4R8WH

Crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKTSGYSFSTYGVSWVRQAPGQGPEWVGWISAYTGITDYAQKFQGRVTLTTDATTATAFLDLRSLRPDDTATYFCARDKVQGRVEVGSGGRHDYWGQGTLVIVSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title A potent broad-spectrum protective human monoclonal antibody crosslinking two haemagglutinin monomers of influenza A virus
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9))
total genus 28
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r8wH00
4FQPA 1JYXA 1P9MA 2CDEB 2EO9A 1AY1H 5ID1B 3MREB 4G6KL 4POZC 5CJOL 5ACZA 2Y7QA 4RNRA 1N7MH 4K23L 4YDVB 1WAAF 1TVHA 1KJVB 4PJEF 1T5XA 4DZ8B 1I7TA 3SDXA 4XHQA 5F72S 1L7TL 4H8WL 5I2IA 4OCSH 3DBXA 1EXUB 1W72A 2BVYA 4OFYA 5E9DB 3V0AC 2CIKA 1KJ3L 5HHNB 4X5WA 4X5LA 1ZA6B 3SE9H 1CDCA 1FL5A 2Z92B 1OW0A 3BWAA 3S4SG 5GS0H 4TPRH 4YX2H 4X99B 3MRQA 1F02I 4MSWA 5DRNB 1Q9KB 2H2SC 2CO7B 3BKJH 4YPGB 5CIPH 1T7WA 5BXFB 2GW5A 4KJYB 3QPQC 1W8NA 1SEQL 1UZ8B 4NZJA 2GIYA 3GMNA 4UTBH 5JR1H 4XZUA 2WNGA 1ZLUK 5BOZG 2NR6C 4NQDA 4WU5B 3BKYL 3OKMA 4PY7B 4J3VA 3DXAD 1NEUA 4OCMC 3B8SA 1JRHL 3EOTH 5KVFH 1M4KA 4JFDA 4NNXB 2PTVA 1HSAB 4PIRF 1LVEA 3S35H 3TVMB 5KW9H 2FJGB 1J1PL 3NMEA 4L8BB 3BMVA 2Y23A 3ULUC 4ZXBD 4YDKH 2EDJA 3MRRA 4RMRA 2IFFL 3LKRA 3OKNA 5GSVA 4K7PL 4S2SA 4OLVL 2HVKA 3MV7D 4XPAL 4CU7A 2NY6D 2GTZA 3VCLB 3BD3A 1FG9C 2WBWB 1VFBB 4LEXL 1G9EA 1Q1JH 3VW3L 5HJ3B 4MXWL 3C8DA 5GGVL 4F7PA 5IMOB 2NY7L 2HTKC 4OD3L 1TXKA 4HWNA 4ZUVB 4FQIH 1NJ9A 2CDEA 5ID1A 3MREA 3DYOA 3MLUL 5F93C 3VMNA 1KN4L 1O7SA 4PJ8C 4X80H 4E9LA 3CFBA 2UUDK 2E7LC 3RFZC 4PTUA 5TJWK 1NEZG 5BS0A 3D0VA 1SJHB 2IC2A 1RZFH 4JM2D 1CLZH 5HHNA 5DURD 3QG7H 1Z9SA 2JIXB 1ZA6A 2R69H 3GKWH 2Z92A 2Q6WA 4N8CH 3IDXH 5B21A 2YK1H 4F58L 2BSTB 5DRNA 1PZ5A 3CCHB 1Q9KA 1L0XA 4FFVD 2VZSA 4H88L 4DFIA 2XKNB 3IDYB 4KJYA 3PWJA 1UM6H 5J1TC 5ESAB 1UZ8A 15C8L 1JNLL 4PB9L 1LNUB 4N0FA 3OGCA 3HB3D 4YR6B 5BJTB 3L5IA 1BF2A 2CXGA 1N26A 3OXSB 4ELKB 4L9LC 4NNXA 2AJVH 1HSAA 3TVMA 2FJGA 4Q9RL 1FZOB 3RUGB 4WHTB 4L8BA 4KZEH 3OG6B 3U2SA 2B1AL 2J4WL 4KKAD 2ITDA 2VZ3A 3RL1A 5EPMB 1MRCL 4PRDA 1OAXH 2YBRB 3C2SA 3SJVD 2YSSA 3VCLA 3RWHB 1D3CA 2DF3A 3QDMB 4OLUH 4LLQA 5HJ3A 1K6QH 1SBBA 3S3PA 1G9MC 4W6WB 4F7CB 1V3JA 4K94L 3S88H 2YD6A 3W5NA 4JO4L 2DQHL 4G6AD 1IAIM 4ZUVA 4XCCL 2XICA 4NKMB 5DC9B 3HR5B 4J3OC 4OF5A 3DSNA 5CILH 5E8EA 3WFCH 1EJOL 4Z7VE 4HKZA 2Y36H 2ORBL 3QEQA 2I5YH 1KCLA 3QO1A 5F88B 5L88H 4Z78B 2Q8BH 3VRIB 1T89A 2AI0L 5B39B 4X83A 2JCCB 5E99L 1DJSA 1I3VA 5GRZA 1LO3H 3ZKXB 1AE6H 1WCQA 4Q58C 2MMXA 3SDAD 5C71A 2EXWD 2VQUA 5K9KB 4HIJA 2JIXA 1MCOL 2OL3H 2AJXH 2W9DH 1QEWA 2NY3B 4EUPB 5K9QG 1NDGB 1WLHA 4NM8H 2LU4A 2BSTA 5F21B 2VLKB 5ADPL 2BNUB 3I6KA 3KVQA 4R97C 1QKZL 2FD6L 5GGTL 1KEGH 2XKNA 1A6UL 3VXUD 1NL0L 3F7YA 3SE3C 3X13B 2XXCB 1JBJA 5ESAA 1JMXA 1KEML 2AEIT 4U6VL 4G8IA 4E5XB 3S36X 1TZIA 4U1SA 4YXKL 3RVVD 4JKMA 1FFRA 4WV1B 4J3UA 4F9PC 2WWMD 2XQYG 5LWYH 3BWUC 4OLEA 3RUGA 1FBIL 3BSZL 3D9AH 1T1ZB 4Q2ZB 1U3HB 4NN5B 2OR7A 1QO3B 4HH8A 3UTSD 3ZE0F 4QCIB 2CKBH 2YBRA 2J8HA 3RWHA 3QDMA 3LQZB 4JKWA 1BQHG 5F1SA 1CF8L 1QBML 4PB0H 1UJTA 4KC3B 4BQ8A 1G7QA 1WSST 1KB5L 2HT3D 2ZSWA 5DMKB 4JGUA 3GIZL 4F7CA 2DQUH 3H9SE 1M7DA 1A6WL 1CE6A 4MNHB 1T5WB 3C6SB 4NKDB 4NKMA 5KTEL 3F65A 3QFJA 4Y1AB 1KB9J 3LMJL 4ODBD 4UBDC 4OLXH 4UQ2B 4W4NA 5E1AB 2BVQB 2GITB 1SYVB 5SWSB 1ZLVH 3TFKC 3MBXH 3V5DB 5F88A 5T3ZL 1W72L 3RVWD 5D1ZB 5CUSL 3WFHB 4M7LT 4PBVC 3NA9H 4TUJB 3R1GL 5B39A 2HLFC 3CMGA 3CLEL 2B4CH 2JCCA 1NCCH 4NO0B 1FV1B 1MCEA 1I9IH 3WIIL 5E7BA 4PJDB 5K9KA 1JP5A 1IC7H 3IJYB 4P9MH 4EUPA 4JVPA 3DYPA 3LVEA 4ODXB 4AEFA 1PAMA 4AENB 1X44A 1NDGA 1QRNB 2NY2D 3QWRD 4E41A 5JOPE 2VLKA 4HUUB 2BNUA 5EU7E 2G5BB 1VDGA 1JWUA 4Y2DB 4NYLB 5IF0A 1VEMA 3X13A 1FNSL 4HMDA 5CEYA 4XNQB 4HUWB 4R6UA 4OZFB 1ZHNB 4E5XA 2Z8SA 4TSAH 4NZTH 4XVUC 1A6ZB 4PJGF 1LWRA 2NTSP 4ZTPL 1MFCL 1GGBH 3PL6D 5HHMB 1I85A 4F33B 1A1NA 4WV1A 3I50L 3LD8C 1NGPL 2GJZB 2RAMA 1CQKA 5CSGA 5FECB 3NA4A 1RV6X 4LGSB 2WV3A 1T1ZA 4HFUH 4Q6YA 4Q2ZA 2NXZB 1F90H 1U3HA 3HE6D 1QO3A 3WFBH 3JZ7A 4UT9H 1CD1B 3O3DA 2VISB 4QCIA 3RP1A 3OHXA 3O2WH 2R0ZL 4BJLA 3LQZA 3MXVH 2QBWA 5DJDA 3VFWB 4RGOL 2YWZA 1U41A 1CFSB 3C08L 5DMKA 4P3WA 4XNUH 4QWWC 4JFYB 4IS6B 4MNHA 1P7QD 3GMPB 4LHUA 4NKDA 3MNZA 3UPRB 1FHGA 3ZTNH 4WEBL 3QQ4B 2BNQA 3WLBB 1BAFH 3QQ3A 4Y1AA 1J9CT 5E1AA 2BVQA 2OZ4H 1JHKL 2IH1B 2B1HH 2X89D 3WFHA 2AXJA 3VG9C 4TUJA 3QZWA 3D2UB 2A6IA 1UWEH 1FV1A 1JGLL 1AHWA 5C0RL 4L8CB 4LSSL 3P77B 5MEQA 1ODAA 3WEXB 4LSRH 2FBJL 3INUL 3V2AR 4D0DA 4FQXB 4GLRH 5IR1A 5KVDH 1PY4A 4Z8FH 4W81A 1RUPH 1F6AB 4V1DE 5T3XH 5SX4H 1BIIB 4PJDF 4Y5VA 1WFNA 3X3FH 1MSPA 1MOEA 3RWGA 4PUBL 3LRHA 4X6FB 5FYKE 2G5BA 3THMH 4Y2DA 2Z31D 3FKUS 3L3DB 4MJ4A 3TO2A 3LN9A 4NYLA 4KY1H 3BPLC 1RJLB 2PYEB 4HJJH 5KSAC 3W5MA 5J57B 5DD5L 4PFEA 5D7SH 1FNLA 4HUWA 1UKQA 4RWYH 1SM3L 3PDDA 1ZHNA 3BQUB 1G7LB 4ZS6C 3NH7L 1A6ZA 5SWZB 1NGQH 4YHIB 2RCSH 3GI9H 4JZNB 3AMLA 5T33L 5DMGD 4F33A 4JFOA 5JW3H 3DX7B 4Z7NF 1LO0H 2GJZA 4I1NB 5FECA 4U1GC 1MAJA 4QRUB 2IH3B 4QOKE 3VRJB 3RIFK 2DL2A 3CXHJ 3A67L 3FOMB 4JG0L 3ZL4L 2VISA 5DWUL 3CC5B 5DGRA 5GRWA 7FABL 4X9IA 4FQ2H 2R0WL 3ULUE 3VFWA 4O2EB 5GRVL 3GM8A 5DO2C 3UJTL 4NJAL 1N0LA 3JTSB 1CFSA 4O02H 4U6HB 1X4YA 2JB5H 1NDMB 4OT1L 5IFJB 4EZMA 4JFYA 1HE7A 2ZSVA 3KYKH 3GMPA 1R5WB 3U0WH 1YEJL 3UPRA 3QQ4A 1YYMH 3I3EA 4AIZB 4WO4D 1ZLWH 1WVZA 2DQIH 4EXKA 2IH1A 2M26A 1JGDB 5EO0B 3BP6B 3BMWA 1RK1B 3G6JE 3MRKB 1MHCB 5ITFA 3D2UA 1BZQK 5JORA 4L8CA 1G0YR 2A74B 5EZOL 4P5MA 4YDLB 3RZCC 2IALA 3D87B 4FQXA 1OARH 5MEPB 1F6AA 2AJZB 3DXAB 4HBQA 3MOAL 4NOBA 1BIIA 1KCVL 2A6KB 1PYWB 2XZQH 3O6ML 1DBKL 4F7TA 3GHEH 2XA8H 4HS3B 4X6FA 3IRZA 4ZXBB 3JV0A 1I3RB 3L3DA 3MLYL 1RJLA 2PYEA 5IUSA 3U9PH 3RL2B 3QXVA 3MV7B 2NY6B 4K7PX 5I1CH 2VQTA 4KVNL 1J11A 3BZDA 5DTFB 4YAQB 3KR3L 1OY3B 1S9VB 2DQGH 1G7LA 5D72H 2AJYL 4DGVH 4AIXA 4HIEB 1CZ8H 5A2KH 2FBOJ 2IPUG 4PJFA 2EH8H 5CEZH 5HVFB 4XVTH 3JWOH 1HWGB 3DX7A 4NWUL 5D6CB 3KYOB 1HYRC 3MRLB 1CVSC 4EIGB 3ZYZA 3VRJA 5E2VH 3IU4H 2KKQA 1I9RL 1IC5L 3ARBD 3FOMA 4N8VB 1MCNA 5DGQA 5FCUH 5C0ND 3CC5A 4FG6D 5ALBL 3NTCL 3FAXA 4OAWA 1HWHB 5K9OB 4KJWC 1JL8A 2FGWH 4XHJD 4PJXE 4RISL 1SJEB 2CLZA 4FTVB 5I75B 3FRPG 4LU5H 4JM2B 3QRGL 3HC0B 3JTSA 4GRLD 4IIQB 2WBJD 3EKCA 2MQCA 2WUBL 4JQXC 5DURB 1NDMA 5TE7L 3TC9A 5IFJA 2I26N 3QISA 4NSKA 1R5WA 3C9NA 5JPMB 3LS5H 4FMFA 2EZ0C 4MA3B 5ECJE 5EBLB 3PWLA 2I60H 2CK0L 2GFBB 5IEKB 4HUMB 5ADOL 5F7EH 3DUUB 1FLTX 4EDXA 2HJLB 2CQVA 1OVZA 3BP6A 5EOCL 3SE8L 1EA9C 1RK1A 3JVGA 2FJHB 5GRJL 3MRKA 4NM4L 1MHCA 2IANE 3VXNB 1P69B 5BVPL 4Y4FD 4ODTL 4YHOH 4DFHA 1Y18B 2YMXL 5D5MB 1TLKA 4LKXB 5DMIL 1NGXB 2B5IC 5MEPA 2AJZA 3O4OB 3RAJL 2C1PB 2NTFB 3GSRB 2A6KA 1PYWA 2J8UE 3K1DA 3MV9E 4HJ0D 2GJJA 3EIFA 1IE5A 1FYHB 4ZMAT 4NZUH 4RFEB 1YYLL 2LTQC 1JPFB 4HS3A 1R3IH 1I3RA 4LSDA 1M6OB 3B5GA 1HINH 3VXOB 4TVSa 2DI7A 3DV4B 4KI5C 3MV7A 3SJVB 4K9EH 4S1DC 1AJ7L 5DTFA 4RGMB 1ONQB 4BYHA 12E8L 1BQSA 2ICCA 4GUPB 5IBLD 3SOBL 1NCBL 5CFHA 4HIEA 3ZHDA 1A6TB 3H9SD 3AGVA 3EYOB 3WHXB 4F9LC 1EFXD 5FUOH 5D6CA 2XZAH 1BBDH 3KYOA 4TRPL 1JZ4A 3ET9F 3I6LE 3S36H 3U36A 5FUZH 3IGAB 3GI8L 1E6JL 3RWIB 4X6EB 2JB6A 1PQZA 1F11B 3NZHL 1A3LH 3GJEB 3CJJA 4FTVA 4JM2A 4OLYH 3HC0A 4IIQA 3SDAB 3MMEB 4FQJH 2OJZL 4M1DH 2YOCA 1HXYB 1TZGL 2CDFB 4N5UA 4X7SH 1CCZA 1AC0A 4XCFL 4HD9A 3Q48A 4OJFL 4X8XA 1F4WL 1TZHA 1KT2A 2GYSA 5J56B 4ZSOE 2YA0A 5JPMA 4GS7B 5E5RB 4OZ4B 4LCIL 4XCYB 2GFBA 4M62L 5IEKA 5JOPD 4JDTL 3DUUA 2HJLA 1QLEL 3VXUB 3VXNA 5I8CB 1W0YT 3MROB 1GAFH 1JTOA 3EOYG 3RGVA 4ZAKD 5FV1L 1Y18A 1D5MB 1BBJA 4FQHA 2GJ6E 2C1PA 1E4KA 2NTFA 5GGRB 3GSRA 1P5VA 5D5MF 3H7BB 3KJ4C 4O51B 1V8HA 2W9LA 3AROA 3P4OB 5MEOA 3MOQA 3NABH 1M6OA 3VXOA 5EU3A 2DKUA 3UTSB 3O45B 3SJVA 1RZJH 3EDFA 2VDOH 2J8OA 1ONQA 2X7LB 4JB9L 4PJBA 2G60L 4HS8L 3DSFL 3GSQB 3T8XB 2X4OB 1UWXH 1KLUA 2FDBP 1A6TA 4BFIB 4LLUB 4DOHE 3EYOA 3WHXA 2DQEL 5J7CC 3IETB 1DSFL 1INEL 5GJTL 4BFGA 1CLYH 1YUHB 1CFQB 3HZKA 1FPTH 4YFLI 3KYMB 1U8OB 3IGAA 1YEGH 5KS9E 4X6EA 4Z0XB 5AYQA 1MQKL 4ODHH 3B3IA 1JNHA 5FHAH 4M7KL 1A9BB 4YHLL 3ZMRA 3B9KB 1EDQA 3U79A 3MMEA 4HLZH 3HAEH 3WFDL 1HXYA 1XF5B 3LS4H 1Z3GL 1RUQL 1JTPA 4PJCF 4MQSB 5F9AC 1KPVB 1WBYB 4DK3A 1ZGLP 3RIAK 4V1DD 2NY2B 1RIVH 1NFDE 3K3QA 3KG5A 4TSCH 5FYKD 2YEZB 1S7QA 5IJKC 3ZE1E 1AGBB 2DWDB 1PZUB 3MV11 2YKLH 3V6OC 3L3JA 3ARGC 3T1FA 3MROA 2H2SD 1I4FA 3GFUA 1MLBA 4AQOA 1NLDH 3FQRA 1GXEA 5I1KL 3QPQD 3PL6B 5GGRA 1NUDA 3H7BA 1M7XA 1FRGL 5D96B 2NR6D 2VDML 3WIHH 3TCLA 4QOKD 3HE6B 3UTQB 5I73B 3P40A 1LEKA 4OCYH 3O45A 4NGHL 4GG6A 4UZGA 2EYSB 4JFHE 2Y07H 3O6LH 4PPTA 3ULUD 1ZSDB 2HJFB 3GSQA 3T8XA 2VXSH 3HTLX 3VXRE 1I1CA 4BFIA 4DZBB 2C3VA 1P7QB 5DEFA 3ARFD 3IETA 4TTGA 5HHVH 2WZPD 2H3NA 2PXYC 1E4JA 3AS1A 3KYMA 5GS3A 2QQKH 3N85H 3HC3L 1C08B 4FQ1L 4HH9B 5KVGL 1CT8B 5DYOB 1HH6A 5JMOC 3HI1A 4XBGA 1A9BA 4NC0B 4P9HC 4G8FB 4M48H 1RQ5A 1X4XA 3B9KA 3OMZA 5A40E 4F15B 4PJ8D 2R1WA 4NN7C 1P7HL 2PO6C 4Y16C 1XF5A 3GO1L 4XPHL 1PLGH 4X6CE 4DJMA 4Z95H 3ZDZF 1GC1L 1KPVA 4N9GA 4P57B 2D03H 4XP5H 5DUPH 4GKZA 3WIFB 1JCKA 4KJPC 1FYTE 3QWRA 5DHXB 4Z77B 4Q74A 4RIRA 1Z9LA 1XF1A 1NBZB 3FO2A 5H2BB 1B2WL 1SY6H 2H32B 2YEZA 3DRTA 2Z31B 4KUCD 5CJXC 2VTFA 3BAEL 4JY5L 3TEUA 5L8JB 1BREA 4ODWB 3D25B 4HKBA 3TWCL 6FABL 3C60C 4RFNB 4MZ2A 5F7YC 2NXYC 5TQ2L 3KPSE 2CK2A 4WU7A 4LVHB 3KLSA 3WHE1 3O4LE 3PL6A 1CE1L 3IF1B 2VZ1A 3TYGL 3EDEA 4U49A 2FX9L 2HRPH 1G0DA 1A9EB 3O0RL 4UT6H 4DK6A 4RX4A 5FHBL 4HF5H 1XZ0B 4KPHH 3HE6A 4CMHC 3O6KL 3UTQA 5DJ0A 1UQSB 3ECBA 3S4SB 3HRZB 5I66B 3PHSA 4NUGL 3TO4C 3W9EB 1KFAH 2EYSA 3BT2H 1ZSDA 4NWTL 2A0LC 2HJFA 1QSZA 4NIKB 4PREB 4GH7B 1CWVA 4NRXB 3DWTA 2W60B 4DZBA 1H3WM 2C4FT 4F80A 3QDGE 1WICA 3VDAA 1PBYA 1HYSC 4WO4B 1WFOA 4AQ1B 5J1AA 3ARXA 5CSBA 4CDHA 5F6IB 1U58B 4WW2C 1QVOB 3PDGA 1QYGH 1MFEH 1C08A 4HH9A 4Y5XB 2X89A 2DIBA 1X5ZA 4KQ3L 4H1LG 4KROC 2HN7B 1WITA 1KTRL 2F74A 2BDNH 4G8FA 2IAND 4OZGE 4NFCA 2VAAB 1N5AA 3TBSB 2NY5L 3FQTB 4L9DA 1GGCH 3BEWB 2ATPB 3PQYA 4XP6H 4XMPH 3WIFA 1U42A 5TDNB 3MV9D 4XX1G 1XT5A 3KYAA 4DKFL 5ETUB 5H2BA 2YD7A 1UM4H 3CVHB 2CJUL 2H32A 2JJSA 5JPNB 2Z31A 5GS0D 4Y19E 4BELD 5I1DA 1FSKC 2AK1H 3DI2B 4ODWA 5E8OB 5CMAB 1JRHI 5CP3H 5F89B 3AM8C 1DN0B 2ERJC 2KQMA 2MCPL 5K59F 5FOBA 2G2RB 3BZFB 4EI5A 1J8HE 3FB8B 1CK0L 2IPKB 3RVUD 3K2UH 5D7JA 3AY4A 5HY9A 4PGBA 3A6CL 5TE6L 4RMSA 1A9EA 3EBAA 3PUCA 3FN0H 4AEIL 3I6LD 3ARBB 5HD8C 3S4SA 4YXLH 5DMYA 3ARUA 1RZGA 5C0JB 4Q0XH 5I66A 4UIKH 3W9EA 3EYQC 3LKNB 1C7SA 2W0FA 25C8L 1U6AL 3O9WA 1S9KC 2EDEA 3RRQA 3ESUF 3EHBC 1F42A 4GRLB 4DUVA 2WBJB 4KI5E 4NRXA 1U2HA 2W60A 3UPAA 3RTQC 3D3VE 4DAGL 2R0LL 4I0PD 5DJXA 1I3UA 5E8PB 1W2KT 4L8SB 1MLCA 4WO4A 2O5YH 1U58A 2IBZY 3HNSH 1OAQH 4PJHF 3GSNB 4OQTH 5I1JL 4GXVL 4XX1E 3TV3H 2YD9A 1EEYA 2AV7B 4CNIB 2WSKA 1UH2A 4ELMF 4I18A 4Y4FB 3TBSA 3SGKA 4U6XA 3FQTA 4HWBA 3TFKD 4N0UA 2VJXA 4AJ0A 1FNFA 1YC8A 3Q6FA 2BX5A 2FO4B 2GJ6D 4H8WC 4X9BA 2HLFD 1CICA 3U4BH 3CZFB 3HS0B 3QUZC 1EBPA 4NP4H 1DUZB 3VGDA 5JPNA 4GXUM 4E42A 2X42A 2DRUA 4QTHB 5TPWH 3TZVC 3E3QE 3BPOB 3CVIH 3HNTH 5C1MB 1LDPH 3LB6C 5E8OA 1LGVA 5CMAA 1IGML 1K5NB 2DBLH 1J18A 5LXGL 1FP5A 1TFHA 2XN9E 5FUCC 3NCBB 3VDCA 4XNZC 4TVPH 3QR2A 3CFCH 4BQBA 5KSBE 4FFZL 2G2RA 1XF4A 3BZFA 2KBGA 3H9SB 3FB8A 4ONGH 3TBYB 3TJEL 2IPKA 1EFXB 3NCEB 2WWKO 1DEEB 1F6LL 3JWDC 2WQ8A 3TT1H 5GS2H 4EXPX 1N0XL 2X4QB 4XVUD 4S1SL 3ARBA 1SBSL 5KSVB 2M8XA 4HCRH 5GRVK 4UAOB 4EKXA 4Z7VF 3LKNA 3MRFA 2EDKA 2OTWB 2XIDA 3NCMA 3O3EB 4L3CB 4GRLA 2QSCH 4TYUA 1DQML 3DGCR 1H8NA 4XWOC 1IKNC 2ZUUA 5TE4L 4ENED 4Y5YC 2FR4A 4NC2B 1SQ2N 3TPUA 1B9ZA 3TM6A 4X98A 3MLXH 5E8PA 5C0CE 5CEZE 3FO1A 5CZVL 5AYUH 3C2AL 2R2EB 3UC0H 4U33A 1H5BC 1K8IB 3GSNA 4QWWD 3IRPX 3V52L 2BHYA 1MCWM 1WTGT 4CNIA 4MLSA 2P5WE 1IEHA 1P4LB 1QFWI 2V2TB 43CAB 4LPYA 4Y4FA 4N5ED 3P9MB 4S10A 4ALAL 4ZAKB 2XKUA 4U6YB 3V6FA 4DUWA 4HZAA 5GISH 1MIEL 2OK0H 1JTTA 4S0SD 3H9HB 1PG7X 3HS0A 5BMFL 2ZCKL 1IM9A 2KZ1B 5ID0B 3E2HB 4WHDA 5E03A 1DUZA 3FT4A 1DZBA 3LQAH 3M45A 4UINH 5BO1H 2X4TA 4HKXB 4NO5B 2YC1B 1MCJA 3R0MA 2GTWB 4MAUH 1U92B 1K5NA 3VJ6A 3HMXA 1ZVSB 1ZHBB 1B88A 2F5AH 2O5ZH 1WTLA 4JFHD 1TNNA 1W8OA 2NZIA 5IGXL 1A7RH 5KSAD 1F13A 3C5ZD 5L2JB 4X9GA 4XB8A 3VXRD 1CDJA 3H9SA 1EFXA 3SBWC 1DEEA 1UCTA 4HV8B 5I8OL 3MCLH 5F9OL 3EDJA 3B2UD 5IESL 2DICA 3QEGL 1JWSB 4BFEA 5KSVA 1K8DB 4JKLA 1XCQA 3BUTA 3PWNB 4RSVA 2QJDA 2BCKB 2DMBA 4MAYC 2OTWA 3O3EA 4QKXB 4L3CA 2A9NL 4Z7UE 3UYRL 2MPAH 3CFEA 2D7TH 1LP9F 2XQBH 2BVEA 2J7LA 1FZMB 4HG4J 4V1DB 4ZFGL 3VFVB 1A7PH 1CR9H 5E94A 4UU9B 1MCPH 5DO2D 2Q86A 1U95B 2EYTB 1FYTD 4PGDA 5GGQL 4LLYB 3MRNB 1A6AB 3RPIA 4OV5B 1K8IA 4K94C 5JOFB 3WV0A 1C5CH 1T0MB 3UBXI 3HE7A 3N1PC 5C09A 2D7MA 3RWEB 4EI6B 3O8XC 1P4LA 2DLIA 43CAA 1U8PB 3FAWA 5DI8A 5EOCJ 2D0HA 1JUFA 3P9MA 4OCXL 3MRHB 1MY5A 4ZAKA 3PP3H 3KPSD 4U6YA 5I19L 2F19L 4CRPA 1KENH 1DVFD 1BWWA 1B6UA 1JI2A 3H9HA 3MBEC 3HFMH 3O4LD 3IFOB 3OX8B 4B7IA 3OZ9H 5ID0A 4HPYL 2WMPA 2VDQH 5E2TL 5E70A 3RZCD 2OLDA 4BSJA 4IDLA 1XR8B 4QOKB 4BZ2H 1UVQB 4NO5A 2YC1A 4O9HL 4KKLC 4GMSL 3OQ3B 5ICZB 3GJFB 4U6TA 1EEUA 1B4JH 1A7NH 1ZVSA 5E8NB 3CMOH 1LE9A 5CWSB 4HLZG 3HAEG 4XVJL 4KTDH 4ONOA 1I9JH 5E2WL 2X4SB 5CHNB 2VUYA 4JFXB 1IJ9A 1AGFB 1MVUB 4Q6IB 2QHRH 3ARFB 3QDGD 2O5XH 4OB5L 5E6YA 4BKLA 1XCTB 2Z35B 2C4FU 4XNXL 3W2DH 1JWSA 4OD1L 3MRPB 1K8DA 4Z76B 4AL8L 2Y1VA 3GMRB 2BCKA 3UDWA 3G6JB 4FNLL 1ZLUH 1X3DA 4PJ8B 1UWGH 4PP2B 2H26A 2FHBA 3IS0X 3KPQB 2K9UA 2VLJA 5T1LD 5D9SA 5MP6L 1OAUL 2ENYA 5IHZB 2AJUL 1FZMA 3L3IB 2CLRB 2WK2A 4V1DA 2NNAB 5T5FH 3VFVA 5EU5B 3RHWF 2EYTA 4XC3H 2BVOB 1M7IB 2EDWA 3MRNA 1P9MC 5D7IE 5DQDL 3VFNA 4OV5A 1JIBA 2FIKB 1JNNH 5F7MC 1T0MA 2FNBA 4HWBL 4Y19D 2ZOLB 4G5ZL 2Y9RT 3RWEA 4EI6A 2NY1D 4M6NL 2HKFH 3VXPA 1A7BA 1OAZL 1FVCB 4NNYA 3MRHA 2D9CA 3ZT6A 4A6YB 4M7ZB 3KAAA 3OAZK 1QSEE 4PYHA 4G42B 5E5UB 5HVHB 3CVHL 4PRHE 5J3HC 1J8HD 4KKCC 2DKSA 1XR9B 3H8NA 1OW0C 1F3DJ 4I4WB 4DQOL 4JR9L 2QQNH 3K7UA 2UUDH 5F70A 1XR8A 3G5YB 3IDGA 4R4ND 1P4IH 4QOKA 1UVQA 1CBVL 1YEEL 4MD5A 3IDJA 4GJTB 4O5LH 5ICZA 3KPLB 1TVDA 3GJFA 4I3SL 1IQDA 2EEDA 2EECA 5E8NA 3RVTD 4BSWB 3P11H 4PJGA 5CJBA 4PJXB 3PWPE 1Y0LA 3GNMH 5DA0B 4LARL 4KI5D 3CDGB 5CHNA 1QR1B 5H37G 3ULUF 2GEEA 4R8WL 1MVUA 4XMKL 4Q6IA 4S1DD 2J6EA 3HUJF 3D3VD 3ARFA 3VD7A 3H0TB 3U0PB 1XCTA 2D7OA 4ZOEA 2CMRL 2Z35A 4NC1E 5TFSL 1X5JA 1BM3L 3MODL 4OKDA 2Y72A 2ED8A 4WHYG 2OR8A 1UCBL 3GMRA 1KF9B 2B7DT 1FNGB 3OJDA 2IANB 5IHUL 3KJ6H 4HS6B 5C08A 3KPQA 2ZUVA 3G6JF 4NN6C 5GRUL 1YPZF 5IHZA 3L3IA 4PJIE 3GSNL 3VH8G 1INDL 2NNAA 4D9LH 4YEFA 5EU5A 3MV9B 2B39A 2J8UB 4K2UL 3N50A 2BVOA 5E2JA 1M7IA 1YJDL 4KUZL 4NQSB 2FIKA 3KPTA 3ULVH 1RU9H 3WNPA 2YPVL 1MAMH 3WDHA 2WLYA 4WCYH 5AG9A 4TNVF 4UIMB 3KPMB 1UH3A 1JHLH 3T0WA 1NBVH 3A0OA 5HGHA 1B0RB 1T80A 5CIPB 5DVMA 3K8KA 4KGJA 1FVCA 4WY7H 1OCWL 1LO4H 5GHWL 3HI6L 2XN9D 4XBEH 5DJ6B 1X5LA 4BH8A 3RWJB 4G42A 1S8DA 3DHMA 3ZDXE 1RIHH 3MCKA 4JM4L 5CGYD 5TDPA 3OB0H 3WUWG 1D5BB 1IVLA 3CLFH 4PTTA 1XR9A 4JPKL 4KAQH 3GB7B 2YUWA 2OM5A 1HI6B 4I4WA 4JREB 4JPIB 2EDNA 3HMXL 4UV7L 2RGSA 3ZYOA 4KRPD 2FL5B 4LSQH 1MFBL 1EUUA 1H3GA 1E6OL 3MA9L 3UTTA 5DFVC 2CUHA 3C8HA 4PJXA 5KOVC 2HT2D 2OMBA 3CIQA 5FV2A 1UXWB 2DKMA 3CDGA 5L6YL 2EKSB 1MFAH 3QQNA 4OIIL 4KWUA 4RQQA 1YC7A 3LKPA 4K3DL 3A6BH 4P5KA 2E27L 4M43L 4I0PB 5D70L 1F97A 5ANME 3H0TA 3UAJD 4P4KD 3KHOA 5C0CD 4ZSOB 5CEZD 3U0PA 3TVMC 4OCWH 5KVMC 3GSVB 5INDB 4OLZL 1IGFH 3S5LG 5CJ5A 2HT4C 4YHKL 3QG6B 1IGJB 5FM5O 2HTLC 2P5WD 2IANA 1T1XB 4GAJL 2FEDD 4JO2H 3FFDB 1WIUA 3BKMH 3ILQD 2DQJH 2GJ6B 3TNNA 1SMOA 3IDUA 5MI0B 3IXTB 4M8QB 3WO4C 4TUOB 3GMLA 3C87A 2X4PA 3CD4A 5JHLL 1S7SB 2E6JA 4NQSA 3VD9A 3STBA 1Q0YL 2NW2B 4KMTL 2J8UF 2L4OA 4UIMA 5LBSH 1F4YH 3S8WA 2HLAB 3BN3B 2HJKB 1IEAB 1T89C 3QEHB 4KFZC 2E3VA 2J2ZA 2P49B 4X7TA 3QXWA 3X11B 2QADC 5BRZD 3S96B 1FFPB 1DUYB 5DJ6A 5I76B 4XMLL 2V7NA 5EO9B 3RWJA 3FZUC 2ID5A 1MFDH 2VIRA 4NQEA 3ARGD 4QRSA 4DOHB 5C7XH 2IQ9L 3BDYH 1ULVA 2BY3A 3GB7A 3QP3A 2APTA 1HI6A 3FMGH 1FH5H 2W1NA 4JPIA 4S11A 1EZVY 1Q72L 1Z0NA 4JO1H 4UV4H 3T2NH 5B38G 5CKAA 4PJ5E 5KS9B 1TCMA 3MUGB 5DS8B 2VC2L 1PG7H 3IDYC 3MRCA 1TNMA 2D0GA 1TETL 2JJVA 1WCBB 5J6GA 4IRZH 3EFDL 1G0XA 1RZ7L 1UXWA 4N0YH 4AIOA 5FA4B 1ROWA 2EKSA 5F8RC 1RULL 1AR2A 4KK6D 2X1QA 4X6DB 2A6JA 2YUXA 4I0PA 2R1XB 4MXQC 2RIKA 2BZDA 1Z5LB 2NZ9C 2HKHH 3V4PH 1MFNA 4WI9A 2IG2L 1NFDB 5JHDE 5FIEA 1BVKB 4HXAL 1MCLA 3VA2C 1X5AA 5INDA 4DGIH 4A2LA 4QXUH 4LSPL 1N5YL 1IGJA 2VDPH 1Z6JT 4I48A 1VFAB 1T1XA 2AXFB 2R29H 1KCUL 2DL9A 1JPTL 2ZCLL 1QP1A 5SWQA 5CP7B 2L7UA 3IDMB 4LF3B 2GJ6A 5FYKL 1MJUL 4HQQL 5J12C 4LSVL 3UXFA 1KBGL 1R3KB 2AJSL 4L4TE 1MRDH 1J7VR 5H8DA 3IXTA 4M8QA 3SGEI 2OL3B 4NKOB 5C2BH 1RJYB 1YMHB 4Y16D 1CFNB 3PP4L 1OSPL 1WWWX 1S7SA 1YEFH 3PF2A 3QO0A 3REWA 2IADB 3K81A 3P30H 4P46D 4ZNCD 1ND0B 1IEAA 3FB5B 3QEHA 4F8TA 5BV7H 3W9DB 2OTUB 3F7VB 3S96A 5J0BA 1HIML 1DUYA 3ZKXC 2RFXB 3JV6B 3BPLB 5EO9A 5KSAB 2OBGA 4LAQH 3C5ZB 2DWEB 1JGEA 3EO0B 3VXRB 2F54E 1J0YA 3C60D 4LDLB 4EQ2A 2VXQH 5DR5L 2NY3C 3L3KB 2A83B 4ZO9A 4PBWD 4OBRA 4M1GH 1N6QH 4MDJB 4S0TD 3RWDA 1BQLH 3FB6B 4NOFA 2YD8A 3S34H 4EEEA 3FT2B 3ULUL 3OV6A 2H1PL 1CU4L 3TBWA 3NFNB 3RX5A 5KS9A 3MUGA 1XGTA 1J1OL 1U3ZA 4U1GB 3HHRB 1CIDA 1EMTL 4NCC1 4G8EA 2CKBB 3G9VA 5F1KC 3WKML 1GHFH 2YR3A 2SEBB 3L5XH 4JDZB 2F8OA 3EOAB 4X6CB 3QB7C 4M61A 4X6DA 4MA8L 4M3JA 1I85C 3MRJB 3I3DA 1Z5LA 3LIZL 4WV1C 4PD4J 2A0LD 2XZCH 5C07A 5FFLA 1FYTB 1ZHKB 1M05A 1BVKA 1A7QL 1U3HC 1A3RH 4NN5C 1FORL 2A1WL 1NFDF 3MV8E 3U7WH 1VFAA 3MRDB 1OAYH 1MUJA 1BZ9B 1LE5A 3KPSB 1HCVA 2VXTL 3MUJA 5CP7A 5JIHA 4ZFFB 4XT1C 2HG5A 3IDMA 4X9FA 1RHFA 4IJ3C 4RMTA 4LF3A 1DVFB 4KROD 5D1QD 1QSED 4UQ3A 3O4LB 4M7JH 3QXAB 4HUKB 4PRHD 4I9WE 2OL3A 1RJYA 1YMHA 1LD9B 3RZCB 3BISA 1CFNA 3NFSL 4R90H 5F1NB 3FRUB 3LH2L 3Q3GB 1MVFA 1RZIB 4A6YL 5JLZB 2ARWA 5HHOE 1AFVH 2VWEC 5FYJH 3FB5A 2CKNA 1FAIH 3OAUL 1T1YB 4Y4KD 1NAKL 4U1LA 4PV8B 3EO1A 5EFIB 4JG1H 1PEWA 3P4MB 1CQYA 4HIIB 2RFXA 2BFVL 1AHWC 3IT8D 3JV6A 2X05A 1J1XL 4RZCB 4L4VA 1DBML 3PWPD 3C5ZA 3EO0A 3VXRA 3SDXE 4JLRB 4R3SB 3L3KA 2A83A 3QDGB 3JV4B 1IT9H 4Y5VC 1I7ZB 4GQPH 5T3ZE 1IARB 1MI5E 3FB6A 1ADQL 4UDTA 1FGNL 1FDLH 3NFNA 4Y2DC 1MWAH 1AXTH 2D4FA 4PRIA 5E4EC 5AZEL 3HZYB 4OZGB 5HI3D 1LEIB 3IKCB 1J86A 3ZTJH 3HMWL 4P3CL 2AKRB 5T1LB 4JDZA 1OQOA 2YPLB 3MXWH 5BVJB 3EOAA 2DLHA 1G9ML 4X6CA 2FX8L 1DEDA 3WNNA 1AY1L 3MRJA 1YEHH 1KYOK 1JF1A 1N7ML 4NQDE 5KJRH 1WZLA 4ZPVB 2NXZC 4Y19B 4HEME 4JFDE 4QXGH 3IVKB 1ERNA 2ICES 1HZHL 2NY1B 4OCSL 3DUSB 2QQLH 4EBQH 1MCHA 4JHBA 3MRDA 4J6RH 2AEWA 4IOSD 3KPSA 1MNUH 4JDVB 1DVFA 2WWKT 3O4LA 5GS0L 3KPNA 3P9WB 1J8HB 3QXAA 4YX2L 4APQD 4OFKA 4ETQB 1LD9A 4F57H 3BKJL 1MCIA 1T20B 5F1NA 3FRUA 3CX5J 1P7KB 4XPFH 3EO9H 5DJCB 3Q3GA 2B5IB 1QUNA 4R9HA 3T1WA 2DDQH 1UXSA 2IBBA 3B6SB 5JR1L 1T1YA 5DC4B 3QUZD 3TA3D 5IOPA 3PG2A 1SJVA 4HIIA 4OZIF 4RZCA 2YWYA 1X5XA 4Z5RB 3EOTL 5KVFL 3QULA 1C7TA 5BS0E 4FQXC 1IGTA 4R3SA 3S35L 5KW9L 3D3VB 5EA0H 3U1SH 2ZOKB 1XGPB 2V5YA 3JV4A 2A9MH 3R0NA 1I7ZA 4YDKL 2UZIH 2ILLA 3DI3B 4L3EE 2NX5E 1INQA 2FECL 2DAVA 2EDQA 3B9EA 3U82B 3QUKB 5IM7A 1K2DB 1A21A 3SQOH 1G9NC 2GCYB 1Q1JL 4U1KA 3HZYA 1SVCP 3IKCA 4A2MA 3BPCB 5T1LA 2YPLA 3OKEB 1J87A 4FQIL 4OZGF 2FH6A 2WP3T 2DLGA 1IL1B 3MFFB 2R1YB 4XNMB 2HFGL 4X80L 3VU2A 1U0QA 1MJJB 2Q3ZA 3UO1H 2KL6A 1OSZA 5E08H 2OZ4A 1YN7B 1KTLB 4LRNH 3VE0A 1RZFL 4JKPH 3DUSA 1CLZL 3GMOB 1DFBH 4M3KB 3QG7L 2XN9B 4KV5E 1A7OH 4N90E 3GKWL 4N8CL 1KJMB 3IDXL 5KSBB 1YNTB 4FRWA 5GGUB 4ZOAA 1KXQE 2YK1L 4F37F 5DEGB 1ZVHA 3FHAA 3Q5OA 3ETBF 2ICWI 1JPST 4K23H 4ETQA 2BC4B 4OUUB 1T20A 5IROA 1X6LA 4IOFD 5DJCA 2DQDH 1FG2A 4KRPB 1GC1C 1KIQA 5DK0A 1UM6L 3L95B 5CLWA 2EIEA 4U0QB 5E8DL 5B22A 1P84J 3ISWA 4PJ5D 3B6SA 4GAYA 3JVGC 3FQNB 1DCLA 2AS5M 2DS4A 3H3BC 4XPBH 3QPXH 3QEQE 4BUGA 1OD9A 4Z5RA 4RDQG 1F2XK 2DN7A 2AJVL 3ALPA 5JXAH 1XF3B 3D3VA 4KZEL 1CXFA 2ZOKA 1XGPA 4KI5F 1PKQA 4P4KB 5C0CB 4GRMB 1OAXL 5JHDD 3O41A 3QUKA 1K2DA 3TESA 4KDWA 4OLUL 2GCYA 5ALCH 2P5WB 2NY6C 4B53A 1K6QL 2NW3A 3VFMA 1ZT1B 1JZ2A 3BPCA 3S88L 5IHBA 5B39G 2V2XB 1U93B 2YUZA 1AKJD 5IB4B 1Q9OA 1NBYB 4D8PB 3K74B 1IL1A 2IFFH 5CILL 2R1YA 3WFCL 4MAYD 2W91A 4LPWA 3S97C 4XNMA 4L4TD 2Y36L 2I5YL 2E9WA 3QH3A 4EUPG 3M1BB 1MJJA 3KXFA 5LAXA 5D1XA 5L88L 2Q8BL 3S7GA 3DLQR 1KTLA 4XNYH 1LO3L 5FM8A 1AE6L 3PWVA 3RVXC 5BRZB 2XN9A 5I75C 1AP2B 2OL3L 4UT7H 2AJXL 2W9DL 4JM2C 1F4XH 4IIQC 2R2HB 3BOVA 3L5JA 1R24B 1YNTA 5B3JE 3QDJE 4QHNB 1B3JA 3LAFA 4NM8L 1GH7A 2F54D 2HH0H 4JFQB 3ARGB 5DEGA 2D4DA 3NAAH 2FZ3A 4ZUWB 3ZSSA 2NY5C 4HULB 4OUUA 5KSBF 1MCWW 2Z91B 1BEYL 1KEGL 2DJSA 1DBAH 2ZUWA 4G80A 4MB5A 2EDBA 1IAII 1URLA 4FFVC 2CDGA 3MLZH 3QFJE 3GHBL 5I1IH 5L7XH 2WM0A 2KDGA 1KPRB 5JNYA 4CVWA 5CAYB 5CLTA 4Z7UB 1T1WB 3RGVC 2D31A 4Y4HD 1IMHC 3V79C 5DSCA 2P24B 4RMVA 2O26U 4TVPD 1XF3A 5E4IA 5LWYL 3O4OC 1E4KC 3D9AL 4P4KA 5C0CA 4R0LA 4NHCH 1U8MB 4LHUG 1YMMA 1FLRL 2QSVA 2CKBL 4N1HB 2Q20A 4R7DA 2P5WA 4LPXA 4E41E 2P5EE 1Z9OA 4PB0L 4G6MH 4BM7A 2GY5A 3MV8D 5DRZB 2BVPA 5I17B 2DQUL 4O2FB 4LLDB 3QZWG 5JW4N 2V2XA 1U93A 4LOUC 1FGVH 1MCFA 5IB4A 4D8PA 3QCTH 7CGTA 3MO1A 4G6AC 1RFDH 4I9WD 3EYSH 5I9QB 1MRCH 5CBEB 2PCPB 4X8JB 3MBXL 4WFHE 3M1BA 4Y16B 1GYAA 1YNKH 2ZCHH 1CXKA 5EO1A 4P46B 2FRGP 3NA9L 4C4KT 2B4CL 3BE1H 1NCCL 4FZEL 3TP4A 1WIOA 5HHOD 3WLWC 1I9IL 1JZ6A 5BRZA 3VRLF 1Y6NR 2HWZH 4QO1A 4P9ML 2R2HA 4OZHE 4X0KA 4I5BB 4DTGH 4QHNA 2Y5TB 3C60B 4JFQA 2VSDA 1EEZA 3I9GH 1WT5A 2D9QB 4ZUWA 3S37H 3CH1B 2O93L 2Z91A 1CGYA 1MI5D 1KCSH 1VSCA 4GRWH 1JWMB 4MD0B 1BJMA 3HKFA 5J3HD 2DMCA 5F44A 2BNQE 3TLRA 4LGPB 4YWGH 1B0WA 1MCOH 3Q0HA 1NCTA 4TSAL 4NZTL 5AG8A 3KLHC 1QFWH 1MAKA 3WXWL 4CMHB 1GGBL 3CSPA 3ESVF 1D5XB 1I7RA 4Y7MA 4Z7UA 1KN2H 5KANI 1F6FB 3MYJA 2VWEE 3RVVC 2P24A 3ILPB 3IAGC 4HK3N 1FNAA 1GZQB 4HFUL 3NCYS 2WWMC 3TH4T 1F90L 1L0YA 1U8MA 3WFBL 4UT9L 5D7IB 2EIZB 4NQDD 5D8JL 3MFGB 4EVNB 3O2WL 3DX8A 2VZTA 1KTDB 3MXVL 4JFDD 1EO7A 3QUXD 2W92A 1A02N 3RWCB 4UB0H 2CXKA 5DRZA 1Y6MR 4XNUL 3V6BR 4XP9L 1XF2A 3WSQH 2HT3C 1ZHLB 1FBIH 3BSZH 4KK5D 4YZFF 3ZTNL 4KROB 4DVBB 5D1QB 1QSEB 1BECA 3HAEB 1BAFL 2AK4A 4PRHB 2DLFH 4MVBD 3HZMB 4X6BB 5CBEA 1ORSB 2XXMB 2PCPA 2OZ4L 1UJ3B 1FVEB 2X09A 1FVDA 2X4RA 5CEXB 3K4ZA 2X4UB 2B1HL 3QNXA 4YDIH 5DJZB 4P46A 4MLIA 4TOYH 1YDPA 4FFYH 5DRXA 3TIDB 1UWEL 3BO8A 4OI7A 3RVWC 4Y4KB 1PFCA 4LSRL 5EWIL 1IM3B 3B9KC 5T1MB 2W38A 5KVDL 4Z8FL 2P8LB 1RUPL 1AGEB 3PWPB 1FSKB 1OB1B 2CGRH 2Y5TA 3X3FL 3B9DA 5BS0D 4MZ3A 1Q9LB 5HVWA 2AABH 4YHZH 5C6WH 2ERJB 1TJGH 2Y25A 2H2PD 2EEAA 4KY1L 1HHIA 2C5DC 4HJJL 5F3HB 4L3ED 1JWMA 5DD1L 4M6MH 4LBEB 2NX5D 2KZWA 5D7SL 3V5KB 4JHWH 1CYGA 4RWYL 4KK8D 1B6DA 1NGQL 4Q9QH 1BOGB 2RCSL 4FQCH 3N9GH 4FABH 3K1KC 4YQXH 3V9FA 4QY8B 5JW3L 3ILPA 1LO0L 2YHGA 3QWQB 4HIXH 3PL6C 4PJIB 1U8LB 1EVTC 5DFVD 4X5XA 1GZQA 1AGCB 3L5WB 5J4MA 1FNSH 5D7IA 3FQUB 3GSOB 3ORJA 3RHWK 1EAPB 3C5JB 3HE6C 4FXGB 4FQ2L 5I73C 1QTYT 4ZTPH 2XZZA 4K55A 4O02L 3QNYB 3RWCA 1CFBA 2JB5L 1AXSB 3I50H 1MIMH 5I8EB 3HNVH 2HT4D 3KYKL 4N90D 5IVXA 3U0WL 4WW2F 1YYML 5D1QA 5K9JH 4KTEH 4B7LA 4APQB 4PRHA 3RBSA 3LKSA 1NCNA 1UJ3A 2DQIL 3DYMA 4DWHA 5HGGS 2X4UA 5HI4C 4PJFE 5DJZA 1G1CA 1FNEB 4HKJA 3C08H 3DARA 5E00B 4Y4KA 3QUZB 3TA3B 1T6WA 1C5DB 1IM3A 3SDDD 2A6DA 4F15C 1PJ9A 1T3FA 4I13B 3QEQD 1N64H 3PWPA 4PG9B 4WENB 1UGNA 3VGGA 3LSOB 2XZQL 4H20L 3MNWA 3GHEL 3V0VB 1JHKH 1T03H 5E95B 2XA8L 4N9OB 2QADD 1TVBA 5ANMB 3ARQA 1NCUA 3VH8B 1IAOA 5F3HA 3U9PL 3LV3A 3FZUD 3CUPB 3TBVB 1UZ6E 2JJSC 3MACH 5C0RH 2Z31C 4LSSH 5I1CL 2P8PB 1JGVH 3WNMA 4IMLA 1OD7A 1RPQA 3WIHA 1E28B 1MHPH 3INUH 4HPOH 1HDMA 4P0DA 2DQGL 5CZKA 4DN3H 3L3GB 4DGVL 1XH3B 4RFNC 1CZ8L 5FYJE 1BOGA 5J13B 3HPLA 2EH8L 4ISVA 5CEZL 2CRZA 4IRSD 3JWOL 4QY8A 1C16B 1RZKH 1AD9B 1YEIH 4M9OA 3P0VH 4EI5C 4PJIA 5DMGC 1H3PH 1U8LA 1AGCA 5E2VL 3EFFA 3L5WA 5D7JC 3AY4C 5FCUL 3FQUA 4Y5YB 1PVHA 1EAPA 2N7AA 4FXGA 4HLJA 4KRLB 4MXQD 4LU5L 1J88A 4TNVK 3QNYA 1VACB 3O9WC 1CGTA 1H5BB 4LPTA 3IFPA 3FFCA 5I8EA 3Q6GH 3X17A 1P53A 1SJXA 5FKAB 3N1QC 4R2GD 4C56E 1TJHH 4AM0B 3QDJD 3DO3A 2I60L 1A22B 1ZLSH 5F7EL 1NQBA 2XKSA 4AG4L 4X7EC 3B9VA 4P2CG 4WO4C 4ZPTB 3T0VA 4MS8D 5KN5B 3SDCD 5D4QA 3UTZB 4PJ5B 1U8NB 4KVCH 1SY6A 4X4YB 1HXMB 3QHFH 3TA3A 3QFJD 4YHOL 1C5DA 4QHMA 3L7EB 3S5LB 4I18C 3V8OA 4QYOB 4XB7A 3SGKC 3D39A 1G7PB 1KJ2B 4PG9A 4EOWH 5J6HB 3PJSA 5DVNA 1MH5A 3LSOA 4KTYA 2OXHA 3MRIB 1V7NH 3V0VA 1VADA 4NZUL 4WIQA 1CICC 4FTVE 5ANMA 1R3IL 2XI9A 1MCBA 5ENWB 1HINL 5L0QB 1XFPA 2D7PA 2YN5A 3LHPH 5A2IH 4K9EL 4OD2A 3VFRB 2P8PA 3B9AA 3NBNA 3HA0A 1QBBA 1E28A 3PABB 5K9QI 3KDMA 3L3GA 4MQXC 4E41D 2P5ED 2BSRB 5F1IB 1VKXB 4I3RH 1WIPA 4XP4H 3O6MH 4D0CB 4MJ6B 3TBTB 1EV2E 4LLAA 3LKOA 4ORZC 2GAZB 5FUOL 4JQIH 1AKJB 2XZAL 1L9MA 5HHQA 4MAYB 4LLVB 5IW3A 3K4AA 4L4TB 3S36L 4DGYH 5FUZL 2XYCA 4UTAH 2V7HB 4YHML 2YXMA 4WFHD 1QR4A 3ARBC 3OBAA 4Z7WF 2HYMA 1A3LL 1Z9MA 2QSQA 5C0NC 3QHTC 3MLRH 4FG6C 1NCDH 5C0FB 4OLYL 5IVZB 5FYLH 1FN4A 5B38B 4FQJL 4M1DL 1I1YB 3QDAA 3T2QA 4X7SL 4GRLC 1BVLB 4OCNC 2JJUA 5FKAA 4OCLC 2F54B 1BZ7A 4JANA 4PJBE 3DPBA 5IB2A 4MJ2A 4MX7B 4GW4A 4K7PY 4ZPTA 4W68A 2V5RA 3LZFH 4LASH 5KN5A 1R0AH 3DIFB 3L7FA 3UTZA 2APFA 4PJ5A 1CGUA 2PYFB 1LMKA 1HXMA 4LHUD 2WLZA 1GAFL 2ZPKL 1L7IH 5GGVY 1R3HB 2BNQD 5DQ9B 1I8KB 5IFAL 2ZNXA 3L7EA 2H8PB 4P5TB 4Y4FC 1A1OB 1G7PA 1P1ZA 5CP3A 4LMQE 4Y4HB 4YFEA 2BVTA 4CKVX 3MRIA 4LDEB 2D7QA 1MHHB 2X70B 1NGYB 2EH7H 1JYNA 2V2WB 2FJFB 4RAUA 2XWBB 4HJ0C 4K3JH 5C92A 3NABL 5ENWA 4Y8AA 1IGCH 4NM4H 5TQ0H 3DMMD 4F7EA 4H5SB 1JPGB 2Z8WC 4QXTB 2VDOL 3BPOC 3PABA 5A43C 1I1RA 4LNRA 5F7UA 5FK9B 4DN4H 3KLAB 1E4WH 2BSRA 1VKXA 4YDJB 1RZKC 3MR9A 3WMSA 1L6XA 4D0CA 5IBLC 4JN1H 4MJ6A 4Y2DD 2EEBA 3KGRA 4HUXB 2GAZA 2EE2A 4ONFH 2J1KA 4IEFB 4H0GA 4L4TA 1FPTL 4AH2A 1YEGL 1CGWA 3TYFB 4ODHL 12E8H 2NY4C 2AQ2A 3O3AB 5FHAL 2R15A 1UB5B 4C57C 1CLOH 2FEEL 3GRWH 5C0FA 4XXDA 4OQTA 4NBZB 1J0JA 5IVZA 5HHOB 4LPCA 5B38A 5HYJE 1I1YA 5M94B 3LS4L 4J23A 5FGBA 5IJVB 5GGSB 1FCGA 4XWGH 5ACZB 1BVLA 4RNRB 4POUB 4GG6E 1RVFH 4TSBL 1TVHB 2BHZA 5FYKU 3RWFB 4ZD3H 1T5XB 1I7TB 3SDXB 1RIVL 3GI8H 2UY7A 4TSCL 5CZXD 4MX7A 5HDBF 2EDXA 1P5UA 3ELAT 1MI5B 3NZHH 4JFZH 5C3TA 2CIKB 2HFFA 2YKLL 3E6FB 3T3MF 4KJQD 4LKCB 3W11D 1S7TB 1II4E 3HE7C 1FL5B 2AVGA 2VQ1A 3PIQA 3F7QA 4Q97A 1R3HA 4XCFH 5HI5D 1I8KA 1NANI 5FDYA 4P5TA 3MRQB 1NLDL 4MSWB 3ARYA 5AD0B 5AWNH 4ZAKC 1HEZB 4CVZA 4Y4HA 1IILE 4LCIH 5K33A 1MHHA 4L29B 2X70A 1NGYA 3HC4H 2V2WA 2UYLB 4U1IB 2FJFA 2XWBA 1TMCB 3GMNB 3WIHL 4XZUB 3SGEH 3E2HC 4NQDB 4OCYL 4QXTA 2WUCH 4OM1H 2Y07L 3O6LL 4JFDB 3QUXB 4HCRA 1RY7B 2LQRA 5IMLB 3QUYD 2VLME 3OAZH 2CR3A 4BUHA 3OKNB 1IAMA 3LKRB 5GSVB 1BMGA 5HHVL 3JUZA 1IGIH 2GTZB 5LG1A 4OZFH 4WJ5A 2CRYA 3F12B 1D5IH 2QQKL 3N85L 4GSDH 3MCG1 4ZUSB 1T4KA 3TYFA 1KELH 3O3AA 4WI7A 3T0XA 1UB5A 3DSFH 5IP4A 4J4PD 4M48L 4O4YH 1JE6A 3DVNB 4DUXA 3SCMD 3UDWC 5INCB 1PLGL 5IJVA 5GGSA 1ZGLA 4Z95L 3AAZB 3CFBB 2D03L 4XP5L 5DUPL 1WBXB 2BJMH 4PTUB 3EYUH 1WISA 3RWFA 5BS0B 3D0VB 4HGWA 5T1DH 1KOAA 1SY6L 2DI8A 2JLLA 3BYYA 2Z0BA 1OLLA 3SDXF 4PY8J 1MI5A 4TTDC 4L3EB 3E6FA 1FFNA 3MV01 5BCAA 4LKCA 4MMXC 2NX5B 1S7TA 2DI9A 3CSGA 5C6TL 2J5LC 2Q6WB 4ESKA 2EC9T 1PSKH 2MWCA 5FKPA 5F71A 4PGEB 5F96H 4QT5A 5AD0A 1PZ5B 5FYJD 5DZNA 3D69A 1HEZA 2VITA 2GI7A 4L29A 4PLOB 3WFEH 2HRPL 3PWJB 2UYLA 4U1IA 1LO5B 4UT6L 4HF5L 5DDHA 4KPHL 3JWDL 3QT2A 1JV5A 5F7KC 4J3TA 4N0FB 3OGCB 5D71L 5HXMA 4XBPB 5ICXB 2BY1A 5IB1A 1KFAL 5IG7B 3PQYE 1CVRA 5DD0H 4GRWE 3EGSB 3BT2L 3NN8A 3VGBA 3QUXA 2ZWLT 5DZOA 5E56A 3RU8H 5JW4R 3OJVC 4N0RA 5IMLA 3TF7C 2W59A 2XRAH 4HAGA 1GOHA 3WDJA 5F8QC 3U2SB 2ITDB 3RL1B 5E6ID 4PRDB 1UT9A 5IVOA 4C56D 2YSSB 4Q6IC 3GM0A 3ARFC 3F12A 2AW2A 1HHKB 4NGHH 2ESVE 1OGAA 4YBLC 4LLQB 4ZUSA 1QYGL 2EE3A 3UZVB 5DZLA 4P4RB 5AZ2H 1CXHA 2BDNL 5LQBH 5C0IA 3DVNA 3U7YH 2PW1A 2WIIB 3O11B 1LILA 2M2DA 2ZG3A 4XVSH 3WO4B 3WDIA 3SDDB 2AQ3A 5E8EB 5INCA 4HKZB 2I9LB 4KHXH 1YQVH 3QEQB 1S9XB 3AAZA 4Z0BH 5GJSH 3RJDA 3QO1B 4XP6L 1CDIA 4XMPL 1WBXA 2OYPA 4MJID 1EK3A 5AUMB 4XRCB 3K8LA 2KUTA 1V3MA 3RVXD 4I0CC 3WKNA 2QADB 1UM4L 3WBDA 4FTVD 3WCYA 1XGYH 1YY9D 2AK1L 4L3EA 2O61B 1ZT4B 4NO2B 4HIJB 2NX5A 4WGWB 1I7UB 1HNGA 1QEWB 4JZJA 1KJ2L 3LQMA 4PGEA 5EZIH 2YS4A 3I6KB 1H3TA 3KPRE 1FO0A 4ONHB 4TQEH 4IRSB 4M7ZC 2BHUA 3VI3F 2FECI 3W39B 3K2UL 3UP1A 3F7YB 5MENA 5DVOA 2DIJA 5HVHC 1LO5A 4LVOC 2G75B 3FN0L 3BGFB 2VDNH 1M71B 4MDIA 4KHTL 4G8IB 3RGVD 1TZIB 4N0UE 4YXLL 4XBPA 5ICXA 2A38A 4U1SB 2DQTH 4Q0XL 4UIKL 3ZKQD 2JE8A 5DXWA 4P2YA 5IG7A 3OF6A 5TQ2H 1NC4D 2PTUA 3EGSA 4V2BA 1FC2D 5EUOA 4YE4H 4ERSH 2W07A 2P45B 3VWJD 3F5WA 4N68A 3CX2A 1FIGH 5C0AB 1RURH 4UNUA 2BK8A 4DW2H 4NQXA 3O0RH 4R2GB 4BA8A 4FXKB 2QLVB 3QDJB 4HWZA 4KI1A 3NZ8A 5A16B 5IT2H 2O5YL 1A14H 3HNSL 1HHKA 1OAQL 1EHNA 4OQTL 4F37K 3TV3L 1G7QB 4LOUD 2EDHA 3P0YH 1VCAA 4P4RA 2ZSWB 4WI6A 3SDCB 5J12B 5F7NC 1M7DB 2AERT 1CE6B 2VERN 4OSUH 4BK5A 2WIIA 3O11A 4G9DB 1UYWH 2APBA 2VO5A 5HPMA 3QFJB 3VXME 3SDDA 5DVLA 1ZTXH 2BMKA 2I9LA 4MCYA 1FCCA 1S9XA 1FFQA 4BQ6A 3RKPA 3M17B 3VGFA 3U4BL 5AUMA 4XRCA 4WWKA 3MA7A 3WLWD 4M6OH 4NP4L 5HBBA 3QSKB 3MUHL 1MF2H 1S9WB 1ZANH 4HMCA 5TPWL 1I1AD 5J11C 2VDKH 2O61A 3HNTL 3CVIL 1ZT4A 1LDPL 2V5MA 2E8YA 4NO2A 1I7UA 3MOBH 5GS0C 1QQDA 2DBLL 1XAUA 4QHKJ 2Q76B 4TVPL 4E41B 2P5EB 3EYVB 3CFCL 4I0KA 4K8RH 4DCQB 1H0DB 4RGNC 1RIUH 3LEVH 4ONHA 1JWUB 4IRSA 4ONGL 3W39A 5IF0B 4DKFH 3TT1L 5CD5C 5CEYB 3OKDB 2G75A 3HI5H 2K3TA 4L5FL 2P42B 1M71A 1OP3K 3RVUC 3KLHD 4JFEA 1HH9A 4JREC 4KXZI 3BRFA 2OR9L 2DB8A 1X4ZA 1A1NB 1FC1A 1TQBC 1I8LA 2BRQA 2E8ZA 5HYJD 3HN3A 2C3GA 2UV3A 3V95A 1CDUA 1XEDA 2E9JA 2BY0A 2YD3A 5C0AA 1EHAA 3GSXB 4U31A 4JVWA 1VPOH 3HLAA 4OZHB 3ZSTA 3RUGF 2FX7H 3O3DB 3MLXL 4FXKA 3OHXB 3QDJA 5A16A 5EULV 1T7XA 1MCDA 4I0PC 1YNLH 5AYUL 3UC0L 5DJDB 4HC1H 1BHGA 1T2JA 3BN9C 5B3JF 3VA6A 4RA0C 4RDQF 1KB9K 4IJ3B 5ESQA 3SDCA 1IBGH 3OJMB 2FWOA 3VFGH 4C55A 2ED9A 2R23A 3PE9A 4G9DA 4PRAB 1X5GA 4LHUB 3MNZB 1OF2B 3QQ9D 2FB4H 5I1AA 1U8HA 2BNQB 4ZQKA 3ARDA 1ORQB 3QQ3B 3TJHD 4LCWE 4OGZA 3OSKA 2AXHA 5GISL 1UH4A 2OK0L 4HBCH 3M17A 3U48A 4KRNA 3QZWB 3LQAL 2V5TA 2A6IB 4UINL 3BPNB 5BO1L 5MI0C 5EIIA 2J3SA 3B9KD 1AHWB 1S9WA 2XFXB 5MEQB 4H26B 5CKGA 2V9TA 3DMMB 5JDSB 4D0DB 5I8KH 2JCCF 4MAUL 5IR1B 4RMWA 3FJTA 4G6FD 4XCNB 4XC1H 1NSNH 2F5AL 4XAWH 2O5ZL 4WI8A 4Y5VB 2Q76A 5J1SC 2P5EA 3EYVA 4DCQA 1A7RL 3ARPA 4JKKA 3RWGB 1KUMA 1H0DA 1NKOA 1ZKAA 3PHQB 2XG5A 1CS6A 2VLMD 3TO2B 5C09E 5J89A 3ARED 3OKDA 4QRPA 5E4EB 3TGXA 3DVGB 1S7VB 4X4MA 5HGBB 1BFTA 4PBXA 5D6DA 3BGMB 1S9YB 1A8JH 3BW9B 1IAIH 3JXAA 4JFOB 4FFZH 1T83A 4CMMB 3REVA 1J10A 3TJEH 2MPAL 4RX4D 2D7TL 2XQBL 2BY2A 2X6MA 1QFWM 5TF1H 3GSXA 3ARTA 4OZHA 2YN3A 4ENEC 1A7PL 1CR9L 4QGTA 1MCPL 3QCVH 1C5CL 2ZUSA 1IAKB 4CN1A 3WS6A 4WI2A 1C5BH 1VGEH 1I9EA 1N6VA 3SN6N 2ZSVB 4PRAA 3QA3A 1HSBB 1OF2A 5TE4H 1DBBH 3G5VA 4M5YH 1ORQA 2PTTA 5C3LD 2AQ1A 5DC0A 4N5EC 5HI4D 1KENL 4YHYC 2EC9U 2H6PB 3HFML 3ZZ1A 3M8OH 5ESVA 4NJ9H 3OZ9L 5IB3A 2VDQL 5ITFB 4M4RA 5JORB 4BZ2L 2XFXA 2VLJE 4H26A 4P5MB 3DMMA 5JDSA 1GSMA 2IALB 1B4JL 1MPAH 1A7NL 5EBMB 4XCNA 3PQYD 2JJTA 3CMOL 1JF6A 3EAKA 2DTMH 4F7TB 1A6VL 4KTDL 1H8OA 1I9JL 1DLFH 3H6JA 5D7KE 3QUYB 3LRSB 3PHQA 4YHNB 2ZCKH 1D5ZA 2QHRL 3C5ZC 1BFVH 3PWUA 1KACB 2HMIC 3DVGA 1S7VA 3FOLB 2VZVA 4G9FA 3W2DL 1F00I 5HGBA 5KAQG 2ESVD 2A73B 3BGMA 3RY5A 1S9YA 3B2UC 4XCEB 3BW9A 1S5IH 4PJFB 1NBQA 3BP5B 3CXHK 4EI5D 1W0WB 3HRPA 1RUKH 3G04B 1UWGL 4GKOA 5D7JD 3SCMB 1NPUA 4CMMA 1PX3A 4MQ7B 1T2QH 4YEEA 4TULL 1N3NB 2J88H 5I8OH 5T5FL 3Q1SH 4P2OA 5IESH 4XC3L 4OAWB 1IZKA 4PJGE 3O9WD 2KQNA 1QSVA 2XTJE 3O3BB 1RK0A 2CLZB 1JNNL 1DL7H 4K3EH 2YZ8A 1AO7E 1IAKA 1G7JA 4GLRI 5CJQH 2HKFL 5SX4I 3VFPB 4NQVA 1HSBA 4J8RA 4NSKB 2R0KH 4X4ZA 4YH6A 3C9NB 2NPLX 3SDYH 3PWLB 1IC4H 3KPRD 3QI9D 2H6PA 5EZJA 4EDXB 2B4CC 5F7LB 2DMKA 4JRXA 4NZDA 2LU3A 1DVFC 3MJ9H 4MA1B 2QQNL 3I75B 1F45A 5C08E 5T5NG 1P4IL 3IJHA 4AZ8A 3BZ4A 1JNJA 5EBMA 2Q7YA 3T77B 2QHLA 5AAWA 1CICD 3R4DA 3OPZH 1S5HA 1MWAB 2PETA 1VHPA 3GNML 3QUYA 3LRSA 3C6LA 4YHNA 1CG9B 5HDLA 3CFDA 5E2TH 3X3GH 4J2XA 1BPVA 4URTB 1JZ7A 5E6IB 2A2QT 3QHZH 2EE6A 2DM7A 1P6AB 4CU6A 4C56B 1DDHA 4MQXD 4Z9KB 4LK4A 3FOLA 2D0FA 2YA1A 3B43A 3JWNC 3U4EB 4D2NA 2X9YA 2I07A 3QIUA 2A73A 2GQHA 4NKIH 4XCEA 1AQDB 5I0ZA 5DFWH 1PY9A 2A77H 3BP5A 1W0WA 4J4PA 2C3XA 3CDCA 4RWHA 5F6HJ 3G04A 1WGOA 3SCMA 4U2ZA 2E9BA 3KS0H 4MQ7A 4PJFF 1MEXH 4GBXD 3VXMD 2DM4A 3L6FB 1N3NA 3U36B 2EICA 3JUYA 5JXED 4MJIB 4D9LL 3CFJB 3T2OA 2JB6B 1PQZB 3UTTE 5F9JB 3NFPB 4FN0A 3O3BA 1RU9L 4HAFA 4WCYL 4G7VL 8CGTA 4Z7NE 1JHLL 1NBVL 1BF8A 3VFPA 3LDBB 3LPWA 1TZHB 3OKOA 1KT2B 1T7YA 4WY7L 2NY1C 3DROA 1LO4L 4XBEL 4J3WA 3MLVH 3S6CA 1UZ6F 1V7MH 2GK2A 3GMMB 2ARJA 3GEWB 5IBTL 1N2RB 3CLFL 3UYOD 1T22B 4KAQL 4EN3D 1RAMA 4FA8A 1GGUA 1YEDB 4EDWH 3I75A 1JPSH 4HXBH 4ZTOH 1IFHL 5CCKL 2AAVA 1UM5L 3RGVB 4LSQL 5IROC 4F3FA 2N56A 4R4NC 1BBJB 4FQHB 3T77A 1NC4B 4Y8DC 1QA9B 5DUBA 1RJZA 4YNYB 1MWAA 1IM9D 3RVTC 3CVHH 4FP8L 3VWJB 5MEOB 1MFAL 3A6BL 1CG9A 5B3NA 3B5HA 5I30H 5E6IA 5EU3B 5IW6A 3CZJA 1J8KA 1WWCA 4C56A 4HW6A 4OCWL 4OGYH 1OTSD 4PJBB 4RGNE 3L1OL 1NC2A 1ES0A 3U4EA 3MLWH 1IGFL 1AQDA 1KLUB 3EJYD 4DKEH 5L2KA 4NQEE 2ADJA 1DE4A 3ARZA 4JFFA 5JA9A 5ABDE 2Q8AH 3U46B 4UMGA 4XMKH 1I3GH 5I18H 4LDOB 1FFOA 3L6FA 2HRLA 3C5SB 3BKML 3HZKB 1R3LA 2NY4D 4LCWD 2DQJL 1MELA 1NLBH 5FA3B 1S3KH 5HHXH 4MJIA 1GIGH 1BD2A 3CFJA 3B3IB 1JNHB 5E2UH 1BM3H 4DKAA 1MREL 5F9JA 2FO1A 1CL7I 1A5FH 4P23A 3NFPA 3P73B 1JFQH 1I1AB 2VL5B 1EERB 1QPXA 3RA7H 5J9PB 5D1XC 1F4YL 1QNZH 5KBNC 1PG7W 5ISZA 4KU1A 4NZRH 4JM2F 5EZLA 3VDBA 3E3QC 5IBUB 5IIEA 4WW1B 3GMMA 1INDH 4N1EA 1MFDL 1Q94B 3P4NB 4S1RH 1S7QB 5ERWA 3OB8A 1N2RA 4JQVA 3HE7D 5C09D 1C1EH 5C7XL 1T22A 1YJDH 3BDYL 3WD5H 5T1KA 4UOW0 3FMGL 1FH5L 3AC0A 1YEDA 5CGYC 3L3JB 3T1FB 3T08A 4JO1L 4UV4L 4XP1H 2APXA 3QUMH 1I4FB 3KLDA 1ITCA 1MLBB 2VMFA 3FQRB 4KRPC 1S7WB 1PG7L 3ES6A 1NC4A 4UNTA 5GHWH 1QA9A 2VOTA 2KH2B 4IRZL 4YNYA 3ZYJA 1ZT7B 3VXSE 1PKOA 5HYJB 3VWJA 1AGDB 3V7MA 3SGDI 3TCLB 2HT2C 4C59B 2F58H 3MTRA 1KC5H 1LEKB 3QCUH 4GG6B 4PRPA 4CJ1A 1V5JA 4EQ3A 2HKHL 3V4PL 4J3XA 2UWEA 4J1UB 3UAJC 3MGTB 4P4KC 3JWOC 4R0LC 4QXUL 3V5HB 5JZ7C 5GS1A 3MYZA 2IQAB 1KCRH 3ZKMC 5FM5M 2C3VB 4RBPH 5DEFB 1BJ1H 2FIRT 2R4RH 5L6YH 2MHAA 2R29L 4OIIH 3U46A 4IRJD 2H3NB 3GGWA 3PNWB 3CDYA 1JHTB 3C5SA 1D9KD 1I75A 1EO8L 3L9RA 1XIWD 2FEDC 3ABZA 5FA3A 3ILQC 5C2BL 1HH6B 3HI1B 4XBGB 4OLZH 1YEFL 5CINH 3ZYIA 3P73A 1I1AA 1AR1C 2R1WB 2VL5A 1R3JB 2RJMA 3P30L 2VLJD 5J9PA 4MA7L 4YLQT 4X6DE 4PJAA 4GXUN 4AEHH 4G6FB 1Q0XL 4N9GB 2DTSA 4GKZB 5C07E 1WZ1H 2OTPA 3GSUB 4WW1A 3EJJX 4RIRB 4TTDD 4PJ9A 5ITBH 1VFUA 5BW7A 3FO2B 5IQ9B 5D7KD 1NMAH 1Q94A 3P4NA 3DRTB 4KQ4H 2VXQL 3AREB 1K85A 1QFPA 1KXVC 3KWWA 4HKBB 1FL6B 4M1GL 1N6QL 5D2NA 1BQLL 1WT5C 3S34L 4G43A 3T0EA 3FONB 2VYRE 3H2WA 1PW3A 4WU7B 3PV7A 2UVFA 5H94B 3LN5B 3VWKD 4HJGA 1S7WA 3CNKA 3QXDB 3VD5A 4M5ZH 4XMLH 1G9NL 4LIQH 3NIGE 1GHFL 1ZT7A 3L5XL 5HYJA 2BOBB 1AGDA 4K9EC 1TITA 5DJ0B 3ECBB 4M4PA 4NDMB 1KCKA 3OKYA 4OKVB 5F6HI 2XZCL 4KK6C 2R9HD 3B2VL 5IB5B 4J1UA 3UZQA 4K71B 3MGTA 4TUKH 4U4BA 4GG6F 2XTJD 4L4VE 3V5HA 1A3RL 2LAGB 3CAFA 1AO7D 2GT9B 4U3HA 2IQAA 5GGRY 1A2YB 3U7WL 5EIQA 3RI5F 1OAYL 1RULH 3PNWA 5J1AB 3CXDL 1JHTA 4Z7QE 2GSIA 1DBJH 2VH5H 2Y06H 2OP4H 5GRYA 4KGLA 4M7JL 4Q9BA 1DQJA 4PRIE 1SYSB 3BP7A 2F74B 4R90L 2YZ1A 4LSPH 2P47B 3L5HA 1N5AB 5I9QC 5C08D 2IAMD 1R3JA 3BIBX 3ULSA 1AFVL 1IQWL 1JGUH 5FYJL 1FAIL 1GZPB 4P46C 3PQYB 2X40A 4GRWB 2ZCLH 4JG1L 3SE4A 2YUVA 2WW8A 1LK2B 3MZTA 3GSUA 1EFQA 5LGHH 4C83B 5B8CA 1MJUH 4BSVB 2NYYC 3HG1A 1KBGH 3NCYP 5IQ9A 4QHUA 5I1EH 4EJ1C 1K3IA 1YECL 5I1DB 2EDRA 3AREA 2AEQL 1WJ3A 2UZXB 5D2LA 1FL6A 1IT9L 1T04A 2AEPH 3MPCA 1VEPA 1WC7B 3FONA 4PJCE 3NIDE 1FDLL 2VXVH 1YA5A 2ESVB 1MWAL 1AXTL 5H94A 3LN5A 2V17H 4QLRA 3FN3A 2DBJA 3NVQA 2VZUA 5FOBB 3QXDA 4EI5B 3DETD 5D7JB 5HY9B 4PGBB 4YC2C 3MXWL 2BOBA 5EU4A 1RZJC 1NANH 1PDKA 4OTXH 2MQ3A 1UEMA 1UA6H 4NDMA 1YEHL 1RZGB 4GMTH 4OKVA 3HR6A 3U83A 5DLMH 4NT6B 2FSEA 2W0FB 3ULUH 1CU4H 3O9WB 5IB5A 3UTTD 5KJRL 1LO2H 3I84A 1FAKT 4QXGL 2GT9A 1FL3B 1QFHA 3BUYB 3QJHB 4P2RE 5IQ7H 1UEYA 1A2YA 4LEOB 4O58H 3DVFA 2B2XH 1KIPB 3ZHLA 5DJXB 4EBQL 4E0RA 2Q87A 3TIEA 1T7ZA 4J6RL 1MLCB 4KDVA 1MNUL 3GMQB 3KPRB 3QI9B 2L0DA 3WN5B 4NRZB 1EEYB 4U1NB 5FF6B 3T0DA 1SYSA 4PRNA 5D1QC 4F57L 3AB0B 1FJ1B 4I18B 1X5HA 4XPFL 3EO9L 4U6XB 5I1LB 1UJ3C 1E4XH 2YPLE 2DDQL 4N0UB 5E1HB 1JVKA 1GZPA 1DTUA 3UZEA 3Q6FB 2ADIB 1DLHA 3HPJA 1CICB 2VXTH 1LK2A 3Q5YA 4C83A 4Y4KC 1ZEAH 4BSVA 5ICYA 3AS0A 2CIIB 2XG4A 4E42B 5KANG 5EA0L 5FCSH 3FCTB 4PJ7A 3U1SL 2IGFH 2A9ML 2UZIL 2P7TA 1WC7A 2W65A 4X4XA 4A6YH 3WUZA 3ZDZE 4RGND 2ESVA 5D93C 3OAUH 5JW5B 4CW1A 4R4BB 2X9WA 4NC1C 4S1QH 1XF4B 1OM3H 5CD5D 4NQED 3L3HB 5T3XE 1AIFA 4AY0A 4RFOH 1LK3H 1MJ8H 4GBXB 2R8SL 3VXMB 5HI3C 5JUEH 3BJ91 3ROLB 5E0QA 3V4UL 2ZJSH 3ALWA 5I1HH 1ADQH 1DQLH 4NT6A 2W9EH 4QRQA 3MRFB 1WWBX 3UO1L 5DD6A 5E08L 4FQLH 1FL3A 3BUYA 1QBAA 1GOGA 3QJHA 2FR4B 3UROR 4IHOA 4LRNL 4LEOA 4JKPL 3TPUB 1KIPA 4LCYB 1DFBL 4X98B 1PKQE 3FO1B 1A7OL 3BN9D 1KB5A 1WAAA 3H3PH 2FATH 3GMQA 3ZT7A 1OTUC 4PJEA 3KPRA 3QI9A 3WN5A 4NRZA 5IMMB 3X14B 4I77H 4U1NA 2C26A 1NGZA 3ZKND 1MRFH 1J0ZA 4EN3B 5FF6A 3OKKB 4LQFH 2ADFH 4APQC 1FJ1A 5HGAA 2APWA 3LRGA 2DQDL 4P3DB 5I1LA 1HZHH 4CVUA 1UACH 5EORH 2F15A 2Q7NA 4RCAA 3V6FB 3TN0A 4G7YL 3VG0H 2ADIA 1TJIH 1VGKA 4XPBL 3QPXL 1IM9B 3TA3C 1IKFH 3P3YA 4BQCA 4PGZA 3KXFE 3UBXA 3FT4B 2CIIA 3VXSD 1OWRM 1Z2KA 3UJIH 2X4TB 3R06B 5JXAL 3ZO0A 4GKNB 3FCTA 5HHPA 5EC1B 3STLB 4NNPH 3PDOB 3VJ6B 3N1GC 3H9YA 2NCMA 5C0BE 5C9JB 3IFLH 4UUJB 1ZS8A 2LVEA 5JW5A 3UTPE 4R4BA 3BIAX 3K2MC 5ALCL 3BEVB 3AXLB 2Z4QB 5C70A 3OR7B 3L3HA 2IFGA 2GUOB 3QNZA 3KPOA 4GBXA 2BSED 3VXMA 3RY6A 3ROLA 5J13C 2NY4B 4LCWB 4OGXL 5JXEA 5DVKA 1FE8H 1XCQB 2P46B 4ORGB 5BZWB 5K59E 4NPYB 1YZZA 2VDLL 3DUHA 3SKNB 3WL9A 1XGUB 4OLWH 3CFEB 3MNVA 4XNYL 2ADGB 1H3UA 4H25B 4LCYA 4DKDC 3GUTB 5E94B 5C07D 4UT7L 2Q86B 1F4XL 4Q9CA 4PGDB 1YMME 3RPIB 5TDOB 1D7FA 5DQJB 2HFGH 1D6VH 5IMMA 2HH0L 3X14A 2BNRE 3HE7B 5C09B 3NAAL 4YDVA 4EN3A 4KZDH 3OKKA 3SO3B 1KJVA 4DZ8A 5DI8B 2OS7A 1JUFB 4GOSA 1M1SA 1DBAL 4P3DA 3WS3B 3RDTD 3TH3T 3RGHA 2XY2A 4IOFC 1EXUA 3MLZL 4JN2B 5E9DA 1SEBB 2QR0B 5I1IL 5L7XL 1ZV5A 5JDJA 1PGRB 4PJHE 4R26H 4HFWB 4HWEH 4X99A 1NAMH 4C54A 1VFOA 4ELME 3R06A 2R2BB 4AMKH 4GKNA 4K8RD 3LKQB 4BK4A 4Y0GA 4YPGA 1CN4A 4JPVH 5EC1A 3STLA 4MCZB 3PDOA 5BXFA 1KGCE 4NHCL 5BRZE 1LE9B 1BX2B 5C9JA 5E8DH 5KZCD 4LCCB 4UUJA 4M93B 3LOWA 4L4VD 5L0QC 2Y4SA 3BEVA 3PXHA 4WU5A 1CFTB 3AXLA 4WWID 4PY7A 1FZJB 2Z4QA 3NACH 4FZ8H 4G6ML 3OR7A 2HMID 3RPKA 3CGTA 2GUOA 3T0AA 3MUY1 4IRJB 4BKLB 3FQXB 3WXVH 1D9KB 1FGVL 4LCWA 2Q1EA 3O6FD 1XIWB 2PW2B 3QCTL 5DJ8B 5KSUB 5EC2B 2X2YA 2CO6B 1RFDL 3CDFA 3KYNB 3EYSL 4ORGA 4ZOCA 2N1KA 4PRID 5BZWA 4NPYA 1YNKL 2VB5A 2ZCHL 1VFBA 4HG4K 2Y5EA 3SKNA 2H26B 5MERB 1XGUA 2VLJB 5D9SB 3BE1L 5IMOA 3CK0H 4KXZH 2ADGA 3GBMH 1QACA 3IXAB 4H25A 2F5BL 3GUTA 4OQ1A 2E5EA 2V5SA 2HWZL 4L1HA 3ZE2E 1DQDH 2DOCA 5F7WC 3OB0K 5F7DB 3VFNB 4DEPC 1OPGL 5TDOA 1TQCB 4HUNB 5DQJA 4DTGL 5FGBC 1SMAA 3LEYH 3I9GL 3G5ZB 1OTTD 2J5LB 3S37L 2VRAA 4G3YH 32C2B 5M95B 1B90A 1QOKA 5DJAB 3VXPB 1SJHA 5BQ7B 1P4BH 1KCSL 3WS3A 5FAAA 5ILTL 4NNYB 5EOQH 5DMJB 1OT2A 3VWKB 1EHLH 4JN2A 1RHHB 1SEBA 2QR0A 1A0QH 4YWGL 2AK4E 3O2VH 1IRAY 1QFWL 4GFTB 3SKOB 4P2QE 2Y6SC 4HFWA 3WO3B 1KN2L 3IAQA 1F2QA 4P5TC 1NCAH 4WI3A 2G9HB 3IDGB 3E8UH 3CCHA 2EDDA 2R2BA 1N4XH 4LSUH 2ZKHH 3LKQA 4MD5B 3J7HA 3IDJB 4Y4HC 4MCZA 1BEYH 3O81A 1GGIH 4MHHG 1IQDB 1FO0H 1BX2A 1EJ6A 1G84A 4PJGB 4LCCA 1LNUA 2XTJB 1Y0LB 3GHBH 3RNKB 4ZDHB 3PGFH 4QGYA 1AO7B 4YR6A 5BJTA 1CFTA 4YO0B 3OXSA 4P2RD 1FZJA 4ELKA 1TTFA 4HMEA 1BGXH 4PS4H 4UB0L 1UKSA 3VI4E 4IRJA 4YBLB 2ZG2A 3WSQL 1FZOA 3FQXA 1KG0B 3EJZC 1D9KA 4WHTA 1WQVT 1XIWA 2PW2A 5DJ8A 5KSUA 5EC2A 4OIBA 1WEJL 2DLFL 5FXCH 3OR6B 5JO5B 3KYNA 5EPMA 1FLRH 3E6HB 1U9KA 3OJDB 2B0SH 3SHSA 5A2LH 4YDIL 5C08B 5MERA 2IAMB 4TOYL 5DT1H 4OBSA 2YPLD 4FFYL 3B83A 1HHGB 1OLZA 2JF1A 3IXAA 1BIHA 4WFFE 3HR5A 5F7DA 2CGRL 4HIHB 4U2YA 4P99A 5AAMA 4MXVE 1U8QB 2EXYD 3G5ZA 4B5EA 1EEQA 2AABL 4YHZL 4Z78A 3VRIA 4F2MB 32C2A 1TJGL 3QAZB 5DJAA 1HOCB 5HGHB 4L4JA 5BQ7A 1LP9E 4FZEH 4M6ML 5JQ6H 1F58H 3VWKA 3MGAA 2X1WL 1RHHA 5IVXE 4JHWL 4BH8B 3BVNB 3FHQA 1S8DB 4LVOB 3LQAC 3MCKB 5TDPB 3G6AB 3SKOA 2P1YA 4PTTB 4Q9QL 4FQCL 3N9GL 4FABL 5T3XD 4YQXL 2G9HA 3DURB 4HIXL 5JTWA 3D1MC 2EE9A 4HEPG 4JRYE 2CR6A 3UTTB 3P2TA 3EDKA 4HT1H 3RNKA 4ZDHA 1AO7A 1KXTB 1GVIA 4RQQB 4YO0A 3LKPB 1MQ8A 3WXWH 4P5KB 5EH1A 2DYPD 3DTXB 4ZODA 3WJLA 4OM0H 1RD6A 3QUXC 1MIML 3GRWA 3GK8H 3HNVL 1KG0A 4LIQE 3DX6B 1YEKL 4AT6B 5K9JL 2CPCA 5C6PB 4KTEL 5C86A 5JO5A 3OR6A 4KK5C 3QWOB 5HDOA 1R5VB 3E6HA 5D8JH 5F7HA 3M07A 4MVBC 2IAMA 2MCG1 5GXBB 4OCRH 2N4IA 1HHGA 1EGJH 5DUMH 3TNNB 5JOEA 4XP9H 3JSSA 1T5WA 3C6SA 1AI1L 5ACLA 1JYVA 1N64L 5J11B 1GJIA 3GMLB 4HIHA 5KAQF 2X4PB 3KXFD 5D1XD 4UQ2A 4I2XE 5SWSA 5HYSG 1U8QA 2BSSB 1SYVA 2GITA 1T03L 3V5DA 1PEZA 1GCFA 4F2MA 5D1ZA 5KG9B 4KUCF 1HOCA 4JE4B 4X7TB 4NO0A 4RGNB 3FFCE 5C0BD 5LGJB 3MACL 3F58H 2H2PC 1JGVL 1BP3B 2V7NB 5HVGB 3BVNA 5EWIH 1MHPL 4HPOL 4PJDA 3UTPD 3IJYA 4DN3L 2VIRB 4NQEB 4JZJC 2VDRH 3GBNH 3G6AA 4QRSB 4ODXA