4B9CA

Biomass sensoring modules from putative rsgi-like proteins of clostridium thermocellum resemble family 3 carbohydrate-binding module of cellulosome
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GSHMGLKIQYYSRKPHDSAGIDFSFRMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANKYLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLVWGIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE 3A CELLULOSE-BINDING DOMAIN PROTEIN
publication title Fine-Structural Variance of Family 3 Carbohydrate-Binding Modules as Extracellular Biomass-Sensing Components of Clostridium Thermocellum Anti-Sigma(I) Factors.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Carbohydrate-binding protein
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9cA00
4TF4A 4B9CA 3ZU8A 2XBTA 4B9PA 1K72A 2WOBA 1G87A 1NBCA 2WNXA 1KFGA 2XFGB 1TF4A 4B9FA 1G43A 2YLKA 1JS4A 4B96A 3ZQWA 3TF4A 3ZQXA 2WO4A 3ZUCA 1GA2A 4C8XA 2L8AA 4B97A 4JO5A
chains in the Genus database with same CATH superfamily
4WNQA 1MJUH 4HXAL 4YFEA 3SCMA 2HLFC 4NC1C 2ZUQB 4B3VA 3MJGX 3PP4L 4YNYA 5GRYA 1F6AB 3GJFA 1R3KA 3VFWB 4DK6A 4DGIH 4KK6C 3FU7A 5K69A 2NR6A 5HGHA 5MENB 5C6PB 2Z1PA 4IDJH 4P2CG 3FSWA 4FCHA 5IW1B 1BDYA 1F11B 3L3KA 4R2GB 1QWHA 1XF3A 1M1XB 2WSKA 4Q2ZB 1PZUB 2FWLB 4M6OH 5I71B 4XE0A 4K3JL 4TN9A 5K39B 3NCYP 3QHFL 4HG4K 1J0YA 3VWJB 3WXWH 2XU9A 4Q0XH 3WNOA 3ELQA 1MF2H 4ZZFA 2ZPKL 5C3TA 2B0SH 1XCXA 5L88H 5DFVC 4JFUA 3MREA 2DEYX 3SDYL 3NFNB 4WFFD 4LLAA 2YK1H 1YMHB 1GAFL 4K5NA 3OZ9L 2XFXB 4FQCL 1ZTXL 4I4WA 4HPHA 2VLRD 2VXVH 1RIUL 2Z0BA 5H94A 1TMCB 1JFQL 1OT1A 3L7FA 4CU8A 5LGKA 1FA4A 3CSPA 3CGTA 1DVFC 4K5MA 4I2XB 2UZIH 1AGDB 5BO1H 2R0WL 3UTSE 1KIRA 1N70A 2A4ZA 3WKNA 2IV8A 4QRPB 2K8QA 2QSVA 4LLDB 3WXVH 4YSSA 4JO5A 1A3LL 4KY2A 1Z9MA 1QYGL 1S7TB 4XWOD 5AB0A 5HYSB 1A4AA 4EVNB 4AI7A 5KSUB 5KOMC 1OARL 3EYQC 3RHWK 3V52H 1BBJB 2JKWA 4LMQI 2CGRH 3EHBB 3HAEH 2XZAL 4JZJB 3JZYA 3KEHA 5JXEC 1F3DH 1A9VA 3PRZA 3IGKA 3RB5A 2P7TA 2WXRA 4WK2B 4ECNA 2DWDA 4PRNA 3DARA 4K2UH 3U7WH 3DJRA 1F4WH 2WYZA 3ZDZE 2GBAA 5GGSY 1XHHA 2PNDA 2LAGB 4PWGA 1IB5A 4ORGA 3TV8A 4WV1B 2F7QA 3PIQB 1JNJA 4R7XA 2Z8SA 1I9JL 3GXNA 4W9CC 4OW6A 5EPMA 4AJVA 4LPVA 4K8RH 1EHAA 2VLRA 4PIRF 1BFVL 2AMGA 4IKJA 5D7SH 3NEXA 3CX5K 4OKVB 3TBCA 1JE6A 2CHWA 2X2JA 4DQOL 3FCBA 4NZFA 1SXBA 3X3FL 2YO3A 3IN2A 3ZRSA 3MJ6A 4KQ0A 2DQGH 2EIBA 4MA8L 1LO5B 1RJLB 4W4NA 1GYCA 3K4DA 1DSFH 2Y4SA 4PBWD 3QYMA 2P8MA 1DYZA 4O02B 1L9MA 4P23B 1P84J 2BSBA 4WY7L 4ZDHA 3K71A 3F62A 3I3BA 2DQCL 4UUJB 3ZN6A 4AVKA 4JFWA 3RY6C 3T6WA 3WI9A 4L9DA 2AITA 1AE6L 2JKJA 3BPOC 4FE9A 5DUMH 1SJMA 2H32B 4Z6AT 4N6RA 4I0KA 5F1NB 3S36L 3NJIA 1JHKH 2G2PA 1YZZA 4ZO8A 2XN9D 2YAPA 3MGTB 2L3BA 2J2ZB 3V6ZA 2UWEE 7TAAA 4XPAL 1KZQA 3ILQC 2IJ0C 1NANI 4QHKI 4UMSA 2QQLH 4F8NA 4M48H 2Y7MA 3CMOL 4LPXA 4TVPD 1FAKT 4IM8A 5CGBA 6PCYA 1NFAA 4HG4J 1MJ7H 4KQ3H 2WGNB 1PLAA 2ZICA 3PXHA 3SE6A 3TOPA 1PU0A 4TNVF 3UJJL 2W94A 5EO9A 2MOQA 2DOCA 2VLMD 3SCMC 3VXNB 1KCVH 1KENH 3NA9H 4Y16D 3T0EB 5HHXH 3L4WA 2XPGA 4NGHH 5FYLL 5EF3A 1USZA 3BVNB 4UV7H 2CMRL 1GKEA 3ARPA 5GGRB 1JV5A 2P1YA 3KS0J 2NR6C 1FNSL 3GSUB 2CIKA 3MCG1 3PWNB 4XH2B 2XXGA 5KVFE 2J20A 1E8XA 1C5CH 3VD4A 2PETA 4ZAKB 1NCBH 1Z5LB 5I1IH 5FHBL 4FNLL 2HT2C 5CJOH 1VB9A 1XGRB 2FB4H 1WBYA 3NYKA 2IAMD 1CFQA 3WNMA 1ZD6A 3WFHA 3AXLB 2OR9L 1CXKA 1XEDA 4XNQB 4F91B 5IBLD 1IGTA 2JJSA 1J11A 5GRZA 3MGOA 4E42B 4FJ6A 4ONOA 3IFNL 3FO0L 1VEMA 1DLFL 3NSYA 3TH3T 3SOBL 3ZDZF 4PJXB 3IVKB 5KBMA 1MVYA 2XN9A 1KN4H 2C3XA 2AXGB 3ZL4L 2EYRB 3QH3B 3MFGB 2Q8BH 3QJUB 1HINL 5GXBB 4PJIE 2GCYB 4ENZA 1EAPA 5JMOC 3HR5B 3T6ZA 1E2WA 3DDGA 3PWUA 1NMCB 3HCVA 2FEDD 3CHOA 4HQQL 1U58A 4Y16A 2EO9A 4NP9A 4FMVA 1CE1H 1WJ3A 1NA8A 5BJTB 2YQ3A 3SKMB 4ZK8A 3NUKA 4XO4A 4OT1L 5E1AB 4NUMA 5KYUA 1A6VH 1VFBA 2PYEB 3LD8C 3V4PH 5JLZA 3L3HB 4D9LL 5IB5A 2C4FU 4NN7C 1HH6B 2A77L 3C5SB 3CFTA 1PG7W 3CX5J 1RZJL 1FG9C 3L1OH 5FLVA 2QADD 1YA5A 4HU2A 3KGRA 3DX2A 5I73B 3MMEA 2NT0A 4F7KA 1DVQA 3MRGB 4PLKD 3BKCH 5C0EB 1IRAY 2R23A 1OAQL 3UYRH 1PJWA 5DHVA 1SLWA 4GUQA 1K2DB 1QEWB 1A7PL 3LS4L 2XQBL 3Q43A 4J3OF 5A7EA 3FU9A 2A6KB 2DQJH 5D4QA 3O3AA 1FPTH 5KVEH 5M95B 1FO0B 2QV4A 2UWEF 1CQYA 3OKOB 3QEQB 1KGXA 5JHBA 4S0HA 5DXWA 1UB6A 3RU8H 3GT6A 4ELKA 5HDOA 2YD3A 5AALA 4IS6B 3NCJL 3V8CA 3D85D 4PJ9D 1PFCA 4PD4J 3QUMA 4WFEE 4P8QA 4IRZA 3BKMH 1CVSC 4XWOC 3VI3A 1H5BB 4YDMA 4GRLB 5I8OH 3FRUB 3CN4A 5MHSE 5FB8B 2LE9A 2GAZA 3BZ4A 1Z66A 4PSRA 2VUKA 5GS2D 3T2OA 2IF7A 1MCKA 4A7GF 2AV1A 3MROB 4XX5A 3T3PE 1JD9A 4WU7B 4NQCB 3PHOA 2E9IA 1G7IA 1KTLA 1S7XA 3AACA 3B34A 3NCMA 5F6IB 1P2CB 3U7AA 4APXB 4CVXA 3Q8BA 4EIBA 2ADFL 3N50A 5EUKB 2VDMB 1BXUA 1A1OB 2XBTA 5TE6L 4BFKA 1GL4B 5KUKA 3MYJA 2WOYA 4UM9A 1J5OL 1HNFA 4U2YA 1D5BA 1LO2H 4K55A 3C08H 1BIIB 3KBEA 4YDKL 1FNEA 1QTPA 3CPUA 5G4MA 5A2AA 1FE8H 4H8WC 1JN6A 2GITA 1C5BH 5DHEA 3OAUL 4HV8B 3REVB 1W0WB 3TT1H 4A66A 3T4YB 1MFEL 1BQUA 3M1BA 4UU9B 4PJIF 4XN2A 1ROWA 1ZIAA 1WGOA 4BXSV 4QJ5B 1YEKL 4F7EB 1SXCA 3PFUA 3DGDA 2XWJA 2X44D 4F80A 1XCQB 3CFBA 3RBGA 1MJ8H 1VENA 3EJPA 5D1QD 3W0WB 1JK8B 3BH4A 1TZGH 2ZX5A 4Z3GA 5EBMB 3BQUD 4LIQL 5CZVH 5KBKA 1MLCB 4FGMA 4X4XA 4FAAB 1DVTA 3PS6A 1BZEA 2JKSA 2HKHL 3ARED 1O5DT 3LRKA 1VEOA 2JJSC 3MNWA 2GK0A 4JFHD 5FAAA 3G6JE 2J56A 2WLHA 3MJ7B 4WI9A 5CSZA 1FGNH 5A2JH 4E9LA 3HLAA 3N9GL 3VD7A 5JIIA 4GSQA 1MFNA 2O30A 2WQAA 4YBHA 2AAVA 1DUYB 1QRNB 1UEMA 1I7TB 5GISL 3JV6B 5J0BA 2WNGA 3K1DA 2OR8A 2APXA 5SX4I 3ZX1A 4UT7L 3KPSB 2HLAA 1D5RA 4EI6A 1CCZA 4FFZH 2NNAB 1XGPB 3HUJA 4JDVA 1IU1A 5C7XH 2AANA 2BSSA 3W11C 4WGWB 4P48A 1DQMH 4ODSH 1R3IH 1RK7A 4DKFL 2Z35A 5EC2A 5F89A 1BVLA 3AC0A 4FFVD 3C09B 4NAJA 5D1QA 2QL1A 4ZUUB 3SQOH 5BV7B 3BQUA 5IM7B 4GOSA 2F08A 4JQXA 5DJ2A 4JPKL 4ZD3H 3ESMA 4J7RA 3QXTA 4H25B 3AREA 4XCEB 1KPRB 1TETL 2A6DA 4JUSA 4PV8B 5IBLC 5IKCB 4AK2A 1R3HA 4G7YH 3IBEA 1ZJAA 5DEGA 2JNZA 3LB6C 5GGVL 3V4VL 2FD6L 4HZLA 1S7VA 4WIQA 4I3SH 4XI5C 1JF1A 4KTDH 3MTRA 3C8KB 4W9EC 2BMKA 4WHYH 3QZLA 1GW6A 3H0TA 2IADB 1WTGT 4P49A 2V8MA 1N67A 3J2PA 5A2KH 3NSXA 4YQXL 3HRPA 1S7SA 2LLGA 3CTTA 2PWEA 2DQEL 1F6FB 5FK9A 1PSKH 2Y22A 3QW9A 5C0AE 1UH4A 3J07A 3SE9L 3CVHL 3I6LE 4J3WA 5T3XE 2Z7UA 3QORD 2ALWA 3FT3B 4MA7L 3BVUA 4PLKC 4N2OA 4OCWL 3S37L 2VH5H 4FNUA 3IF1A 1WPCA 2CJUL 3L3JA 3WFEH 5TFSH 1EJ6A 2X4RB 2V37A 4PJFE 2NQDA 1H3UA 4Z7UB 2VO8A 3C2AH 5PAZA 3G6JF 1PGRB 3ULUD 1HKLH 1YDPA 1DQQA 4Z7VE 3MV9B 3ARVA 5ENWB 1YO4A 4XMPL 1TZHB 1TZIA 1T0NA 1FCCA 4PWHA 1RHHB 1TQBB 1YCSA 3LPOA 2VLKB 4FL4C 2G4EA 2GHZA 4OUUA 3GSQA 1MHPH 3B43A 5A6MA 4MA1C 4MXQD 4WFHE 5DJAA 3ESVF 3WNPA 4JPVL 4HWUA 1L9QA 3IWUA 1QI4A 5F97E 5KSAD 1NEZG 4XP4L 2GSMB 3ATAA 3CLFH 2VN6A 2AEOA 3V0EA 4NPJA 4NRXA 1R5VA 2VDKL 4V33A 3QCTH 5I1JH 3SE8H 2WUCH 3KCWA 3I9GH 3DHMA 2F1BA 3FSVA 3QEGH 4AQ1A 3QORA 1UB5B 3V0VA 2J5WA 5I1DB 5ALBH 4DK5A 4W9HC 4PCSA 1YEHH 4HIJB 3BEVA 5B3JF 1XB3A 4OU3A 4GUOA 1CXIA 3HG1B 1YEIH 4X5XA 2HJKB 4WFGE 1HWWA 4JDZB 4LNRB 3SBRA 2BNRD 2BM3A 4J39A 2A9NL 4NZUL 1HEZA 3WY2A 4M6ML 3G9AB 1DEEA 5MEOB 4XMKH 2FT7A 3RP1A 3A4AA 1MW3A 2NY7H 5DUBA 5ABAA 1OOWA 1JCVA 3EDFA 4JG0L 2VQUA 4DKDC 5JO5A 5LHDA 2H41A 2CNZA 2W1NA 3OD3A 5DYOA 4GYBA 5I17A 5C6TL 3ZVVA 5KSAA 2AF2A 1ZVSB 4AMKH 4MASA 2OJZL 2D3VA 5A2FA 2KS0A 1P4UA 2P52A 5ICXA 1QR4A 1VCAA 2OYLA 4BUQA 3T3PB 3GD1C 4V1DD 5D1QC 4G6FB 5FKAB 3W57A 2QSTA 3BQUC 4W6YB 4ZX4A 3TBWB 1IGMH 2M26A 4JQXC 4YHZH 1IUZA 2YAQA 4YVNA 4U0RB 4BXVA 5C0FA 3W5MA 1NC4D 2COVD 2AJXL 3F7VA 4MRCA 3AREC 2CLRB 1C1EL 3A6OA 2W80C 4L3EB 1JUFB 1U6AL 2FIKA 5D2NB 5F21B 3KR3H 4QHMB 4J3VA 1IM3B 1BOYA 3MKKA 5C0ND 4MB4A 4NO5A 4PJFF 2H6OA 2BNRA 1SF3A 2AQ2A 4FX5A 4HKBB 1U8HA 3GQFA 4Z7VF 5AKVA 4R26H 3TFKD 4PJGA 1S46A 3OAZK 4YL4A 1W72B 4RAHA 4HKXB 3QQ4B 2WAHA 2WTRB 2AV7B 3CDCA 1I1AD 2F5BL 2W0PA 4HMCA 1JNNH 3FO9B 3QUYB 4TNVK 4EN3D 1G43A 2WCSA 4DZBB 1UVQB 1KY7A 4XN5A 5JOEA 5L2JA 4KDTC 2GBTA 4GEIA 2PTUA 3ATFA 3GRBA 1I8IB 2QJDA 4WKZB 1BYOA 4UNTA 4LL9A 4FFVC 4V1DA 4EKJA 5KG9B 4TTGA 3RAJH 5J8OA 3ZSSA 1FYTE 1ONQA 4U1MA 3A23A 2IAAC 2OPCA 3QFJE 4NQXA 5KS9F 1NC4A 1KNOA 2G5BB 2X6MA 1QA9A 1PG7X 2AK1L 4P46B 4M1GH 1E9OB 1Y0LB 4M6AA 5D2LA 4K0OA 4M8VA 1TF4A 1TZ8A 3FUNA 4YDJB 5L8JB 3FAWA 4KVCL 1WFOA 5EBGA 4ZS6D 5GJSL 2DW5A 3A67H 4EXPX 2WBKA 5KBLA 2FSDA 4AWJC 2VMJA 3MBWA 4JZOB 4I7ZC 1KF9B 3H55A 4TQHA 1OIOA 3NCXA 1QNZH 1RZ8A 5HGAA 2VDOB 4FNRA 2VXQH 5EO1B 1JI1A 3D6GA 5JA9A 3ZIMA 3PP4H 1G9MH 4U05A 5FUCC 1I1AA 4WJKB 4PJ7F 4EN3A 4A6YH 2QZ5A 3EH5B 1C8QA 1JXKA 3H42H 3BSHA 3O11B 4FLHA 2WWKO 4IGBD 4HC1L 3GLDA 3V4PA 4OGYL 2JELH 1WCBA 2ICES 2NCMA 5E1QA 5D7LB 4LRIA 1O6SB 1NIAA 2AJUL 2E6PA 4AQ1C 3QORC 1E27B 2AI0L 4PJBA 1IJ9A 2GJZB 5IOPA 3E9TA 4ODUA 4WHDA 3CVBA 3D18B 2DI7A 3KGSA 2N1TE 2AVFA 1FH5L 1TEGA 2WMPA 4QRSA 2APSA 3I75B 4JG1H 2HAZA 4AZ8A 4P4KB 1T83A 1GAFH 4LDOB 4NKMA 1ZTXH 5IEHB 3U9UB 4GMTL 2QELA 1IBZA 1RUQL 1RIUH 3ATDA 5FOJA 4QTHA 3ULUC 4QI3A 5D5MB 4K8RC 4N2LA 2LT9A 5FFLA 3AS0A 1KYFA 1LMIA 2B15A 2R0WH 4XX1G 4H0GA 5EEYA 1IIIA 4MCZA 2DQMA 4HALA 4KTEH 5GGQH 5IBUG 3FOLA 1QYGH 2DBLL 1E4HA 4NN5C 3VI4A 5KSAC 1EGJA 1CICA 4R7LA 4GXVL 1OARH 2PR9A 5I8EB 2P8PB 1HQ4A 1IFHL 1WAEA 4MTMA 5I6PA 4IGBA 4OF7A 2E6QA 3Q5YA 3OXRB 2Q7NA 5IMOA 5ACLA 1MFDH 4MNGB 2DLEA 2WQUA 3BAKA 2LW3A 3INOA 2OQJB 2EP6A 3RRQA 1IBHA 1H9DA 2XNAA 3BN9C 3IMUA 3MRPB 2R1XA 4XZUB 4NO0A 1P7HL 3MRQB 3LKSA 4PN6A 3ULUL 3MOBL 1JGDB 1ED3B 1I9JH 2Y69B 3LKNB 3HTLX 3LZQA 1J1XL 4XAWL 2L7UA 4QXTB 1BFVH 3OTTA 2ROXA 4P3WA 3ILEA 1UD6A 5FYJD 2D4DA 4DFIA 2FBRA 1LDSA 1N0XL 3W56A 2EE6A 3JTTA 4DPBX 4HZ1A 3QRBA 4OD1H 1U3HD 3CXFA 1XZ0A 3X3FH 4DWHA 4ZPVB 1D2PA 4MSWB 4OGQC 1IVLA 4ZODA 5DSCA 4DN4L 3HR6A 3B9DA 1BF2A 2BWQA 3MJ9L 2I9LA 4YSRA 4F57H 3T77B 1IL1B 2AQ1A 2YAOA 5HI3D 4OGXL 5DHYB 1F4XL 2IDQA 1SRDA 4HS8L 4B53A 4C56B 4X98B 1EFXD 3ZE1B 2Q7YA 3KYMB 3RDJA 2A2QT 1N4XL 4R83A 4WI8A 3UBXA 4YK4B 4P59L 2WINB 1AZUA 1AE6H 2XHNA 1OGAB 3QZWB 4NIKB 1WA1X 2AQQA 3S36H 1ZHLB 3AS3A 1QLFB 1MQKL 4ZFZB 1EWHA 4A2DA 3WHXA 4X0KA 2PYFA 2WXNA 4PS4H 3HEIB 1ES0B 3A24A 1E6OH 5C0NC 5EU7C 5I76B 1WCQA 4D0DA 3JYBA 5E2TL 2ED8A 3S3DB 3AITA 1A47A 3MRIB 4NDMA 3FFOA 3FUIA 4FN0A 4CSTA 1OSZA 2EO1A 3LXUX 3UJJH 3UMTA 3TFKC 4G6KH 2NPLX 5DJ8A 1OP3K 1U3HA 1AJ7L 4JFZH 4NZDA 4GT7A 1PS3A 1NH6A 3EOYG 5E94A 2BRRL 5SWZD 2R0KH 2ZYSA 1I1AC 3BP4A 2CMRH 5LGYA 4EN3C 4FQQB 1ZS2A 2OZNA 4G8GE 2WP3O 4FQJL 4IJ3B 3B2MA 3GSNH 1J8HE 3BVXA 2YXWA 3UO1L 4UB0H 4LCVA 3HBGA 1X7QA 1IGJA 4IIQB 1MHEB 5M7QA 5AZEH 3TO4B 5I24A 1EFXA 4LRIC 3OAWA 3DXAE 4GG6E 3U4EA 1OM9A 3ZE0B 4PJEE 1J86A 1NEZA 4FFWD 1WUNT 3NCBB 2K4AA 2DQ6A 2UY6A 2UYLA 3IPEA 5E6SB 1RHFA 4JCMA 5D70L 2J8UE 3IFNH 4JRYE 1E9PB 1LGVA 3FO0H 1DLFH 4XPBH 2ZWZA 3OLIA 2Z0UA 1T83C 1PLGH 3STLB 5B38G 4KROD 1G94A 3MXVL 3FONB 4P2QE 3QR0A 4ZS6C 4LVHC 1WZ1L 4FHBD 4GUPB 5F7DB 1ZLDA 5LNDA 1TVHA 5J3HD 2CDFB 1X4XA 4OKDA 5F88B 4POUB 3UTTB 2H1PL 3D2UB 1R75A 4HQQH 3MBXL 2XXFA 5SWZA 1B2YA 1SJVA 4B41A 3EO0B 4JDEB 4P9ML 3S35X 1IILE 4OT1H 1A14H 1CICC 4UIKH 3KNBB 1OM3H 1KZYA 4IGBC 4NNXA 3C6LD 2ARJB 4TLUA 4U1LB 1X9UA 4PGDB 3RGBA 4C59B 3E7JA 1AP2B 1QWUA 2HRHA 3QFJB 2Y2TA 1NBVL 3OJDB 2YEZB 4FQLL 1MHCA 3O3DA 3ZR6A 1G7LB 4BH7B 3R8QA 4TVUA 3QQNA 5I8KH 1DBML 3NFSL 5IHUL 1A7PH 4WHTB 4IRSB 3DX7A 4KKRA 1UH2A 3TX4A 1A02N 4IBTA 2VC2B 2P8LB 1J8KA 4OV5B 1E9QA 1FBIL 2BNQA 4FULA 2KHAA 4MS8D 3OR6B 3UJTL 2H1XA 2CE6A 3JT2A 3K1KC 1CR9L 1IFRA 1PMYA 4DTGL 1DCLA 1E65A 1U8MA 1ZHNA 1NWPA 4HIEB 3MRFB 3NOIA 2SEBB 2YA1A 1ORSA 3NCJH 3VMPA 5HJ3A 4JRXB 2X4PA 2VRQA 1GS7A 4N2NA 3T1FB 5BZWA 1U3YA 3GB7A 1P7QD 1R46A 2GBVA 5D8JL 3VXME 1QFWL 1HSBB 3FQYA 4HVBA 5JPNB 3QRFM 5DVLA 2WQVA 1R24A 4BGLA 3C6LA 1KB5L 3MUGB 4Y2OB 5GJTH 1WFUA 3A5VA 3WIIH 3B7SA 2VZUA 4KH9A 4Q56A 3D39D 2VR3A 3LNFA 4KDVA 4PRDA 2BPBA 4Z7OF 3ILPB 4D0BB 4PJEF 3ZTCC 1ZS8A 2WXQA 4XNYL 1TU2A 4GIOA 1RUAH 5C0RH 5TE6H 3IAQA 4R7DA 2DIAA 1D5MA 5IK3A 2XIBA 1O9ZA 1J5OH 3UBFA 2J8UF 1JOIA 4IBYA 4JREB 2BFGA 3ASWA 5SWSE 2I07B 4YDKH 3KYAA 1UASA 3P30L 5FLUA 1FSKC 1UJ3B 3GSOA 4HBCL 3H9SD 1L9RA 4NKOA 3FUDA 5I5JA 4N2CA 4NLAA 1TPXB 2CHNA 1MFEH 1U3HC 1TIUA 5LBSA 3RZWA 2WWNA 3BSZA 4RQQA 2PP8A 1WIPA 4N2GA 4UNUA 3CFNA 4OZ4B 2WLMA 1DP0A 2CKBH 1F41A 5L4MA 5JNYB 2X05A 1JDDA 1PIFA 1P7QA 3VXRE 1DDHA 5G2NA 3SIKA 4MQ7B 4AGNA 1U41A 4ZO9A 4HEPA 3KVPA 3OSKA 5HI3C 2CO3A 3VFPB 5JHMA 4WTQA 4DCQA 4LIQH 1EHKB 3V5HB 3VX0A 4DGWC 5A3ID 1DBKH 3W9DA 5EOTB 2A4CA 2HKHH 1XEUA 3IJHB 3F04A 1XTMA 1YMME 3K2MC 1E3XA 2FHBA 4P05A 3WSQL 3F58L 4RMBA 3T2NL 2MNJB 3UTZA 4GW4A 2OX5B 3RIKA 3NESA 5HHOD 2RD0A 3KHQA 1UQSA 2CDGA 2BHZA 3N9GH 4O2FA 4P2OB 4HJGA 5I16B 2G60L 4P2RB 2EADA 2QFPA 4O5LH 5GISH 3FZUD 3L5JA 4X9IA 3X12B 1ODUA 1JZ2A 4KBPA 3H9SA 5D7HA 2IVFC 4UT7H 3I50L 3N04A 4R7NA 3MNVB 5CEZD 3RGVB 4OJDH 1Y18B 3SYAA 1FFOB 3IJ8A 1DJZA 3ZYZA 1GZHA 5JQHC 5L2KD 3NPSB 2D7MA 4N87A 2R7EB 1WHPA 3V0WL 2D3LA 4XCNB 4S1SL 2XVKA 2JB5L 2APFA 4DKFH 2J4WH 4D3CL 1V3JA 1F6LL 4KNTA 4PWFA 4RGNE 4MGXA 5F9AC 2VSCA 1BM3H 5BMFL 2VJ8A 5DJZB 5AW5B 4LPYA 4RAVB 2VE6A 4ELME 3FQTB 3L4XA 3P9LA 3DUSB 4JPKH 4FFWC 5HYQA 1L9TA 3V6FA 3EO9L 3V55A 4AYEC 4NC1E 3MNDA 3GUTA 3HBQA 4TUJB 3LRSB 3PU7A 3V8OA 1JYXA 3F6IA 4QXGH 5HHOA 1SM3H 5T1LB 1FFPA 3NJXA 4KROC 4WTZA 3FB7A 2Y1ZA 1YPZF 2V5RA 2BVPA 3EYVA 5AVUB 3SKJH 4J1UA 3DRTB 2RIKA 2YOCA 3DSNA 3LV3B 1HQRB 4HFWA 5J3HC 1MFUA 4PBDA 3P2DA 3QG7L 1MEXH 2VXQA 4BWUA 1CFTA 3II1A 3RNKA 1IIKA 4E0RB 1ZA3B 2BOLA 5E7FA 2OMBA 4A6YA 1VF5C 5L2KA 4F1ZA 2WNWA 4AM0B 3PQYD 2ERJB 3SE9H 3CVHH 3GHBH 1XAKA 1EO5A 1E67A 3HHMA 3DXAB 4JKPL 4GG6B 3RURA 1BZ9A 4R9HA 5CBEA 4U3SB 4ZFGL 2YRPA 3HRZB 4MA7H 4JFXA 4DHLA 5JQ6L 2NUPB 3RNQA 1PIGA 1U3ZA 4OCWH 1ZPUA 2IFGA 4P5KA 1F4YL 4ETYA 5E6IB 2CJUH 2EH7H 4Y2DD 5CFAA 4Z8FL 2DZEA 3BP5B 5EEWA 1INQA 1TEYA 4F2EA 1XGUA 4G7VH 5JOPD 4GRWB 3NSDA 1WH0A 4P2QB 2CPCA 3IXAA 4X8GA 4Q89A 1T2JA 2FT8A 1KN2H 1DN0B 4XMPH 1XIWB 5T5FA 3WGUB 1DVUA 4IKIA 3GEFA 2WLNA 4MS8C 1A4JB 1OB1A 3ZQXA 1TQTA 4P5MB 4DKAA 2XZCL 1SY6H 1NMBH 1WAAF 4UT9L 3DX8B 1AGCB 1WC7B 2ZSWA 3HMXA 4KRLB 1VEPA 1T4KA 2AK4E 1JXJA 3IU3B 1T04B 5IG7A 5A43C 5DO8A 3LPFA 1KBKA 1C16A 2ZXDA 3QP3A 1NUFA 4LDLB 1XF2A 4ZXBD 1H6FA 1Q9OB 1XCTA 1M7IA 2VDKH 1RPQA 3PQYA 1JPFB 3C8DA 2ZKHH 4F58L 3ME0B 1S7UA 3IJEA 4MCYB 2JCWA 2ITCA 4L1DA 4Y2LA 4O00A 3ULVL 4HDIA 1EHXA 3FB5B 2Y2WA 3L1GA 3FH7A 2CBQA 3BT0A 4LCWB 4XVJL 1ZHKB 3O0RH 4JKWA 4ODXB 1XMWA 3LIZL 3J27A 4Y2DA 4I1NB 1TYJA 2E86A 3FH5A 1YECH 4FKEA 5HP5A 6FABH 5AG9A 3IFPB 3BMVA 4NZUH 5F9OL 5ISZE 1ESOA 2CXKA 3D08A 1RZQA 1IEBB 1EZVX 5C0DB 1N5YL 1DJGA 4LF3B 2VDNL 4G80B 4NHUB 1EZVY 4OM1H 1AGFA 4UT6A 1LTXA 5HVGB 3AQYA 1KLGA 4TUOA 1GZPA 3VYOA 4I88A 5EZLB 5B38A 4AW7A 1AGEA 4R8WL 2YD8A 4JFED 4LEOB 4JFOA 2K3TA 5HGBB 4MCMA 4JFQB 1WAPA 2FGWL 3MA9H 1OY3B 1GZHC 2X4TB 1AANA 3OKLA 2OMNA 3VXMB 2B2XL 1YNTB 3HC3L 1T03L 2HZHA 1JWSA 3QT2A 3ZHKA 3D25A 4YPJA 1MY7A 2YAFA 4L8CA 2RQ8A 5IB2A 3AMKA 4RGMB 2GJ6E 2VISB 4AC4A 3UH8A 5JORB 4TMPA 3DHJA 4ZW8A 3UOAB 4EN2A 5A3IC 1A6WL 3T2QA 1KWGA 3KH3A 3U2SB 4Y5YB 4EI5B 3VRIA 4N0RA 5MEQA 4GKSA 5MEPB 1QLRA 1PZ3A 1C1EH 2HFEA 3V9CA 1AR1D 3EJYD 5F8RC 4R90L 4BWTA 2YMTA 3RWEB 2DWEA 4N3TA 2K6WA 3G6AB 1DJYA 2K7QA 5JPMB 1E4JA 1HH9B 1OCZB 2H3KA 4LE8A 3VFVB 1GIGL 2EIDA 2N3JA 2R8SH 2DD8L 4X99A 3UTQB 1TLKA 2D9QB 4S1QL 5LG1A 4F7PA 3PDGA 3S2CA 3K46A 5CLZA 4MNQD 2VITA 4J3TA 4W93A 2YWYA 4K23L 3QE5A 1Z0MA 1LEIA 4DAGL 4M5SA 4JFEA 4PRAA 2IH3B 1IFGA 3VXQA 4JHBA 1G9MC 4AMWA 1Q9LA 3K4ZA 3VXRB 3GSNA 3D3VE 1RZ7L 2IBZX 4JRLA 4H8VA 5C3LD 1OHQA 3CPLB 4GRMB 2BFVL 2IBZY 4H0HB 5CWSA 2F53D 4AY0A 4WNSA 2P28B 2ZWLT 2JK5A 3WY3A 3P11L 2BO0A 1B4LA 1FZMA 2K8MA 3BCDA 4KKAD 4L2YA 3RDTB 4ZSOA 2A0LD 5AYQA 1RIHL 2AK1H 3DTXA 4ACPA 3QZBA 4K94H 3G04A 5F7LB 5DLMH 5CIPB 4PRBA 4AYDC 2IFFL 4KVCH 4PJDB 1JPSH 5GJSH 1NBZB 1RUKH 1T1ZB 4WHCA 2H9GB 4BFJA 2GIYA 3TEXA 2WANA 4Q4EA 4Y8DC 4PGJA 2CRYA 5T33L 1KMGA 4MNQA 2LGNA 4HGKC 4FLQA 4D0CA 3OVUB 4D9QD 2ZYIA 2OL3A 2W9DL 5KAQG 4B9ZA 2FWSA 4R3SA 2C4FT 5GIRB 1RAMA 2J6EL 3FTXA 3VVWA 2ATPA 2PO6B 4HC1H 4QMEA 4OGYH 4RGNB 5HI5D 5FHAL 4XZ4A 3GGWB 1Y1UA 4JHWL 1GJUA 4MMYB 1MAKA 5LGJB 4XBGB 4ZMPA 4ELMB 5EN3A 5JHDA 2F53A 2CRZA 2NTFB 2GTWB 1MQ8A 1E6JL 1KJ2B 1NFDF 1X5GA 2AI0H 9PCYA 2AJ3B 1JNLL 4U1JA 4XNMB 2F19L 1BM7A 1FH5H 1LNUA 1UT1A 4Y2DC 4CW1A 3LN4B 5JIHA 1AOHA 4YS4A 5BQ7B 2Z4TA 3CMGA 4OLEA 4PG9A 4GMTH 4GKNA 1RUQH 1IV8A 3FFDB 1Z2KA 1FL3A 5TDNA 1CTMA 3TF7C 1FDLL 3AG1B 4N9OB 5DJ0A 4FA6A 3KL3A 3QPQD 1H6TA 2Y36H 4QXWA 2J55A 3IETA 3K6SA 1ITCA 3UMNA 5LN8A 1PQZA 2DBLH 3LNHA 2AGJH 5EU6E 2BSTA 5J6HB 4K9EC 4NKDA 3BUTA 3F01A 3PHQA 4YMPA 5AAWA 4GXVH 3EXJA 1IFHH 4H0LC 1FZOB 4HJ0C 1PAZA 4XCFL 3FOMB 1FHGA 4LVNC 2WQXA 1RZIA 1DVFB 3V9FA 3QISA 4QGYA 4GSDL 3QWOB 4DUXA 1ORQA 5BZDA 1UD3A 4AYSA 2NW2A 1H3XA 1QD0A 3OG4B 4OH2A 1OTSD 3PPEA 4MZ3A 1M7DB 1Z9SA 1A4KA 1ILUA 4FG6D 4KOBA 1TJGL 5C0BD 3SEPA 4ZNCD 2ZCKH 2YEVB 3MOBH 1NLBL 1YQ2A 2EYSB 5IW6A 3CNKA 3FB8A 4AEHL 5C9KA 2NQCA 1T66D 1EDHA 4UT6L 1W9XA 1H0DA 4XT1C 1S9VA 1EPFA 1N5AB 4L8BA 5FPIA 2BZ7A 4XVOA 2ZUUA 2X7LA 2Y1YA 4GO6B 3OLGA 4EJ1C 4EO5A 2XDHA 1AH1A 4PJ5B 4G7QB 3MJ9H 3PGDB 4DP2X 3AU1A 3IDMA 2CKBA 3P4NA 3A21A 2VAAB 2A83A 1F8TL 3ENEA 4OGXH 5JW4M 1F4XH 1HCYA 3KDPB 5LAXA 1XGTB 2J44A 1KC5L 3IKKA 3QJHB 5ETUB 4E41D 1MKFA 4UNIA 4TVPE 4X6FA 4EDWL 2R69A 1OPGL 4P59H 1HSAB 5JW5A 1BPVA 1ZA6A 2X12A 2DI9A 5CILH 1RLWA 3GIZH 2B4CL 4WUUB 1I7ZB 3EOAB 1YHPA 3R1GL 1BOGB 5CBAB 5T3ZD 3TU6A 1X4ZA 2NSMA 1AR1C 3EJYC 3VD1A 3H9HB 5C0BA 4LSPL 1CXHA 2C7UA 4KJPD 3CBKB 2XWZA 5F2FA 2ZWSA 2DEXX 5E2TH 2Y7LA 2N4IA 4ILDA 1Q1PA 2VMCA 2RMNA 4YHNA 4QHKJ 3RWDA 5L4IA 5KJRH 1X44A 1E28B 2YIHA 3BPOB 4X6EA 4ALAL 2WXHA 1OGPA 1J9SA 5CCKL 1Q9KB 4N2FA 1Q1JL 2V2WA 1JK9B 4YHIA 4PGEB 2Q6WB 4O51A 4Q52A 5H37H 4P06A 4JFFD 1ETZB 4FQJH 2VDLL 3U0PA 3UO1H 3EFOA 3IPFA 2RFXA 3MRKB 4N6QA 2KERA 2B14A 2X5PA 2ZF9A 4FKHA 3ZRFC 4XRCB 3KPPB 3HIZA 3BPLC 1XSKA 4EOWL 3QJXA 5J12C 2OULB 3HVDA 2OYPA 2XQYK 2ADJA 2QZQA 4WEUD 4WNQB 4E41A 1JVKA 2B3IA 1ZLEA 4WWNA 3SCMB 1QPXA 5LG6A 3ZDXF 4YNYB 2P5PA 3VXOA 5AKTA 1OAXH 3GJFB 4KKAC 1R3KB 1MCJA 2A0LC 3QNXA 3AVEA 3E6FA 3FU7B 3TEYA 4UM8A 1GYAA 3ULSA 1MG3C 1E2ZA 3T0VA 3HB3D 3L54A 2NNFA 3L3KB 4KQ4L 2MKWA 2R0LH 4A7SA 5IHWA 3ARDD 1XF3B 4FOMA 2VW4A 3HG2A 2R4RH 3X17A 2F1AA 1JL8A 2D2OA 4L4TA 4NWUL 1IGCL 1A3QA 4JPSA 4ODVH 4TNWF 2H1PH 3SYCA 2IGLA 2QQQA 3MBXH 4L1BA 4J23A 3MREB 4I3GA 2JLPA 4OJYA 1GGBL 4AL8C 3OG6B 2H8PA 5CCGE 2VDPB 2QLVB 1AIZA 1JWUA 4P9MH 2J5LC 1QSED 5AAWC 4I4WB 3L4TA 4JFFA 1A7QL 1OLZA 4CN1A 5INDA 3FTGA 5H94B 5JYLA 1ZT7A 2CO6A 3QHTC 1GC1L 2UX6A 4GBXD 4ANVA 3L7FB 5HI5C 3BKJL 3TASA 5E8DL 3SPGA 5I5IA 2EEFA 3GXIA 2Q20A 4LAQH 1KIRB 4NQQA 1X5MA 4S0TD 3BX7C 4QIRA 3Q13A 5IFAL 2OK0H 4FQLH 4GPVA 1L0XA 1B4TA 4HISA 4FG2A 4YVUA 5E56A 5KSBE 2VLLA 1V7NL 4B9PA 1NCAL 3VM5A 2VM9A 3IFOA 2HMIC 4XVSL 2G3MA 5IHUH 1QVOA 4CVZA 5EV7A 3HNTL 4P4RA 4NN7B 3CE1A 1FBIH 1AG6A 1U3NA 4LBEA 5EZPA 3H1ZA 3DKHA 3STZA 3ETBF 1B4JL 4WQOA 5D96C 1RKRA 2VQ1A 3KLSA 1D7BA 1KJ3L 1UUNA 1CR9H 4DTGH 5KYXA 4U1IA 1MI5D 2P7TB 1SY6A 2DWDB 3L9RA 3QPQC 4H5SA 1NBYA 3L4YA 1FIGL 4GAFB 4PRNB 4Q58C 2FHFA 3SGDH 3WFBL 1MUJA 3ARBD 2HP4A 4PVNA 4ORGB 3M8OH 1QFUH 2H4EA 2VERN 5EPMB 1QSEA 2D0GA 2ZNWA 5D8JH 4U7SA 2VLRB 4HMEA 3LZPA 5B1BB 1HZHL 1KB5H 4GBXA 3CDFA 2P5WE 1I7RA 2TRYA 4MZRA 4TSAL 5B1CA 4XNDA 1CYWA 3U0TA 1CJYA 2BSRA 1EEQA 4OJAA 3I02A 3MZTA 3RWFA 4XNYH 4Y9CA 3GDCA 1OTSC 4FG6C 3ARTA 1GJWA 2P8MB 4OD3L 3BPNC 2EXTA 1H3PH 4ZDHB 4HOZA 3L1FA 3Q6GL 3K71B 3P30H 1T1XA 2YKLH 1B0WA 2EKJA 3VGDA 3P73A 4XMXA 1BZOA 3SE3A 2CLZA 4WO0A 4G9FD 4IOFD 1UUSA 2V7HA 5KVDL 1NGWA 4N6RB 3VD9A 5IVXA 2BK8A 4JLRA 3ARBA 5IJBC 2CBOA 4UNVA 4JR9H 2R27A 4ZNEE 3V6ZB 3DRQA 2YRZA 4IBQA 1QBML 4X83A 2OMYA 2BVOA 4WWKD 1ZSDB 4PIBA 4A7QA 2R69L 3QB7C 1A3RH 4DNLA 3B7UX 5K9KA 3DDFA 1PZ2A 3BDXA 3WSQH 2XPGB 4FA8A 3T2NH 2CA4A 1ACXA 1UT2A 2D8KA 3FTYA 1JV5B 3UPAA 2QR0A 3LQAC 2BP3A 2CIKB 5KSBF 1EAQA 5I0ZA 3WTUA 1A6UL 4NM8L 5GS1A 4KJPC 2HPTA 4Y5VA 2EDWA 4EKXA 5DC9B 5IESL 3CH8A 5E9AA 3VDAA 5IB4A 1GTFA 4IYKA 1T3FA 3D09A 5B7FA 1WBYB 3FQRA 1FG2A 1HHGA 3WFHB 2DBJA 4LSUL 4QEGA 5ECGA 1K3ZA 4G9FA 2Y23A 1IGTB 3MGOB 4MJ6A 4X42A 4TLKA 3H3KA 5IOKA 1OAYL 1BEXA 2XKSA 2CHZA 3TA3D 1B0IA 1O75A 2VN5A 2IIJA 2XN9B 5CJ5A 3LPPA 3WL9A 3MLXH 4TNGA 2ZKWA 3PPSA 2JKRM 1TJXA 4GLRI 4D3CH 4I48A 1MRCH 5D1ZD 4LBAA 5FUZL 5BMFH 1EAPB 2C9RA 1PW3A 3EZ8A 4JFVA 5FF6A 3N1QC 1JHLL 3PWUB 4DERA 1T20A 3RX9A 1CD9B 3EO9H 4OLVL 1TR7A 2DF3A 1U8OA 1X9QA 3ROLA 3WU1A 5KYUB 4KUCD 5AZUA 1VFBB 2DJ4A 5JLZB 4JFSA 1FHNA 3GSVA 3HB3C 3WGVB 1P1ZA 4YXKL 4URKA 1ZDQA 1SHMA 2KYIA 3MMEB 1PD0A 1N6QH 3DIVA 4OTXH 4KZ0A 4LLQA 2R23B 4PLNC 4ZMLA 4WENB 5DRNB 4HFUL 5HI4C 2LFEA 3MXWL 5DHVB 2VDQL 4DGUA 1S7WA 1DL7L 5A6IA 4Z7IA 4OBSA 3TWCH 2R2HA 5D71L 5C0GA 3QNZA 1KTCA 3K4AA 3KLDA 3O3AB 4MHHI 1T7YA 5HHNA 1SOKA 1CZ8L 3D1MC 4GBXC 1KCRL 1SJHA 2PCYA 4U1HA 4OGZA 4TVSa 3F7PC 2LVEA 1K5NA 5D1ZA 4CADA 4JPWH 3WO3B 4ELKB 3NH7L 4N0CD 1UA6L 4JN1L 1F4YH 4NKIH 1QW9A 1TNNA 4UQCA 3GI8L 3QUMB 4OLWH 4JM4L 5F1OB 3VI3B 2IOOA 5DEFA 5ERWB 2Q3ZA 4U7KA 1MAMH 2AZAA 1DSYA 2GAZB 3BZ4B 3TIEA 1CWVA 3HOGA 3WE1A 3FT0A 4ICXA 3DO3A 2AV1B 3ZO0A 3VWJD 3V4UL 3PHOB 3SE3C 1G7IB 1S7XB 2XZCH 3ULAB 3VXUE 5HD8D 4DIXA 4CVXB 2ESVA 3ESPA 4HYTB 2FDBP 1W0VA 2E7MA 2XX1A 4OZGA 3IE4A 3VW3L 1A21A 3ARBC 2YFOA 2N7SA 4UM9B 3DUUA 4HK3J 1E8YA 2DTMH 1D5BB 3DURA 1XH3A 1FNEB 3MUUA 3BFWA 3CCHA 1FVDA 4A7UA 4EZMA 3KPMB 1MVUA 1JN6B 2GITB 3T71A 3O6ML 2X4OA 4FL4B 3ULVH 3WTWA 2VW6A 3M1BB 4NUPA 4MA1B 3Q5TA 5DUJA 4XVJH 3HI1A 2QHLA 1OD9A 4F8PA 1IBFA 3O3BA 5JW4Q 1JCKA 2XIIA 3SB3A 1WIOA 2XWJB 1LP9F 1F11A 3B2PA 5IW1A 3L2MA 5GS1C 4YHKL 1CQKA 5F9OH 3F5WA 3CZEA 4Y5VC 3WUWG 5EHFA 3UG5A 3NJHA 3SJVD 1N5YH 1S9YA 2EDBA 2X9ZA 2A3TA 4NIYE 4P9HC 4X4XB 3TV3L 1GY1A 2WLLA 4NN6C 5FM4A 2MCPH 1T0MA 1U33A 1JHTA 1QI5A 3FBKA 4FQ1H 3MNWB 5EF2A 4HKZA 2GK0B 2E7BA 2FJGA 2Y0SA 4OB5L 5CSZB 1PEZA 2I5YH 1KGWA 3HLAB 5D2LE 1BJ1J 2B2XH 3HC3H 4BZ2L 4XP6H 2DAVA 3ARQA 3FHEA 3SKNA 2VO5A 1JDAA 5EU7E 4HWBH 1JF5A 2Z1KA 5AYUL 3DA0A 2VN3A 1G7PA 3IMTA 4TUKH 3LZFH 3WAJA 2HLAB 5HDLA 4B5EA 3FQWA 2X2UA 4EI6B 2VZ3A 3HUJB 4IHBA 4JDVB 4EF3A 5KOVC 5A2BA 4DEUA 3DECA 4HLZH 4QRRE 5CM1A 2BSSB 4K94C 3GI9L 4J3OG 4XC1L 4AV0A 2AEQL 4WI3A 2Z35B 5EC2B 1WV7T 1BVLB 3PXLA 1CGSH 5F89B 5D1QB 4M6NL 5FUOL 5KJ4A 4N0UE 3SJVA 3BQUB 4S1QH 4YHOL 4GO8A 4UZGA 5DJ2B 2VYRE 4XTRD 3RWJA 5C08E 3UCQA 4NPKA 4PRID 1MFVA 4U1NA 3WTXA 2X9WA 3AREB 3V7AE 4G42A 4K23H 4TL5A 2A6DB 3HE7D 1R3HB 4FS0A 1OP3H 5DEGB 3BI9X 2RCSL 5ICZA 2W81C 1KPUA 1BAGA 2X1WL 5H37A 1XGQB 3OKMA 1OAKH 4HZLB 4XP1H 5FA3B 5HHVL 1S7VB 2DICA 4R96A 3ZTEA 2BWDA 1ET8A 2HRPH 1JF1B 2BFVH 4X5WA 1J8SA 5KVEE 1V55B 2Q2LA 5D1ZC 1HYSD 3KBHE 4Y9EA 2E3VA 3P11H 2BMKB 2A9BA 4XNZC 3LEYL 1TSHA 1KTDA 1L3NA 5MP6L 3VI4E 1TTFA 1S7SB 2E9JA 4PCTA 4Y9GA 5FK9B 4B95C 5DA4A 4MJ4A 4NC0B 1COBA 3BH8A 4ADGA 4UV4H 5SV3A 4B0MM 3B5GA 4EDXA 2EDFA 1JZ6A 3KL5A 2TRHA 4NUGL 2V5MA 3UTPE 3ABZA 4PP2A 3GNML 1IAMA 3N0AA 3IF1B 1KT2A 3PABA 5T33H 3L3JB 2WXPA 3BWZA 3FMGH 4PRIA 5C70A 1JZFA 2FBOJ 3ZT5A 2RGSA 2W9DH 3HE7A 3FQXB 4TNWK 3IWVA 3QQDA 2J6EH 3MLUH 3OKEA 4FQIH 2EE9A 4AT6A 1I8MA 4JPQA 1YDPB 1DQQB 4PRPE 2FJFA 5EEXA 1JRHH 1TZIB 1X7SA 1T0NB 2F54D 4OUUB 1DFBL 3GSQB 1QX1A 1BCIA 5DJAB 4N0CC 2CRIA 4EXKA 2F19H 1QFOA 4NRYA 5AVTB 1H8SA 4Q6KA 2HRLA 2QVMA 1AG0A 2YJQA 3TBSA 4NQSA 2FYYA 1G6RA 4NRXB 4OLUL 2IPTL 2MKLC 1IZKA 4LVOC 4QNPE 5KEZA 4AQ1B 3QORB 4I77L 1KBPA 4ADIA 1I3RB 5HD8C 4ONFH 1FVCA 3BD4A 3BEVB 3CSGA 1MCIA 5E99H 1YEDA 3E6HA 4AYFA 4X5XB 5I30L 4WO4D 1O0VA 4PP1D 1PFOA 3D69A 2HUEA 2F18A 4IOIA 3IFLH 2Z8VC 1NPNA 1DEEB 2HKAA 4XCFH 1GSMA 5DUBB 2HWZL 4DP1X 1FL6A 1IC5L 5FDWA 2F54A 2I26N 3GSRA 1MCDA 5E23A 4AJYV 3LH9A 3ARSA 4MFHA 5CD3A 5JO5B 2Q7AA 4YWGH 1N68A 2HB0A 5LJYH 1SEBA 5A2IH 4G59C 1EXUA 3CVCA 3EDJA 4NN5B 4B9JA 5I17B 3K2UL 5KSAB 4X6CE 3SE4C 3MR9A 3HNSL 4KXZH 4N24A 4G8FA 4PHZA 1NLBH 5ICXB 1EMTL 1JTTA 5ESVA 3GUFA 2XXCB 1E7VA 1YAIA 1DQDL 4BFOA 4WSGA 5IHLB 3U4BL 5C0FB 3F7VB 1BPLB 2GEEA 3JBG7 1LXMA 2VSMB 4KTGA 1BQLH 2FIKB 2VRKA 1P6WA 3FU3A 1A9BA 2JI1A 4EZJA 4WO4A 3IMVA 4NO5B 5DRXA 3MRMA 1SBBA 1F8TH 4FMFA 5DVPA 3TBYA 3UTSD 4UIMA 3LHPL 4OGAC 5GS0H 1F97A 1U8HB 3CC1A 1CI3M 5DZOA 5TQ0L 3ZL1A 2PF6A 4PJGB 1ACCA 4UQDA 4EDWH 1OPGH 4IS6A 4OF6A 5KJ7E 4PBVC 2ENYA 3ZIYA 4H8HA 2B4CH 1KCSL 3EFDL 3B1TA 3R1GH 4N90E 4UTAH 5SWZE 3GO1L 5KVMC 2IWKA 2YGPA 5FB8A 5A40E 1BQHA 1WVZA 4YXHL 1RJYA 3L8QA 15C8H 5FDYA 2GC4C 3DGGA 4V1DB 1OLLA 3GMMA 4B9IA 4A38A 3PWJB 5KYNA 5DUPL 1SMOA 3BRGC 4NQXB 4NUJA 4XTRC 2FBJL 4QNPF 4ALAH 5JW3H 3G6DH 1NC4B 1KNOB 1QA9B 3VXTA 5CCKH 3VFGL 1A1OA 1Q1JH 4FA7B 3HE7C 5D2LB 5DQ9A 3RGHA 5FECA 4U49A 1UXLA 2CG9X 5KTEL 1CYGA 2V3DA 2Q3XA 5E2WH 1KBVA 1LO0L 1W6LA 5HHPA 4K9JA 2IDFA 2BNQE 3HZKA 3UTSA 3MLPA 1CDBA 3RTLA 1RZ8B 2JLLA 3REVA 5CU5A 1RSYA 3ETBJ 3QS2A 2GEQA 1HYSC 1KB9K 1OPOA 3FKUS 1LK3L 3NDYE 3NJVA 3P40A 4NP4L 2W91A 4LLWA 1TQCC 1ZY9A 1I1AB 3ZO9A 4EN3B 4XE5B 4FEMA 4H8UA 4O02L 4DH2A 2R2EA 4YJZL 32C2A 4L8DA 4PPTA 4NJAH 1S5HA 3V4PB 2ZX9A 1QFHA 4X6CF 2YGQA 5GGSA 4EIZC 1WCBB 1HC1A 1FAIL 4N0UB 1HCVA 4Z95L 3U6XS 1BSIA 4E5XA 2FT6A 4XPGL 4MB3A 1SPDA 4J3OD 1G7MA 3K6IA 1VADA 4ODUB 5DMKA 5IOPB 1YUHA 2E47A 5I1KL 3TVMC 4MD5A 2IDTA 2RTTA 1P7KA 1X5FA 2WMPB 3MJ7A 4QRSB 2O26U 3WUWA 3U48A 4UAHA 1RMFH 4AZ8B 1AS7A 4DOHE 1UOWA 1JZJA 1W91A 1ZK9A 3K2IA 4MAYD 4NKMB 3WKML 2YR3A 2YXVA 4QTHB 1I7TA 5DI8A 1GC1H 4PFEA 4LVHB 1NDGA 1P9MA 3BKJH 4NFBA 4G70B 4IBSA 1NBQA 1TKWA 5IFAH 4MCZB 3O0LA 4HS3B 1NFIA 2AQ3A 2AEIT 4JGUA 5DEJA 2LLNA 2VMFA 2P24A 1HILA 2PTTA 3FOLB 3VI4B 4QRQA 3S3SA 1GMIA 4XVSH 1MREH 2OYKA 1BQ5A 4HHWA 1CICB 2DQTL 1M7XA 3OC8A 5TF1L 2EDJA 3ZR5A 1HQ4B 4CKVX 1R3JA 4KHTL 4EBQL 3HNTH 4IGBB 3DIFA 3DNKA 4YDZA 4F7MA 4ZFOA 5TGBB 3C5ZC 3U2JA 1B4JH 5ALCH 5IMOB 2CO2A 1KJ3H 3MO1A 2ICWJ 1NWOA 2XNAB 4PV8A 4LLVA 2GVYA 5IQMA 3WFBH 4R97C 3C5JA 3MRBA 5CP7A 2R1XB 2OBGA 2X89D 3QR1A 4NO0B 2UWEA 4PLJD 5D93C 4YBQD 4WO4C 3LKSB 3WDHA 1RL1A 3MLZL 4PP1C 1IC0A 2Z7YA 4MAYA 3ZXAC 4PQXA 3QXVA 1L4IA 1YEFL 2LOEA 1OQOA 5ES4B 5I6LA 4LL1A 1JYVA 4WSJA 3B1UA 2C9VA 2M1KA 3L45A 4YHLL 5JIQA 1QBBA 2HTLC 3JTTB 5FWRA 1XZ0B 4X9YA 2FUQA 2RALA 2WN3A 2EILB 4CMHC 3UADA 1UGNA 4Z0XA 5DSCB 4I1RA 1PCXA 2NDGA 4A7GA 2XN2A 4ZUTA 2B1AL 2I9LB 3QZWG 2MEJB 1QASA 4OD3H 3N0PB 2V33A 3V0JA 1PG7H 3Q6GH 3D52A 1FN4A 3M88A 2W95A 4NO2A 3WFZA 3TEWA 3HKZA 1BZ8A 3FT3A 3UBXB 4HIHB 3ZKXC 1KB9J 3FQNA 1QKZL 2G9HA 4HCGA 4W70A 4M7JH 5KVDH 3KLKA 1WZKA 2IC2A 4H20L 1THAA 4HUMB 1M2VA 2YD9A 2NXYD 5I1HH 5IQNA 1X5HA 3WHXB 4X0KB 2PYFB 5I0DA 4MDJA 3F2LA 5I6OA 4XP9L 3RPIA 5K33A 5T1KD 4BUGA 2BIMA 4G6ML 4N1EA 5C92A 1TZHA 4PJIA 4MD0A 1FSKB 4JG5A 2HCZX 1XF5A 4HWBA 1XF1A 4NDMB 4CL7A 2MOVA 1OSZB 3PFQA 5EU5A 5AW1B 2E56A 2JF1A 2FECL 4WFED 3O2DA 5DJ8B 4BSWA 1U3HB 3V6OA 1U95A 2F1EA 2ZUTA 1KYDA 2H3NA 2W59A 5E94B 3UCRA 5MHSD 3BP4B 4A39A 3G5XA 3DO4A 2NYYC 3QNYA 2VABB 1OSEA 1A6UH 3W2DL 5HPOA 4NM8H 4G6FD 3U1SH 2I25N 1X7QB 1IGJB 3D0VA 4ZW6A 1Z0NA 1EFXB 1TVBA 5IESH 2LHAA 5I1DA 1KPVA 1NEZB 2WM0A 4LSUH 2UY6B 2UYLB 2VDML 4XCYA 2VJXA 5ANMA 3LXCA 1LDPL 3C9NA 4UYPA 3DVNA 1OCOB 1OAYH 2E27H 4DPRA 2AJSH 5HJGA 3TN0D 4CGUB 4RWYL 1OCWL 1RCYA 5T1KA 2YA0A 1WWCA 1ZTXE 1P9MC 5AW2B 2KI6A 3AXHA 5FCUH 2HG5A 4K15A 1TVHB 3OKYA 3UAJD 1JHLH 5AVWB 1ICTA 1RQ5A 5GRVK 5GSVA 1PYWA 3ECUA 2VW7A 2IWFA 3MA7A 5SWZB 5KANG 2AW2A 5AWNH 3GXDA 4KMQA 4PRHE 4EQ2A 1ZVSA 5FM5M 3MJ8A 1X9LA 2YD0A 4Z7NE 4NNXB 1VGKA 3V0AC 5FKAA 3ARFC 2PCFA 3M1OA 3VJ6B 1SGKA 1HOCA 3SBQA 3F7LA 5I0YA 1J5DA 1G0YR 3WIHL 4RETB 2YARA 1S5IL 5DFAA 5LGHH 4J3OC 4FDWA 1MHCB 3O3DB 1L7IL 2J7LA 4UI2A 3J8F7 1K6QH 3MXWH 4DP5X 4PJCE 5J57B 1DL7H 3QZPA 3DX7B 5D71H 1N10A 4MAYC 4KROB 3RWGA 1E9QB 3TN0A 2BNQB 3F6JA 5FYJU 4XPHL 2ZYRA 2TAAA 1PZAA 1CZ8H 3MLTA 5F96L 1KCRH 1E4WL 4O4YH 1TQWA 2YHGA 5LQBH 3BDBA 1O7DC 3P9WB 1U8MB 1UM4L 1ZHNB 1R17A 1HXYA 3K81A 3NH7H 3UAJA 1ORSB 1H19A 1RERA 5HJ3B 5IBTL 1T89A 1NANH 2X4PB 3GI8H 4XNUH 2EDLA 4HSQA 5BZWB 4BZ1A 3QUZD 4GAJL 1I8IA 5IHZA 5DF0A 1R24B 5BV7L 3APNA 3D4GA 3SZ6A 3NIGB 1VZHA 3V4UH 3BP6A 3HI6L 4PRDB 5F9DC 4OCSL 5I19L 2AXFA 3G6JA 1ZS8B 3T2LA 3GIVA 1TU2B 1N9PA 3VW3H 4A1RA 5IK3B 1D5MB 1UURA 3FCTA 1IC4L 3NCWA 3PDOA 4L5FH 1BVNP 4DT2A 4A2EA 4PLJC 4Z76A 1DCEA 1RV6X 4QT5A 4E9YA 3L9EA 5D7EA 4NWTL 1W15A 1CFVL 4JZOA 5AQ0A 2XRAL 3BHBA 2X87A 2DLHA 3KDMA 4YN3A 3GSOB 3S36X 1IKOP 4QKTA 1RK0A 2WNKA 4NKOB 3K72A 1LQBC 1TTBA 3O6MH 8CGTA 3SZKC 3HG3A 3V6OC 1OANA 3OKNA 2OSWA 4R5VA 3RQ3A 4NBYB 4QRUA 3S0PA 3N1FC 5J9PA 3WTVA 5KVFL 3NJKA 5C0AD 2X9XA 4LHUA 4F24A 3I6LD 2HPOA 5BVPH 3N42B 4ABUA 5T3XD 1P7QB 1DDHB 3PP3H 3QUZA 1CL7I 2DI8A 4NX0A 4F8TA 4DCQB 3EBIA 3QDME 5F6HJ 4Z7NF 3OZLA 4ONGL 5ITBH 4NQDA 2PCXA 4AQ8A 2VXSH 3D18A 1CFMA 2JKIS 1RURL 1MLBA 3UTZB 4GW4B 4NQEE 1IC7H 2DEWX 2YSTA 4DN3L 2DLGA 3MDJA 5L8LB 4ERSH 1UQSB 3UAAA 2CDGB 2NXYC 4JPIA 4LDEB 4O2FB 4X5QA 4HJGB 4M43L 4AX3A 5DTFA 1YNLH 4PJCF 3KPQA 3N43F 3U25A 1B4RA 4HCRL 1J1PL 2DYSB 2ZX6A 3R0NA 4KRNA 4WFHD 5IB1A 1MCWM 4HWZA 3O2DL 2AC0A 5KSVA 3AM8A 5DURD 3NVQA 1LO3H 3LEVL 4R84A 5IGXL 2Y72A 3AU0A 4QTIH 3W5NA 4AKQA 2P49B 3IN0A 4UTAA 3LIUA 5FW7A 5C0AA 2P8PA 3GI9H 2HFTA 2DJUA 3SDXE 1EH9A 1RZGA 4XC1H 2F7RA 3ALXA 1EJOH 2AEQH 4PGZA 3MRNA 3BZDA 1NKRA 3FT9A 4FNQA 2J73A 5LCVL 2X4SA 4GAGH 5IBUB 3GLZA 3WHE1 3VFRA 5F7HA 4YHOH 1SLXA 3TYGH 4AXWA 2VE6B 3P4LA 1JZHA 3P9LB 5JHDE 3WN5A 5E1GA 2L7QA 2WYIA 2GQHA 3CZSA 1CB4A 3V6FB 3T8VA 4PJFA 3P77A 4WFGD 4LFHD 5CZXD 3UBHA 1BVNT 3GUTB 5ID1A 4XOEA 3VGBA 3F05A 1OXYA 5CKGA 3UAEA 5HDQL 5HHOB 3L3GA 4Z7VA 1FFPB 1NAMH 1WFTA 2BC4A 5BXFA 4JFDE 3T4AA 3TN0C 1E3ZA 2LTQC 3FB7B 4OFPA 1B9KA 4N5UA 5C07E 1OF0A 3EYVB 2BVPB 3DX9A 4J1UB 4P3CL 3U82B 3DSNB 1O6VA 4HFWB 4UQAA 3N2JA 3UAJC 1MWAH 3JV4A 1CFTB 1T89C 3RNKB 3X1NA 1U8IA 1PNDA 5MP6H 2O5XH 2OXGA 4K71C 3M86A 4A6YB 4H1LH 1A7BA 2X1XR 1X5LA 5HHME 3L6FA 5L2KB 4OIIL 5GRUL 5IJKA 1QBLL 1IE4A 1SOQA 3CFIC 4IBWA 3FUKA 5KS9A 4G2AA 1UWEH 4PJ8D 1BZ9B 5CBEB 4DSYA 4N8VB 3P4OB 1LILA 3A4FA 4JFXB 4M8QA 3RNQB 1P0SE 3D9AL 5C97A 4L0YA 3EOBA 3BUBA 3QZWA 3GNMH 4P5KB 2Z93A 4BKTC 1T80A 1QG3A 1RZKH 2AAAA 2EE3A 5EF0A 1INQB 1XGUB 3ESUF 2ZOLA 4HAKA 3VSVA 3VFNA 5D1XE 3AGVA 4GMSH 5C1MB 5GGUA 1E0OB 3KYNA 4YIQA 3BZEA 2J3SA 4H8PA 1NLDL 4JKNA 1W72L 4WI2A 4HX1A 1QFWI 1FLRL 3LYRA 1R4XA 4PJ7A 3D2UD 3RVWD 3WIFA 1DFBH 2ZCHL 4MD4A 4OZFH 2VXTH 4PB9L 2EUXA 1CGWA 1T4KB 5KN5A 4QLRA 2KL6A 4JX0A 5E8NA 5IG7B 3QR2A 1A9EA 1WITA 5E2VL 3PAYA 1RU9H 4AIZA 1C16B 2NUTA 1XF2B 2O6DA 3QCUL 3QA3A 5SX4H 1SDAB 2P26A 1XCTB 2XKNA 3QUZC 1M7IB 5F93C 5H4ZA 3PQYB 1EHLL 1FYTD 3SDXF 4ZS7L 1BG1A 1S7UB 3IJEB 3PNRB 2RB8A 2ITCB 4PJ8A 3T65A 4MAZA 2YPLE 2DLIA 4DFHA 5ADPH 4AQ8C 4LIQE 1PZCA 4HDIB 4HSAC 3ZU8A 1T6WA 4LOUD 2DQUH 1J9RA 1PZSA 5J06A 3FSAA 4Y2DB 3KGUA 4IRSD 4WTXA 5I30H 1IGYA 3MV7A 1JERA 1AGBA 2D3JA 1VKXA 2XQYG 3MRRA 4PJ6A 3A3YB 3KWWA 5F7DA 3VTMA 4OI7A 5ADOL 2HUHA 4OM0H 2VDOL 1IC5H 1I8AA 1AGFB 5GS0C 5E9NA 4WUKL 2YC1A 4BFIA 1KLGB 4OFIA 3MUY1 1BGXH 4TUOB 3NJMA 2EDMA 3AM8C 5B38B 4JO8A 1AGEB 1HEHC 4XO8A 5HVHC 4JFOB 2FLMA 4ZMVA 4ATTA 4JM2F 4BA8A 3ZHNA 3K2UH 5KW9L 3OKLB 1IGIL 1TQUA 3HNSH 3NZ8A 3ZKND 4ANKA 1JWSB 2OZ4H 3D25B 4LL4A 1EMTH 4RSVA 4L8CB 5IB2B 1A25A 1O5PA 3T6XA 1FZJA 1P5VB 4LVNB 2KQMA 5DJXA 2Q8AL 1FYTA 2Y3AA 1WFMA 1ZJBA 1DQDH 4HC1A 1NDMA 4L1TA 2X42A 3WN5C 1TYEB 3MPCA 1FH2A 1ZVYA 2GI7A 3VRIB 3OXSA 2NTSP 3E0GA 4GKSB 5MEQB 1QLRB 2HFEB 1V3MA 5K9OA 3W3BA 4R0LA 4XPFL 5DMGD 1IM9D 2KC0A 2DWEB 5JUEH 5FM8A 3KYOA 4XBPA 3OAYK 1T7XA 4R4FL 3T4AC 4F5CE 2MQCA 2XWDA 3UC0H 4ETQA 4WSKA 3OPZL 4ZFFA 1NPUA 4X99B 4YX2H 5A6LA 5HYEA 1KGJA 1Q0YL 2DQFA 5FFOA 3WJLA 4L4TE 3IDGA 2SEBA 3CAFA 2P43B 2VITB 5GGVY 2XA3A 1UM5L 2QDVA 2L7EA 1LEIB 4JFEB 1UKSA 3VXQB 5GZND 3IGLA 1Q9LB 4RFNC 5FFGA 2XV3A 1ZEAH 1UXSA 1S2EA 3CLEH 3EADA 2NLJA 2VDLB 3GSNB 4X9HA 3IPBA 3NAAH 5JPNA 5IJKC 3MCLL 4B9YA 3QS3A 4UOJA 1B0RB 5CWSB 2EDKA 1ADQH 4NENB 4OCYL 4DZ8A 1OZUA 4RIRA 2JK5B 2B1HL 4TL4A 1CDIA 3QPKA 5I2IB 3V0FA 1GYWA 4NQEB 3LHAA 4HH9A 3ZQ9A 1FZMB 2FBJH 2D3NA 5DZNA 4ZSOB 3DTXB 5CZXC 2ICEA 5ESAA 3QIUD 4X50A 3VFGH 2WO4A 3I85A 5DJCA 3G04B 4WKXA 2XA8L 4OR1A 1IM9A 1G0XA 5KTEH 1AR1B 1VDGA 4PRBB 3S37X 3BC9A 3L5IA 2GI0A 3JWOC 1XH1A 3LZLA 1XB6A 4D9RD 1P1VA 4H88L 5T1DL 4KKBD 4U3XA 1BAWA 3UEQA 4AGQA 4M5ZL 3C60A 3FF8A 2P80D 6PAZA 3T8MA 4N2KA 4MNQB 5I28A 4C54A 2IMMA 3PGFH 4D0CB 2OL3B 1DBJL 4NEHB 3BVVA 1D6VH 4R3SB 4E36A 3JSSA 1IQDA 3EGSA 5GZNA 2KQNA 4N2IA 1QLEB 3LNGA 4V2CB 1G9NC 1WF5A 2ATPB 4PREA 1EO7A 3BPLB 4Z95H 2E7HA 5J12B 2A9AA 4MJIA 4PJ8C 5JHDB 2F53B 2QPSA 4DGVL 2YQ2A 1ZLWK 3HC4H 3L9BA 3IGUA 3KL0A 4U1JB 3S5YA 1G87A 1ZTMA 5IQ7L 1LNUB 3NIFE 1CLVA 5T5NF 3PWLA 4CW1B 4XB8A 4QLWA 4BK5A 3FUHA 5CCJA 1KLUA 3QIUA 5FYKH 1SEQL 1ZAGA 5JDSA 3MI6A 3WKMH 3AS1A 4PG9B 3TTSA 2DQDH 2Y07L 4GKNB 3FAXA 3IEAA 3U4AA 1FL3B 5TDNB 4C57C 5DJ0B 4OZHE 3MLYH 4XHJD 4CSPA 5AOZA 3RVWC 2JKNA 4FZEL 5E7BA 1H8NA 5FX3A 1J1OH 3UTOA 2P80A 1ZCRA 1KACB 4G8GD 3K6SB 3MLRL 1UGKA 5DHXB 4MS6A 1PQZB 1J8HD 1JFHA 2YUWA 4XN1A 1JYNA 2HT3D 2BSTB 2QGEA 4NKDB 1II4E 3PHQB 2J5LB 2DQTH 2R7EA 5TF1H 4DW2L 1WIUA 3OPUA 3D50A 4XCNA 2YLKA 4KHTH 4EBQH 4G43B 3OWEA 1QNIA 1HHHA 1RZIB 4YLQT 3O41A 1WD8A 1ORQB 4JRYD 4TPRL 2AABL 4LOUC 2NW2B 1LK2A 3I6GA 3KWVA 1KTBA 4U1GC 2HFFA 5DJ6A 5TTRA 1MNNA 1Z9SB 1A4KB 3MFFA 1I8KB 4R0LC 4DPCX 1V7ML 3FYIB 4GW5A 3LCYA 1OWWA 1UJTA 4M1DL 1ZE3H 4F33A 2E4FA 4GT0A 3I2CL 3LKPA 4PB0L 1VZIA 5D96B 1H0DB 2DN7A 4XAKE 3LV3A 4YHLH 3TJEL 1S9VB 3WJLC 1UXWA 1JNHA 4L8BB 5CEYA 1KEMH 4G8GA 2X7LB 5DVMA 2R29A 1AYRA 2H2SD 4HKJA 3HI5H 8PAZA 4ODTL 1J8HA 3TFBA 4KPHL 2B1AH 3N5AA 3AU1B 3TONA 3IDMB 3QWQB 2CKBB 3P4NB 2VXUL 1MCBA 5F7WC 2A83B 3ZKNC 4XMTA 1F2XK 2EIMB 3IAGC 4HH8A 5LAXB 4GG6A 1X5XA 5D72L 2I32A 4PJEA 4NFCA 1M9WA 4JQIL 5BOZG 2FEEI 1CLZH 4X6FB 4Q9QH 5JW5B 1JIBA 5I0VA 1F45A 1ZA6B 2J8UA 3GTTA 4JHAL 1CF8L 4JRYA 4LEBA 1ZT4A 2ICEC 4H20H 3GS4A 3ARUA 5TPWH 2VC2L 5DMGC 5K9JL 1VAHA 3NIFF 4CBZA 5C0BB 4LARL 1ZLUK 2C7UB 3TYFA 3BPNB 4RISL 1FO0H 4G6MH 3K6NA 1JDCA 1OKEA 3FHQA 4OI8A 1A4JA 2YUXA 4NT6A 3EKCA 4YHNB 1I8LC 4B0MB 4F2FA 2GY5A 3ZDYB 1YYLL 2HSIA 1WFJA 3E9UA 4LASL 1OE1A 3C60C 2VMEA 4MMXA 4X6EB 1Z5HA 2AQNA 4I85A 1T04A 2VJ0A 2YPVL 1XQ4A 4OZHF 5IY5B 4YHIB 2V2WB 4Y4KD 2VL5A 2DQHH 4O51B 3VXMD 1QQDA 3FYEB 3UGEA 5GZNC 1EX0A 3U0PB 4JB9H 3EFOB 2RFXB 3W2DH 1KIQA 3LSOA 3MLWL 2C34A 2C9XA 3BZFB 1WS8A 2YFNA 1TT6A 2GK2A 5KVGL 1I4FA 3BJ91 1A3ZA 1XXFC 3N44B 5AENA 4XNBA 2ADJB 4OQTL 2D0FA 4MXWL 1IQWL 4E41B 3WV0A 4EI5D 5GGTA 1ZVNA 2VDMH 4CGTA 1MIEL 1SHWA 5IVZA 3VXOB 3HNVL 3ZE2E 2J1ZA 1MW0A 3QNXB 4BK5C 3E6FB 1LDPH 1U8CA 3QIUC 4UM8B 2WBWB 4JANA 5SWSD 3THML 3ULSB 3BLKA 5K5YA 2CCWA 1J0JA 4RWYH 2X6VA 1WWBX 1IEBA 1NAMA 4RAUA 5IR1A 3HW7A 1A22B 5E95B 4L4TB 1KGCE 1NGQL 5I1EL 1CK0L 1CLYH 4BELD 1L9PA 3F7YB 3M07A 2ESVE 2XQYA 2DYPD 4OZGE 43C9A 2H8PB 3VXRD 4Y4KA 2VDQB 1FQ9C 5F7AA 1JWUB 1JTPA 4HF5L 4JFFB 1KXHA 5AW7B 5INDB 3FTGB 4AQOA 1JGUH 1ZT7B 2CO6B 2LU4A 1IAIM 4CBPA 1YMMD 1I53A 3RG1C 3SY6A 3T09A 4DP8X 3WIHH 5FC9A 4XN8A 4OJFL 1S5IH 3NA4A 3U2SA 2ID5A 3U36A 4QRFA 2VLLB 1WK0A 2DWTA 3G5WA 3ZYIA 2NYZA 3G5YA 3EYOA 3PGCA 4ADJA 1S9WA 3IFOB 2FX7L 4IHOA 2M8XA 1QVOB 3SDAD 4CVZB 1YPZA 5SWSA 1X5ZA 5DVKA 5AW0B 1BECA 3KWTA 3RL2A 4P4RB 3BGAA 3ARGD 3D5OF 2NNCA 4LBEB 1H8OA 1BZDA 5F96H 5A1AA 1E4WH 4ODWA 2VQ1B 4LLYA 3K74B 1XH2A 2E9WA 5A7BA 5KYXB 1ZV2A 4U1IB 5JHLL 1UM4H 3GMPA 1MAJA 2H0FA 3L9RB 4H5SB 4ODHL 1NBYB 4XHJC 4ABQA 1I9EA 2BLFA 3DVIA 5IBTH 1MUJB 2NRDA 3WNLA 5AVVB 2DYPA 3DETD 4FMKA 2WVTA 2HT3C 1YN6B 3VXRA 1KELL 4RGND 4NSKA 2WW8A 1LWJA 2BRQA 4GAJH 4F8OA 4YXLL 1IVTA 4G5AA 4GBXB 3B2XA 1Q0EA 4OV6F 1XGYH 1G7QA 3KVDD 1CT8A 1TO4A 4F7TA 1YMMA 1MRFL 1Z9OA 1YUKB 1AY1L 2EH8H 3HI6H 4IU2A 4KXBA 3U0TB 3F00A 1OK8A 2BSRB 2OYMA 4FFYL 1DVYA 5I19H 3S4SG 1VCBC 3T8XA 1IGFL 2H47C 3ESOA 3I02B 3LDBC 4JVUA 5HTSA 4LSVL 3RPBA 3V9EA 5JXAL 4PR5A 2VGLM 4XO5A 1XF4A 3SDAA 4HOMA 1JYWA 3ZE2F 4HJJL 3R4DA 3DX6A 4GKZA 3L1EA 4G9DB 1CFVH 3ARGA 1T1XB 4YFLI 2YAHA 3GTNA 1OEZW 3P73B 5K93A 1JSYA 2CLZB 3SJVE 4DVRL 3IK2A 2UUDH 5LXVA 4MMXC 2V7HB 4HGMA 1NGWB 4CU6A 1E30A 2R29L 3BWUF 1OSPH 2P5EE 2HX8A 5IVXB 5J1AA 4JLRB 5GHWH 3O3UN 3ARBB 2H2SC 3SPHA 3TP4A 5IROD 2C9UA 3KD4A 3NZSA 4HETA 2CR3A 3DRQB 3EGXA 1H15A 4WEBH 3KCPA 3OKDA 1XCWA 5BRZE 2OMYB 4HXBL 2OZ4A 2BVOB 1DVFD 2P44B 3GRWH 1F3RB 4LCIL 3WUZA 3NTCL 2EEDA 4NRZA 3CFDA 2GSIA 4ONGH 4QF1A 2BJML 5J56B 1E4XI 5K9KB 3BT2L 2FX8L 3JZ7A 3AADB 1YEJH 3MTXA 2G3NA 4U6YA 2QR0B 3CZKA 1HU8A 3BEWA 1YJDH 5EU4A 2XC8A 4M43H 3JVFC 3TURA 2XV0A 2YS4A 1WQVT 1EDYA 5GS1B 5I1AA 2O5ZL 4GKOA 1PKQA 3ETSA 1UOVA 3S8WA 4Y5VB 3TNMA 3Q8FA 3QJFA 2Q87A 4HCRH 3FPXA 4N8UA 1JJUA 3S35L 5IB4B 1T3FB 4NN6B 2AK4D 3FQRB 4YDVA 1CDYA 1HHGB 1FG2B 4CDHA 5TDOA 3ABGA 4A68A 4CJ0A 4G9FB 4MJ6B 3VGAC 5IGXH 3GZQA 1RUPL 5GZOD 4Y4KC 1I1CA 3F64A 3MJWA 3K0YA 5IROA 1M6UA 4AIEA 1PCSA 2J57A 3WL9B 1DJHA 4EIGB 3O81A 5E1IA 5IMLA 1IT9L 1BAFH 1B9ZA 4I48B 1DVFA 5HDBE 5LCVH 3IRPX 2CUAA 4JY5L 5FF6B 5LWYL 3FDWA 1T20B 4KWUA 4F92B 4FXKA 3D8MA 1INDL 2ENPA 4K3EL 1OAZL 1U8OB 3LS5L 3LJ3A 1RZKC 3APFA 3ROLB 5ISZD 5HDQH 3BVTA 5FYKD 5JTWA 3VSQA 1IC1A 2UY7A 1DUZA 1N8ZA 3CU7A 3GSVB 4FTVE 4Y2NA 3UIYA 3FL7A 1VFOA 5JW4N 1P1ZB 1DJSA 3PREA 4YHYC 3JWDH 4LRNL 4HEME 3M17A 4P3CH 2V17L 4LLQB 2AK4A 2EIZA 1M9SA 2AXJA 3M1CA 2IGFH 2UVFA 4S11A 4U31A 2CZNA 1MW2A 5DZJA 4F27A 2H7WA 2O5YH 35C8H 1BX2A 3PF2A 1S7WB 3KLQA 4LOEA 5GZOA 3IM1A 2R2HB 4GAYA 3QNZB 2GJ6D 2XY2A 2ARWA 3OJVC 1XH0A 2WTOA 5GRUH 1QBLH 3CDZB 3O2WL 4WI0B 5HHNB 5CR8A 3QJHA 1SJHB 4U1HB 3WJJA 1TJHH 5EORL 1JMZA 3HE6D 1K5NB 5D1ZB 4CADB 3SO3C 2F54E 3Q7JA 4LO9A 5CINL 4XNZB 1RZFL 2K78A 3P0GB 2CRMA 4LLUA 3EYFA 2EDEA 5TK2A 1OAUH 4OFYD 1REIA 4P04A 5DEFB 1AKJD 1KFAL 3SDAC 3B37A 5ISZA 1M3IA 2YMOA 3TIEB 2DM7A 4CKQA 1QOKA 3ARGC 1K8IA 3BOVA 3NACL 2CH8A 4G7SB 5I18L 2NY2D 2MPAL 4WI7A 4FQXA 1E28A 1AXIB 1FLRH 1S3KH 2J88H 1M05A 4F15C 2ESVB 1SXAA 3HMWL 3QO0A 1W0VB 3AW5A 4OZGB 3RX8A 1DBAL 1L9OA 2F8OA 2DV6A 5D7JD 5AVXB 3IDJA 3L4VA 4KGLA 1J0ZA 3CFQA 3D3VD 4Y19E 3DETC 3DUUB 4M7LH 3DURB 3GKWL 1XH3B 3D51A 3EJQA 3WNIA 2GJ6A 1NFDA 3DOSA 4NLHA 5D7IE 1E50A 3CCHB 3N40P 1FVDB 2OMUA 1EHLH 3UYPA 4D7BA 2M2DA 1MVUB 3BP7A 3HN5A 2FATL 2X4OB 2PXYD 3HE6A 5HDBF 2Y25A 4XXDA 2V9TA 3TCTA 5CJQH 3O3EA 1NIFA 3F85A 3HI1B 3OQ3B 2FNBA 2O6FA 4PJBF 1MRDH 3X14B 3O3BB 4OFYA 2FJSA 3FN0H 3RUGE 3CZFA 1BYPA 5E2JA 4N8CL 1AKJA 1IKFL 5DK2A 3ML9A 2VN7A 2ATKA 3CFJA 3F5WB 5FIEA 2EC9U 3ILDA 2IANE 4HIIA 5ADOH 1S9YB 4LVOB 3PNWA 2WLLB 3CZLA 4WUKH 4C83A 1T0MB 1ETA1 1JHTB 1OHZA 4DUWA 4DGYH 1ZHBA 3CN0A 4F9LC 2EUZA 3U6RA 4OVUA 2R2CA 4HKZB 2FJGB 3KPLA 3BAYA 5EA0L 5D7JA 1HHJA 2BY3A 5KW9H 1Y1DA 3D3VA 5IROC 3SO5A 3ECQA 4HUXA 3SKNB 3EYUL 4G1MA 1TJMA 4I1PA 1CD1B 5DU7A 1OL0A 4RBPK 3VRLE 2WLIA 3LEXA 1KJVA 3EF7A 1KJ2L 2Q8AH 1YC8A 4IOSD 1N6VA 1WLHA 5JOFA 1G7PB 1U8PA 2PXYA 2XPZA 5E2UH 4E9QA 4FXKC 3FQWB 2KZBA 3CIAA 3NZHL 3H3BC 4KKPA 2PWGA 4CNIA 1TLMA 5D4IA 1NMAL 5F3FA 1JZEA 1FI8C 4G11A 4DKEL 2FHCA 4EUPG 3OPZH 3QK0A 1L3WA 5C09E 3SJVB 1AKPA 1YEEL 2WD0A 4QJ3B 1AZCA 4N0YL 2KDYA 2OXHA 3RWJB 1MELA 4U1NB 2UZPA 3A4EA 2YPKA 4Y8AA 5EU6D 4G42B 1EJ8A 1UM5H 3HJ0A 3TT3L 4PU2A 3EBGA 5GZOC 5ICUA 5ICZB 5E0FA 1KPUB 1NL0L 3N41B 4WDIA 3OKMB 4A2MA 4R96B 5EIQA 1N12A 1D5IH 1FRGL 4JRFA 3QZMA 4PVBA 3MCLH 1S9XA 4X5WB 2WWMD 3WJJC 4CU7A 4OCYH 5D7IF 1N6UA 4AZUA 2B1HH 3IGFA 4IOSA 2YQGA 1U8LA 4OVVA 3INUL 4HGWA 2X1PA 4M00A 1KTDB 5JR1L 4ZPTA 4KKNA 2LU3A 1I3GL 4YSTA 5GQBA 1C5DA 2NQ3A 5G5DA 3TBTA 1T21A 3ATEA 3RWIA 1LL1A 2APWA 3QXAA 3BH8B 2YD7A 3RUGF 1FLTX 3S4SA 3IS1X 3QEUA 4EDXB 2DY2A 4O2CA 4PW9A 5T1DH 5L8KB 1AD0A 2E0PA 3S5ZA 4FQXC 1B2WL 2NY6D 1RIVH 4M5ZH 4PP2B 1WT5A 3PABB 1KT2B 3LNIA 3Q6FA 1J9CT 4PRIB 4OFDA 1OO2A 2GY7B 5EU6A 2FYVA 1DBJH 1OD7A 3HE7B 4YSPA 5LBGA 2ITDA 2D7TL 5D55A 2ISDA 5HSFA 3US9A 1KCWA 3QQDB 3FRPG 3OKEB 4QPEA 1I7UA 1Q38A 4GS7C 4AT6B 1TFHA 2WBJD 3QWRD 1I8MB 1EZSA 1ILSA 3PAZA 2FJFB 1OB0A 1XWVA 4S1RL 1ZSDA 3GBMH 4KJWD 3ZY7A 2WXGA 5IEKA 2Z3FA 3F7RA 4KX8A 5IW3A 3WFDL 1NGZA 4QWWD 3DPDA 3VRLF 1BREA 3HE6C 5IFHH 1SXZA 4AUUA 1O7DE 2QKIA 4Z3HA 1J7VR 1ZANL 3HAEG 3Q8CA 1UYWL 2HA1A 3ULVE 5I75B 4PAZA 3AY4A 1TQCB 1MCOH 1GH7A 4NRYB 4J6RL 3W11D 3ZMRA 3GLEA 3ZTNL 1SEQH 2O72A 5MI0C 3RKPA 3TBSB 1K8DA 4NQSB 2Y07H 2FYYB 1G6RB 1U8QB 3OX8A 5DD3L 3CXDL 4RDBA 4G5ZL 2NY2C 5I66A 4HP5A 4YEFA 1KXQA 3BJLA 2H26A 4FZEH 4W4OA 3GXPA 2NCEA 3ECWA 3TVMB 1FVCB 1WICA 4FD0A 1YEDB 3E6HB 3U83A 1JWMA 4AYFB 4AGMA 4WLCA 1KGIA 3LB6D 5D7JC 1XZWA 1MZYA 1A7RL 2JWYA 2ZJSL 3D69B 6TAAA 3D87B 3EDEA 1MJJA 4IOIB 1AO7E 1IAKA 4XI5D 5IMKA 2WBJA 3QWRA 1MN4A 3BSZL 4UQIM 1FL6B 2V5TA 3L95A 4ZO7A 5FDWB 2O1AA 2F54B 4LVEA 2Y06L 1GCYA 3GSRB 3TC9A 5CD3B 1ZSHA 2PXYC 4NI6A 3AWGA 2D7NA 1VFMA 2ZOOA 1T2QH 3BLBA 3V6OE 1N7ML 1SEBB 4BQBA 5DZ9A 1EXUB 3N3EA 4CSZA 4XO3A 4POYA 3MR9B 4NNYA 2ZCLL 1DQTA 5EN2A 5LNGA 4G8FB 4JW3A 4M1DH 1ODAA 5DQDH 1Q72L 1MCQA 1AMXA 2CBMA 4L05A 4FJYA 4KI1A 5ESVB 3JUZA 5F7UA 3C5ZB 4PB0H 2YD2A 1A6ZA 3TJEH 4TRPL 2JXMA 1JAEA 2DKUA 1EXGA 3NJJA 5E9DE 5AEAA 1L9SA 5DRNA 1QPPA 3V0DA 5DK0A 4HIPA 4OSUL 3QDJA 4RDQF 4V11A 3Q9QA 4R97B 2VDPL 4Y19B 4UM9D 2E7DA 2KMWA 5ANME 4QHPA 1A9BB 4NKQB 5D93B 4PJHE 1MOEA 4WO4B 1BXXA 1G4MA 3IJYB 5DRXB 5C2BH 1UCTA 3MRMB 4Y1TA 1JPTL 3VWKD 1IO4C 3ZHLA 3TBYB 4UIMB 3IMSA 4MJJA 2XZZA 5D72H 3GRWA 4ENEC 4YE4L 3ZQWA 4JQIH 4HAGA 5BVJA 3AG2B 4HK0A 3C75A 1HHIA 5FO9A 1CF8H 4BM7A 5BUAA 4CMHB 2HVBA