9NC 1JRHL 4JFDB 2IH1A 5KW9L 5DEGA 3RWCA 4G43A 4N8VG 4DKEL 2VQTA 4PTUB 1IEBA 3UZEA 1HXYB 3FJTA 4MJID 3D3VD 3DXAE 1OQOA 4MD4B 4UDTA 1HDMA 2XKNA 5FHAL 5BXFB 5L8JB 5C0DA 3ARRA 4QRQA 1K5NB 2D03H 2KZ1B 4Z7UE 1CIUA 2ZSVB 3U0PA 3VGBA 2LV4A 1D5ZA 3N1PC 1I1CA 1MCQA 1YYMH 4P59L 5B8CA 1OARL 2XIDA 3HE7C 1JGUH 2HT2C 4ELME 3N9GL 2R8SL 3PV6B 4HH8A 5IBUB 3E2HC 2UYLA 1A22B 1KEGL 2R0KH 1B4RA 2V2XB 1KB5A 4KDWA 3CMGA 3KHQA 1WZ1H 2FBJL 3OAYH 3UTZA 2NY4C 1ZLWK 5HJ3A 4PJDE 4BUHA 2CR6A 3PWLB 4KK9C 1JGEA 3PP4H 1MAMH 4JFEA 1EBAA 2DMKA 4JCLA 1Y6NR 2C4FU 5FGSA 1MWAH 5BRZB 4WW2A 4IJ3B 2P49B 2Q6WA 5GSVA 1MQKL 4M62L 3MNWA 1T89C 4CDHA 2VUYA 5EFIA 3QNXA 1RI8A 9CGTA 4AL8H 4BFGA 4LLMA 5DUBA 3X3GH 4O2EB 5HPMA 1TITA 4QRTA 4K94L 4KHTL 4XVUD 5LBSH 3TZVA 3ZHKA 1DQQA 4JM2D 2CKBH 3PL6B 3CNKA 1IJ9A 5D72H 3GUTB 1J1XL 1U58B 3V6ZB 3QDJB 4PG9B 2YUWA 1QSEB 4GW1B 1X5KA 2A9MH 1QBBA 4BKLA 5HGBA 3TT1H 4PJCB 3PUCA 5B22A 3VGEA 4HX1B 5F9JA 3LN9A 2A0LD 4DN4H 3BIAX 1KIUA 3AAZA 3QUYB 1BVZA 4W4NA 2YA2A 4PREB 4XVJL 1A8JH 1NSNL 1YMHA 3BH9B 1CXHA 4OCSH 2DQDH 1DVFB 1RD6A 1ZHLB 2V7NB 3WHE0 1FPTL 4ERSL 1ZSDA 1W0VB 2VZSA 4IDJH 3MGOB 4QGTA 3H9HA 5GGTH 1HHKA 2FZ3B 5D2LF 4JY4B 1LO3L 3EUUA 2A6KA 1NEUA 3ULVE 1BJ1J 1CLYH 3GBML 1FJ1B 1A1NA 2QQNH 4B41A 3UYPA 1UJ3A 2L0DA 3BRGC 2EYRA 4E0RB 1CFTB 4BH7B 2XWBB 1IKNC 1KT2A 2FJFA 2F58L 5C1MB 3TEUA 1VENA 3CFKA 2BNRB 3BKYL 5DSCA 1J8HD 4PP1C 4P3WA 1YUHB 2CUHA 4HIHA 1MHCA 2L7UA 4KQ3H 1RAMA 2WV3A 3OZ9H 4ODBD 3G08A 5B3JF 2P5WA 1LE9A 1H8OA 3L5XH 1OGTB 1U41A 5TDNA 1B4JL 4ZQKA 1TJIL 4EQ3A 1KTLA 4M43H 2W0PA 1NC2D 1OTUC 2AEWA 4MNQD 4FQ1H 5E6YA 1S7QA 3ESUF 4R2GD 3MRJB 2XN9A 4HC1H 5F7MC 1NAMH 5I66B 1RY7B 2E9JA 4MCYB 4YLQT 4Q97A 3QIUB 1Q0XL 1VB9A 1U8KA 2H1PH 3BH8B 3CCHA 4R4ND 3S34L 2VABB 5DTFB 4F33B 3OGCA 1PYWA 3BP6B 2FJGB 5DO2C 5EN2A 4L3AA 3DURB 4FZEH 3VXTA 2Y6SC 2YD1A 1A9EA 3MBXH 4KXZH 5ETUB 4UAOB 1I1AB 3CU1A 2CO6B 3BEVB 3K80A 3RWHA 2PN5A 4V1DD 4JHWL 4YXLL 2V5SA 2E27L 3DLQR 1I7UB 1MPAH 1HI6B 2ICWJ 5FB8A 5IVXB 4OTXH 1EIBA 4YC2B 1BM3L 2AV1A 4P5TD 4TUKL 5I0ZA 5DQ9A 1OOAA 3D39D 1RPQA 4URTB 4JB9H 5HYJE 3VDCA 1JHLL 4RMVA 3OKNB 2H8PB 1GXEA 2XFXB 3LV3A 4MA7L 4P23D 2MJWA 3EIFA 2NX5A 5I16A 2AJYL 1A3RH 1BQSA 1XCTB 4LBEB 1EGJL 1RUPL 3DUUA 2WK2A 3LN4A 2CIIA 4PJAB 4W68A 1IGTB 4TNWK 5E99L 1G7JA 2DTMH 4WUKL 5D2NC 2VN4A 4U1MB 1S5IH 3BWAA 4NN5B 5JMOC 1EA9C 4QHLA 1EHAA 4NWUH 3TNNA 4R7DB 1N0LA 3MV11 1ZHNB 3W9DB 2WWMC 3CSGA 5CIPH 3O3EA 1CYGA 3MLTA 4WI3A 4PRID 4DK3A 1C7TA 4HLZH 3T77B 1HEZB 5HDQL 2X4UB 6FABL 2M26A 4HDIA 1E4KC 3MJ7A 3EDEA 1EAJA 3TBYB 1CL7H 2VC2L 3DX8A 3GJEA 5DHYA 3UAJC 3QFJE 1XH3B 1MNUL 1OCWL 3T3PF 3IJSB 2NZ9D 1JYNA 3N1MC 5DJDA 2PYFA 4A6YA 1UM5L 3TYFA 5C70A 4XP9H 2P7TB 2X2YA 4XWGH 5DMGD 5IUSA 5IK3A 4OB5L 4KRPC 1HE7A 4Y8AA 1QEWA 4XGZA 2YPKB 5KSAB 4AEIL 4UT7L 4H26B 5C0IB 2GK2A 3HCVA 3G6JB 3JVGC 1A7RL 4PRDA 5EZIH 1MCFA 3VXMA 2VAAA 4ISVA 4KTEL 2NY5C 3VA6A 5LJYH 4Z8FL 1OGAA 4LLYA 5BV7B 3W39B 2RIKA 3KLAB 4ZO7A 4PJCF 3PGCB 3NCFB 1JI2A 1OSPH 2DQJL 2F54E 2Q20A 3VWJA 3P4NB 1BQLH 4MA3A 3DYMA 4XMKL 2NMSA 3ROLA 3EO9H 1NCDH 5EOTA 2EE3A 3SKJL 4Y4KA 3QWOA 5HHNA 4HEPG 2X6MA 4MJ5B 1J11A 3FB5B 1I1RA 3MUY1 1FVCA 4FTVE 2XRAL 4G6AC 3VXSD 4Z0BL 4KRNA 1I3RB 4P2QE 4GG6A 1G0YR 2BCKA 3MRDA 5AD0A 1JYXA 4XPBL 1Z5LA 2PUQT 4Y5YA 3STZA 1WTGT 3X12A 3DYPA 1XGUA 4XX1G 2ATKA 4RWYH 4C54A 3SGDH 1UFUA 5F1KC 3O3AA 3WO4B 1Q1JH 1KENH 2DQEL 4X4ME 5DMKA 4ZSOA 3MACL 4OQTA 3BP7A 4WFGE 5TE6L 1T6WA 2XY1A 3ARFC 5I73C 1MVUA 1U8MB 3QXDA 1FGNL 4X6BB 4NRYB 1Q9KA 3O6FD 4U31A 1VPOH 5E4EB 1TENA 1YEGL 1R3HB 2A83A 3EO1A 2VXSL 4XP6L 5F88B 2VL5B 3EO0B 1SY6A 4QT5A 1U91B 1JNNH 4QLRA 1ZTXL 1IGIH 2R2HA 3VFVA 1DBAH 4E9LA 3T0EC 5ITFB 3WFZA 5IQ7H 1QO3B 1L6ZA 4XC3L 1QNZH 3KG5A 4YGVB 4QXUL 4H5SA 4KVCL 3B8YA 1LHZA 3O4LD 4LPVA 3CX5J 4WFFE 4YDJB 5FYJL 4NOFA 2WBKA 3NN8B 3LKSA 2V9TA 4CW1A 2IBZX 1C12B 2DLHA 1XGPA 3RTQC 1GC1C 1T1XA 3QPXL 1RJCA 5EWIH 1F58L 1KCRH 2PYEA 5CZVH 3QUZC 4JO1L 2EDTA 3QIWC 15C8H 5D93B 3WN5C 1FLRL 5IVXF 2DQIL 1RU9L 3OKEA 4X9HA 3LMJH 4CUCA 2EXYC 3EYFA 4PGZA 4LARL 3GSNB 1ZLVH 2QHLA 4NZRH 5TQ2H 1LD9A 1T3FA 2BFVH 3VWKA 4HZLA 5SX5K 2ICWI 3KYAA 1AE6L 4LVNC 3RUGB 4Y4HC 1VKXA 1ZA6B 2IJ0C 4NQDB 5D1ZA 4L8BB 4M7ZC 5HHXL 1NLBH 5T3XE 5I1IL 4QXWA 1XF2A 4C55A 4KJPC 4GW4A 5T3ZD 4WV1C 2OX5A 3MUZ1 4G6JH 3HE7B 5MEPB 3QUKB 4YHIA 5HHMB 2XQYK 5JW4N 1ETZA 4ZPVA 4OM1H 1N5YL 3EYOB 2XZCH 4FQHA 1WGOA 3AREA 2ITCB 3SDCA 1ZOXA 2ATPA 3SY0B 1MLBB 1N3NA 4LSUH 1FGVH 2XTLA 2AJVH 4P2RA 4Z77A 5F3BB 2NY4B 2MCPH 5GSRB 1EHNA 1KC5H 2HFEB 3VFGL 5GGSA 5BS0B 1E6JH 1KJ2H 1NGZB 5DWUL 2E5EA 4UMGA 3UJJH 3QXUA 3V6BR 1H3XA 4HK3J 4FQCH 4X4XA 3TIDB 3WNOA 4EVNA 2WUBL 4CU7A 1ZLWH 5I17A 3INUH 5DHVH 4S1DC 1VFOA 3WXWH 3B3IA 4HS6B 5C0ND 1GRWA 4Z0XA 1DDHB 3BXNA 4PRPB 4PJEA 5I6XC 5IW6A 2WIIA 3QEQB 1ZHKA 1GPOL 4AENA 2LVCA 4F8TA 3VXNA 1ZT7B 3QI9D 1JUFB 2DM2A 4LP4A 4H88H 4KI5C 5EU6A 4QXTA 4FZ8L 2OYPA 3KWWB 4NQVB 5A40E 5CP3A 3SDDA 5E8NA 2AABL 5SX4I 3GHBL 3JZ7A 3N85H 5EU5B 2A9NL 4L8DA 1MFBH 2VLMD 3C9NA 3G5VB 4OZFH 1IGML 2VWEC 2YWYA 3RI5F 5E9DD 1WITA 4KROD 3H42L 5TDPB 5GGVH 1NBYB 2QQKL 3IDXL 4ODXA 1FNFA 2QKIA 4RSVA 1SBSH 2X7LB 5DVOA 1O7VA 3KNBB 1BOGA 2HN7A 4XNQA 1VSCA 3IU3A 3MRPA 1BQHB 3DIFB 5ACZB 3G6AA 1S9WB 1IGYA 1KB9K 3D0LA 3MYJB 4HIIA 2F5AL 1GJIA 1U8HB 1ZGLP 4I1NB 4AZ8A 5CS7A 1CBVH 2AGJL 2X10A 1TNNA 2UZIL 1AKJD 2UWEB 3L3OA 2V7HA 4Y0GA 3UZQA 2AKRA 3SDYL 1MCIA 4FFZL 5CLWA 5GS0D 3ZT7A 2YA0A 4UTBH 2VISB 4S11A 5I1JH 2VLKA 5EOCH 4APQB 4LQFL 4K7PL 2LTQC 1IC4H 4KGJA 4KHXL 4XBGA 1LO4L 1F4YH 5GS2H 2PR4H 5MEND 3MYZA 4OCLC 3MMEA 5INCA 2VE6B 1CN4A 5GRJL 3TZVC 3S88H 4HWBH 4X80L 3NZHL 3HR5A 2VZVA 4K3HA 3VH8B 1QACA 3FQXA 1UH2A 4ONHA 2XZAH 3QEUA 5BW7A 1RIHL 1F3RB 2PF6A 3K74B 3UYOD 1G7LB 1BBJB 4BH8A 2FECI 3CSBA 2EC8A 5BJTA 5DVMA 5CJ8A 3QUMA 5C0JB 1K4CB 5T33L 3DETD 3S97C 4N0CD 1A5FH 8FABB 2DLTA 1YNKH 2LQRA 5IGXH 5F9WC 1CVSC 4Q0XH 1KCVH 1EO7A 3JWNC 5C0CD 3LZFH 4YBQC 1I7TA 1DQMH 2UVFA 4JG1L 2NZIA 4L8SC 4ZUVB 5D7LA 3EGSB 4J12A 5KAQF 2KZWA 1KIPA 3LS5L 3RUGF 1BMGA 1T20A 3QIBD 1MJJA 1UJ3C 3L6FB 3IJHA 2DLFH 5DRXA 2WBJA 1G6VK 4U6XA 3CH1B 3V52L 4OZIB 5DMIH 1UQSB 5CSZA 2OXGA 1BX2A 1RUML 2IALB 1JWUB 3WFCH 4HF5H 4KUCF 1BOYA 2EDYA 3QCVL 3VRJB 5E1AB 5HGAB 5I1HL 2WANA 4Q9QH 2NY6D 2ZJSH 3U4BL 3O2WH 5D2NB 2OSLA 1GOGA 5B39G 3HR6A 1LEKA 4FFVD 4OJFL 3QHTC 3HE6D 1MAKA 1VEMA 3B2VH 3QNYB 3BN9C 1U8IB 2JK5B 4K8RL 2EDHA 3MO1A 2YD3A 5DJZB 1GGBL 4OSUL 4IOIA 4L9LA 3ZYZA 5I30L 5E8EA 3KYKH 1CT8A 1KNOA 5A3IC 1QSFD 4U1NB 4S10A 4HBQA 1JGLL 3ALWA 3UZVB 1NCUA 4B0MM 1FZKA 1FSKC 5KSBF 1CCZA 1OT2A 1U8OB 4IRZH 4KRPB 2LVEA 3C5ZD 4F3FB 5HGDA 3O3BB 3P0VL 5SV4A 4F7MB 1LEIB 5E5MB 2OBGA 4QRUA 1QLEL 1IE5A 1KIQB 2NY0B 3LN5B 3D48R 3G6DL 3KPSB 4P49A 4PYGA 5FKPA 3O11B 4ODVL 4P9HH 3BZEA 1J05B 3QNZB 2GHWB 4HS3B 1XIWC 3OGOE 3JBG7 2ARJB 1CICA 2NY2C 1HHJB 4HKJB 3PF2A 3ULSA 3G5YB 1DBKL 3NIDE 5DS8B 3IJYB 3QG7L 3GMRB 1SY6H 3M1BB 3BKCL 3B9DA 4TYUA 2YK1L 4OF6A 4PJ7A 4MZ2A 2ZCHL 2IPKB 3H3KA 1M71B 2BRRL 4AQ1B 4J2XA 2DYPD 1OAKL 4DOHE 1XCQA 2BSRA 5ENWA 3ZYIA 3MJ9L 4LPUA 1X5GA 5E2TH 2SEBB 2OLDA 5DRNA 4PGEA 4ELMB 3QULA 3T09A 2VDPL 2I60L 4HCRH 5EBLB 1WT5A 2AJ3B 3IU4L 5CD3A 2QQQA 4XX1E 4LAQH 3MNVA 1DBJL 1EJ6A 1ZANL 3SJVA 3C08H 3O2DL 3MV01 5I1AB 5DI8B 3ARFB 3QWRA 5I73B 2P5EE 1KXVC 4CRPA 3KPPB 4LSRH 3LPFA 1YMME 1XR9A 2BY3A 2X4SB 4HXBL 4YDVA 3QR2A 3ELAT 2C3VB 3R0NA 4QOKD 3B5GA 3TIEB 4I2XB 4OZ4A 4UTAH 5L88H 1LO0H 3P11H 4K2UH 1YN6B 2CDGB 3SE9L 1I3VA 2R29L 5ALCH 2PTTB 5DK0B 3ORJA 2XNAA 5E56A 4C56D 2EIBA 2R1WA 3L3HB 2P4AB 4NQSB 3D2UA 1RZGA 4NJAL 4ZXBC 1M7IB 3UTSD 1MUJB 4OFYD 4HULB 3LKNA 4AEHH 4GAJH 1U36A 3MRKA 3QQ9C 3MCKA 4NNPH 3UTOA 1P6FA 2IWGA 5L0QC 5FA4A 2GAZB 3VWJC 3OKYA 2R4SL 4GBXA 2K7PA 5ERWA 4JHBA 4PP2B 1NDGB 4Y4KC 1W0WA 2BNQA 3GBLA 1OD9A 5HTSA 5C71A 2ID5A 3RTQB 1LO5B 5JNYA 3U0WH 3A67H 5IJKC 3QUZB 4ACPA 1G9ML 3QIWB 2XG5A 2NR6D 5GGRA 3WN5B 3BGAA 1QKZL 5FO7A 1FVDA 1BZ9A 3E3QC 4OKVA 3BDBA 3FB6A 3G5XA 5C07B 5TFSH 3BPNC 3GKZA 1INEH 2D0FA 4XP1L 4W70A 1AGDB 5DMYA 5B38B 4OZIF 2OZ4H 1H5BA 4NBYB 4N0UE 1IBGH 2VLRD 3QQNA 3S36H 4OLEA 3FT3A 3GMQA 4OLXH 4Y4HB 3ZE0E 1YEDA 3VI3F 5KSUB 4M7KH 3FO9A 2FLBT 4PB0L 4M7ZB 5CJOH 3PV7A 5FA3B 3U48A 4D9LL 5J13C 1JZ4A 5SX5H 32C2A 2B1AH 4X6FB 4WV1B 1U8PA 4Z7NF 4EOWL 3BPCB 4ZTOH 1HXMB 3UBXG 5JORB 2BC4B 4Q2ZA 3U46A 2EZ0C 1JWSB 3HMXA 3SOBL 4EN3A 3CDGA 1Z9SA 1AJ7L 4JZOB 5E95B 4PRBA 4OZGF 4HWUA 3BQUA 2X42A 5I75C 4ZFZA 1N6VA 3S37X 3VFOB 3DVNB 3HB3D 1NCTA 4XAWL 3WFDL 3ZE2F 4HKBA 1KFAL 1BFOA 4OZHA 2QEJA 4AM0B 4LSPL 3TVMD 3B9VA 3QEHB 5K59E 1RK1B 7CGTA 5FO9B 1CU4H 4EBQL 1SJEA 3LRSB 2V2TA 1N7ML 5I6XB 3RPIA 3TBVB 4OM0H 1ZVSB 1D5IH 3I6KA 3P40A 3X17A 1Q94A 4UQ2B 4PJ8D 5GZOD 2RFXB 3RVWD 1ZGLM 1C5BH 1N5AB 3UYRH 3MV8E 2W60A 1A6WH 3GBNL 4K7PX 4GXUM 5D7JD 3VD7A 2ZUUA 1JPST 1YECL 2IH1B 2HRPH 5DEGB 2EE6A 3RWCB 2YR3A 5DC4B 3ECBB 4G43B 3B9KD 5FOBA 4QHNA 3VWKC 1IEBB 2IH3A 3DV6A 5ACLA 1VEOA 4PPTA 1NQBA 3QDMA 1MSPA 4UZGA 3K4DA 4TQEH 4Z7UF 4BSWA 1CGWA 5C0DB 1EO5A 4DKDC 4GJTB 5D1ZC 3PWVA 4QRQB 3RY6A 4GQ9H 4Z7VB 5AZ2L 3U0PB 3OJMB 4YHYB 1AIFB 1UB5A 3KPTA 1D5ZB 2I25N 1JNLL 5EZJA 4NFDA 3MSPA 2FIKA 3JWDH 4ELMF 1MI5D 4Y2DA 3ZTNL 1OQXA 2Y36L 3RA7L 4U7MA 1AH1A 4LRNH 3LB6D 3CDCA 1DQJB 2UYLB 2DICA 4ORZC 5AWNH 3DGGA 2AEQH 1J88A 1VFUA 3AREC 3SDCC 1WSST 4JPIA 4WTZA 3UTZB 4TN9A 5HJ3B 3STBA 1KF9B 3RX7A 5ITBH 4N0FA 2VO5A 4GRLD 4KUZH 1A0QH 4G8IA 35C8L 3O6ML 1N59A 2O5YH 2LTQB 3JWOL 5GSVB 3MNWB 3GSOA 1D9KD 5AYUH 5EFIB 5FFLA 3QNXB 1SM3L 4LLMB 5DUBB 1DL7H 5HPMB 1TJGL 3PWPD 4BFIB 1FYTA 1BFSA 4YHKH 3TZVB 5T1KD 1DQQB 3F12A 3TC9A 2CMRH 1L0XA 4PJIE 4WCYH 2F19L 2H2PD 5E94A 3SDDC 4POZD 1Q38A 5F3HB 5A1AA 4GS7C 4YUEH 1A6AA 4LCCC 5JIPA 1QD0A 5HGBB 4BKLB 4PG2A 4IRJA 2GJJA 2ENSA 5F9JB 3QT2A 5CKGA 1S9VA 2A1WL 3AAZB 3GIZL 3CVHH 4NQTA 3QHZH 3BUTA 1YMHB 3K2UL 1KTRL 3WV0A 1X3DA 1IM9A 5F9WB 4EJ1C 3CD4A 1ZSDB 1GOFA 1AQKH 4NZDA 4XPHH 5KVEH 1I9JH 4IMLA 1TCMA 1YY8A 3H9HB 2AI0L 5IWLA 1HHKB 5C3LD 3SDXB 4F80A 5LQBL 1NEZG 4L8SB 1NBZA 1S7WA 2A6KB 5F8QC 4UNVA 3QXWA 5J12C 3VE0A 1QPXA 1A1NB 2XZQH 1RURH 1N6QH 1UJ3B 4TOYH 4W6YB 1PG7L 4MXVE 1QSZA 4DAGH 4HEME 4YAQA 4ZNCD 1KT2B 1A7QL 1CDCA 2FJFB 3BSZH 2LAAA 1PQZA 1ODAA 3QDGE 1F42A 2CK0H 5ICYA 4M1GH 3A6BH 1GGUA 1KJMA 4HIHB 3VFSA 4ZYKB 3HC4H 1MHCB 2EO1A 4HHAB 2X1WL 5DVLA 3G08B 2P5WB 5CUSH 5DD6B 4GMSH 3MC0A 4ZFGL 1LE9B 5DGRA 5TDNB 2A77H 2VITB 2EECA 2WBWB 4ZQKB 5IT2L 4HAFA 5JPMA 3OKOA 4XI5D 3OR7A 1BJMA 1S7QB 1AGEB 2FX9L 2ZUWA 4P5MA 2XN9B 5J56B 4PJFB 5FGCE 3KJ4C 1U8NA 4YXHL 5BW7C 3CCHB 3W0WA 5HY9A 4I9WE 4BQ9A 3OGCB 4JGUA 3RRQA 5CGYD 3A6CH 4MNQE 5ANME 1FSKB 3QEGH 1IKFL 3VXTB 2P47B 5T5FH 4IRSA 3RU8L 1A9EB 4GXVL 3MODH 4EDXA 1WAAF 3DX7A 5HDLA 4KI5F 4NQCE 1NMBH 2HFGL 1ZT1A 3VXRA 1XIWB 3S5LA 2AV1B 2NY2B 5EC1A 1A02N 2BVOA 4WY7H 1A6UL 2AJZA 5F7UA 2OCFD 4L3CA 4V1DE 4N8CL 1L6XA 4GRWH 1JHKL 5DR5H 2WBJC 4UB0H 4DGYH 4JAMA 4JQVA 4Z7VF 4LSSH 2BDNL 4H0IA 3WKML 4WO4A 3EYSL 3LN4B 3DUUB 2EH7H 2CIIB 4RMTA 4DTGL 3GDBA 3D39E 1G7JB 1X5XA 3F7RA 2HTKC 3QCTL 4X6CA 5IVNA 2F53E 3FQNA 3BWAB 4QHLB 1KCKA 2Z31A 2BY0A 5F97E 2GQHA 2QADD 3O3EB 3MLTB 3SN6N 4JFDD 4WUUE 1JBJA 5DJYB 4TNVF 2VZ3A 3RFZC 2J4WL 3FN0L 4JRYB 1EJOL 2C3HA 3WIIL 4KJYA 1CGSL 2O5XL 3CFDA 5IBLD 3MJ7B 3V2AR 4L9LC 1NCBH 4X6DB 3FTGA 2VDKL 3DX8B 3GJEB 5DHYB 5FCUH 5MP6H 5IFAH 5EBMA 1KJVB 2OR7A 2Z93A 5GS2D 2BY2A 2HTLC 1FNAA 2P48B 2G60H 2PYFB 4A6YB 4RMWA 5EPMA 3TYFB 5CINH 3WS3A 4XMLH 2NY1B 5KOVC 1MRCH 5C09A 5IK3B 1GGYA 1QEWB 4XGZB 1IZKA 1HWGB 2R0WH 4W81A 5C6WH 1MIEH 1J5OL 5BVPL 3PIQB 3PABA 2Q8BH 3HCVB 5HHVL 3OXRB 3RY4A 3VXMB 2VAAB 4ISVB 4FRWA 5HDBE 2HA1A 4LIQE 5IG7B 2D7MA 5J1AA 2GW5A 4ZXBB 3KPRA 1OGAB 2N56A 3IDIB 4YHNA 3ZDXF 4OLZL 3MFFA 5EZOH 1CICC 3RZWA 4PRNA 1A4JA 4NSKA 5L0QB 4L4VD 4P2QA 3VWJB 3EDJA 3EOAA 3KYMA 5HHOA 3UC0H 4MA3B 4EI6A 1ITCA 3IXAA 4XAKD 5BRZD 3BUYA 5EOTB 1T1YA 4JN1H 4KK6C 2OI9C 4Y4KB 3QWOB 2R56H 1EGJA 1KPUA 4IMKA 5BQ7B 3REVA 3UTTE 2KPNA 1FVCB 1YEEH 5JXED 2QHRL 4RZCA 4M6NH 5L8KB 2OR9H 3SDXF 4PB9H 5AD0B 5J11C 3VI4E 5AEAA 2E6PA 4P2CG 4DK6A 4J4PD 1Z5LB 3STZB 2E9IA 1J7VR 5JOFA 3X12B 2C7UA 1L7IL 4JFYA 1XGUB 3PL6D 3BPNB 4YHMH 1WT5C 3O3AB 4X7FC 4UV4H 2W9LA 3VXSE 5FF6B 4LSTL 3KLHC 1F8TH 3EYQD 1P4LA 4NO2A 1OW0C 4Y4FD 2ESVE 1MVUB 2HFFA 3QXDB 4UIMA 1CVRA 1Q9KB 1QFWM 4FMFA 5J13B 3ZDZF 1JZ2A 2B2XL 4NGHH 3TYGH 4F7PA 2WNGA 4OLYH 1PW3A 2A83B 3EO1B 5FUCC 1CDHA 4QT5B 3SKOA 1FP5A 5T3ZL 2FBOJ 5IBTH 4MQ7A 5T5NG 2ZOKA 4LPXA 4KKCC 2R2HB 1EMTL 4JDVA 3VFVB 4KTDL 2XA3A 5T1LA 4PJFF 3ZE1E 3C2SA 3ALPA 2FSEA 3GHEH 3NBNA 4ZD3L 1KCUH 4H5SB 1EERB 2Y23A 3WJLA 1JP5A 4M5YH 4H8WL 4ZAKD 2BNRD 3LKSB 4RGOL 1XGYL 5CJQL 1V7NL 2CUMA 3P0GB 2ZKHH 5J1SC 1XGPB 2PW1A 1NC4A 2IEPA 2Z4QB 2PYEB 3T0BA 4J3OC 4R4FH 1QZ1A 1UM4H 3SO5A 1KEMH 1CGYA 2A6DB 3NACH 3OKEB 5GZND 2E7LA 1X6LA 1NCCL 1F02I 3OAZK 4YFEA 4MAYA 1FDLL 3T4YA 3QIUD 4AY0A 1J1PL 4F7CA 1M7XA 3VWKB 1GGCL 1H5BC 4QTHA 4XCYB 4HZLB 1BWMA 3IFPA 3D87B 3EJZC 1R3LB 1YJDC 5IF0A 3TN0A 1VKXB 1IGCH 4Q9CA 2ICCA 3CX5K 3NMEA 5AUMA 2VXTH 4MNGE 2HH0H 4A2MA 5IVZB 2D0GA 5D1ZB 3RJQB 2EDRA 4NN7C 4S1RL 1I1AD 4LCWE 3UCRA 2B8OT 1XF2B 4FQIH 5D7SL 4GW4B 2CDFA 3MLSL 3UO1L 5ILTH 1Z0NA 4NO0A 1FG2A 3KR3L 3I2CH 3MXVH 3MGAA 1A47A 1ETZB 2I07A 4ZPVB 1FL3B 4U49A 5KS9A 4FQHB 3AREB 3SDCB 4HKZA 4X6DF 1IQDA 3R8BB 4EN3C 1EUTA 1YY9C 3UBXI 1A3LH 4JHAL 3BQUC 4Y5XA 3EHBD 1DQDL 3HNVH 5GGSB 5TF1H 3BYTA 3BIKA 3ULVH 3W82A 4YK4C 4DZBA 4ZMAT 5F72S 5CEZD 5GS0L 5SWSA 4X4XB 3V0WH 3MRHA 4ZOBA 5E2UH 5JR1L 3MLRH 4EVNB 1ED3B 1FL6B 5SWZB 5I17B 4P48A 1INQA 3B3IB 1SMAA 1AXTH 4Z0XB 1KBGL 1QFWL 3BXNB 4PJEB 5IW6B 3LEXA 4OLUH 1LP9A 5D5ME 3CC5A 5FHBH 2FBJH 3VXNB 4P9ML 1DSFH 2OJEA 4PJBE 3BOVA 2APFA 5EU6B 4QXTB 3SDDB 5E8NB 4OV5A 5E5UB 4GS7B 5CD5D 4LCCB 5E2WL 4L8DB 3P2TA 4U6HA 2O93L 5FUOH 3C9NB 5ESAA 4NP4H 1NUDA 3NZ8A 4AEEA 1W72L 1AHWA 3OAUL 4OIIH 4YDKH 5IB4A 3B2UD 1UZ8A 4I5BA 2JJSA 3RY6C 3RIAK 4ODXB 3C2AL 2QKIB 5EZLA 5KSAD 3FO0L 1MCDA 1BOGB 2HN7B 2R0LH 4JANA 4Y2DC 3IU3B 4PGJA 2RAMA 3QISA 2B0SH 1IGYB 3FN3A 4LLWA 1A1MA 3D0LB 2N7BA 4HIIB 1JMZA 4UT9H 2V9QA 3HG1E 5J12B 1UM6H 3T1FA 3WNLA 1Y6MR 3EZJB 4HJ0C 3L3OB 1F13A 5EC2A 2AKRB 2D03L 4PGDA 4ONFH 4RBPK 4PJXE 2Y5TA 2XQBH 1YYML 5DJ2A 5KANG 3NAAH 2VLJE 2VLKB 4EIGB 2XPGA 4XMPH 4PR5B 2GSGB 1TNMA 2AQ1A 1E27A 3VFMA 1JGUL 5GRYA 4RGNE 1RZFH 4WFED 3MJGX 2BSTA 2R0KL 4ZUWA 2DI8A 4C59B 4NUGH 3MMEB 4XPGH 4U6VH 3MGTA 3E6HA 3U83A 4ETQA 3BRDA 1CF8H 3HR5B 3RWIB 5CKAA 2X1XR 3PP4L 1MAML 2RB8A 2YPLD 3FQXB 5DJ6A 3AU1A 4WFHD 2DM3A 3KJ4B 4NOBA 4KKBC 4L29B 5F96H 2MKLC 4E42A 4LCIH 1JPTH 2AEPH 1UZ6E 4NKDA 4AL8L 4PG2C 4IRJC 4JPWH 3WMSA 3X3GL 3JV5A 3H3PH 3FFCA 2DD8H 2IBBA 3QUMB 2A6IB 1RZKH 1G7IA 4H25A 4F7EA 1X9QA 2UUDK 3SE4A 3NFSH 2A38A 5E24E 1P7QA 1C08A 5LGKA 1EK3A 2CKBL 2VSDA 1QVOB 4JPVL 3HI1A 1ZKAA 1I7TB 5D72L 1BIIA 5IWLC 5LXGH 3HI6H 5JW4M 1KJ3H 2A9ML 3TT1L 3OHXA 5D7LB 4NQUA 5CWSB 1FBIH 3HAEH 4D0CA 3FFDA 1KIPB 2ZPKH 4DN4L 1T20B 5J1TC 1MJJB 3IJHB 4K07A 1K2DA 1IVLA 5C0CE 5DRXB 5IV2A 3MRFA 2WBJB 1GH7A 1OP5H 4U6XB 2MQCA 3QQ3B 3KPNA 4OCSL 4NC2B 5CSZB 2DQDL 1BX2B 2RHEA 4M6AA 2VZOA 3DECA 5I1CH 1LWRA 2DLEA 4IDJL 2XG4A 1R3KB 4XB8A 5GGTL 2OSLB 3DX6A 3VW3H 3RVTD 1LEKB 1BM3H 4K94C 3CLFH 5F89A 1CLYL 5F7YC 4PJ9D 2QQNL 1C5DA 2Z8VC 3MRCA 3MO1B 4LEXH 4K3DH 4EZMA 4IOIB 4HH9A 4J8RB 4L9LB 4Y19B 5E8EB 4KVNH 5TE4H 1CT8B 1KNOB 4HPOH 4U7KA 4KQ3L 1OTTC 3OZ9L 5DURB 1HHGA 1FZKB 2JKXA 3L5XL 4X7TA 4PJEF 4PJGB 4IRSC 2J2ZA 4KUCD 1OLLA 1XMWA 4NCC2 1QFPA 4M43L 5HGDB 5A2LH 4FQ1L 4G8FA 1MAJA 5HDQH 5HHMD 4QRUB 4Z7WA 1AY1H 3D25B 4HC1L 1NAML 3O6LH 2D4DA 3NA9H 1CE1H 2H1PL 1N8ZB 4JO3H 3VGHA 4M6MH 4KJQC 1CICB 3NIDF 2NTFA 4OCWH 2ZZUT 4QHUA 2ARWA 5EG6C 4FZEL 4HIJA 3LCYA 3ULSB 4LLDA 3MBXL 1ZXQA 1KPVA 5CSGA 1MCOH 2OI9B 4JQVC 3P73A 1CLCA 1I9EA 2X44D 4V2CB 4Z7OF 4WO4C 4IEFB 4LSVH 3QEQD 3P9MA 1MPAL 3BN3B 4ZUUA 4QXGH 3C6LC 5J11B 1XCQB 4OTXL 2BSRB 5ENWB 5K9JH 1JFQH 1RZ8A 5DRNB 3FN9A 2Z31C 4JB9L 4PGEB 3QULB 1YMMA 3CPLA 1J87A 4F58H 4GAGH 5CD3B 3KVQA 1CFSA 2QSCH 3SJVB 4PGBA 4JPKH 2YBRA 4NKMA 1A3RL 3VCLA 3V5KB 5DC9B 5SX4H 3AXLA 5DRZA 2DTML 1XR9B 3H7LA 5H2BB 1JZ5A 4YDVB 3BO8A 3SKMA 4Q7DA 1S5IL 4OZ4B 5HBBA 4NWUL 1WF5A 2LU4A 4L4TD 4CMMB 3RHWK 2NXYC 3IDMA 1UXWB 1CD8A 4I3RH 3RWDA 1E28A 5T3XH 4D0DA 4KMTH 5EU7E 4QOKE 2B4CL 3ZKSD 3D2UB 1RZGB 3N06B 1CL7L 3IFNH 5L2KE 3RVUC 4IOFC 3ULUE 3LKNB 2AXJA 1WEJH 5IBUG 3MRKB 2IQAA 3MCKB 2UY6A 1YEGH 4H20H 4XP9L 5FA4B 4J6RH 4CAGA 4PJ5D 4XWGL 1I3GH 4APQD 1F11B 2DIBA 5ERWB 3X14A 4TUJB 1W0WB 3UTSE 4BK4A 4JFHD 4NFBA 5EZIL 4IMKC 5JNYB 3MV7A 2I9LB 5GGRB 2YC1A 3MJ9A 4ENED 4FOMA 5FO7B 1FVDB 1BZ9B 1OSPL 3G5XB 3FB6B 3OKDA 2FX8H 2N4IA 1BQLL 1RIUH 3UP1A 5JW3H 5CHNA 3WIHH 5JLZA 3EO9L 1NCDL 3O2DA 2H3NA 3WD5H 1KXTB 3VDBA 3ZE0F 1A2YA 1H5BB 3OPZH 5IW3A 5DEZA 4WTXA 2NW2A 3GMQB 4J3VA 5E2JA 3DI2B 2JJTA 3OAZH 1TDQA 2R4RH 2OMNA 3EYUH 3FO9B 2R9HC 3QDGB 4NN7B 3W2DH 4L8CA 2V17H 4RA3A 1QYGH 3RDTB 32C2B 3L7FA 4S0TD 4RWYL 4LARH 1H3VA 2VLRE 1MHHA 1U8PB 1CFNA 1Q1JL 3WUWG 1I9RH 2Z8WC 1QA9A 1KENL 4KKAC 5JHDA 3PWNA 1XF5A 5B39B 1QRNE 3LKQA 3PQYA 4Q2ZB 1FRGH 3U46B 4OGXH 4EN3B 3CDGB 1RZJH 2NYYC 4PRBB 1KLFA 3DWTA 1VA9A 1VPOL 5E6ZA 1U8JB 1NFDA 3BD4A 1DCLA 2ZNWA 3T04D 1RJYB 3QPQC 4YK4B 1MRFH 4HKBB 4PJGF 4YFDB 4TULH 3ZHDA 1DTUA 5ANMB 1JNNL 5D71H 1SJEB 1IGIL 4JRXA 3RPIB 3V0VB 1DBAL 4G3YH 1PFCA 4G9FA 4FN0A 1P6AB 2JCCE 3I6KB 4HXAH 5IQ7L 1EZVX 1Q94B 4FXLA 1QNZL 5C0AB 3HKFA 4KXZI 1QRKA 5HPOA 2W60B 4P46A 1CD1A 1MJ8H 5JUEH 3F58H 2E7LC 4KK8D 2IQ9H 5K93A 1MF2H 3VFWA 2X4PA 3H9SD 3ARBD 1PKQA 5FOBB 4QHNB 4NPYB 3DV6B 3CFBA 1T80A 3DSFH 1HHHA 2MQ0A 1T5WA 4MJIA 4DZ8A 3QDMB 5EWIL 3TN0C 2OR8A 3D3VA 1KCRL 4BSWB 5CZVL 1QLRA 2CKNA 5I8EA 15C8L 2GY7B 3PWVB 4F57H 1AGBB 3HZVA 1UB5B 1I7ZA 1WC7A 3LMJL 2DQUH 3RL1A 2FIKB 3MUGA 1GZPA 5C6TL 2D9QB 2NY0D 4Y2DB 4FHBD 2F53B 3KPSD 3VFUB 4NZRL 4ELKA 4RRPA 1JK8A 5TQ2L 2BFVL 1D5XA 2E8YA 1FNSH 5LAXB 1MFCH 4LGSB 1IGMH 3DGGB 4JPIB 4RNRB 4P2YA 5GGRY 1KULA 4Y5XC 3GFUA 5GHWH 1NLBL 1BGXH 4FNLH 3T8XA 4N0FB 4G8IB 1Q9LA 3S37H 1N59B 1DR9A 4G6JL 1MCSA 2P8MB 1CL7I 3GSOB 2XXCB 4OM1L 7FABH 2RCSH 3W11C 2XZCL 2VDRH 4NQEB 3ARGC 1FGVL 1FYTB 1M6OA 2AJVL 3HC3H 1ZLUK 3WIFA 2MCPL 3F12B 1KC5L 4DJMA 3V6OA 1E6JL 5JMRA 1KJ2L 4FFZH 4NO3B 1BEYH 3GSUA 3UJJL 5BO1H 3F7PC 4FQCL 5E94B 1M05A 1DE4A 3OXSA 4X9FA 3HMWH 3DV4B 3V95A 4RFNB 5E70A 1A6AB 3INUL 3PWPE 3MRNA 1HQRA 5BMFH 3WXWL 2HKFH 4IRJB 2YD8A 1D6EA 1LO4H 1FO0B 4I3SH 1RMFH 4KRLB 2AXHA 3ES6A 4U6YA 1S9VB 5MERB 1I1FA 2AK4E 2JJSC 1NGXA 4H88L 4TSAH 2ZSWB 1SVCP 5C0GB 1IM9B 4U1SA 2CGRH 3L5HA 4OFPA 4IMLB 1A7NH 1YY8B 2B39A 3N85L 1K4DA 4TTDC 5IKCA 2UUDH 5F1NA 1MFBL 4WRLA 1NBZB 4UOW1 1S7WB 4YQXH 1OAXH 5DYOA 4MXVF 3VE0B 5C7XH 2H41A 5D1XD 5J6HA 1BBDH 1KUMA 3DYOA 3SGDI 5GGVL 1TXKA 4YAQB 4H1LA 1PJ9A 1SBSL 1S7UB 4WW1A 5IB1A 1Z9MA 2DDQH 1KJMB 1J8HA 3QUZD 1IRAY 4X8JA 1JI1A 3VFSB 4G8GB 1HYRC 3LQAH 3STLA 2C4XA 2XZZA 2PCPA 2EXYD 5F9OH 4JJ5A 1CBVL 5JPMB 3OKOB 3OR7B 1DBBH 1NC2A 3ULVD 1YNTA 4CN6A 4M7LT 4P5MB 1P4IH 1S3KH 4UTBL 3OSKA 2CLRA 2O5ZH 5EOCL 5I1JL 1GYAA 4Y4HD 5F21B 3ZT6A 3W0WB 4U1HB 1IC4L 2HT4C 4MXQD 4YJZL 5CZXC 4ZNEE 1F4YL 4BQ8A 4ESKA 5D2LE 2PR4L 3DNKA 4KJPD 4IRSB 1RHHB 2DQTH 3GMMB 1D5MA 3WNPA 3HUJE 3SE4C 3S88L 4HWBL 3O2VH 4EDXB 3DX7B 5C0EA 3HNTH 4MSWA 2IG2H 1U95A 1WFNA 5D7IA 2XZAL 5CEYB 2YS4A 3VXRB 1NGQH 1ZGLA 4LNVA 3S5LB 2YKLH 5EC1B 4P5TA 1Q9OA 2AJZB 2P24B 3HLAA 4I0PD 4L3CB 4LRIA 5B3JE 1RV6X 5DRWA 4D9QE 3P0VH 4P23A 1A5FL 3GRWH 1IAMA 4JAMB 1KG0A 1ACZA 1YNKL 3U7WH 5IGXL 2J6EH 2Y5EA 4Q0XL 4D2NA 1KCVL 1I8IA 3LZFL 1DQML 4OD1H 3C6LB 2NTSP 2VXUH 2VOTA 4Y16D 1DQLH 4X6CB 2IANA 1A14H 3RQ3A 5DGQA 5H94B 1CXLA 2OTWA 2GY5A 1WCBA 2Z31B 1FFQA 5FIEA 1U92A 4LPYA 1JTPA 4PRIA 4JKMA 2DLFL 1OD7A 1G7QB 2WAHA 5HYJD 3MV9E 5DQDH 4KJYB 3CFDB 3GMNA 4NM8H 1T22A 1IT9H 1XGRA 3WFCL 4HF5L 5HVGB 4NHCH 3FTGB 3MOBH 4Q9QL 2BRQA 5DJAA 2DQHH 5EBMB 2ZJSL 3O2WL 1OAKH 4XHQA 5I1LA 3CXHK 1DQTA 5HHPB 4JFDE 1G6RH 4JLRA 2F15A 2IBZY 3I75A 3WS3B 5FYKU 2VDPH 3B8SA 1KXQE 3B2VL 5C09B 1LDPH 2EE9A 3WHXA 5D96C 4GRMA 5HDBF 5HYFA 3PABB 4JFOA 3S6CA 1IAII 3KYKL 4QF1A 4OI9A 3MREB 3KPRB 4YHNB 3MFFB 4WU7A 4L9DA 1A4JB 1AQDA 1U3HA 4NSKB 3QFJD 2IAMD 2R23A 3KYMB 3EOAB 5HHOB 3BRFA 4NKIH 2IMMA 1T1YB 4QWWD 4CMHC 4Z7QE 1I85A 1S7VA 4HW6A 1KPUB 3REVB 5JW4R 2D7NA 4ODHH 3VI4F 3DPBA 4RZCB 3VXSA 3BW9A 3GK8H 4P9HL 3KPQA 4YZFE 2C26A 2YN5A 1MFEH 3RWGA 2W0FB 4LHUD 5JOFB 2C7UB 2FJHA 4JFYB 3FHQA 2WIMA 3OQ3B 2WLYA 5ESVA 4BZYA 4MCZA 1MQ8A 3HN3A 4K8RC 4MAUH 4OF0A 3T2OA 4JO2H 3GJFB 1P4LB 4NO2B 3L3IA 5ELIA 4WHYG 2HFFB 5EU3A 4LPWA 2ZWLT 3SPVB 2Y06H 1QFHA 2XTJC 2FRGP 4D9RE 4KJWD 5E2TL 3EBAA 4F7PB 3QDJE 5F8RC 5A2JH 2FR4A 5JZ7D 4U3CA 1QSEE 4HCRL 4PJCE 3SKOB 3QG6A 5DFVC 4LAQL 1G7HB 1AR1D 4ZFFA 2ZNXA 3ZE1F 4BQBA 4JDVB 4OF5A 3DO7A 4YH6A 5T1LB 1G1YA 1NCNA 1K8IA 4LSRL 4WFGD 5GRUH 1BQHG 5DD1H 2FSEB 1S7RA 1E6OH 3D18A 5F1IA 2FEEI 4N68A 3BJ91 3D5OF 1F4WH 3D6GA 4L5FH 4UTAL 1LO0L 1SJXA 5LG1A 3P11L 1T0NA 2QSQA 3O4LA 4K2UL 4OT1H 5DK2A 5ALCL 2EDOA 4YPGB 2YHGA 2HVKA 4TSCH 3BZ4A 1C7SA 3FO2A 3TJEH 1CD0A 4NDMA 5HI5C 2PW1B 1CIDA 4JFZL 1MH5A 2OTPA 1ERNA 2AJUH 3S4SA 1BZ7A 2DI9A 4AEHL 4GAJL 3SQOH 4HIEA 2BNRE 4N5ED 4MVBD 2HYMA 4M61B 4NNPL 1BVLA 3G04A 4N0YH 4R9HA 1ZV5A 3T4YB 3W5MA 1G7MA 2DF3A 3GMPA 3RL2B 4WFFD 2G2RA 2JLLA 3IFPB 3VH8G 4QKXB 3TN0B 3U0WL 5IB3B 3A67L 43CAA 2JJTC 4Z95H 2X4TA 5BVJB 3F7YA 4YXKH 4HT1H 4X6CF 2NY3C 5GGUA 1P5VA 1OSZB 3GNMH 5TFSL 1M1SA 4QRPA 1J0YA 4NN6C 3TBSA 1INEL 1FG2B 4DCQA 3FQTA 4WI5A 2OZ4L 1MIMH 2X1PA 3KPOB 1XIWD 4O2FB 1I7RB 4GH7B 1IBGL 3S36L 5F93C 2NY2D 5KS9B 3ZKMC 4OLXL 2RBLA 1IQDB 4UBDC 1NGWA 1HOCA 1CZ8H 4M7KL 4Y5XB 1YDPB 5CJOL 4TRPH 1CGUA 1MREH 3BIKB 4LP5A 3QXVA 1SYSA 3VD5A 5GJSH 4DZBB 2B1AL 5IVXE 5SWSB 3LQMA 3CU7A 3LHPH 3MRHB 4HK0B 5T3XD 4NNYA 2EIEA 2Y36H 4YR6A 4ZTOL 5D5MF 3HHRB 3C60D 1RFDH 2XACC 1PX4A 5I1GH 3LEXB 4G8EA 1G9MC 1LP9B 1WIUA 3CC5B 3ARGB 4UQ3A 4JR9L 5CEZE 4GW5A 4KKLD 1T6VN 3IRZA 4BELD 4E41A 4PJAE 3QI9A 4NWTL 3U79A 1EEZA 4P46C 4JRYD 4XVTH 5EBGA 35C8H 3T1WA 3PNWA 1U8LA 3GB7B 1C5CH 1UWGL 1ZLUH 2E6JA 1NDMA 3NCYS 1NKRA 1WBYA 3FOMA 1CDYA 3CFCH 5BZDA 1I8KB 4DEPC 1CU4L 4U6HB 5ESAB 3BGFC 4OM0L 3RZCD 3NZ8B 1D5IL 5E9DA 1QUNA 2HG5A 3O8XD 1FZOA 2IPUG 1DUZA 2NY1D 1UZ8B 1GCFA 1HKFA 4I5BB 1C5BL 3UYRL 1SEBB 3ZDYF 4CJ1A 5KZCD 5EZLB 1A6WL 4KDTA 1QFUH 4WENB 2XV6B 5AG8A 2VKWA 4JANB 1J0JA 3PJSA 2HRPL 5MEOA 4ZXBD 1I9IH 4K23H 4LLWB 1K8DA 1ORQA 4R90H 1Y18A 1OVZA 3T1FB 4TQEL 4RDQF 2PTVA 2FB4H 2HJKA 2OK0H 3G6JE 3NIGE 1AKJA 4TUOA 4Y7MA 5EC2B 2EXWD 1A64A 4GQ9L 4GKZA 4Y4KD 4X83A 2VDQH 4HLJA 3OJ2C 3JWDL 5D1QC 4J3WA 3GGWA 1GSMA 2XPGB 3FT4B 4E5XB 1E27B 3VFMB 1CGTA 5E6IB 5FUZH 4LRNL 4GUPA 3GSQA 5AWNL 2AEQL 4ZUWB 4CGTA 5MENA 3T3MF 5A2FA 4M8VA 3ABZA 3E6HB 4XVUC 2ERJB 3V6OC 3MLZH 3K81A 3DBXA 5ITBL 4EUPG 4KUZL 1A0QL 2DL9A 5DJ6B 4OV6F 5HI4D 3B9EA 3OAYK 5HXMA 4RFEB 5AYUL 1U3YA 1FHGA 4ZS6C 2OL3H 3RWEA 4WTWA 3IXTB 1DL7L 1W72A 3TBTA 3FFCB 3TPUA 5C2BH 2ZP0T 2A0LC 4FQJH 1G7IB 4H25B 4CNIB 4YHKL 4F7EB 3FQUB 1ORSB 2CMRL 1P7QB 1C08B 2PO6D 4HUVB 4HQQH 4WCYL 1LNUA 3L95A 3HI1B 5C0CA 4WGWB 2EZ0D 3GSVA 4M9OA 1QQDA 4QTIH 1SEQH 4YUEL 3TCLA 3JUYA 4JFFE 5D7KE 1IEHA 2VZ1A 3FB8A 1SBBA 1H0DB 2ED9A 2J88H 3FFDB 4XXDA 2BVYA 5IMKA 1JPGB 4LIQH 5K33A 3F8UB 1FZMA 2XKUA 1NCAH 1K2DB 3CVHL 2LE9A 4F37K 4LSQH 5HSFA 3QHZL 4FFWC 2FATH 5IV2B 3D85B 1P84K 5TQ0H 1HINH 4NM4H 2GCYA 1IAKA 3KPNB 3MRIA 4PLJD 2Q3ZA 2PKDA 2C3GA 2FNBA 3QUXB 4XPHL 5KVEL 1I9JL 3U1SH 2KL6A 1A7PL 3RJDA 4F2MA 1T1WA 3KAAA 4PLKC 1EHLH 1IEAA 1I3UA 5F89B 5KS9F 3O45A 1KN2H 3HE6A 2BOBA 5E00A 2XZQL 1RURL 1N6QL 4N8CH 1U3ZA 4TOYL 1C5DB 4ZPTA 4S2SA 5DT1H 1J1OH 4DAGL 3QQ4A 1F3DH 2DBJA 4I0KA 3MRCB 4R2GC 3BP4A 3BSZL 4HH9B 4HFUH 2IC2A 4XPTH 4LKCA 3BJLA 4P2OA 2CK0L 2YD6A 4NCDA 4M1GL 3A6BL 1QSFA 1MY5A 4LPCA 4R4NC 3HC4L 1HHGB 3HPJA 3KPMB 5CUSL 4GMSL 3W9EA 4X7TB 4WWKC 2A77L 1XFPA 5E1HB 3LD8C 3SCMA 4G8FB 5D96B 3RUGE 2CKBA 4Z7WB 1B3JA 3NA4A 4NQDE 4CKVX 2W9DL 1INDH 2J7LA 5DC0A 1MCCA 4HSQA 4HG4K 2X09A 5TGBA 3A6CL 4P5TC 1N0XH 2NTFB 4QHUB 3NABH 1CFBA 4LVOC 3QEGL 4HIJB 5T5FL 4LRIC 4LLDB 1KPVB 1RZ7H 4P23C 3MODL 5SWZD 3P73B 2GJZA 1FAKT 3I3EA 1DP0A 1NMBL 3HZYB 5D6CA 5BS0E 5IHLB 5GGTA 4ZG1A 3LRGA 2X41A 4ZUUB 4MS8C 2DYPA 1P7KA 3VD9A 3C8KA 5JDJA 3S35X 3BEWA 1A9BB 4WY7L 2H9GA 3GM8A 1MCPH 4NO5A 1MCRA 3PP3K 2KBGA 2V6HA 4PRPE 5DR5L 5HGHB 5EO1A 4DGYL 1CFSB 1KGCE 3QEQE 1Y0LA 4PS4H 4X7SH 4PGBB 2YBRB 4LSSL 4NKMB 4NT6A 4WEBH 3VCLB 2Y4SA 2R2BA 3AXLB 4J3UA 2FH8A 3E8UH 2EH7L 5DRZB 5I9QC 2DIJA 4AIXA 4M02A 1VGEH 5F6HJ 2XTJB 3BO8B 3SKMB 3UTPE 1HIMH 1UYWH 2NZ9C 1HHIB 1ADQH 4R3SA 1B0RA 5DMGC 3U9UA 3MRRA 3RWDB 1E28B 5TE7H 4HC1A 5DF0A 2BHYA 4C56A 1NAMA 2G75A 4XHJD 4D0DB 4LSDA 2CRYA 1NCBL 3ULUF 2IPTH 4K7PY 2HAZA 2HLAA 5MP6L 5FCUL 5IFAL 4OFYA 2YEZA 4M4PA 5LCVH 1GOHA 1V3KA 1FN4A 2IQAB 2P5ED 1U3HC 2G60L 5EORH 5TH2A 4OKDA 5CINL 3MRQB 5KN5A 4XMLL 3RNQA 1MRCL 3HA0A 2VLKD 5F7NC 5ADPH 4WI7A 3VXQB 1QR4A 4JO4H 2R0WL 5GGQH 1MIEL 3X14B 1I85C 4NHUA 2Q8BL 2UWEE 5HD8D 3MV7B 1NFKA 3U4EB 4I13B 5ISZB 2YC1B 2N7AA 2GEEA 4Y5VA 3I02A 3IDGA 3V5HA 5BZWA 5EZOL 3OR6A 2EEBA 3OKDB 3FO1A 3UC0L 4JFHE 5CHNB 5JLZB 3L5IA 5FEBA 5GIRA 4JN1L 1A2YB 2X4RA 2R56L 2VLRA 4UIKH 3OKMA 1YEEL 4OFDA 1B9ZA 1FVEA 2J8UE 1NCWL 4M6NL 4MB3A 2OR9L 3EFDH 4PB9L 4HUXA 1QFOA 2NY3B 4JY6A 4L8CB 2KQNA 5CIPA 5FV2A 1KLUA 3L7FB 2DQCH 4YHML 3WHE1 1CFNB 4UV4L 3LQZA 5IP4A 1QA9B 4G9DB 4LCUB 3Q1SH 3TJHD 3WNKA 5JHDB 3PWNB 3HRPA 1JL8A 1XF5B 2P43B 3LKQB 1F8TL 3PQYB 1F00I 4B7IA 3VRIA 4OGAD 5FK9A 2E7CA 4S1QH 2GYSA 3TWCH 3X11A 1FNEB 1K3ZA 3M8OH 1NFDB 1KYOJ 4GAYA 1ZWIA 4BQ6A 4NGHL 3TYGL 4JVUA 1P69B 5KVFH 4OLYL 8CGTA 3S8WA 3GJFH 2GSIA 3OF6D 4M5ZH 2Z91B 4EXPX 5IBTL 3TVMA 1UCBL 2HTKD 1JF1A 1M4KA 4JRXB 5C2UB 4OZIE 4G9FB 1U3JA 1GGIH 4JZNA 2VERN 4PJ8A 3GHEL 1JYVA 3VI3E 2IMNA 1KCUL 2DN7A 4L1DA 4P46B 1CD1B 5JQHC 1SYVA 5E8PB 5D2NE 4QO1A 4Y19D 5D7JA 2FDBP 5GS0H 1DLFH 2QR0A 3RKDD 1JGVH 4M5YL 1YC8A 2X4PB 3R4DA 1WWBX 5EUOB 1PKQB 1KN4H 3B9KA 4DEPB 1MFAH 2ZKHL 2Q76B 5DURD 3BGFB 3DMMD 1T5WB 4MJIB 4V2BA 5JDSA 3D3VB 3BPLC 5I8KH 1QLRB 5I8EB 4QRRE 4XP4H 4R4FL 1UM4L 1PLGH 1KTKE 3PWJB 4OCMC 3NACL 3KS0J 1I7ZB 1TJHH 3MLXH 1WC7B 4RWHA 3RL1B 1GZPB 3BPOC 1MI5A 2E7BA 3MV8D 4U33A 2YRLA 4JY5H 3ARSA 4ELKB 1JK8B 1TVHA 4DVRH 5FGBA 4XCFH 2BVQB 3GI9H 2K9UA 5H37G 1IGCL 1EFQA 4KMQA 4Q6YA 2VXTL 1NGPH 4WI2A 4QYOA 2HH0L 1AD9A 4PIRF 5C08B 4WHDA 3KPSE 3SBWA 3T8XB 5HHQB 2DIAA 4GRLA 3I84A 4FQIL 5D1QB 4H8WC 5ILTL 3ILPA 4JFPA 5FDYA 4IDLA 3I2CL 1IILE 1DEEA 3MXVL 5EBWA 2DQFA 1YEFH 4CU6A 5C0NC 5F6HI 2F5BH 5CMAA 3M07A 1M6OB 1A3LL 3PWPA 3WIFB 4UDUB 4P4KD 3T0WA 2W1NA 5FYKE 5T1KA 3HNVL 1NUGA 5TF1L 2E6QA 3QI9C 1U93A 3ULVL 3CJJA 3GSUB 1DN0A 5L7XH 3OXSB 1DE4B 3V0WL 2Y7QA 5E2UL 5IR1A 3MLRL 4U1JA 3TA3C 3ARTA 3IAPA 5C0BB 3MRNB 1HQRB 4U6TA 4Y1AB 1AXTL 1D6EB 4OD2A 4OLUL 5I1DA 5C0RL 2R2EA 2VR5A 4KROC 3ES6B 4U6YB 2R1XB 5FHBL 4ODSH 1OP3H 2XI9A 3HPLA 1F2QA 1DSFL 5J06A 4R97C 2L7JA 4HD9A 3RWFA 1NGXB 4KDTC 2X4QA 2WSKA 3ROOA 4U1SB 4R26H 2GTWA 3RIFF 1D6VH 1K4DB 4I2XE 3ZKXC 1WFTA 2ARJQ 5F1NB 1FCCA 3BMWA 5FUOL 3B83A 4NP4L 5L88L 4F7TA 4M8QA 4P5KB 4OIIL 4YDKL 5D4QA 3P4MA 4NQXA 4H1LB 1R5WA 1UEMA 3OKKA 4PY8I 4JPVH 1V7MH 2R0LL 5IB1B 4GMTH 1CE6A 1J8HB 3NFPA 4X8JB 2B0SL 4KK5D 3STLB 1CG9A 3BIBX 4UT9L 5AG9A 2VQ1B 1UM6L 2PCPB 3OJDA 1JHTA 3MRMA 1AO7E 5L2JA 3PXJA 2KDGA 4JJ5B 3WUWB 2EIZA 1KJ2A 4ONFL 1YNTB 2HWZH 1WWAX 3BZFA 1F4HA 4R2GB 3MBEA 3UROR 5GQBA 4FP8H 2XQBL 4OUOA 3NAAL 3R06B 2CLRB 2NXZB 3EJZD 5D6DA 4JCMA 5CBEA 4C57C 4XMPL 5DHVA 1BD2B 1PBYA 1CXFA 5C07E 3QDGD 3FRPA 1DANT 1RZFL 4DUWA 3HUJF 3DUSA 4WWKB 4CBPA 3RDTD 4NUGL 1I8LA 4XPGL 4U6VL 3LKRB 2VL4A 1C1EH 1ULVA 3LD8B 2KH2B 3DETC 3WL9B 5A16A 1CF8L 2HJLB 5C0EB 5K9QG 2M8XA 4MSWB 1U95B 5BCAA 3JTSA 5D7IB 2IGFH 4M1CD 5EUOF 1YY9D 5F96L 1GIGH 2PXYA 2Q86A 5IMOA 3T2PA 4LCIL 1JPTL 1ZGLB 2AEPL 4OZFA 4F15C 1EVUA 5E0QA 2H2SD 2WINA 4P5TB 4JPWL 3RGVD 4LVOB 5JXAH 3U0TA 1Q9OB 3WLWD 5IFJA 3H3PL 1IM3A 3HLAB 2DD8L 4I9WD 1GHFH 1RZKL 3ULUH 5DRWB 1T7ZA 3BGMA 3NFSL 2ZCLH 5JPNA 4HUKB 1JE6A 1KG0B 1ACYH 3FZUD 4WEMB 1NGYA 1JJUA 3GSRA 1I8IB 1E4XI 2GJ6B 1EFXB 4ODWB 2C5DC 1OTSD 1QHPA 5LXGL 3HI6L 4G7VH 1KJ3L 5IEHA 1Q9WA 4NQCD 2IANB 3L3DA 5C0AD 3VXUE 3HC0B 1WCBB 1FBIL 1UH3A 5F7LB 4FFVC 2Y25A 3HE6C 2V2WA 2YZ8A 2ZPKL 5F7FA 2Z8SA 4PRIB 4LLQA 5C92A 3V4PH 1DBMH 5JO5A 3GMNB 4PTUA 3B6SB 1T22B 3WFHB 1XGRB 1HXYA 4ZFOB 4P2OC 1WAAE 5I1CL 3BVNA 1WBZA 5I9QB 4KI5E 5JQ6H 3PP3H 5DJAB 2JJWA 4J3TA 3VW3L 2CQVA 5I1LB 4RMSA 3CK0L 3CLFL 4JLRB 3I75B 4XCCH 4LVEA 4HWBA 5F44A 2VWEE 2F53D 3SCMC 3WHXB 4S0SD 4GRMB 4Z78A 4LEXL 4GFTB 4KH2A 4JFOB 4K3DL 3PV6A 4KVNL 5TE4L 4WUUD 2CDEB 4P3DA 1XF4A 4HPOL 4Z7VE 2DJUA 2P44B 4HJ0D 1QBMH 4JE4B 1U3HB 1WICA 3MRGA 5DJXA 2R23B 2MPAH 4JKWA 4L4VA 4Z7QF 4RQQB 2ED7A 1F6LL 2OJZH 4YHLH 1OB1B 5BRZA 3LEYH 2FH6A 1AY1L 1S7VB 3OJVC 3O6LL 5FM4A 2NW3A 4AIZA 4YZFF 2B4CH 4FFYH 3NA9L 4O2EA 5I1KH 1JV5A 3BW9B 1CE1L 3IFOA 2VDNH 4NQED 4JO3L 3KPQB 1S7TA 3BFOA 4M6ML 4WIQA 3RWGB 4WJ5A 5DJCA 1CI5A 4J4PA 2FJHB 4OCWL 3NGBC 3PL6A 5DVKA 2VRAA 5ESVB 3VFNA 4MCZB 3SKNA 1DFBH 4KKBD 2DRUA 3GUTA 1MCOL 1U58A 5H35A 4PG9A 4GSDH 3FT2B 1YPZA 4MA1C 3L3IB 4Y4FA 4HX1A 4LSVL 1L9MA 3GM0A 1MVFA 2J5LC 4QXGL 5E03A 3S7GA 1A7BA 1RSFA 3F6LA 5K9JL 3UTTD 1JFQL 3FQRA 3ZDXE 2FR4B 1TLKA 1T0MB 2XOTA 4F58L 4GAGL 4UV7H 3RKPA 4XNUH 4EIZC 2FZ3A 2QSCL 1UWEH 4JPKL 2WLZA 3JXAA 4RAHA 5I2IA 4CN1A 1A7OH 1RK0A 3DO7B 3UMTA 1K8IB 4OFKA 1B2WH 1S7RB 3Q3GB 4LDLB 3D18B 2ESVD 2PETA 1CFTA 1J10A 4D0BA 4KZEH 3SDXE 5ID0B 3O4LB 3BP5A 3B4NA 5DK2B 2IBGA 1JN6A 3K1KC 3MZGB 4ZAKA 2BNRA 3BZ4B 3TM6A 4I3RL 5T3XL 3MJ8A 5C0FA 4G8GD 3NCBB 3QZWA 2YMXH 2ICES 4KMTL 1MEXH 3C5SA 5D7IF 3QXTA 1I8MA 3IFNL 4BA8A 1MJUH 3WKNA 3S4SB 3RVVD 2NR6C 4QRSA 4Y5VC 4HIEB 1WEJL 3MR9A 1BVLB 1CTOA 4JFFB 3VJ6A 2I26N 4H20L 1XR8B 5A2IH 1X7QA 4K3JH 5I66A 3GIVB 4J6RL 2H32H 3ZDZE 4MCYA 1I3GL 1G7MB 2P5WE 3QIUA 4R6UA 4C83A 2MHAA 2VABA 3FL7A 2X1OA 3JTTB 3BP6A 3GO1H 3NIFE 2V5RA 2UZXB 2CK2A 3BPLB 43CAB 4OBSA 1AGFA 2X4TB 2XN9E 4IRSD 1T66D 3F7YB 4ZOEA 4HUWA 4PJFE 3ET9F 4MX7A 3EJYD 5GGUB 4HCRA 3OG6B 4LLVB 3BPOB 1A1OA 2FX8L 4QRPB 2Y07L 4X5XA 4DGIH 1RIUL 1W8NA 5JW3L 1H3PH 3WIHL 1I1YB 4EI5C 4DCQB 3QB7C 3WD5L 3FQTB 4KJQD 2BOCA 3OPZL 1NGWB 2R4RL 4KPHH 2AAVA 3EYUL 2EKSA 4BK5A 2H8PA 2XFXA 1RZIA 3ARXA 2OS7A 4MDJA 3W2DL 4XRCB 2FECL 2V17L 5DUMH 1SYSB 5M95B 1QYGL 3HB3C 5C6TH 4NNYB 1I9RL 1IGTA 4LCWD 3TVMC 3C6LD 3O9WD 3QJFB 1UA6H 1CDBA 1KCLA 1NFIA 1FRGL 4G8EB 1FL5A 1MHPH 4OGXL 4PJAF 2WWKT 4AG4H 4BZ2H 1RZJL 3RI5K 5B4MD 4GW5B 3HNSH 4PJ8C 4TTGA 1L0QA 4X9GA 4E41B 3QI9B 4JREC 1EEZB 1MRFL 4WWID 5D7JC 1DLHA 3PNWB 2ILLA 5E2VH 4TULL 1NDMB 3QCUH 3TA3B 3FOMB 3AC0A 5D71L 1P5UA 3B9KC 5BZDB 3KXFA 4PRHA 3UX9B 3E2HB 5A2KH 5TDOA 3HRZA 1JZ7A 4G3YL 5E9DB 4KROB 4GO6B 4HXAL 4JRYE 3D0VA 1DUZB 5ECJE 3C6SA 4R97B 1Q0YH 3NTCH 4TPRH 4X6DE 3KGRA 2YPKA 1MJ8L 5JUEL 3F58L 4NC1C 2IQ9L 3DRTA 1MF2L 3PJSB 1WK0A 5MEOB 5FAAA 2OZ4A 1KLGB 1ORQB 5FGBC 5C8JB 1IAIH 3LB6C 3DSFL 1IC7H 3W39A 3G6JF 3NIGF 2VB5A 2YD7A 4RMUA 2HJKB 4TUOB 1AKJB 1TZGH 3VXME 4F57L 3SBWC 4KRMB 1Y6KR 3MA7A 2DQUL 4GRLC 1OGAE 5CCKH 3GGWB 2P8LB 3VXOA 4MB4A 4XWOC 4EEEA 3MOAL 1I3RA 1ZLSL 1FNSL 3GSQB 1KCSH 1MFCL 3TO4D 5MENB 1NUNB 2P45B 4J7RA 5GHWL 3WLBB 3HG1D 4NJ9H 1BGXL 4FNLL 3DBXB 1FFRA 2YPLA 2H2PC 4GG6E 2K7QA 4FQ2H 3S37L 3WNNA 2JIXD 5I18H 4POZC 3OX8A 5B8CC 2Z35A 4LGRB 3E3QE 4YNYA 5FXCH 1U8MA 5KJRL 2VLJD 7FABL 2RCSL 4R4BA 3RWEB 1QTYT 2QV2A 1IQWH 3TF7C 2VDRL 5IHBA 4ZSOE 2IF7A 3TPUB 2YWZA 3HC3L 5IEKA 1K85A 4BJLA 4RGND 1JZ3A 2VL5A 4NKOB 3SE3A 4KKAD 4G6FD 3K4ZA 1BEYL 5BO1L 5J4MA 2DL2A 3L9RB 5C3TA 1LNUB 2HFTA 3HMWL 3L95B 3GSVB 3C8HA 1QQDB 4WW2C 3TCLB 2NYYD 3FB8B 4F15B 5BMFL 2AW2A 2HKFL 4I3SL 1RMFL 4XXDB 3EJJX 2EDFA 1OPGH 1W8OA 1FZMB 3NN8A 1M7DA 2GCYB 1IAKB 3MCG1 1WIOA 2DMBA 4TSAL 2J8UB 3AMLA 3MRIB 2EDDA 3AROA 4PD4K 1ZHBA 4DUXA 2CGRL 2WUCH 5TJWK 1A7NL 1LEGA 3SDAA 4PLNC 4G6MH 2WWKO 4F2MB 1HCFX 43C9A 4PJHA 5T1MA 4YQXL 1IEAB 1OAXL 5JOPE 5C7XL 3HE6B 2BOBB 5E00B 4PJ9A 1BBDL 2YPVH 4NZTH 4ZPTB 4S2SB 3QXAA 2CLZB 4QNPF 4XI5C 3FKUS 3QQ4B 3RVXD 3Q5OA 2PYEE 2QTEA 3MBEC 1HSBA 4XZUA 4LKCB 1MWAB 4P2OB 4TSBH 4I77H 5D6DC 3ARDA 3TN0D 3I9GH 1UKSA 3NCMA 2DDQL 2Q7NA 2W65A 1ZA6A 3GKWH 3LQAL 4GAFB 3S3JA 1MY7A 5CGYC 5DA0B 3HPJB 4MNHA 3W9EB 1D5BA 4X9IA 2YXFA 2A74A 4HJGB 5HGGS 5F9OL 3WYRA 1S5HA 4KV5F 1DN2A 4ZUTB 1TQBC 3SCMB 1DBBL 3DJ9A 2CKBB 2Y72A 2R15A 3K8KA 1P4IL 1S3KL 2O5ZL 3X3FH 2ITCA 5FECA 3UEZA 1MLBA 2AJXH 2PXYC 3PDDA 2K3TA 2HFEA 5TGBB 1RVFH 2C1PA 1TTGA 3FMGH 3CVHA 4DW2H 1JMXA 5SWSD 2DQTL 4M6OH 2OQJA 3O2VL 2XICA 4P2RE 3HNTL 1H9VA 4QRRB 2DI7A 2IG2L 4HS6A 3THMH 1HYSD 5KSBA 3QEQA 3ARGD 1NGQL 1ZT7A 2D9CA 1KB9J 3C8KB 3BEWB 2YKLL 2H9GB 3NGBB 5SWZE 4NO5B 3L3KA 2QADC 1AGCB 4PJEE 3GRWL 4U0QB 1Y0LB 3U7WL 4NT6B 5IBLC 3QBTB 2J6EL 4MA1B 3FRUB 1HK6A 1E4JA 4MMXC 4ALAH 2HVJB 4LHJB 5EU6E 4OD1L 2ADIA 2VXUL 4O5LH 1DQLL 5ALBH 1KSRA 1A14L 3E0GA 4XNYH 1BFVH 4XCEB 4R3SB 4L4TA 1B0RB 2X7LA 1C16A 3U9UB 2HP4A 3TH2T 3MRRB 4C56B 4MHHG 3DIFA 1NAMB 5DQDL 3AS1A 2G5BB 2EEAA 4NM8L 1CDJA 1IFHH 1IT9L 4NHCL 1U8HA 3PDOB 3MOBL 1YZZA 2EDBA 2KUTA 2BVTA 3CXDH 2HLAB 4AT6A 4Z7OE 2DQHL 1FFOA 2YEZB 4HGKC 3MX0A 1JTOA 1NPUA 1FN4B 1G6RL 2EO9A 4EUPB 4HUUA 5TH2B 1RUAH 5KN5B 3RNQB 2VISA 4PJ5A 4CDGC 1LDPL 4OGYH 4WTZG 4NFCA 3H2WA 4APQA 3MZTA 1X6NA 2UWEF 2VLLA 4YE4H 5E6ID 4ZOCA 4NHUB 5F9DC 3MLYH 5FOJA 3LKPB 3CFJA 3PWUB 4YDIH 4O51B 4JVPA 4K7FA 5CP7B 4Y5VB 3I02B 3IDGB 2CLVA 2VLKE 3AUVA 3V5HB 3VFPB 3OR6B 4J4PC 5L2KD 4M03A 3PL6C 4M7JH 3ULUD 3FO1B 3IGAB 3S35H 3ZTJG 1AD0B 5CEZH 2VZTA 5E08H 1JZ8A 4NKIL 3AY4A 4XPAH 5GIRB 2X4RB 3MLUH 1GVIA 1S78D 2J8UF 4JFZH 3IRPX 4TVPE 1B0GA 2D7PA 3EYQC 3OKMB 4ODHL 4Y4FC 3T0EB 1FVEB 1RJLA 3FFCD 3GK8L 4LKXB 5F7KC 3QDAA 1NJ9B 3VRLE 1MFEL 2YOCA 4HJJH 2ADGB 1UVQB 4JY6B 5F1OB 2BXZA 5CIPB 1KLUB 2VXQH 5FO8A 3LQZB 3NCJH 4EI5B 4MAUL 1AO7B 1P2CA 4K9EH 3IF1A 4JO2L 1VHPA 3L3GA 4LEOB 3EGSA 5E5RB 3SE8H 5FK9B 2Y06L 3X11B 4LU5L 3D85D 4GAYB 4Y5YC 4XH2B 1ZWIB 4XBPA 5E8OA 1Z3GH 1NAKH 4MLIA 4FA8A 5EO9A 5D7LE 3QUXD 3IETB 2GSIB 5E7FA 4ZAKC 5I8CA 5HGAA 3TVMB 4YWGH 1JF1B 5DVNA 2BERA 4N5UA 3BAEH 1X4ZA 5EUKA 5BV7H 4LVNB 4P9HC 3CUPB 2E9WA 4UINL 4AMKH 4FXKB 4JZNB 2ITDA 3U4AA 5GRUL 5IMLA 1QRND 4PJ8B 5DD1L 3RBGA 3PGDA 1E6OL 4JREB 1IC1A 4L5FL 1F4WL 5GZNC 5DJZA 5D7JB 3BMVA 1E4KA 4KGLA 4OT1L 4LOUD 2QR0B 4YHPA 2XA8H 5DZNA 3QSKB 4NBXB 3H9SA 1RQ5A 3ARBA 4TSCL 4OZGA 4U1NA 3B9KB 4RCAA 1UEYA 3TJEL 1JYWA 2DLIA 3KYNA 1AC0A 4PV8A 4OCXL 5JDSB 1ZMYA 4JR9H 2AJUL 4Y19E 5E8DH 1WCQA 4F3FA 3AM8A 3FCTB 3SQOL 4F7MA 4NWTH 4ZDHA 3EW3B 1F2XK 4N0YL 1MI5B 1BFTA 1UWGH 3VXUB 3KPSA 2ORBH 3VGDA 3O11A 1TVHB 1J05A 4HUNB 4PJGE 2C3XA 1N2RA 4HS3A 4ONGH 4X6EB 3ZYOA 2F9BT 4L3EB 1HHJA 4Z95L 4GKOA 4QEGA 4QYOB 4YXKL 1AD9B 4XXCA 3EHBC 3IJYA 4HT1L 2AV7A 3S5LG 1HWHB 3GMRA 3DXAA 1YEKH 1OM3H 4GRLB 1P9MA 3ARPA 3GNML 3H0TA 3ILPB 2IPKA 4JFPB 4Z7UA 5LGJA 1M71A 1E4WH 5GRXG 3Q0HA 1DEEB 4OCNC 5EBWB 4KQ4H 2DQFB 3MA9L 1MIML 1MJ7H 3HS0A 4G7YH 3EZ8A 2KKQA 4BFEA 4UDTB 1HDMB 2XKNB 3GSWA 5CMAB 4ELMA 1CZ8L 5T1KB 2XKSA 5F7EH 4TRPL 1MREL 4HIXH 4LK4A 1DN0B 1R3IH 5F6IC 5GJSL 3LHPL 5B8CB 4PJDA 5IR1B 4U1JB 1UB6A 1MCHA 5CD5C 1HQ4A 1NL0H 2XTJD 1RFDL 2APWA 2C3VA 4OD2B 4AK1A 5I1GL 1MCKA 3RGHA 5I1DB 2R2EB 1KB5B 1Z9OA 3SJVE 2CDGA 3HPLB 3T2NH 1VFAA 1G9NH 1RHFA 4PV9A 3RWFB 4FG6D 3VG0H 2D2OA 3GSNH 4KY1H 2X4QB 3ROOB 4G80A 4XVTL 1X4XA 1JGEB 4KTYA 1YEHH 4JFEB 3UJIH 2GTWB 4S1SH 3OB0H 1YQVH 4F9PA 3NCCB 1C5CL 4WW2B 2Q6WB 1M7IA 1FH5H 1MUJA 3CFCL 2GT9A 5FUCE 4JHZA 3X13A 2WMPA 1EXUA 4QRTB 4F7TB 4M8QB 5D1XA 2GI7A 1LDSA 3P4MB 4G42A 4NQXB 1TQCC 2A73A 4NZUH 3LS4L 3OKKB 1QFUL 3VA2C 3WBDA 3HZMA 2AK4D 1CE6B 1QBLH 5EDXA 3NFPB 1F6AA 1I9IL 4K23L 5ISZD 1KTDA 5HYSA 3WN5A 4R90L 1OAYH 1FAIH 4HPYL 1VFBA 1PEWA 3OJDB 1JHTB 3MRMB 5L2JB 2FB4L 4PUBH 2BNQE 3ARZA 2OK0L 2EIZB 1KJ2B 4LLAA 2WM0A 4UILH 3BZFB 3OG4B 1AGDA 3NPZB 1WBXA