4B9CA

Biomass sensoring modules from putative rsgi-like proteins of clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GSHMGLKIQYYSRKPHDSAGIDFSFRMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANKYLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLVWGIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding protein
molecule keywords TYPE 3A CELLULOSE-BINDING DOMAIN PROTEIN
publication title Fine-Structural Variance of Family 3 Carbohydrate-Binding Modules as Extracellular Biomass-Sensing Components of Clostridium Thermocellum Anti-Sigma(I) Factors.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9cA00
2WNXA 4B97A 3TF4A 2XBTA 3ZQWA 4B9CA 4C8XA 1G87A 2WO4A 2L8AA 4B96A 2XFGB 2WOBA 1NBCA 3ZQXA 3ZUCA 4JO5A 1K72A 4B9FA 2YLKA 4TF4A 1G43A 1JS4A 4B9PA 1GA2A 1KFGA 3ZU8A 1TF4A
chains in the Genus database with same CATH superfamily
2EC9U 1ZLDA 3MODL 1T22A 2HLEB 5CIPH 3WLWD 3S8WA 3D3VE 3L1EA 4RA3A 3RNKB 1FFPA 1NSNH 2XTJB 3D30A 4K9EC 1VZGA 2P5WA 5SWZE 3SD2A 3U6XS 2G30A 1YNTB 4XMPH 2Z93B 5IJDC 2EADA 3CFKA 5CSGA 3WELA 5FO7B 2X1WL 4GSXA 1J0IA 4R90H 1D5MB 2F1EA 1UJTA 2AEIT 1T80A 2Y7OA 2V5TA 4O51A 4QY8B 5BRZA 3WAKA 3GMPB 5EPMA 3T09A 2YPLE 1SZNA 3NCMA 5AW0B 5AAMC 2BNRA 1MCNA 1L5GB 4IGBA 3GXNA 2Q6WA 4AV4A 4OJCA 2VLRD 1DLHB 2BVEA 1KLGB 4OGZA 1FCGA 4HWBL 5L9DH 2J4WH 4EN3A 3U4BL 4S2SA 1P5UC 5FGBA 2DBLH 4D0BA 1H3PL 3UMNA 1LO0L 3HRZB 3CX5J 1PPIA 1NFDB 4P2OB 1UWEL 5CR1A 4HJSA 1A7OH 1ONQB 2FE0A 1T5WB 1U58A 1G6RH 1PD6A 2FJGA 2OW6A 4B0MM 1XO8A 2QQQA 1RUMH 4XCYA 3KLQA 4F37F 2PTTB 5FV2A 3QQDB 1BPVA 3TCLA 4NO2A 2MRYA 2MKWA 5DC0A 2VO5A 1SMOA 2DWXA 2QKIB 2J8UB 3M17A 3LKSB 2COQA 3GXPA 4X80L 2K45A 2PWGA 1QA9A 3RA7L 1JPST 2AJYH 3SN6N 1FJ1A 3S88H 4WI0A 2E6QA 3FTZA 4GG8B 3S3SA 4DP0X 3ECQA 1J0HA 3WIIL 4PY8I 3S35H 3CZFB 2CCLA 4KZDL 1CDGA 3I2CL 3OWRA 2A74C 1WT5A 4JLRB 1KCLA 2ICWA 2MOQA 3S5YA 2ZX5A 1YYMH 2A83B 5GRJL 1UEMA 1GCYA 4Y8DC 1GYVA 2R1WA 4H4NA 2OMYA 2BLFA 1VFBA 3BT2L 2A9NH 5E94B 1CB4A 2A6DA 1FA4A 1UB5A 1D9KB 1IGIL 3L9YA 4U4BA 3U30C 3IDYC 4HDIA 2VW7A 1X3DA 4EMZA 5D7LE 4JHBA 2R1XB 4BFKA 3T77B 1IAKA 5DVLA 4MCZA 1RHHB 3MLTB 4QRPE 5EZIL 3VTTA 1YN6A 4IIZA 2IFFL 3AG2B 3FB5A 5AVZB 4NNYA 2YKLL 1QFPA 4U1MB 4F7EB 3K4ZA 3AT9A 4WENB 1J0JA 1ACYH 1SLXA 3AREA 3SY0B 3KG5A 5ALBH 3HMXL 2I5YH 4H1LH 3MJ9L 1J9SA 2Y1YA 4NPJA 4HSCX 3ZT5A 4HYTB 5E9DB 2WLLA 4OB5H 5JHDA 4RGMC 1S9XA 2LR4A 1A0QH 5AW1B 4JKMA 5I76B 4JANA 4ANXA 2A4ZA 1SJXA 2P8MA 4YDLB 3GKWL 2CBPA 4FNTA 3OLDA 3NRQA 1GGCH 3QUMH 2TRYA 5EIVA 2ODHA 1NBYA 5ENWA 1SDDA 3JT0A 3AQXA 5FFLA 2KYIA 4NI6A 4M93B 3CDCA 4JCLA 5DUML 3V0WH 1TPXB 4ISVB 5DJ6A 2EDTA 2BOBA 2CNYA 2DKMA 1LLAA 3V5KA 1UZ6F 4TPRL 4OM1L 1M56B 1DEEB 3UG4A 1F42A 2F7QA 5DD5H 1YQ2A 3KZ8A 4GEJA 5ITBL 4MMXC 4HIHB 4IU3A 3MRHB 4LSDA 2IDTA 1KTJA 2AK4B 3V0GA 2ED7A 3SBQA 3STZB 2YPVH 3PUCA 1MFBL 4TQPA 1KYOJ 1EK3A 4UQIM 3RFZA 4HVBA 3MUJA 2IWGA 3NCWA 5K1JA 5C0AD 4A7GF 3V55A 1QTPA 4DGUA 2NUTA 3VGGA 2R4RH 3IVKB 3QI9D 4TQEH 4UT9A 5C9JB 2VSMB 4XMKH 5TPWL 4QUOA 4ZXBC 1X6LA 3UCQA 4POYA 2Y1VA 3BRDA 3REVB 1FSKC 1ZS8B 5J1AB 1IBHA 4ZTPL 1XF1A 2WTRB 2GI7A 5AVVB 4C56D 2YWZA 3KD4A 2AXFB 3HNTH 3PV6B 4AYFA 1F3DJ 4H8VA 3RDJA 1L9RA 2C5DC 3H7LA 4PJ6A 2RB8A 4BXSV 5CGMA 1LEGA 1FNEB 1E40A 2EIMB 2YA0A 3TWCH 4PWJA 4BWUA 1BYNA 5F9WC 1U95B 3BISA 3ABGA 4NO3A 1QFHA 35C8H 5T1KA 3UC0H 2XA3A 1L6PA 5C6PB 2YWYA 3L5HA 3VI4B 5J56B 3BGAA 3QRGH 4JO4L 4DQOL 4HFWA 5HVWA 5IG7A 1A3QA 4TLTA 4LCYA 2ATAA 5FUOH 2B4CH 3KHOA 1J0ZA 1BQRA 4WJG3 3QDMA 3S8FB 1ASPA 4MYPA 4N8CH 1W6WA 4X6DB 4BFGA 5J3HD 5AB9A 2PPFA 5HYSG 5A2KH 3ULUL 1MCPL 2XHNA 3RWFA 3HFML 3V0FA 4OCYH 5E6ID 2AQSA 1FC1A 1I7RA 1DQML 3GBDA 3NFSL 5JHLA 1V55B 5I18L 4E68A 5PAZA 1CK0H 5B1JC 2AGJL 1DZBA 4AM0A 4GQQA 3VFVA 5C09A 3L9RB 3E0GA 3HAEA 4HJTA 4JUTA 4HS6A 1ZIAA 4LPTA 3BEVA 3KPRB 1QAWA 3TNMA 5FR3A 2HKFL 2BFVH 2X89D 3EOAB 5B3JF 1J8HE 3V4UH 5D2LA 1U9KA 1G43A 3T0EA 2UYLB 2VDLH 2GHWB 2IPUG 5GGQL 1D5ZB 4XN7A 4RIRB 5BOZG 4EAEA 1JZGA 4ZFZA 4M61B 1B4JL 3EOYG 3L16A 3OHXC 5I2IB 5IQMA 1J87A 2D7TH 4G6AD 5ID0A 1SOQA 4RNRB 4Y2DB 5EA0H 3ZYIA 2QFPA 3TF4A 2LE9A 3QZPA 4Y4KD 5LG1A 2VR6A 2OSYA 3IDGB 1DQKA 3CN1A 3U9UA 5CIPB 4HALA 4JHUA 3JWDL 4MD5B 3SDDD 4BZYA 4NENA 5CP3H 3D87B 2Z7UA 1RUQH 3U2IA 2I9TB 4OY9A 4ODHL 2WQVA 1IBGL 1PZSA 3VFNA 3RVVC 2A6JB 3GEWB 1T6WA 2D7NA 4POZD 1KCSL 3HZYB 4AGNA 4TNFA 2D9CA 4HS3A 1FZOA 3V6ZB 2EE9A 2IOMA 5I8KH 5K9JL 4FJZA 2E9WA 2Z35A 1R0AL 2BP8B 4LDEB 5DSCB 1S7XB 3HC3L 4WHDA 4TUKH 4KKBC 3FQWB 5BZDA 3GZPA 3R4DA 4HJEA 1ZPUA 3DHMA 1IQDA 1N12A 2XG5A 3LRLA 5EZJB 1WFMA 4XB8A 2I26N 4WW2C 1GZQB 1A1NA 3MRMA 5EIIA 2FAUA 3L5JA 1K3ZA 4L29B 3W38A 1BIHA 3DVNB 4GSQA 4J3OH 4AV5A 4QHUB 2ADGA 3N44F 5F9AC 1Z9OA 5DTFB 4HMEA 5MERB 3K0YA 1MJUL 5HVFB 1IGFL 2EDBA 2LLLA 3R4RA 4HH9A 2DQ6A 4ZUSB 1ID2A 1QKZH 2X6UA 1G6RB 1GHFL 4I13B 1JAEA 4OLWL 1WC7A 3FRUB 1DBAL 4R26H 5I28A 4YSUA 3BRFA 2WXMA 4GOSA 2XRAL 2P80A 3HI6L 3FUKA 3O6KL 3S9DB 4EPSA 3VD2A 4XGZB 2NTSP 1U21A 1I1AB 1BZDA 4G80B 4A39A 2E9GA 4F80A 1ZTXH 1DO6A 3L6FB 4JFDE 3FO0L 1XF4A 4ETQB 5C0FA 2GEEA 4WGVB 4Y5VA 2O61B 4Q14A 5EHFA 5GPRA 4B7LA 5CS7A 4Q58C 4Z95L 3VFOB 4F9PC 2EUZA 1I3RA 4QOKB 2FQDA 3FCGA 2VE6A 2VO8A 3WD5H 1A9BB 1QNZL 1VERA 4JZJC 4YH6A 3WBDA 3FDWA 5DR5H 2V3EA 3O8XA 3EBGA 4HPHA 3K0WA 5F1NB 3S36L 4BDVA 1EEQA 3DVIA 4HUWA 3UTSB 2RR3A 2X28A 4FXLA 3ZOAA 3T0WA 3B43A 3TBWA 4JO1L 2O5YL 1PAZA 5B7EA 3FT2B 4GRLD 1QABA 4HUUA 4UNIA 2HRPL 5C3IA 2WGNB 1JHTA 3RI5F 3LRSA 4PCTA 2XPGB 1X6NA 1MG2C 3VXMA 4M9OA 3K6IA 3BZFB 1PTZA 2VLKB 2ZSVB 4GAFB 1GGYA 2R56H 4Z3EA 3N6YA 1ZAGA 4R97C 1A8ZA 3RQ3A 1CFQA 1T0MA 1SEQH 4JO3L 3TTSA 4Z3HA 5K39A 2VLLB 1OOWA 3IJYA 4MXWL 4E36A 5CCJA 3AUVA 2IH9A 4IK7A 5CLWA 2VC2H 4YSRA 4DOHE 2D31B 2FSDA 4GT0A 4D7BA 1DUZB 3X1EA 1GW0A 2IMNA 4GAAA 3W0WB 1DSWA 1I7UB 3LZRA 3O45B 5IVOA 3U0TA 1A22B 2VERN 5EO0A 4ZZFA 5BO1L 1NAMH 2QDVA 2A9BA 3FB8A 2XTJC 1U8QB 3ISWA 1DQJA 1FP5A 4UQ2B 5DC9B 1HXMA 4GAGL 3TO4D 4BUQA 5J6GA 1GKEA 3WENA 4C4KT 4P5TB 3NA4A 4WLCA 1JXFA 5IM7A 3CZSA 3HPJA 5DFTA 3C5SB 4PRIB 5KANG 3CIAA 5F9OH 3GUTB 1BMWA 2XTJE 5GRXG 3B2VH 2IQ9L 1JYWA 2DQDL 3O9WA 1XH3B 2AVGA 1D6EB 5DJZA 1OHZA 4BINA 3TM6A 3GMNB 2HJFA 3MRIA 3QPKA 5JOPD 3W2DH 1EH9A 3QUYA 3HRZC 1SXCA 4RDQG 1UD8A 4OGYH 1CD1B 4P2OC 3PS6A 5KEZA 3WEOA 1LP9A 2R9HC 4WFHD 1A7NL 4Q2ZA 3D85A 1A25A 2KL6A 5FW6A 4CMMA 2IDSA 1G7QA 5AW4B 3ULVD 5D9SB 1GYCA 1OTUD 4PJDF 5I23A 5C0GB 3VM5A 5MEQB 3BXNA 4IRZA 2UV3A 1NFDE 5D7IA 5FYLH 2XNAB 1DR9A 2Y7LA 4HK3N 4XNXL 3ZO9A 2QKIC 2X4NA 4QIRA 4LDOB 5E51A 3A47A 1CI5A 4NKDA 2LTQB 1FVDB 4X0KA 2JJSA 3WL9A 1N0LB 2UZYB 2X1OA 4WKZA 2BM3A 4X9BA 2Y2YA 3K6SB 5F1KC 2F54A 2FQEA 3BP5A 3CSPA 2J8UE 1JZIA 4MZ3A 4KDVA 3DXAB 1I9RH 3BPOB 1M1SA 1RFDH 2P8PB 4NM4L 3JTTA 4LLUB 4B53A 3IFPA 3MJ7B 4HHAB 4AMXA 3EJQA 2XG4A 4X9HA 3II3A 4F8QA 2Z34A 3OAZK 3EKCA 4ZRGA 1CFTB 1WZAA 1D9KC 4XNMB 5AYTA 1YNLL 4M5YH 1BZ7B 1L9TA 3NAAL 5HHNA 3GHBL 3I85A 1TKWB 3MO1A 3TA3A 4ONHB 1SXSA 1PF3A 5CEYB 2X2UA 1O6SB 1QFWL 2ZAIA 4DW2L 4GYBA 2EO9A 1HQ4B 5EBLA 1NCTA 4KKRA 1ZPLA 3MMEB 5IOPB 3US9A 1T04B 4AW7A 2DQGL 1FAKT 3FRPA 3LKQA 4M6ML 1CDHA 1CFVL 3OKLB 3E8UH 4JRXA 4JKLA 4AMWA 2H8PB 4IDJH 4OM0H 3GMMA 5CEZL 2FATL 3SPIA 4XXWC 3ZTJH 4UNVA 2ADIB 1EFXB 5CFHA 4L18A 2CR6A 2WJ7A 4WI6A 4XNZB 1X5YA 2EABA 4U1IA 5T3ZD 4YDLC 1P4IL 3IN2A 3T2QA 4UB0L 2VDLB 3OXRB 4P5MB 3TVMA 4QHNA 4KJQC 4U0RB 3I75B 1MCOL 4MAUH 1MCQA 3GHPA 2A0LC 2VB5A 4M93C 5I1IH 1TPXC 4BFJA 3MYJB 3UPAA 1T2XA 2CXGA 5DO8A 4JFZL 1R4XA 2MQCA 4IOSA 4ZFGL 1EMTH 3IDIB 5CAYB 1A6PA 1L0YA 1CD8A 2NTFA 1V27A 4QJ4B 2D2OA 1DUYA 2EICA 2V7HA 3DI2B 2Z4TA 4NJAH 5B38B 1WFIA 5CD3B 1IVLA 1EJ6A 3RU8H 3ZMNA 2OYMA 3O6ML 1ZIBA 5JLZA 4ZTOH 4KQ0A 5EUOB 1IM3A 4LHUA 4EZMA 1JG9A 4F7PB 3RZWA 3KPOA 4D2NA 1MAML 1U8CB 1N64H 3FN9A 1DJZA 2X4RB 3R0MA 1A6UH 1A4BA 5D93B 4Y7MA 3VYPA 1E9OA 4LLWB 3CC5A 2AK4E 3EJZC 3HKZA 4XMLH 2X42A 4J1UB 4TQ8A 4DTGL 5ELIA 2OTUB 4KGJA 2CWRA 3GGWA 2E4TA 3SDXB 5C92A 4DGIH 3U2SA 4NO5B 1HH6A 1SLUA 1V7NH 4QTFA 5DMJB 5GJTL 32C2A 1MIEL 3EOTH 1A7BA 1USQA 1FFTB 3V0DA 1PX3A 1SFDA 2NY1B 1QW8A 3EJJX 3UYPB 2W65B 2OMZA 5FB8B 3AWFA 3U6XA 4YBQD 5KJ4A 4XO9A 3TCXA 3CSBA 4HU8A 3FONA 3QEGH 1PY0A 1BQHG 2W9LA 4ZUTA 5IBTH 1J05A 1H5BA 1IGYA 4AE1A 3RBSA 5E2VH 1NJ9B 1Y1UA 2IAAC 3HVDA 5DT1L 4CC4C 2H2SC 3IFNH 3B3BA 1FCCA 3V0VA 3CMOH 3V9CA 3DHUA 4NQED 1QZ1A 1T2JA 4YSDA 3SZ6A 4HETA 2OZ4L 4N87A 1HS6A 2XZZA 3C6LA 5F89B 3UTQA 4D0DA 1OZUA 1FVEB 1KCVL 1SYVA 2PCYA 1HVXA 1M6UA 2VLJD 2EIZA 4M7LH 2FSEA 4YWGL 3MLPA 4X6DE 4IS6A 5F7EL 3RTQB 4F37K 5ACZA 2OI9B 1QBLL 3VG0L 4BSVA 1TZHB 2AJ3B 4UZGA 4Z77A 5C0JA 1SY6L 4Y9BA 4X42A 3TESA 2CRYA 4K23H 3P0VH 1BZ9A 3PJLA 3GSUB 1JS4A 3HE7A 3A67H 1DVUA 4RGND 4FNQA 3X3FL 4DVRL 1FFNB 2VXQH 2FWLB 3CAFA 4WK2B 1P7QA 2WUCL 4Q56A 4ZUVA 4EI6A 5LJYH 1TF4A 2X44D 3CD4A 4FZEH 2H3KA 2OS7A 3VD7A 2MHAA 5JMOC 4PGEA 2VDQL 4N1HB 5MEOB 2RCSL 2VC2B 1CGSH 3KPRE 4Y2DC 5SX5K 4Z5RB 5SWSB 3OMZA 8FABB 4XVJL 3LH9A 3RLSA 1SLWA 5KSAA 2VISA 4NDMB 1J5DA 5T1LA 4CN6A 4EUPH 1TO5A 1UYWH 4LP4A 3S4SB 1P7BA 2PMZA 4PD4K 2IGFH 1BYOA 1XD1A 3TZVB 3KPPB 4M00A 1CGVA 4E9LA 1I9IH 1KCBA 4HW6A 5AUMB 4LVHB 4HOWA 2NQ3A 1MRFH 1AQDA 1XGRB 5IGXH 2XWXA 3REWA 3TA4D 4GY4A 3O4LB 3W57A 1PZUB 4NUGH 4QYOB 1UUNA 4Z7VA 4YUEH 1BVNP 4AJWA 1EO8L 2JB5L 3PJSB 3X11B 2CO7B 3PWUB 3U36B 4ECNA 2OTPA 1CR9L 3GJFA 2XCMC 3LSOB 3WJLA 4EZJA 1CPUA 4PRPB 1MFDL 3KDPB 1OCWH 4X7SH 5DJXB 1U6AH 1QPKA 5IR1B 4XMZA 4KH2A 3SJVE 4JQXA 4O9HH 4QCIA 1U8KB 1G7JA 1KXVA 3RWDA 1I4FA 1YECL 2J7LA 1HE8A 2CKBH 4E9QA 1TTUA 3IFLH 3PNRB 2WKLA 3AXLB 3NJKA 1FZMA 4X5XA 4ZO7A 4JO2L 1I1AC 1YCSA 5HJDA 2FLBT 4PS4H 5IB5B 3BH8B 4KXBA 6PAZA 1HL9A 1UTDA 4RDBA 1HDMA 1LK2A 4I0PA 4X7EC 2D0GA 3OKNA 3BSGA 3TIDA 2ZUWA 1MAJA 4Z3FA 1JVKA 1R3JB 3CDGA 1JHLL 2J20A 1JWUB 3UAJA 5I1JH 3VW3H 2ZNXA 5FF6A 5C08B 2WNGA 5AOIA 1T7WA 1JHKH 1WA2X 2AK1H 2YA2A 2VM9A 4Z3GA 4M7KL 4QOKE 2X7LA 5GGRA 4P23A 4PTUB 5EZLA 5SV3A 2YFOA 1J1XL 4CKVX 2ENPA 2P5EA 3WCYA 1IKFL 3CLEH 2CO3A 3CPLA 4IM8A 4OT1L 1R3KA 3UTSE 2OAAA 3QDGD 3UTZB 3C5JB 4MJIE 3MRQA 5GZOD 2EEFA 2R69L 1NC2D 3HG2A 3KLAB 2IOOA 1DFBL 4N2KA 3WTYA 5E2JA 5I17A 1BIIB 4XNDA 5KN5A 4PP1D 2V2TB 3TO2A 2XOTA 4LSRH 5AB1A 3MUY1 4G7YH 1EO7A 4WO4B 2KI6A 1GJUA 4KI5F 4NM8L 3NZ8B 3V4VA 1TU2B 1ET8A 2FVNA 1FE8L 2ZX9A 4YZFF 1T7ZA 3ZL1A 4XBMA 5JIHA 3BQUD 2FX9L 4WFGE 3EO9H 4JFFD 1DQQA 4GIOA 3RIFK 2ED9A 5FCUL 2GJZB 1FNFA 3C60A 4PJGF 1ROCA 4U2YA 2W9EH 4P5TC 3BH9B 4V33A 2Y07L 5TE7L 3VI3E 2PPAA 3W0WE 1HAWA 1O6VA 3BAJA 1U91A 1X5ZA 1KG0B 2A6IB 4J8RA 4MMZB 3OMAB 4R84A 3SQRA 5DEFA 3T6VA 3CCHB 4R7DB 5IW3A 2P42B 1DVFD 4R2GD 1HAUA 2NX5D 3NESA 1EGJA 4WWOA 3O0LA 1MQKL 3KHQA 2E7LC 2KHAA 2Q3XA 5BW7C 4PRIE 4R0LB 1J18A 3OBAA 3Q13A 4YS4A 3DX0A 4N5EC 2ID5A 1VDGA 1TETL 2OXGB 3FO9B 1QX1A 4PI2A 4NQXA 1BVKB 4FQQB 4ANKA 4ZMPA 1MFAH 4GFXA 1VFUA 1B9ZA 2H2PC 3F84A 3TXAA 1MLBB 2NR6D 3RB5A 1F1AA 4Y1AD 4HUVA 3IDMA 4E5XA 1Q0EA 1M9WA 1XSJA 5BOPA 4LLMA 1QI5A 3QUZA 5CJOL 4AYSA 1CL7I 3F85A 3I9GL 3F6LA 3LHPH 1SJHB 3EBHA 4K7PL 4UTBL 5DZNA 5DCCA 3X13A 1H6TA 3FUDA 2ATKB 1DP0A 1T7VA 2LTQC 2VDPL 4NKMA 5IESL 4PJ9B 3BIKB 4J3SA 4DKFH 2VMJA 3KXFB 2ESVD 3D2TA 3OZLA 3PL6D 2OQJB 1Z1WA 2VH5L 3K2KA 2YARA 3O6LH 1VFOA 3GZOA 3BPOC 3L7FB 3PDOA 4NFDA 4OUUA 4OVUA 5L6YL 5DJ8B 3W9EA 1HSAB 1TVHB 4IOIA 1Y6MR 1ZWIB 5DJDA 1WPCA 3OJDA 1S8DA 1YY8B 2JKWA 5IZ7A 1EBAA 2IDUA 1LE9A 2YHGA 3DXAE 4X5LA 3SKJL 1F0LA 3Q1SH 3AW5A 5KW9L 3EZ8A 2AQ2A 2B4CC 4PJ5D 5BUAA 3QHFH 1Y18A 4BQBA 2Q76A 2AVFA 2VLRA 3S35X 2XICA 4A6YH 4LARH 1KGXA 1HI6A 4JPVL 1N6QH 3B9VA 1NDTA 2IWFA 2PTUA 4H20H 1GGBH 1ZHBA 1EXGA 3CFNA 3ZDXF 4UM8A 5I1DB 5IB2B 3LZFH 2WXPA 1YEEL 4PG9B 1YEIH 3CXFA 5D6CB 3T2OA 25C8H 3EOBB 2CDFA 5FKAB 2GTWB 1P9MC 3LNDA 3ZZSA 5FGRA 2ZYSA 4BJLA 3LNGA 1WDAA 5DVMA 4XB7A 4URTB 2BP0B 2EDDA 4XNZC 1WWAX 2QPUA 2NYZA 4XX5A 3LN5B 3TEYA 4NYLA 3QHZH 1LHZA 2XYCA 1A6ZA 4HS8H 3ARQA 4EBQL 3EUDA 4IJTA 2Z92B 4U0RC 4PV1C 5F8RC 5LGHH 1OAQH 4XZUA 4ZAKB 4BK5A 5AZUA 5F0JB 5EOTB 3OGCA 3QO0B 3CFJB 1COBA 2GB2A 4OAWA 3BE1H 2YD4A 2Q3ZA 3OAZH 4ODSL 3ZYZA 4EUPB 5LGJA 5FA4B 4AIXA 3VWJD 4MA8L 4XWGL 1JPGB 4H40A 3MHZA 1MUJA 4AZ8A 1J5OH 3VJ6B 2NRDA 1NGWB 3BP4A 4U1KA 3DX9B 2IADB 5FA3A 2DD8L 5E9NA 4XVOA 1BQUA 5EU3B 3BPLB 1IC4H 3H7BA 4A7VA 2JVUA 2YUWA 5D93C 5JORA 4PHXA 1NGXB 4O5LL 1LXMA 3DUUA 3H2PA 4DT2A 4OZFA 4G82A 3OQ3B 1RZ8A 5IVXF 4G8IA 4I0CC 1LDPH 4R8WH 5EUOE 2DZEA 3QB7C 2X5PA 5E6ZA 1D6VL 4CJ1A 4GW4A 2DMGA 2VDMH 1EEZB 3LH2L 3MJ8A 1ZDQA 4RZCB 4Z7VF 4LEEA 1XBDA 3DGGA 3C5ZD 3FQXA 4XPFH 3N9GH 3VCLB 3VFSB 5IB3A 3ULUD 2P7TA 1HKFA 1E5YA 1KYAA 3ZMEA 3RX8A 4KV5E 2NY1C 4FFYH 3DPBA 4PG2C 2C3GA 4WUKL 1KPRA 1Q9OB 2CKBB 3CBJB 3SDXE 3SY6A 3AADB 3CVCA 2X88A 1JPSL 2DRUA 4YHPB 1TTAA 4ZODA 4BKLA 3L8QA 3U0WH 3S37L 3BZ5A 2PCPA 2WVTA 5L4IA 1GW6A 3ZE1F 2EZ0C 1XSIA 1F58H 4KX7A 2AQ1A 2GBTA 1T03L 4DAGH 1AGBA 4P2CG 1RERA 2FWSA 1PQZB 4JY5H 4PTTA 2VZOA 3QEQD 4FTVE 2AKRA 5AKTA 1ZTXE 4N68A 3OAWA 2EDRA 4DPRA 1QLFA 2AC0A 5DRWB 1WGOA 2CGRL 2EC9T 2X40A 3CVHL 1A7PH 5FW7A 2J55A 3VXQA 3T4YB 1V10A 1EA9C 2E86A 2R23A 4GAYA 3RTQC 4NQDD 2WP3O 2OI9C 3MLXH 1BD2D 2ZKYA 3RL2A 1C8QA 1PG7H 4HPYL 5JQ6L 4HZLB 1BHGA 4Q9RH 3CFDB 4KRPB 3B9AA 4TLKA 3DBXA 2BP3A 3QI9A 4C59B 4WI2A 1C08A 5IB1B 1JV2A 1PLGL 4O58H 4OD2A 1A3LH 2MOVA 4F5CE 4LGRB 5BV7H 1WBZA 2G3ZA 1MHHA 3RUGB 3LRGA 4ZD3H 2PW1B 1RIUL 3GC3A 1OAYH 2IAMA 1NC4D 3G9VA 5BPPA 5DK0B 3P9LB 4C56A 5EO1A 4OLXH 4XOEA 4JM4L 5I5MA 1UVQB 1HNFA 1VKXA 3PV7A 1X5MA 1TOXA 3L3OA 1AFVL 4Y19E 4P5SA 1YMMB 5B39B 4WHCA 4NRZA 1IARB 2X6BA 3R18A 2FX8H 1L3WA 3HHRB 4QRTB 2OJZH 4KVNL 3WEAA 2KPNA 2ZOUA 3TBSB 3X12B 5SWSE 3TZVC 5AWNH 4JFPB 5EBWB 1C5DB 3MLZL 4HISA 4LVHC 5KBKA 3PHOA 1RVFH 2B9AA 4HEME 3SO3C 1PLAA 3D25A 5DC2A 2H6PA 3ZZLA 5F8QC 2IGTA 1DBBH 2JXMB 2XETA 3FF7A 1L3NA 2J3SA 3DETC 4CDHA 4WO0A 2MCAA 5HGHB 5IROD 4CSSA 1FFQA 3OZ9L 4G9FB 3I9PA 1WZ1H 4Z7WF 5ID1B 2QPFA 2EYRA 2N0MA 3LZLA 3BUTA 5I16A 1Q8MA 4U1GB 2OMXB 3O4LE 1YJDL 1C1EL 1UGNA 5K9KA 3M1BA 3P3UA 1KV3A 5E2TL 1DJWA 4M8UA 3WE6A 2VW4A 4N0YL 3SO5A 3U2JA 3IGAA 1F11A 5K9QG 2XZQH 4XPTL 1EJOH 1WA1X 4M62L 3GTVA 3CU1A 4PRPE 5SX5H 3I84A 3VGAB 1PZ5B 2ICWI 1KBGH 1PIFA 3GZQA 5TQ2H 3P0YH 4J7RA 4DO4A 2AS5M 3V4PH 4DGWC 1O9WA 5FYLE 4G1EB 4Y4KA 1D5BB 4LSPL 4JB9L 2IXQB 4JFSA 3WUWG 4P4RB 3PAYA 4LEOA 3SDDA 3VXRD 3WXVL 1EAPA 1I8AA 2QHRL 3QZBA 3UTTD 5BXFB 4JN2B 4ABVA 5KBDA 1E8YA 3SBWA 3BUPA 5IK3B 2XQYG 5IWLA 4P57A 4R4NC 4UT6L 5T1JA 1AHWB 5E8NA 2X9WA 3AJ7A 5HHMB 4UBDC 7FABH 4ZO9A 4ADIA 1JK9A 3EG9A 1HK6A 4U05A 1OCOB 4HCRA 2VXSH 3GRBA 2M83A 2R15A 4A6YB 5E0QA 5FYKD 2PP8A 2PYFB 3KR3L 1RP8A 3ASWA 1RZKH 1IGCH 5I1HH 1XEUA 2F0CA 4Q9QL 2BSED 5GRVL 1GZHA 1RZIA 4JZNA 5FYJU 3DVGA 4MQ7B 4WO4C 1CZ8H 4FHJA 5D8JH 3ECBB 3D52A 1ZS2A 4OZHA 4QXUH 5ALCH 4YDKH 5E5LA 4PGDB 5T5FL 1WO2A 1YC8A 2BCKA 3A6CL 3NFPA 3NJLA 3SCMB 2HZHA 3KNBA 1GY2A 4XI5C 4RMRA 5D55A 1BG9A 3KYNA 5J06A 2H1PH 5J13B 1HC1A 3QJXA 4Z7UB 1A4KA 2WLYA 5JXED 2ISDA 1OE2A 2IALA 1KY6A 2P49B 3QIWD 3ZE2E 1X9UA 5DD1L 3UZQB 2OX5A 1RK1A 2VABB 4MMZC 2KLSA 3INOA 2X87A 3LPWA 4XCFL 4LCWB 3RNQB 1DANU 2R4SL 4ZMYA 3BP6B 1QTSA 1WTLA 4FZ8L 4LCCB 3L4TA 5T3XH 2ARJA 3TGXA 4R0LC 1QSFE 2VDRB 1F4XH 3V0JA 4EDWH 4P05A 3L7EA 3QFJB 1RUAL 1OD9A 4L5FH 4GRLA 4ZPVB 2YAFA 3NA9H 2XA8H 2JI2A 3VXNA 4N8VB 4FULA 4W1TA 2GY7B 3KLHC 4YO0A 3L3KB 3MDJA 2BNQE 5EZOH 2BSRB 1KEMH 1QLEL 3E6HB 1F2XK 1FL3A 1RIVL 2YQGA 1JWMB 3VFWB 1JZDC 4P2AA 2Y5QA 5DRNA 4R96B 5I0VA 2AQ3A 1XR8A 5D7JD 5DHYA 5KYNA 4Y2NA 3V5HB 1NGZA 1EXUA 4JQIH 3WXWH 5EEZA 4PJ9C 3PWJA 2GT9A 2WLIA 4HP5A 1MVUB 3R8BB 2VDMB 1T20A 3HN3A 5AVUB 1OAUL 1CD9B 1GGIL 1U2YA 2PPDA 4KAQH 5EOCL 4B97A 4FERA 3RGVD 2XN9D 3CBKB 1OTSD 1AY1L 2F08A 2WWKT 2WIIB 3ATBA 3QJFB 4OF0A 2Y0SA 4LP5A 5GS0H 5DMIH 4HF5H 1WCBB 5HDWA 3KXFE 3TO4A 1K4DA 3PHQB 2MTAA 5L2KD 5BMFH 5KSVA 4G70B 5CEZD 2MKLC 1I8KA 2ZJSH 4X98B 3RWGA 3QORB 4HJ1A 4JG5A 2R8SL 3MNWA 5AQ0A 4NGHL 4XBGA 4JM2F 4U1NA 3SE8H 1K8IB 2DWDB 3N2JA 2HYMA 1JRHI 1ZGLA 3ZMRA 1HEJC 1JZ4A 2WAQA 1E4XH 5IQ9B 4MKTA 3EDEA 1AIFA 4TV3A 4X6BB 5EEUA 4GXUM 4NRXB 4OQTL 3VD3A 4N2BA 4AH2A 4P4KD 4DP4X 4GKNA 3V5DB 2BWIA 1AXSB 1MFCH 1TVDA 3B83A 3TBBA 2FT7A 5DJYA 2Z65C 2R7EB 2MOGA 4IEFB 1KNOB 2F53D 3O2VH 5I1KH 5KVDH 3FT4A 4O4YL 5ETUB 2ZT9C 4HLEA 4BH8A 1PDKB 5T1MA 1G9NH 3RWJB 2H1XA 3BH4A 2A7BA 4XVUC 1EHLL 1RZ7L 2E6JA 1EVTC 3HBQA 4NERA 2AEQL 1E6JH 4HT1H 5HHXH 4ZAKC 5TE4H 4TVPL 4NN6B 5DMGD 2GITA 3BCFA 2ZSWB 3RVWC 3GZKA 1AS6A 3P77B 1U41A 3BD5A 2ZKHH 2JK5B 5D71H 4X6FA 4U1JA 3D9AH 3FB7A 4AENA 3LEVL 4XAKE 3IB4A 3CZGA 1BX2A 1IE5A 2HKHL 2K6YA 5ANMB 3TWYA 3P73A 4XXDB 5LDSA 1PX8A 1CDYA 5G5DA 3VH8A 4X7CC 5SX4I 2WLNA 1Q0YL 4NO0B 4WHTA 1JOIA 5C0BB 4DP5X 1CXKA 1YEGL 2YGPA 1BJ1H 4W9JC 2XFGB 1DQVA 4EI5B 1VCAA 3FT3B 1QUPA 3BPLC 3VFPA 4ODBD 2NXYB 4XCNA 3R7QA 3JV4A 4W4OA 1ZKAA 4Y4HD 3IKCB 2QELA 2YLKA 4FI6A 1UOVA 5FGSA 2BNUB 3VXUD 4XH2A 3OSVA 2GI0A 4DETA 3MQIA 3IDJA 3SPVA 3CHSA 1CMOA 1BQLH 4KFMA 2AEPL 2JI1A 4PJAB 2P43B 2V8LA 2BIPA 3CFQA 3MV11 5C07B 5LNGA 2XU9A 2YD0A 4LCIL 4MVBD 5DDHB 2GFBB 2VKXA 1M57B 3U1SL 1ILUA 3GXFA 1G7MB 1UWYA 5D1ZD 1F6AA 1CL7L 3TPUA 3QZWB 4MDIA 1RMFH 2W60B 4Z7NF 5L7XL 2EH8H 3T2LA 2Z8VC 1QMUA 2YZ8A 4HJGB 4NQQA 4PB9L 5CP7B 3UJIH 3VFUA 2KERA 5IMOB 1XGZA 4NZTL 4L4VD 3PAZA 2JKSA 4RX4D 2NXZD 3LQAH 3DRTA 3NIGF 3A4DA 4I85A 1TQTA 4HIEA 1DEDA 2B9BA 1WWCA 3V4PB 4LKCB 5I1GL 1G5AA 3M7FB 3PWLA 1PKQA 2JSFA 2MCPL 4HGMA 1G5GA 3ETBF 4PRNA 4PRBA 1C7SA 2XJKA 3FK3A 1CLYH 2H3NB 3Q8BA 3ZO0A 1AGCB 5GGSB 4YHLL 1FORL 2I07B 1A4JA 2P8LB 4JDZB 3FFCB 5DYFA 5TJWK 1PIGA 4U3CA 1SXBA 5CU5A 3QYNA 5GGVL 4RA0C 2YSSB 5DUPL 4HAKA 4ATWA 1ZEAH 4J3WA 3SGKC 4MD4B 2CBTA 5E4EB 4Q97A 2OYLA 3OR7A 2IG2H 4MQXC 4A2FA 2BSSB 3MLUH 1HEZA 3US0A 1E9QB 4BQ9A 3BZ4B 4M7JH 3V95A 4BSWA 2VR3A 4KRPC 1SQ2N 4YXKL 3VTAA 5HI3D 4QNPE 3MA9H 3UGXA 2VM4A 4KO7A 3S6CA 5DD3H 5CJXA 1K85A 5A40E 5L88L 1C16B 2ZKMX 2HJKB 3FQRB 1MLCB 3TBVB 1MCFA 3IMRA 1VIWA 1Z5YD 4ZW6A 4FQCH 5TQ0L 4IRJB 4HBCH 5DJCB 1K6QL 2WVUA 1ZV5A 3L1OL 4H26B 3RUGE 1S7SB 4DGYL 3UAFA 2NZ9C 3PXLA 4OZHF 3L95B 5IEHB 1TLKA 3GXUB 3IXTB 1JZEA 4I4WB 1YMME 2GK0B 3DO7B 2X12A 4BXVA 3UTOA 2R1YA 2ZXGA 2PO6B 5LQBH 3OKKB 3AXIA 2ITCB 4LVEA 3D4YA 5JO5B 4LAJH 5DEJA 3ARFB 3VXSD 4NQEA 1HHJB 5HJGA 5KSUA 3B2PA 4GXFA 4QHMA 2AITA 1OLLA 1U8MB 2CLRA 3IYLW 1UH4A 5AEAA 2PYEE 1MREH 4X8CA 4FDWA 3RIAF 4PJ7B 2GQHA 5E8EA 1YEHL 3DMMB 3WY3A 3PWPD 3RVTC 5AD0B 4JFOA 1GH7A 2GBUA 3WMPA 3ECUA 4G3YL 4N1EA 1S46A 3IAQA 4ZDHB 4H0LC 4JKNA 4K3DL 3VGAC 2KDGA 1N7MH 1SM3H 3Q44A 3HG3A 3Q5OA 1YQVL 4X5RA 3VWKB 3ATEA 4R4BA 5BCAA 5E2UL 4H25B 3MV8B 2PCXA 4KWUA 1UATA 1SRDA 2YPKB 3KLSA 5EU7C 3BUBA 3VDCA 3BWZA 2K4WA 1EZVX 2FH6A 4B9JA 3KYMB 5CMAB 4XN4A 3B7RL 4CSTA 1A6WH 4U31A 3WTSA 1BQ5A 1I7TB 1F5WA 2VSCA 3NYKA 3Q48A 4YC2B 4RFEB 3RB7A 3TEWA 3VXOB 1S7VB 5EU7E 1N0XL 2CK0L 5LBSA 5DMYA 2LT9A 1AHWC 1H3WM 2FEJA 2OCFD 1QEWA 4AC4A 2CIKB 1RZGA 5HYSA 4I48B 4LXFA 5KVEL 4CRPA 1EHAA 1YPZA 1TTGA 1UD6A 2EXWD 1MRDH 2YN5A 4Y9FA 1FG9C 4LRIC 5DZLA 3MR9A 1XAKA 1CFSB 1WAEA 3B9KD 2JH2A 1VF5C 1A3ZA 5HHME 3MNZA 1T7XA 1VADA 2NY4B 3PABA 2FJHB 3EFOB 5H37H 3Q6GH 1P1VA 1ADQL 4KI1A 4WGKA 5DLMH 1KGIA 3CBRA 1CBVL 3GJFK 2EO1A 5EU4B 4JUSA 5F7BA 3WFDH 5EU5A 3G5YB 3FSAA 3SCMC 4TNVF 5I1EH 4AEFA 2O4EA 4XMTA 2VUKA 3MV9D 5JPNA 4UINH 5J13C 5DUJA 3DIFB 3RVUD 3UADA 2DS4A 4EIBA 3ARGD 2Q8BL 4EIGB 3AQZA 4QWWC 4TYUA 4HKBA 3KWUA 3FOMA 3VXTB 2HAZA 5I24A 2K3HA 4YDJB 2DTML 1NDMA 4Y16D 3W39B 1UD5A 4HHGA 1X5IA 6FABH 1B4RA 1F3JA 5FDYA 4E9SA 1TVBB 1T22B 2NCEA 2P44B 2QLYA 4ZOCA 3ZTNH 1RULL 1A5FH 1RURL 4LCCC 2XWEA 2OMWB 5LG6A 1FFPB 1RJYA 2R2HA 4OLVH 2P5WB 5E5UB 3HZ3A 4I5BB 2HB0A 3BMVA 4KROD 4LCWE 4FABH 3MXVL 3EW3B 1IIKA 2X4PA 3DX7B 4U6TA 4NKOA 3QUKB 4AITA 3G6JF 3ALPA 1K2DA 5DA0B 1F41A 2JJTC 3CSYA 4O51B 2J43A 5EPMB 4LQ1A 4X50A 4GSUA 4OLZH 1YA5A 5IBUB 2IPTH 3N44B 2BNRB 2Q6WB 5GZOA 5TE6L 1J0YA 5SX4H 5ADPH 2AXHA 4DUWA 4JFEA 4QRUA 3MV7E 3RDTD 1NC2A 4S2SB 5IEKB 3C2AH 2CJUH 2FX7L 4UOW1 4YSSA 1P1ZA 4UMGA 3Q5YA 4ES8A 3WFHA 3WNLA 1ETZA 5IFHL 3BUDA 1A0QL 1N67A 3LN9A 1CDBA 2X3AA 3QCVH 3CTTA 1NMBH 1E5ZA 2F18A 3I6LD 4HWBA 1G9MH 1LO4H 2Z91B 5HJ3A 2DL9A 5BVJA 2HVBA 4XCYB 4BH7A 1EXHA 3BQUA 3SDCB 5FOJA 1JYNA 3T6XA 5H4YA 3TCLB 4JFFA 1ZA3A 2V2WA 4NO2B 3WGUB 5GSVA 1HCVA 3M17B 3DV4B 5FYKU 5M95B 2QADB 2CO1A 4H88H 3VFGL 3MJ6A 2VN4A 2W0LA 1XZ0B 2ZX8A 5F7NC 2V8MA 3QORC 3U1QA 2V7NA 1XAUA 3HNVH 2AXWA 5EIQA 4PUBH 3MX0A 5GS1A 4OLUL 1VEOA 4KK5D 3FQYA 2CU9A 1DVFA 2F58H 1QOKA 2NX5A 3VRIB 2JQAA 4U49A 4G8FA 1U92A 3QUHA 4D9RD 2L7EA 4RAVB 2GTQA 2OSXA 3QR2A 4AUJA 1KTLA 2OMYB 1JNLH 3ZL4H 4CBPA 4ZW7A 1GPOH 2A6DB 1H3GA 1CCZA 2CO4A 4OFKA 5IFAL 2J1ZA 1TENA 4U7SA 1B6DA 5I8OL 2YJLA 4NZUH 4HDIB 3WFZA 1JZ3A 2DM2A 3QNZB 1H8NA 1IAKB 1FNGA 2NR6A 3I6GA 3L2NA 4Y1AA 4YE4H 5DHDA 4WSJA 5C3LD 3AY4C 1KTBA 4PJBE 4BFBD 3FB5B 2EXYC 4NNYB 4BEIA 2ZCHL 4M43L 5G4OA 3OM3B 2AQTA 3CN3A 5LCVL 5BVPH 4FG4A 4HGKC 4S0SD 5J4MA 5HJBA 1QNIA 2HA1A 2X4QA 3CVIL 1KCRL 3T4AB 1ZMYA 2ESVA 1L6ZA 1YZZA 1BFOA 2AJSL 2VXTH 3ARZA 4NN6C 4GAJL 4AQ8C 3IU4L 3PL6A 4FQXD 3FN3A 1S9XB 1A7QH 2QSQA 1FPTH 4YX2L 4W6WB 5IY5B 5E08H 3HMXA 5EN2A 1JTOA 4M6NL 5JHBA 1BLNA 1TZGH 2EDXA 1LEKB 3G08B 3MJ9A 2VJ8A 3OAUL 4MCMA 3MLYH 4R6UA 1YYLL 2AMGA 3PXJA 3OPZL 2WBJD 2VR9A 1NBYB 1BAGA 3MBXL 4KKLC 4ODVL 5ENWB 2YEQA 3JWOH 1ETA1 4K3JL 2IV9A 4NJ9H 1QW9A 2XWRA 2IDFA 4PJ5A 4UMSA 1Q94A 3MXWH 4EI5C 1PYWA 1S78C 2BC4B 2CMRH 3L2LA 4FXTA 4KJWC 2SODB 3LS4H 2NXYC 4KK9C 4LDLB 4OD1L 4MJJA 4R4FL 5TDNB 1JFQH 4FN0A 3V7AG 1UD3A 3QZLA 2GIMA 3QIBD 1SHWA 3UPRA 5AW6B 3ATDA 5C0BE 1J8KA 4ANUA 4Q4IA 4UT9L 3B5GA 2HT4C 4IU3B 3O11A 2NY2D 2PR9A 4J12A 2CIIA 2ORBH 4YOKA 4GKSA 4M29A 4DP7X 1MI5A 2JCCE 5I15L 5ESAB 3EGXB 2BVQA 4V1DB 1WLHA 3HRPA 4XODA 2FRGP 5I19H 2BDNL 5EEXA 2KBGA 1JPFA 4UDTA 4S1QH 2UWEF 2EH7L 1S9VA 2FO4B 2JMRA 3GMQB 1Z6JT 5D7SH 4AXWA 4PJAE 4X6CA 4A04A 1NIEA 4FHBD 1WBYA 5C07E 4ABWA 3K71B 1NEPA 4R7LA 2VR8A 4YSCA 1O9VA 3DRQA 2E46A 3MACL 5I66B 5HGAA 4UM9B 3U46A 2GJPA 4AYFB 4JMNA 4O02L 1QHOA 3ZTEA 4MJ2A 4W9KC 5DU7A 2FJFA 3UIZA 3PGDB 1LEGB 1D7BA 1NCBL 1TTFA 2P1YA 2UY7A 3SODB 3UGEA 4ZT1A 5LN8A 3AT0A 2D9QB 4NO3B 3X1FA 5CKGA 5LB1A 8CGTA 5T1KB 4QTIH 5D1QD 5I73B 3W3BA 3FU3A 2UXFA 4R9HA 1KIUB 3LYRA 1FIGL 1NUFA 3IU3A 5E4EC 2A1WL 4K9JA 5E99L 1NPJA 1JXJA 1M2VA 2FBJL 4AL8H 1JRHL 4LQFH 1AJ7L 4M6OL 3FFCE 5IOKA 3TBYB 3RKDC 3DO4A 1HILA 2YAOA 4WEBL 2FL5A 2OW7A 2ZG2A 3MBEC 1I8IB 1RZKC 4JDTL 2BY3A 4LSTL 1ZA6A 5IVZA 4EIZC 3BLBA 4G5AA 1I7RB 3IBEA 3RGHA 4Q4EA 1J8HD 5HPOA 2BRRH 2W0KA 3K7UA 3MOBL 4YPGA 5CZVH 5C09B 1E27A 4C54A 3C5ZA 3FTSA 1AS8A 5KAQG 4HS6B 3WFBL 4IRJC 4JKPL 5TDOA 3LMJH 1PG7X 1HHHA 2YMTA 3GRGA 2I60H 3P4LA 3WUZA 4E9TA 1J8SA 4PLNC 1XGYL 2XIDA 2ZONA 2ZCKH 1UXSA 5AENA 4IHOA 2QV4A 3V9EA 4ZFZB 5IQ7H 3BX7C 3VDBA 4W9IC 2OP4L 4W4NA 4MAZA 5ID0B 1OPOA 4ODUA 5F7UA 2V17L 5A6MA 1AAJA 3B8SA 5F7YC 4U6VL 3NIFF 4LPCA 3QEQA 4IMLA 4NENB 3ARFC 4FQ1L 2NY5C 3Q1EA 5FV1L 2NY3D 3QEUA 3FHAA 3RVVD 2RMNA 3VFNB 5DWUL 3FU0A 4HS3B 1FZOB 1HQRA 3INUL 3L81A 2XQBH 5IQNA 3Q5TA 5HYJD 4DKEL 1GC1L 3FMGL 4KMTH 4NQDA 5T3XE 4BQ6A 3DMMC 1YNTF 5FO9A 1BD2A 1HH9B 2VZ3A 5CJ8A 5AW8B 1AE6L 4K5NA 1IQDB 5GZNC 2H1LM 2E7MA 3LV3A 3WIFA 4L5FE 3O3BA 2VL4A 4J2QA 4PJ7E 2C4FU 3W1ZA 3M86A 4F7TB 3MRMB 3FCUB 3GFUA 4RH4A 4TS6A 1U3NA 3NABH 4PR5B 2QTEA 3SYAA 4WUUB 2AANA 1BGXH 3VWKC 4HFUH 5ESQA 4I18B 3TTYA 1GIGH 4WTQA 3SGJC 4KBPA 3SKMA 1NC4A 3KPNB 4WFFD 1AGEA 3U9PL 2CJSA 1WC7B 1BQHA 2DOCA 4TRPL 1Z5LB 1WF5A 3RAJH 3G04B 5GS0C 5E00A 4YC2C 5JQIB 3BVXA 4JHWH 4FQPA 4M4RB 2EYTB 3OKOA 4NN5B 4FMFA 2HG5A 4CW1A 4KJPD 4NPKA 1F90H 1XF4B 3ZHNA 4P3CL 5C0FB 5FOBB 2HXAA 3TJEL 1W16A 1MFUA 1UZ8B 2G60L 4WY7H 5AOKA 4D3CL 2YD3A 1N70A 3RY5A 3FHQA 4Q6IA 4WSGA 3LIZA 1D2OA 2P24A 2EKSA 1K5NA 3QG6A 5EULV 3PAUA 4TL5A 4HUWB 4MZIA 4XNAA 4MNQB 3TBWB 3MRJA 2NY4C 5JIIA 4UQAA 1N8OE 2V9TA 2J57A 4FKHA 1Q72L 3BPNB 4HUUB 3QWOA 1DQLL 4F8OA 2R51A 4JPKH 3IFOB 1JHTB 2V6HA 3LRSB 4WDIA 2LV4A 2ZYHA 2C9AA 1FLTX 2DWEB 2P3YA 3VYOA 4XP6L 1OP4A 1CYGA 3EH4B 3MNDA 1QYGL 1S5HA 2ZOKA 3GBML 5FLUA 4A7TA 1G9NC 2F6AA 2N4IA 3IJYB 4P3DA 3MRPA 5I30H 3L3JA 4TNGA 4IBWA 1FFOA 3SBRA 1R3HA 4FD0A 4OD3H 2I24N 4PBXA 3SGDI 5I75B 5KVDE 1HYSC 1G84A 4TULH 1C12B 4XWOC 2Q86B 2DL2A 2DQTL 5DYOA 3QZOA 1OGAD 3U0TB 5H35B 2VR7A 2XTJD 5EO0B 3ZKXB 3UBXB 4M3KB 3FB8B 1DQJB 2N59A 1HXMB 4LASL 4HK3J 2VN7A 3K4AA 3AG4B 4HUXA 1ZV9A 3WS3A 5BZWA 5DK2A 4U1SA 3POHA 5IM7B 2OMTA 4OZIA 1QSEB 1EAJA 2MCMA 1AR1B 2AJVL 2BVYA 4NUQA 2XWJB 3K46A 2P5WE 3OTTA 3P9MA 5GGTL 5JA8B 5ABDE 4ZMLA 1EDQA 3O9WB 3NP3A 2WQRA 1E7VA 4FCHA 5AVXB 4Y5YA 3MGTB 1FNSL 4JQVA 5E8PB 3IJ8A 5F7KC 1GRWA 2HJFB 4IRZL 3GJFH 5BRZE 2XWBA 3QUYB 4NOBA 5AYUH 3PP4H 3NACL 2BNRE 4PMFA 5HYEA 1T5KA 4PJXA 4Q2ZB 3D85B 3V6FA 4CMMB 4RDQF 3GSRB 2A9CA 4OZ4A 5KBPA 3VD9A 1NCAH 2BZ7A 5D7KD 1H6EA 2DLGA 2YGNA 5CXPA 3SDCC 2P45B 3T9WA 3NJVA 2A9MH 4CSPA 1AC0A 1BFVL 2DLFH 2X4NB 3OKYA 4MZRA 2QADC 5JXEA 1T2QL 2ATPA 5DJ0A 4NKDB 3QO1B 3WL9B 1TTBA 5B1BB 2WNXA 1MCWW 3MLSH 3QIWA 3IE4A 4QGYA 1BECA 2DH2A 2J25A 1BAFH 3FQ2A 1BJMA 4AMKH 5EEVA 1NDGA 5FM4A 5DQ9A 1WT5C 4XP1H 4KK8D 2C3HA 2WQUA 4QRSA 4WHYG 3D48R 1CICD 1DSFL 1MW1A 3JTTB 3RIAK 2FR4A 2X3BA 1OLZA 2Z0BA 3KGSA 3U0PA 1GS8A 2Z31D 2XG4B 3GWJA 1DCEA 5DFAA 3C08H 4GW5A 1U8OA 2VIRB 3MRNB 4C83B 1D9KD 1SVZA 5HHVH 1WHOA 4HOMA 4AZUA 1RZJH 1WZLA 4NCC2 5CR8A 3KWXA 3APDA 1AZRA 4PJFF 1G7IA 4I9WE 5B38G 1V7ML 3MO1B 1ZLSH 5TD4A 3B56A 3N55A 2I7SA 2XV6B 3FYEB 3EOTL 1HCYA 1KELL 3M8OL 4QHKJ 1QBML 2PXYB 1B4LA 1FZJB 5D7JA 1GL4B 2BHZA 3LVEA 3KWWA 5EBLB 2Y7MA 4R3SA 1UM5H 3AREC 3NCXA 4W6YB 3KYOB 4X8GA 4PJGB 2O6DA 3KDMA 3V4VH 1OSZA 4U6XB 5FC9A 4PGBB 3T4AC 4JRXB 1HIMH 1WRFA 1OGTB 5E9DD 3CHOA 2EVIA 4N2LA 1JYVA 3F7YA 3RGVA 2XN9A 3FQUB 5ILTH 2C1PA 2DQHH 2GUYA 4UYPA 4F57H 2E4FA 2N3JA 5I8CA 4GO6B 4MB5A 3HAEG 4U1IB 2UVFA 4FKEA 1URIA 1CDIA 5L2KA 1WIOA 4K4KA 4L3CA 1KLUA 3TVMB 1RJZB 3TT1L 2X1QA 3FSWA 1PZ2A 3GJEA 2H7WA 1UFGA 4YFLI 2DQUL 1UWGH 1V54B 1WQVT 1VFMA 4BA0A 3QQ9D 1KC5L 4GKZA 4XAWL 5FFOA 1T5XA 5D6DA 2W94A 3MRLA 1EGJH 5GS2H 4RMSA 3SSGA 5HHOA 1LD9A 1O5DT 4JFWA 4MLSA 1MCEA 1Q0XL 5IUCA 3M1CA 2V2XA 2Z4QA 4FEIA 2WXHA 2NTFB 1V3KA 1X7SA 1ZLUK 5CKAA 4MGXA 4XE5B 3RZCD 2V7HB 4AGQA 4TNVK 1F2QA 4P4KA 3WFEL 1YN7B 4Z0XA 3RWHA 3PP3K 1JI2A 3FQ1A 2GAZB 1TCMA 3KPOB 3ARWA 2WQSA 1FBIH 4K8RH 1AXTL 1OAKL 2ENJA 4Z6AT 1XGTA 2F53A 1OM9A 4ICWA 1ZT4A 1E9OB 2HKAA 1KENH 3CC5B 3B2XA 5FAAA 1FIEA 2FH8A 2G3NA 3K81A 4HXBH 1YEKH 2A4CA 3GGWB 1FRGH 4NRYB 4HH8A 3ZT6A 2BK8A 3MLWH 4LCUA 4V1DE 4X7FC 1ORSB 3U2SB 2VQUA 1HH6B 3JVGC 2GCYA 3NDZE 2DKUA 3CHQA 2D03L 4PEEA 3NG5A 3TP4A 4M5ZL 2OMZB 3HN5A 4XPHH 5I73C 4HWEL 4LF3A 1CE6A 4WI3A 4N2EA 5FM8A 4PJHA 3BSZL 1DVQA 3V0EA 1J05B 4L1BA 1H5BB 4AYEC 3GHEH 4QTHA 2H0EA 5HDQL 2H2SD 4HUCA 4K0OA 4UIKL 4JGMA 3ZDXB 3V0VB 5JTWA 3NH7L 5KOMC 2C9XA 2ICES 1JGLL 1UCBL 2FLMA 2ERJB 1QFOA 3G6DH 5K5YA 4Y4HA 3EYSL 4NHCH 4D0DB 3C6LB 1DBKL 1NAKH 1YNKH 2XKSA 4JO5A 3BN9C 4DEPC 1SYVB 4GIAA 5JYLA 4PW3A 3VXUA 3QDME 1ZHLA 2EIZB 2F1AA 3FOLB 3WY2A 3TV3L 3G5XA 3QYMA 2Z9TA 4IS6B 5DMKA 3KVDD 4LIQL 5ACZB 3SDYL 4BGLA 2DQEL 2K8MA 3EJCA 3MJWA 1OSPH 2W9DL 3KPQB 1NCHA 3H53A 4ZMAT 2EIEA 4FQJL 1UXWB 3QJRB 5D1ZA 4IW4C 3J7HA 3OXSB 3JVFC 3J07A 2YAMA 1OARL 3NQIA 2AQRA 3ARDD 5C09E 5KS9F 2Y5EA 2LU3A 4PBWD 4L4VA 4JFQA 3HVNA 4K3HA 4RX4A 3LY6A 3U7WH 5L2JA 3DTUB 2NNCA 4U7MA 4XT1C 3JTSA 1UZGA 4ODXA 5KSAB 4YHKL 5T1LB 1B0GA 3IF1A 3SQOH 4IRSB 1UM6H 4N0FA 1KYFA 5A3ID 1HL4A 3D18B 1IFGA 3G5ZA 3LEYL 4UI2A 3SGDH 4BM7A 3NSFA 1THAA 3VI3F 4NAMA 1KJVB 3OLGA 2AJUL 3FT0A 4F33A 5HGDB 3DYMA 3STBA 1NBZB 3REWB 4V2BA 3HUJA 1BVOA 5IBLD 1YSOA 2X4TA 4CVZA 1ODUA 2P47B 1XGQA 1JERA 4Z7VB 2JQMA 4B9PA 1GOFA 3GNMH 1LYQA 3IBOA 1D5IL 2R0WL 3K6DA 2V3FA 4FCAA 5B8CA 3IKKA 4OZFH 2V4LA 4NXKA 4XO4A 1IC7H 1FYTB 2E8ZA 3GJFB 5AAWA 2BSTA 2Y1AA 3G7TA 4I18C 4WI5A 5MI0B 4RLDA 4N6QA 2Y6TE 3MU3A 1KULA 4BZ2L 3J8F7 3MCKA 3ZE1B 1KJMA 3PDGA 1N19A 4QCIB 1G7JB 4CNIA 3RWIA 2F7PA 3BOVA 3IAPA 1DBMH 2FWUA 2HN7A 2C34A 4M7ZB 4U6YA 3FAXA 1AO7D 2ENSA 5CUSH 4AG4L 5JIPA 1AKJD 4X5XB 4O2FA 2KMWA 4NN5C 3VXPB 1D5XA 1UB6B 1SJEA 4MDRA 4I0PB 1A1OA 1CVRA 1T1WA 3OKNB 4UAHA 3Q05A 4TVSa 5F70A 3VFTA 4G9DA 4NZFA 4QOKD 1KBVA 4I3RH 2QQKL 5FWQA 1NIDA 5AZ2H 3CDGB 3UYOD 3IMUA 1P6FA 1SJMA 1ZSHA 3QFGA 3TC9A 1SBSL 3VXSA 4HC1L 2C1OA 1UJ3A 1IL1A 1JGVL 2JTDA 2PF6A 4MJHA 2X7LB 5GGRB 5EZLB 2C9SA 4GBXB 3BPNC 4Q89A 3RPIA 4CVXA 2VMFA 2L04A 2NT0A 4YMPA 5A1AA 3CPLB 1S3KH 1R3KB 1NCUA 3O3EA 4MNQE 5J6HA 2WWMC 2VLKD 3PWPA 1NOAA 3C09B 1Q1PA 3ILQD 4LSSH 4XTRD 5CGYC 4EN3D 1OK8A 2LU7A 3CVDA 4E41B 3D07A 3O2DL 5E8OB 2RFXA 2FCBA 3BWAA 5I17B 5KN5B 1OT2A 4XOCA 3PREA 3QH3A 3T6ZA 4YHMH 4JN1L 1PJWA 3KPLA 5CHNA 1I7ZB 1MEXH 4HJ0D 3FO2B 4H0GA 5I75C 3U1PA 12E8H 4NP4L 3LIUA 1TZIB 2HT2D 3MFFB 3PPSA 2C3WA 2QGCA 3FRPG 1MJ8L 3KYKL 3ZIMA 2L7QA 1F56A 3DX3A 5IF0A 5LXGL 3MPCA 3ZKXC 2XUWA 3VUAA 5A2CA 3Q43A 4NN7B 1ZVHA 4OZGA 2CXKA 3C60B 4MX7A 3FUHA 5DHEA 4MNGB 4Z7WB 4E9VA 4XC1H 2CO6B 4WWKD 4J8RB 3JWOC 1AR1C 5DEFB 1KF9B 3PWNB 1FYHB 2WXRA 3Q8CA 4IBUA 1AD0B 3O9WC 5D96B 1AP2B 4QRQB 4XC3L 3D69B 5HHQA 2ZIDA 3KH3A 5GSRA 1QSEE 4AUYA 1SF5A 3AS3A 1I3GH 2WJ5A 3B9KA 4K5LA 5AZEL 2DQCH 3QUYC 3T2NH 1HOCB 6CGTA 4FLSA 3I3EA 5IMKA 2JWYA 4NQXB 4S1RH 1YDPA 2HTKD 4NWTL 3DI3B 2ZICA 2ZWSA 1KT2A 5HDRA 4NNXA 3IDMB 4E5XB 4HUVB 3SOBH 4X7TA 3L3IA 3ZT7A 5F6IB 1B3JA 4K07A 1R3LB 2XX1A 4MS8D 3MV9A 4LLMB 5GRUH 5DRXB 1WAAA 2YMXL 3ZHFA 2IPUK 3X13B 3ARGA 4MLIA 4KRMB 4N4YB 3ARXA 2DV6A 1NMAL 3DA0A 2R0KH 3FH5A 4FGMA 2W07A 4XPGL 1PY4A 3WUWA 4PVMA 4MA7L 2NZIA 2VDRL 2JKNA 4FFVC 2PWEA 1NCCL 4UTBA 2XQYA 4KV5F 4AQAB 3PDOB 3BDYL 4J3OF 1UH3A 1Y07A 2NLJB 3AAZB 2YPLA 1K8DA 3HZKB 3W9EB 3ZY7A 4FI8A 1TEFA 4UV4H 4ERSH 4PRHD 4DCQB 1FLRL 4AYDC 2BHYA 2NUPA 3CXDL 4EUPG 1LE9B 1D7FA 4X9FA 3GM8A 2OPCA 3IETA 4HWUA 3NCJH 2H0PA 4XP5H 4FEMA 2F5AH 4IOFC 2Q76B 1UH2A 3I3BA 4KI5C 4AL8C 3SEPA 4AIEA 4HCRH 2WOBA 3TA3C 2VLRB 1E30A 4PJHF 1KGWA 4XMUA 4YQXH 3WSQL 5EWIH 2EEXA 3EAKA 4TSBH 4PU2A 5F0PB 1TJHL 4YGVA 4OTXH 3RDTA 1HI6B 1P5UA 5LXVA 5B3SB 2PXYC 4OH2A 2Q2LA 5LAPA 1JV5A 5FDWA 4G11A 4GFTB 1IGJA 4KI5E 4WWPA 4X6EB 2APWA 3TT3H 1MIMH 5F7MC 5CCKL 1N4XH 1Y1DA 4OSUH 3BRGC 3RTLA 5CO1A 5ADOH 1CXFA 1A7RH 5CSZA 3EBIA 2X9YA 1B9KA 4FQHA 1FF5A 1QWNA 2VZ1A 1JWSA 4PJGE 3QNFA 4NYLB 2VXVL 1A6ZB 1R5VA 4JRXE 1WGVA 2FECI 3TVMC 1J48A 5D5MA 1S5IL 3MRCA 5ECGA 4Z3IA 1XWVA 3D0LA 1A4AA 1AC6A 3FTYA 1XB3A 3UG3A 4PB0L 1ZHKB 2VM3A 3AWGA 1XCTA 3BQVA 3OGCB 5JOFA 2OYPA 1BOGA 2ZPKH 4CN1A 1H9DA 2A74A 1ZHNA 1MCDA 5EN3A 3CZLA 5LGJB 1HKLL 4M56A 1IV8A 3H9SB 5D2NB 1DQDL 2DPKA 3ROLB 1T4KB 2GSGA 5IHBA 4WEMB 3BAYA 4OGQC 4PLKC 3N1FC 4NT6B 4GJTB 1MUJB 1N2RA 2ZD0A 4HUKB 1OPGL 5K33A 3L4YA 3CU7A 4DEUA 1A64A 3MROA 1K5WA 3D34A 4E2OA 4HCIA 1UKSA 3ZYJA 4YDVA 5CD5D 5H2BB 5JORB 3RWEB 4CBZA 3U25A 4GRMA 4MSWB 4WQOA 3T0AA 3L5WB 4IBYA 4S1DC 4RESB 2HCZX 5FLVA 1VGEH 3QZNA 1OM3H 1XD0A 2CDEA 4APQD 2NY0D 2OL3A 3B3IB 4GW4B 4YBLB 2WXLA 1JZ6A 2V3DA 1E90A 3N43F 1WBXA 2CHZA 4PSPA 1BZ8A 3FQXB 1RUKH 5IB3B 3VU2A 2P7TB 5FM5O 3QEHA 1NWPA 4PY8J 5EV7A 4FQXA 3Q2WA 3DPBB 1OAXL 1KPRB 1OW0A 3D05A 4JM2B 1F4WH 5FECA 4QXTA 4XHJC 3IT8D 3KW7A 5EF2A 1MFEL 2B1AH 3MOAH 5MEPA 5F9JB 3MZTA 5HDLA 2XBTA 2BERA 2NNAB 1H5BC 2WBJA 1KFAH 3FCTA 2QGEA 1HSBA 2YD2A 3Q6FA 2ZCLL 4KK6D 3HR5A 5A7BA 4JPQA 2JV6A 4TSAL 1AGBB 4FQIH 2AXJA 4PS7A 4F24A 1ZLUH 4F3FB 4UT7L 4JL2A 2XPZA 2ERJC 3GS0A 3STLA 3UP6A 4TF4A 3C9NA 3C6LC 5GJSL 3QIBA 5DHVA 4P99A 1KBPA 2YRBA 3PP3H 3VXQB 1KWKA 3F5WA 1MCSA 3L3HA 2YOCA 2DQFA 4OJYA 2R23B 3DX6B 4GAYB 3OLIA 4J6RH 3ZYOA 3ULVH 3Q2VA 3V6BR 4K73A 3DX4A 3ME0B 1ACZA 1MJ7H 4AKPA 2AV7A 4FA6A 3SQBA 5C0AB 1YAZA 4JDVA 3BAEL 3GIVB 3RY6A 3HE7C 2VTFA 3QI9B 1JGDA 3FU8A 1TUPA 4AJ0A 3ETSA 1A9EA 4ZXBA 1NPUA 3V6OA 4B60A 5LWYH 4IKKA 2Y9RT 1MHHB 4ZFOA 1R6VA 3QQ3A 1CGUA 5CJBA 5SWSD 4LO9A 2E9BA 4G8EA 4C56B 3LS5H 5MHSE 3KS0H 2IQAA 4L37B 4J3TA 5KSAC 4YGAB 4FOMA 1QHQA 1JPTH 4NRZB 4IRSC 2RH0A 4LSQH 3RX9A 3TZVD 4TSCL 4ZSOA 5D1QA 3GQFA 2HLAA 4X5WA 2NOYA 3U79A 3QJOA 1DL7H 3ZE2F 1GYWA 3CZEA 4NBXB 1NGYA 3A6BL 1C5BH 3D25B 4N8UA 1GCFA 1U8LB 4F27A 4XCCL 2H6PB 1T0NA 1AS7A 2EEDA 4OZGF 4CN4A 1DJSA 1TEYA 2EC8A 5B22A 3TYGH 2C4XA 1L0QA 1JDCA 2XN2A 3Q9QA 3UYRH 2EYRB 2OA9A 4W9GC 5ICUA 1NEUA 1LE5A 5E6IB 1OE1A 2BVPA 4Z7VE 4N0UA 4PRPD 5MI0C 1J8HA 3BDXA 1ITCA 1QP1A 4K5MA 5B1JA 3VXMD 2ENQA 5EOQL 2FJSA 4RFOL 3NRPA 3UMTA 3WE6B 4P5KB 1CF1A 4JQXC 2Q5BA 1KXVC 3IGAB 1F11B 4GT7A 1FYTE 3NIGB 4LNRA 4L23A 4QEGA 4W81A 1XB8A 5KYWB 4M7ZC 2E75C 1VEPA 1VPOH 1BWWA 2HTLD 4OJFL 5T3ZH 3VMNA 5DD6B 4BD4A 4DP8X 2XYBA 4PRAA 4MJ5B 2NY5L 3OHXA 4I0PC 2QKSA 3JXAA 1G9EA 4H5SA 2QSCH 4N9OB 3GRWA 2WXNA 1KIQB 1E5AA 1BBDH 2F74B 4PS3A 2YEZB 5ES4B 1N3NB 4XBEH 5JXAL 3UAJC 3FSVA 3T0BA 2BY0A 1WEJH 2Y36L 5C08D 3SKNB 4LEOB 2Q7NA 3QULB 3SDDB 1EAPB 2OZNA 5CN3A 4KVCL 1G7HA 4BWTA 1CIDA 1O6TA 4P57B 3SGEH 1UOWA 4GBXC 1CLOH 5HYJA 2R29H 4HIPA 2VDNH 1KZYA 2BP5M 1RZJC 3BYYA 1QZNA 3MRDB 1JK9B 4B96A 4G72B 2FT6A 3C09C 1UASA 1RUPH 1JNHA 1GAFL 3GBLA 5JW4M 4NKIH 3QG7H 4UT6A 4UOZA 3NCYS 1CYWA 1UACH 4NLHA 3ZSSA 1PU0A 1SDYA 5JW4Q 2GIYA 4PREB 4W9ZA 4JZNB 3DVGB 1O75A 2DI8A 1W72B 5MENB 4HF5L 4ONOA 2Z8RA 15C8H 3OR6A 4OZHB 4GXVH 2V9QA 1SOSA 1G0DA 5CLTA 1UD2A 3NFPB 4XI5D 2B14A 4ELMA 4YEEA 1Z66A 3QP3A 4NN7C 4KY2A 1UHVA 3C60C 4ACTA 3D3VB 4NCDA 4GO9A 5ICZB 3VQ2C 2IALB 4W93A 2DJUA 3US1A 1O7DC 2VDKH 3NSYA 1M1XB 2DM4A 2UXGA 2K7QA 4NZJA 2VITA 2F54D 4F9PA 4X4ZA 3QXWA 5CBAA 1AZCA 2KUTA 2D4DA 2CA4A 4I89A 1EDHA 1N59B 3BKJL 1F8TL 4JZJA 4MNGE 5D96C 5J9PA 1O7DE 2CM6A 2ICEA 3BVUA 2PKDA 3GLEA 5C0RL 4Z7WE 1O9ZA 2ARJB 1FDLH 2VOTA 3AZUA 2Y5TA 1B4TA 1AOZA 1PY9A 2CLVA 4KKCD 1P4BL 3JV5A 5CLYA 5I1LB 3MA7B 3L7EB 1KB5L 2BOCB 4KQ4H 1AKPA 3WY1A 1UCTA 3QPXL 5L4MA 3VXNB 3ZE0E 3HCVB 3EADA 4YO0B 3BO8B 3T3PF 1J9TA 3BUIA 1UEYA 1BZOA 3K5SA 4K8RC 1EERB 5F6IC 4RSYA 2WKOF 4DP2X 3GSQB 3M88A 4DJMA 3RWCA 4M8VA 4NQCD 1FGNH 1XR8B 1LWHA 2E27H 5DHYB 3DOHA 4HXAL 3KJ4B 1GXEA 2XZAL 1KJ2H 4PJ9D 1PCSA 2QQNL 2XZCH 3PWJB 4PJCA 2WLIB 3KXFD 5IMLA 3CFCL 1T20B 3E1ZA 2VQ1A 5E4IA 4EVNA 4JNXA 1YUHB 4I7ZC 4IDLA 2WY3B 2WINA 4XP9L 1XSOA 3RNKA 2RBLA 1OGAA 4M5SA 1J1PL 4NBZB 5DURD 1DQIA 2BSDA 5LBSH 3AG3B 5KSVB 1XR9B 2RAMA 1H15B 5FO7A 4LOUC 1I8KB 5EU6B 1D5MA 4N2GA 5C2BH 2X2HA 4DQAA 3MCLH 2PPCA 3L1FA 3GMPA 5C6TH 3SE9L 3CLFL 2ZYIA 5DS1A 3T71A 5DZPA 2BFGA 5JW4R 1DLHA 1BM7A 4GQ9H 4W9FC 5A2JH 5IHUH 4DGVL 2X10A 1L0PA 3P30L 4H44C 2CZNA 3MLVH 4OIIL 1T89C 2R0LH 3HRZA 1NFDA 5CINL 4AH2B 4TLSA 2FD6H 5E23A 2E9IA 1Z9NA 4GUPA 3FH7A 3U30B 1ONQA 1XCQB 2VLRE 3IDYB 5DVPA 2CCVA 5SV4A 2VAAB 1OP9A 3GMLB 5KVGL 2VN5A 2DDQL 3HI5L 2FEEL 4N2HA 4L4JA 3JV6A 3N40P 4NHUA 5D7EA 1E8XA 3FT4B 3WE1A 4OQTA 1RU9H 3VDAA 1MVYA 5AOZA 3QQDA 4PJEF 4KITB 4QNPF 2PWDA 5T1MB 4N2CA 3LKSA 3QNYA 4JS7A 3ML8A 4XX1E 2JIXB 4ZAKD 1L7TL 2C4FT 2BZDA 1RJLB 5DQJB 4BK5C 1ND0A 5JW5A 3G6JB 2OLDA 3CZFA 4JLRA 4LB8A 3RPKA 2ENYA 2B39A 4QRFA 4X6FB 5ITFA 1IRAY 4YEFA 5D2NC 1CICA 2A83A 1BX2B 4L3AA 2XXMB 5G5DB 3MODH 2Z31A 2LFGA 5E94A 2RGSA 4WHTB 1HOEA 5JR1L 4KNSA 4BFRA 1D9KA 3GMOA 2E7HA 4P04A 4AEHL 2O5XL 3H9SE 5D2NE 2EE3A 1T1YB 4XCNB 3MLTA 1NGQL 3JV4B 3HLAA 2E76C 1OZTG 3PHSA 2ZXCA 4MYWB 3ZKMC 4XH2B 5KJ7E 2XWCA 3IDJB 5I6NA 2O5ZL 1U33A 3SPVB 3SY0A 3DIVA 3DSNA 4YBLC 4LU5H 1NEZG 4HWBH 1BXAA 5C0DB 4PBDA 1KGJA 3U4BH 2J88L 1TJGL 5E9DA 5F9DC 1H3PH 3KLDA 2DBJA 3QJUB 3QVAA 4FYTA 1LO0H 4XVSL 3V7MA 4HKZA 1UWEH 1GGTA 3V9FA 4JM2C 3FTXA 3RE0A 4L48A 3C5XA 3J2PA 3VFUB 1WS8A 1RL1A 4G7RB 2O6CA 3BUYB 4ODWA 5TDPA 2BJML 4YXHH 4JFHD 1JGUL 4WTXA 3RVXC 4A38A 1E3XA 6TAAA 4ISVA 2VMCA 2TAAA 4FG6C 3PWLB 1PKQB 2XXCB 3QXDA 4X80H 3TCTA 2G2NA 1ID5I 2CO2A 4M48L 4KNTA 3RA7H 5J5EA 2G3XA 2H26A 1F1GA 5DVKA 1A4JB 1DEEA 1S9YB 2I69A 4HPOL 1MJJB 2BIQA 2YS4A 4RMBA 3WIIH 2X0VA 3C8KB 4KZDH 3MRHA 1SOXA 3I2CH 4Z8FL 1K4CA 5AAPA 2CLZB 1DSYA 2VDNB 2XFXA 2XKUA 2Z3FA 4J27A 4MQXD 5EORL 1KACB 2FB4L 4LKXB 5GRZA 3ZW3A 3RX5A 4XBPB 4BSWB 4IKIA 3IVKA 1RLBA 3QI9C 1INEH 1IGIH 5C0CB 5IFJB 1OAJA 1IEHA 5D72L 3TBCA 3REVA 4ELDA 1ZS8A 2G75B 3NRFA 4U6HB 1OTTC 4M6AA 4BFEA 2NY6D 2WTRA 3TPKA 2ZNWA 5EZIH 3HI1A 4XNYL 5C0AE 4BQCA 3ZBMA 2IFFH 4N0RA 2BSBA 4H8WL 2FGWL 2YKLH 2WXFA 3HMWH 1K3IA 4B7IA 2QJDA 1U95A 3HMXH 8PAZA 2NZ9D 5E8DL 3MJ9H 4C56E 1C8PA 1X5FA 3VI4A 4DF9A 5HD8D 1RZQA 5AW2B 2VDKB 2BIOA 3TEXA 3ORJA 1DLFL 2PNDA 4ELMF 4RWYL 1S7TA 2WOYA 4CC4A 1CDCA 1TG8A 1G7LA 1A14H 3MTRA 3GKWH 1FO0L 4OCMC 2R1YB 4Y2OA 2I85A 2WXJA 4X6DA 2CRZA 2NY7L 3WYRA 4G9FD 3NBNA 1TLMA 3D8MA 5CILL 2D3JA 4WK0B 5J3HC 3WEBA 4FNLL 4U1HB 1BW8A 2CLRB 5DUMH 2EUVA 2VLJB 2UWEB 2UY6A 5HY9B 3UAAA 4F7MB 5E6IC 4F92B 1HT6A 1DJIA 3OMIB 2ETWA 5DEGA 2N01B 4QD2E 4QHLB 1IC5L 3RVTD 5FKPB 3DWTA 4TPRH 3U4AA 4OM1H 1HXYB 5KYUB 4JFOB 3L9RA 3CQFA 2ZAGA 3BHBA 5ITBH 1UT2A 3TN0B 2B2XL 4HJJL 1QR1B 3B2UD 2CHWA 3CH1A 5DQDL 4IKNA 1MFBH 1D5ZA 4FFWC 4RIRA 3GBNL 1OWWA 1A6VL 4OBRA 1KJ2B 3ARDA 3S3DB 4R4BB 4D94A 1B90A 4JDEA 3NIGE 4G6AC 3O6FB 4Y2DA 1TIUA 5FYJL 3NZHL 1BM3L 5TPWH 1A1MB 4UTAH 1KTDB 1NLBL 1Z0MA 5H8DA 3IDGA 1RXLA 1HZHL 3HB3D 3HZMB 3K8LA 4MD5A 4Z9KB 4ZTPH 5C8JA 3SDDC 5E9AA 1E5BA 2CD0A 2QZQA 3FT9A 5JPMB 2I9TA 5F21B 3SBWC 4FNPA 2XKNA 2K4AA 3HZYA 4POZC 1ZGLP 3N0AA 3NPZB 3ZJAA 1L9MA 4NPYB 1QEWB 1RZGB 1MWAH 2YUXA 1YEDA 3FQWA 5GIRB 1YPZB 4N1CA 4JO4H 1CG9B 4DQOH 3VA2C 1AZVA 4AYGA 5EZJA 3ZKNC 2WB7A 1QRND 4D8PA 5F3FA 5IBUG 3MAWA 2NMSA 2YKKA 4K2UL 1FV1B 1GZHC 2FYYB 2XSKA 4L29A 5KSBA 1D7DA 3DVNA 3EUUA 1BXVA 5DTFA 5MERA 1A9VA 1S7RB 3WKML 3TJPA 1MCIA 5L8JB 3SCMD 2F2HA 1LGVA 5EU5B 4I1PA 3ULUH 1MCPH 3DJSA 3CDZB 3VRLE 5LGKA 3HFMH 3FRUA 4PJBF 4LOVA 1DQMH 3NFSH 3DECA 5I18H 1FL5B 3UO1L 1ADQA 1AO7A 2AGJH 3KPSB 4F93B 4XGZA 1HJCA 4OZHE 4QWWD 1AKJA 3NIFB 2AABL 1IC0A 3HS9A 3LZNA 4G80A 4KU1A 3L6FA 1HHGA 3FOMB 2J1WA 4J3XA 5E2WL 3WV0A 1NDMB 1NM9A 2UZIL 3QS2A 2HKFH 5IW1B 1EHNA 3VFOA 2QGDA 4QOKA 4J3UA 4R5TA 2ZP8A 5GGQH 1A9BA 5LAXB 4HWZB 3F2LA 4UANA 3ROOA 1B4JH 2R59A 2R2HB 2VNCA 2L7JA 1EO5A 2ICCA 5DXWA 4CADA 4KO6A 2HFGL 3QFJD 2QHLA 2X4PB 4A2EA 1FVCA 1OANA 3IWVA 5DWPA 3JWDH 2XVBA 1INDL 1IGML 2ZUVA 3CSYB 4LBAA 3MUZ1 4XO3A 3RIKA 3VH8G 1IVTA 5AW3B 1IEBA 2XPGA 4ODHH 1IBGH 3QDGB 2VLKA 2ZSVA 2BIIA 1KCSH 1QI4A 2ZCZA 4B0MB 1AHMA 4XRCA 1TQBB 5IJVA 5K9JH 1R0AH 3QDJD 3EJYD 3HC3H 3KJ4C 2VLLA 4DZ8A 3UBHA 4P9HC 3HC0A 3UTPD 4UV7H 5CFAA 4TTDD 2JCCF 1DUZA 1Q38A 1I9EA 4Y5XA 5HJ3B 3FN0L 3KPMB 5BVJB 4W9CC 4LSUL 1I7UA 3TNNB 4BH7B 3BQUB 1X5AA 3O45A 4KOCA 2DB8A 4JFFB 4NQVA 1U8QA 3ABMB 4PJAF 4UQ2A 1MJUH 1IGFH 3ABKB 1R5WB 3UABA 4F7CA 2GTZA 4DO6A 3M45A 3LS4L 1GHFH 4HAGA 4OLWH 1DBAH 3QORD 3OKMB 5BQDA 5LVEA 1DDHA 3C5SA 1OV8A 3F7VB 4WWKA 2XRAH 3MRGA 4EZKA 3GUTA 3H8NA 3HI6H 3O6KH 4U3SA 3X3GL 3QUXD 5J12B 4YLBA 1S7WA 4TM9A 4R2GB 3HBZA 2F9BT 2E7LA 3EDJA 4AC2A 5A6IA 5EU6E 2NNXA 3TH2T 4JREB 2WVSA 4Z95H 1IX2A 4ZX4A 4DN3L 4YHZL 1UFUA 3ES6A 4MCYA 3CDFA 1CD1A 5D1ZI 3DARA 1QNZH 5EF1A 2DWSA 2PTVA 4QYAA 5HDOA 1NUDA 1ET7A 3S36H 2YPVA 3P54A 5K9OB 1C7TA 3ZGHA 4JPIA 1OTUC 5MEQA 4JO1H 3I6GB 3NEXA 1FNGB 2IV8A 2O5YH 3D0VB 5DZ9A 5J8OA 4NI3A 3WKYA 5JOPE 1KYDA 1MCKA 1WG3A 2HRPH 3FSZA 1G4RA 3H1ZA 4K5PA 3H54A 1QO3B 2SEBA 2ZOOA 3ULVE 2F61A 3ZR6A 4XVTL 1N0LA 2X4QB 1WAPA 4GNKB 4OV6F 4NUJB 4QKTA 1UA7A 2ZWLT 4XOAA 1BFOB 1T66D 2IBGA 4JO3H 4KUZH 4B3EA 3PL6B 2O6PA 2ADFL 2DQJL 4MXWH 5LCVA 2P8PA 3P11L 4A7UA 4JZOB 5ACLA 2NYKA 2LU4A 1AH1A 3WTWA 2XQYK 4L8SB 2NW2B 4D7PA 3T6QC 3F7LA 3G6JE 4PRHA 4KY1L 2EECA 5EB9A 2Q1EA 1E28A 1CFTA 2FK9A 1AQHA 5BO1H 5JNYA 4Z7IA 2H9GA 1CXHA 2QVFB 4GAGH 3D33A 4MDJB 5AB2A 2NXYD 4KK9D 4ALAL 4DKTA 1J11A 1TKWA 3LKNB 1KWGA 1KUMA 3UPRB 4YDIL 3JBG7 5B1AB 1JZJA 4PD4J 1OB1B 3D4CA 1A02N 2HT4D 2IQ9H 4K3EL 4G5ZL 5HI4D 1IAOA 2ADJB 2DQDH 3O41B 3S34L 1T04A 4WCYL 3BKCL 5C07D 1Z3GL 4GKSB 2WZAA 1GKOA 2PETA 2H8PA 2YXWA 3KLLA 2BVQB 5CN1A 3BYTA 3F65A 1GYUA 1EFXA 1KBWA 3HS0B 4UDTB 5I82A 1A7NH 4PJ7F 4X6CB 3I50L 2VQ4A 4TUUA 1U4FA 3F58L 4JG0L 1WBYB 2BMKA 4B50A 2FWOB 1KLFB 3OXRA 4P5MA 2IAMD 2Y6SC 1FH5L 5ECJE 4YNYB 1LK3L 4LRNL 3QJQB 1YO4A 3QHTC 3B6SB 3CZNA 3V52L 4XNXH 1X7QB 2XT1B 4B9YA 3C87A 5T3ZE 1PW3A 4ZO6A 5C3TA 3BD4A 1NCDL 2UY7B 4LLDB 2JJUA 2YK1L 4PJFB 3IDIA 2H0JA 3H9YA 2A38A 1IIIA 4NZDA 1SQMA 4O02A 3VWJB 1CU4L 3RIFF 1OD7A 1V3JA 1OB0A 1PKQE 5B38A 5CD3A 4NM4H 3F6JA 2Z1PA 4WVRA 3IU3B 5EUOA 1NPNA 5CWSA 1MWAB 1U8CA 5F7AA 3PDDA 1IC1A 5KZCB 2X4RA 2LAAA 3HLKA 4W9EC 1EHXA 4LLWA 4A2LA 3LEXA 4AK2A 3DX8A 3BPCB 4J1UA 5AKVA 2FL5B 3CQPA 3P2DA 2OTUA 4PWGA 4B9ZA 5IVZB 1YNLH 1SHXA 4KTEL 3NAAH 3BKYL 4HG4J 4J4PC 5KVFL 3GHBH 1YEFL 3IJHB 3IJEB 3SDXA 1MF2L 4APQA 4AIOA 1M71B 3AXHA 3FB6A 4DW2H 1B0WA 1QFWH 4IU2B 1V3LA 2GW5A 3JT2A 4ZS7L 1E27B 5BO0D 3C5ZB 1CC3A 5C0CE 1EVUA 5TDOB 3WHXA 2R0ZL 1HHHB 2VMDA 1QHPA 2GABA 3NSDA 3UYPA 2DQGH 5KSBF 3W37A 4M6MH 3PU7A 4UIMA 4YL4A 4I77L 1CFVH 2EYSB 3POCA 3WJJC 3CFTA 4IHOB 4QXVA 4WI4A 4IJ3B 3EGDB 1YEJL 5CEZH 2FATH 4C47A 4ODUB 1NJ9A 3WJMB 4HIIB 2KS0A 1QBAA 5F1IB 1CGWA 3MYZA 2F7OA 1P4IH 2W0FA 4L05A 2C8NA 2PO6D 4J2XA 4PRDB 5K9QI 1M7DA 1ZK5A 4G42B 4UB0H 4X4YB 1LO5A 4OFDA 4L0PB 4B27A 1MCOH 2QZ5A 4BRVA 1AR2A 2A73A 3MRFB 4HLZG 3S2AA 4FQLL 1BMZA 4GQPH 3GB7B 1DBJH 4KUCF 3W5NA 3TFKD 1EJFA 4PVNA 4ZPTA 2AQPA 4JFZH 5CZXD 2QVIA 4ZFGH 1BJ8A 3DMMD 1F00I 3MZGB