4B9CA

Biomass sensoring modules from putative rsgi-like proteins of clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'GSHMGLKIQYYSRKPHDSAGIDFSFRMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANKYLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLVWGIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE 3A CELLULOSE-BINDING DOMAIN PROTEIN
molecule tags Carbohydrate-binding protein
source organism Clostridium thermocellum
publication title Fine-Structural Variance of Family 3 Carbohydrate-Binding Modules as Extracellular Biomass-Sensing Components of Clostridium Thermocellum Anti-Sigma(I) Factors.
pubmed doi rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9cA00
2L8AA 1GA2A 1K72A 4B9CA 4TF4A 1JS4A 2XFGB 3ZQWA 4B96A 4C8XA 2XBTA 4B9PA 2WNXA 1TF4A 4B97A 2WOBA 2YLKA 3TF4A 1G87A 3ZQXA 1NBCA 3ZUCA 1G43A 3ZU8A 4B9FA 1KFGA 2WO4A 4JO5A
chains in the Genus database with same CATH superfamily
1MLBA 3OPZL 4K9JA 3SDAA 1MQKH 1P7QB 3OLDA 4FCAA 4PGDA 4RX4A 2HFGL 5KVEH 3BOVA 1D7CA 2Q20A 2VDOH 1KN2L 4GYBA 4P99A 4Z76B 3EGDB 1LK2B 4FC3E 3O4LD 1MJJB 4HS6B 5FUCE 4CMHC 3TEYA 3VDBA 1NUNB 2DL9A 5TK2A 1ZLVK 3KAAA 3IJ7A 4NQED 2F1AA 4R96A 4F20A 1NFDE 5C0FA 1SVCP 3DURA 2WZ6A 3GHBH 3WTXA 1AD9A 3C6LC 3NAAL 1MRCL 3U0WH 3NJXA 1MRDL 1HILA 4AKQA 3GINA 4HIHA 4ZRGA 1YUKB 2FQFA 3G5XA 3VWJD 1AO7B 1JJUA 2R2CA 4HP5A 4XNQA 3T0EC 3KLHD 1G84A 2HMID 3P73A 1U95B 4L1SA 5DLML 3D34A 5HDBB 1RD6A 2EICA 4FA8A 1FGNL 4J3VA 1E3ZA 2FEEL 3IPEA 2I9LA 2W07B 4NUJA 4MD0B 1EMTL 3IGFA 2ENYA 3LKSA 1PAMA 1KCRH 2FNWA 3T8XA 2VDMB 2NNRA 4NQDB 2VXVL 3R18A 1VFAA 3PP3H 2QSQA 1CLVA 4HK3J 1GYAA 1NCBH 1TPXC 5GXBB 3J27A 4ZNEA 1HHKA 1JFQL 3GBMH 2QVMA 3QUMB 3ZDYF 4UBDC 1MFDL 3GSWB 4WEBL 3NDZE 1R3LB 2AQTA 2WZ0A 3MRJA 5E8NB 3S35H 1L0PA 1VADA 5IJVB 1JPSL 2EYSA 4HOWA 1R34A 1TT6A 4G8FB 1M05B 3W0WE 1FNHA 4U3SA 5J8OA 2EVHA 1E9PB 5D7SH 2BX5A 3DKHA 3RVTD 2IALB 4J3TA 3ATEA 3UPRA 1THCA 3QC5X 4AQZA 1YPZF 2O5NA 3VG9B 3IRCA 5I8OL 2R0ZH 1CFTB 1FZOA 1U8HA 5EO0B 2V5YA 4PV1C 5ECJE 1MFCH 4LKXA 5JLZB 1BM7A 5FXCH 4MJ5A 1OV8A 3UBGA 4Z7OF 4HOZA 4XCFH 4BBWA 4RGND 4C4KT 2R51A 1PDKB 4DERA 2ID5A 4NO3B 1XF1A 1JK9B 5CAYB 3QH3A 4Z7VA 1NCGA 3QUZC 1NFKA 3B34A 1G87A 2HKFH 4IOSD 4LDEB 3AG4B 4L0YA 3FUJA 5ISZB 5JHDD 2AANA 1FZKB 5DJZA 3IMWA 2SEBA 3F6JA 3NRFA 1E4KC 4F2MA 1AKJB 5JXAH 4NNPH 3TBVB 5CEZL 4MXVE 2AKRA 5FGCE 3SYPA 4DTGL 3NCYP 3WHE1 1NGQH 5DHYA 4N1HB 3WG7B 1SMDA 3OKOA 1TTFA 4HETA 4NRYB 4W4OA 3S4SA 3U36B 1UYWL 3TEUA 2ZYIA 4ZS6C 3T09A 5GZNC 5CD3A 3O3AA 3Q2WA 4MQXC 4AYBA 4OZGB 1A21A 4YH6A 3RFRA 4F2FA 3VW3H 4XP9H 4RWYL 1CICA 2MPVA 2VLLA 7TAAA 4BH8A 2NY2C 3MNWA 3VD3A 2YD7A 5H94A 3VFRB 2X2YA 5F7NC 3PP3K 35C8L 1M7IB 2ITFA 1TFPA 3RWFA 3CMGA 1BQLL 1DBMH 2UYLA 4MYPA 3TBYA 5IJDC 2H26A 2D4FA 1EXUB 1PY9A 3GZOA 3H4HA 3V4PB 5KBKA 4PJEF 2Y07H 4P57A 1TZHA 5L2KE 1EGJL 3QUYA 3U0PB 8FABB 1UH3A 4IMKC 1NEZG 5BUAA 2ADJA 1OOAA 5EV7A 3QJHA 3FBQA 3KCWA 4OB5H 4URTB 1Y0LA 2GSGB 4PJXE 5K9JL 2HKHH 2N7BA 3NMEA 1ASQA 3OG4B 5CLZA 2MCG1 3VI3F 3WTWA 3R4DA 3FS9A 5MEQB 4XB3A 5B1KA 1ZLVH 2PCYA 2ZOWA 4MTMA 4C4UA 5HY9B 3HB3B 1DSYA 2RR3A 4N0UA 1KUMA 4JO2H 1TR7A 1P4IH 4CW1A 5IQ7H 1INEH 1OCWL 2DICA 4Y16D 2NY4D 3FUIA 4G6ML 4P5TA 3RZCB 2NLJA 2FHFA 4Z9KB 2VZTA 5C6PB 4HDIB 1S7XB 3ZKND 3IWUA 3GMMB 1LQSR 1XF3B 4ELMF 3ZDZE 2AJYL 4NQXA 3V10A 2EEBA 4PJ5B 2WOYA 1J8HA 4M8UA 2CKBL 3V6ZB 1OE1A 5IB4A 4AE1A 4WFED 2H32H 3D0VA 3MNVB 4M1GH 4U1IA 2O26U 1JGUH 1NDGB 4XPFL 4XBGA 4XXDB 5EBGA 2WINB 1OE2A 2FWOA 5EU7C 2P8PA 3JSSA 4I9WD 5HHME 4OZGA 1OP5H 1CDJA 3ZTNH 3TN0A 2E27H 4NC1E 2FECI 4IBQA 4X99A 3MAWA 1ZT4B 2AJZB 4WUUA 3RBGA 1GCYA 2VC2L 4G43A 1A2YA 1UFUA 1B0IA 1M6UA 3WJLC 2HVKB 5AWNL 1E90A 3FU7A 1NCTA 4C56E 1JHKH 3QUHA 5BS0A 3HZVA 1R5WB 2J5WA 4N4YB 3L81A 4EIGB 1PY0A 3OKLA 4UTBH 3O0RL 4FCHA 3T3MB 2CO3A 4NI3A 1KIQA 2W60A 5DFWH 3W11C 4F2MB 2C3WA 4L18A 1J9RA 1M9WA 5E6SB 3T3MF 4K7PL 2UWEB 3IJYB 1J9QA 1CXKA 4IU3A 3RY4A 3LQAL 4V1DB 3B8SA 2Z4QB 4MMXB 4PJDA 1DQLH 2IPUG 5AVXB 1E2WA 1OSYA 4HWUA 1TEGA 4Z7AA 2PYEA 3PRZA 3RVTC 4Y2OB 4KRLB 4Z3TA 4HJGB 4YDIL 1RXLA 3TC9A 3TP4A 1CVSC 3F5WA 5ITFB 3NIFE 1KXQE 3QIBD 4ONOA 4BZ2L 4ODSH 3POHA 2BOCA 1UXWB 4K2UL 1I3RA 5CKGA 5IFAH 3SOBL 1JZGA 1KSRA 3L95A 5F70A 4CAGA 3LEXA 1F4HA 3M17A 1UA6H 2IALA 4L3AA 2ADYA 2FQDA 3IU4H 3PJSA 1N4XL 5B3NA 3VJ6B 1LP9B 3QQ4B 3BKYH 4N2DA 3MV01 4B50A 6FABH 4KXZI 4NQEE 4DAGH 3X1GA 3ISRA 1ZVNA 1AE6L 2OCJA 3EYSL 4ENEC 1F58H 1USQA 5DC2A 3RWJB 4IBZA 3IN2A 2K3HA 5BVPL 5JXEC 2VABA 5EUOE 2V3DA 4F58H 3LN4A 2LQRA 1UD2A 2ICWA 5DD5L 5J3HD 4N2IA 4GG6E 5LAXA 3O9WA 4Z0BH 3DIFA 1UB5A 5JW4N 3GSNL 4ZMAT 1HOCB 3ZSSA 4PJGF 3T0WA 2WQAA 4UOZA 4HLZH 5E5UB 3P02A 1T20B 2TRHA 1GIGL 4RSVA 1PSKL 2VDPL 1CG9A 1PZ2A 1XIWA 3MMEA 1QLEL 3OQRA 5D2NA 2H0EA 1EJ6A 4PVBA 3CC5B 4PYHA 1H8OA 2ZUSA 4UF7C 3H2QA 4S1QL 4CVZB 3A0OA 1A7PL 2JK5B 2WQUA 1HIML 2V8MA 3MBEB 4LGRB 1QSVA 4GRMB 1ML0A 1KWKA 4Y9CA 4OLYH 3QUKB 4AL8H 5C0AA 2X89D 2UWEE 2Z31C 4PJBE 2GFBB 2MNUA 2QFPA 2V2XB 2VWEC 4CL7A 3QPQC 1RQ5A 1Z1WA 4YQXL 1OTSD 2OYMA 4LLQA 4PJAF 2BZCA 5DD3L 2JIXB 5C0BB 3T3ME 2DKMA 3Q8BA 2Z8VC 4U6TA 3KYAA 4X9GA 3QWRA 3O8XD 4XVJH 1B6UA 2HVJA 3QQ3B 4LVOB 4XMKL 1TLMA 1KPVA 2QR0B 2BFVH 5I76B 3CZFA 1FIGL 2R4SH 4FQXC 4F80A 3C6LB 1WA0X 4HJJH 4RGNB 3SDAB 1Z9MA 4M7LH 4ZFGH 3DO3A 1TZIA 1NZRA 1HH6A 1LXMA 4YHKH 4NYLA 5AW7B 3FO1A 5KG9A 1P1ZB 3RNQB 5E4IA 4JG1L 3D2UA 4LNRB 3FSAA 2BOBB 3CUPB 5E2VL 1TSHA 2F08A 3MV8A 3UGUA 5JHDB 2NSMA 3B2DC 4TVPD 4A63A 4F9PC 2NUTB 3FCSB 4R97C 3V5HB 4GAGL 1ZD6A 5SWSE 5IREA 1AQDA 4OUOA 1DN2A 3FSZA 1ILSA 3HE6A 5GGQL 4P2QA 2A73A 4XE5B 1BZ8A 3MRQB 1DQDH 2IH8A 4Y5VB 3ILEA 1HHGB 1JE6A 4H1LA 1DZ0A 2HP4A 2XYBA 4O9HH 3T1FA 4K8RL 4Z77A 1GYVA 3EYSH 1XSJA 4BSVA 1MHCB 2ZKYA 1KELL 4XN2A 1R3JA 1E30A 3GIVA 3VGEA 5DC0A 4C55A 2IPTL 3LN5A 1XGYL 4KKNA 3P54A 2HAZA 5F0MB 1RK7A 3VYOA 3HS8A 5GSRB 3QC6X 2DQEL 2K4WA 3GSQB 3IF1A 3MLSH 5E00A 3GDCA 3LJ3A 2EIZB 4I3RH 1OSZB 3GMOB 5J13C 1KYUA 1NDMA 1G6RL 3Q13A 1PD0A 1MCLA 3ME0A 5DHXB 4FP8H 1HS6A 4YHOH 3VMPA 4UNUA 1CF8H 2YARA 5KYXB 4EVNA 1Z32X 5DMIH 4PGBB 1FVEB 1T1ZA 4NQVA 1UM4L 4FJ6A 2HJKA 4KKBC 1L9NA 3FYEB 1BF8A 2HRHA 1SGKA 5C6WH 2VITB 4UTCA 3MFGB 4LRNH 1U21A 1E5CA 5D1ZA 2AQ2A 4GAJL 5D6CB 4B6ZA 4OGXL 1R17A 5BXFB 3C5SB 4G6AD 3ZE2F 1SOKA 5DJYB 3W39B 4PJ7F 2EXWC 4FS0A 1E9OB 2VDNB 4GO8A 1G9NC 3QHTC 4M5YL 4ZO6A 1TVHA 4M62L 2R23A 4F3FB 3UTSB 1XH0A 2FGZA 5F1IA 4DP4X 5DJYA 3W39A 3OV6A 1MG2C 2R29L 4PJIB 5DMKB 2FYYB 4PY7B 2V3EA 2DWSA 4W6WB 5F9WB 4RZCB 3EOBA 2CDGA 4H2AA 3SE4A 3V79C 1NFAA 4U1SA 4JFOB 4K3DL 3JWDC 3QDMA 1N70A 1T1ZB 1XL6A 3VA2C 1TTRA 5EEVA 1WJ3A 4V33A 4Y16B 5DEZA 4JFSA 5HDOA 4AQ8C 2AV1A 3B6SB 1P84K 2VXUL 4HCRH 5B7FA 3EIFA 3L54A 1XAUA 1L6ZA 2NY6C 4J3WA 4WVRA 4AVIA 3RVXC 1QLRB 2EIZA 5D1QE 4WWPA 3LHAA 1FFOA 1WGOA 2QPDB 2ZSVB 1JXKA 2EE2A 2CGYA 4LBAA 5F1KC 5A40E 2HH0L 2GBUA 4JJ5B 5GGVH 1HXYB 2ZWYA 4JO2L 2OZNA 3WYRA 4KUZL 2A74A 4OW6A 1JNNH 3VFTB 5K33A 1DVYA 5BOJA 3T0DA 1LO4H 1YPZE 4JFDB 3FCGA 4EN3B 3WKPA 4B5ZA 1CLCA 3LRKA 5L9DH 1BXUA 1S7WB 4BSVB 1I3VA 4XO3A 2KUTA 4XPAH 2QPSA 5I9QC 2J8UB 4H7VA 4E9LA 3BIBX 3MU3A 2KDGA 1TCMA 4DOHE 4HF5H 4V11A 4GXFA 4OD3L 3HC0A 5EO9A 4MZIA 1JHLH 5GGRY 4XB7A 3QZWA 2C1OA 4PBWD 2YJQA 3MA7B 2WVSA 1UWFA 3I75A 3TA4D 4BFGA 3MRCA 3EO1A 1X5JA 4P2OD 4HT1H 2DRUA 3L5HA 3QULA 4L4TD 3UACA 4I85A 4I9WE 4QKTA 5HHMD 1MFUA 1JNJA 1UACL 4IOFD 1SN5A 1BQLH 1Q4NX 4MRBA 2WB7A 5E9DD 3ZYZA 3QUGA 3O8XC 2LR4A 3WNKA 2XZZA 3LV3B 5LKNA 3AUVA 4RWYH 3Q5OA 2WB1A 5EZIH 4IRZH 1RZIB 2PWHA 1ZPLA 5I1GH 2X5PA 2W0LA 2HJLB 3BH9B 2H9GB 4ZS7L 2HVJB 3QQ3A 4IKIA 4MNHA 5LN4A 5IK3A 5A2KH 2NYKA 1GZHC 2CHNA 3LXUX 2E7BA 2JIXA 5C0BA 1A5FL 2QELA 5EWIH 1IVLA 1BZ7B 1TJIL 3H9HB 5F2FA 3U9PL 2QLYA 4Y1AD 3QZLA 1MNUL 3QSKB 1LP9E 2P3YA 4FQPA 1TQTA 2I26N 2B2XL 4JFDE 4JY5L 4UOQA 4YWGL 1V27A 1WBXB 2VE6B 4M93B 1X4ZA 4OCYL 3AY2A 3KXFA 4BZ1L 1IARB 4KKRA 4FL4B 4WW2F 5F0JB 4GRMA 4PJDE 4ZG1A 4NM8H 5F7AA 4K5NA 4F33B 1AACA 3VQ1C 5C8JA 3D39D 2LE9A 1Q9KB 2C3VA 3VXRE 1BBJA 3HN5A 3GEFA 4KZEH 4E9XA 1IBGH 5EDSA 3QPXH 2VW7A 2NQ3A 1MLCA 2XLLA 1BZDA 4IS6A 3GYRA 4LRNL 5K1JA 1FQ9C 4K5MA 4UT6A 3L1FA 2R2BA 3LPFA 2G5UA 1HAUA 4HUWA 3G6JE 4FE9A 3ZMNA 3DBXB 3UTSE 5B1JA 3SDYL 5DMIL 2A6IB 5B38G 1MZZA 4JQXC 5EOQL 3MRIB 5ESVB 5G4OA 2H47C 2VABB 5HYJA 1J0ZA 1A3LL 1ZS8A 3JZ7A 1JMXA 4U1GB 5KVGE 5SWQB 2IBZX 2QHRL 1C8PA 3CZKA 3C6LD 2D8KA 2XKUA 4LLUB 5CJ8A 4F7PB 2FGWL 3VCLA 1KB5A 2F7IA 1ADWA 5AFAA 3IRZA 1A6UL 3VD0A 2RQEA 2OMTA 3FUNA 3H54A 1H9VA 3B5TA 1F4AA 1JF1B 3GT6A 1HXMB 3O4LA 1QSFB 2XQBL 3JTSA 1MUJB 1MDTA 1Y6KR 1HDMA 3N5AA 3ZHKA 3MRPB 2FATL 1Z3GH 2CGRH 2X2JA 3D3VE 1NGWA 2VXVH 4L9LB 5DK2B 1AP2B 5F9DC 2VLJB 1V7NH 3DROA 3RQ3A 1QHQA 1R4XA 4MJ6B 2WXLA 4P46D 5JOFA 4IRJB 1TENA 3KYNA 4OD2B 5E99H 3K72B 1HZKA 1Y6MR 2W80C 3M1CA 3FO2A 3QXDA 5DLMH 5HHPB 3R7QA 4KTEL 4PREA 3CFUA 4LZKA 1XXFC 3DVGA 2QKSA 3PWUA 2EC9T 3E9TA 4BUQA 2Z92A 3BP5B 1RZKC 2ZUQB 2WZPA 3Q6GL 4FEMA 4H26A 3V0VA 1K2DA 1QFWI 1OARL 3MXWH 3APMA 2P5PA 2UXTA 2UVEA 5TQ0H 1VLXA 4JKPH 4RQQB 1EBAA 2R39A 3HBGA 2A83B 5HYEA 3ZZ1A 3SDCA 4OI8A 5BS0B 4WNQB 4E36A 5T1MA 1V05A 2W9DH 3VRIA 5L2JA 1GA2A 5A6LA 2FZ3B 5T1JA 4JPKH 4X99B 4KKLC 4K7PX 1G9MH 1TYEB 1YC8A 2WWMD 2P8PB 3GI8L 4W9ZA 1T83C 4PS3A 1H0DB 3RDTC 4QRPA 4J1UA 1ZLDA 4HMDA 4RDQG 4DQOL 4TTDD 4IIQA 4HK3N 5BRZD 3V6ZA 3DV4A 5JHLA 1UFGA 1P4UA 4IDJL 4KVPA 5C0EB 1ZOXA 2HJFA 3KPSE 4JFHD 3CDCA 4E0RB 2R69L 2JJTC 2XFXA 5D4HA 1Q0XH 2JQZA 3MLWH 4A67A 3L4YA 4KRPD 3AY4A 3MA9H 4RIRB 4YSRA 4NQEA 1AZUA 1EZVX 4M6MH 1F6LL 4ZTOL 3HRPA 4YVNA 3KL3A 4XVSL 2VMEA 4U1LB 5CKAA 4HULB 3A47A 3GMQA 3QJQB 5CEYB 5DDHB 4GG6F 1F13A 1I3GH 1IRAY 4LOUC 4GUPA 4ZW5A 3WKYA 4QXVA 2NNAA 4PJBB 1GH7A 4I2XE 5EZJB 2IH3A 3CXHK 3VSTA 4HKJA 5GRZA 1IGFH 4PJHB 2DQGH 3BPOB 4PY8J 3LXCA 3W56A 2XXFA 2EVGA 4LSUL 4N0CD 1U30A 1I8LA 3E2HC 3I6KA 5G4MA 4JQVA 1BCIA 2CBOA 3T6WA 3W81A 4AH2B 5I0XA 3IBOA 3CXHJ 4A2LA 4HCFA 2VUKA 2ZX6A 1IC0A 5I8KL 1WD9A 3RWGA 5CCKL 4YHPB 1OVZA 2VXSL 3AVEA 3VCLB 1FYTB 2EDJA 2VZSA 3NIGE 4IRJD 3RIFF 2LAGB 5I18H 4OLEA 5B7EA 3GSXB 4BKLB 4LEXH 1CZ8L 3S3BB 5E8DH 3RWFB 4A66A 1SF3A 3D50A 5AW3B 5KVFH 2J8UF 1SHSA 5ICXA 3IXTB 3GUTB 3N44B 1RHHA 4HS3B 3B2XA 3OG6B 2A4ZA 1AI1H 3QNXA 3P3RA 3PIQB 4HC1A 4WW1B 5EG6C 1I1AB 4I3SH 3VD1A 1EFXB 3U79A 2X6UA 3U1PA 4R4BA 4GG6B 4YBHA 3SO3C 3TVMA 3U36A 1MI5A 4BFIA 1KTDB 1VFUA 5DFVC 3VI4A 2G5BA 4J3OH 4ONFH 4KJQD 5L8JB 4ABQA 4FFWD 2AKRB 2DQMA 1IEBA 4X50A 4G6FD 1PG7H 4TMPA 1N0XL 3D33A 4PW9A 4DP9X 3F7QA 4FI8A 5FK9A 3SPJA 1JP5A 3Q05A 2HN7A 4KI5C 4HZ1A 4RMWA 5DRXA 5A3ID 4E41A 4UTBL 3BUIA 1NKRA 1VPOH 1Q72L 4Y8DC 1DFBL 5E9DB 1ZEAL 4D0DA 2DH3A 4WAFA 4MX7A 2MFNA 2WK2A 4APQC 5EOCL 1NJ9A 2FCBA 4IHOB 1HQRB 2IQAB 1FBIH 4XC1L 3RI5K 3S9DB 4XHJD 3F00A 1I82A 1I8IB 3EDJA 5FF6A 4FXGB 1FE8H 2DEYX 4XPFH 3UX9B 3H7BA 3WJJA 4MJ2A 1ZV2A 4DT2A 1FA4A 2HLEB 3VFUB 3F64A 4JFPB 5E9AA 1E9PA 1NL0H 1E5ZA 4Y1AB 4KKPA 1M57B 3OAUL 4TVPH 2ZXCA 5I8CB 5I1HH 1A3LH 2A6KA 3QIWA 2X7LA 1H5BA 4G6MH 3SD5A 4AJVA 4ZD3L 3OF6D 3QUXB 5AOIA 4X7CC 3HMXA 1NGZA 5F8RC 1R3LA 3SGDI 2ED8A 2UX6A 1G1KA 3D39B 3JT2A 1MREH 4PJ8D 1M4KA 2OXHA 2AJSL 4X8JB 5LG1A 4CADB 3CAFA 3V4UL 3FUFA 3BGMB 2B16A 1MHHA 1SJEB 3NSJA 2OXGB 4TNVF 4Q0XH 3WOVA 1PEWA 1MFAL 3BYTA 5GRVL 4L5FE 1BREA 3WL9A 4UANA 3SKNA 1CXFA 1I7UA 3B43A 1JZ7A 1JWSB 2JF1A 4XRCA 3NSXA 1SNRA 4IK7A 3GLAA 3E1F1 2ZYSA 1ITCA 5TGBA 2PCXA 4MMXC 1QEWA 2E9WA 4DZ8B 3LEVH 3ABKB 4LSQL 2VUYA 2X9ZA 3OBAA 4UNVA 2VXQA 4X4YA 5CJOH 2ZSVA 3L3OA 4R0LA 3EG9A 5CU9A 2Y07L 1ID2A 2Y3AA 5EWIL 2NW3B 1ZLUK 2DW5A 4NN7C 4P2RD 4P2OA 2XWCA 1HSBB 5M94B 1FDLH 3L4ZA 2WXPA 3DA0A 3C8KB 3B6SA 4NUQA 2AV1B 2I07A 1ITBB 2V2WA 4IU2A 5ERWB 3MJ6A 2FJHB 3I6SA 4UQ3B 2YXMA 3TT3L 2ATKA 3PU7A 1JYWA 3R06A 1DBBL 1UOKA 1OTSC 3QDMB 4XP9L 3S5YA 2ZCHL 3NCFB 4F2EA 3KH3A 4B60A 3VXQA 5AYTA 1JK8B 3F6LA 4KO6A 3IDMA 2YPKB 3SDDD 4KVCH 1B3IA 5DQ9A 1S4IA 2MHAA 3OKMA 3OKEB 4N2KA 3GKWL 4DN4H 3OZLA 2R23B 3VFSA 4LHUD 5DHDA 1ZS2A 5T5FL 2BWIA 1QATA 1EEZA 4TQPA 3V52H 1NBVH 3BAEL 4ZZKA 4WDIA 3OHXB 2BC4A 5E4OA 1FC2D 2D03H 2XWTA 5CJQL 1CGVA 5F0LB 3WTVA 2E5EA 3KWUA 3KL5A 4PUBH 4LVEA 3ZE0E 5KSBA 1Z6JT 1VFBB 1OP4A 4X7FC 1JV2B 2O5ZH 3AT0A 5AW8B 4WI8A 3H4FA 4JE4B 4F8NA 1GGTA 4JFFE 5FYKL 2EH7L 5MENB 1A6WH 2H6OA 4HXAH 1HZHL 4M4PA 4LKCA 1UH4A 3X12A 5HHVH 3MLVH 3ETBF 1G5AA 4PG2A 5D2LB 4S2SB 3EZJB 3CIAA 3K6FA 3VXPA 4I4WA 5JTWA 3BQVA 5FGCB 4M7KL 3IXAB 4FABH 1B90A 4WFEE 3N1PC 1YEEL 4ZUUA 2W65A 3JV0A 1PS3A 2FSEA 2Q8BL 2YQ3A 3X3FL 4EAEA 3O9WD 5EB9A 5GGTA 2FB4L 3CSYA 5BMFL 5FLVA 5JORA 4AJWA 4PWHA 1K8DB 4QR7A 4DH2A 2MOVA 3GJFA 1VCBC 1DUYA 2FUQA 1HKLH 2Z93A 4PRBA 4Z5RB 4O51A 5E70A 4ELKA 3TA3C 2Q86A 2CJTA 4FEIA 1IILE 2GY5A 5FYJH 4KY1H 1LILA 4PP1C 4UTAH 2IPKA 5GJTH 2DIAA 3PXJA 1IGCL 4KI5D 3SPVA 4ZFOL 2ICES 1JWUB 4U1JB 3HFFA 4XC3H 5HP5A 1C7TA 4ESKA 2VRQA 4N68A 1HTYA 1Q72H 1LDPL 5IR1B 3D2UB 4LNRA 5C7ZA 4J3OC 4LLYB 4ZOAA 5E6UB 4KH9A 1XCQA 4GAJH 4KO9A 4LSDA 2P80D 2X4NA 2WIIA 3JTBA 4HAGA 4NSKB 1JBJA 5FAAA 3G6DL 5I2IB 1TZIB 4ANWA 2JTDA 1DVTA 5CHNB 2AQQA 3QJVB 4WQOA 1MRCH 2EKSB 3HKZA 3MREA 3D85D 4LHUB 3WE1A 3GHBL 1KPVB 2QR0A 3KH4A 3JWOL 1DQJA 3RKDC 2KZWA 3FRUB 4AQAA 4PV9B 5JDSB 3NCEB 2P5EE 1FPTL 2JI3A 1LE5B 4AW7A 4GQQA 4I1PA 4GB9A 2UXGA 3GXDA 1XWVA 2AP2A 3CVCA 4PV9A 2YPVH 2GTWA 4FFVC 4NQCD 2A9CA 5TPWL 1YNKH 1ZWIB 4JQVC 1YPZA 3D1MC 4YAQA 5FEBA 4XMPL 5JW4R 1L7TL 4N2EA 4XAKE 5GQBA 3U46A 3PUCA 3NZSA 3FQUB 4M6OH 3UZQB 3AQXA 1QPKA 2EXWD 4B9ZA 1BGXL 3DO4A 3L8QA 1EFXD 1F8TL 3GXUB 3MLZL 3UC2A 3WY3A 3CFKA 2F53E 2IV8A 5I1CL 4PLKD 1C08A 3D9AL 5HGBA 1ES0B 2XN0A 5CWSA 1NFDB 3WSQH 5KBDA 4TUOA 2ZONA 2B3IA 2QVKA 4XXWA 5JYMA 4F7CB 1HOCA 1NMCC 1NLDL 4Z7QE 3DIFB 1J9SA 5KAQG 1X5ZA 2IPKB 3O9WB 4BQ6A 3VU1A 5LGHL 5F7FA 3HKFA 1BVZA 1IGFL 5FM5M 5GRXG 1JUFA 2QV4A 2Z65C 4QJ3B 4K8RC 2Q86B 1S9WA 2VKXA 3IYLW 4OF5A 3MUHL 3RWJA 3LRGA 2R7EB 5E2VH 2YN3A 1V3LA 2BP3A 1JD9A 5HJDA 2IWFA 1CIDA 4HCIA 3ZMRA 1L9PA 5T3XH 5CBAA 1E65A 1TDQA 1TNNA 2IMMA 4OZFA 4P06A 4YHZL 5IQ9A 2PYED 4M6ML 5IM7B 3T6VA 4ATTA 4QRUB 3HEIB 1ORSB 1GJUA 4HQQH 4AQ1A 3M88A 4Q14A 4KAQL 2NW2A 4MZ3A 2P24A 4RAVA 5G5DA 4OCXH 4KJPC 3C9NA 3MV9B 1KIPA 1CTMA 3DVNA 3MOBL 1VERA 2WOBA 2R69H 3JUYA 4WWID 3S8WA 3N9GL 4XCYB 1AHWB 3RDTD 3VFSB 3KJ6L 3WHXB 1INDH 4DN3L 2H6PB 2WXFA 3FU6A 3QEQE 1AGBB 4KJYA 2DV6A 4RNRB 5CSGA 3FB6A 3SO3B 2G3ZA 1FFNA 3OF6A 1FAIH 2NY5L 3BCDA 4PJEB 4HUCA 3CXDH 1YRKA 5FO8A 1N5AB 2ZG1A 2IDQA 3QDJB 4E9TA 4TVSa 3O3UN 1L7IL 5FW8A 2BK8A 1EFQA 1KIQB 2W60B 3I3BA 3WDHA 4S1QH 3OKLB 1L4IA 1IB5A 1SHWA 1LO3H 2K4AA 4JKNA 3FTGA 1KGJA 4LARH 1RMFL 5E9NA 5GZOD 5KZCB 3VRLE 1H6EA 2GC7C 3UROR 3PJLA 3E2HB 1NIEA 4JFDD 4EN3D 2NY2B 3IETA 2JKTM 4R4FH 2JQAA 3KLLA 4M56A 5SWZB 2BDNL 3QQXA 4B41A 1HHJA 3U48A 1S7TB 5DT1L 4P46C 2F8IA 2LW3A 3MVSA 4I0PD 2IO5A 2CD0A 1QRND 2DQUL 1MJ8H 1IKFH 2H3NB 1YEGL 1CDUA 1E6JH 1H3XA 3R06B 4AMXA 2EDXA 1Z3GL 2CGRL 5IB3B 4FYTA 3GMMA 3NZ8B 4OF8A 1Q9OA 3F85A 5HBBA 4X8JA 4A39A 4CADA 2GJZB 4P2OB 5A2AA 1QLFB 3CFBB 5ALCL 3D85A 4FQLL 2JCCF 3VH8G 1NUFA 5EHFA 3VSQA 1IMHC 1HSAB 5JOPE 2A9MH 3WNNA 3IJEB 3AS3A 2XJKA 2PO6A 3SBRA 2BNRE 4HKZA 3TYFA 3S5LB 3MUGA 4U2YA 4LDOB 5TGBB 2DIJA 2HB0A 3Q8CA 2YD6A 2DDQL 5HVWA 3DTUB 4I9XA 2VGLM 1D5MB 4JB9H 3LDBB 1LTXA 1I85A 2AERT 2ZJSH 3UPCA 3H3PL 3LEYL 3WL9B 3RWEB 4JUSA 1MXGA 2NY0C 3D3VD 2DLGA 3FOLA 2QGCA 4NEHB 3H7BB 5L7XH 3ECBB 1K6QH 3B7RL 5FYLE 5BZWB 3MNMA 3HMWH 3PREA 2G2PA 2O5XL 4X4KA 5DYOA 3C08H 4QYOA 5CIPH 5D4IA 1SJVA 3TCXA 8FABA 2B77A 3O0RH 4M3JA 2VZOA 1FG2B 1RUMH 3QA3B 3ES6A 4GKZA 1KBWA 4YGVA 2QQQA 3BUBA 3IJHB 3TJEL 1OHZA 4M1CC 5D1QD 4ZX3A 4H5SA 2WJ7A 4PB0L 3OKDB 4JREC 2B2XH 4JVUA 4IJ3B 3FUDA 2AF2A 1X9UA 4GEJA 4IBUA 3TBSB 1NCNA 1CLYL 1NCOA 1CICB 2VLLB 5LO7A 1S46A 2VR6A 3QWNA 1ZANL 4WTQA 3MRFB 4N90D 5H2BB 1WPCA 1S3RA 3IMUA 4RA3A 2A9NL 3O3AB 4NT6B 1MIML 1OM3H 1CGXA 4BFIB 1A4KA 4IOSA 2W92A 3OKOB 4NRYA 3O2WH 1TCRB 4AI7A 3NCMA 2QTVA 4JS7A 4N24A 1OXYA 4HU8A 4PCSA 1DO5A 1U3YA 3GSVA 4X7DC 4WI3A 3QUYD 3MJ7B 3NIFF 4KJQC 4UM8B 1QRNB 2CO6A 4QT5A 2CRMA 3SODB 5DRXB 4DK5A 1FL3A 1EJFA 1RZ8A 2YA2A 5ILTH 1RZKL 1J48A 1BXAA 4LIQE 4AYFA 4QT5B 2YC1B 4I3GA 1QRNA 1NPJA 4X98B 4X2UA 2E8ZA 5B39G 1TU2A 2GBAA 2I25N 2BIOA 1AXIB 1K5NB 3O3DA 5DZ9A 1WAEA 5K9JH 5FDWB 2G0KA 3AW5A 3JWNC 4ETQB 4KV5E 1INDL 3DETD 2WSKA 5F9OL 5CLWA 4N0RA 4EZLA 3BFWA 3MRFA 4P46B 4UV7H 3PGFH 5AYQA 1IGIL 5I30L 2VO5A 3TLRA 4OKVB 4PW4A 4FG4A 5DGQA 3VXRD 4KJPD 4ZFZA 5CJ5A 2JLLA 1DBML 3HFMH 4GUPB 4KXZH 5I6KA 1MCPL 2AEQH 2HTKC 2M8XA 3MYJA 2EYSB 2ZWZA 1FYTA 5GGUB 4GMTH 3BX7C 2O5YL 3UYOD 4G8GA 3I9IA 4FMFA 5GS1A 3RWGB 2ESVA 4GSQA 5C07A 5D7IE 4AH2A 5FFLA 5JIQA 3AT8A 4TNEA 1NGPL 5HDLA 3V4LA 4OUUA 5I6OA 3C60B 3FOLB 3V0FA 2V17H 1AOHA 2FLRT 2XN9E 4P23D 5C08E 4L2YA 3S0PA 3T0EA 2YGNA 3T2LA 4HWEH 4NKDA 1TNMA 1YN7A 2L7JA 3D9AH 5J4MA 4PWKA 1MCOH 4HBCH 4JMXA 3MLRL 4Z7WA 3QCVH 3WS3A 1GGBL 3P73B 2FWLB 3E1ZA 4K3DH 4R7VA 4HKZB 3TYFB 1T1YB 2DWYA 4RCAA 5CCGE 1SZNA 3QQ9C 3MV7B 3OB0K 4O00A 5SX4I 3VTTA 4QJ4B 1XHHA 4KHXH 4OF7A 3CHOA 5JDJA 1CL7L 1QABA 1IC1A 2GJZA 3TBCA 1W6LA 1CO1A 4P3CL 4UILL 1YMME 4OQTA 3AY4C 4L4TA 2JJVA 3R1GH 3SDAC 1T03L 4ZFFB 5FO7A 1IQWH 3H9SE 2VQTA 1OTUC 3M6DA 5I8OH 1FO0H 2Z9TA 4GJTB 3DTXB 3RB7A 1WHOA 5C0ND 5I15H 5C0GB 1H0DA 4BQ8A 4IRJA 2ITDB 3NRPA 3VFNB 5LUMA 5JMOC 4FP8L 1J5OH 3BO8B 1U8JB 2FEDD 3IFNH 4HWZB 1T03H 1RZPA 3ESMA 5CO1A 5DK2A 3REVB 4NQSA 2XXGA 2EDOA 3BAWA 1KXVC 1QI5A 3MLSL 1JF1A 4WY7L 3TTSA 1QI3A 3DXAE 3AT9A 1MFDH 5JHAA 5KYWA 1KF9B 2OMTB 2BNQE 1FLRL 2CLVA 4GKNB 1T22B 1E3XA 2B4CL 1A6VH 1A9VA 2ZD0A 3MXVL 1JNHB 1JYVA 2OCFD 4D8PB 2YXFA 2BHYA 3HLKA 4O9HL 5HHOE 4OM0H 1OGTB 2JCCB 3GTTA 1R75A 3K72A 2O1AA 3KYNB 2MQCA 3EGSB 2X2UA 3MRIA 4MJ6A 4HWEL 2A77H 2ED9A 5ID1B 1HL9A 3DROB 3WFBL 5JPMB 2C7UA 3IFPA 2B15A 4KNSA 3NIDE 5CGTA 2YLHA 5F7BA 1JCKA 1NGXA 2X6CA 4A7VA 1H8NA 3G3LA 4X9FA 2W88A 2NR6C 1MRDH 5EU3A 3BP7B 4FABL 2AJUH 4JFTA 4WV1A 4Y1AE 3ZRSA 2XCMC 3QZPA 1TYJA 2A6DA 1RZFH 3N3EA 3SDDC 3CDFA 3L1OL 4HXBL 4HH9A 4NKOA 3ZHDA 2OSYA 2ADGA 3GXMA 2BS9A 4MCZB 3AREA 5DVOA 4XVUC 4PRDB 2OMZB 5FUZH 5HHVL 1PD6A 3DJ9A 4Y4HD 3V0WH 4MNQB 3KYMA 3GMPB 5DK3A 4PHXA 2M1KA 4Z8FL 3QYCA 4AGQA 2VN7A 4ZAKA 1A9EB 3GF8A 2HFGH 2BFVL 4F9LC 1XXDC 3BP4B 2CPCA 3UXFA 4WHDA 4L1TA 4NGHH 3NUKA 2VR3A 1D6VH 2D03L 2AVGA 4NENB 4NXSA 2FL5A 5I16B 1C08B 1H19A 1VIWA 3DRQB 1MLCB 1S9VB 3QRGH 3LZNA 4UDTB 3ROLA 3CFKB 1KXVA 1HYSC 4IOIB 1YJDH 2V9RA 2VR9A 4GW1B 4P2YA 1IO4C 1ZVYA 2EXTA 4JCMA 3T4YB 1IUZA 5ID0B 2BMKA 1VKXA 2FD6L 5AZEH 1XH3A 3TZVC 2E6JA 3HIZA 5J57B 2XNAB 4MA8L 1EHNA 1ZJBA 3V6OC 1O6SB 1BQHB 3CFNA 3G9AB 5I75C 1KEML 4PJ9D 3X1EA 1YPZB 3QUXD 4N25A 3SQOL 4UTBA 1QLEH 3QFJE 4LMQI 1N18A 5EC1A 2W9LA 4GFTB 4APXA 1I8AA 1OHQA 1FIEA 2KKQA 3D4CA 5AZUA 3T6XA 2ERJC 5AUMA 5TF1L 1G7IB 1XIWD 4HEPA 2OW6A 3UP1A 4G6KL 5D1QB 3QNZB 1DQJB 5ALBH 2YMXH 1J12A 3RWDA 2BPBA 3MNDA 4D3CH 1KDIA 2ZAHA 3LH2H 3MREB 2QKIB 2Z3FA 3SDXF 3NN8B 2JE8A 1J18A 2FHCA 2VAAA 2LVEA 2BP5M 2CJSA 2I85A 3V8OA 4G7VL 2H32A 5DYFA 4KO5A 3Q1SL 4PB0H 3UIZA 3ZL4L 2ROXA 3BPCB 2IANE 3BKYL 2JCWA 4HJSA 3DXAD 5CLXA 3VXUE 3ZYJA 4NWTL 4IMLA 3KLQA 1JN6A 2ADIB 4QHLA 1H3WM 3WAJA 3UP6A 1MQ8A 1JWUA 1HXKA 2YSSB 1N7MH 3UO8B 3NJNA 3ET9F 4U49A 4PV8B 3MRCB 3EXJA 1MJUL 4IKJA 5CZXC 5HDBF 3QAQA 3NA9H 4G1EB 3QPKA 1HEZB 3PF2A 1I9EA 5DMGD 5CEZD 1QPXA 1QBMH 4U7MA 3G5WA 4FQIH 3EXLA 3JWNE 1K6QL 2D0FA 3FTWA 4YC2B 3TNMA 1J8KA 1T2QH 2IQ9L 3SJVE 4OV6F 1F11A 2RACA 2RB8A 2DOCA 4JM2D 4IMLB 3T0EE 4FFYA 2HT4D 3X1NA 3LQAH 4QCIB 1U3ZA 2FBJL 3K8LA 1E4XI 4YXLL 1JVKA 3H9ZA 3HI5H 3ATDA 2AK4E 2E7MA 2WNWA 3O6KH 3W57A 2A9ML 1T7VA 2MCAA 4HIJA 3KPSB 1CQKA 2EDBA 3UTSA 2R0LL 4P23A 3T0ED 3U2SB 3KLHC 3LD8B 2F9BT 3ESUF 1KGWA 2VDLH 4OTXL 1ED3B 4N8VA 3V0GA 1FORH 2XV3A 3MLYH 1DLFH 1FBIL 4TQIA 1SY6A 2IG2L 1M2VA 1CFVH 4EZMA 4G8GD 4DGYL 2DQUH 3E8UL 1YMHB 3CZJA 3O6LL 1FVEA 3TN0C 4PGBA 4OZIB 1F5WA 3C6SA 2J21A 3VFGL 4JRFA 3RWCB 3VRJB 1A0QH 2XYCA 3L5WB 5KYXA 3DOSB 3MRBA 3VQ2C 2E7DA 5AVQB 3VI4F 3T4YA 5ID0A 2XWRA 3IJSB 3U4BH 4F3FA 4P23B 1T7XA 5KVMC 2QPEB 1INEL 3GSQA 3U4AA 4TRPL 1VRSA 3IFLH 5CF3A 2XPGA 1BBDH 1AXTL 4XVTL 3IJ8A 3OAZK 4ZFQA 3T0XA 5IVXE 3TWCL 3BRGC 3IGLA 3L6FA 2NSXA 2C1PA 3MBWA 4XHQA 2B0SH 4W9IC 4OIFA 4UQ3A 1FAIL 2NY5H 2PETA 2ENQA 2C3HA 3LKQA 4FYSA 4Y5VA 2B9BA 4PVMA 4P9ML 1FP5A 4YDKH 1URIA 1RVFL 3DJZA 5FECA 4JQXA 3TNNA 3KYOB 3DX6B 3HZKA 1U8OB 4M5SA 1QR1A 4BE5A 2QQNH 1W6WA 3ZJAA 2F5BL 3FPYA 4FXKC 3HMXH 3BP7A 3MLTA 1O5PA 3QWQB 4U6XB 3Q1EA 1HFUA 4PJBF 1R47A 4W9KC 4RRPM 5TDNB 4IRJC 5CLTA 4YDJB 4AIZB 2PMZA 1L5GA 3IMRA 4LSUH 1CI5A 4GT7A 3UJIH 5T3XL 4JM2A 4KI1A 2Q6WB 3QORA 2NY6D 4M3KB 3NABL 2JJSA 5MEPB 1II4E 4CJ1A 2YAOA 2PPDA 4G8EA 3UGXA 3ALWA 5HJ3B 5SWSD 1IBYA 2WUCH 5F97E 4DJMA 1OGTA 3DX7B 3C6LA 5AAMA 3WTTA 3O2DH 5IOPB 4N0YL 3RWDB 2D7OA 5D7JB 2IBZY 4B9CA 4WLCA 1LD9A 3QCTL 4S11A 1QA9B 4FZEL 2VRAA 5AVWB 2DKUA 5FHAH 2A4CA 3ARVA 4L4VE 3UEQA 1H5BB 2GG1A 1M71B 4DTGH 5KJRL 4PRPA 1Q0XL 2NT0A 3B2UD 3OGOE 5H4ZA 5HJBA 1EVTC 4MZ2A 1G1YA 4PRHE 5DJ2B 1AYRA 1R3HB 4B3VA 3C6EA 4TXVB 3E3QE 3L3JA 3K7UA 5HJGA 3VXME 2ED7A 1U8JA 4HWZA 1KXHA 3BO8A 3EO0B 2XTJB 4QOKA 3MBEA 2JLPA 4AIXA 3HZ3A 1Z9PA 1UCBH 4BFFA 4H2CA 1A47A 1A6PA 3P4NA 4HKBA 5EFIA 4XMPH 1KN4L 3KPRD 2ZSWA 4LQFH 4CGUB 2CRZA 4NO5B 1BFVL 1CYWA 1TJMA 1W72A 3DRQA 2JKXA 4MQ7A 5HDRA 3S37H 1X6NA 4XCFL 5EOTB 3VWJA 1K3ZA 2F58L 4PLNC 5IEKB 4AYDC 2YLKA 3WE6B 4R26L 3U6RA 1HOEA 4PLJD 5E9DA 4ZS6D 4PAZA 3VD2A 2ZYHA 4WCYH 2ZXGA 5AOMA 5JPNB 3FHEA 4HUUA 1FSKC 1OARH 2VQUA 4L0PB 4WKXA 4JZNA 2HFFA 3GRWA 4TULH 5E6ZA 4IHBA 1JGIA 2KZ1B 4WKZB 3BPOC 1U8PB 5JOPD 3AREB 2MTAA 4MCZA 3HC2A 2D4DA 4IEFA 4UV4H 5EUKB 4L0ZA 2G5RA 5E2UL 4NP9A 3N43F 3TVMB 1CG9B 1WK0A 4WV1B 2D7NA 4EE2A 3RI5F 1I8MA 3OC8A 2GJJA 3MOAH 2J8UE 3ILQC 1UKTA 1OF0A 3EOTH 4PCYA 5HI4D 3PIQA 4AV5A 3ZL1A 2AZUA 3P4LA 2ADFH 5ID1A 3EJCA 2OLDA 1CDIA 3WCYA 3SDCD 5LDSA 4DO6A 2MQ3A 3IU3B 4RMVA 4DF9A 2ZXQA 3T0BA 5IT2H 2TAAA 4PD4J 3VACA 1FL5B 3BLPX 3U9WA 2QEJA 1HNYA 1LJMA 5D7JD 4R7XA 4YLBA 1I53A 2CHWA 4JFQB 4PJ5E 2UX7A 1TJGL 1FF5A 1U91A 2D0GA 2QVIA 2E9IA 2P43B 4OCWL 4OJYA 3PJSB 2HLFC 4CDGC 3L95B 1R5WA 4P46A 2HZHA 5AW0B 3UTZA 3CSBA 1A4BA 1I4FB 3I85A 5G4NA 2H2SC 3NACL 2Y36H 2BOCB 2FLMA 1U41A 2ZE0A 3RTQB 1ZT4A 3RHWF 3U7WL 3NH7H 2Y7SA 4A55A 3O3DB 2WXJA 3EDKA 5IHUL 2FWOB 2WNXA 4G70B 4QXGL 2WXMA 2LAAA 5KVEL 2VZ1A 3OPZH 3D0VB 4JRLA 1XQ4A 2TRYA 2J2ZB 4LPTA 4R84A 1ZHKA 1C8QA 5AW4B 2Y2YA 1GYUA 1T3FA 4OLZL 5CJQH 3I9PA 1KY7A 2F54D 4YWGH 1BWWA 5DVKA 2XJLA 4FD0A 5DUMH 1I31A 3QRLA 2EE0A 2DWEA 5EO1A 4YXKH 5E23A 4TYUA 2F1BA 2ENJA 3KPOA 3QAZB 5T5FH 5BZDB 3OL2A 4RDBA 1G9NH 3R4RA 3F7KA 5F7WC 1XGRA 4GI6A 5JA8B 4CW1B 1XF5A 1EWHA 3DMMD 3MJ9H 1MFMA 1RJCA 4JHAH 1YY8B 4TQEL 1VA9A 1WFNA 4NIKB 4XXDA 3OXSA 2BRRH 2OI9C 2Q0ZX 2FJFA 1SYSA 1DN0B 3KPSD 3GLEA 3PWLB 3F58H 2WLNA 5TE7L 1FNAA 3OLGA 4PJ5A 4Z1PA 1L3NA 2N4IA 4EUPG 3RBSA 2GUOB 2BS71 1BQKA 2G3MA 2NXYB 1JXJA 3GMNA 4NQTA 3X3GH 5FKAA 5IFJA 4EF3A 1U8CB 2BVYA 4AYGA 2NZ9D 3T0AA 3DJTA 4HDIA 4XVUD 1IM9D 2VMDA 1XMEB 2CUHA 4KRMB 1B0WA 4UZUA 5FB8A 2WKLA 1E4XL 1J05B 1JPEA 4GRWB 4I0KA 3W37A 4LK4A 2DJSA 2DYPD 4OLWL 4UOW1 3ZOAA 1CUOA 3MO1B 1UD5A 2ZTBA 4P5TC 4B7LA 3AREC 3FONA 3DHJA 2HFTA 4PJ6A 5EUOA 1SEBA 3DX9A 2ZPKL 3BDXA 3BVUA 3PWLA 1ZAGA 1DN0A 3OAYK 1YC7A 3EJZD 4P5KA 2V9TA 5DQJB 3TEWA 2OR9H 4ENZA 3C2AL 4YFEA 4LSTH 1I1FB 4K3JL 3BUQA 1OPOA 1J1OL 2ADJB 1IE4A 1G7HB 1WYJA 4LVOC 2XU9A 2EDWA 3ZE1B 1PJ9A 1XF5B 1HE7A 3ETTA 3QUYB 3U0PA 4JG5A 1ZLWH 4BK5C 5BZDA 3FH8A 4XTRD 1SXAA 4X98A 1V3JA 2BVOA 1I75A 1MY7A 1FZKA 5DJZB 1E9QA 1U92B 2XRAH 5HYJB 1P9MC 3UBXB 1J10A 5H94B 4B9GA 4LCYB 4NCC1 4F92B 5I1LA 2ZF9A 1VGKB 4H20L 1FE8L 3GSVB 3OJVC 5T5NG 1DJWA 2OJEB 1SLXA 3S97C 1NTDA 3PDDA 1AR1B 1YN6B 3FUHA 1CN4A 2CIKA 2R29H 4AGOA 4MJ5B 4BFOA 4CUCA 5JNYA 1Q9KA 1PGRB 5DHYB 2C8NA 2J1KA 3ARBC 3FTSA 1XZ0B 1KCUH 3FSWA 5LQBH 3MJGX 3MGAA 4XNXL 4F33A 1W0VA 4OFYA 4KDTC 4YXLH 4W9CC 4XN7A 2UXVA 4S1SH 3PS6A 2WQVA 4H44C 3C2SA 2WPGA 4U4BA 4Q52A 3VO0A 1JZIA 2UUDH 2ALWA 1FL5A 2BVTA 4MB4A 1CFQA 3Q06A 3QHZH 2Q87A 3QAZC 1XGTB 5IJBC 4YSTA 1MAML 2JB5L 1MI5D 2GJ6A 2R1YA 3PQYD 1IBZA 3LQZA 3D0AA 1XTLA 2H6PA 1A6AB 1JWMB 3FU9A 1NANI 5FYKD 1IM9A 1IEAA 2D2OA 2ZG2A 4HWBH 4Q9BA 4PI0A 3G7TA 3OWEA 5E1AA 4FA6A 1YYLL 2X1QA 1UHVA 4HMEA 2YK1L 2DQEH 5JQ6H 3PWVB 1Z9SB 2ZPKH 3K81A 3MUZ1 1Q9WB 4MD0A 2CR6A 1P5VA 4Y19A 4ABVA 3HLAB 3DLQR 3IKKA 1RPQA 4HU2A 3F8UB 4U3SB 1ET5A 3MUGB 1W0WA 15C8H 1KYOJ 4Y4KB 5I18L 1KENL 2YQBA 5GGVY 3L17A 5J1AB 1U8QB 2GIMA 1S9WB 4FQCH 5CCKH 5MP6L 4PJXA 5IHZA 3S96A 3HAEH 2VM9A 2B9AA 1QLFA 3NK3A 4GIAA 1QP1A 3B1TA 3G6JF 3FSVA 3IS1X 3QUXC 3X3GL 3RJQB 4LF3B 1VFAB 5C0CE 4MBOA 1XMWA 3UAEA 1TZOA 4N9GB 3HNTH 4KPHL 3Q3GA 4V1DE 3T8XB 1PZ3A 5DXWA 3KVPA 1YECH 2AJVH 4KH2A 2Q7YB 2ZOOA 1GGYA 3FPXA 2ZSWB 4UWQB 4HUMB 2C9QA 5DEFB 4JAMB 3MGTB 4HUKB 1R0AL 1U95A 3MC0A 1S7TA 2ZNWA 3FQWB 4G9FD 3DMMC 1RL1A 4NKMB 5BCAA 5JIPA 3IT8D 4LSPL 2ZQKA 1I8LC 4X9IA 4D2NA 1SMOA 5HDQH 5LXGL 1OAJA 4JRYB 4JG0H 4JFZL 3JTTA 1HN1A 2J1XA 3VD5A 1QSEB 3GB7A 3DURB 5GISL 1D9KA 1M71A 4Y8AA 4NZUL 4JHZA 5F6IB 3LNGA 3WJMB 4PJ5D 5ADOH 1TG8A 3K4AA 4U3CA 1K4CA 1L0YA 3DJSA 5IVZA 4M7ZB 1YDPB 3EZ8A 2NZ9C 3S2AA 4Z76A 4LHUA 3ZDZB 3OKYA 1EHLH 1B4JL 1RSYA 2I9TA 1CGSH 3HRZC 2W0FB 3BFQG 1P7QA 3F7RA 3HC3H 4W70A 3SCMA 3DGCR 3QIUD 4BDVB 5GGRA 4JPKL 3QO1A 4Y4HA 3QORB 5FUZL 2AV7A 1J5CA 3FO0H 3D12B 5LWYL 1KYFA 1E9OA 4NFBA 2ZKHL 2HG0A 4UDUB 1X9LA 2AJUL 2WXQA 3MLTB 5D1ZB 4NXKA 3FQRA 4J3BA 4A7GA 3NRQA 3F62A 5J06A 1QR1B 2R56H 5IWLC 3TNNB 1KT2A 4L8SB 4A7SA 4OZFB 2XTSA 2WHVA 5CBAB 1JGLH 2Y5TB 1HHHB 4LLDB 3RG1C 5KAQF 4Q8BA 3EH3B 2PR9A 4J6RH 3P3UA 3U6XA 2ADFL 2W59A 3K2IA 5C2UB 3UAAA 1U2CA 3PWPD 3T71A 2AK1H 1M53A 4PJFF 1DQML 1NM4A 2CR3A 1EUUA 1BW8A 1URLA 5SWSB 2WXNA 3FF7A 3FT2B 4HPYH 6FABL 4AIOA 5E00B 2HMIC 3D0LB 2AC0A 3BPLC 3JV6A 2A0LD 5D96B 2EE3A 4WHCA 4O5LH 3BMVA 2E7HA 4CSTA 2WN3A 4HIXL 1YEFL 1S2EA 3QEUA 3RILA 4KZDL 1WICA 3MLXL 1ROWA 4R2GC 4YDIH 2OL3L 3CDYA 3MRBB 4N5ED 4IRSC 2W0FA 4YE4L 3SCMB 2X1WL 3MRKB 5DJXB 4Z7WF 2IWKA 5MI0C 4QLWA 2R15A 2RH0A 4N0FB 1BFOA 3U9UA 3REWB 4TUJA 4LBEA 1QSED 3N42B 1JG9A 1IQWL 1ET7A 2J88L 2DKSA 2BP0A 4UT9L 3TONA 5GGSY 1WHPA 4X7SL 5C0BE 2QGBA 3ZDWA 3C5ZC 4ONHB 3CUPA 4HD9A 3EH2A 3ETSA 2BSTA 1FLTX 4Z95H 3IDUA 3PCYA 3OKEA 3SDXB 1KGUA 3QO0A 1IC7H 4LHJB 5AVRB 2Q8AL 1AGDA 4BZ1H 2EZ0D 4GW4B 3CHXA 2VJ8A 2AEOA 3MGTA 4HUVA 3AFLA 4ZXBB 3WO4B 2H5UA 2OKMA 1AHMA 5FGBC 1UWGH 2FO4B 1F97A 4ZQKA 1JGUL 2YWYA 3T4AA 5IVZB 4Z7UE 1OO2A 3ULVD 3D09A 4XP6H 2M26A 3WJMA 2YAFA 4BFEA 5C70A 4BHUA 1RLWA 4TOYH 4LLQB 2KZKA 1UJ3B 3NQIA 5E6YA 2CIIA 4O51B 3L3OB 4R0LB 3SDAD 4ELKB 3S3CB 1QWUA 2G2RB 2YSSA 4NOFA 3EJQA 1A7QL 3CG8A 3FN3A 3P1VA 4AQEA 2HFEB 3C09B 4AVJA 2XZCL 5DEFA 2WV3A 3ZZLA 1P5VB 3N06B 3D52A 2WXIA 5DS1A 1I7UB 2H32B 1CYGA 2FJGA 2YPVA 4L4JA 5IROA 5AOLA 5FV2A 3DOIA 1JXGA 3SQBA 4KX7A 4UV7L 5F1OB 3NEEA 1Z5YD 1P7BA 1UB5B 1A22B 3HZMA 4Q74A 3D39A 4NBXB 3HA0A 3S96B 4P23C 1NGZB 4JY6B 1EEYA 1ZA6A 3KXFD 3RVVD 1HINH 2YD0A 1EEQA 2MJWA 2VZUA 4APXB 3C5XA 1KDJA 4Y4KA 3SGEI 5DHVH 2VDOB 1PKOA 2A2QT 3ARDB 1MY5A 1XAKA 1X9RA 5ELIA 3RPIB 1LO4L 4LLVB 4FNSA 2K6ZA 4Y19B 1CD9B 3TCLA 4LEEA 5E24E 4MNQD 1XH3B 2D2CC 1DVQA 4EI5A 3ZU8A 5I5MA 4LASL 4MJ4A 2Y7NA 3CZEA 5GS1C 4GW5A 2ZX7A 1G7MA 1IEAB 3RVUD 1A14L 2XV0A 4A7TA 2FL5B 4G59C 4HCRL 2I7OA 1YQ2A 3IDMB 1IC4L 5AOJA 4AYMC 4JZJB 4MBRA 1LNUB 1CFQB 4MXQC 3E8UH 4NP4L 4YBQC 3P9MB 4EIBA 1XGUA 1E8WA 4XZUA 2R2EB 3MTXA 2FJHA 5KN5A 4ZODA 5TDOA 3CN2A 5ADPH 1WEJH 3EBAA 4L1BA 1BD2D 1ZDQA 3II3A 2BHUA 1AZCA 3QJFA 3S36X 1RZGA 4M8QB 3S35X 2CDFB 3WIHH 4M5YH 4U05A 9PCYA 4TPRL 1CU4H 1IGTA 4K94C 2UY7A 4X4YB 4OGXH 3TV3L 4BK8A 3ARXA 5IMOB 4UT9H 3GC3A 1QEWB 2FBJH 3CQQA 1OALA 1ZT7B 4C4KO 2LTQC 2JH2A 3KVQA 2HUHA 4J3OG 4FHBD 3LS5H 4PP1D 4RAUB 2N7AA 1RHHB 4GG8B 4HS3A 3L1EA 1KC5L 3P0GB 4OSUL 2GB2A 3BGMA 3KYKH 5C0CA 1W72L 4F8QA 1OTTD 1JNHA 3QIUB 1WFTA 1OK0A 1J05A 2E8YA 3PNRB 4H0LC 5B4MD 4YHPA 4APQA 4N5EC 2CLVB 4C8XA 1ZXKA 1FNLA 4N6RB 1IEHA 3II1A 2Z8WC 3FTZA 3UOAB 2VB5A 2XXMB 4JFXA 1EJOH 1H15B 1RIHH 1BZEA 2WLYA 3GMNB 1SXZA 5I6XC 4PWJA 4HJIA 4MA1B 1RJZB 4WWKC 2CJUH 3GRWL 1Q1JL 3PWJA 2A0LC 3HS9A 2A1WH 4LCUB 3OXSB 1MJ8L 3IBEA 1FSKB 4UCFA 1GS6X 3POCA 3JQOB 3MFFA 3QUZA 4HV8A 4NM4L 4NZTL 1SOXA 1DQDL 2WLMA 1YY8A 4JPWL 3MO1A 3NCJH 4G6KH 2R56L 3WIAA 3VD7A 2EEAA 1L9QA 2NY0B 4G6JH 1XGRB 1DLHB 3HBQA 2X09A 3LIUA 1CDYA 4QDGA 3ZE1E 1AANA 1C12A 3WUWG 5DVPA 3V4PA 5D70H 5TE6H 2OV0A 1QZ1A 1H6UA 3CMOH 1JV5B 4MJJA 4J8RB 5IMLB 3I6LD 5FKAB 5LWYH 1B88A 4QO1B 5EZOH 1P7QD 3FO0L 3IGAB 1TVBB 3L4WA 2HN7B 5EU7E 3VDAA 3TZVD 5AVTB 2AABH 1OCCB 2EDKA 2DWTA 3AROA 2FD6H 4WO4D 3MV7A 5AZEL 5JIHA 1CLOH 4ZFGL 4GUQA 1M56B 1F6FB 4G11A 1P53A 1MWAL 5DJCB 5HGDB 1T0MA 3DUUB 1F90L 4ODTH 4LPUA 4FFZH 4QHNB 1FO0A 1MQKL 3SQRA 4OLUH 4NQUA 4XPBL 3HRZB 8CGTA 3KM2A 1U8KB 1BX2B 1PCSA 5GGSA 4ODHL 3INOA 4R4BB 1YEJH 4FI6A 3GIZL 1LVEA 3B5HA 4AYSA 2GIXA 2WQXA 4NZUH 3KNBB 1KTLB 3QWOA 5GISH 3SDCB 4P0DA 5HYQA 4OIIH 1HK6A 4E41D 4QKXB 1OAXH 4ODTL 4ZO7A 4HG4J 3AM8A 2ZKXA 1F86A 1K2DB 3V0VB 2JV6A 1JIBA 1MXDA 3QEHA 2CRYA 3SIKA 3MYJB 3BT2H 2P45B 5EPMA 5HHPA 1R3IL 1JK9A 1CI3M 2CLZB 2Y7LA 3U7YL 2EEXA 4AT6B 1P4LA 1CE6A 3Q2CA 1BM3H 5KSAB 2VDPH 2YD4A 3PV7A 3VU2A 2VLJA 3VE0B 2VL5A 3HNTL 4HX1A 4NB7A 4Y4KD 5AVYB 4BWWA 1QFWH 4B95C 3A6CH 1I4FA 2CHXA 4BHUI 1D7DA 4RFOL 3AUWB 2JKLA 3RE0A 2PCPB 3E38A 4PJ8C 2A77L 5BJTA 2E4FA 2OZ4H 3LD8C 3SE9H 4B9JA 1U33A 1HZLA 4OLVL 2NNAB 1CE6B 4UT6L 5GJSH 1FVCB 2A1WL 4KBPA 4WHTA 3ZKQD 3ZHFA 4X6BA 5D1XB 2CJUL 1EDHA 1F8TH 5DDHA 3B9DA 5CUSH 15C8L 3HAEG 3RVXD 2IJ0C 2Z64C 3GBNL 4C4BA 2HFFB 2APSA 3O6FA 4MXWH 4XNMB 3MROA 1PTZA 2H7WA 4RIRA 1MSPA 4Z78B 3I84A 1L7TH 2WSDA 3QUMA 4WY7H 2CO6B 1G7JB 4HUWB 1O9VA 2XFXB 2WP3O 4E0RA 3WUZA 1QW9A 4OM1H 4HWBL 4O2CB 2XQ0A 4JRYD 1FPTH 2NY1D 1W9XA 5I74C 3G5ZB 5C0AD 3LKSB 1BOGB 2L4OA 1A4KB 2K78A 2JB5H 5AAWA 3HRZA 2AZAA 4TNWF 4J3UA 4ZBJA 3H2WA 3QXUA 4FQ1L 3P4NB 5E2TL 5EFIB 2F53D 1DVFB 3G04A 5D4JA 4XNQB 1AGEA 2DYPA 1DJYA 3KXFB 2HKAA 2NY4C 3US9A 3R1GL 3P11L 1HILB 3TV3H 4N2BA 2FZ3A 2E6QA 4ZUTA 3IGAA 4QO1A 4LU5L 2FX8H 1VACB 1J1XH 3MV8E 3QDGE 2Q3AA 4R96B 4KHXL 1WFOA 2QKIC 2PW1B 2EABA 2IDFA 2VC2H 5H4YA 2X4UB 3LSOB 1DLHA 4N20A 2V9UA 4GI8A 5D7JA 3RIFK 2H9GA 1S7UA 5AKRA 5ADPL 1UM6L 2RIKA 3ML8A 4G71B 1J88A 2IEPA 5KWYC 3NEXA 5D1ZD 1AQMA 3FQYA 3MV8D 4XZ4A 2PP7A 4TQ8A 2X3BA 4JY4A 2X41A 1MLBB 3L3OC 4HISA 4R0LC 1U9KA 5BRZB 4EZKA 3J2PA 2GVYA 5BO1L 4LCUA 4DETA 3CX5K 4BK5A 1J0JA 4WW2C 2WZAA 4YDJA 2FH8A 2XZAH 4YX2L 2H8PB 4AIZA 1AXSA 1HDMB 5AAPA 4PP2A 3RYMA 1ORQB 2VDRL 4W9GC 3BDYL 4HHAA 1PLCA 5B39B 2BSSA 3QULB 1RK1B 4ZFOB 1H3GA 4HWBA 2QADC 1P2CB 4XPTL 1IT9L 3BVVA 2QL1A 4BXVA 4GBXA 5F7LB 4TLSA 4LL4A 1LD9B 4XGZB 3DX6A 4APQB 1W8NA 5JQIB 3FO9B 3S8FB 4F7PA 1PZUB 2R69A 4XN9A 2X3AA 4U31A 4OVVA 4WTZA 2D31A 1TIUA 4KDWA 4XCCH 2J55A 3TH2T 1ZS8B 5B3JE 2VZ3A 5B1BB 3THMH 3T9WA 2BNQA 4FXGC 4JHWH 3VTAA 4I18C 4GO9A 5FM5O 1KULA 4WFFD 1QBAA 2C1PB 1N59B 1NA8A 3MDJA 1NCWL 2VLKD 3DV6A 1L5GB 5TDNA 1RIUH 4L3EB 4H0IA 2JCCE 2YUVA 3LY6A 1OP5K 2HT2D 4N86A 4OH2A 5DJ8A 3IB4A 1X5XA 1KJ3H 3ARFD 2EDDA 2IMNA 2O6EA 2WNKA 4DHLA 1P5UA 3Q8EA 5CZRA 4D9LL 2CDFA 5J0BA 1C5CH 3E7JA 4DN4L 4HD5A 2PTUA 2NZIA 3ARTA 4YSUA 3LKQB 3RWCA 4DWHA 3EJTA 1OK8A 5JPNC 1N64H 5GS0D 1JF6A 1EHKB 2X12A 4KMTH 3H3BC 3K2KA 5B3SB 2KQMA 3L6FB 5DZAA 4PJEA 2CA3A 3IPFA 4FYQA 5C6TH 4BH7A 3OZ9H 3N42F 2EACA 3X11B 1UQSA 4QEGA 2WGXA 4TOYL 1FDLL 3F7VA 1OCOB 3UCQA 1NGQL 4ALAH 3OKKB 1A9BA 1TQUA 4X6DE 1BQUA 1X4XA 4LOFA 5LCVH 4NNPL 5E7FA 2WGNB 1UWGL 3S5LG 1DVUA 2P24B 1X7TA 4RAVB 5DUML 4XNAA 5FW6A 4TKWA 2J44A 3VRJA 4GAYA 4KJWD 4X4MA 4QCIA 2VKWA 2D7PA 4QRUA 1TMQA 4FQXB 4FTVB 1HVXA 4R3SB 3VH8B 1RZ7L 4FKHA 5AD0A 5A2JH 1BEYH 5K1VA 3TZVB 1CFSB 5JO5B 3X2QB 4KKCD 4PJEE 1MFEH 1D5RA 1MFAH 4WWNA 2R0KH 4WO4B 5JMRA 3D6GA 5CLYA 5K59F 2CMRL 3I75B 5F7EL 3ME0B 1EPFA 1T0PB 1HCFX 1JUFB 2NNFA 4WK4B 2AJSH 2OM5A 2YGQA 4Y4HC 3HZMB 3W1ZA 4F7MB 1KGCD 3N40F 3OQ3B 1PYWB 4AZ8A 2FBOJ 1EIBA 5C08B 3LZOA 4NO0B 5MHSD 4GBXD 4PJXF 4F7CA 3CFJA 1ETJA 2ADIA 1JN6B 1P1VA 4BFJA 2ZJSL 1H3TA 1F3RB 4H4NA 2VJXA 3FQNB 1A1MA 2MTPA 2H0PA 2EH8H 2JSFA 3OHXC 3UZEA 2UZIL 3GIVB 4Q9QH 4I48B 5DR5H 3UJTL 1KGCE 1A7NL 3KXFE 3VFTA 3QEGL 5IT2L 5GS0H 5LNEA 3ZBMA 3FN9A 3CFJB 1UVQA 3DPDA 5D7LA 4NO0A 1EH9A 1MKFA 4LIQH 3O4OB 4MSWB 1L9TA 3HI6H 6CGTA 3QORC 4HLEA 3EF7A 3AM8C 4GSUA 2MCMA 3WHE0 1JZHA 4KOBA 3EOTL 5A7EA 4XPGL 4W9LC 1BAWA 1EZLA 3N44F 1LEIA 3DGGA 3N2JA 4Z3IA 1LE5A 1SRDA 1SVZA 4Y16A 4X42A 3FQXB 5EC1B 5JHDA 3DJRA 3HW7A 1WSST 2NSQA 2X4SA 3COOA 1FGNH 3BPCA 5JW4M 4GSDH 4ZQKB 1M3JA 1N2RA 3CLWA 4UMGA 3UTTB 4N26A 1FNSH 1XD0A 4ZXBA 3FB8B 5EIIB 1FZJB 1XIWC 2AVFA 2YXVA 1PPIA 3ESVF 4WI0B 5D2NC 5FV1L 4PW3A 3RDTA 2R27A 1CLZH 2QV2A 3IDNA 4TULL 4UQAA 2VNCA 4XMZA 2DWXA 4L4TE 5C0BD 1GW0A 3LIZL 1A9BB 4N3UA 3CZFB 4GT0A 1TVHB 4LARL 2J5LB 2OTWB 4FQ1H 4WCYL 5E2TH 3VWJC 2BSTB 3RTLA 2V2TB 1O7VA 1OT1A 5ABZA 3F7VB 1XSKA 4U4IA 1KXQA 4M8RA 4Z3FA 3ZO0A 4WZ9A 5D6CA 4YMPA 1NBZA 3BPNB 3RRQA 3MLPA 3LRLA 1PMYA 4TUKH 4IYKA 1RUAH 2HJKB 3ABLB 4WTXA 2GT9B 4HJ0D 4JANA 3O3BB 2WVVA 3GXPA 4JNXA 2XSKA 2APVA 5C0AB 1BHGA 3QI9B 1EA9C 4OZFH 3KYMB 4GH7B 3ZXAC 5IUSA 2Y5QA 4YXHL 3UTPD 1U93A 5BZZA 1FNGB 4I13B 2OMZA 3GBNH 3CDZB 1NAMB 4OGAC 4LEXL 3L2NA 1N3NB 3W2DH 5JORB 2GPZA 4O2FA 2Z0UA 4UT6H 5ACZA 5D7IA 2OMUA 2HVBA 2HRPH 1NCUA 3S98A 5INCB 4NENA 3VXOA 5HXMA 2COVD 3HUJE 4AGMA 4I4WB 2AK4A 3F6IA 3PQYB 4R7DA 1K3IA 2BS8A 3SCMD 3SEPA 4WEEA 4UIKH 2C7UB 2L7QA 5EF0A 4P5TD 2WYHA 4BXSV 1NCHA 4BD4A 2WUCL 2G60H 5JZ7D 3NABH 5IIEB 2VDQB 4PRDA 3AACA 3PNWB 3LQAC 4UIKL 4HOMA 3ULSA 1FNEA 3KHQA 4ZXBC 4HH9B 4WGKA 1NC2D 3VJ6A 2A6DB 3L9BA 3UJJL 4RDQF 2D7QA 1J1PL 2XWTB 3BH8B 4DKFL 5ESAB 4KXAA 4HHAB 3RFZC 1ORQA 5D9SB 1NGXB 4WHYH 3W0WA 3QZMA 3M1OA 4FXKB 3FO1B 4LPCA 1TJHL 2Y06L 4HJGA 4HUXB 3X1BA 4HZAA 2ATAA 3CVBA 1TTCA 4JVWA 3HE7C 2IH1A 3FYIB 5BRZA 4FJZA 3BXNB 3ZE0F 2Q2EB 5C0GA 1HCZA 3Q9PA 4PRPD 1YUHB 2X3CA 4WUKH 3KWWA 1DVFC 5C1MB 2Z4QA 2YPVL 2AMGA 4QUOA 3FTYA 5K39B 1T22A 4WI4A 2X4UA 1BAFL 1NFDF 4P5SA 4JQIH 1LGVA 2ZICA 5AKSA 2OQJA 3A6BL 3CQFA 1XX9C 3CN1A 3ZDXB 2YGOA 1ASPA 4U6HB 3BZFA 3BAJA 3IFLL 3VXMD 1QSEA 2V7HB 1VACA 3A3YB 3GB7B 4AENA 1V5JA 1MRFL 1NUDA 4PG2C 3SPHA 3K3QA 3REVA 4MXVF 3WKNA 3L3IB 4ZYKA 4M3HA 2P52A 3Q6GH 5IOKA 3G6DH 3MCKA 1KB5H 1ZCRA 2DYPB 3NP3A 5J12C 3NK4A 3BVWA 4LEOA 4PJ7B 8PAZA 4I0CC 3WS3B 4JAMA 4EPSA 1NDGA 5FHBH 2X4QB 4U1IB 2K45A 5T33H 4KUCD 4M02A 4I7ZC 4XNXH 5DO2D 4RGNC 3QW9A 4OGAD 4PGCB 2C3GA 4PI2A 5I17A 1WIPA 3R8QA 3TA3D 4ZFFA 2IG2H 1GYCA 5C3IA 2GSIA 2WKOA 4Y7MA 1N68A 1LO2H 3QORD 3MLYL 3CVIL 4H25A 4EIUA 1UKQA 2DM7A 1KACB 4QD2E 2X38A 4XP1H 1QD0A 4P5TB 5LAXB 5GS1B 3AU1B 1HKLL 2OP4L 2VLKE 1DEEB 4UOW0 4OR1A 1KCWA 1XF2B 2YFNA 4N87A 2A6KB 2QPFA 2Z91B 5DEJA 4OFDA 2EEFA 5EC2A 3MBXL 4JRXE 4ZFZB 1NBCA 2A74C 2ZX9A 4JFPA 4RSYA 4P4RB 1CBJA 1YN7B 2Z7YA 2E4TA 4GIOA 2XQYG 3E9UA 4TSAH 3M17B 5EU6D 4N22A 4FKEA 2VQ1B 3HHSA 4UU9A 1LM8V 4NRZA 2PF6A 2BY2A 2XIIA 2ITCA 2XN2A 2QBWA 5HHNB 2CUMA 1MH5B 2FUTA 3R7RA 1YEDA 4MCMA 4ORGA 3D39E 3BQUD 1A6WL 5FDWA 3MRGB 4EQ2A 2IQAA 2N1TE 3BVXA 1RHFA 4NHCH 1T6VN 5A16B 4CNIB 4TPRH 1XGTA 1QRKA 3GDBA 3K4DA 3WIHL 1S7RB 3R0NA 3FFCD 1G4RA 1VENA 5DQDL 4NM8L 3BGFB 1BD2B 3AGWA 5C0AE 1U2HA 4Q58C 1TQWA 2AXHA 2PABA 4KK5C 4IU3B 4YVUA 2B1AH 4DP2X 4FMKA 5I1EH 1T7WA 3FMGL 1AIFA 1ERNA 4OKVA 4UQIM 2VR8A 1AJ7L 2R4RL 4L5FH 3ATBA 1NBVL 2X70A 3ZE2E 2YEVB 3U9PH 3O8XA 1KBKA 4LNVA 5GHWL 4TN9A 1RURL 1IU1A 5GRUH 1A2YB 1MI5B 4GAAA 4NOBA 1J8SA 2XWDA 3QIUC 1BX2A 1JYNA 5T1LD 3CFQA 3OR6A 4E9QA 1YN6A 4NT6A 5AG8A 5DURD 5EN2B 4K4KA 3OZ9L 2X89A 1BZOA 1F2XK 1G7QA 4IRZL 1KLGA 1GJWA 5EZIL 2QQLL 1VGKA 4FI7A 3QPQD 5F7YC 3SQOH 1VCAA 4EEEA 2YC1A 2DWDB 4TVPE 1LDSA 2AXJA 2DB8A 1Y6NR 2BCKA 4LCYA 4MA8H 5CP3H 1MPAL 4EIZC 1XB3A 4H5SB 4HFUL 4JKMA 4J8RA 3UIYA 1WWBX 1S7XA 2K9UA 2Z31D 3VG0L 4LL9A 1JTOA 1V3KA 4ISVA 3A4AA 1LYQA 3B9VA 3B9KD 4WO4C 5IJKA 3MRGA 3NSYA 4XBEH 5ENWA 3P0YL 3HG1E 1UH2A 2WWOA 4HFWB 5KYUA 5LVEA 3DGDA 2ITCB 5D96C 4ZTPH 4ORZC 4NPJA 1NCWH 4N9OB 4IGBD 3O41B 3BZEB 4P5KB 3MCG1 5DQJA 4YSEA 4QXGH 2FLBT 4JHWL 1WTLA 2O6DA 2XY1A 3CVHL 1ZV9A 1WZLA 4NN6C 4JPVL 4XB8A 4XCCL 3U1SL 1SVBA 1HKFA 5JXED 2XX1A 4NPYA 4MQSB 4E9VA 3QS2A 3N43B 3AWEA 3QJHB 1KB9K 1XF2A 1A7QH 4Q4EA 1E67A 1XCTA 1MHEB 3QZOA 2NXYC 4XPTH 4J3XA 4GQ9H 4OF3A 1FCCA 1IQDA 4TLUA 5DJAB 3K71A 7FABL 5K9KB 2H26B 2HG5B 4OAWB 3GBDA 4LGSB 5D93B 5BZWA 1T0NB 4LCCB 4XP6L 1MW1A 1TMCB 3VFRA 4PJHE 3PHQB 1PFOA 2L7UA 2X0VA 4IIQB 4RAUA 3S4SG 1D5MA 4BIKA 1H6FA 4NJAH 1DSFL 2H2PD 5B7MA 3OX8A 5MENE 5IMOA 3QXAB 5HTSA 4RETB 5LN8A 3WEBA 1OEZW 3S34L 2XVKA 4N2CA 4BRJA 3U1QA 5KSAC 5KS9B 4TQHA 3HPJA 3UBXG 2AITA 4M62H 3FTGB 3SBWA 3NVQA 1RZGB 2V7HA 4M8QA 4WNQA 1PQZA 5EIVA 4ZAKD 4M61B 1OWWA 2VDQL 4NAMA 3N91A 2WTRB 3RX7A 3VGFA 4X7SH 2IBBA 4MNGE 3ZTDC 5C0RL 1YYML 5ISZA 1CICD 3MCYA 5EF3A 3DVGB 1LNUA 3ABMB 3LQMA 1PVHA 4JZJA 4ONFL 3ULAB 4JR9H 4QXWA 1RCYA 2FIKA 3B9KB 1FO0L 2VDKL 4P9HL 1KCSL 1RIVL 1SM3L 1T1WB 3TV8A 1N19A 2Y24A 5HGHA 4C58B 2HYMA 1AP2A 3MKGA 2PPAA 1E5AA 2EXYC 5D71L 1JGEB 5L4IA 2XICA 3MLXH 4O58L 4GW5B 5L88L 2AQPA 2VDNL 4DKAA 1UUSA 5GRVK 5DEGA 1S7VA 5F3HA 1AI1L 4HIXH 3O4LB 3KS0J 5JIIA 3EYOB 2E6PA 4ZAKC 5GRWA 3UPRB 2J4WL 2CCWA 3SGEH 4YLQT 1XGYH 4LLVA 1BPLB 1OF2B 4W9FC 1TQCB 3DX4A 3EOAA 2ATPA 1N5YL 1CZ8H 4Q89A 3PNWA 3UFIA 4DPBX 2XOTA 4MAYA 4F9PA 4D94A 4FFYL 4LLUA 3T2OA 1D5XB 3CHRA 3NJGA 3H85A 4DPCX 2EECA 2J72A 5DWUL 4YHIB 2DQDH 5SWZE 4JY6A 3SPIA 1FH2A 2A99A 4LRIA 4KJYB 4JX0A 2NY4B 1M3IA 4UUJB 3WD5H 2V17L 3I6LE 4FZEH 5F21B 4MLSA 3WNPA 3FQ2A 1OANA 1N0LA 1TF4A 2IAMA 1BLNB 3QJXA 5FGRA 2DTML 7FABH 3BWSA 2FJGB 3CN4A 1B0GA 4BFRA 4K8RD 1IM3D 3A4FA 1ORSA 3QDJE 2QVTA 4EOWH 5IQ9B 3ARGC 1BVLA 4IEFB 5EUKA 5EEUA 5BRZE 3EYFB 5E94A 2DJMA 4LOVA 3MRNA 4TVUA 5T1DH 3WFDH 3WXVH 1LLAA 4JZJC 4PJCA 1WFUA 3MA9L 3VXSE 3NIGF 4JZNB 4WI6A 2WXOA 2Y72A 3FJTA 3ARWA 1XTMA 3Q2LA 3RNKA 1F1GA 5EEZA 2ZOLB 3QEQB 4Y19E 1GXEA 1IGIH 1OAXL 4NNXB 4PRIB 2F5BH 4HSQA 1Z0MA 2XIDA 2AMUA 2Y1YA 3EKCA 2GQHA 2ZX5A 5F9OH 1RVFH 3WGUB 3SGDH 4G2AA 4PTTB 1PFCA 2BHZA 3M7OA 5C09D 1A4CA 4TNGA 4XI5D 4F8OA 3K2MC 5EZPA 3FT9A 1SFHA 1LK2A 1W72B 3UCRA 2XA8H 4U6YA 1JSYA 3T77B 5J1SC 3CPUA 4DKEL 2B0SL 5FDYA 4HKBB 3VG0H 1WZ1H 1JNLH 1TO4A 1YCSA 3QDAA 3LV3A 1RZKH 1N8OE 4GKSB 2CG9X 3LAFA 1WCQA 1N2RB 5EZOL 3G6AA 1FUNA 4FF9A 1A8JH 1FVDA 4WUUE 2VDMH 3BCFA 2PCFB 5AOZA 5F72S 4U1JA 1MCNA 5TQ0L 2KI6A 3MUJA 4RH4A 1EXGA 1TZGH 1PNCA 4NFDA 5BQ7B 3U4EB 43CAB 3CVDA 1MFNA 2YAQA 3QDHA 5FUOH 3TJHC 4JPWH 1G9MC 4KTEH 4OIBA 2IOIA 3GJFH 5DS8A 5IOPA 2BIQA 5TFSH 5DVMA 4NM4H 5BS0D 4Y89A 3C12A 4MDRA 2RFXA 3T2NH 3V9FA 4CU7A 1LO0L 1F58L 2DQCL 5BVPH 3HG2A 1WBZA 5I1KH 1MW3A 1S7WA 2Y4SA 2WIIB 4F37K 2YZ8A 1E4JA 3V7MA 4JFDA 4EN3A 3KPNB 2F15A 3APNA 4X5RA 5DURB 3IXAA 5I71B 4LLWB 3FH5A 3JV6B 1GC1H 3SPVB 1MCSA 2P5EB 4GNKB 1YYLH 3ROOB 1M42A 1F00I 1PYWA 1RFDH 2CU9A 3HI5L 4LLMA 3LMJH 3CN0A 2N0MA 5JUEH 3AXLB 3LS4H 4IKNA 2QSCL 4JGJA 1EZUA 3WIHA 1QBLL 1W8EA 3EADA 5L7XL 4GSRA 3Q44A 4QXUH 1DCLA 3LCYA 1CFSA 4AE0A 3SDYH 4U7SA 3P40A 1B6DA 2LU7A 4S1DC 3GSRA 4XBMA 2PTTB 5KSBB 5EU6A 3RAJH 2XWJA 3VWKD 3BVNB 3S2CA 4K0OA 2P5WB 4J4PA 3EOBB 3P9LA 2B5IB 1E2VA 1F3JB 2YUXA 1CU4L 3SSGA 1KCUL 1YNLL 4K3HA 1CGTA 4LFHG 5EIIG 3WMSA 1OLLA 4IGBB 5FWQA 3BSGA 3PFQA 1KGYE 2DQFB 2ODHA 4TNVK 5DUJA 3QO1B 4Y4HB 3AG2B 1PEZA 2YQGA 3STZB 4XMLH 3KWTA 1UQSB 5EBLB 5A2FA 2ZUUA 3QJOA 2HX7A 1A25A 5EA0L 1E6JL 3VNYA 2OR8A 4M1GL 4R2GB 1VZGA 4JDZA 3NBNA 1A5FH 5T33L 1K4CB 1P9MA 4E5XA 1JRHH 4W9DC 5KVFE 1PIFA 1TTAA 1V55B 3A24A 2BDNH 5C7XL 4H1LG 1QMUA 5B21A 4F24A 4KQ3H 3OHXA 3UZEC 2X6MA 1WGVA 1A14H 2DD8L 4MKMA 1UADC 5HI3C 2O6FA 2WXRA 4B9IA 1ZHBB 2BJML 1MRFH 3OXRA 1GPOL 2B20A 2GEEA 5IB2A 2EDTA 4XO4A 2VLME 4QTFA 5GSRA 4XCEA 2OTUA 2NXZD 4YN3A 2IVFC 2NTFA 4YZFF 1XH2A 5E1QA 4Z7VE 2QGDA 3VXQB 2ICEA 2OTPA 2GABA 4IK6A 3CVHA 1CD8A 1JWSA 1AC0A 5A2BA 2F18A 4KDTA 1JYXA 2X4OA 3CXDL 2F6AA 2ATKB 3KBHE 4BFBD 3QRGL 1BJ1J 1WQVT 1Z66A 1GMIA 2QSTA 2WM0A 1MAJA 3KPQB 2CO1A 2IBGA 2WMPB 1JHLL 2XKNA 4NN5B 4DN3H 4OD3H 1UEMA 3FO9A 4QNPF 4RA0C 3JWOC 4UT7L 3PABA 5GRJL 2NW3A 5DS2A 2O30A 4RRPA 2WBKA 1RJYA 1SOSA 1XEDA 1K72A 1RK1A 1XCWA 2CLRB 5GGTL 5ACMA 1JERA 3FCSA 4ZX4A 4R4ND 1HE8A 4QHLB 5F93C 3D69A 4JEGB 1AXSB 5KYYA 3VTMA 4YPGB 1WITA 3G6JA 5FYLH 4DVBA 1JOIA 4N0CC 4LCCC 4KUZH 1JDCA 3ZPDA 5GGVL 5EF2A 3WNOA 4X9YA 4W4NA 2OYPA 2EDRA 2VAAB 2NYYC 1E50A 3BKCH 3H6JA 4FXGA 3NN8A 2MQ0A 1HHIB 2F8VA 1MHHB 3LPOA 3K74B 4XCNA 2F61A 5IUCA 2V7NA 3VXRA 3BJLA 2OXHB 1AZRA 4TQEH 1ZY9A 1S7UB 4RBPH 3OC5A 3M86A 2GJ6B 1NFIA 1M7UA 3MRRB 3KPLB 5AUMB 1Z5LA 3KLDA 5HGAB 1GGIL 3FUEA 5CINL 2ZOUA 1LP9F 3QIWB 4PYGA 2HRPL 3UYPB 4QRPE 2MKWA 1PLGL 4E41B 4OJFH 2FX9L 1UXSB 2X4OB 3O0LA 1UD8A 1F3DH 1ONQA 4LRIC 3W2DL 4P4KC 2ICEB 2C7FA 2Q76B 1PF3A 5DLLA 4OJCA 1XZ0A 2CUIA 2J4WH 3HE7A 2DMGA 5D7KD 1GL4B 4XCEB 1KV7A 1AD0B 1EEUA 2B7DT 3V7AG 5IQMA 1RK0A 5CSZB 3KG5A 1OGAB 5AW9B 2DH2A 3TO2B 3NH7L 1KV3A 3MLUL 3RWIA 1PZBA 3LRSA 1DQQB 2EDYA 3AQYA 3JWOH 1HL5A 5I1LB 1BAGA 2KC0A 3IXTA 4G5AA 3ASOB 2BIIA 5ICXB 4UQBA 2GYSA 3QZWG 1CF8L 2FO1A 3DRTA 1WC7A 4NLAA 2KMWA 3GMPA 3NEOA 1PCXA 3DK2A 4AUYA