4B9CA

Biomass sensoring modules from putative rsgi-like proteins of clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GSHMGLKIQYYSRKPHDSAGIDFSFRMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANKYLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLVWGIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fine-Structural Variance of Family 3 Carbohydrate-Binding Modules as Extracellular Biomass-Sensing Components of Clostridium Thermocellum Anti-Sigma(I) Factors.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Carbohydrate-binding protein
molecule keywords TYPE 3A CELLULOSE-BINDING DOMAIN PROTEIN
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9cA00
4TF4A 1G43A 2XBTA 2WOBA 1NBCA 4JO5A 2YLKA 1KFGA 1GA2A 3TF4A 2WNXA 4B96A 1G87A 2WO4A 3ZU8A 1TF4A 3ZQXA 4B97A 3ZQWA 4B9PA 2L8AA 2XFGB 3ZUCA 1K72A 4C8XA 1JS4A 4B9FA 4B9CA
chains in the Genus database with same CATH superfamily
4BEIA 1NC4D 4KQ4L 2VQ4A 3IPEA 5FDWB 3TBTB 2A4CA 3SDXF 1UZ8B 5A1AA 7FABH 2H32A 5HP5A 2IQAB 4GSXA 5ERWA 5B8CA 1NCDH 4HWZA 3H8NA 5IG7B 1H6FA 2NY5H 5IHLB 3GSVB 3RI5K 3ARGD 3IJEA 4FFTA 4PRBA 1EBAA 1CTMA 1FG2A 4NQEA 3U30C 3MV01 4WNQA 3T77B 4W9LC 2E4FA 3QIWB 5EC2A 1NJ9A 4WAFA 2BSCA 3JT0A 3MLRH 4PJ5A 3EYFB 1OSEA 5JPMB 4UIMB 2VDNB 4P5RA 1N0LB 4J8QA 4KVNL 4M5ZL 1ETZB 1NBYB 3F7VB 4YDLC 4A6YL 1FC1A 4U6XB 4PJ7A 3UFIA 3BKCL 5EUOF 1ADQL 1BBDH 1EK3A 1SGKA 3C09C 3VXSA 5E5MB 4Q9QL 2ARJQ 5JHMA 5MEND 2V3FA 4O51B 3CFDA 1BIIA 1PX8A 4F33A 3QJFA 4ANUA 5GS0L 3REVA 5EO1B 2GHZA 4A2FA 4ZFFB 5E24E 2F8XC 4LAQL 1E9OB 5T3XL 1ODUA 1QW8A 2IH3A 3BPNB 3O41A 4LCYB 2FO8A 3B2MA 4OKVA 4P3CL 4GQPH 4PJ5E 5DJ2B 2WAHA 3MFFA 1XGPA 4LAJH 4F57H 4TN9A 3EOTH 3NESA 3OMZA 2EE6A 1NCCH 4PJ6A 1NFKA 4KKLC 1IV8A 5AVWB 5I8OL 5ETUB 4XP9H 3B2VH 5CWSA 1MHCA 2YQGA 2D7MA 1RXLA 4B9KC 2IFFH 1YNTF 4H25A 4WO0A 1K3ZA 1TYEB 2APFA 5I6XC 3II1A 5I1CH 1UH4A 1NMBL 3S3BB 1FJ1B 1I7RA 2AGJH 3ZKQD 4ODUA 1O7SA 1IC7H 1S78C 5ESQA 1T5XB 2BXZA 4X6BA 3QAZC 4J7RA 4TQHA 1SM3H 4BHUA 5IHHA 2EO7A 2J6EL 4WO4A 3BLKA 2A77H 4P3WA 2YOAA 3RWFB 5BUPA 4PLJC 1WFTA 3AXIA 4PJXB 2F54D 2P52A 4KUZH 1SYSA 2EVJA 3CZKA 4UUJA 3QQ9C 3T0BA 4R4BA 4WFED 2EH8L 5E4IA 1FVCA 1QRNE 2CLZB 2GTWB 5DZVA 4A2LA 2AXFB 1ORSA 4UAOB 3FT3A 2ARJA 2IWFA 3AVEA 4MJ2A 1HH9B 1SY6A 3OSKA 3NJNA 4IU3A 5I1HH 2R0WH 1E7UA 3IJYA 3TIEA 4P04A 3N85L 1FFPA 1HXMB 4IJ3C 4ZYKB 3RP1A 4DP6X 4DKTA 2X87A 5E2JA 1MW3A 5D6CB 4X8XA 4HETA 1YYML 3VI3B 9PCYA 4HLJA 1A6ZB 4U31A 1QPKA 2OP4L 1ODAA 3EGXB 1MRDH 3VXRD 4YUEL 5DWUL 2MHAB 4CN6A 3FO0L 2IDCA 1XTLA 3FTXA 1S7WB 1JGEB 3NABL 2YRPA 4EF3A 4QNPE 1N6QL 3NJHA 1M7DA 3MRCB 3MRKB 3VXNB 4QY8B 3GSWA 2GHWB 2IPTL 3CH1A 2KLRA 2CKNA 4X5RA 5EWIH 2VXVH 2R59A 3LKRA 2F53D 3CBKB 4FG4A 3ZGHA 2PPAA 1SXAA 3WIFA 1RZFH 5CZKA 4JQIH 2P8LA 4XNDA 2GITB 3PWVA 3KBPA 3U36B 4F8QA 1N2RB 3OHMB 3QQ4A 3RNQB 2GJRA 1NC2A 2E7LA 1SLUA 4G80B 4R2GC 2FJHA 3NCCB 1L9PA 3GEWB 1A6AA 3R1GL 4MNHB 3V52H 2WVVB 1MRCL 3APNA 4R5XA 1Q94A 4MNGB 4GT7A 1DUZA 3HC0A 2CIKA 4KHTH 1DZ0A 4DVRH 4IOFC 2WCPA 1RK0A 1F4YH 2C9PA 3BC9A 3D87B 1A21A 2HJFA 2IXQB 4JEGB 3WIIH 2O5ZH 1EZVX 1FO0A 2ZUVA 3CFNA 3C6SB 1A02N 3TPKA 1IARB 3C5XA 2A3TA 4NRXB 2KMWA 5F93C 3LVTA 3VFRB 2CSPA 5B8CC 4QRSA 3VD4A 4O02A 3T09A 2WQ8A 1E8ZA 3RGVD 4Y7MA 5KSAC 1RJLB 1VACA 4XMUA 5E1GA 3KGRA 3WTUA 4UDTB 3FZUD 1G7IA 3HI1B 2WXLA 1N67A 3P9MB 5E6ZA 3E6FB 1DQTA 3TO4B 3A67H 1RIUH 3WTYA 2Y2YA 5MHSE 2UZXB 4HXBH 2PN5A 3Q5YA 4HCGA 3U48A 1CFQB 1U92B 5G55A 4YAQA 1BG1A 5F70A 2EDNA 4DZ8A 4OCRH 3EYQC 1U3HA 4JREB 4NZTL 1BZ7A 3G5VB 1HKLL 2VLRE 3K74B 5E6IB 4W9CC 1KCLA 5BQ7A 5HGAB 2R1YB 1OAKH 1E90A 4JO4H 4XP1L 5IKCB 1T89A 7PAZA 4PRHA 2GUOA 1CICD 3O2DL 4I0PB 5HHXL 5D5ME 2XTSA 4FXGB 4JBSA 1I7ZB 1CFBA 3B3IB 1CLOH 1KTCA 5E1QA 1MJJA 5DFAA 3NIDE 1BMGA 1S7TB 4NNXB 2X3AA 3CVHH 2ZCHH 3BIKA 1LHZA 1ACYL 3K4DA 3WENA 4B9CA 4QOKE 4ZX4A 1CT8B 1N12A 1RI8A 1ZT1A 2H6UA 3GSQB 4M7KH 4ODHH 2GYSA 4XVTL 4CAGA 1JNHA 2F53B 2VISA 5BCAA 2GPZA 3QFJD 3O4LA 1KJVB 4AG4L 3GT6A 4P5TA 4I48A 1RHHB 3S96A 1SZNA 2GG1A 3GK8L 4PCYA 1K8DA 2PNDA 4K9EL 3GO1L 4N25A 1IJNA 4F9PA 4H25B 4U7SA 4G9DB 2AEIT 5F9JA 2DDQL 3DO3A 1I9JL 1MCRA 4I89A 3W0WE 2A6KB 5JHAA 4EVNB 4XOAA 3GPSA 2ADGB 3MJ6A 3BZ5A 3BVDB 3LSOA 3LRLA 2WLJA 4PJAB 3ZK0A 5BV7B 4R8WL 5A7BA 4KK6D 4QKXB 4X4ZA 4YDKL 2ADJA 5K1JA 3WUZA 4F8LA 5GJSH 1GYUA 1KLGB 2QLVB 3DO7B 1JI2A 1PCSA 4Z7IA 2XG5B 3FCGA 4U4BA 3IFPA 3N3EA 2CCLA 3BVXA 1NCUA 4S1SL 4U1HA 3H2QA 1KTDB 1G0XA 3O9WC 4D9LL 1VPOH 3DX7A 1BG9A 1MHPL 1MCIA 3OC8A 3KMDA 4ZAKA 5JHLH 4G2AA 3VXRB 3T3MB 1PSKH 4FTDA 4AMKL 3QQ9D 4F2MA 4OZFH 4X4XA 1NC2B 5DK0A 1R0AL 1HZHL 3OZKA 1UA3A 4EI5C 1OAXL 4Y2OB 2W9EH 4TSAH 3TJHC 1Z9SA 3BT2L 2Y3AA 3K7UA 4KK5D 3TA3A 1XSIA 3ESPA 2NYZA 1U3JA 2XN9B 4JFDB 2CO4A 5DC4B 5JIHA 5EZPA 4HIHB 5CZRA 4OCSH 3UPCA 2UXGA 5LCVL 3QWOB 4N0RA 4ODBD 2A38A 1IM3B 3UC2A 3U25A 3BFWA 5DURD 1T6BX 2DQUL 3TIDB 4TS6A 3C09B 2WUBH 3DI2B 4OF3A 4HCRA 3LKOA 4OLZH 4ZUVB 3B9KC 1G1OA 1RUKL 1S7WA 3V79C 2J4WH 3KPSE 2OW7A 4DGUA 1PJ9A 4TTGA 3BMVA 5E5RB 2EYRB 3UCQA 5T1KA 1XIWA 4JFOA 5DLMH 3CV5A 5JHDD 4QRPA 1VEPA 5FCUL 2WLLA 4MCYB 3UTPD 3QZBA 4H13C 4JKLA 2IFGA 3E6FA 1PZDA 1CDGA 2BSTA 3FKUS 1OT4A 4JE4B 1P7BA 5J6SA 2HFTA 3L1OL 3NQKA 4YXHL 5ABDE 1ZGLA 4AQ1B 1OD7A 1FFOA 2VMJA 1JYWA 1KBVA 3AG1B 3U9UA 2I32A 1N8OE 3CFCH 2PWFA 3HVDA 4K7FA 3TJEH 4X6CA 2Y36L 1MI5B 2CM5A 4QXTB 1LLAA 3GINA 1G7QA 4XNAA 3PGDA 4JG9A 1I9IL 4IOSD 1XR9A 3FQNA 1Q9WB 2B1AL 5BOJA 4NC1E 3SGKA 4IYKA 4MA1B 4A7SA 3D3VB 2Q6WA 3GIVA 3CH8A 4PG2C 4OLWL 4JVUA 2GTQA 2AJSH 1WWCA 3LPGA 4AGNA 1IC1A 1HT6A 2Q3ZA 3SYCA 2V17H 4HUKB 2NSXA 2R8SH 3IN2A 3HS8A 1CLZH 2C9QA 5AW6B 3EBGA 1M71A 4Z7QB 1U8KA 4B9FA 4FFYL 2APXA 4HMEA 5EZJB 2YAFA 3PWLA 3V6OC 2NR6A 3WI9A 3VAEA 4HYTB 1QD0A 2DIEA 1F8TL 4LARH 3QNYA 2CO7B 3UPRB 3MJ9L 2ZXDA 4HH8A 3IF1A 4AQEB 1F0LA 1SN2A 2NY7H 4LZKA 5DJXB 3CVCA 3TBVA 1ECYA 2MCAA 3CMOH 3MU3A 4P59L 4NQED 4AZUA 3RVWD 5F1SA 3TC9A 3UABA 4L0YA 4YDVB 2JKIS 4YHML 1MN4A 3MCG1 2OMUB 4LGSB 4DVRL 4JCMA 3WL9B 4PI0A 2OK0L 3WDJA 2WZAA 3TONA 1NCTA 4FMVA 5E2WH 2X1QA 3QNXA 1D5ZB 4ZD3H 3HNVH 5A16A 4H0HB 3VM7A 4Z7OF 1U3YA 2W80C 1E43A 5D7IB 2YHGA 3BO8B 3MACH 2D9QB 4QXUL 5EEWA 4FQCH 3WFEH 1F58H 4WI0B 4MJ6B 3UTSA 4ZDHB 1CL7H 3FAWA 1B4RA 3HPLB 5TF1H 4BELD 3N44B 3P2DA 2PMZA 4MYPA 4Q6KA 2PPDA 4WWPA 4OJDH 5ACMA 3GIZL 2ESVA 3LIZA 1W6LA 1IAMA 5IEKB 3ETTA 3HC3H 4F8TA 4R7XA 2VIRB 1A1OA 4M8QA 4WFHE 4GUCA 4WV1B 2D3LA 4J1UB 1BD2D 4MLSA 3IGKA 3IBEA 3H2PA 3HE6C 4B9IA 4Q8BA 2GFBB 3GSRA 3KJ6L 4JZOB 1PY4A 5DJ8B 1Z0MA 2O5XL 4PQXA 4G1MA 5SX4I 3UBXA 2J21A 4P5KB 3VWJB 4LBEA 5TF1L 4F37F 5DCCA 3U1SH 3GRGA 1ML0A 4MB5A 3NACL 43CAA 4HKJA 4OF7A 1UXMA 3CHPA 1XV8A 5ACZB 3ULUH 2ITDA 4NBXB 2BP8B 1OGAB 1AZUA 5JLZB 2ZWNA 4D9QE 1JGEA 4XCEB 2IAMA 3ALPA 3IXAA 4X7FC 3PHQA 5KZCD 3EBAA 1WAPA 2JCCB 5IB4A 3LSOB 5BO1H 2HFEB 1QWUA 2EDFA 3CLEH 1IGJA 4K9JA 4CMHB 4GP8B 1U95A 4MDRA 5SWSE 3U1QA 4I77L 2R2EA 1DYZA 3EFOB 4UILL 3NFSL 5J3HC 4JM4H 2DV6A 3L6FA 4CADA 2EDJA 4DGYL 3NDZE 5DZ9A 1MFUA 4C58B 2JTYA 3G3LA 5DGRA 3T2LA 2A9DA 1BXUA 1WA0X 3B34A 4K2UH 4KWUA 4M93C 3QXWA 4MQXD 4V1DA 5E8OB 5IREA 1R3KB 1E9QB 4L9LC 3L16A 4ZUSB 3UADA 5BZWA 3VI4A 3W57A 2XTJE 1ZHLB 4X9YA 5F1OB 2IADB 3MBEA 2EQDA 2WJ5A 4OZIE 1NGZB 1H15A 2V7NB 4NGHL 4YSSA 1J5OH 1HSBA 1CJYA 4JG0L 4NKDA 1DUYA 2VJ0A 2P28B 5EOTA 1WC7B 3O0RH 1GPOH 1Q9KB 1F97A 1HKLH 4F2EA 1CBVL 4PGJA 3AG4B 3K72A 3MV8B 4YH6A 2CHDA 3BX7C 3MV11 1T21B 2W0PA 4Y9FA 1M9SA 4AUJA 4S10A 4CA4A 6CGTA 1BLNB 1IKOP 1FV1A 2H9GA 4AM0A 1YRKA 3UTOA 3NRFA 3NOIA 1U8IB 2JLLA 3C6LA 3BW9B 3TYGL 4BH7A 1P7QD 5GRWA 4KV5F 3ZTEA 4QT5B 3OAWA 3BWUF 3DJZA 5DHVA 3FHQA 4OJAA 2OMXA 3BKYL 4DO5A 4BA8A 2HUEA 4CSPA 2H3NA 4PV9A 5KW9L 2C34A 1XVSA 3ZIMA 1SYVA 3SDXB 2XCMC 4QNPF 1E4WL 3QT2A 1AQDA 1CGSH 1ZANL 2F54A 2X41A 4X8GA 2ATPB 1MCKA 2XWEA 4U1HB 5DQDH 2AVGA 1J10A 5DMKA 4BDVA 1XR8A 4FFYA 5DZPA 4MZRA 2CKBL 3BPOC 3L2MA 2OSXA 3KGSA 4JM0A 4W4OC 4CU6A 3CU7A 5KS9A 1PQZB 1BJ8A 5LDUA 4JFVA 4ZMVA 3F62A 5IVZB 1M9WA 3IKCB 3CN2A 1BOGB 2HVJB 3RFZA 4RGMC 3QPQD 1SJVA 4A2DA 4CU8A 4N6QA 4U1KA 5DUPH 2KH2B 3TNNB 1IKFL 5EU5B 3A4DA 3B7SA 1R24A 3ZN6A 4Y4HB 5CHNA 2E7LC 1MCNA 3TBSB 1IAIM 5CGTA 3OB0H 5J11C 1O7VA 4AGMA 1ET7A 2NDFA 4TM9A 4E0RA 3LS4L 3GI8H 2YZ1A 3TO4C 3X1FA 2XIBA 3CK0H 5ES4B 4NJ9H 4TNFA 1LE5A 1CFSB 2OS7A 1EJFA 2WNXA 3EOAB 5C0EB 1VADA 1Z6JT 1U8LA 1YEKH 4DCQB 3QYCA 1Q94B 1WFMA 1DVYA 2IG2H 1P5VA 3CQQA 3G6JE 3VXRE 5IFHL 4U0RC 3U4KA 3SDDC 5CEZE 1D6VL 2H0FA 4Z5RB 4GKOA 4LCUA 1YECH 3SQOH 3QEGH 3H9HA 2G2RB 4XP9L 3ABGA 3B9KB 3WS3A 3A0OA 2I69A 2E7BA 1PD1A 4FL4B 3MYJB 5B39G 5JXED 4NKQB 2N7AA 4PWIA 1J1XL 4JJOA 3SPCA 1UWFA 1P53A 2OK0H 1X5ZA 4ZQTA 4UQDA 4N68A 3D0LB 4CDGC 2C5DC 4ALAH 1L0YA 5B39A 4P2QE 4HLEA 2FEDC 2AKRA 5C0CD 3OAYK 3EGSB 8PAZA 4OM0H 4WWNA 3OKDB 4F7PB 2EVHA 1F41A 1MY7A 4CVZB 3GFUA 3KH3A 4Y5XA 4CKVX 3MBXH 5E5LA 2NTSP 3VFTB 2LAGB 4GW1B 4PW9A 1YHPA 1H6EA 3IMVA 3AAZB 4P5TD 4MDIA 3M8OL 3C60D 3E2HB 3GMRA 3TO4D 3CUPA 1PD6A 5KJ4A 3I6LD 4ODWA 5I75C 3GNML 3POHA 3UAEA 3IDIA 2FX8L 4LHUA 3MUGB 4TPRH 5AOLA 3ZLQC 3LH8A 4MNQA 4A7UA 3PWPA 3FT3B 2G60H 5D5MF 3RZCC 2R1WA 4I13B 2X2JA 4IIQC 3LNGA 3MA9H 4N2BA 2LLLA 1B0RB 4J3WA 4MA7L 4BHUI 4PEEA 2WXFA 5FO7B 1QI3A 2BP3A 3ETBJ 2J88H 3DSNA 3EADA 3ARVA 2O61A 3I6LE 1YPZF 3ATEA 3T2NH 4XBPB 4URTB 4KI1A 2QDVA 4JO2L 5D4HA 3DTUB 1IQDB 1B9KA 3RVTD 2CUAA 1DFBL 2G3ZA 3QI9B 4M6NH 3UBGA 4DQOL 3L9YA 5BS0B 4FLRA 3OGCA 5JMRA 3LPWA 4NWTH 4G7VH 3TN0D 4GG8B 3Q6FB 4YK4B 2Z35A 4GI9A 1X5GA 5F96L 2XIDA 4ACPA 4UQCA 3O6MH 5C3LD 3HOGA 4XN8A 3MRQB 1ZT7A 3IAQA 2DQJH 4LNVA 2Y6SD 1URLA 5DMYA 3I3BA 1KFGA 1XGUA 4WTQA 2VR9A 3S9DB 3IKCA 3V10A 5EF1A 4HCRH 1DANT 1Q0XH 3RWDB 3SDCB 2QR0B 4PJ8A 2FGZA 2XBZA 4OFKA 2LT9A 4Z0XA 4HWEH 4LSSH 2R15A 5F0MB 1JZIA 2R9HC 5E56A 1YN6A 1AY1H 5AAMA 3NT0A 4XPGL 2BOCA 3VX1A 4FQXD 4LSUL 2EDTA 4NEHB 1UB5A 1AQKH 1EAJA 4ORGA 3PJLA 5CD5C 2DMKA 3NIGF 1C5BH 2VOTA 2VMCA 2AEQH 1I8KA 3H7BA 4N26A 4PJEE 3TEXA 2FL5B 3ULUD 4ONHB 3O11A 3TFKD 2YAEA 5SWZD 1HESA 4L1TA 2J8UB 4X6EA 3V0VA 3AQDA 4YJZL 3MLYL 1F58L 1CFVL 1N8ZA 1JZDC 5E4AA 4XWOC 2QFRA 3Q6FA 5E9AA 1Q9LB 2X2YA 4NQQA 3WFHB 2G2NA 3NIFB 4XE0A 2UY6B 1T21A 3VD5A 4PJIA 4OD2A 3MMEA 3MLXH 3BQVA 2I7OA 1QASA 2IQAA 4RRPA 5ERWB 3F12B 4QXWA 5IB5A 3VXOA 3UZQA 4A68A 2WTRA 4ZOCA 4XNZC 2F74A 1T1WA 2BFVH 3NCFB 4LCWA 2WC7A 1L9TA 3BVWA 4NO2B 3ME0B 4YHYB 3N43F 25C8L 3EUUA 4PJCF 4AMXA 1A9VA 1KIPA 5KVFH 1XD1A 2WW8A 5JPMC 4LKCA 4Q0XH 1EDYA 2YQ3A 4XPTL 1R3IL 1II4E 3FQXB 3ZRFC 1Z9PA 4K7PX 2WMPB 4G7YH 3N9GH 4U3CA 3SCMD 3B9VA 1WF5A 4HIIA 4GBXC 2CBQA 3KPNA 1MCQA 1ZDQA 5F7UA 4ORZC 2OA9A 3UTSE 2IDSA 1TZGH 1K5WA 1FH5L 1ZEAL 1FCCA 3LN5B 3HNSL 1OANA 1Z3RA 2IANB 5C0RL 1U58A 2N0KA 1DVSA 5GRUH 4K3JL 1E9OA 4Z8FL 1CUOA 4PY7B 3TS8A 1OB1B 2B3IA 3HKZA 4QRPD 4R7LA 1NCWH 5TF0A 3HAEB 5E2VL 3T2OA 1BIIB 2G2PA 4JRFA 1S7XB 1GZPB 3CFJB 1MI5E 3BFOA 3GMOB 3OAUL 5EU6B 3V4PA 4CNIB 3A21A 5KVGH 1AXTL 3RU8L 3WD5H 4G8GB 3WNJA 1EZUA 3QWQB 4XXCA 2EDEA 3QYMA 1RY7B 4NAMA 5DMIH 3UPRA 5IGXH 1NGYA 4Z7QE 1OTTD 2Z9TA 3CTTA 3HNTH 5KBLA 2QDWA 5DVLA 5EBWB 4FCAA 3P4MB 5E4EC 2Q7YB 5EIIB 1D5IH 1IBZA 2WSDA 2F5AL 1XH3B 2OTWB 2W0KA 3B2PA 4HALA 4YAQB 4KI5C 3WFBH 1WAEA 5HHQB 3ULUL 5IMMB 3L4VA 3SY6A 5ADPL 1I3UA 5AL8A 4O4YH 4X6CF 5J1TC 2NX5A 5E94A 4KY1L 3D50A 3VFWA 4LDCA 4F7EA 4YSRA 4HWZB 5DTFB 4YXKH 3DX2A 3T1FA 1RZPA 5EN2A 4ELMA 3BT2H 3Q8EA 4XMLL 3V7AG 2B5IC 3O4LE 2VL4A 2Y2WA 5KAQG 3GBLA 4YNYA 1EEQA 3D30A 1F3RB 4XPHH 4G8IA 1BQHG 4RGMB 1MNUL 5DJCB 5KVGE 3CE1A 2ZAGA 3HG1B 5FV1L 1MRCH 1OKEA 4ZFZB 1ADQA 2P4AB 1XL4A 4OF5A 5EOCH 5C0GA 4BZ2L 3IAGC 1PAMA 3ZZQA 2FZ3A 3MV9B 5F0PB 4A67A 5EEVA 2NLJA 3NFNB 3EIFA 1ORSB 3AXLA 4LLDB 3J7HA 1KYFA 1YEEH 4RMBA 4Q9BA 4TNWK 3UIYA 1HQRA 1A6VH 2RGSA 3STBA 3EH3B 4M5YL 1EFXD 3KWWB 2B39A 1MKFA 4M6MH 1X5HA 1EJOL 1GYVA 1HAWA 4OCMC 3IMBA 3TJHD 3P4MA 3ARDC 2ITCB 1L5GA 3N06B 1U8IA 5DUMH 4LBEB 1HCZA 1Q9LA 4IBTA 1CYXA 1NMCC 4PJFA 2EUVA 3OZ9L 4P2OD 1X7SA 3IDGB 2FJFB 4PJIB 3B6SB 1DDHA 1FAIH 4JFXB 5E1AA 1SOKA 1N5YH 4XT1C 5CD3B 3KD4A 4GW5A 4YSUA 3LNEA 4ZUTB 5CILH 1KY6A 5BQ7B 1ICTA 1KLUB 3LXBA 4M61B 3AQYA 4M3JA 4L4VA 3TCTA 1XR9B 4Z7WE 2A4ZA 4UV4L 2BRRH 4WV1A 1QSFB 3UEZA 3H9SE 5I1JL 4UTBA 4YHIB 3DOSB 5GZNA 3QGVA 3SKNB 1W8NA 3BP4B 2J25A 3V95A 4P3CH 3V9EA 3CVBA 4Z78B 3U6RA 4G9FD 1MQKL 5D5MB 1N6UA 2GTWA 5GGUA 4APQA 1YN7A 4GSDH 3K4ZA 1EAPB 3BP6A 1FE8H 3OV6A 3BPLB 1OW0A 4CW1B 3EDFA 3ULUC 1R5WB 4Y1AB 4BFFA 4ETQA 1UATA 3LKSB 3MRJA 4YE4H 1JXDA 4NOBA 5AVYB 3AJ7A 4PYGA 4JO4L 4XP1H 4L37B 4HWEL 2AGJL 4G6ML 5T1KB 1TVBB 5I16B 4ZW5A 5IHZB 3A67L 4MA8L 1UM4H 5GGRA 3OGCB 5FM4A 2Z8SA 2ZOTA 2ZKXA 1XTMA 3CVHB 5G4OA 3TFKC 2WP3T 3KE0A 4I18A 1QHOA 2UY6A 4MQTB 1UOKA 2Q86B 2QKSA 1E27B 1OP4A 4L5FL 4XNMA 4WF7A 3AMLA 1S3RA 2GC4C 2P26A 2FJGA 7CGTA 3KBFA 4UBDD 2DQGL 3CFBB 3WTTA 3ESUF 3RIAK 5JZ7D 5L88L 3BD3A 4WCYL 3STLB 3SKOA 5D8JH 5F9AC 1JCKA 3NJFA 2NCEA 1A3QA 3BI9X 4L05A 3BSHA 4WI8A 3SGJC 5H2BB 1FZJB 1UVQA 2VM9A 3O2VL 3CD4A 4N85A 4UANA 3S7GA 5INDB 3HZVA 2OJ1A 3DXAB 1P4IH 3PDGA 1VZGA 1QW9A 4LBAA 4BM7A 4EI6A 3DA0A 5D93B 2Z0UA 5EEZA 2PO6D 3DRQB 4EUPG 2MSPA 2E5EA 2NLJB 1OAXH 4J12A 4F9LA 1QLRA 5DJ6B 1MWOA 2QPDB 2PW1B 3X11A 1OARL 1X9QA 4FTVD 1QOKA 4YLBA 3BAEH 3LN5A 2JJTC 3O3EA 1SJEA 3QG7H 4X9HA 4G6AC 3ZYJA 2VQ1B 1TSRA 1RP8A 3VO0A 4L3EB 2VRQA 4D9LH 2A74A 3FRPG 3QI9D 3OPUA 4WTZG 1SDYA 2QQKH 3IDJA 4RSVA 3KXFD 3G6JF 3P0VH 4WTWA 3U4BL 5EZIL 1FGNL 3RVXD 2ZOUA 4HKXA 1QSFD 4OB5H 4UV7H 3DHMA 3DV4A 5C0DB 1LEIB 4GG8A 4FOMA 2YPLE 1C7TA 2G5RA 4G1EA 3O0LA 1D5MB 1FPTL 2EACA 2H6PA 3HLAA 4JFEA 2GJ6E 2EIEA 2CDGB 1L7IL 3T8VA 4KXDA 1F5WA 4LHUD 5B7MA 1DE4A 3V4PL 3MYJA 4PU2A 1KLUA 3TBTA 3AS0A 4M7LT 1TJMA 2Y07H 3CQPA 3RZCD 1RUPL 3FHEA 5F7BA 4MQ7A 4H26B 4GIAA 1P9MC 5E0FA 4YZWA 3Q6GL 3MJWA 4JGNA 1FQ9C 3ASNB 4ILDA 2XN0A 5F89B 4YHLH 5IUSA 4YHYC 2WQVA 2AXWA 1NH6A 1FDLH 3F6IA 4HMDA 4F80A 2FD6L 3PNWA 5IESL 3SOBH 2ENJA 4FZEH 1U8JA 5FKPA 3WEXA 4X0KB 3MV9E 2C9SA 1IBFA 2DL9A 3SCMB 1XF2B 3MQIA 5DR5L 5IFJA 4XRCA 3V0IA 4U3HA 5ENWB 1V05A 5KEZA 2D7OA 5I1GL 1KEMH 4ZQKB 1BD2B 1KN2L 3VTTA 4HS6B 4FP8L 5J1AB 4Z6AT 1J1OH 4WWKB 3AAZA 3ULVF 1JGLH 3L3GB 4MAZA 2P5EB 1LTXA 4S1RH 1GTFA 3KPSA 1B0GB 3VRLE 5DJ2A 3TJEL 5C86A 2R23A 2UZPA 1L0XA 3D1MC 3MRHB 4M02A 2MTAA 4O51A 5PCYA 3RDTC 4H1LH 1J8HB 3IGAA 3O6FB 3PAUA 4YDIL 2HTLD 3BKMH 3T1WA 3QDGA 2BHYA 4M5SA 1QVOB 4QRBA 5DK2B 4UDUA 3VCLA 2ZSVA 4G6JL 1WZAA 5CJOL 2ZCLH 4JPVL 1FL3A 4WHYH 3BW9A 1AD9B 3FRUA 3SDXE 3ETSA 2JB6B 1RUQH 3IF1B 1UM6H 2X0UA 3SDCC 4PGEB 3F01A 2RFXA 4BFNA 5DQDL 4X4ME 2P7TA 3DPDA 1E4XH 4YHOL 5DVPA 4QDGA 1BYOA 4GG6F 1G7MA 3S37X 5MHSD 3NCWA 5D71L 4QTFA 1KG0B 3F64A 4H2CA 2FLBT 3HBGA 2A1WH 3U79A 1NCCL 2GAZB 2CPCA 2JKLA 2Z3FA 4I2XE 1TTBA 3CMOL 3NN8B 1Z0NA 1OT1A 4M5ZH 1DBBH 1FZOA 3MNZA 3PWPD 3MRFB 2XXCB 4IOIB 4CUCA 1U91A 5D2LB 4WZ9A 4X6DA 3RVWC 3QYNA 3DSNB 4Y19D 4BBWA 2VN5A 4J3OH 2V5YA 3QVAA 4EUPA 3WHE1 5DWPA 1ZT4B 5BMFH 2HFGL 2P80A 2K6ZA 1KYOK 3EOBB 2H26A 1H5BC 2VC2H 3QPXL 4R7DA 5C6WH 1AGDA 2JJTA 3MLUH 5I8EB 4KROB 1QFPA 1QI5A 3IDJB 1YEFH 4F9LC 4RZKA 5LWYH 4J3OG 5E2UL 1KPVB 2WB7A 1G5GA 4PJ9A 4X4MA 5T5FA 5KYWB 4B96A 1F3JA 3GBML 4A1RA 5AVSB 3QIUB 1Q8MA 3QWRD 4N0UE 1JYNA 4NENB 1ZLVH 1WD9A 5I8CA 3GI8L 1OF0A 1HHIB 1RIHL 1GGCL 2H0JA 2NW3A 4AM0Q 3GBNH 3RX9A 2FATH 4ZMWA 2N3JA 4DP4X 4S0SD 4IS6A 1NMCB 4PGBA 4BZ2A 1NC4B 2BSSB 2HXAA 2FEEI 4HA1A 1LO5B 4EN2A 5J89A 4MCMA 1G6RA 4ZMXA 3WNOA 4ZS7L 5AW4B 4A2EA 4JHVA 3TJPA 1PU0A 3PIQB 4WHYG 4JMXA 4L2LA 1ZLUK 2FHFA 5CJQL 5J7CC 2LLGA 3GXNA 3OXSA 2ESVB 2Z93B 4PUBL 1JXGA 3GKZA 4Y4KD 1JF5A 4J39A 4P3DA 3LH9A 2VIRA 4I9XA 4H2AA 3T3PE 1SJHB 4I4WB 3E8UL 3BD5A 5CKGA 2FIRT 2WVVA 3M88A 3RB5A 3FU0A 1MIEL 1D7BA 2YA2A 1MSPA 1DBKH 4NT6A 3QIBA 2B15A 2Y5TA 1WHOA 4NHCL 2ZG1A 3LB6C 3BLPX 1MY5A 4PS4H 2O61B 3ARFD 2E9JA 4B41A 4BWWA 3AG2B 1MCOH 1AZNA 2ZSVB 3BAKA 2QTEA 5D7LA 2WO2B 1GGIL 3QORD 4F7CA 3WS6C 1IL1B 1T0NB 2ED8A 1J8HA 3UMTA 3VG0H 4HGWA 1CDCA 3VTMA 1GKEA 2QEJA 1L9SA 1NIBA 3IFNH 3IRPX 1TCRB 2AXHA 5ICYB 4GJTB 4LCCB 2YBGA 5L0QC 3LIZH 2GTZB 2J7LA 4PRPD 4OUUB 3NCYS 3R4RA 4PMFA 4YIQA 1HJBC 3DVFA 1JNNH 2KZWA 4TLKA 4ZO9A 5B38A 3FYEB 4YHPA 3CXHK 4DP0X 3SD2A 4N0CC 4W9DC 2EEDA 4K5NA 1HSAA 3ARGA 4X0KA 3MGTB 1AMXA 1R5IA 1YYLH 1UXSB 3STLA 4DGYH 4KK6C 3M46A 1WT5C 3DUUB 3ZL1A 1DJHA 4KZDH 3UXFA 1K6QH 2RIKA 4F2MB 1A4JA 1CS6A 4X6DB 3QCVL 5EU6D 3T5WA 4I0PA 1E3FA 4I9WE 4DGWC 1I82A 4UQBA 3ALWA 1KDIA 2DKUA 4ENED 1NJ9B 4PJ5D 3NN8A 2EE2A 4HISA 4KAQL 3ARUA 3MA7B 3OPZH 2NT1A 2E6JA 2VR8A 4U1SA 4JPIB 5E9DA 1WAAA 4R4BB 1V3KA 2OMNA 1LK3L 3D0VA 2BNUA 2UZIH 3DX8A 1ASOA 1GGUA 2JTDA 2R4RL 1VADB 1TZIA 2AK1H 3B5HA 4RWHA 2F18A 2WLIB 2Y6SC 4NQSA 3HI6H 3WSQL 1RUPH 2NQDA 2FB4H 3D9AL 2OBGA 3DHPA 5E6IC 4FQIH 4XBEL 4XC3H 3IMSA 2Z6FA 1OCZB 4NENA 3HB3C 1KJMA 3PNRB 3D8MA 3EYUH 4U1IA 5T1KD 3IGFA 4DGVL 1QYGH 5IJKA 1AKJA 2ICEC 3PQYB 2CIIA 1EANA 2X2UA 5FGSA 2FE0A 4NIKB 1XIWC 3DVIA 3LEVH 1UXWB 1NDMB 1J5IA 3MYZA 5DEGB 3TLRA 2XNAB 2CHNA 2XWDA 1E9PB 4ONOA 4BV1A 2C7UA 2NCMA 5AOKA 2DWDA 1NMBH 1VFAB 4MBOA 1BEYH 3KEHA 2YA0A 4NN6B 1BVKB 2EICA 5EPMB 2DQEL 1V5JA 1KCVH 4X9IA 3KPMA 4OLEA 5TDOA 1QSFE 4AY0A 4NM4H 2EIDA 4WW2A 1BQLL 4WK0B 4RWYL 5CD3A 2DM7A 3MJGX 3AZUA 2FJHB 2UX6A 2RJMA 3L4TA 3IU4L 4EI5A 4I7ZC 2WVTA 4P2RD 2IDUA 1GW0A 4QAWA 3WN5A 4JFDA 4W9JC 3QUMA 1A2YA 3ULVD 5CUSH 5DHEA 3RPKA 6TAAA 4RMRA 3G5XB 1I7TA 3NCJH 4FQHB 4AG4H 3WIAA 1A1MA 1IC4H 4F37K 5C0JA 1FFNA 3DYPA 4MASA 2ZCKL 4RIRA 1R9FA 5D9SB 3LB6D 2VB5A 4APXA 3AY2A 1AZCA 1D7CA 4TNVK 4AT6A 4CILA 5DO2D 2I85A 3KYOB 1DUYB 3O8XA 1P5VB 2BW5A 1TDQA 3TU6A 3ECQA 1MREH 4UDTA 4HULB 4LNRA 4CVXB 3UTTE 2ENQA 3P40A 4HEME 1G1KA 1KCWA 4FYTA 2PW2A 2RAMA 4WDIA 3S88H 4N2EA 4ETQB 3EYVA 1IFRA 3RWIA 5I24A 5SX5K 1D5ZA 4ABVA 4GAYA 3L08A 4X8JA 2D3VA 2YPVA 4PJFE 1RZ8A 1N6QH 4OGXL 2WBJA 2KPNA 3Q2VA 4ZMLA 4NAQA 4G43B 4HOWA 1TUPA 3C87A 4ZO7A 2OMZA 2EDLA 3K8MA 4GW1A 4YHIA 5FV2A 2V33A 4DAGL 4RDBA 3FUKA 4AV5A 2LV4A 1WISA 3Q2NA 3AREB 2EH7L 2XRAL 3C8HA 3ZDZB 1W8EA 1OE1A 1RP9A 4YLCA 5D96C 5FF6B 3LZRA 3VFGH 4MCZB 3ILPB 3RY4A 3D85D 2EILB 4WUUA 2UXTA 5HYJD 3S48A 5KSVA 3SKOB 4N0UA 5FLVA 1ZVHA 5F6HJ 2FGWL 1KBBA 2IBZX 1KT2B 2NY3C 4E9WA 1GZHA 3NIDB 3VFOA 4BCYA 3QS2A 2EKSB 2WINA 5L6YL 3O3DA 3GJEA 3S3PA 1ILSA 3WHXA 2GCYB 5A2IH 5I1EH 1TKWB 4I3GA 2XWJA 1HHGA 4W9IC 1A1NB 1QQDB 4ZS7H 1HXYB 2X88A 1AC6A 4FQQB 1AQKL 5CJ5A 4BZYA 1ZGLP 3ARBB 2BCMA 2OL3H 1OK8A 1DO6A 4FFZH 4KMQA 3QIUD 4GKNB 3QFJB 4ZMTA 1RLWA 4GYBA 3FTYA 5CM1A 3IDXH 3B7YA 4ZMOA 5F6IB 1NFIA 1HOCA 3GDBA 2JCCE 4IU2B 1R5IB 3D2UB 4ZUUB 4BQBA 1CTOA 2ETWA 2X4NB 2VMDA 4P46C 3UTTA 4ERSH 1BF8A 5I0VA 1BA9A 1IFHL 3OBAA 4BXSV 1RZFL 3NZ8B 5G5DB 2VQUA 4OSUH 2BNQE 1JVLA 3F7RA 5AAMC 1JUFB 1BMWA 2D8KA 2R2HB 6PCYA 1F2XK 4LPWA 2WK2A 3PQYD 1RURL 4L1DA 3PWUA 1CICC 4M7JH 5ICZB 1S5HA 1A3LL 5EF0A 2B59B 3SPIA 4G59C 3REWA 3WS6A 4HT1L 2WWKO 1X7QB 5F7KC 1N9PA 5I82A 2CO7A 3WY2A 2DI7A 1AS6A 4N87A 4Z3GA 3F00A 1E4KC 4PWEA 4XMKL 4HIJB 3HS0C 1IM9B 1I8IA 1OE3A 4MAYD 4RIRB 5H37H 1K9TA 1WBZB 3G5YB 1AD0A 2MCG1 3UCRA 2YXWA 2DMHA 2RB8A 1AI1H 3IRCA 4C4KT 4C83B 5IHUL 2P8MB 3TCLA 3NQIA 1KYOJ 3KVPA 2FL5A 5J12B 3K5RA 2PYEB 4ELME 4ANWA 5F9OH 4NOFA 4IRSB 3MBWB 3O4LD 3R18A 2DBJA 4J3XA 1BGXH 1UWGL 4TUKL 3ECVA 5AKRA 3T6VA 4ONGL 2R0KL 3SGEI 2R39A 1UD8A 1YEWA 1ID5I 3MFFB 3L9BA 4Q6IB 3C6LD 4RFEB 2K78A 2E7HA 4Z1PA 3N04A 4G7YL 5DFTA 3UDWC 5C3TA 1H9VA 1UT9A 4OLYL 3MRHA 3S34H 2VZUA 4I18B 3T4AC 2DZEA 2X4QA 3D85B 2BWDA 4K71B 3NZ8A 4KO5A 3DGGB 3DMMD 1HNGA 1XDTT 1MW1A 1WS8A 4G43A 4HAKA 3RWCA 1KOAA 4L9DA 3BJLA 3BN9C 1MJ8L 1XGYH 5DHXB 4YDLB 1YNTB 3G08A 1KLGA 2FWUA 2J8UF 1AR1C 1QZ1A 3H6AA 4AX3A 3PV6A 3F7YB 2QVFB 2C4FT 1NKGA 4XPBL 3HW7A 4XRCB 2D4FA 3MUHL 4NBZB 1RMFH 1OGSA 3O6FD 4DNLA 3D05A 5IJCC 4RWYH 2R29H 2AK4E 2V4LA 1JK9B 4KO6A 2YS4A 1OAUH 4HUXA 3WGVB 1JP5A 4LKCB 1GA2A 1B0WA 4AEHH 1AACA 3OXRA 1I8UA 1CXHA 4KQ3H 4AE1A 4EZJA 2GT9B 2DQGH 3KH4A 3AT8A 1TQCB 1HHGB 2XWJB 4LVEA 4UOQA 1J05B 2I26N 1TTUA 4V1DD 3N1QC 2Q5BA 3F3HA 4XCYA 5IQOA 4Q56A 1RZJC 1J0IA 1UA7A 2GKIA 4YSEA 5DS1A 3VFOB 1XL6A 2FSEB 3FU7B 4MXQC 3HUJE 1I7TB 2OR9H 5JW4R 4NWTL 5D4QA 2R29L 3D12B 3GJEB 3FQRA 4LPCA 4B5ZA 4EDXB 2VDNL 1EHAA 3HZYA 4N0FA 2CUHA 3AU1A 1NLDH 4QHPA 1JIBA 3U9WA 2JJWA 1U3ZA 1XCQB 3DMMC 4L9LB 3L9EA 2AXJA 1I8KB 3H7BB 4YS4A 1S7XA 1V54B 1GZPA 2HT3D 1QZNA 4MKMA 3B6SA 4JRYD 4X6EB 3ELAT 5H8DA 2WWNA 1NCBL 1FH5H 2IVFC 2WKOF 5K9KA 3HRPA 3L1EA 3UJTL 3HUJA 4F2FA 1NGQH 2FBOJ 1RPUA 3KGTA 1QFOA 2D3NA 2EXWD 1VFAA 2BH0A 1X5XA 2B1HL 1C16B 2HA1A 2CQVA 3EJYC 3WNNA 5EORL 3FTGB 4B53A 4YHLL 1PLGH 1PQZA 1FFOB 4L1LA 1YPZB 5IQ7H 2ADGA 3SKJH 3EDEA 2C9VA 3INUH 4K7PL 1FORH 4NN6C 4M48H 1A7PH 1IQWH 4R7VA 5F96H 5HDBE 3SOTA 1MFNA 3NIFF 3GI9L 2DLEA 2L3BA 3DXAD 1BZ9A 4X5LA 2N7BA 5SWZE 4ZNEA 2ZUXA 1R47A 3RFZC 4XAWL 1J11A 3OQRA 1PLBA 2ZOKB 1JNHB 4EOWH 1BX2B 3BDBA 3PWNB 2ED6A 1Q9OA 1UHVA 2A6JB 2VKXA 3ZR5A 5I2IB 1NEPA 5IEHB 3MROB 3T3PF 5ADPH 1UCBH 4YX2H 3INUL 2WLIA 4DP9X 4PY8I 3WNLA 2XZCH 3Q44A 3GXUB 2ZP0T 1JN6A 3G04B 2TSBA 1LE9B 1AR2A 1JNJA 3TCLB 1CXIA 4DCQA 5KVDH 1A1NA 1QQDA 3ORJA 5IHZA 5KSBA 4J2XA 4ATWA 5DEZA 3IDMA 5DD6A 3O45A 1D5XB 1NAKH 3FMGH 3IWUA 5FOBB 4PRIB 5AB9A 4RA3A 3RWEA 4A66A 5ILTH 2W60A 2VNCA 3US1A 2ZJSH 4IDLA 2WLMA 4AJWA 4QRRA 2ITCA 3WYRA 2AQ3A 5JXEA 2WD0A 1JF6A 4AH2A 3BQUB 1DE4B 1WICA 3DO4A 5CJXC 2AVFA 2NY4B 4NQCD 5DSCA 1SDDA 3HFMH 5DZNA 3FPYA 5I1AA 3FN9A 5D7KD 4QHLB 4PG9B 3NMEA 5G5DA 2K45A 1DEEA 1VFUA 4Z0XB 3JWNH 4HUXB 5HDBB 4MQSB 4M7JL 5HI3C 2X7LA 1X5LA 2FWOA 4RDQF 3O6KL 1YEIH 2K0RA 1WJ3A 5CSZA 1KY7A 4QOKB 1H3XA 3MXVH 2VDRH 5IMLB 2WKOA 4UINL 5JHDB 4X99B 1N59A 1SLVA 3B1TA 3GSOB 2VL5A 1NOLA 5KANG 4UIMA 3PE9A 5E6SB 3OKKA 1SMOA 1X44A 1OAZH 2HRPL 3L3IA 3W9DB 4NN5B 2Y7QA 4S0TD 2IXQA 2A0LD 2EYRA 2WN3A 2YMOA 3KBEA 4HU8A 5I74B 4R97C 4PPTA 1A9BA 1O7DC 5BZDB 3K6OA 3QUKB 3VVVA 4HJUA 4YGAB 4X6DE 3P9WB 5GS0C 1RD6A 4Y2LA 2Z1KA 1O9ZA 2VLRB 2NT0A 3DURB 3MV8D 3VFMB 4Q9QH 1KN4L 3KWWA 3MOBH 2FEEL 4OFIA 1F6AB 4IQHA 1XXDC 2NY3D 4P9MH 4KDTC 3RTQB 3ULSA 3ZU8A 2JNZA 1HKFA 1DQJB 2VUYA 1T7ZA 4PMEA 4ICXA 4XC1H 1YECL 5ESQB 1NBQA 2RBLA 3SQOL 1NC4A 2BSSA 2H2PC 2CDFB 4FXKC 3ZKXC 1T7YA 4KK5C 2NW2B 2NY1B 1DSWA 2BHZA 3BFQG 3PWVB 4XZUA 2D3JA 5GSRA 3ZE0E 2KT6A 1TZAA 4X98B 2GC7C 4KFMA 5AW9B 1USQA 5KYYB 3UGUA 1LO3L 4ODWB 4L18A 2AV1A 4K8RH 4ZTOL 4N90E 4QWWC 3WKPA 4HC1A 1BVOA 2RQEA 1TG8A 4QRUB 2VDMH 1FN4B 5IFAL 2IMMA 3AMKA 3S36X 2LVCA 2JKXA 2OTPA 1JNLL 2A9NH 3ZUCA 2XZAL 1UB6B 2BC4A 1WBYA 3B2XA 5AOZA 1PZSA 2PCPA 1HXKA 3C5ZC 1BVNP 1MWAH 4BK5A 1CE6A 4R7DB 1AKJB 1ETB1 2ICCA 5FHBH 1QSVA 2HAZA 1AKJD 1W80A 2J12B 2P24A 4DUWA 3GSNH 5DHYA 4K9EC 4OSUL 3VXSD 3R7QA 5HYSA 2EDDA 3LTVA 5FYJL 4GT0A 5CGBA 2HJLB 5I9QB 4FYQA 5MEQB 3HS0A 1F6AA 4IRSC 5D7SL 5E03A 1EO7A 3C6SA 4GKNA 4P2RB 5LG6A 5E8PA 5F21B 1BF5A 2ENPA 4Y89A 2VDMB 4P4KC 4EQ3A 4E41E 3W3BA 1AO7D 4FERA 1PKOA 3PHOA 4M8UA 5D1QD 2CLRB 4Y2DC 4O2EB 3WJLA 3RWHB 3FQTA 3L5WB 4HKBA 1T0PB 3QISA 4ZXBD 4P0DA 1QRKA 3EJYD 4I77H 4AENB 5EF3A 3DUSA 2I9LB 1ID2A 3MI6A 3O0RL 1QR1B 2QMKA 4OLXH 4HQQH 5CEXA 3FU8A 3IMUA 3GLDA 4KH9A 4BFIB 5CCKL 5C6TH 1NUDA 4JPKH 1EGJH 1WZLA 1RIUL 4P46A 4AMWA 1B2WH 2JK5A 1T0OA 5C0BB 5IMLA 3VXUE 4PG2A 4CJ0A 5IVZA 1DEEB 3C9NB 2ZWSA 4NQDA 4PRID 4G7QB 4E9TA 1REIA 2R2EB 3EFOA 1RZJL 2PWDA 4F57L 4EOWL 1D2PA 1TXKA 4DP5X 3BKYH 3L6FB 4HGKC 4CADB 1OPGH 4P2AA 2OZ4A 3FS9A 1E8WA 2F7OA 1I1FB 4NLAA 3NFNA 2P5EA 1NBZB 1AG6A 4LU5H 4ZMPA 1OWWA 5GSVA 3GMNB 3VH8G 1I3GH 1FWXA 1RHFA 1CXLA 1QSZA 2CK0L 2DYSB 3GMQB 4XN2A 4YLQT 5F3HA 4E41A 3IPBA 2EXYC 2JXMA 2K70A 1T4KB 2KUTA 2VDPL 2R0ZH 3WXWL 1I1AD 4FXGA 5C09B 1FORL 3FT0A 4N1HB 3CSYA 1NPUA 5HHXH 5I18H 3GGWA 5ID0A 4M1GH 5J6GB 4KK9D 2IH8A 3EOBA 3PP4L 3ZW3A 4IU3B 1KXTB 5EEUA 2APSA 5AVQB 2OTUA 5CP3H 3BQUA 3V0DA 3O11B 3F83A 2VDQB 1DQKA 4L4JA 1WQVT 4UNVA 2YMXL 4JRYB 3THML 1G0DA 5PAZA 2Y7NA 1BGXL 1JDCA 3O6LL 4PM1A 4UQIM 1ONQB 1MG2C 4FQIL 3TBBA 2Q76A 2WKLA 3FSWA 2W60B 2VLJD 4GP5B 4HZAA 3V6ZB 1RUMH 4AQZA 3RIKA 1TCMA 3OKLA 3QJZA 1TMCB 3SIKA 4NXKA 4YO0A 1VPOL 2JIXA 2WZ5A 4WNQB 2H6PB 3T77A 3HLAB 1YMHB 3PIQA 5HVFB 1SVZA 4OGAD 2GK0A 3S2AA 4XVOA 4NP4L 5IZ7A 3AG3B 1FHNA 4H20H 3L95B 4JHUA 5GGRY 5ITFA 1PBYA 1S9WA 3AS3A 1A5FH 2HCZX 5C0AE 1S8DA 4JGMA 1PS3A 1GGYA 5T1MA 3L3IB 4R8WH 4ZUWA 4PVMA 4NQDE 1CDHA 4ODXB 4ZAKC 4OQTA 5J1SC 1F42A 5DUBB 3CN3A 4NM8L 4DKAA 1BCIA 1HCYA 1KNOB 4AIZA 3CLFL 5E08H 3SYAA 4P5TC 1WEJL 1YN7B 5F7LB 1BD2E 1M05B 1CGSL 2DD8L 3VXME 1H0DA 3I9GH 4WFHD 5ICZA 3GK8H 2GSIB 3KCWA 2HVJA 1XWVA 2H3XC 2OXGA 3O6FC 4X6FB 5CINH 5D1XD 2CHWA 3VA2C 2ALAA 5E8DH 5KYWA 4D9RE 3P3SA 1M4KA 2AAVA 5FKAA 4PGDB 1DQQA 1BZDA 2X4UA 2E9IA 3G5ZB 5DMIL 4W9GC 1ZIBA 3KPSB 3HNTL 4MKTA 4UT7L 4X80H 5BRZE 2Y0SA 1J0JA 3MRMA 5DU7A 4TQEL 1EHLL 1GGIH 5I8KL 4GSQA 5I6XB 4JRXB 3QIWD 1HILB 3DROB 5FUOH 4Z76B 3HKFA 3L1FA 1EEYB 2DTSA 3L2NA 3P0VL 3S5LG 2G5UA 2LABA 4ABQA 2UYLA 1JDAA 4NWUH 4S11A 1MELA 2AQ1A 3Q5TA 2PTVA 3HMXH 1YEGL 4PRBB 1U3HC 3FQTB 3L5WA 4HKBB 2ZXGA 1CGUA 3FSVA 3K1KC 4HJJL 4Q6YA 3GBMH 5FO9A 3VFVA 3ZE2E 3IM1A 3HE6B 4RQQA 1LO5A 4I0CC 4QR7A 2XG5A 3FO9A 5I1DA 4ABWA 1AH1A 1F3DH 3WN6A 4YQXL 2WLKA 3GQFA 1MCPH 3OR7A 4FNPA 1NOAA 2AF2A 5EZOL 3L45A 4GRWH 1DVUA 1T89C 3BZFB 3U9UB 3FQ1A 4POZC 5TQ2H 2XFXA 3V0WL 1U93B 2CGYA 1KFAL 5HPOA 4OH2A 3A6OA 4IHBA 4QXTA 2ZOKA 4LAQH 5T3XH 4A55A 3DSFL 1UKSA 2WVSA 5F3HB 4TLUA 5HJBA 2EKJA 1N64H 2YSTA 3C2AH 4HFUH 1S9XB 4HIEB 3RPIB 1QSED 3BVVA 4H44C 2I60H 3OVUB 5IB2A 4M1DH 4FXGC 4RAVA 5C0CB 2PCPB 1CD0A 4A7GA 1JPFA 2IPKB 4LVHC 1BZEA 5K1VA 4IGBA 1SFHA 1QUNA 1WUNT 3CGTA 3KYKH 2X4QB 1FHGA 4Z3IA 5AOJA 4TOYH 4AEIH 3JUZA 4YDVA 4U1NA 4R4FL 4X7SL 1LMKA 2VZTA 4NQSB 4QRPB 1KB5H 3QFJA 3MJ8A 4A7VA 1IC5H 1RZ7L 4YHOH 2N4IA 1OGTA 3KR3H 4U7KA 3BPOB 1IAKB 1JHKL 3W2DL 1CIDA 1RZKL 5E23A 4BINA 4JFED 1KUMA 4N2AA 4IBZA 4B5EA 4JFUA 1QFUH 4N2MA 1WSST 4PH8A 1T1ZA 1IBHA 4LEEA 3ILDA 1S9KC 3IMTA 3LKPA 5EF2A 2PUQT 3WXVL 3DXAE 2YUVA 1I8LC 3ARGC 3CN0A 3UTPE 1ZSDA 4FHKA 4Z7WF 2AEPL 1EV2E 1TETH 1KXVA 2R1XA 3FDWA 5CR1A 5L2KD 4DTGL 4LLQB 4XVSL 1OAKL 3NJKA 3MAWA 4IMLA 3C5ZA 4Y2DA 4YSDA 1GOFA 2B4CC 5EO9B 2B59A 3U46B 3L1OH 5HDBF 3PGDB 3VGBA 4YXHH 3FB7A 2X0WA 4ZAKD 1FP5A 4UT9L 4WSKA 4Q14A 3T9WA 4JN1H 4JY4A 4LHJB 4RAVB 1R5WA 4Y1AA 5DHVH 3VRIA 3EGDB 3VACA 3F84A 1GH7A 5L4MA 3RWDA 4EI5B 4NKOA 3EJZD 2Y7QB 3BISA 4FNLL 3LQAL 3DX4A 4Q74A 3TTSA 4FZ8H 4IEFA 2AEQL 4YEFA 2XBTA 2J5LB 3TBWA 5HJ3A 3C5SA 4NC0B 3QULA 2DQDL 3KL5A 5DEFB 5JHLA 2WLHA 4BFRA 1VGKB 1I31A 3JT2A 1VHPA 2JJSA 2XUWA 5EDSA 5M94B 1RZQA 4TQIA 5CN2A 3TO2A 3S37H 3OGOE 4OZHA 2MOVA 2B0SL 4X0NA 1I1AC 3BSZA 3WY4A 2Z31D 1OT2A 2GK0B 3MJ9H 4HS8L 3VE0A 4PJIE 3ZT7A 3LYRA 1U8PB 3AABA 3HZKA 4UM8B 4XOEA 5E8NA 5AYQA 1UD4A 4JHWL 2OZ4H 2AKRB 1B4TA 3MLTA 3T3PB 2BRQA 4LLVA 3DX0A 2AK4D 3DX6B 1UQSA 4QTIL 3CZJA 3FSAA 1BREA 4GXUM 4TPRL 2Y1AA 3FT2B 1YEHL 5EU4B 4KI5D 4XWOD 1GJIA 3GZPA 4BSVA 3SDAC 4R97B 2OMWB 3KPQB 4K55A 4PJHA 4PP2A 4ZOAA 1ND0B 1FFTB 2VAJA 3THMH 3SBWA 2ZSWB 3PLYA 5C7XH 3BESR 3P11H 4HPYH 2VSKB 1SEBA 1KJ3H 3HNVL 4XMLH 4ZSOA 4ZK8A 4HG4K 5LXVA 1JZ3A 3U9PH 3L54A 1DQQB 4XXDB 2L7QA 1LQSR 4MA1C 4WFGD 4E36A 4FADA 1MJUH 4NKMB 1DQLH 4BCXA 2GJ6A 2HYMA 3QEHB 5DEFA 1N10A 2JQZA 3O2VH 3G7TA 2M8XA 4XAKD 5J9PB 3AXLB 3NFPA 1SXCA 2KC0A 5HHME 4EIBA 4R7NB 5HYSB 2VE6A 3HS9A 3QJRB 5ACZA 3H56A 4HJ1A 1CG9A 4JKKA 3V5KA 4D3CH 5IY5B 5FHBL 4MTMA 1BHGA 2XI9A 5DD1L 1TU2B 1H3VA 1KWKA 4X6DF 4FN0A 1KJMB 1EXHA 4IRJD 2NOYA 4NYLA 5IBUG 5D7EA 3PP3K 2XVLA 4F8PA 3FRPA 2F7RA 1IZKA 3CFQA 4HS3A 1UACH 5DS8A 4OT1L 4MAUH 3P4NB 4AC2A 5K9JH 3QCTL 1A7OH 2FYVA 3S3DB 2YAQA 5IBLD 5I0ZA 1FI8C 3EJRA 3FULA 3O3AA 2NNAA 4HIQA 4RBPH 2G30A 3BPNC 1B6DA 1KB5A 2Q87A 3C5ZB 1U30A 1K5NB 4Z7OB 4OD3L 1FIEA 2R0LH 2Z7ZA 1AHMA 3FH8A 1G7MB 3OQ3B 2O6CA 5C0AB 2GUOB 2Q7YA 3GB7A 1FE8L 3DPBB 3TYFB 4EIGB 5LGHL 2AJXH 5SWQA 5DI8B 4ENEC 2D31B 5HGAA 2XIIA 5F89A 5JIKA 2DIAA 2NY3B 1KT2A 3NTCL 4MJJA 5FYKE 5ALCH 3ZQWA 5B3JE 4X5QA 2NY0B 2YO3A 3PL6D 4D0BA 1ZV5A 1NANH 5KJ7E 2DWEB 2Y5QA 5D70L 3CDFA 5LQBH 1T03L 1PY9A 3BSGA 3D06A 3MTRA 4PJXF 4UNTA 1A3RL 3QZMA 4QRQB 2PO6B 3QAZB 1M53A 2BIOA 4IOSA 4U1NB 1B0RA 5A43C 5FFLA 1KTLA 4DOHE 4RFOH 1MFCL 3IJSA 1EAPA 3BP6B 3WE6A 1XB6A 1V10A 5DRXB 4HMCA 5C7ZA 4URKA 1JWUB 3QO1A 1ACCA 3FB5A 2HMIC 1KJ2B 5B1AB 4ZJ9A 5C09E 1RHHA 3A4AA 2HWZL 3S96B 3D2UA 1F6LL 4LF3A 4NO5B 4KOCA 1DP0A 4Q9RH 2X4NA 4OI9A 5F3FA 4YHMH 1QPXA 1CDUA 2BSBA 5EOCJ 1JGIA 1HHIA 5HYJE 1KCSL 1XGQB 2XY2A 1YEFL 3N40F 1OL0A 1AKPA 5DRNB 3S35L 1IE5A 5EN2B 1Q1PA 4JW3A 4IJ3B 4EN3A 1RZGB 3GXTA 4G8EB 4LCWB 2PXYC 1LO0L 4TSAL 4YSTA 4H26A 4QHLA 3MACL 1CF1A 3JTTB 3OSVA 2I5YH 3D3VA 1NAMA 3EFFA 4DN4L 3SBRA 5D1ZC 2ZSWA 5FB8A 1ASPA 1FZJA 1UVQB 5DQJA 3E38A 3BIKB 1JXJA 5CSBA 5F1KC 3LQMA 3F7LA 2F9BT 3SDAA 1I85C 2KQMA 3DTDA 3ILPA 2WB1A 4EBQH 1BEXA 1XF4A 1IGCH 3SO3C 1U8LB 3RVTC 1Z3GH 2OSYA 1G84A 3MRGA 4ZW3A 2WYIA 1UB5B 2FAUA 1Y18A 5F0JB 4PJCB 1LNUA 4N24A 5HVWA 4GKLA 4P23C 1T83C 2B3RA 2JQMA 3FHAA 3HAEA 2VZ1A 5CLXA 4DQAA 2WVUA 2ZAHA 2F54E 2LAAA 4Q7DA 1AANA 1I1YB 1VACB 4YQXH 5F88A 1H3WM 3ARFA 5TE4H 5E7BA 1G0YR 3PP3H 5DS2A 1CPUA 1F3JB 2EJ1A 2GSGB 1E9PA 1KBKA 3GMMA 4ZXBA 4OFYA 4YIQB 2FX7L 1XZ0B 5G4NA 5F7AA 5IK3B 4HF5L 5IP4A 3RKDC 3WNKA 4WY7L 1MAMH 1GCFA 3G08B 4GG6B 5ICYA 1IM3D 2HKFL 4PRAA 4XCCL 4JFFE 3T3MF 1L9NA 5JO5B 2DQFB 1PW3A 1EXGA 2V2WB 1NGQL 2ORBH 2CK2A 2D7NA 3KLDA 3QHZL 4O00A 4AGLA 5CIPH 1J18A 4B7LA 5CBEB 3OZ9H 3LDBB 1T2QL 5GISL 4JY5H 1F11A 2EEBA 5EORH 4FHJA 5EZIH 5FO8A 5KS9F 3MLZL 4OQ1A 3VXQA 1M57B 3LPOA 2CKBH 4HBQA 3AUWB 3QIBB 3U46A 3G5XA 1XQ4A 1AZBA 5JIDA 4P5SA 1E5ZA 1RKRA 5BV7H 2J3SA 3T4YB 2XV2A 3IU3A 1RFDL 1U41A 5ENWA 3HE7D 4DVBA 1DUZB 2HT2D 4JQIL 1IE4A 4P3DB 5F97E 4ZFOA 2UVEA 2BRRL 4Y1TA 3VWJC 3W9DA 4CVUA 2HZHA 4L3AA 4GFXA 1IGML 2HG5A 2ITFA 4ZTEA 3WU1A 2CXKA 5BS0E 3D3VE 4ONHA 1OB1A 2JKWA 5A3IC 4BYHA 5D6DC 3RX8A 3M7OA 3RVVC 3WTXA 3NCXA 4ZG1A 3ZDZE 3IJHA 1R6VA 3D3VD 2YPKA 1ZS8B 5JW4N 4NO5A 2DQUH 4X50A 1GJUA 3W5NA 1YC8A 2ZNWA 5FX3A 3OR6A 3F7PC 4UF7C 1TQUA 3I9AA 5LAXA 1UM6L 5FKAB 3E9TA 2HPTA 3MUY1 3UIZA 3P0YH 4B3EA 2YGQA 4Z3EA 2Z91A 5HYQB 3T2NL 1IMHC 1F2QA 2DBLH 4LQ1A 5I1AB 1TR7A 1G7LB 3CHQA 1X9RA 1QBMH 1DO5A 2CD0A 2VDQL 3MLYH 2QL1A 1CGVA 4DGIH 4E9RA 1EVTC 5D1XC 1YNKH 3ARQA 2P8PA 3D25B 1LO4L 2JVUA 2AXFA 2H5UA 5FC9A 4HWNA 5TFSL 5EC2B 1PY0A 2ADIA 1J88A 3CFEB 1WPCA 1DQDL 1DBAL 4H8WH 4BK8A 3QXUA 2KDGA 3DARA 1WFUA 3ZL2A 3VFVB 4I4WA 1WIUA 2ZPKL 4MHHG 1DVXA 1MDAA 1T2XA 4J4PC 1TFPA 4Y4FD 2GFBA 3GSRB 4JPIA 4GRMA 4JZOA 4XHQA 4ATTA 4N2NA 1B90A 1P6WA 3MJ7B 4PJBB 3SE9H 1UURA 3EXJA 2VUOA 4FQHA 1KZQA 5TDPB 1EH9A 2QADC 5IEHA 1HILA 3DROA 1HQRB 3RZCB 3DV4B 4N6RA 1YQVH 1EEYA 4GOSA 4YFDB 1PF3A 3RY6C 5E2WL 1GZHC 4WI9A 4GRWE 3CH1B 2Z31B 1DBJH 2LVEA 3P3UA 1YYMH 4QJ5B 3S4SA 2DI8A 3QORB 2ZCHL 3DVNA 3DWTA 3VDAA 2R23B 4LRIC 3EKCA 2NMSA 3LRKA 3GMMB 4ZXBB 1SYVB 3SDXA 1NQBA 4WVRA 4LRNL 5AZ2L 1IGJB 3HG1E 4EEEA 4YMPA 1SDDB 2UY7B 2XX0A 2EYTA 4OJEH 1WAAE 2IG2L 2LU5A 4WFFE 1XR8B 1RSYA 1SBSH 3IXAB 4N2LA 1F45A 3GIZH 2G4GA 2XWCA 4PJDA 2YR3A 5TJWK 1XF2A 1JMXA 2DYPA 2HP4A 4YZFF 4M3HA 4NJAH 3UO1L 5IR1A 3PGCA 1NFDF 4PBDA 4KUZL 2WMPA 5C70A 4ZW6A 1RU9H 3NCEB 5DUPL 4KKLD 4XZUB 4ZUWB 5AENA 4H8PA 4L8SC 3WFCH 1A65A 2W91A 4FCHA 4KK8D 4MJ4A 2G4EA 3C5JB 5I1LB 2WANA 3RUGE 3CDZA 4D0BB 4APXB 4Y2OA 1P0SE 4NN5C 4LPUA 3HHRB 4OTXL 4S1SH 2AQPA 2JKNA 2VC2L 3L4XA 3SDDD 4LIQE 2NY0C 4P57A 2Y7SA 3SDDB 5EOTB 3BUQA 4JLRA 1MOEA 1Y7VA 2MKLC 3MO1B 5MI0C 3OLIA 1A1OB 4A7GF 4XPGH 2A6JA 2V7NA 4XP5L 3B4NA 4QHMA 4KQ4H 2MQCA 3BDXA 1FZMB 1HXYA 5DD0H 4Y5YB 2WLYA 4BWTA 1K8IB 4XWGL 2ZD0A 2WZPA 1VGEH 4JJ5B 4QHNA 3HN3A 1BPVA 1WZKA 2FJFA 1K4DB 4ODVH 3P73A 4P23D 1PJWA 3BQUC 4TUOA 2PPEA 2CGRH 4G1EB 2XACC 3D48R 2MMXA 1W91A 1CVSC 4O2FB 3B83A 4C8XA 4CKQA 2YRZA 5D2LF 4PWKA 3X12A 4HZ1A 4BQ8A 1OK0A 4DP1X 4FABL 3Q43A 2WV3A 1QI4A 2VXQL 2Z91B 3GDCA 4F1SA 5HYQA 1T66C 2X6CA 4N2DA 3WTSA 4AL8L 4AEFA 5HSFA 3ARBC 2FYYA 3CVHL 5F7WC 1QWNA 1UD3A 5HJGA 1U8NA 1AGEB 1K85A 2HLAA 3BP5A 3TN0A 1W8OA 1TTAA 4QKTA 2F54B 4AKQA 1OOWA 4HK3N 1DANU 1PLCA 1CWVA 4LHQB 3K2MC 3KPPA 4DQOH 1QWHA 4PJGE 1T6VN 1HHHB 3SSGA 1QBLL 3HMWH 4CSTA 1UJTA 1YEJH 4DGVH 4AQ8C 2E47A 4IIQB 3K5SA 4LSSL 4MWFB 4JZJB 4WI4A 3WLBA 2DWEA 2WIIA 4NFBA 4EO5A 4TULH 1NWPA 3WTWA 4J3OF 2VGLM 2AFNA 3N0PB 2X2HA 3NAAH 1M71B 1TZGL 1KELH 4WGVB 1AJ7L 2TSAA 4QRRE 2HLFC 1AD0B 5DJ8A 5EUOE 2KL6A 4H8WC 2BVTA 1S9VA 1V7MH 5ANME 5C0EA 4AQOA 4ODSH 5HGDB 3V0WH 1CU4L 2IH9A 4F7TB 2EUZA 1RZKH 5BS0A 3FT4B 3TBYB 2DTMH 4ESKA 4WU7B 1DDTA 4OFPA 1H3GA 2JCCF 2ZICA 1EEZA 5EUOB 1ZLVK 4RH4A 1FNGB 1ZWIA 4NPJA 4WFGE 1S3KH 2ILLA 5C0DA 4WI2A 3MRJB 4KRPC 1P5UC 1A7NH 2IGLA 3V5DA 1B4JH 3UJIL 1TEGA 2YXVA 3RRQA 4XCFH 3UYRH 1W9XA 4W6YB 4FLSA 3EZJB 5IR1B 1KXQE 1NAML 1MNNA 3ZQXA 4Q2ZA 2HFFB 3CXDH 5T3ZE 5CXPA 4N2HA 1UYWH 3VH8B 5TDOB 1JZ5A 1H5BB 1HI6A 1EVUA 2G5BA 1KCVL 3IJ9A 1PZUB 2P47B 3N50A 2F8OA 3CUPB 5C2BL 2DYPB 3PWJA 1SXSA 3RBGA 1CZ8L 2V2XA 2XX1A 5F7EL 3QRBA 4AIZB 5DTFA 2ZP8A 1CLOL 4PBWD 5AEAA 1R3LB 2P44B 4YN3A 4ZUVA 2YPLD 4AJVA 2I5YL 2YC1B 3E1ZA 5DDHB 1PEZA 1QTYT 4FKKA 5I8OH 3S0PA 1AGDB 4JKNA 5IOKA 5SWQB 3DGDA 4OZGF 1C5DA 1I75A 1MPAL 2K1MA 4ZS6D 1OP5H 5GGSB 4CGUB 1PZAA 4N3TA 4GQ9L 1FLRH 1IT9L 4PVBA 3QG6B 5D7IF 2X1PA 1NKOA 1XCQA 4PJXE 4IRJA 3RWJB 1N6VA 4M1GL 4X5XB 3UBXB 3HTLX 1ZV9A 4FXKA 4LPVA 5HI4C 1OAZL 2HRPH 1T1XA 2Q7NA 4EDXA 1Z3GL 4FX5A 3DRTA 2ZXWB 4TXVB 1GRWA 3KGUA 2C1PB 4M7LH 1RK1A 1PIGA 2OFQA 1CF8H 4GMTH 4FA8A 4MMZC 4AWJC 5I19L 4V33A 5DLML 4JDZA 3J8F7 4IDJH 2MNJB 2ZXEB 4X4YA 4HZLA 4TLSA 4Q52A 4GQ9H 4P99A 5GGRB 4E9SA 4GAGH 4JPWH 1PZ2A 2EZ0C 2GI0A 1VRSA 4PGBB 1A6ZA 1SMDA 4GAYB 4UQEA 1QFHA 4X8JB 5C92A 2C3GA 2WXRA 4PTTA 1G9NH 4FTVB 1FH2A 4LQFL 2F68X 1QO3A 1VZIA 4RESB 2W8CA 3WJMA 1FYTD 1UM4L 5HHOE 1Z5HA 3NJIA 3PFQA 4NO0B 1P4UA 3I6GB 4JFHD 4EXPX 3EGSA 4JO3L 5FYKH 3PG2A 3CLWA 1EJ8A 4UQ9A 2DRUA 4BSWA 4PRNB 1ZVYA 2ZXCA 3F5WA 3T0ED 1A4CA 5TQ0L 3CXFA 3DHUA 5LNGA 5HXMA 1M6UA 5B1CA 1BV8A 1RJYB 3L17A 4ZOEA 3N1PC 3IT8D 2HRLA 2H32H 1JGDB 1CQKA 2AJVL 4JFYB 4K94H 1TQBB 3O2DA 4NRXA 4XE5B 1GS6X 4NNXA 4C4BA 1I1CA 1NCOA 5FW8A 1IM3A 5JIMA 5I76B 4P57B 1R4XA 5KBDA 1A2YB 2PYEA 4OCWL 4M7ZB 4ZQKA 2UWEF 4GRWB 2CIKB 4K3HA 3DTXA 3R06B 5BUGA 3WFHA 4QUOA 3MCKB 5EDXA 3MODL 3JV5A 1R34A 1GZQA 3NA9L 3ZT5A 3KYKL 1KXHA 4ALAC 1GIGL 2QTVA 4TVPD 3QQNA 4FNRA 5SV3A 5JOFA 1KXTA 2V9RA 1GC1C 4P9HH 5EIVA 4GLRH 3SDYL 1LDPH 3B56A 2BIHA 1T22A 1KB3A 2WOBA 1E65A 1U3HB 2A9BA 3VD9A 3CVHA 3VDCA 2FT8A 1A7PL 1IQWL 4N8PA 4ZTPL 5DZAA 3S4SG 3BZEB 4XO4A 5FGBC 4DN3H 5HD8C 1AYRA 3W39B 4HWBL 3NIFE 1Q90A 4HBCH 2JB6A 4IM8A 1OPGL 1KTDA 1X5IA 4Z7UF 4BUHA 4Z7NE 2HFFA 3TPUB 1JNNL 2VITB 3QDMA 2BOLA 5DC9B 4HIIB 2PKDA 3ARSA 3D69A 5AKTA 3S97C 4LSQH 5I73C 1A0QL 1R46A 4ZFZA 1L7TH 5F71A 2DWYA 1M7XA 2DLIA 4PJHF 5AVRB 4C4UA 4G6MH 4ELDA 2V17L 4QCIB 3RYMA 3JWNC 2PCFA 1O7DE 4BZ2H 2OR7A 5JHDA 3L3GA 1D9KA 4YEEA 4HBCL 1R3IH 4OJFL 5DURB 3NK3A 2N1TE 3TT1L 2VISB 4HG4J 2FO4B 5HDRA 1RK0B 1OZTG 3QE5A 1YMMD 2YRLA 2AC0A 3U0WH 3KPRD 5BO1L 5TK4A 3K91A 3MHZA 2HWZH 1P4LA 2IJ0C 4FQXC 3FXIC 4WCYH 1ZXKA 3O3DB 5KTEH 2F19H 3ARRA 3BKCH 3QI9A 5ESAA 4GY4A 5I75B 3UZQB 2CO6B 4YL4A 2PR4L 1J9RA 1XSKA 5FOJA 2H8PA 1T1ZB 4PJAF 5E1AB 2Z7WA 3CFUA 2QPEB 5LNEA 3X17A 4APQD 3OKEA 4GAFB 1E8YA 3DMMA 2ATKB 3A4EA 3BHBB 3IMRA 3RWEB 1CD1A 4Y19B 4R0LC 4TSBL 5EU3B 1NCGA 3OJ2C 3FNKA 4J8RB 1U8HB 4KMTL 1HINH 4EQ2A 4MCZA 1M7DB 5FECA 4KRNA 4K7FB 4TF4A 1QLFB 1AGEA 4LSPH 4DZ8B 2CU9A 1XAUA 3FQ2A 5FR3A 3HHSB 4HJTA 1WTLA 2A6DB 4Y88A 3WV0A 2HVKB 3VW3L 2OL3A 3ARBD 1KIQB 4OIIH 3ET9F 1AR1D 3NH7L 4K3GA 3WKML 1KC5L 2YD6A 2G5BB 3K4AA 4KX7A 4OD1L 1JK9A 3JWOC 1I1FA 2YXMA 4Y8DC 2O72A 5DZLA 2EE0A 3AY4C 3UO8B 4YXKL 2DQIL 4KKRA 5D2NA 2OXHB 4P2OB 3BAEL 3ZSTA 3LN4A 1HNYA 4MNGE 1JG9A 4XPAH 3BRFA 2E9GA 3GMLB 3PABB 2IIJA 4M5TA 1SJHA 2X9WA 2AI0L 1HOCB 1U3NA 4XNYH 3NSCA 1FO0B 4JDZB 3KYOA 1F4XH 2QPUA 4N2KA 2GIXA 4FQ1H 4NNPL 3KLQA 4P9ML 1ULVA 2FQFA 2Z4TA 2ZOOA 1NGPL 2J55A 3GHEL 3JWDL 2GY5A 3P30H 2ODIA 1FSKB 5FYLE 2NNXA 3O9WB 3VI3F 1WUZA 2NZ1A 3Q5OA 1ONQA 2YFNA 5T5NG 4I1PA 1B9ZA 5MEQA 4DSYA 1S7SB 3DBSA 3UEQA 2AZUA 3UZVA 4Y4KB 3K6DA 2ZKWA 2AABL 2A9MH 3JWNE 5DD3L 2BJMH 3SGJA 2WO3B 4ODUB 5EO0B 4KNQA 5E5UB 3BLBA 3L81A 4HOMA 4O2CA 3L3JB 4R3SA 1JZEA 3IPFA 4CMMB 3OHXC 5I71B 1OW0C 1DDHB 1PG7H 1Z1WA 4PGEA 1I9RH 4C56D 4IS6B 1G6VK 3K80A 2YA1A 2GTZA 2XWBA 3NZSA 3QCUL 5LN4A 3ZO0A 5C07B 8CGTA 2RCSH 3NEXA 3CFMA 3WG7B 1PD0A 3V0FA 1O6TA 3QO0B 3QPKA 1TPXB 3GIVB 1E4KA 5CMAA 5BRQA 2VZSA 3KPPB 2G60L 1FO0H 3FUEA 2NNAB 3MCLL 5GGQL 4XMTA 5IVXB 1DHKA 2J1XA 2XPGA 3FBQA 4POZD 1E4XI 4P46D 3ZIYA 2G3NA 5GSVB 1I8MA 5FLUA 4AOFA 1B3IA 3RGVC 4EAEA 2YD2A 2AW2A 4JPVH 2WYHA 1AO7E 3VFTA 4FFZL 3U6XS 3CFDB 1KB5L 4S1QH 4K23H 1WV7T 3MLWH 1HXMA 1AQMA 5F7HA 2KKQA 4U6XA 4PJ7B 1C5CH 3DGCR 2YUWA 3W56A 5FFOA 2P5ED 2C1OA 5CN3A 3LQAC 4XMZA 2WBXA 4NUQA 2VRKA 1EA9C 1YAIA 2H41A 3E8UH 4BZ1A 2BVUA 4B9GA 2BVOA 4GO9A 3KAAA 1J8SA 4IEFB 2QQQA 4M4RA 1R3HB 3VYOA 3VQ1C 1H6UA 1T3FA 3A23A 3G9VA 3VWKA 3TWCH 3ZMRA 4AENA 3VWKC 1JHTB 1KEML 4DOHB 2Q9OA 3PDOB 2Q76B 3V6ZA 3EOTL 3ARDA 5K9QG 3I84A 2JH2A 1O6SA 3B5GA 3JSSA 3MLVL 4JFZL 4NZUL 4I8DA 3RTQA 1FZMA 4EIZC 3ILEA 2F5BL 1S7QA 1KV7A 5CCHE 1KIRB 3FF7A 6FABH 4RMSA 4FNTA 5EUKB 4NPYA 5HHQA 4QHUA 4MJHA 5T33L 5DRZA 3QQ3A 3Q6GH 3DUUA 1AE6H 1N2RA 4CC1A 5FDWA 5JZ7C 4N90D 3ZPDA 1FJ1A 1I7RB 5IW6A 4QCIA 1Z5YD 3LRGA 1DSYA 4RGOH 3W1ZA 1X4ZA 3GUTA 2CCVA 2IPUK 3MGTA 4J3SA 5JOPD 5BOZG 2OPCA 5BS0D 2Z65C 3JYCA 5JDSB 1OF2B 5JR1H 1VEMA 5BUAA 2AEPH 2ZJSL 1U6AH 1JV2B 1H3PH 3JZ7A 3LXUX 4W4NA 2FB4L 4MAUL 4LLMA 2UV3A 1VAHA 2PO6C 4KDWA 5FK9B 2SODB 2Q3AA 2F8VA 1PFOA 3U4BH 4NP4H 3O41B 3SE4A 1CZ8H 2H47C 3HPLA 4L37A 1HYRC 2MFNA 4OFDA 2V9TA 1TQBC 1MHEB 4UAOC 4OGZA 5D6CA 3BWZA 4FE9A 3QRGH 4K5LA 4KZCA 1FNLA 2WQXA 5AG9A 2Y5TB 1PL3A 1W0WB 3E6HB 5D7HA 3QJFB 1J8HE 3SE6A 4IRSD 4YWGH 3FCTA 1QLEH 3AY4A 4QMEA 3B2VL 3HEIB 5AYUL 3OKNA 3O3BB 4YBLB 3QORA 5E08L 1I3GL 3ILQC 4JK0D 2KERA 1RPKA 1HCVA 4U1MB 3HN8A 3V4VH 2CNYA 2GQHA 4U1LA 5DYFA 3FAXA 5DHVB 2FBJL 2E27H 2CDEA 4O4YL 1FL6A 4WU7A 5F2FA 1E67A 5FYJE 3ZVVA 5EIIA 1HEZA 4NZFA 1L6XA 1D5MA 2OULB 4LSRL 3D07A 2GAZA 5GGVH 5EBLA 3SPVB 3FO9B 5I1DB 5FO8B 3OKLB 3MXWL 1ZE3C 1F6FB 2E86A 1MVFA 2J56A 2WP3O 4H1LB 4FRWA 3DIDA 1EFQA 1V3JA 5IGXL 3KWUA 2K7QA 2MPAH 3VDBA 1U8CA 3WN5B 3MROA 3IS0X 4P2OA 5L9DL 4JR9H 1F4HA 5HI4D 3CC5B 5JUEH 4U0QB 4TTDC 5TD4A 4PRDB 2OCFD 3O3EB 3PGFH 3S35X 4HV8A 1ETA1 2CA3A 3HMXL 4WHTB 4L29A 1E7VA 3HFFA 3JVGA 3MUUA 4YPJA 1TZOA 1MIEH 1RIVL 2VERN 4JE0A 3W0WB 4E41B 4M6ML 1QUNB 4I48B 5J1AA 3UTZB 1MCFA 2KZBA 3KPNB 1HZHH 2NXYC 3P02A 4ICWA 2L0DA 3EYOA 5EO1A 5FYJH 3WGUB 5C0CA 3QFDA 4KXAA 4HW6A 1D9KC 3UG3A 1FYTA 4PJCA 2IF7A 3P9MA 2Z7YA 3FH7A 5D7IE 3U4AA 1ZHBA 3QJXA 5JORA 3CWGA 4IGBD 4TSCL 4JQIA 1N5AB 3L1GA 1OWRM 2ZX6A 2LGNA 3RWIB 4TUOB 2IAMB 1X5YA 1DJXA 5CINL 4X5XA 3GS4A 3TBCA 3KLHC 3FSOA 4FQXA 4O2FA 5C07A 3FO1B 4NO3A 2A0LC 3EO9L 2Q86A 1BLNA 3MRQA 4PS8A 4P07A 3P0YL 4DK5A 1AXIB 1BBJA 1UEYA 3LDBC 4KJPC 1KIRA 2OX5A 5E6IA 3C6EA 3NSYA 2CJTA 5SWZA 3EDDA 3WUWB 5EBGA 5DEJA 3IJEB 4OLXL 4YGVB 5F8RC 4DPBX 5KBPA 1AP2B 1GS8A 3G6AA 3LRSB 3LHPH 4NQXB 1CLYL 2CG9X 3Q1SH 3DSFH 4XNQA 3WEAA 5EEYA 3GTVA 4LO9A 1FA4A 3I6KA 4KHTL 5HY9B 1LO4H 4OBSA 3MBEB 4H7VA 2ZX5A 4P2QA 4I88A 1QP1A 2R2HA 1Q9OB 4LCIH 4I0PC 4V1DB 1BAWA 5A2LH 2UZYB 4X7TA 4GSRA 2MQGA 4R26L 1LQBC 1OVZA 1RJLA 5EU6A 3ZDXF 1ZEAH 2R0KH 2VDQH 5D5MA 4RZCB 5FGBA 1SJXA 1CLYH 2YD0A 5HI3D 5LN8A 5IB1A 1LMIA 3PJSB 1K4CA 5AB2A 2VQ1A 3HC4H 4KTEH 3H4HA 3V4VA 1X5KA 1OQOA 5IHBA 1AMYA 5E95B 4W9ZA 1XF5B 1TCRA 1OLLA 2OJZL 2YD1A 3VX0A 4Q0XL 3WKMH 1ZS2A 3RDTD 1I1YA 4FI8A 2UY7A 4X98A 5E51A 1FBIH 3F65A 2VLLA 1G6RH 2WWKT 2XTJD 2FX9L 2BNRD 5D1ZD 2JE8A 5D8JL 1JRHI 1P7KB 3UBXI 3O6KH 1PYWA 4ODSL 2V2TA 3L3JA 4OCYH 4W9FC 4MSWA 5FAAA 2O5YL 1JYXA 2GEQA 4F5CA 4FF9A 1CBJA 2PXYD 5ELIA 1L0PA 25C8H 4GXUN 4NDMA 1MWAB 4KHXH 1Z2KA 3ME0A 3K0WA 4TVUA 3QIBC 2IWKA 2BY3A 2BIQA 3IDGA 3S3JA 2DJ4A 3L95A 3OXSB 3KPRA 5JNYA 3AC0A 3FFDB 5IFHH 4IBUA 1KENL 2FUQA 5G2NA 5LBSL 1J5HA 3SBWC 3UO1H 1HZKA 4XBGA 4XAKE 1HS6A 2GT9A 4FLQA 1DJSA 1GYCA 1KEGH 3B5TA 3QH3A 4GAJL 3T08A 4DP7X 5I5RA 5LKNA 4JRWA 4FDWA 4N8VB 5BRZA 2AABH 3L5HA 1OCCB 2YLHA 4ELKA 5KJRH 1UYWL 2QPFA 3NH7H 4ZUSA 3DBXA 3HB3D 5C1MB 2XQBH 2YK1L 5FEBA 4YHKL 2R0ZL 3LN4B 3CCHA 1G87A 2VR4A 3CJJA 1G7PA 3IETA 3Q48A 4FC3E 2UWEA 4MJIB 3TV8A 2E9WA 5B1JC 4BUQA 3IE4A 5A7EA 2HKHL 4JG1H 2A74B 1XIWB 4JFOB 3UTZA 1KEGL 2OJEA 3L2LA 3N42B 4HUUB 2WLLB 4MCYA 3SCMC 5AW5B 4UDUB 5CSGA 5CEYB 1I1RA 3RL1B 3VCLB 1NMAH 3H55A 4NZ8A 3TNMB 5JXAH 1I9EA 4PJIF 2OYKA 5A2AA 3HVNA 2ZYSA 2XC8A 2FCBA 3RHWK 2AQ2A 5HVHB 4HJIA 4G82A 3U1SL 2QHLA 4IRJC 3K81A 5F7DB 4Y9CA 4AH2B 3DK0A 2JK5B 2O5NA 2AJZA 4XNUL 3D0AA 5GGVL 3NABH 3C9NA 4NQDB 4DKDC 4XP5H 3KPRB 1U8QA 2DQHH 3QXTA 2VDOB 1JGVH 2H45A 1NSNH 4J4PD 5EBLB 1Z9SB 3SPVA 2BNQD 5EFIB 3WAJA 2K6YA 5GRJH 4DW2L 4OGQC 1DSFL 4NT6B 3RI5F 1EZVY 1SBBA 2ZWYA 3VQLA 4J3VA 3GYRA 3NJMA 3HJ0A 4Y16A 4ZPTA 2BX5A 2VDOL 4KJYB 2QADD 1CICB 4DEUA 2QADB 1CFVH 8FABA 3E3QC 2OMVB 4FG0A 4ZX3A 3C08H 3REWB 1KXVC 1ET8A 1XT5A 2DKSA 1YEEL 3S3CB 5DJZB 3SE3A 1U58B 1NGWA 5I16A 1P7QA 2PP8A 4JX0A 4XBPA 3HBPA 4OZGA 4F91B 1A9BB 5BZDA 4FFWD 5HJ3B 2X6UA 3GRW