1IM3D

Crystal structure of the human cytomegalovirus protein us2 bound to the mhc class i molecule hla-a2/tax
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PWFQIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESLKWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Antigen presentation subverted: Structure of the human cytomegalovirus protein US2 bound to the class I molecule HLA-A2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 18
structure length 95
sequence length 95
chains with identical sequence H, L, P
ec nomenclature
pdb deposition date 2001-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1im3D00
1IM3D
chains in the Genus database with same CATH superfamily
1MW3A 2GSGB 2ICCA 4LB8A 1CFBA 3D69A 5D70H 2Q7NA 4JY4B 1I3RB 2EDQA 2VQ1A 3VG9B 1ZSHA 3EYFB 1H5BA 3OHXB 4MAYC 5D1ZA 3RGVD 1G9NH 2FO4B 6PCYA 5CILL 4JO5A 5KOMC 3HHSA 1TU2A 3U1SH 4URTB 1MUJA 1QFUH 4ZAKD 5A7BA 2C9QA 5ANMA 3MLRH 1XBDA 2EDNA 3EGXB 2P5WD 2V9TA 5KBKA 4AOFA 2PYFA 5C09E 5J89A 2QV4A 1UQSB 3QIUA 4HJGA 5J8OA 5T3XE 5INDA 3OTTA 4FDWA 5F7EL 5EEYA 4Z7WF 4OGAD 2XWZA 2DICA 3IDJB 5J12C 2BERA 4XMKH 4YO0A 3U1QA 2VW4A 3Q5TA 4GXUN 4ODUA 2FH6A 4U3SB 1MOEA 3DXAE 4XC1L 3L4ZA 4YXLL 2K70A 4CRPA 1HQ4A 3PV6B 2B39A 1A21A 3VFTA 3WIIH 4PRBB 4UV4L 5B21A 1DQQB 2NY3C 3SDDB 3TONA 3UBXA 1CB4A 3WD5H 3D18A 4WV1A 3TH2T 3K7UA 4NQCE 1TETL 4WK0B 1JHKL 2NXYD 1OPGH 3IN0A 3L13A 1N7MH 4OZFG 5FYKL 5I8KH 2IPUK 2RGSA 3O6FB 3P11H 1OOWA 4FNQA 4XC3L 3ZZLA 4DO5A 4FC3E 4LQFL 1A64A 1QRNA 2VDLB 3NEOA 3AWGA 3MXVL 4Q0XH 3ZKQD 3Q8FA 4AEHH 4N0UA 4E5XG 3QUMB 3OLDA 4UT7H 4YBLC 4I13B 1BBJA 1RK1B 1NCBL 2WLJA 3A23A 1A02N 1E8ZA 5JIPA 5B8CB 3PE9A 4P48A 3TV3H 2GC7C 4QRQA 2YGQA 3G6JB 5AW8B 1VESA 3MJWA 4GY4A 4L4TA 5DSCA 3E6HA 1RV6X 5DHVB 5DA4A 5IW6A 4ZUSA 4JFDD 2DQUH 4FXGA 4CN6A 5I8CA 1OP4A 1DQLL 1NEZG 2PMZA 3W38A 2VXVH 2HJKB 1HN1A 2YZ8A 1BLNB 4AQAB 5D8JH 1M6UA 4ZOEA 4EVNB 4IHBA 1CIUA 3CUPB 3MRFA 1ET7A 4RFEA 3IJ9A 3IJYB 4L1SA 3VI4A 1I8MA 4F7TB 2WP3T 3I50H 1U2YA 4U1JB 3T0WA 3DTDA 3ZO0A 1O6SB 5JOFA 1MAML 4DGYH 4KKBC 1KCRH 3QUHA 1OGAA 2OYMA 4O5LL 5E95B 3EDJA 1MZYA 1MRCH 3G9AB 1K4CA 2IDFA 2KDGA 2LOEA 5FM5O 4S1SL 3SKMB 1EEZB 5E99L 1SJEA 4Z7WA 1I3GL 1TEFA 1TTAA 2R4RH 3N1MC 4JRXB 2C3GA 2BSCA 2ZUVA 3HIZA 3X3GL 4D9QD 1VFBB 2PNDA 5I8EB 4HLEA 3NT0A 4MA1C 3TCTA 5CEZE 3WLBA 1XGPA 3FUEA 1ODUA 3QIBB 4JN2A 4P5KB 3MTRA 1BWMA 4NZTH 1A6TA 1QI4A 2N4IA 3D39B 3SN6N 1JYVA 4R7LA 4Y1AD 4XN8A 4Q6YA 1OW0A 5EUKA 3D52A 3JWNH 3V9FA 4ERSH 1IM9D 2VLRA 1WA2X 3VH8G 1DE4B 4NZRL 4ONFL 4N4YB 3QCVH 3V55A 3GD1C 3LV3A 1A7NL 1IM3D 1G7IA 3MBXL 2X87A 1ZVHA 5IBUB 4KKAC 2VXSH 4GKSA 3OPZH 4KJQD 3N9GH 2A0LD 4X9GA 4I1NB 2OMVB 1WISA 5D7LB 3T0AA 3AG4B 2IXQB 3FQNB 6TAAA 1H15A 2XQBL 1CK0L 1QQDB 1UJTA 5G4MA 1P6AB 1GH7A 1I9RH 5D1QD 3V95A 5DJDB 3OM3B 3PNWA 1JNLL 3RU8L 4LLUA 2DM4A 1PLBA 5K93A 35C8L 1EDYA 2R2BA 1K6QH 2RACA 5ES4B 1JPTH 3NSXA 43C9A 1E8YA 3C2AL 1R3JA 1X7QA 2Z4QA 3TA3D 3EOAB 4L48A 4XCCH 1RD6A 1ASPA 4LNVA 1SY6L 1NCTA 3MMEA 1W72L 3IDUA 4X7FC 4MXVE 1NUNB 4OT1H 1NZRA 4YHLL 1YYLH 1U8JB 2YK1H 5AWNH 1LO5B 1D5ZA 3BUTA 3LEXB 3BQUC 5KTEH 4UZSA 2BVOB 1YY9C 2H7WA 2ZOTA 3HG1B 5A16B 3DHMA 4UILH 1U92B 4P5MB 2OMYA 3TH3T 3PWUA 1PLAA 3CSGA 4XHJD 2WPGA 3U6RB 4KUZL 3ECBB 5CR1A 3B43A 1FFQA 4JANA 2W0FA 1W72A 3WKML 4G6AD 4ALAH 4GRWF 1N0XL 3U46A 1USZA 1NQBA 3UDWC 2OMTB 1Z5LB 1FPTH 4WFFD 2JKWA 5IROA 4JFHD 1AO7E 5EOCJ 3QUZB 2AXGA 2ZKMX 4NAQA 4LRIC 5E94B 3H53A 1OAQL 5GZOA 3UFIA 2E7LC 4LLWB 4OCMC 1Q9KB 1TLKA 1LJMA 3PAVA 2X2JA 3L2LA 1C08A 1S7UB 2OXHB 3EDKA 4Z3IA 1NGPL 2ZZUT 1JSYA 4GAYA 4LSQH 3CDYA 4G2AA 5DQDH 1SOXA 3GMNB 4LVHC 5FYJU 3TH4T 3ILPA 1TLMA 1V7ML 1RZ7H 3HI6L 4TNFA 1U8PB 1BYOA 1TFPA 1PZUB 2C3WA 3RTQC 2ZXAA 3MUUA 4JM2B 5TD4A 3M07A 5BNXD 2DBLH 4MGXA 4HC1H 1MI5E 2WYTA 4CC4C 1FZOB 4E9XA 1UH2A 1MIML 4KK9C 4U6YB 4UTBH 5DZAA 1KJMA 3ZDZE 3K6FA 3FQUB 5C0GB 4YSAA 5EMYA 4M29A 2D03H 1F6AB 1NCWH 2VAJA 3T3PE 3K6OA 1XSJA 2ZCHH 1T2XA 5CZVL 4GRMA 1J18A 2HLEB 1WYJA 4I0KA 2W0KA 5I1GH 2EXWC 1EAPB 1OTUD 2X4RA 1DO5A 1NDGB 4ODTH 3MYJA 2XRAH 1BAWA 1PW3A 2FO8A 4LGPB 1LO2H 2D8KA 2F6AA 1GGBL 1YJDL 4I7ZC 4WW1A 4X6DA 2Y72A 4K3JH 1KBWA 2WWMD 4IOIB 3PWVB 1IC5H 4AK2A 3TIEB 5F7NC 1B90A 1IGCL 4XNMA 2HPOA 5LBVA 1IGYB 1DZ0A 3OQ3B 3T04D 1MFNA 3W2DH 1P2CB 1GTFA 3AY4C 4X8XA 3EJCA 5L9DL 4AGPA 2ENYA 2P8MA 2BOBB 2PWDA 3MV8D 5I16A 4HHWA 3ZIYA 5IR1A 1E27A 2VR6A 4DHLA 4MJIA 4YIQA 3F6JA 1UWXK 3S3JA 5KSBB 2DLGA 3DX7B 5SWZA 2DQFB 3QUKB 5HVFB 2HH0H 3HHRB 3PUCA 4HJTA 2DQTL 1DLFL 4WO4B 3D4YA 5AOZA 3ZIMA 3ZRCC 4FNPA 3KWXA 1BZOA 3VTAA 1DLHA 2ZSVA 4HZLA 4TSBH 1U8KB 3MV9A 3S3CB 1UXWB 4OFKA 3C8KA 4XXCC 5AUMB 1EQWA 2UWEA 3BP6B 5C1MB 3NIGE 2QZQA 4LPTA 4QYOA 4MCYA 1GS6X 4A7GA 3CVIH 1WZLA 3CHXA 7PAZA 3O4LB 1I1AD 4L9LA 4AQEB 5F97E 1TNMA 5C09D 2NLJB 5T3XD 3BGMA 3AB0B 1YECH 4EUPH 4NAJA 5F7MC 1NCUA 3VRIA 2QTEA 1QEXA 3O6KH 4KJPD 1H9VA 4L4VB 3VXUA 4XNDA 4NO0D 1UB6B 3IS0X 3CU1A 2XKSA 5MP6H 3QE5A 4ZMNA 3NJMA 2EXYD 2RALA 4KPHH 4KITB 4JQXA 3Q1SH 1QBMH 3BO8A 3WS6C 2DQDL 4EPSA 2CCWA 2CIKB 2RMNA 3FTYA 4JFFD 5I66A 4P57A 5KSAC 2IDSA 4RFNB 3R4RA 2XWRA 5AOLA 1VGKB 1BVNP 1R19A 1OALA 1U95B 3RUGB 1GC1L 3UAAA 3DDFA 3W5NA 1FNLA 1SBBA 1E2WA 1NOLA 4YHIA 3KPRA 3L7FB 4HPYH 4NQCD 5EO1B 1VFOA 3DV6B 4FFVD 4JO1L 4L1LA 2Q10A 1EXGA 3NCWA 1P9MC 1FUNA 5HHVH 1Z5YD 1ZANL 1LEKB 5D7JA 3SE3A 1RXLA 3DMMA 3ECUA 2I60L 2GIXA 1F97A 5HDRA 2AJXL 3P0YH 2V8MA 3QFJB 4Z7VE 4ES8A 4NDMB 2QGDA 4QCIA 5EFIB 4TULL 2FEJA 3OB0H 1QSEE 3DUUB 3GS4A 4U6VL 1BEYL 1FIEA 1K2DA 5CHNA 4M1GH 4DP5X 1DO6A 2XJKA 1XCQB 5DT1H 1QWNA 1Z1WA 2ALWA 3HE7B 1QLRA 1NMBH 3ZHFA 2CIIB 4PJ9A 4EZKA 3APDA 2APSA 4TL4A 5TPWH 3MODL 1UWGL 1DVSA 4M3JA 5CJ5A 5E2WL 2NXZB 1ZCRA 4M7ZC 2VZOA 5IP4A 2MCPH 2HN7B 1AVAA 1JN6A 2MNUA 3MBWA 4MA8H 4M5ZH 4XOBA 5DWPA 2JIXD 4MX7A 5FLUA 1G9MH 3T2NL 4TTGA 5LKNA 3H3KA 3II1A 1IKNC 3QEGH 4YGVA 5J6GA 5AKTA 4MWFB 3KPOB 3B2VL 4Y8DC 1AGCA 4GINA 3LYRA 4ZMXA 4MB3A 4ECNA 1H3TA 3NGBC 2Y7SA 3D4GA 1HC1A 3HB3D 3KCWA 3GMRB 4YDJA 3UTPE 4IK7A 5EZOH 3CC5A 3P3TA 3TEZA 1AD0B 2BCKA 1CICA 3LZLA 3B1TA 3FRUA 3WIHL 2D0GA 4LSSL 1ZTXE 3OR6A 3LDBC 1TG8A 4GBXC 3BRDA 1J1PL 1Z9LA 4Z7IA 3E2HB 4OFDA 4RISL 5LGYA 3IYLW 2HLFD 3DECA 4G43B 4PJ8D 1OK8A 4FXKC 1M42A 5E2JA 3TEXA 3V0VB 1X9QA 4OCYH 4RZCB 5DLML 2YD3A 5LWYL 2X1XR 4PREB 2VDKL 3AXLB 4U1IA 3CIAA 3MRKB 3FDWA 2IV9A 2CO7A 4YNYA 4XO5A 2DYSB 4ELDA 1HJBC 5JDSB 3S35X 2FX7H 1NOAA 3FCTA 3WCYA 5HPMA 4MMZC 1U93B 1H3GA 3GTTA 3IFLL 4TSCH 4DETA 1NEPA 2XOTA 1YQVL 3L4VA 4PAZA 1QKZL 4M03A 1FFRA 3ES6A 4Q89A 3OKKB 1JWSA 2FRGP 1IGFL 4FA7B 4JZJC 3GQFA 4PCYA 3W37A 4GS7B 3G08A 4N86A 2G5BA 4QKTA 2IOOA 3V6ZA 1IBGH 4L1DA 2CM5A 2YPLD 3K8KA 1FZJA 2GIMA 3LRMA 4MB4A 4M7JL 3UH8A 4NO5B 5LGHL 3U6XA 2EYSB 2JKLA 3MO1A 4OAWA 2J6EL 1FLRL 1JFHA 1F4WL 5D2NC 5F1KC 3OXSB 3VFRA 3EHBC 3JTTB 1AJ7H 4W9KC 4UQ3B 3ROLB 1RIUH 2P5EB 4GRLB 1S3KH 3V5KA 4CL7A 3L45A 4L8SB 3SPCA 4PCSA 4HUCA 3LCYA 3U6XS 1A1NB 5CJXA 3EYUL 4NNXB 1KDIA 2JFCA 1RZKH 1OE1A 4C4KO 1ZPLA 4L3FA 3E1ZA 5BZWA 4YK4B 3S36X 2QVFB 4X7DC 1AZCA 3WY1A 5IMLB 1G4MA 2FQFA 1Q9WB 3WNKA 4K3DH 1GSKA 5GISL 4RRPG 4YEEA 5FYLE 3EZJB 2N3JA 5KYUB 2ITFA 4LL1A 1AY1L 1BW8A 3N43B 4G9FA 2VE6B 4L8DB 5ILTL 4L8BB 2HJLB 2P5PA 3G5WA 3ZQXA 4M5TA 4QRPA 4HCGA 3FSAA 4LOUD 2XZAH 3N44B 4XNYL 2H32B 2NZIA 1ETA1 5CUSH 4Z7OE 4B5EA 1HI6B 1VACA 2P80D 1J8HD 3GBMH 1FYHB 1CG9A 5IKCB 3I6GA 2Y6SC 4DSYA 1WICA 2EEDA 2VN6A 4QTIL 3CV5A 4L1BA 4JQIL 5DWUL 2A6KB 1ZGLA 3KWTA 1BIIA 2BX5A 1AO7B 1MLBA 2HVJA 1MI5D 3EFFB 1GGYA 4X4YA 2GUYA 2C7FA 3N1GC 1PL3A 1S4IA 1E6JL 1VFAB 2DRUA 4EEEA 3HPLB 1CLOH 4Z6AT 1R75A 3STZA 1MWAB 3SGDI 3U9WA 1A4AA 1A4KB 2WNXA 4PJGA 1XB6A 2WZPA 3W39A 4E42A 1MFAL 3DNKA 4AGLA 4M8QB 3MACL 3WJLC 2GPZA 2CLZB 3SQOH 4FTVE 3T08A 4QWWD 3TBCA 1FG2A 4BJLA 4D7BA 3DGDA 5JTWA 5EBGA 1DN0B 3TBVB 1TJHH 4UUJA 3IU4L 3QUMH 1KOAA 4G11A 2V7HB 2HRPH 5JQ6L 1MELA 3V7MA 3HC4H 4QXVA 1FA4A 2MPVA 4ZPTB 4UQ2B 2BDNH 5HI3C 3ZDZB 4PSRA 4JAMB 4QRUA 1XZ0B 1W6WA 5AL0A 4ANVA 4JFWA 4RWHA 3I9GH 5ESVB 4NKIL 1E4XH 1RMFL 3FOLA 4R90H 2MKWA 5DHVH 3T1WA 4ICWA 1N68A 1T5KA 4ZMYA 2ZWYA 1U36A 1G0YR 4AV4A 1JZ6A 4WW2B 2XWBB 2BIIA 1KLFA 4OD2A 4LCWA 3HG3A 4G80A 3Q9QA 5JXAL 4F1ZA 1CURA 1AHMA 3BAWA 2OQJB 2XXGA 1E4KA 5F9OL 1CXLA 4K8RD 5TFSH 4XB8A 2WLZA 4AVHA 2R39A 4LNRA 3OAUH 1T7ZA 4LOFA 4Z0XB 4I0PB 1BPVA 1A7QH 5DRNA 3Q06A 1HWWA 2AAVA 3D87B 3HMWH 4OCNC 3U9UB 1IAKB 5BZDA 4LLYA 3LSOA 2XPGA 2Y2TA 3HCVB 4NLHA 1T89A 2CBTA 3TO2A 1QW8A 3HI1A 5KSVB 2OZ4H 1NKRA 3QCTL 4MMXB 5IWLC 3AACA 3GUTA 1IGML 3PFQA 5EU4B 5BV7B 4E68A 3PHOB 1KB3A 2AQPA 1BBDL 3MBEB 1NCAH 4HEPA 1BG1A 1LO4H 1FVEB 2G3MA 5E23A 5TDPA 5FYJL 4PJCF 5EU5A 2B0SL 4JJ5B 4S1RH 3MLUL 2IAND 2VLKD 3LKRA 4KO9A 4O02A 3RL2B 1PEZA 5HYJE 1W8EA 4GT0A 4HKXB 4YL9A 4NN7C 3UTTA 1AZZC 4D8PB 1U3HA 3BVNB 4OJAA 5SV3A 3WHXA 4BDVB 4HJ0D 2B3IA 2HVKB 2PO6D 3EO0A 4RFOL 4R7DB 3MRLB 4K5PA 4LHUG 4ZSOE 1KJ3H 1MJ7L 2PYEA 1SOSA 3M46A 3OLIA 2OAAA 1G94A 3B2PA 2LAGB 2Z7ZA 1JVLA 2HRLA 4KU1A 1BAFL 4KVNH 2PTTB 5DDHA 1XX9C 3MJ8A 3NP3A 1QSED 5F9JB 1D5IL 1WTLA 4N6QA 4N8UA 5DRXA 5GJSL 3T1FA 3VVWA 5I74C 2R1WB 1S7TB 4F2ME 4MSWA 3HRZC 4N0YH 4NZFA 3BZ4A 2G60L 2RBLA 4M4RA 2CXKA 3CDGB 4MCMA 4NCDA 1QBAA 4QRFA 1HHGB 4JREB 2BXZA 5KVDL 2PKDA 2XN1A 1LL1A 4KDVA 4Y4HD 1UVQA 2Z8VC 3VO0A 4ZFFB 3RBGA 3QI9D 1JWMB 4QF1B 5GGSB 2R0LL 4IRSB 3ZOAA 4PJFB 1CBVH 3QJZA 4LSPL 5FV2A 3OKOB 1YN6A 4LLDB 1FN4B 5F89B 3VSVA 4H44C 4HH8A 5ESAA 3FB5B 5LAPA 5AW4B 4ZX3A 4N6RB 2ZG3A 5CZXD 1OY3B 4XH2B 3QIWC 1NPJA 2ZAHA 3ULVC 3PL6D 1A9BB 2TRHA 4JRYD 2BOCB 4FG0A 1CL7I 5BS0E 4Y2OB 1WFIA 3D4CA 4UIKH 1N59B 4LDLB 3HUJA 1T4KA 1ACCA 3QJXA 2KUTA 4LSRL 4NKMB 4AX3A 2JKJA 1OB0A 4YHML 4YVNA 2J5LB 5K9QI 3KXFE 3N42B 5IB1B 3MRHB 4NKDB 4X5XB 3DURA 2VSDA 3EJUA 5TF0A 4X9HA 3UTPD 1MAJA 4JE0A 1KPVA 2DW5A 5ADOH 3ESUF 3F58L 3FTZA 1J48A 3LXUX 1KEML 3ARGA 2X4OB 4PJCA 1GGCL 5DZPA 3L3OB 1GL4B 4K9JA 1IBZA 4UT9L 3BAEH 3VI3F 3C5JA 4FLOA 5E4OA 1NIEA 2YIHA 4C56D 3NCYP 1LP9A 3FU3A 1VCBC 4OU3A 5DFAA 4BSWA 4ETQA 4RIRA 3S3DB 3DGGA 4P2QB 5JYLA 2V3EA 5C0DA 5LQBH 3B9KA 4JFQA 4UT9A 1RHFA 4R0LB 3WU1A 4IS6A 4MA3B 3IJEB 5D70L 1ED3A 1CJYA 4LXFA 5CKGA 5D5MF 3NJHA 3QPQC 4AIEA 3ARVA 2EDFA 4HMEA 1G9NL 4XPBH 3MJ7B 1AGEB 5K9JH 2DKUA 5HVWA 2NY0D 3U1SL 5KVFE 2A4CA 5GS0D 1QFUL 1QMUA 4RSVA 1UT2A 5DTFA 5CS7A 3MLRL 4NFDA 1TTCA 1XF4B 3MROA 3JYCA 1I1FB 3D07A 4LKXB 3O41A 1Y6KR 3IVKA 2ICEA 3FW6A 4ZDHA 1NC2B 4WFHE 1PY4A 1FZMB 5DK2B 2Q9OA 1T1WA 1NUFA 4XMKL 5C0NC 3GINA 3M17A 1OD9A 3FHEA 4PJ5E 4UT6H 4ZUWB 2E9JA 3JT2A 3PQYB 4HS6A 4U2ZA 3RDTC 2JKNA 3QQ9C 4YDZA 1IQDB 4MZ3A 2HLAA 4HWZA 3ARFD 3X12A 3QG7H 1GW6A 5F7UA 4JGMA 1CXHA 3PDOA 1CFQA 1QI5A 5BO0D 3WIIL 5SWSA 2X6CA 1CU4H 2D7PA 3UBHA 2LW3A 1RJLA 2J8OA 2J8UF 4J3OG 4YX2H 4G8FB 1PEWA 2AJZA 3FU7A 1AYOA 1OPGL 2FX8H 4B7LA 1N7ML 5I8KL 4AM0A 3P11L 1T0OA 3VD2A 1WWCA 4DO6A 4K9EC 5DMYA 4OCWH 3P4OA 3QO1B 5KBMA 4F15B 4Q0XL 2AC0A 4JMNA 3INOA 3H3PH 4AEHL 3H9ZA 4QLRA 4FEMA 4DGIH 4RSYA 1HZKA 3QP3A 4UT7L 2ZYSA 1XGUA 3TJEH 4G8GA 1MFBH 4KHTH 2B59B 3CHRA 3K72A 3NFPA 4AENB 3QNYA 4RAVB 5T33H 4JO4H 3FQTA 1O5PA 2XDHA 4NNYB 1XR9B 3TV3L 2QKSA 2WCGA 4XE5B 4N2LA 2D3NA 2Y24A 4P46D 3CSFA 3OKLB 4RDQG 4APQB 2DQUL 4PJBF 3C9NA 3GPEA 3IGFA 3VD7A 2X9WA 2VXVL 2BINA 4PWJA 4KY2A 4KY1H 1DVUA 4WJ5A 5D8JL 2CK0H 2EYTB 4LVNB 4GYBA 2PCXA 2VERN 2X70A 3K2IA 5KUMA 4M5SA 4N90E 3V52H 4YLCA 1KLGB 1ORSA 3OZLA 1A6ZA 1MNUH 1JNHB 3I50L 4MAYD 3DO7B 2GJRA 4WUUA 1TZAA 2DN7A 4PLKC 4Z7OB 4DGYL 1KCRL 1TEGA 1KTRL 4NQXB 1PG7W 2E9BA 3FQ2A 3ZHDA 1BQHA 1XGQB 1AR1D 2FWSA 3CFIC 1MRCL 4ACTA 3W0WA 4F7CB 1JL8A 2P9RA 3HFFA 2XTJC 4LL4A 4A2HA 3APNA 3IK2A 3ILQD 3OSKA 1JWUA 4V2CB 2R4RL 2ZCKH 1WC7B 5F8RC 4BCXA 4BZ2A 4RQQB 2L8AA 1DEEA 1NINA 1JNNH 2H1LM 2WLKA 4IGBC 4ZS6C 3RPKA 4NZTL 1NDMB 2DYPA 3GM8A 1IGJA 4ES9A 4GW4B 3BD5A 4H8WH 3LRSA 4AT6A 4ERSL 2JE8A 2EDXA 2DIEA 3D0AA 4FTVB 4UDUB 4EN3B 4CW1A 4U0RC 1QRKA 2JJTA 2EDDA 2P8LA 4AGNA 3QCVL 2TSAA 4UQAA 3EUUA 2LLLA 3HBQA 4IKKA 2J8UA 2XV2A 3O8XC 2VXSL 4AJ0A 3OPZL 3CHPA 1UB5A 4HS8H 3N9GL 3HN3A 2BWIA 4AZ8B 5EIIA 3BP5A 4HX1A 4KROC 4LPCA 3MLPA 5AW0B 3BT0A 1E5UI 1R3LB 1MCCA 1BQSA 4PU2A 1AGBA 4YSUA 2JH2A 3LZFH 1AIFB 5FKPA 1EHLH 3D3VA 3ML9A 3SPJA 1I85A 2XXMB 4F2EA 1I9RL 1RPQA 4Y16D 4KX8A 5DRZA 4W9HC 4WFGE 5DO8A 3DX0A 1CDIA 1FJ1B 1ZS8B 2VIRB 5D7IF 2DEWX 1ICTA 2AK4D 2VLJE 1K6QL 3KNBB 1JPTL 3WTVA 3GSWB 2XWTA 1A6PA 5F88B 4HIJA 3MOBH 3QZWG 2BPBA 4XCCL 4RZKA 3NJKA 3TNMB 1M3IA 4ELME 2MIZA 2I7SA 3T77A 3EF4A 1KTDB 1V3JA 4LO9A 5K33A 2OK0H 4KVCH 4OT1L 4K15A 1YYLL 2YK1L 5AWNL 1U8OB 5KTEL 3VFVA 5HYJD 4R5TA 4UILL 3KPPA 1PMYA 1KTBA 2FECI 1YUHB 4X7TB 4YAQA 1GYCA 1U4EA 1KBGH 4OTXH 3S4SA 1DSFH 3V9CA 3N0AA 4H26A 1NSNH 4ALAL 1JYNA 1TQUA 5KBPA 1AXTH 5CCKH 5CEZH 4AC2A 2Z35A 4X9IA 3FONA 4YBLB 4PJXE 3VE0A 1FPTL 5DZOA 1KCSH 1PYWB 4X4ZA 5C0EA 4UZGA 4CILA 1XB3A 3UC2A 5CMAB 5CBAA 3P4LA 3QQ3B 1E3XA 2G75B 5DHXB 1R3IL 5IMOA 4Z7UE 2XACC 3WFCH 4WGKA 3BISA 3BVXA 1RZPA 2CHZA 5F1IB 3S5YA 1I7TB 2Y5EA 1GW0A 4LSQL 5DQDL 1KN2H 2Q7YB 1IV8A 2FYYB 3IS1X 4ODBD 4ADIA 4F37F 4IBYA 5GS1A 4Y19A 3SDXA 5I1JH 4LKCB 1RZ7L 1P7QB 1MFCH 4HH9A 1DVFA 1J0YA 3PGCB 2CWRA 2P24A 1G7JB 5K39A 3DYPA 2DBLL 3IXTA 1AQDA 1P5VB 1KB5A 3ERXA 4HC1L 5DJCB 3UTSD 5AVTB 1NGXA 3VFOA 4UTBL 3QXDB 1C5BH 1J87A 2FECL 3LN4A 1B0GA 2D03L 4TVPE 5FF6B 4F2MB 4QLWA 1NCWL 3SKOB 4BZYA 1HH6B 4EF3A 2ZCHL 4MA1B 2BWDA 5C0BD 3ESVF 4M9PA 1HXKA 5I1GL 3KXFD 5DMKA 2MWCA 2ED8A 4ODTL 5F7DB 2XKUA 2XRAL 1LEGB 1LO2L 1ZVSA 4NNPH 4PCTA 4OZIF 4K3JL 1M7IA 3QS2A 1IC5L 4IEFB 4AQOA 5ID0A 2H2PC 1E30A 1GS8A 2H32H 2J1XA 4Z7QF 5EBMA 3VFWB 4A04A 3O3DB 1EJ6A 3W2DL 2AFNA 2FVNA 3UJIH 1HS6A 3IMBA 2WTOA 3EF7A 1INQB 5BS0B 1NL0H 2ZP8A 5D2NE 4N8VB 3SPVB 3WE1A 1OP5H 4AKPA 2IGTA 3BQUD 2PXYC 3KYOA 3FC8A 1INEH 3G9VA 1UH4A 1NCIA 2XV6B 4E0RA 5L7XH 1J9QA 3Q8AA 5BRPA 1PG7H 5FDYA 2HH0L 2D73A 4NPJA 1NIFA 3FHQA 4PPTA 1QEWA 3CH1B 3TN0C 3BMWA 3EOBB 4TSBL 1XF3B 4JUSA 3V6BR 5KS9E 4ZQKB 1I7RA 1KTKE 3WO3B 3VYPA 1FGVH 3ARBB 1L7IH 4N1EA 2BSDA 4XVTL 2HYMA 5I1LA 2GI7A 3SD2A 4N9GA 4KK6D 5EORH 5G55A 4KKCD 4PS4H 4X5PA 4O2EA 4UM9D 3S5LB 4FYSA 1E28A 5K9KA 3TWCH 3UTOA 1AXSA 1YECL 5J4MA 4I2XA 4BQ6A 4WFHD 5ITFA 1CFTA 2NT1A 3O6KL 1JK8B 2HT3D 3OLEA 4HSAC 4ODWB 4DEUA 4PJAE 2FWUA 5MP6L 4XI5D 5HHMD 2A74A 3CCHB 2JCCA 1BD2A 2EUVA 3RIFF 3QH3A 4KPHL 1AACA 5B3JF 2DF3A 3FUJA 5JXEA 3Q1SL 1QBML 5JPNA 3OV6A 1HCYA 3RX9A 4YLQT 4BFJA 4J4PD 1FHGA 4X8JA 1YJDC 5E2UH 2FIKA 1BAGA 3B8YA 3O45A 12E8H 1V10A 5C2BH 3FRPA 1U2HA 2BSRA 3BKMH 4X6BB 3WGUB 3SODB 2YBRB 3G04B 4HPYL 3GJFB 2VXUH 1SN2A 2NY2D 1WVZA 3OB8A 5JW5B 3VD4A 4GAAA 5HHVL 1IC7H 3O11A 3JVGA 4LVHB 5HGBB 1J1XH 2GUOA 4OI9A 4R97C 4OFVA 3SJVA 3ZDYB 1MHEB 3P0YL 2DQMA 4PJ5B 4RVBA 2DMBA 2HJFB 3RTQB 2ADGA 1KUMA 1TTFA 3SDAA 4HYTB 4C54A 3AQZA 5IMKB 1FH2A 4J3SA 2VISA 4NEHB 2FR4B 4JFEE 4M1GL 3LXAA 2VO5A 3QPKA 4W4NA 5BV7H 2EJ1A 1QBBA 1HYRC 4MNGB 5DT1L 1CWVA 3L08A 1NMBL 1T04B 3I3DA 4ZXBA 3NQKA 2BNQA 1I9JH 5TPWL 2PWFA 3UTZB 3WUWG 3EGSA 4AYEC 1X5IA 1Q72H 3UAFA 3N1PC 4PJ7B 4WSGA 5CSZB 2BMKB 5F0JB 3T4AA 3UX9B 3RGHA 4F5CA 2BSSA 4Y2DA 3TBWB 2CD0A 3IDGA 1Y1DA 2G2RB 2MCPL 4GOSA 2EC9T 1DVXA 4RGND 2OL3A 5CNHA 4CSSA 1TQCC 2H1XA 3OJDA 4MA8L 4M5ZL 4N90D 5GRXG 3SY0A 3DOIA 4GUQA 5I1DA 1G9ML 2A5UA 2IH1B 5LAXA 1NFDA 4GG6A 4EI5D 2M83A 2X6UA 3AXIA 5L2KB 3ZYIA 3QEGL 1ILUA 1KGJA 3FQRA 3GLZA 3GEFA 2EVGA 5HHOD 2CLRA 3MNWA 1AHWC 3MRBA 4IJTA 4NOFA 1K8DB 2WBKA 3NSDA 2Q3AA 4X5QA 2G9KA 3AM8A 2A9BA 4O51B 5KANI 1EA9C 4PVLA 3II2A 3HBGA 2YZ1A 5C0IB 5EZOL 1TYRA 2W60B 2PWHA 4PG9A 4H25A 4FQ1H 1S7WA 5E4EC 3DHJA 4FCHA 4W9LC 3D25A 1CDHA 1EMTH 1HHIB 3NOIA 1NAMB 1W0WB 5DQ9A 1CI3M 5JIQA 4OCYL 4OF3A 5KZCD 4H5SB 5IREA 4XOAA 3L3JB 1FNGB 5KSAD 4AYSA 4HEME 3DJZA 2FX7L 3FFCE 1BGXH 4B96A 4M62H 1DBJH 3RGVB 2Y3AA 4Y5VA 1XQ4A 4TSCL 2AXFB 2C1OB 5MEQB 1F42A 4CVXA 1E67A 1I1RA 1JK9A 2HVBA 2MNJB 5C8JB 2ARJB 2C3VB 3FTWA 4MCZA 4ELKB 5CZRA 2B1AH 4ZAKB 3L3HB 5C0JA 1LWJA 2YPVA 2AERT 2P5WB 3MA9H 4X6EA 3K2UH 3VGAC 4PJHA 1IBGL 1F3DJ 4M48H 5CEXA 1AHKA 3MTXA 4ABVA 2ZOKA 4MDRA 1ZLVK 4B41A 4D0CB 2H3NB 1EUTA 1LK3H 5F7AA 2CGZA 2IAMA 5BOJA 1KPRA 3QG6A 4OJYA 3JT0A 4GSQA 2YXWA 1SYVA 3IDYC 5EU6A 1DBKH 1JV2B 5BMFH 2WYZA 3FTSA 3MV7D 1RERA 3N06B 3QWOA 3WFHA 2KLSA 2C4FT 2NY6C 1AJ7L 2UXTA 3LIZA 3PXHA 3P9MB 4Z76B 1RIUL 4MBRA 1S3KL 1HE8A 3NZHH 1JGEB 3P4MB 4YHPB 4JPKH 2DH3A 3QXAA 3AMKA 3TJPA 1SJMA 1JD9A 1AZBA 2DJMA 1AQKH 5E6IB 2WXNA 2A6DA 1IX2A 1RZKL 3ULVE 2XLLA 2AQ3A 1NMCB 3BI9X 2VLJB 1LE9B 2NXYB 4K94H 3HG5A 1ZTXH 2ESVE 3G6JF 5DVLA 5JA9A 1AQHA 1A2YB 3P02A 2BC4A 4K3DL 3GZKA 1IGTA 4OLXH 1S9KC 1BFSA 4WU7B 3KDMA 2DI8A 5HYSA 1HTYA 2GJJA 2K0RA 4RAUA 1RLBA 4Z78B 2WK2A 3JWDH 5D1XC 5IQMA 2NUPB 2ZXEB 3E6FB 3FT2B 2FSEB 3BUQA 4M7ZB 1WF5A 1A6WH 4HGKC 3P3SA 2XZAL 4AWJC 1ROWA 3V10A 5CU9A 5CUSL 1E43A 3VU1A 1K9TA 4KK8C 3GBML 3IF1A 3CVCA 2Z6FA 4X0KA 5C0CA 4U1LA 4PJXB 3GSRA 4CGTA 1XH1A 4XTRD 4L0PB 3REWA 1T22A 4ICXA 5IQ9B 3CDFA 1TQSA 3R4DA 4GUOA 1M2VA 5EO9B 2V2WB 2W65B 1G7LA 3FTXA 4OJFH 3K71A 2G2PA 3N41B 4MZ2A 4N2BA 2CLVB 5AYUH 4XX1G 4TVPD 3GHEH 1E2VA 3WY2A 4UMGA 1J8RA 3OAZK 5D71H 1DJIA 2XKNA 4MJ6B 1J0JA 2F7IA 3OGCA 1EUUA 1FV1B 3SQOL 3LPGA 2R27A 4GBXB 3PLYA 1XR8A 4C83A 3QNXB 1FZKA 1VF5C 3MFFA 1MLCB 1RIVH 3KL0A 3WIFA 4DUXA 1TJHL 5AVUB 1TSHA 4QTFA 5C70A 2YHGA 3NJFA 2OMWA 3FO0H 3QUML 3WNPA 1IC1A 1XSIA 2HRPL 3ZKXC 1MJ8H 1UTDA 2H6PA 3JVFC 2BDNL 4PRDA 5E51A 2CJUH 1PKQA 1GOHA 4Y1AB 4ZX6A 2WHVA 3D34A 3DYOA 2LVCA 3I9GL 3L5IA 5AOJA 3EHBD 1E4XL 4MMZB 2D31A 4R90L 4JGNA 4LCVA 2ITCB 1RK0B 3ZT7A 4UF7C 2B1OA 5G4NA 5FYLH 2EVFA 4LPUA 3G6AB 3TZVD 3BKYH 3T0EB 1P1ZB 2ZP0T 3FFDA 4JZJB 5DR5H 5F44A 4AEIH 5DC4B 2BFVL 4I5BA 3L4WA 3S2CA 4U6XB 1T21A 4YBQC 2EDHA 4ZPVA 1X4XA 4L3CB 3KGRA 4NRYB 2EIEA 1SZNA 3O9WB 2BVQA 5CWSA 5AFAA 2WSDA 1ZE3H 3KGUA 5SX4H 1R5VB 2OULB 1M1SA 3V8OA 2XQYK 4JM0A 5IB2B 4GJTB 4NP9A 2QR0A 5EC2A 5D1QB 5B1AB 4F2FA 5EB9A 4TSAL 5AVRB 1KEGH 1NFIA 1A7QL 4UNTA 5D2NB 4KWUA 2WXLA 2NW3A 2M2DA 2R1YA 3BN3B 4TUOA 1E50A 2GJ6E 1A3LH 1U8NA 3KG5A 3DO3A 2GABA 3HMWL 1KIPA 4B6ZA 2A73B 3ATEA 3GXPA 3HPJA 3CFBB 3D0LA 4G7SB 3VD0A 1S7VB 3HS0C 4NQDE 4P2OC 1ZGLP 3L16A 2AMUA 3MRCB 5ISZE 4HU2A 5EZLA 3LZQA 2OZ4L 2VR9A 3RB7A 3IXAB 4PRPE 1HEZB 4YDVB 1R3HB 1L9PA 1GOFA 4WWKD 4Z3GA 4FTDA 2AJ3B 1M71A 5JZ7D 1NCAL 1YNTA 4F9LC 3ATBA 1LO4L 4JFDA 8PAZA 4HJEA 1QATA 4S1RL 2FJGA 1G7HA 4Y4FD 3TBYA 4G5AA 2OZ4A 1RIHH 2B4CC 2G9HB 3MR9B 3FS9A 5EO0B 5EZJA 3QORB 4XP9H 5EV7A 2HMIC 4U1MA 4JFUA 1DJYA 4ZFOA 5F0MB 5KYXA 2X40A 4A6YB 4HIIA 4TM9A 1RZIB 5DK0B 4KRPC 4LBEB 2WQSA 5ANHA 4JM2F 1NJ9B 1KJ3L 1ZT7A 2OMXA 4ANUA 1VDGA 4NRZA 2EDYA 4J7RA 2RAMA 1AKJD 4KVNL 3L9BA 1QOKA 4I77H 1MVUB 2XTJE 4HULB 2ZNXA 4RH4A 2F19H 4JFED 4N0YL 1JPEA 2LGNA 5F7WC 5HGAA 3T9WA 3PRZA 2YC1A 3U9PH 3Q7JA 2D7NA 3DARA 1IE4A 2DKMA 1Z9OA 4AVJA 3LKNB 1IM9A 1INDH 3NABH 1XSOA 2NUTB 3VNYA 3RFZC 4LARH 1CBVL 3IJHB 1IM3A 4M9OA 2VW7A 5DJ6B 5B4MC 3RP1A 2X9YA 4ODHH 5DQJA 1P84K 4QHMB 4WIQA 2IF7A 2GSIA 4XWOC 3BD3A 3LNIA 1A7RL 3T0VA 3VXSB 4J5VA 2WLHA 2VGLM 4HUVA 4UIKL 1HXMB 2MTAA 4I88A 1VKXA 3C5SB 2VN5A 4MD0B 4HMCA 3TCLA 3GMOB 1BEXA 2B16A 3D2UD 4NWTH 2NYKA 4OZ4B 1OAUH 4NBXB 3L8QA 4FD0A 4QHKI 5EA0H 5KSBF 4H8UA 3TURA 4R4ND 1L5GA 3TA3A 2GFBA 2LFGA 4MNQB 5ADOL 3L5WA 1L3WA 1T1ZA 3BP7B 1FCCA 3HG2A 1JGDA 3BPCB 4EDXA 3CZFA 4CDGC 3BAEL 3NK3A 4L0YA 4PJIA 3DSNA 4JG0H 4OY9A 4Y4KC 2P26A 4NN5B 3CJJA 3WE6A 2RIKA 3MOQA 1WIPA 1YN7A 4Z77A 4LOEA 4IKLA 5LQBL 3FFCD 4R96B 5IW1A 1X5AA 4P5TB 4NBYB 2Y5QA 5DEGB 4AVKA 4ISVB 3UIZA 3ME0A 3SHSA 3V9EA 2X6VA 2Z0BA 4KUCD 1F00I 3LEYH 1J9RA 5IV2A 4Y9CA 3VWJC 5JW4R 1ZT4A 4OIIH 2R0ZH 4OZFB 1G7QA 4PBVC 4XPBL 1PIFA 2XETA 3T65A 5K9JL 2F53D 2K3TA 1LGVA 3I85A 3HR5A 1UJ3A 1HSAB 4HGWA 5IT2H 4XNAA 3FT3B 4PQXA 3RUGF 4E5XB 2VDPB 1DANT 1W9XA 4QHLA 3BKJH 2A9NH 2WXPA 2CO4A 4NN7B 3KM1A 4G6FD 3RZCC 4DVBA 1LMIA 3RY6A 3UYRH 1OHZA 2AEOA 5E0FA 1OLLA 4QYAA 4FABH 3E0GA 1IE5A 5I17A 2J2ZB 3V4PH 1EXUA 1EO5A 4UT6L 2GAZB 3ISWA 4OGXH 4ZO9A 3VUAA 4BRVA 3D9AH 1AQ8A 2IH3A 3X1BA 3UL4A 1N67A 1M7DA 3QIWD 3QG7L 3KJ4B 3VRJA 4CN4A 3KW8A 4XNBA 4ZMZA 4OZHB 1CU4L 3F8UB 5I74B 2ESVD 3IRZA 4YX2L 1WK0A 3HRZB 2X7LA 4IBZA 4X98B 5FEBA 3CU7A 2FX8L 4GUPB 2H45A 4LCCB 1OCCB 4EI6A 5FM5M 3GM0A 3ASWA 4KDWA 1YEDB 5KYWA 3F2LA 3B7TA 3CMOH 1SHWA 4OCWL 1AG6A 4NPKA 1KYAA 2WINA 4DUVA 2BS9A 3EJZC 4DGIL 4DW2H 3TJEL 5AZUA 1MFBL 3BIBX 4KHTL 2YSSB 2ADJB 2QSQA 5ICZA 2OTUA 3AMLA 5T33L 4JO4L 3F12A 3MV8A 1A3RH 5A7EA 1F4XH 1EFXD 3OKDB 4KBPA 4OKVA 2ZAIA 4P3DB 5EEZA 2AV7A 5C6TH 3VH8B 2KPNA 4IIQC 5KVFH 3QQDB 4WI8A 3MCG1 3UPRB 3GO1H 3BGAA 4QY8A 3OXRB 5MERB 2MHAA 4KY1L 3LB6C 3AAZB 2CK0L 4KHXH 3TGXA 5MEOA 2DWYA 3L7EA 4QHUA 1VAHA 3GJFH 4H0HB 5T1LB 3V52L 5T3XL 1MNUL 4GQRA 1UD2A 3W5MA 5C97A 1S78C 3PWPE 3QPQD 5GJTH 1NBCA 5A1AA 3OR7A 4IRJB 1MJJA 3TFBA 2IQ9H 3WO4C 3QA3B 1I1AA 4A68A 3HB3B 1CFSA 3CFKB 4F8PA 5C09A 4HIEA 1MWOA 2CDFB 1Z9PA 2HFGH 4F8OA 3QFDA 2ATPA 4Y8AA 2A9CA 4BYHA 3QJFB 1OAKH 4XNQA 2ZCKL 1MFMA 2WB1A 2PCPB 4WSJA 1MVFA 3A6OA 4NO0A 4YWGH 4PG2A 1JNNL 1AP2B 3V4LA 5GGTH 3ROOB 3I02A 3DXAA 5C0ND 4KMQA 4XBPB 1ZHLA 4H8WL 3MUGA 3MX0A 5E6YA 1XL4A 2Y7QB 1SPDA 1TOXA 2Z8RA 3QO0A 2AQSA 4HIPA 5HD8C 4QRSA 5LGKA 4JFFA 3PWLB 4UIMB 4E41B 1WD8A 2X1PA 1FVDB 4UTAH 1WBZA 5ESQA 2YXMA 2BY1A 5EC1B 3RJQB 4XAKD 3VXRD 4PY8I 4H4NA 4NQCA 1WJ3A 5E8OB 3LPOA 4FYQA 3E80A 5L8LB 1TQTA 4XPGH 4XMLH 3FU8A 2ZUQC 3RVTC 2VZVA 2ZX9A 1TZHA 4Y5YA 3LZFL 3UZQB 3HS9A 4ZYKA 4IU2B 1EHLL 3L5HA 4L29B 3RNQB 1I75A 4H7VA 1BJMA 1Q0YH 2EDOA 1H8LA 1QAWA 1VA9A 2CDGB 3VM5A 1F2XK 3JTBA 4L18A 3HLAB 4PV9B 3OZKA 4X4XA 2X4NB 3Q8CA 1KCKA 3ZX1A 2HTLD 4B9CA 5C3LD 2OMUB 3PIQA 4NQDD 3C5ZA 3L4YA 5ISZD 3SZKC 4WGVB 1S7QA 4FYTA 2X38A 3MOBL 5FECB 4PRPD 2WSPA 1U58A 1NAMH 3QZPA 4M61A 1XTLA 1LDPH 1K5NA 2DM7A 4PB9H 3AROA 1AI1H 4KVCL 4RMQA 5F6HI 2XN9B 4BK4A 2OK0L 4MXVF 4C47A 1N4XH 1SFHA 1GTNA 4JPWH 2L7UA 3ATDA 4Q6IC 4BFBD 5I1AA 3M1BB 2D4FA 4NHUB 3BWZA 1IBYA 4W6WB 4PJEB 2I32A 1KBGL 2JIXA 4OTXL 3VTTA 1DSFL 2O5ZH 3N44F 4FG6D 1NSNL 1J9TA 1AXTL 5CCKL 5CEZL 5IEHA 5TE6H 1F1GA 4OQTA 4PLKD 1KGCE 4G6JH 1UZ8A 1VEOA 1KCSL 3WTXA 4KDTA 5I82A 3MC0A 3LZOA 1KIQA 4UDTA 1FL6A 5FB8A 2DJSA 3JWNC 4XN1A 4L1HA 2WVVB 1WIUA 4NRXA 3ZE1E 1I9IH 4F7EA 2YO3A 4XX5A 1RURH 2E27H 4FFWC 4PUBH 1KIRA 5JPMC 4HLJA 3SE9H 1RAMA 2WVSA 5I5MA 4JS7A 1U8IB 3UBGA 3WFCL 3T6QC 4NKOA 1QRND 4E9RA 1HYSC 3TT3H 4KZDH 1UH3A 3IETB 1KN2L 5B1CA 4BQBA 2E5EA 4ZS6D 1KLUA 4BH7A 1ET5A 4PJ8A 3V7AE 4CDHA 5CN2A 1FC1A 3DJSA 1ONQB 4FNRA 4G71B 1WLHA 5I1JL 1MFCL 2NQDA 3IKCA 1ZLEA 5FYKD 4ODXA 4YJZL 1NGYA 4K71B 3PCYA 2UZYA 2WLIB 3OF6D 2GG1A 1IEHA 3A21A 5FO7A 1UXSB 3QXWA 3F7RA 1XH3B 1OTTC 3BUBA 1LK2B 1I8IA 2XA3A 4Z7AA 3REVA 1YLBB 1C5BL 2OR8A 2QEJA 2XWDA 4P23D 1WGVA 5DMIH 3ZDZF 4MTMA 5I0DA 1VPOH 2BIPA 3K2KA 4JKLA 3T8XA 3L5XH 3SQRA 2GBVA 2PPFA 2E6PA 3RURA 1KV3A 1CGSL 2Z4TA 2W0PA 4IGBB 2DM2A 4OSUH 4AVIA 2O61A 1G87A 3DX1A 1GJUA 2P46B 1YEIL 4OIFA 3ZO9A 3MA7B 2WXRA 4WW2F 3OG4B 5CZKA 3EYVA 4NNPL 2YPLA 1P5UA 4OFYD 2NY1B 2EEAA 2IO5A 3Q3GA 2APXA 3P9LB 1G6RH 1ZWIB 2C1PB 2CKBA 2OSYA 1JHLH 2XWXA 3VRLE 1KYOJ 5E1AB 2YKKA 1T0MA 3O8XB 3UJIL 4N1HB 3A4EA 3B7SA 1BMGA 1PCXA 4FKKA 3FU9A 1NL0L 4KROB 1OB1B 4LOVA 3KMDA 3STLA 4OIBA 2XG4B 3ELQA 1JPSH 1D5BA 3KE0A 1INEL 3M86A 3OQRA 2VR5A 4LVOB 4YHYB 1DQMH 1AGDA 4QOKE 5L7XL 3MRPB 2E75C 2HT2C 1FORH 1CE6A 1PG7L 2AV1A 3ZL2A 1FL5B 3Q48A 3GSVA 4GKNB 3CDZB 2V2TB 2YOAA 4FFZA 2IBGA 5D7KD 3WMPA 1DQTA 5FGSA 3QDGB 2G2NA 8FABB 5A6LA 3BVDB 3IGKA 4OGZA 5AAMA 3PAYA 3KPMA 3AVEA 3TJHC 1B0RB 1FGVL 3DI3B 3FSVA 1L7IL 4FQIH 5F1SA 4DPAX 3UADA 5LXVA 5IFJA 3MNVB 2WYIA 3N1FC 5EORL 5D1XE 3RVXC 5AB9A 1A8ZA 3SDYH 4L0ZA 4JG1H 2DKSA 2P80A 2BHFA 4GFTB 4QD2E 5DGRA 3QJOA 1E4WH 2OP4H 1J8HA 4NI3A 3TWCL 4BGLA 1MHCB 1M3JA 1QHQA 1TJIH 4A2EA 2FTAA 1YMMB 4N2MA 3VJ6B 3QFGA 1PPIA 4RMBA 4AI7A 4Y2NA 2H47C 1E5CA 2GCYA 1KBBA 1MI5A 4A1RA 1M53A 3C60D 4PM1A 4PRHE 3CVHH 4LPXA 3FT0A 3NCXA 4BK5C 5JYMA 1XIWC 3FTGA 3OB0K 1K3ZA 3U4KA 3WN5B 3T0DA 5E2UL 1QASA 3Q43A 1RFDH 2GTWA 12E8L 1XCTA 1YG9A 4NYLA 5C2BL 3TFKC 3MRIB 4PBDA 3BKML 1CS6A 4P5RA 3N2JA 4H2AA 2GTZA 2LV4A 1KPUB 2X4QA 2VXUL 3BLKA 2Y9RT 3H9HA 1IC7L 1PD1A 3O3AA 5IB3B 4DN4H 1J1XL 1PF3A 2KQNA 3RX5A 4HDIA 1TCMA 1JFQH 1U91B 3FB7A 5GSVA 1X3DA 2R9HD 1HFUA 4J3BA 4WNQB 1JIBA 3GSUB 1K5WA 4MD5A 3D4ZA 5EPMB 4CU8A 3QNZA 1FL3A 2OSWA 4X8GA 3UG3A 5BV7L 1OCWH 4PRIB 4H8QA 3LH9A 3GI9H 3GSXB 1UEMA 4NN6C 5D4IA 4Z1PA 3RIFK 5KSUB 3FQXA 1I9JL 1WBXA 5IQ7H 1SLVA 5CR8A 1Q72L 4P2RE 1R3KA 3N42F 3VFGH 1GZPA 2FE0A 1V8HA 1HH9B 1KFGA 1QPXA 3QZBA 4KJYB 2WOYA 5IJVA 2O72A 2H41A 4NOBA 2J1ZA 4Y5XB 1R1CA 4JRYB 2B2XH 4ZW5A 2A9DA 1HDMB 3NA9H 4WGWB 3TN0D 4UQBA 1I8KB 4BFIB 1KMGA 3AABA 4CBPA 3T2OA 2VMJA 3B2UD 3P69A 1UYWH 3FO1A 3T6VA 2AZUA 4MMYA 2OLDA 2W07A 3AITA 5H37H 1G6VK 2A1WH 2IIJA 4BM7A 2JJSC 4DZ8A 2IPKB 4JFXB 4LCUA 4YXKH 2WN2A 2HX7A 4GW1A 5SX5H 1H3WM 3LQAC 3QEQE 2PXYB 3FFOA 3DX6B 4KKZA 1O6TA 2AXWA 2YGOA 2AJSH 4FQ1L 3P40A 3CFEA 4J6RL 4ZUVA 5DYFA 3CFMA 2D4DA 2R2EA 1EMTL 1UD3A 4MCNA 4PRNA 2KKQA 4U4IA 3PWPB 3BVVA 2IANA 2NY5H 2VLKA 5B7MA 1S9XB 1KYOK 3PGFH 3VFNB 1CDYA 1HCFX 5BZZA 3RQ3A 3KLAB 1V27A 4IBWA 2B9BA 1NLBH 4HHAB 4HU8A 3BAYA 4PV8B 3S88H 1COBA 5KOVC 1BGXL 2DWTA 5G5DB 1EZVY 3DPBA 4G1EA 4JN1H 4M62L 4G59C 3PWJA 1DBJL 3BCFA 2PO6A 3MLSH 3VXMD 3VXQA 1VCAA 1LE5A 5SWZD 4PTTA 5DJXB 3WY3A 4CAGA 3MPCA 3GBLA 1T0NB 3VD1A 4NZJA 2EILB 2TSBA 2B1AL 4Z7VA 3QDME 5BVPH 2HA1A 3H9SE 3GSNB 3MA9L 3K2UL 1QSEA 1NCDH 3B9VA 1Y6NR 2CUHA 3MCKA 3N91A 3EFOA 4M48L 4BFOA 5MEPA 1LK3L 5FLVA 5K5YA 4Y4HA 5TJWK 1U21A 4MJJA 3CH8A 4U3CA 3QI9A 3BAXA 1H5BC 5D1ZC 3ZPDA 2WO2B 1DBKL 2ERJC 3FCSB 5BMFL 4TTDD 3QUGA 3FPXA 2WO3B 4WU5A 2O6FA 5F3HA 2RD0A 3VXUD 1WFNA 4HS3A 2P48B 5H8DA 3VFSA 3NZHL 5ERWA 4B95C 4R97B 4JPKL 3TWYA 3WJMA 1QUPA 3PL6A 1AQKL 4H88H 4JPVH 2H4EA 4HBCH 3MCYA 3QIUC 4YHKH 5C08E 3HN8A 3ARDB 4XMTA 2D0FA 4OF8A 2AJYH 4K94L 1ZTXL 4MS8C 1M6OA 4OZFH 3D6GA 1QSFE 3SE4A 2X9XA 5CFAA 2OM5A 3DX8B 3KPRD 4OLXL 3RWGA 5IF0B 2BWQA 2NYYD 4BXSV 1UXLA 1VSCA 3EADA 2MCG1 2WAQA 3BWAB 5M95B 5D7JD 1W0VB 2VDPH 1RK7A 3JWDL 4U1NA 2CO2A 1AC6A 3O2WH 4DKDC 1N2RB 3NJJA 1A6WL 1AKPA 1CVSC 1TQCB 3CC1A 5LGJA 1E5YA 1YEJH 4NQEE 1XF2B 4IKJA 5DJ8B 4Z7OF 3RWCA 5FA4B 4C56A 1ET8A 4XCNB 3SSGA 2YPKB 3T4YA 5DURB 4V2BA 1UFUA 3AG2B 1ES0B 3K6SA 4UQDA 5A2FA 4HEPG 1KBPA 3PWNB 1EVUA 4A7UA 1KENH 2JK5B 3KPTA 1KZYA 4S0TD 3KAAA 4DK5A 1MDAA 3DC0A 4BFEA 1AHWB 3S37H 4ZMOA 4CVZA 3ZE1B 1SDAB 1X6NA 4OJFL 1QACA 4UYQA 4C4KT 1NCGA 5AYUL 1C12A 1QA9B 4EXKA 3GHEL 1H0DB 4I4WB 4UAHA 1QFWI 2K78A 1T1XB 2EO7A 5D71L 5HHNB 5HHXH 5DJYB 2VZSA 5I2IB 4FQ2L 4IOFC 4R4BB 5HXMA 5E9DD 2WWOA 3GMMB 1C5DB 2RA1A 1FC2D 1RIVL 5HY9B 3LKQB 3F7YA 2X12A 2W0LA 3L3GB 2AITA 3RVWD 5F9WB 5IFHH 1PS3A 3FO0L 1TPXC 4UNUA 1HKLH 4Z23A 1MJ8L 4G7RB 4CA4A 5DHYA 3ULVH 2AQTA 2BXYA 2CJUL 4YE4H 3OHXC 5H2BB 4YR6B 1XGZA 4NI6A 1UD5A 4JVWA 2GKIA 4TS6A 1LXMA 4NZ8A 1OF2B 1R5WA 1I82A 5J9PB 3RWIA 5FYLL 1AC0A 4WHTB 3ARFA 4PD4J 4QOKD 3NCEB 1EGJA 3BKYL 1N6UA 5FGBA 5DR5L 4AEIL 1N3NB 3Q8EA 3DHPA 1KCVH 2EDTA 3GMQA 2F7PA 1WZ1L 2LFEA 3JV6B 1BVZA 5CJOH 4LF3B 4LT7A 4O4YH 2I25N 2BJMH 3G5VB 1C16A 4OV5A 2FWOB 4Z3JA 3BH9A 1YEKH 2JB6B 3AS1A 4IU3B 2EE0A 3G3LA 2FX9H 4C4BA 3CQFA 3MGAA 2UYLA 2YD7A 5H4ZA 3IDYB 1KEGL 4LHUB 3EJYD 3H3BC 5EDXA 2NY6B 5DUJA 5AAPA 1A3LL 1M1XA 1UACH 1FYTE 1X44A 1J9CT 4NSKB 5AOMA 4C4UA 1D7BA 2HFFA 1QVOA 2O5XH 1Y0LB 5JNYB 2V3DA 2CCVA 4I3SH 5D6DA 5TDOB 3ZTJG 3WXWH 1BVKB 2Q76B 2Z92B 1JZIA 2V17H 2A6JB 4IRZH 2P7TB 4KK8D 1BMWA 2ZKXA 1YAZA 2J44A 1BVNT 2DEXX 3BDYH 2VDMB 2F1BA 4P46A 1U8MA 4XVJH 3P73A 4MJ2A 3LN5A 3O6FC 2MNWA 4P8QA 3ALWA 5A3ID 5KAQG 9PCYA 5C07D 2X28A 4L3EE 3ZL4H 1R24B 4OBRA 1D9KB 1G0DA 2QVIA 3OZ9H 1RIHL 1SXSA 2YR3A 5GRVL 1KXQE 1DBAH 5D1XB 5INCA 4XP9L 1TZOA 3U2SA 1KXHA 4MAYA 3BJ91 1AZNA 5B8CC 4POYA 2DPKA 3ILDA 1RZ8B 1UGNA 4CADB 1L3NA 2IALB 3UP1A 3SDCB 2BNRE 4AMKH 3CN0A 1IGIH 5IBTH 4N3TA 1A1OB 2X4TB 1WZKA 3VQLA 3ULUF 3HC3H 5DD6B 1KGYE 1KNOA 3K46A 1Q1PA 4I77L 4GNKB 4PRHB 1YPZB 4BKLB 2X4UA 1SJHA 1PZAA 3BYTA 2F19L 4MDJB 4P99A 2DD8H 3RWHB 4B9GA 2M26A 4YDMA 5FFLA 4R5XA 3U9PL 4YZWA 3CLEH 5HGHA 3I6KA 1INDL 2HZHA 2RFXA 3C5XA 4HK0B 1RHHB 4QRRE 3NABL 5EG6C 1BVLB 4B27A 5HYQA 3C6SA 4L8CA 3QDJE 3VI3E 3BEVB 3NZ8A 4LARL 4JPSA 5I76B 3TF7C 5GZOC 4EIUA 5K9QG 5TQ2H 3S8FB 1U8QA 4H0LC 2NX5B 4G42A 4K9EH 4ODHL 3B37A 1NBYA 2A4EA 4NQUA 3H8NA 4YBQD 2ZXWB 3M6DA 3ULSA 1ACZA 5I24A 1X5MA 4OLWH 3QIBC 3G5ZA 3K6IA 4P59H 3P3UA 5GGRB 3HN5A 4Y16A 2IPTH 4X9YA 3RWJB 4NWTL 1T7WA 1OAUL 1HHHB 5TGBA 2VN3A 4P2RB 3OKNA 3TNNA 3WFBH 2YD9A 2J6WA 2AK4A 5EA0L 5IHWA 3WIAA 3WMQA 2ID5A 2EC9U 2Y2WA 2ATKA 3NK4A 2WNWA 5IB4A 2QQNH 2XVGA 3BHBA 2BNUB 4P2OD 5ICXA 1BDYA 1UATA 1NGWA 2CBOA 3AU0A 4AZUA 5A43C 4P2AA 4J2QA 4ODSH 3WDJA 3WENA 3QUYB 2VJ8A 3Q5OA 2MCAA 4X42A 3DIFB 4OF5A 3L1GA 2ZOOA 4J8RB 1A6AA 2H26B 5HYJA 2ODIA 3G5XA 4JG0L 3NN8A 2NW2B 3UO1L 1RP8A 4WJKB 1DCLA 3QZNA 3AY2A 3FT4A 4LPYA 3FSZA 4BUGA 3CGTA 3CSBA 5IJCC 3DUHA 2HMID 2F9BT 3D85D 2HKFH 3QEQB 5CP3A 4GMTH 4GP8B 2ZX8A 2NOYA 3TO4D 2E59A 1SVZA 4ZSOA 2C3HA 1WS7A 2C34A 4B50A 2QQLH 3EGDA 4FXLA 3LEYL 2FEDC 1PU0A 3QDMD 2HRGA 4XWGL 5LG6A 4OIIL 2R0ZL 3IU3B 4JKNA 1SMDA 3H9SD 4GI6A 3JWNE 4GW5A 4PY8J 3LZNA 1T5WA 1BQHG 2PTVA 2YD5A 5IT2L 5KVMC 2WTRB 3AT9A 1IFRA 4ZFQA 1FE8H 2BHZA 5D9SB 4RA3A 2WQ8A 2CMRH 1CLCA 3BKJL 2A9NL 2XYCA 4WSKA 3CZSA 1F41A 1EBAA 1T03H 3UYRL 2NR6C 1JS4A 4WI0B 2OX5A 2DLFH 2YA0A 1X9RA 4FABL 1BHGA 2WWKO 5T1KB 3QUZC 1NTDA 4URKA 3V4PL 3IDNB 3L9YA 1RZGA 3OSVA 1T5XB 3ZR5A 5B4MD 3D9AL 1DHKA 2IWKA 5ENWA 1KJ2B 15C8H 1UA7A 2WQUA 3GGWA 5DYOA 1F1AA 3UTSA 3V0IA 4X6FA 1DVYA 4JQVC 2J25A 3K6DA 3ZKMC 4HG4J 5DHMC 1S9VB 4DH2A 5F6HJ 4FCAA 3L4UA 1SDDB 2OSLA 1DUZA 5EIIG 2EP6A 5C0BA 3V4PA 3UTTD 4XO4A 1CXKA 1SN0A 3UAJD 1TKWB 2HG0A 1EZVX 1I8UA 1U3HD 3KXFA 4UBDC 3KM2A 5EN3A 4PJ7F 2C4FU 1TZIA 5BPPA 4Y1TA 5FYJD 2ZXCA 2O6CA 1CT8B 4PGCB 1OXYA 2BP0A 3K4AA 1PDKB 4HUXB 3FQ1A 1HSBA 4GKLA 4HUUA 5EN2B 1CYXA 5JMRA 4JY6B 3A4AA 3HMXA 4DW2L 4JDZB 2NSQA 4OZGB 5KBNC 2P1YA 1L7TH 1OGTB 4W6XB 2GTQA 4QO1B 4HUMB 1A3RL 3BQUA 3NCFB 1ORQB 3LKOB 3S48A 1F4XL 3DMMC 4Q56A 2B9AA 1QSFB 3IFOA 5C6TL 4MD4B 2XA8H 5KVFL 3GO1L 1IAOA 2GJZA 1G7PB 1IEAB 1UURA 3A6BH 4AQZA 3S3SA 3MN8A 4GEJA 2VQ4A 3F7VB 4KHXL 4GKZA 3S4SG 2KBGA 4HOWA 4EI5B 1DSYA 2I07B 3LRGA 3ABGA 4MQ7A 4LP8A 4N2GA 5GJTL 1GA2A 4LRIA 3HZMA 1N70A 3SBQA 4EZLA 4NQEB 5J1AB 4MJ5A 5CBEB 4YFLI 3WDHA 2E7LA 2X4PB 3KPQA 1LLAA 3WHE0 1IAIH 1RU9H 3CX2A 4PWGA 5T5FH 1WCBA 4S2SA 4UM9A 2B8OT 2HT4D 3LZRA 5IW3A 3ZUNC 2HFGL 5BRZE 2DOCA 2UXVA 2K9FB 5H94A 4X9BA 5D7IE 1YA5A 5I0VA 1H8OA 3UYPB 4IM8A 1OAKL 4KJWD 3KCPA 2J55A 4K7PH 1U8CB 3MLTB 1MY7A 1P1VA 4YWGL 4W81A 3P4NA 5GGTL 3ZTEA 4DCQB 1UWEH 2MCMA 1I31A 3C08H 3ARGD 4B7IA 1VZGA 1A14H 4R4FH 3P30H 3O6LH 3VWJB 1IJ9A 4J4PA 1BX2A 2ZUWA 3A5VA 4UB0H 1U3JA 3FUFA 4F33B 4UTAL 3AB0C 3TPUB 5GZND 1E9OA 1UUSA 2R15A 2YEZA 1PD6A 4GP4B 4HJJH 4OD3H 4XPGL 4XMLL 3QUXB 1CLYH 2OR9H 3QJHA 4MZIA 3CXHK 2FSDA 3ALPA 3RZCB 4TN9A 1XGTB 1HESA 2R2HA 1KC5H 1Q0YL 2E7BA 2PWGA 2B1HH 2LQRA 3HE6B 4WWID 3SYPA 3ZMRA 1IMHC 5C9JA 2XNAB 5MHSE 1EPFA 5CO1A 4PJDB 2F54E 2G0LA 2CR6A 2H3XC 4RFNC 3EYQC 4DZBB 1XAUA 1AZVA 1O0VA 1WQVT 1SEQH 2Y1ZA 3WKPA 2Q8AH 3T8MA 2NDFA 3EYOA 4XCEA 5AG9A 2AEQH 3MV7B 1NAML 2CBPA 1LDPL 32C2A 3V2AR 3CZKA 4DEPB 2BM3A 4PB9L 1AI1L 1N4XL 3CD4A 2COVD 3FO2B 5C0AB 4JPWL 1MFEH 3WYRA 3I75A 3OLGA 1R0AH 4HSQA 1A6UH 3VB9A 4X4ME 5IVXE 1LD9A 2Z64C 1FNSH 1JXKA 1S5IH 3GB7B 2O5ZL 3FCBA 5FFOA 3ZE2B 3CN3A 5DZVA 2V5TA 3ISYA 2A9MH 5TE6L 4NLAA 5EOTB 1XF5A 4XXCA 5JHDD 3VA2C 4G6JL 1FO0H 3VU2A 4PJXF 1BJ8A 5HGDB 4J1UB 5HHOA 3DLQR 4WDIA 1TUPA 2JJUA 2FL5B 4E9YA 4FADA 1E4JA 1RURL 2E27L 4PUBL 4XMPH 2J7LA 3SE9L 2E7MA 3N41F 4E9WA 5GGUA 4Z7UF 4PW4A 2Q3XA 1EVTC 1B0IA 3SQBA 4NPYA 3TT3L 2R69H 3X1EA 1DBMH 4LLMB 2EE2A 43CAA 1DJXA 4QRRD 2EECA 4ONHB 3MRGB 5F72S 2EVJA 3QDJD 3L9RA 4FQXB 1HHJB 5HD8D 3BOVA 4NUJB 2BNRB 4YSDA 1XFPA 5JORA 3FB8A 5KSAA 1S6NA 1CE1H 1JV5B 2Z31B 4HKJB 3WL9B 3DOSB 1XCWA 2AGJH 2CO6A 3GS0A 1NFAA 1HXYB 2OTWB 5DMIL 1KIUA 1FVCA 1K4DA 1P9MA 1RJZB 3GJEB 3FRPG 1VPOL 3EO1B 1YVLA 3L5XL 2MFNA 1MCWW 1ZHKB 3KGTA 3MGOA 5SWQA 5DMGD 1JPGA 4TYUA 4W9ZA 1OP5K 2DJUA 4OUUB 2N7BA 1FH5H 1JUFB 4OSUL 3SCMB 3WNJA 1Z66A 3UTQB 4BEIA 1HILA 3ARTA 1AD9A 3GKWH 1F3JB 3CFUA 1C1EH 5HJBA 3KYMA 1G6RL 4ELMA 3V0EA 1FFPA 1KF9B 4TKWA 1JHLL 2VDOH 4NO3A 1F56A 1E42A 3KS0H 3ABMB 2YAEA 1HL9A 2LAAA 5DUPH 3WXVH 3PREA 3TU6A 4ZUTB 3TCXA 3W57A 1W8NA 5K59F 1TVBB 3ML8A 3H7BA 3L81A 4JJOA 3D06A 5IOPA 1Q4NX 1JPSL 1G6RA 2SEBA 2GW5A 3MNZB 1TSRA 5ANME 2MMXA 4R5VA 1DQML 5C7ZA 1FORL 3UMNA 2WZ6A 4D0DB 2HX8A 2F1AA 3GRGA 1IKNA 1B6DA 3RFRA 3NCCB 3PABA 4XR8C 3TVMD 4TMPA 3KLDA 1U8LB 3GKZA 1SUHA 3TYFA 4HKZA 4NO2B 4L37A 1JGIA 4GRLC 4U1HA 5ABZA 3OJ2C 1M05B 4Z7UA 4FQIL 4EIZC 5B38B 3SOBH 3KPSB 5BJTB 4L8SC 3DUSB 5GS2H 5GGVH 4IHOB 2XBDA 4OGYH 3SDYL 1LNUB 5FO9A 4Q6IB 4QHNA 4JG1L 2PPCA 1RPKA 1HYSD 3KZ8A 4PP1D 1E4WL 2OP4L 3MRJB 4PB0H 4YK4C 4XMVA 4TVPL 1TJIL 5IHZB 1EV2E 3QEUB 5CD3A 1E4KC 4FXKA 3H42H 3BH8B 5HDQH 2A83A 4W9JC 2WXGA 2IQAA 4K07A 4M7LH 4QUOA 1R5IB 3CPLB 4CVWA 3WUWB 4V1DE 1QR1B 5E5MB 5GRJH 2YGNA 3IJSB 2BP8B 1ZXQA 1CUOA 3CVHL 1CGXA 4FG2A 2CQVA 4JL1A 2FBOJ 3DBSA 1OTTD 2EE6A 3DHUA 5F7BA 2JTYA 1I1YB 2WAHA 3OKEA 4PV1C 3UIYA 4U7KA 1RFDL 1RUMH 2CKNA 3H54A 2WXJA 2E7HA 1S7XB 2Z93B 2FCBA 1Z9SA 5CN3A 3JWOC 4AJVA 4NC0B 1ZY9A 3ZR6A 5F7KC 3K4ZA 1PY0A 1S7RB 3B9DA 3CVHA 4L4TE 2H6UA 3L2MA 4MNHA 2GB2A 4HV8B 3VWKB 2BVPA 4DN4L 1QTYT 2IGLA 3WNOA 3L1OH 1MG3C 1TFHA 2BLFA 4XODA 2WTPA 1JFQL 4LCYA 3APFA 4EAEA 4JZOA 1A7PH 4JDEA 3MXWH 4PR5A 4W6YB 3V5HA 1UM6H 3FL7A 5CLYA 1VRSA 2DWDB 5FO8B 5K9OA 2VDMH 4EQ3A 1OCWL 3TEWA 2FZ3A 2L7QA 3GI9L 1CF1A 3CN2A 3ARZA 1OIOA 2HFEB 5GRYA 2V0AA 4BINA 1YEEH 1OGAE 1SBSH 5DJ2B 3GF8A 3LVEA 2CXGA 4M3HA 5IQ7L 1N10A 2FQGA 2XFXB 3TZVA 4CNIA 3EBIA 3GIVB 2N1TE 1JHTA 3NVQA 1C7SA 3DX9B 5IUCA 1ND0B 1VB9A 1SLUA 4KH9A 3UO8B 3V4VB 2HT2D 4Q4EA 4U1KB 5KANG 4AEEA 5AD0B 1BG9A 1MCKA 3IKKA 4R2GD 2B2XL 3UEQA 1EANA 5I71B 5I8OH 2VLLB 3NA9L 4APXB 3BP4A 4AUJA 5EU3B 5KS9A 4TQEH 1UENA 3U0TB 4P4KD 1SHMA 4CU7A 3W9EB 4G9DA 5JA8B 1Q9OA 3IDXL 4W9FC 1UYWL 3B2DC 1T3FB 1XF1A 1SMOA 2A1WL 3B3BA 2VLRE 4QTHA 3GXDA 5E6ZA 4WTWA 2BY2A 5E8PB 3TEUA 5AW9B 3CFCH 4YXKL 2FJFB 4UINH 2YARA 1RL1A 5BRZD 1UEYA 3RVXD 3K4DA 4L5FE 5BOZG 5HYSG 1OTSD 2CDEA 2OXGB 4YFEA 5E1HB 3AREB 2J20A 2R0WH 3LY6A 2YAOA 3QBTB 4GMSH 2KQMA 4PJAA 2AJSL 4WWKA 3CHSA 1V3LA 3HRPA 3H56A 3SGKA 3VXNA 1IILE 2KL6A 5CIPH 4XP6H 3VFMA 4M1CD 5ICYB 1FFNB 2OSXA 4I0PC 4Y4FA 2NY5L 4LASH 5KVGE 4DPBX 1OT1A 3PGFL 1S7SA 4BELD 2QKIB 2PW1A 4O2FA 4YOKA 3SO3C 4LGRB 3GT6A 4NQSA 3D33A 1NLBL 5IG7A 3S88L 3C09C 4QRTA 3TFKD 2WBJB 3WJLA 1I7UA 4X6CB 5IIEB 4FFTA 1GXEA 3MLSL 3X14A 1UCTA 4YHOH 3NG5A 4HIHB 4RX4D 4JPIA 5CSGA 1DFXA 2QADD 1PZ5A 3T3MB 4KKNA 5F3BB 5CLWA 3U0PA 3GHBH 5BVPL 4PLJD 1AKJA 3MHZA 4X5WB 4N25A 4GAGH 2Y1YA 4EJ1C 4XCYA 2F54D 1KDJA 1HHKB 1NCDL 2XWEA 4AYFB 4I48B 4JFEA 2BOLA 2A6IA 3BEWA 3ARXA 4FL4C 4OZHF 1XIWB 2P4AB 5IM7B 4RWYH 1Q0EA 1W80A 4I18A 4I87A 1IL1A 4MDIA 3FB6B 1VENA 3B6SA 5T1DL 5CGTA 4E36A 4F8TA 4W4OA 1X5GA 3FUKA 1PJ9A 2XN2A 4WY7H 2V2XA 1GYVA 3TIDB 3DVNA 4H88L 4JPVL 2XWJB 4JRXE 2WGNB 4HBCL 4YHKL 1OEZW 5L4MA 3FBQA 3Q2LA 5E08H 3ULVF 4J3OH 4FQQB 4JREC 3FTUA 4LLQA 2IC2A 2AJYL 3PPSA 3NRPA 4HKBA 4O9HH 2WXHA 4N9OB 3D39E 2BK8A 3VXOA 1A1MB 3KWVA 3D2UA 5MENB 5I75B 3DETD 1DQIA 3C6LB 4LSDA 5HI5C 4NFBA 1JCKA 4I1PA 2JJWA 2W91A 3QJVB 2VDPL 4JO3H 3SJVD 1T80A 1YO4A 3HC0B 3O2WL 2VXQA 3VDAA 2B4CH 1BSIA 1L6XA 4Q52A 5IWLA 1M2OA 3B5GA 3B3IA 5IVXB 2X2YA 5IQLA 5D7LE 1ZHNA 1BZ9A 4Q2ZB 1YEJL 1ID5I 1EFXB 1GYAA 3FZUC 4UM8B 1QLFB 4N3UA 2ZOLB 4HWBH 1X7TA 4HAFA 3Q1EA 3LD8B 3NUKA 1UKSA 2J5LC 2BSTB 3QK0A 1KJ2H 4JFYA 1WA1X 1V7NH 1KENL 2Y4SA 5LCVH 2XBZA 2BCMA 3FFCA 2NPLX 4OCRL 3S37L 4IKNA 1FF5A 2CNYA 1F2QA 3VX1A 1ZV2A 2JJVA 4MRBA 3RX7A 4OI7A 4NT6B 3WNNA 2Y25A 3L3OC 4JG9A 5HHXL 2G3NA 3QPXH 3AG1B 3CIQA 4FJ6A 1NEZA 5DEFB 3SYQA 2FJSA 2NNXA 2ZE0A 4TNWF 4F3FB 2F53A 2ENPA 2JVUA 1U9KA 5EUOA 4M1DH 3H9YA 4ONGH 3HG1E 4KKLD 4MJIE 4R3SA 3L95A 3OJMB 4UU9A 4R26H 2Y7NA 3S8GB 4S11A 5IFHL 3PXJA 5E56A 3BXNA 4U1SB 1HKLL 1H6EA 2ZUYA 4H8HA 3ULVL 1PKOA 2N01B 1GHFH 4HUWA 3B2MA 1BM3H 4FHBD 4PGDA 4YE4L 4K94C 4QKXB 2VN7A 4J3TA 1QFOA 3OMNB 5E8NB 1ZK9A 1KTLA 4ZNEE 2X9ZA 3BZEB 2HRHA 5LHDA 3QIWA 5D6CA 5D2LB 4ZO8A 1N8ZA 1GRWA 2X3AA 1MAKA 4Q9CA 3BPLC 2NNAA 2JKIS 5JO5B 1DBBH 2JV6A 2NZ9C 2Y3NA 3P3RA 1CGUA 1KCVL 1UZ6F 2ESVA 2QPUA 3P77B 4I3RH 5CJOL 1GJIA 2FJHB 3CNKA 2BJML 4O4YL 3W81A 1YDPB 5FUOH 4HAKA 1YEKL 2DWEA 3KLSA 5DEZA 2EIZA 2R29H 1USQA 2FX9L 3D69B 2CHDA 4XVUD 2VQ1B 1BZ7A 4K3GA 2A99A 1S46A 1H5BB 4XNZB 5D1ZB 1SF3A 1LM8V 3V0WH 1N5YH 2ERJB 4UNIA 1HQRA 2K6ZA 3HHSB 1UACL 1BFOA 1J0KA 1TU2B 2VRAA 5GRVK 1MUJB 5LLIC 2CZNA 2O5XL 3MRQA 3NCYS 5ANMB 1JZ3A 3ETBF 4ZMAT 2OW7A 5DS8A 4I3SL 3WXWL 2PYFB 1IKOP 3QIUB 2V17L 3HNSH 4HJGB 4IRZL 4R8WH 2ITDA 3WUZA 2Q2LA 5INDB 1A3ZA 1I3UA 4KRMB 3AT0A 3BDYL 1R34A 3LKPA 1BQUA 3AJ7A 4XVJL 5F0PB 3WFEH 1VADA 1I85C 1QTSA 2EDBA 4YO0B 4ODUB 4JEGB 4KI5C 3IFPA 4YL4A 3RWEA 4GSXA 4F7PA 2ZAGA 3ZL4L 3SKNA 4F15C 3OMZA 4R9HA 1JVOA 4RMTA 5LXGH 4IRZA 4U31A 1HAWA 2OCJA 3N85H 3OZ9L 3OHMB 3QR0A 3QQXA 1HQ4B 1DBAL 2XICA 3MREA 1H3XA 3VFTB 3LH2H 5FXCH 2JLLA 4Z8FH 4DWHA 1MW0A 2MKLC 2X5PA 3UBXB 2VUYA 1QR4A 2E4FA 2UY7A 3D18B 4PIBA 4WV1B 4AMKL 1DJSA 5ID1A 2XX0A 1IGIL 2OS7A 2QJDA 5IBTL 3ZY7A 3JTSA 5IY5B 3ARQA 2EEXA 4N2HA 2CO3A 4K55A 3HC3L 4QHPA 1SQ2N 3TV8A 3EJJX 1SHXA 4M6OL 1TZ8A 5KSBE 1L9MA 1QRNB 3VAEA 5C0RH 1F58H 1XD1A 4PWIA 3ZMEA 2DD8L 2HG5A 2YLHA 4GI9A 1HZHH 4N0UB 3PHQA 1ZSDA 2E46A 2EQDA 2UZXA 4BZ1H 1BBJB 4C58B 3RDTA 3CLEL 3AUWB 3UC0H 1WPCA 3AGWA 5F7LB 3IMUA 4QRQB 4AQ8A 4L4TB 5DSCB 3SGEH 3E6HB 1HOCA 2NNRA 5TQ2L 3RVVC 4PEEA 5C0CD 3O4LE 5IW6B 4K9EL 3T09A 2O6DA 4ZUSB 3OBAA 1ETZA 3VXRA 1P4LA 4FXGB 5KYYA 5I8CB 1ZEAH 1CFNA 2XI9A 3BKCH 4KNTA 4NJ9H 4TLTA 3DBXA 1DFBH 4OLWL 4R7VA 3LRHA 4XOEA 3MRFB 4P59L 3ZK0A 4L4VE 1C8QA 4RFEB 3WELA 1PZDA 3VI4B 1I8MB 4R7NA 1E7UA 4P06A 1DVFC 1QTPA 2GJ6A 1R6VA 2IPTL 3F00A 3FJTA 3IDMA 1AFVH 3L4TA 4MKTA 4NQTA 5I6PA 4AE0A 4EN3C 1JF1A 4D9RD 2PPDA 1OGAB 1D2OA 3WFBL 4NQDA 1JGLH 3KPLA 1K4CB 2NSXA 5ISZA 2B15A 2XFGB 2QQNL 5GSRA 3SDDD 3RUGE 1MKFA 3CBRA 4PRPA 1SJEB 4Z7WB 3NJIA 5I23A 3H0TA 2R56H 1Z5HA 1JNJA 4ODSL 1T83A 2IOIA 3I84A 3WLBB 1XGPB 2WUCH 3O6FD 4JN2B 2GK0A 1A6TB 1MFVA 3K0WA 5DU7A 1BYNA 4WLCA 1IIKA 5EUKB 3QFJE 2VLRB 1MCQA 4QJ4B 5J1SC 2ED6A 1QUNA 3LV3B 1G7IB 2HKFL 3TYGH 4GKSB 4GMTL 4PS8A 3J7HA 5D7HA 4Q4IA 1CC3A 3QHZH 3SKJH 1NBZA 1OK0A 2WKOA 3WFDH 2PPEA 1NIBA 4O00A 4AIOA 1M7UA 2QQLL 4GXVH 4DQAA 1H15B 2YQGA 3MZTA 1JDAA 2WJ7A 3GXNA 3KR3H 3NH7H 5EOCH 1KTJA 4QMEA 4ZODA 3PNWB 5JR1L 5IBLC 4LLUB 3INUH 1KWGA 1FE8L 5FM4A 1ZT1A 1UOVA 1Y1UA 3GSQA 2Y07H 2K6WA 2R2BB 2CMRL 3GLDA 43C9B 1R3JB 1X7QB 2Z4QB 3LQZA 4C8XA 1T1YA 1T03L 1A8JH 4G7QB 2DLFL 1L9NA 4PN6A 1L6PA 2LE9A 2Z34A 3MMEB 4ZUUA 5C6WH 3OF6A 3D5OF 3U2JA 3ARPA 1D5ZB 4G9FE 3CZUB 15C8L 5EIVA 3NJGA 4P23A 4JRXD 1CGYA 5DVNA 2OMYB 3NRQA 4QRPE 3PWUB 1MSPA 4HCRH 2B5IB 3QIBD 4JANB 2W0FB 4QT5A 4CN1A 4DPCX 1TITA 3D39D 1W72B 2XUWA 1ZGLM 4N2NA 1P0SE 3U46B 1IAII 3NIDB 5DHEA 2IMNA 1E9QA 1B9KA 2C7UA 4K73A 4OD1H 5JOPE 1DJHA 5JXEC 4EE2A 1QZ1A 3BWSA 2IFFH 3ULUC 2AXGB 3DJRA 4OFYA 1SOQA 1J12A 3LHPH 5JPNC 1V3KA 7CGTA 3FBKA 4JFPA 5EDSA 1UADC 3GJFK 2BRQA 1THCA 5D7LD 1CFVH 1MQ8A 4PJGE 3HZKA 3RY5A 1U3NA 3HA0A 1C08B 4WUKH 1E9PA 1I9EA 4GAYB 1L7TL 5E5RB 2Z7UA 4PLOB 1WAPA 1Q94A 1MRDH 3JVGC 5GRWA 3ILPB 1HCZA 3AWEA 3I6LD 4WK4B 3NFNA 2QPDB 4PHXA 5AW3B 1G1KA 2XA8L 4AYMC 5T1JA 5J3HC 1F4HA 3A6BL 5HHQA 1Z3RA 1SJVA 3IMWA 5L4IA 3V6FA 3H2QA 5T3ZE 4XBEH 1KJMB 3TBTA 3UOAB 3LJ3A 3GFUA 5EF1A 4A7TA 4N0CD 3EBHA 3KYNA 3X1NA 5KW9H 2AKRA 2NT0A 3RI5F 3FAWA 1J0ZA 3ORJA 3HG1D 1TVDA 2KHAA 3GMLA 4GRMB 3VYOA 1BQLL 2P5EE 4U6HA 1IAIL 1RU9L 4Y2DC 4AH2A 5L88H 3QYMA 3NCBB 4TF4A 4G7VH 2X4RB 5T5FL 1NCNA 2YQBA 1S9WA 2WIIA 3MYJB 2AW2A 2NNFA 4LCWE 4WW1B 4X6DB 1JTTA 1BFTA 2WXIA 3F83A 4K7PL 1AMXA 2CGRH 4XNMB 2NR6D 5FHAH 4OM0H 3VMOA 3NBNA 1B3IA 5A2JH 1UWEL 2Y06L 3F7PC 1O6VA 1FLTX 1NCHA 3C60A 3C08L 4X83A 1ZA6A 2BSED 3ARBC 2LTQC 2WQAA 3VD5A 2P8MB 1A14L 1EDQA 3LS4H 3MGTA 3O6LL 3P30L 3V4VH 3JUZA 5I0XA 1HINH 5I16B 4UB0L 4K7PY 1E27B 5IR1B 2MOVA 3FN9A 4MJIB 4YIQB 1F4YH 4BSVA 7FABH 5FO2A 2E47A 4KZCA 5SWZB 1UXMA 4HJJL 2AVFA 3IRPX 1SY6A 1CLYL 1OANA 2OR9L 2VZTA 2EEFA 3QJTB 1N9PA 2OMZA 3KBFA 1DLHB 2ZSVB 2ITEA 2W9DL 4HK3N 4HZLB 4XVSH 4GQPH 4JM2D 1KC5L 3MV9B 3EBGA 2B1HL 3C8KB 3F01A 1PZ2A 4I9XA 2UWEB 3S37X 4ZMQA 4FLHA 4X7EC 1NKGA 4MCYB 4QYOB 1SRDA 2VZUA 1KB9K 4L9LB 1SEQL 1MH5A 1DYZA 2Q8AL 3ZZQA 1KBKA 3BGMB 2AEQL 4QEGA 4W68A 3VCLA 4POZC 1TCRA 4JFTA 3VRIB 2KDYA 2WN3A 4KK5D 1PSKH 4HLZG 3VXUB 2BIMA 1TEYA 2PYEE 4I1RA 5I15H 4P5SA 2ICWI 2YXFA 1MFEL 5IVOA 1R0AL 1A6UL 2XIBA 5LVEA 3AU1A 4HETA 2Q87A 1UKQA 3BO8B 3TN0A 1MEXH 1FNSL 1S5IL 5E00A 5I66B 2Q6WA 5KUKA 4P57B 4PGZA 3ZKSD 3CFDA 3UCQA 4UMSA 4MKMA 2X41A 3W11C 4XMXA 2A9ML 3QB7C 2E0PA 4FI6A 4YHIB 4DP8X 1FO0L 2F7QA 3KPRB 2R8SL 4AQ1A 3OL2A 25C8H 5HI4C 1V54B 4IBTA 4J39A 2VAAA 4NS0A 5FK9A 4HIQA 3ZUCA 2Q8BH 5D7JB 3DMMB 3N0PB 4N26A 5HDWA 2AHIA 3ZE1F