1IM3D

Crystal structure of the human cytomegalovirus protein us2 bound to the mhc class i molecule hla-a2/tax
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PWFQIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESLKWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Antigen presentation subverted: Structure of the human cytomegalovirus protein US2 bound to the class I molecule HLA-A2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 18
structure length 95
sequence length 95
chains with identical sequence H, L, P
ec nomenclature
pdb deposition date 2001-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1im3D00
1IM3D
chains in the Genus database with same CATH superfamily
1XR9A 4Q6IA 5MP6H 3LEVH 4FG0A 2HG0A 4CJ0A 4ELMB 1JZ8A 1DL7H 3IGFA 2GEQA 4KUCD 1DANU 5IB3A 3BWUF 1FO0B 2AQTA 1G7IA 1RZQA 4S1SH 3MHZA 3EXJA 3H55A 4H0LC 5E2JA 4ICWA 1UM6L 2W0FB 4TNWF 4W9GC 3L3JB 4XNQB 3GHBL 3NMEA 3APNA 4PRPE 2ORBL 3MRBA 3DYPA 2W81C 5L2KD 3CFIC 3QI9C 2CLVA 4W81A 1MLBB 1JMXA 4OIIL 3NJVA 4XCYA 4HF5H 3R1GH 2BOBB 1U2CA 5EC2A 1GAFH 2O6EA 4PRHD 5JTWA 4GS7C 2DIBA 1A3QA 4HCRA 5FB8A 3Q9PA 5IESL 4XNYL 4YXLH 2L7QA 1DVUA 3RKDD 3VXSB 1ACZA 3ZHFA 1BLNA 5DFWH 5D2LE 3S36L 1CK0H 3UDWA 3D3VE 1KGIA 4JPWH 1IAIH 4XNXH 4G59C 1TYEB 4OLWL 2Z1PA 3UTQB 1BBDL 5E95B 5IBTH 3SDAC 4KY1H 2BSRB 4QRQB 3OHXB 1OAKH 4HPOL 4MB1A 2FEDD 4FQXD 4UQ3A 5IQMA 4OLVL 4P46C 1H8SA 3VFOB 4DKFL 1Q72H 3R0NA 5ISZA 4N0YL 2X38A 3P2DA 1MJ7H 4RMTA 5J6GA 3P3YA 3P4MA 4FLOA 2CDFB 2WCPA 5FC9A 5I5RA 4OFKA 4HG4K 3OAZK 1J9TA 1VERA 3EYUH 4X0KA 1GZHC 5JDSA 4U4IA 1T22B 2K70A 3KPRD 4GS7B 4KHTL 3KR3H 4MXQC 2NRDA 3DMMA 3GI9L 4LGPB 4P23A 1JF1A 4ADJA 1TO5A 3M1BA 4BYHA 3AS2A 4V33A 4JL1A 2IMMA 4IM8A 2OP4L 3PNWB 4FDWA 4GRLC 2PO6D 3CK0H 1JRHH 1FAIL 5AOJA 3GXMA 4NHCL 3NUKA 4UNIA 2X4QA 4N0FA 2OYMA 3L3OC 3QPXH 4NKOA 1ND0A 2VGLM 5I19L 3ILQC 2ZSWB 3OSKA 1XF5B 4FFZA 3TJHC 3IE4A 3KGRA 3EOTL 4YK4B 2OMYA 5GS1C 1X5FA 1FZMA 5C6TH 3Q01A 3RZWA 2EINB 4Z3JA 4L8DB 1PL3A 4EDWL 3IJ8A 1FGVL 1OQXA 4ONFL 3GEFA 3RDTA 1FHGA 1ZPUA 3HUJB 2XWTA 3IS1X 4GRWF 5D71L 4JPKL 3BGAA 3O0RH 4LCWA 3OF6A 4WCYH 5DD3L 4FQ1L 4U2ZA 4GAGH 4OQTL 4UTBH 4I3RL 4UM9D 2ZWLT 5C09B 1P5UB 2H9GA 3SBPA 3TIDB 1TVHB 4HAKA 4OTXH 2VDOH 4X6FA 1BD2D 1OD7A 4FKKA 2G9KA 2H3NB 1HXMA 4W1TA 5L2KE 4XAKD 4PJ8A 4ZTPH 3QDGB 2BERA 3GINA 3RZCA 2A5UA 5D6CB 4PGCB 3MLYL 5A6MA 1J8HA 3N0AA 2BP3A 3PHSA 3QXAB 4FA8A 1KCUH 2VN6A 5DJZA 3UPAA 4CL7A 3MZGB 4RCAA 4CKQA 4QXUH 1ZT7A 2DYPB 3C09C 3HE7B 4WUUD 5D72L 2YWZA 1CFVH 1NDMA 3CFQA 2R23A 5BO1L 1XT5A 1S9VA 1RULH 3KDPB 4XMPL 5I0ZA 3OPZH 5ADPL 1PEZA 3T5WA 2SODB 5FOBB 5F9WC 4BRVA 2KC0A 1HWGB 1NMCC 1QBLL 5DJ0A 4WUKH 3SBRA 7TAAA 5JUEH 2LFEA 2O6DA 4ZODA 3JV0A 2LLNA 4P2QB 5CBEB 2VDMH 5GS2D 1ZLWK 1PY0A 3NJLA 3OJVC 2DTML 5HHOD 5EZOL 1CXHA 4PW4A 1MJUL 2WXKA 2R2BA 3IFPA 1EHXA 3KPRE 4TUOB 3EF7A 3ZJAA 1E9OA 3V79C 1M05A 3DRTB 3IU3A 4PTUB 3KVPA 3CVBA 4M5YH 5HI4C 1FIEA 4G9FB 1VPOH 4G7YL 4N8PA 1QNZL 1D5MA 4IIQC 3QIUA 4HISA 3HC3L 5C7ZA 2Z8RA 1ORQB 4FKEA 3I6KB 2JKJA 2R0KL 4MQXC 2OAAA 4RFNC 4EUPH 1D2OA 4CJ1A 5JA9A 3ZYIA 1LO2H 1JYVA 1YCSA 2BMKA 2P80A 2ZUQC 4OCSL 3IXAA 3TBYA 1NMCB 3W82A 4X4YB 2FX8H 3W9EB 3HFFA 4UT9H 4LOUD 3KPOB 4FQCL 4BZ1A 4YSPA 1MVUA 2TRHA 3ZE2F 1S3RA 3C5ZC 4U2YA 4PR5A 1PLCA 2RALA 2BVQA 1HU8A 1T5XA 3SYAA 4XPTL 4YWGL 2YARA 3W1ZA 1OP4A 3CLWA 3WNMA 2Y36H 1E9PB 4P3WA 4BKTC 1SLUA 1CFNA 3G6JB 4I2XA 1FVDB 3EH4B 5D5MB 3B7YA 3APCA 3D85B 1D6EB 2XVBA 4XAKE 5IVZA 4RFEA 2D0FA 2I69A 3CXDL 3QYMA 3ZKQD 3FS9A 2HKAA 1TZAA 4QHUA 4JUSA 4K94C 3BVDB 1LYQA 5HDLA 4MMZB 4JDEB 2P5WB 2JVUA 4RFNB 1VJSA 1U8IB 4ODUB 4QLRA 3R4RA 3AMLA 1AACA 1AC0A 4DF9A 5JOPD 1SEBA 1XGTB 3MRHA 4JJ5A 3GM0A 1RIHL 4YQXL 4J12A 1SHSA 1XGUA 4P59H 1CR9H 3OKOA 3AM8A 2GJ6A 3LKPB 3GGWB 3ZKMC 3VQ2C 1ZDSA 4AZ8A 1CJYA 1CB4A 2G30A 1CYXA 3HG1A 4NCC2 5MEOA 3NT0A 1VESA 2WVSA 5T3XH 4ONHA 4LSPH 1XCTB 3KYNA 5EO1A 4WEUD 2PR4L 4IJTA 4M43H 5ID0B 1OGAE 2C3HA 1YEIL 4HS3B 5DJ8A 1G6RL 5D7IB 4ORZC 4JHVA 2EABA 4HIIB 2KI6A 1WFOA 2DIEA 4L2YA 4NSKB 2DKSA 2FLMA 1OM3L 2Z93A 2Y2TA 2XG5A 5HYQA 4JO1L 4LP8A 4XPGL 3ZMNA 1I8IB 3NFNA 2QQQA 3S4SB 5DC2A 1JNLH 4CC0A 3TCLA 1IBGH 1BOYA 3WFBH 1YAZA 2ZKYA 3DRQA 2V5YA 3FAXA 1VKXB 5K39B 5JHAA 2FHBA 4X5LA 2NXYC 4UOW0 3MGTB 5KSUB 5E8PB 2VQTA 5D8JH 1D7CA 5GGTL 3CDCA 4NBZB 4L37B 4BZ2H 4UCFA 1F3JA 5F7DB 5HDOA 1EHLL 5EU3A 3BAYA 1ZGLP 3BWUC 3FN3A 4MCMA 1O5DT 5F88A 1A64A 4PRNA 1CU4L 2VJ8A 4G2AA 2PKDA 2ICES 2LW3A 5DR5H 3AT8A 1THCA 1TPXC 2F7IA 1B6DA 3L6FA 4K23H 3F64A 3WHXB 5KSAB 1WJ3A 2IPKA 1MFBL 2VMEA 2VQ4A 1E3ZA 7FABH 4LSDA 5E9NA 3FUMA 4HJGB 4XNAA 5DWPA 3VI4F 4JFXA 4BD4A 2CJUH 3QNZB 2WTRA 2WLIB 3WTTA 3I9PA 2OA9A 3O0LA 3L7FA 2AJVH 3AS3A 4JFHD 5DFVC 5DGRA 1YNTB 4OB5L 4DFHA 2J6EH 4Z7NE 3L4ZA 1PKQB 3R8BB 1F4HA 1IGCH 4DAGH 3F58L 2C8NA 3MFFB 2P24B 4R4FL 3ZKNC 4JFEA 4AV4A 1QHPA 1MIMH 5CN3A 3MRIA 1QLRA 4PS4H 5K33A 5F7HA 5EEWA 4ZZFA 3WEAA 3MRGA 4PQXA 4HIEA 5IOPA 4PV9B 3LQZA 5HPOA 1Q0XL 4R26H 5IY5B 3BE1H 1U92A 5JOPE 1XCQB 4C56D 1NFDB 2FLRT 3LVEA 5GGVH 2XIDA 2C3GA 1Z32X 2ITDA 4F8PA 1ECYA 3QNXB 3V9EA 3ZN6A 1NEUA 3I84A 4I18C 3CFNA 3RWHB 4FQIH 2B1HL 4QOKB 2CA4A 3DUHA 4OZFA 3WIHA 4PW3A 3LVTA 3D4CA 2F5BL 2D7QA 3V52L 2B20A 3V4PA 4NO0A 2K4WA 3A6CH 4KI5D 3OVUB 4G8IA 5AYTA 1PYWA 3RVVC 4PJGE 4ELMA 2H32B 1RK0B 4OCXL 5JZ7D 3WDHA 3ARSA 4DW2H 5KANI 1FO0A 2CBPA 1CXIA 2NY6D 1T83C 4HP5A 3SIKA 4EBQL 2QQNL 3ARBD 2XACC 5E6RB 3UIZA 4N8CL 4P3DB 1OP3K 4DWHA 5IVXB 3QZOA 3L3JA 4XNQA 4FTVB 3H4HA 4UQBA 5L6YH 4GBXD 5I1HH 4JY4B 1WC7B 4ODTH 4XN5A 1SDYA 4M56A 1ADQL 2NNRA 4OGYH 2P8MB 1PAZA 3P3RA 2DQDL 4OCRL 5HGDB 2BOBA 5JW5B 5SX5K 1A9EB 2DQHL 4C54A 3LOWA 4C55A 2HRPL 5F7YC 3VXSA 5T8IA 4XNMB 5DVMA 3VTTA 3ZTNH 1CGXA 1CTMA 1RU9H 4BZYA 4N2FA 3KWUA 3V5KB 1BVNT 1L9PA 3UTQA 1NCBL 5D7JD 3CIQA 2YMOA 3S3DB 3O2DA 5DI8B 2BSRA 3T0EB 1CICB 3HOGA 4QRQA 3OHXA 4ZFFB 5CCKH 2CGRL 5AAWC 2OMXB 3NK3A 2VDNL 3VFOA 2GT9B 4ISVB 1FYTA 5D1ZI 2CDFA 3MUGA 4PJHF 4LLVA 6CGTA 5FHBH 2HLFC 3H6JA 2MTAA 2ZOTA 1RZ8A 1YEJH 3I50H 4X4KA 1ROWA 1T22A 1WWCA 2FJFB 4W9CC 2CAKA 4C4BA 3QA3B 2G4EA 2WQRA 4UAHA 2J20A 1TVBB 1TFHA 4KUZL 5JO5B 4PRPB 1E7UA 2GTWB 4OT1L 3PNWA 2BNQE 3FB6B 3U4KA 4ZUVB 1L0YA 4UNTA 4NNPL 1A3LL 4OCLC 5DO2D 5JXEA 4FULA 3W2DL 2BVTA 3SE4C 4X6BB 2ZSWA 3VD5A 1YEGL 1XF5A 4JFWA 4CSPA 3T2OA 2VDPH 4TUJB 4D9LH 1NCCL 1G9ML 3N0PB 2NLJB 5CEZD 1LMKA 3VG0H 4PGJA 2HLAB 3BAKA 2DWSA 4JQIL 5D2LB 4ZX5A 1JNNH 1YEHH 4JN2B 4L8DA 4TLUA 5HPMB 1CFBA 3TT3H 1QATA 1RZ7H 1RUQH 1ZT1B 2A1WH 3GPEA 3HUJA 3LEVL 3M88A 1GSKA 4GMSH 3EAKA 2F68X 2AQPA 2IDQA 2W9LA 5J11C 3P77B 5C09A 4HZ1A 4X8JB 4ZW5A 3ZBMA 4LMQE 1FNAA 1P5UA 4S1SL 5FK9B 3TIDA 1TVHA 2OPCA 3HJEA 1DSYA 4WKZB 4AC2A 5K1NA 3HRPA 4WNJA 3BEVB 1QSFB 3CZEA 3QDGA 4MS6A 4R6UA 1WV7T 1D9KB 4ZX3A 1DN2A 1I8AA 4KDTC 4X9IA 1JZ5A 5D6CA 3LXCA 4PGCA 5G5DB 3MI6A 3HA0A 5DHVB 2O5ZH 5C0EB 1Q0EA 3EH5B 2XNAB 3IKKA 2FHCA 4HF5L 3R1GL 3EF4A 3V0WL 1F42A 1UM4H 4E9XA 1GAFL 4NN6B 3CPLB 3MLTB 3BVWA 3MC0A 1MNNA 2DYPA 2NZ9D 3HE7A 3L5XH 4YXLL 1UTDA 2FQGA 3K1KC 2R4SH 2JH2A 4KFMA 3W5NA 4RMWA 1WIUA 2OSLA 5FHAH 1FWXA 4JPWL 4XNXL 1IAIL 4TLTA 4JQXA 1FSKC 1ILUA 5GZNA 1KLFB 3FO2B 4K7PX 5FOBA 3N43F 1RPKA 1M42A 5EUOE 1UWYA 1RJZB 1UZGA 4W70A 1SBSL 3ZYJA 1OAKL 3EYOB 3TEUA 5CBEA 4P2QA 1CPUA 3BRGC 1NKRA 2I60H 2NTFB 1MJ7L 1QSED 4IKLA 3OX8B 4GUCA 3TNMB 3TO2B 5T3XE 4PYHA 1QEXA 1SPDA 4LLUB 2VC2H 4UOQA 5DJCB 2YXVA 4TUOA 4E36A 2R29A 3QWQB 3ULVE 1YDPB 5C1MB 2F8OA 4FQXC 1LQSR 5T1MB 3DX9B 3MACH 3DRTA 4PTUA 4POZD 4AMKL 4DVBB 3KR3L 4MKTA 2IFGA 4M6MH 4Z0BH 4LPCA 5L2KB 3V7AE 4V1DD 2QQKH 3MFGB 2H1PH 1MI5D 4EAEA 1T5KA 1B0GB 1ORQA 1JRHL 3I6KA 5JDJA 2F74B 2M26A 4ZYKB 2LVEA 5K9JH 5KYNA 3QJHB 3MMEB 5T5NG 3QPXL 1A4AA 1E8XA 2TAAA 3UTPD 3B56A 3W9EA 1T04B 1GGUA 3KPOA 3PGCB 2YFNA 1VSCA 2VKWA 4WEBH 3SDYH 4BGLA 2EDXA 2PO6C 1P1VA 3STBA 1XAKA 3BIKB 3NDYE 1Q9WB 1V5JA 1M53A 2YGNA 1UD4A 1BZ9B 4H1LB 4Q9QH 1X5JA 3TCXA 4FQXB 1DLHB 4OF8A 1E9PA 3O3DB 2ZUYA 1HH6B 3K74B 4ZTEA 5HDBF 3G6JA 1JJUA 1FVDA 5IVNA 5D5MA 3D85A 1ZHNA 4WCYL 1D6EA 4GAGL 1IX2A 3GYRA 4LLMA 4XVOA 2W65B 1L0QA 2AI0L 2VJ0A 4OTXL 1WE5A 2VDOL 4MMZA 1D7DA 4JDEA 2P5WA 2YUZA 4IRJD 1N6QH 1U8IA 4ODUA 1BQSA 3KPRB 2ZF8A 3P9LB 3BUDA 1XGTA 3TA3B 3GJEB 4PPTA 4BGDA 4KFZC 1IV8A 2MOQA 3WE6B 2D3VA 1YNLH 3PG2A 4HIXH 3LN4B 3LKPA 1KCUL 3GGWA 2G3MA 5CR8A 4OIBA 5BQ7B 2XQBH 4MJID 1J0IA 2PO6B 3WN6A 2J1XA 4G5ZL 4KDWA 5D1ZD 4QXUL 1IBBA 1JMZA 4ZMLA 1XCTA 1DUZB 2YAMA 4MA7H 2VZUA 1SQ2N 4G6JH 5ID0A 2X44D 3IFOB 4KXCA 3KPSE 2WJ7A 4NNXB 5DRNB 4HS3A 4RZKA 4UILH 5D7IA 1PY4A 3OPZL 4BKSC 5AVWB 3F3HA 4G6KL 4HIIA 3MBED 1TUPA 1K3ZA 4I13B 2YIHA 4WUKL 1MPAH 3D1MC 5ES4B 3LEYL 1WBXB 5JR1H 1I8IA 3NSYA 3S4SA 1OT1A 4KOBA 3B83A 3ZTDC 4A6YL 3FYEB 3REWA 2WXNA 3KCPB 1VKXA 5K39A 1HCFX 1HT6A 1E3XA 2GK0B 3HLKA 3MGTA 5KSUA 5E8PA 4UM9B 2I7SA 4BJLA 2EXYC 4L37A 4AI7A 4M1DL 4TN9A 4V1DE 1MRCH 4M5YL 2CQVA 1VAHA 3OLGA 1VPOL 1MI5E 1ZCRA 4KZEH 2A9NH 1U8QB 3HEIB 4EE2A 4XPBL 2EDRA 3CXFA 3PF2A 4MSWB 4Y1TA 3O11B 5JOEA 1LO2L 1RD6A 3WHXA 3BGMB 4LDLB 5K9QG 5KSAA 2A74C 2FX8L 4WUUB 4UT9L 4HJGA 1U95B 1F11B 3WKNA 2KBGA 3QNZA 1E8YA 1E2WA 2WLIA 2VZOA 1P4LB 4J4PD 1N4XH 3HB3D 1KCVL 5CGMA 2LLGA 1YNTA 2XJLA 3GZKA 4JL2A 1PKQA 1OGAB 3VH8B 1TTRA 2ED9A 1NBCA 3MFFA 4H5SB 2ZXEB 3B8YA 1RFDH 2P24A 3DV4B 2Y36L 3LZOA 4GT7A 3DNKA 4L1BA 3VRIB 4PWIA 3U7WH 3AY4A 1BFSA 1IVLA 2W9DH 3MLZL 3OR6B 3B9VA 4M7LL 5GSRB 4M5ZL 1TQBC 3MLUH 3GSUB 3GIZL 5ACMA 5E5LA 4PV9A 2JTYA 3SQOL 3ZY7A 4PU2A 5CCGE 1UUNA 3FUEA 4CSTA 2NY1B 1NFDA 3W9DB 3TO4B 3LV3B 4OV5B 3UZQB 3DOIA 5F6IC 3CDYA 3PABB 3QNXA 4MJIE 5E6ID 3WCYA 2MHAB 1P4IL 3H7LA 1QEWB 3MTXA 3S36X 4H0IA 1BSIA 1SXCA 3PUUA 4Y16D 4OQTA 3RWHA 2LFGA 4OBSA 1NCWH 2TRYA 4QOKA 3C6SB 4ZMWA 3EGXB 2WB7A 4HWBL 4OR1A 4PD4K 4J6IA 4DKDC 4LSPL 4X4MA 3PWJB 1ETJA 3GDBA 4OKVB 3ALWA 2XX1A 3ESMA 4J7RA 3MTRA 3L1OH 2O4EA 3IPBA 4K07A 1RK0A 4NP9A 3WMSA 5F44A 1RP8A 5JQHC 4NWTH 4PJXE 3UYRL 1Z6JT 2JB5H 3V0HA 1QBBA 2EC9U 3ZIYA 6FABL 5C92A 3MOAH 5A2CA 1A65A 2CHWA 5ECJE 1JNLL 3X1BA 5IVXA 1B3JA 4P3DA 1P5VB 2NUTB 4XN9A 1IBGL 5EA0H 3V95A 4Z7NB 2Q10A 2NYZA 1H19A 3SPHA 3WFBL 4JPIA 3VRLE 3D4GA 3QP3A 5F6IB 2AXFB 3EYSH 1WC7A 4JY4A 2IGTA 3RX8A 3N04A 2P8MA 3TA4D 2VITB 5D8JL 3BD5A 4TVPH 4XCFH 5HGDA 4UNVA 1IZKA 2WLJA 5CEZL 1IE4A 5JW5A 2C4FU 2G75B 4PJAF 1A9EA 3S3SA 2V7NB 3V6OC 1BDYA 5F96H 3O81A 3QJUB 4ZTOH 3CDFA 1BBJA 1GC1C 1KF9B 1HL8A 3PHAA 4P07A 3QGVA 4WI5A 2BXYA 4XNMA 2WXJA 1SOSA 3BAXA 5DR5L 4N2DA 1TETH 4WDIB 4NP4H 4K23L 3T0EA 7FABL 1CICA 4ZFFA 1T0PB 1BFVH 1X5XA 3N40F 3TEWA 2OMXA 3GMOB 1PF3A 1Z2KA 2CJUL 2GT9A 4Y9GA 4UYQA 9CGTA 5JQIB 4ISVA 5GRYA 3CX2A 4N8VB 3BRFA 2VMJA 2AJVL 1MCOL 3DX6A 5ELIA 2MNJB 2ZD0A 4IK6A 2V3FA 4DAGL 3EJYD 3KH4A 4EN3D 1G9NC 3E6FA 3FHEA 3EYFB 4WV1C 3RA7H 4AIEA 4KRPD 1MIML 5IZ7A 2FJFA 4POYA 3L13A 3QA3A 3Q8EA 1NIBA 4Z7OE 2ETWA 4K8RH 1TVBA 3VWJD 4PRPA 4YHIB 3FB6A 5FECB 4ZUVA 2ICEB 1S9XB 2VWEC 4HJ1A 5BRZE 1FLRL 1UD6A 4H2AA 4IS6B 4KNTA 4ILDA 4X6BA 5FUCC 1T0MB 2C9AA 4LVNC 3IF1B 5DD5H 3MLRH 2VIRB 4NPJA 4U33A 1OL0A 4TUJA 4FQIL 1ZEAH 1IGJB 3PCYA 5IUSA 2NLJA 3VSQA 1TEGA 1EMTH 1QWNA 2H0PA 2VDOB 2HLAA 3QWNA 5HPMA 5D2LA 4JN2A 1NMAL 4D2NA 3D3VA 1H8NA 4OD3H 2JCCE 1PAMA 4XP4H 3IMVA 4JCLA 4LL4A 3GBNH 3VD7A 3OJMB 1ZT1A 4HQQH 1IKNA 1OGPA 3ZDZE 1PG7W 4LK4A 4WU7B 2FJGB 3P77A 4DW2L 1VGEH 1AAJA 4N9GB 3PXJA 3JUYA 4QHLB 5FK9A 3ORJA 2Q1EA 4Q8BA 4WKZA 1CS6A 3JZYA 5I1AB 4KI5C 4AYSA 3BEVA 1CXKA 1X5YA 2W9EH 2ZONA 3FRUB 1FFQA 1D9KA 5CD5D 5I1HL 2D7NA 5G5DA 4YSUA 3K6OA 5DHVA 1WBYB 4LVNB 3GRWH 4OGYL 5C0EA 4PLJD 4GJTB 2WZPA 1I9RH 1HZKA 2DWEB 2XNAA 3K6IA 3ARBC 2D9QB 1DBKH 1BAGA 3SGEH 2A4EA 3CPLA 1UZ8B 3MLTA 3FONB 1ZTMA 5LN8A 3LNIA 1VZHA 4BQCA 4I48B 4LEBA 3OWEA 1A6TB 4CADB 1J9SA 4EJ1C 3ZTNL 5IREA 1YLBB 1G9HA 1KLFA 4RAUB 3ETBF 1ZOXA 1HL9A 1L6XA 5CAYB 1RJZA 4AEHH 4BK5A 5KSBB 3Q0HA 5IFHH 2CXKA 3LB6D 4K15A 3RVUC 3VFNB 2NT1A 4X80L 1ZLWH 3OX8A 3TNMA 3TO2A 3F7LA 5DZNA 5IK3A 4LLUA 2FEJA 4U4BA 2WVVB 5D7JC 1S6NA 4OFVA 5DJCA 5FHBL 4EUPB 4PV1C 2NY6B 4HUWB 1YDPA 2WNXA 1YEJL 2Q76B 4XVUD 3NIDF 5T1MA 3FUNA 3S34L 4OUUA 4AQ8A 3VFSB 4DVBA 3QPQC 1J18A 2BO0A 5TD4A 1KMGA 4OJFL 3E7JA 4GBXB 5AOKA 4GW1B 5L2KA 1TCRB 4TPRL 3DBXB 1JPFB 5HP5A 2YD8A 4N3TA 1ORSB 3S35H 4UB0L 3RFZB 4DPRA 2F74A 4W68A 3AWGA 4ZYKA 4PFEA 5EU7E 1RZPA 3QJHA 4HK0B 4A63A 2EDQA 5JPMC 3FULA 3UAJD 1DVSA 3LHAA 1T04A 3PGCA 2VDPL 5CJOH 4KV5F 4AYEC 4D9LL 1YG9A 4TVPD 3BVUA 3BIKA 5DO2C 1Q9WA 1BGXL 4L29B 1YEHL 2E9BA 3TT3L 1BZ9A 4H1LA 2IWGA 3TH2T 5KVFL 2YGQA 4FQXA 1RZ7L 1RUQL 2A1WL 3O3DA 4HIHB 1HH6A 5I18L 1EVTC 5FFLA 4GMSL 2CCVA 4YPGB 3H85A 2WLMA 4D8PB 1TTCA 1W8NA 2W65A 3P3TA 8PAZA 2QBWA 3E0GA 2VUYA 3P9MB 1HKFA 3U7YL 4D9RD 4HC1A 4ONGL 3SKMB 2A77H 4UOZA 1HNYA 4KH9A 1R33A 2DWTA 4JO5A 4MDIB 3KPRA 3FH8A 1XZWA 3NA9H 2XA8H 3T8XA 3TA3A 3GJEA 4LLWB 3ERXA 2O5ZL 4N1HB 3WE6A 1N6VA 5IJKA 3BSGA 3LN4A 4CC1A 2HTLD 4LZKA 4O9HH 5BQ7A 5IBLD 1UM4L 3L9EA 3GTVA 4WGKA 4YSCA 3AAZB 4JR9H 2QMJA 1GHFH 3M1OA 3L5XL 1DUZA 1SFHA 1NLDH 1XGRB 2WKOA 4N1EA 5GGQH 4IDJH 2UZIH 2R4SL 1CD9B 4NNXA 5CJ8A 3QJVB 5DRNA 4AT6A 2VN7A 3U0TB 3KBHE 2DKUA 4AJ0A 3UCQA 1ADQA 2XUWA 2E59A 5E24E 5I82A 4XX1G 2GJZA 3IXTB 3K2MC 3R0MA 4BSWB 4IKNA 1AQDB 3M1CA 4PTTB 1OCOB 1WBXA 4F1ZA 1EEZB 4QHKI 5LBVA 4LXFA 3PL6D 2I60L 1M2VB 3IS0X 3KCPA 1KIPA 4WO4A 4BBWA 2BK8A 2VC2L 4UMGA 4Q9CA 2GK0A 2APSA 1J10A 4YL4A 4UM9A 5ICXB 3UGUA 1OW0A 3FT3B 5INCB 1MW2A 3MACL 1L0XA 1QWUA 1IGIH 4HSQA 3IVKA 3HG2A 5DWUH 4R5VA 4BFGA 2EO9A 4Z0BL 1N12A 2FR4B 2VLLB 3CLEH 5A16B 1U8QA 1OLLA 1IT9L 1SNRA 4AVKA 2H1PL 2VLRD 3JWDL 3U6RB 2XPYA 1NFKA 1P4BL 4I3GA 1CFQB 4MSWA 5K9JL 3QHTC 3O11A 1J0HA 3K80A 4FLQA 3BGMA 4NQXB 4POZC 3DGDA 4LEEA 4NC0B 1BYNA 3ELAT 3E38A 4AYGA 1U95A 1WO2A 1F11A 2IMNA 2E7DA 3QQDB 3SDYL 3AGWA 2ZG3A 2E9JA 4R0LB 3A0OA 3OKEB 1S5IH 5HYFA 3EGDB 3WNNA 1P4LA 5CCHE 2YA2A 4RSVA 2F8VA 3BT0A 3KPSB 1OGAA 3VH8A 5J13B 4H5SA 3DV4A 4GKLA 5E1QA 3QRLA 5JA8B 5FW7A 5JIKA 4XN1A 3VO0A 1RJCA 2K8MA 4HDIA 2IFFH 2GJPA 2YPVH 3OR6A 5GSRA 3L08A 4UU9B 4HJJH 4RMBA 3GSUA 2CA3A 3WU1A 4H88H 2CBOA 4JRXD 5A3ID 5F97E 4RVBA 1AC6A 2XV3A 5EOQH 3FN0L 1A6VH 3PWLB 3W9DA 1N6QL 3TO4A 1HINH 3AVEA 3LV3A 3PPEA 4L4VE 3ARFA 5E9DD 3UZQA 4F91B 3Q06A 4OV5A 2XETA 1HWHB 5HHVL 3MSPA 3PABA 5HYIA 3NCYP 1GZQB 2MHAA 1QEWA 1QBMH 1YNLL 4MDRA 2CKBL 4V1DB 4HIXL 5I5MA 4D7BA 1F18A 4XZUB 1MI5B 1CGTA 1H9VA 2XQBL 2ZCKH 3ASWA 3GSVB 3OC8A 3C6SA 3BUTA 2LLLA 4IQHA 3EGXA 3VGBA 2MPVA 4IRJC 5C71A 1WFNA 2VDQH 2G5BB 1UEYA 3GEWB 2EIMB 3IMUA 3PWJA 4MAYD 4BFOA 4OKVA 4B9KC 4MA7L 2DD8H 4EPSA 4G6JL 2IEPA 1WFUA 4OFDA 4UILL 3EDDA 4U0RC 1UCTA 3BP6B 3HVDA 4ZS7L 5DD1H 5D1ZC 3O9WA 4WU5B 5MENE 3HMWL 1MPAL 3V7AG 5JR1L 3TXAA 2DKMA 3GSRB 2NUTA 1Q90A 3ZDYF 2X2UA 1OP3H 1X5AA 2LVCA 4N1CA 4J5VA 3MBEC 2AXFA 4U1LB 2H47C 3TV3L 3A23A 2VITA 2ZOUA 1I8LA 4YSSA 5KS9F 1JK9A 2G75A 4PRID 2V7NA 1MRCL 2OI9B 1URZA 4YSEA 1B0RB 2VLRE 1MHHB 3AG2B 1M9WA 5ITFB 2XKNB 2A9NL 4HCIA 4A7TA 2QL1A 4DQAA 4FP8H 4M9OA 5EIVA 2E76C 2B4CH 4PJDF 5F0MB 4WDIA 5C6WH 4MJIB 2OLDA 1A7NL 1T0OA 1TNNA 5JNYA 5BRPA 2AJXH 5EDSA 5CO1A 2F8IA 1NCNA 3ARVA 3GMOA 1GKEA 4X6CF 4JG9A 2WCGA 4BEIA 4N8VA 3V0JA 4KKCD 4KXZI 1N4XL 3OGCB 5TQ0H 3MBEB 1VACA 3LKSB 4PJGA 2ARWA 3RVWD 4F8OA 5C3TA 3EYFA 4PJXB 1RUPH 2WUCH 2JI1A 3GQFA 4KJYB 4X99B 4JRXE 2W9DL 2VDPB 1RURH 4J4PC 3HB3C 1IILE 4RWHA 1U8OB 1W0WB 2C9SA 3CXHK 3LKNA 4TNEA 5DA0B 3GRGA 4C8XA 2GSGB 4E9TA 2OFQA 3MODH 5K9OB 4YHIA 2FEEI 1XF4B 5FECA 2ICEA 2IPUG 1S9XA 3W39B 3DTDA 3CC5B 4KX7A 4YFLI 4B7LA 3IN2A 3OGOE 4IS6A 4AXWB 1T0MA 1K8DB 3IF1A 2VIRA 4PG9B 4UTBA 4ZOBA 1EV2E 1IGJA 1DQDH 1ZHBA 2Q87A 4KMTH 5HY9A 5ETUB 4HKXB 4LLQB 2OZ4A 1NKGA 3JV6B 1XIWC 1DE4B 4ORGB 5IMMB 1BQHB 1K9TA 5E6IC 2DM7A 2DS4A 4MA3A 2X87A 1NPUA 4W9FC 5JXAH 4Z3EA 2AABH 4NWTL 4JFFD 1FNGA 4WU7A 2FJGA 3S3JA 3WAJA 2D4FA 2JB5L 4M62L 4N9GA 1ID2A 1S78C 2HA1A 4QHLA 2BIMA 4DN4L 2WBJD 3MOAL 3O2WH 4OBRA 5I1AA 2QV2A 5EA0L 4K9EH 5FGBA 1QTPA 3CZUB 2Y1VA 1ET8A 3JWDC 1LE5B 3EYSL 5DT1L 4UT7H 4MB5A 1EJ6A 1WBYA 4PRIE 2DWEA 4TVPL 1BZOA 4XCFL 4RGOH 1WCQA 2WCSA 3ZZQA 1Z9MA 1N64H 1UZ8A 3FONA 2NDFA 5F96L 3FBKA 3MBWB 4EN2A 4OIAA 2BNQA 4HG4J 5ALBH 4I48A 1A6TA 3MLWH 4CADA 3QARA 2BNRD 3ZE2E 4LIQL 5BRZB 4LSTH 1RK1B 5KYXB 2VC2B 4Y16B 4AL8H 1U8HB 4QEGA 4X7FC 1TETL 2VR5A 4LBEB 2L7EA 2J57A 4BXVA 4PWFA 4Z3HA 3VFNA 5G4NA 3T6XA 1DZ0A 3VW3H 3T04D 3CSGA 3SEPA 4EDXB 2JCCB 3PXLA 5KWYC 3P0VH 2WVVA 3JYBA 3QCUH 1JSYA 5GS0H 5KVGH 1MCRA 2AANA 1RV6X 1GYUA 2BSED 4P2CG 3NCYS 3RWGA 4HUWA 1AD9B 3LTVA 1TG8A 2Q76A 4OF3A 4XCEB 5DEGA 4KY2A 1LDPH 2ZG2A 4UT9A 3VFSA 3VSVA 3MV7D 5E2WL 5AKRA 3GK8H 1FH5H 1JWUB 1VHPA 3AUWB 4GBXA 2K7PA 4GW1A 4PJ7F 1TCRA 4HPHA 2F5AH 2FX9H 4HZAA 3EJYC 3DBXA 3QT2A 1JPFA 3WFHB 1NIDA 5B8CC 1ORSA 3ARGB 3LHPH 4M8RA 5CJBA 5IW6B 5AVYB 5HXMA 3RFZA 4LQFH 3J7HA 4HK0A 3F00A 4BINA 3GS0A 1P7BA 1SF3A 3FU3A 5BRQA 1S7SB 4KROB 3GRBA 4KKAD 4OCWH 4MXVE 4MKMA 3BFWA 5DD5L 3MLRL 1KYUA 4P2RE 3I3BA 1B4TA 4HFUH 4EI6B 1O9ZA 1OT2A 3VWJC 1ZEAL 4I9WD 4PIRF 1FNEB 3QAZC 3ZQ9A 5J8OA 2H1LM 3QUYA 1A3ZA 2BCMA 1K6QH 3UC2A 1NUDA 3IMBA 2ADJB 4L29A 3B2XA 1NEZG 3RBSA 2EYRB 1J0YA 4GSXA 4OD3L 4Z3IA 3WXWH 5DK0B 4JFFE 4NZTH 3N55A 3HG4A 4HIHA 2YPLD 5EUOA 1N8ZB 5E2VH 4FEIA 5IKCB 2CKBB 4YPGA 1ECZA 2IBZX 1ASOA 3APFA 3F7KA 3RVTC 2EZ0D 1VGEL 2O5YL 1TQTA 2PWFA 4D8PA 5ECGA 1A6PA 1KTDB 1TFPA 3P9MA 3WIFA 4EN3B 3SKMA 3BSZL 1ZTXH 5AQ0A 2AJ3B 2CO7B 4KRPB 1TJIL 4MDIA 5JORB 3MLXL 1NAMH 3G3LA 3Q2WA 4UTAH 3D2UD 4TKWA 5GZOD 5ICUA 1B6UA 3QUZC 4OCYH 3GRWL 3VI3F 1MFCH 2X10A 2YK1H 4DJMA 2UXGA 1FNLA 1DBKL 2CNZA 3SOTA 2AQRA 3KE0A 3AAZA 2BNRE 2J5LC 3VI4E 4IRSC 5LGYA 5CD5C 5JIMA 1XGRA 2COVD 1DQLH 4R5TA 5SWSE 2XQYG 4PLJC 3U0TA 5HYSB 4F2EA 3WNKA 3Q2CA 4UMSA 1XWVA 3QBTB 4X7CC 4ZUSB 1MQKL 5J57B 3H3BC 3IXTA 2ZUXA 4BSWA 3VD3A 3N06B 3BD4A 1AQDA 1VEOA 4BZ2A 3T3ME 5F3FA 4AEHL 4PTTA 5KJ4A 4E5XG 1ZGLA 1JNHB 1EEZA 2ZUVA 3O3AA 5IFHL 5JW4Q 3E9TA 1KACB 1CTNA 1DQKA 5AVVB 1D7FA 5IUCA 1M2VA 4ZPVB 3IDUA 4LCCC 3QR0A 3VB9A 1OWRM 3QORC 4X0NA 1KXVC 2X4NB 3RDJA 4NUQA 1SM3L 3NBNA 1H5BC 4K5MA 5ICXA 1QRND 3MV7E 1JTOA 3WNPA 1BHGA 2EDDA 5INCA 3Q9QA 3LB6C 3BP4B 4DEUA 2W0LA 3TURA 5AVUB 2FIRT 4JZNB 2CUAA 2K3HA 3PJNA 1ET7A 1NC4D 4X6DE 2Y69B 3U46B 3DUSB 2MCPL 2FR4A 2VLLA 5A16A 2VH5H 4U1SB 4LO9A 1ITBB 3DHPA 4Y88A 5BW7C 2J6EA 4MRCA 3U6RA 4WK4B 3S35L 1CFQA 4XVUC 2A0LD 4Q74A 1M6UA 1KIQB 3EJZD 3MO1B 4NQXA 2RIKA 3B9EA 5CFAA 3TBVB 2D2OA 2Q7AA 1B2WH 5CN2A 4GFTB 4R4ND 2NTSP 2C9XA 3QQDA 4WFGE 2R1XB 4R0LA 1EO8H 2WXFA 4WNSA 3OKEA 2HUHA 1UB6A 4ATTA 1HE7A 4LCCB 1GOFA 3C9NB 2Y23A 4R96B 4TTDD 3SZKC 5CLWA 2G5UA 3KPSA 2YPLE 3FT2A 4CN6A 4BFKA 1JL8A 1WH0A 5FUOL 2A99A 2YEVB 2LOEA 4ZMZA 2FAUA 5T5FH 2AJZB 4PW9A 1XX9C 2VXTH 4UU9A 1KYDA 4RLDA 2HB0A 1MXGA 3QG7L 2JELH 4HJIA 1PEWA 3VDCA 3SGDI 2A77L 2M2DA 2ZP0T 4U1MB 5I8OL 3PWLA 1PD1A 1DLFH 1IKFH 2WD0A 3NA9L 2GAZB 4ADGA 3LZPA 2WXHA 3UTZB 1GZQA 1CZ8H 5JOFB 4DGYH 5IW3A 4V1DA 5GS0D 1MKFA 2I5YH 1T7VA 4O9HL 4XZUA 1MI5A 3GSVA 3FKUS 4BM7A 1XF3B 2R15A 4ERSL 4ZO6A 2XCMC 2JXMB 1VFUA 4FFYH 2G5BA 1CXFA 4QHKJ 3BH4A 1Q9LB 4N2HA 1NLDL 2ZXQA 1BP3B 1HE8A 3POCA 2FCBA 4IDJL 2UZIL 5J4MA 3NJMA 2JIXD 4NRXB 4BFBD 1WK0A 3UFIA 1JF6A 2HTLC 5IBLC 3BLKA 3BP6A 1N70A 4PJHE 1MELA 1WZMA 1RL1A 4HEME 5AW7B 1QAWA 4WU5A 1O9WA 2IQ9L 1I53A 3BCFA 2Y5QA 4M3HA 5DTFB 5DRXB 2JF1A 4PWGA 5E08H 4JRLA 1T1XB 2DQ6A 2MCAA 4U1LA 2X5PA 3B9DA 1G7PB 4LT7A 5IWLA 1N7ML 3WNIA 1IGIL 3CFUA 4LVOB 4F7PB 1JDAA 3N9GL 3REVB 1DQTA 1QZ1A 2GUYA 5JIIA 3QUGA 1N26A 3ULAB 5ITFA 2UV3A 2XKNA 4R2GC 1KBWA 4OLZH 3V0IA 4LHUG 1A6AB 3P54A 4L4VB 3E2HB 3VVVA 1HDMB 1MN4A 4MJIA 4MJ5B 1IC5H 4KJWD 1GXEA 4OFQA 4U31A 1N0LA 3MRLB 2YRLA 4OFIA 1QR4A 2X9YA 2WWMD 1L7IH 4FQPA 2AITA 1S5IL 1FG2B 4QRUB 1TEFA 2OK0H 3UROR 3OGCA 1ZHLB 3R4DA 4MJ6B 3LKSA 2QZ5A 2J1WA 4M1CC 2ZT9C 2BVOB 4PJXA 5F7UA 3WTWA 4GSQA 1O0VA 3PL6B 4OLUH 4POUB 5MENB 5TQ2H 4KJYA 4JCMA 1UOLA 2IFFL 2YPVL 1FCGA 4HJJL 1U8OA 1W0WA 2GSGA 3FHAA 2WP3T 5K9OA 1XF4A 3N40P 3DX1A 1NBYB 4S0TD 5EOQL 1BX2B 2H6OA 1HZLA 2DJMA 1A6VL 3CC5A 4YBLC 1HINL 3G5XB 1A4JB 1HOEA 1D5IL 1JZGA 1SMDA 3ZMRA 3FPXA 5KVGE 4AXWA 1UFGA 4GKNB 1K8DA 2HZHA 2ZCHH 1QBML 2FUTA 4PG9A 1Q1JL 4G43B 3L5JA 5A3IC 1PY9A 3OSVA 3WDJA 2QPFA 5B4MC 2VLRB 3BLPX 5KZCD 2ZCKL 4PY8I 5ETUA 4HKXA 4LLQA 5D9SB 4JEGB 3WGUB 3JV6A 3LDBB 4YLQT 3P02A 1MAML 1DE4A 4ORGA 5IMMA 4NQVB 3JYCA 1BQHA 4HWZA 4BQ8A 5F7EH 43CAB 5IT2H 2JJUA 1YQ2A 4FF9A 1A02N 2J1KA 1BQKA 1KJMB 3FTXA 4NM4L 2Z9TA 5IFJB 2I26N 3I85A 5DD1L 4QR7A 3FFDB 4PJBF 4MAYC 2R4RL 4JE4B 1O6TA 3VFWB 4XE5B 4AM0Q 4XN2A 1BJ1J 4ZMVA 1C5BH 4IJ3B 1XH2A 3OQRA 3V0VB 4F27A 5CEXB 3N2JA 1Z9SB 4LESA 1LE5A 1WFIA 2IDUA 4YR6B 4BHUI 2D3NA 3OKDB 4FNUA 1IAIM 1LP9E 4FQHA 4KTEL 3T4AB 2CR6A 4RMVA 1NA8A 5D4QA 1UXSB 3QUMH 4JRXB 3K8MA 5FYLH 2F19H 1ZRUA 4NXKA 4E5XA 3KL3A 1N5AB 3MBWA 1VLXA 2XTLA 3VD1A 3PAZA 4I88A 4IDLA 1MW0A 5LB1A 3VMOA 5IMOB 4N26A 5BRZA 4DK6A 4FP8L 1ZTXE 2LT9A 3QK0A 5KYXA 4YMPA 4Y16A 4G11A 4N86A 4EI5D 2XIIA 3RUGE 1DBJH 3E3QE 4UV7L 5TPWH 2JKWA 2P46B 5I1DB 2AJXL 2XWBB 2JCWA 3VWKA 4GI6A 4DZBB 1CLOH 2BHYA 3LPPA 3QO1B 2BVYA 2WW8A 5EOCJ 2C7UB 2VW7A 2YJLA 1ACCA 1FFPB 2J8HA 4EDXA 1YSOA 2JCCA 4LLDB 1KLUB 4J23A 5TQ0L 2NR6D 3US0A 3BPLC 4YHYB 2MCMA 5B1KA 1QVOB 4NDMB 1OAZH 1IC4H 1AD9A 4APQD 3D0LB 4NFBA 4XCEA 1QUPA 4OGAD 3U82B 3CSBA 1GMEA 4KKCC 2KQNA 3CVIH 1W72L 1JWUA 3TP4A 5F72S 4KXAA 1U2YA 1BXAA 3FSVA 3MODL 2WKGA 5T1JA 2YMTA 3RVWC 2CRYA 4RA0C 3WFHA 3ARGA 3P1VA 5IW6A 3LH2H 1RKRA 3MYJB 2VN3A 4MLIA 1JG9A 2CLRB 4G7RB 3US1A 1IMHC 1F3RB 5EOCL 4PRIB 4DO6A 4DKTA 3A4FA 2ZWYA 1TT6A 2E3VA 1S7SA 2ZAHA 2WYTA 5SWZE 3X12B 1UKTA 2HH0H 2HPTA 3TZVD 4JDTL 3L3GA 4L0ZA 4NO2B 5E1HB 4DP1X 5D4IA 2I25N 4EI6A 1G0DA 3QWOB 1FNEA 4I0PD 2PR9A 4PB0H 2ZE0A 4LSUH 1CLVA 2IJ0C 1KGCD 3HAEG 3BPLB 3TYGH 2EYRA 3SYCA 1U4EA 3DO3A 1O9VA 3V8OA 5DK0A 1DVTA 2DWXA 2XU9A 1V10A 4MHHG 1JPEA 4GI9A 1N8ZA 3JTTB 4DT2A 5IKCA 2RBLA 1HEJC 2ICCA 3N3EA 2KDGA 1O7DE 2ZXCA 2FJHB 1KTDA 3QYNA 1N18A 3O2WL 4EN3A 4Y2DC 3Q8AA 2AJ3A 2CO7A 1E5YA 4L8SB 2YN5A 5JORA 4U1GB 4PGBB 2Q86B 3CU1A 2YN3A 5G4OA 4BIKA 4UT7L 5I0XA 1AFVH 1RXLA 2E7LA 1P9MC 1MRDH 2WBJC 3FQUB 1KIUB 4RGOL 4HX1B 3N91A 3H53A 2F1EA 1AOZA 2WV3A 2IGFL 3ZQXA 4OGXH 2RR3A 1JZ7A 1TNMA 5ALBL 2KDYA 4CU7A 2A7BA 3ENEA 3HHRB 4QGTA 4Z5RB 1QFUL 1AXTH 1I3GH 2KLRA 5HYSA 4AL8L 1RVFH 1G0YR 1GPOL 4B9YA 1DBAH 1I82A 3WO3B 3MCLL 5JPNC 4MJHA 4P2RB 3AXHA 3MCG1 5I6LA 5C08E 4YSQA 4GNKB 1JNHA 3SDDD 3B6SB 1FPTH 1RCYA 4ZPVA 3VW3L 1RZIB 4ZBJA 1AE6L 2X4NA 3P0VL 1AZUA 3IN0A 4JFFB 5GS0L 3MJGX 2QPEB 1T7XA 1MDAA 5GGSY 1CURA 2AVFA 4KK9C 3BP4A 4NI3A 4ZNCD 1DVXA 1JCKA 12E8L 4KTDH 4NQED 4MWFB 2ISDA 1LWHA 3GK8L 5EIQA 3U46A 5LNGA 4JGNA 3DUSA 1NGYB 4U1SA 4DGUA 2F5AL 5EZIH 4K7PY 4CGTA 3IKCB 5FM4A 1ODAA 2EIKB 3G7TA 2Q2LA 4Y19D 3MO1A 5JPNB 1DJIA 1OAYH 1VF5C 3QDJD 2EVGA 3EYQC 4TRPL 3TBVA 4NYLB 2IOIA 5KYYB 4HFUL 5BMFH 2BNRB 3BPNC 4KX9A 3VI4B 1HQ4B 3PGDA 5KJ7E 4KRMB 3C9NA 1K6QL 4R96A 2VM9A 1KXVA 2F53E 4X8CA 5F0PB 1TENA 5IQNA 2E7MA 1HCZA 3WXWL 4GW4B 2MPAH 3CPUA 4AIXA 1OHQA 2PTTB 4Z7UE 1DSFH 2L0DA 1DBBH 2AJZA 3T3MB 1AGBA 5E2VL 1XTMA 4CVUA 2G3XA 1GS7A 3UABA 1G4MA 4TLSA 4XXDA 3ZIMA 1FNFA 2VDQB 4PS3A 4OCMC 4PJAE 2L04A 1CDIA 1KFGA 1GVIA 3CBKB 4U1MA 2ZAGA 1KB5H 4DP7X 1T4WA 3MV7B 3ATBA 3SCMB 1OB0A 2GAZA 4UTAL 5D93C 1UT1A 8CGTA 3UTZA 5DVPA 2EZ0C 5JOFA 4JZJB 2D8KA 3PV6B 4H40A 3SBWA 3DPBB 1MFCL 4ZMOA 1OARH 4Z3FA 5E51A 4X6DB 1R19A 1RHHB 2JXMA 2ZWKA 4G8AC 1Q9LA 2YD9A 2XX0A 3QEQD 1L0PA 3FSAA 3UAJA 1DQLL 5J0BA 3JWNC 4GP4B 4NRXA 2P44B 3MPCA 1I7TB 1T1YA 1YYML 3HI6H 2I07B 4N2MA 1C7TA 4HOWA 1TQCC 1JK8B 3M45A 3UTOA 3EBGA 3GBML 5KYUB 3NIGF 4XMUA 4NBYB 2B39A 4RZCB 2IAMA 3EFDH 4MD4A 3SKJL 5DTFA 4Z78B 4UNUA 1N67A 5DRXA 5M7QA 5G2NA 1FLTX 2YPLB 2H3XC 3OR7B 1T1XA 2Z64C 3HHSA 4KVNH 5KJRH 4QRPE 3PWPD 1FUNA 2B1OA 4NQEE 5CGYC 3NZHH 1OOWA 4GP8B 2R39A 4F7PA 4Y4FB 3REVA 4CA4A 2Y4SA 4LHQB 1N59B 1MZYA 3KH3A 4OM0H 4U6YA 1QI3A 3D2UB 5E1AB 3GUFA 3HVNA 1A6AA 3C8KB 4L4VA 5A2BA 1HILB 2CGYA 3QB7C 4TNVK 1HDMA 1E5AA 2JV6A 1SJEA 3QDJE 5C2BH 3C2AL 1FBIH 3II3A 4MJ5A 5KBKA 2HTKC 2XZQH 1BZEA 3X1FA 4RAHA 3MRLA 5C0CD 4RSYA 1B2WL 4MCYA 5FYLE 4EZKA 4OUOA 2A2QT 1X5GA 2XN9E 2CZNA 1EO8L 5B21A 4QRUA 3C08H 2J1YA 3CZFB 3MRJB 2A0LC 5AUMB 1ZHLA 3EJZC 4MJ6A 1FI8C 1CLZH 4HMDA 4W9LC 4NBXB 3TL5A 3UJIH 4PJHB 1HESA 4RETB 5L4JA 2DOCA 4Z6AT 3PL6A 5T5FL 2WZ5A 5MENA 1KGUA 5TF1L 4PD4J 2VXTL 2Y5EA 4D9QD 4TTDC 3HZYB 1QHOA 2JELL 2XXCB 1WA0X 4N22A 1NBYA 1BX2A 4MVBD 4BFFA 4P9HC 3NQIA 2R0WL 1EJOH 2C9UA 3G5XA 4TSCH 1A4JA 1SDDB 4AL8C 1NC4B 4GKNA 3FFCD 5DJ2B 3MKGA 2Y7SA 3TX4A 5JYMA 3KHOA 3AFLA 2R69H 4DP6X 2I5YL 2FBJH 3D7PA 1R17A 2VLRA 1UEMA 3AITA 5CSZA 4X7SH 3UBXG 2OW7A 1A5FL 4UOJA 4HJEA 3ZO0A 3P9WB 1IEAB 5D9SA 4N9OB 2NNAB 4FFYL 4HBCL 5JHLL 3H4FA 3NIFF 1NGPH 4NQVA 2FGWH 2KKQA 1AHWA 43CAA 3AXLB 4OD2B 5GS0C 1KJMA 1H3XA 3BAJA 3GRWA 3UCRA 2PWEA 4NOFA 5IFJA 1XXFC 2B1AH 3JWOL 1DJSA 4WI9A 2PNDA 3FFDA 1J1XL 4UIKH 3V0AC 4CAGA 1U30A 3VFWA 4PUBL 4PS7A 4W4OA 5KBLA 5E08L 2R0ZH 3OM3B 3V0VA 1PDKA 3SDXF 5CEXA 2FHFA 1HEZB 1Z9SA 2BFVH 4YR6A 4F7KA 4IBUA 1KTRL 3KLSA 3OKDA 4QI3A 3RI5F 3U30B 3T4AA 3UACA 1QSVA 2BPBA 1IC7H 3THMH 1UXSA 4JRXA 4AUUA 2LE9A 1TJMA 5FO9A 2GW5A 5JYLA 2EE0A 1N5AA 4H2CA 3DBSA 1DO6A 2IH3A 1AZZC 3DX3A 3CH8A 2E47A 4NQDE 5IMOA 3U4EB 1RY7B 3HNTL 3ZTEA 4BUHA 3LY6A 4JGUA 4HJTA 3U9PH 5FYJD 1G87A 2GIYA 1SXZA 3NJXA 5DLLA 3RVXD 2VKXA 5JW3H 1XO8A 4EIGB 4QXVA 4W6WB 5HVHB 5I1DA 4S1QH 2XWBA 4EZMA 4NZJA 2F61A 4DZBA 1L7IL 2ZP8A 4JKPL 4AYBA 1J12A 3QO1A 1UD5A 2JIXB 1NANI 2C7UA 4RDQF 2HMID 4JG1H 2OK0L 1FFPA 3QR1A 4HU2A 4LLDA 3QG6B 4KJWC 2Y24A 4GAYB 2G2PA 2XBTA 2E7BA 1QVOA 4NDMA 5KUKA 3SGJC 5C0FB 3CSTA 2NXZC 5LGHH 2VAAB 3D0LA 2WWMC 3RTLA 4TYUA 4D9QE 2DMHA 4FHBD 5FDWB 2CUHA 2YRBA 2JKLA 3HS0A 2WUBH 2YKKA 4J3OH 4Z8FH 5AOLA 3QJRB 4S1DC 2E6JA 4XMKH 4FZ8H 1OHZA 4PY8J 1CIDA 4ACTA 2CLRA 5D7KE 4FXGB 1LP9B 3VFVB 3RILA 4PRIA 3BC9A 5ILTL 4HUUB 3X12A 3HNSL 3L5HA 2APWA 4X5RA 1HYSD 2L4OA 1AZRA 4NO2A 2KZKA 3N6YA 3FT1A 4KK6C 1AD0B 5F6HI 3QWOA 2FO4B 4XMWA 1OZTG 4A1RA 4Z77A 1X6LA 4E0RB 1QKZL 1JI1A 5CJQL 5IT2L 1NAMB 1OOAA 3RUGB 4HLZH 3AS1A 5CLTA 3JTTA 4RGNC 3FN9A 5ISZD 3P3UA 4QHPA 4YUEL 5KBPA 2FJHA 5HDRA 3UPCA 1PBYA 3CCHA 4FNLH 3CQFA 4I77H 4K5OA 1DQMH 1R75A 4PG2C 3TN0D 5GJSH 3FOLB 4L8SA 4YX2H 4PGBA 1FJ1B 2Q86A 2R2HB 3TBCA 3UMTA 4OD1H 4JY5H 5F9JB 3DMMD 1ACXA 4GIOA 3QUML 3FQUA 1X9LA 5I6KA 1KIUA 2F19L 2V8LA 5DMYA 4HX1A 1KC5L 1AQHA 1WZKA 1IEBB 5CM1A 2I9LB 2QADD 4AITA 3O41B 5EPMB 3KM1A 2OXHB 4Z5RA 3VD9A 2VL4A 4X5QA 3Q7JA 5IW1B 5SWZB 4R3SB 2AVGA 4IOFD 4Y9CA 5KZCB 4HA1A 1AIFB 1CBJA 3PIQB 4P2RA 1CDYA 1DBJL 4YBQD 5TPWL 3RJDA 5IB1B 2XY2A 4NC1C 3B6SA 3CWGA 3WLWD 1CLOL 1LEKB 3KMDA 1QUNB 3MDJA 3GMNB 4ZUTA 1RZIA 3RDTD 1DEEA 3NPSC 2DMBA 1ESOA 2NY0B 4JFFA 3FPYA 1L5GB 3DJSA 3VTAA 1DDHB 2UX7A 4HHGA 1IC4L 1KXTB 1P9MA 2NUPB 4HEPA 1INEH 2QSTA 4AJVA 2XXMB 3EYVA 3BZ5A 1PZ2A 2J8OA 4MWFA 2Y07L 1E4KA 3CVIL 1FNHA 4PJ8D 4U1NA 1NGYA 4WY7L 2NR6C 3BZDA 4WEEA 1IGTB 2H0EA 4XNZB 1BOGB 4AEFA 1J8HD 3IKCA 3VXMD 3ESNA 2LU4A 4HLJA 3LH2L 3G9AB 3LN9A 4APQC 4GG8A 1LEGB 1E4WL 2DEXX 4OGAC 5E00B 4A68A 2UY7B 4XN4A 1Z9NA 4NO5B 1ZY9A 3C6LC 5D96C 2HH0L 2UWEE 2OJEB 4NYLA 3KXFE 2IBBA 4LSSH 2P49B 3JWOC 2BLFA 2YPVA 1SN5A 4LSVH 5KYYA 2BNRA 1SN0A 4C4KO 1QWHA 2XLLA 3U1SH 3VI4A 3BKMH 1HQ4A 4PB0L 4EI5B 4L8CB 4A2GA 1JZEA 5SWSA 1OSZB 3BVNB 1RZJH 2J72A 4R7LA 2GY5A 1M7IA 4AX3A 5FM5M 4GW4A 3VFRB 4O2FA 2PTTA 3KLKA 3QZMA 2BZDA 5C08B 4P48A 2MQ3A 1Q9OA 4I0PC 1MHPL 2BZ7A 2OV0A 2AEPH 1LM8V 1A47A 1XSOA 2YAOA 2PCPA 4JM2F 1NL0L 5KS9E 3WS6A 1ZSHA 2BSEA 4F15C 3ZDWA 2FD6H 1DQQB 4G6MH 1XGQB 4APQB 2EIZB 5KTEH 1ZJBA 3MV7A 3SCMA 5FYKH 4DK3A 4XVJH 1AFVL 4JZJA 3QRBA 3PV6A 4RFOH 3DPBA 4XC1H 2Q8BH 3UAEA 4X6DA 2Z31D 1KCKA 2XRAH 1RHHA 4M1GH 3QZPA 4LPUA 4JMXA 3OG4B 4DZ8B 3K8KA 3HR5B 3BEWB 4ODVL 2OCFD 3NCFB 4KKZA 4J3OD 1A1OB 5TDPB 1ZMYA 5EOTB 3TZVB 3U2JA 4YDNA 3A6BH 5DYFA 1I7TA 1FV1A 2I07A 4I0PB 1DBAL 4R7NB 2ZKHH 3ILDA 1WS7A 1J1OH 4HYTB 4P99A 5KYUA 4UAOC 4F15B 4RZCA 2ZUTA 1CGUA 4Z78A 1FDLL 4QRSB 4XP6L 2D73A 2F53B 1KCBA 1KFAH 5KYWB 2YPLA 1EZVX 1PG7X 3OR7A 5FUZH 1A3RL 1NC2D 1QW9A 3EH2A 4G8GE 3ESOA 4PJ9A 4Z7UB 1EEQA 4XT1C 5I16B 3RY4A 5I1GH 3DETC 3SE3C 1SYSB 5CBAA 3KS0H 4Y4FA 1LXMA 4GG6F 5DEFB 4RRPG 1N59A 4PJAB 1GR7A 2VSKB 3VXME 5C0RH 3S8GB 1A7PH 1W9XA 3MBXH 3D2UA 4XWGH 5E1AA 2IADB 2P8LB 5EZIL 1XH1A 4NZUL 5GZOA 5HHME 1HILA 2I27N 1QHQA 3VXQB 4PAZA 2GJ6D 5J1TC 1HJBC 2NNXA 1OCWH 3SY0B 5HDQH 3CZSA 1F4WL 1OAYL 1DVZA 4YC2C 4HD9A 4WK0B 4XR8C 1S3KL 3OG6B 5DZJA 4FQLL 1F13A 4OSUL 3RNQB 4UAOB 3S5LG 5F8RC 5IROA 1RZGB 5JIQA 3DDGA 1T1ZB 3CZFA 3MRJA 4Y1AD 3HHMA 1G1YA 1VCBC 4ZRGA 5AUMA 2MQ0A 2HCZX 4YXKH 5I1EH 5JMRA 1JXDA 4KU1A 4PJHA 5F70A 1G94A 2NYKA 4LRNL 4IOIB 2HPOA 3SDDB 4HEMA 4MA8H 3QFJD 4CBPA 4J8RB 4NKIL 1JV5B 4LSRH 3SYOA 3DVIA 1I1CA 2CR3A 5I6XB 1BM3L 1J8RA 2P7TB 3L3HB 4E9QA 3UG5A 3LRGA 2WGNB 5HD8C 3ILPB 4H20L 3O6FB 5FYJL 4KKBD 1VB9A 5FYJU 3T2PA 2AK1H 4KKNA 2NQ3A 1KB5L 4FFTA 3O3BB 32C2B 1ZANH 1SDDA 1R1CA 5HI3D 4NQEB 3D4ZA 3V8CA 5B1BB 3FXIC 1SJVA 2XBDA 2DQGH 1NC4A 3HBZA 4JGJA 5E8NB 4B50A 4W9HC 1BQRA 1IGYB 1EJFA 2BZCA 3AMKA 3IDYB 1OARL 1OTTD 3NN8B 3T6VA 5CSGA 3QC6X 3NZ8B 1CDBA 3D5OF 2NY4B 3KPPB 2JJSC 2NNAA 2ROYA 1I8UA 1TVDA 3RTQA 5EUKB 2AV1B 3QDJB 1IQWH 3WAKA 1NQBA 1S7QB 3PQYE 4OD2A 4LARH 3N85L 2XXFA 4FABL 1AI1L 2IVFC 3HI6L 3UBHA 3T0XA 1MCDA 3QUMB 3NQKA 1LHZA 2WWNA 3DX0A 2HRLA 5AEAA 3WFEH 1DVQA 2JJWA 1XBDA 1RIUL 3MLVH 5IR1B 2A9DA 2RMNA 4PJ5E 2OJ1A 5DC4B 3G08B 5EEVA 1KYFA 3QEHB 3SD2A 3AT0A 1HEZA 4HCRL 1G1OA 5LKNA 4KVNL 5ICYB 2HJFB 1OAQH 5KJRL 1ILSA 5AVRB 2J2ZB 4AYID 2JSFA 2EE2A 4GY4A 3NZHL 1T89C 1XGYL 4N4YB 3ZHNA 4HAGA 2DF3A 1LWRA 3OHMB 3I02B 3P4LA 4U7SA 4DGIH 2H3KA 4LU5L 4L9LC 1MZZA 1BEYH 4IBQA 2Y72A 4OM0L 2OMZB 3DECA 3MNVB 3HZKB 3U4EA 2VISB 4S2SA 4MXWH 4MFHA 4DKEH 1G7MB 1JPST 3MN8A 3MUUA 3QZWB 1A2YA 4PY7B 4JJOA 2XZQL 2ZKWA 3OMAB 4FQJH 3CXHJ 1SLWA 3VQ1C 1TZGL 4J1UB 3BI9X 1KNOB 4JVPA 5FYKD 2R29H 2R51A 2VMDA 2WZ0A 1E6JL 4QTIL 1TQVA 1L3NA 1NAKH 4Y1AE 5AWNH 4NO0D 4XB3A 5D1XE 2JIXA 2PCFB 3C08L 2B2XH 3IDNA 5EBWB 1E4JA 1USZA 4F33B 2Z34A 4GAYA 3BQUA 4P57B 3QFJE 3OB0H 1ZJAA 3TIEB 3UJIL 1F41A 2VR6A 1OP9A 1RERA 4Z95L 3F7RA 3FDWA 5FDWA 2O6CA 5EF0A 1V3KA 2QGCA 4A2FA 1HZHH 2WK2A 1COBA 3PWPB 4WI4A 2MOGA 3VUAA 3LRSB 1FAKT 5DUML 1H3GA 2AAVA 2EXTA 4TLKA 5C0ND 1EJOL 4FXGA 1LP9A 5GSVB 4TSCL 5C0BE 3TVMC 3VFVA 5I1KH 4OZIF 4HUUA 3V4LA 4P5TA 5T33H 3MJ6A 1I1AB 2R69L 1BPLB 1QD0A 1YO4A 1J9CT 2DN7A 2FT7A 2YEQA 3ABZA 4N24A 1AD0A 2FBJL 5BZXA 2FO4A 3QAQA 4LFHG 4MVBC 1YHPA 3JVFC 3PY9A 5DHDA 1LWJA 1U33A 4FC3E 3QUXB 4E0RA 2FGWL 2D9CA 4Y5XB 2CHNA 4B96A 1NAMA 4UTAA 1AS6A 3RUGA 2OMNA 1QNIA 1F45A 3GSNH 4OF0A 5MHSD 2BINA 4Q2ZB 4ZFGH 1FYTD 3MRPA 3WKPA 1FN4B 5GGRY 4UIKL 3O6KH 3L4TA 4AIOA 2YAEA 4GQPH 3ZDZF 1VZIA 1GJWA 2WQAA 2X12A 5C97A 3D39D 2R0ZL 2A6KB 3FOLA 1DEDA 1U8NB 5IJBC 3WTYA 4FJZA 3QXVA 4R5XA 1O7SA 5F9JA 1ZLUK 4JHAH 2G60H 3FQXB 1IC7L 2VDRH 3GHPA 25C8L 4TULH 3THML 3GS7A 3C12A 5IIEB 2BS71 2BSCA 3BXNB 4JO2H 1KBVA 4Z76B 4NXSA 1F86A 3HG0A 1E40A 1IEBA 3B2PA 3MNZB 4NKDB 2I9LA 4OF5A 5E99H 5F7AA 3UEQA 3O41A 3I6LD 4ZMTA 5EPMA 4A7QA 5JXED 3WEBA 5ABDE 3IETB 4FE9A 4KAQL 2V17L 1CXEA 2OXHA 5DHYB 4Y4KD 2OX5B 2VN5A 4ABQA 1HVXA 1UWGH 3V5DB 2EC8A 4IMKC 4HULB 1QPXA 2QKIC 4JM2C 3FC8A 3KPTA 4R3SA 5SWZA 5ESAB 5IW1A 5GRJH 1CG9B 5FYKE 1AIFA 5A40E 1DYZA 3R18A 1IFHH 5JW3L 2WXLA 2OYPA 3EOBB 4S1QL 1WG3A 2JJVA 5IB1A 1M3JA 5LUMA 4UQDA 1LEKA 1QUNA 3GMNA 4OJYA 3RB7A 4WWKC 2BCKB 4KC3B 1NGWB 4I1RA 3DHUA 3NGBB 4LGRB 4BRJA 3RVXC 1L5GA 4UANA 3K46A 3QZWG 1DDHA 3MROA 1UXMA 2D3JA 1KXTA 2NUPA 4GLRH 4U1HB 2CJSA 1ACYH 4PEEA 5LGHL 4GAJL 1KSRA 2AS5M 3HPJB 4HBQA 1BECA 1GGBH 3UJTL 4F80A 2HMIC 2WUBL 4Q6IC 4Z8FL 9PCYA 2WOBA 5DYOB 3QDGD 5F6HJ 1KPUB 4XMKL 4FYQA 1IGTA 3B5TA 4FZ8L 4PP1C 3DI2B 4ZSOE 1BOGA 5H8DA 2NX5D 4WAFA 4PN6A 1EIBA 1LEGA 1MIEH 2UY7A 4NO5A 1WP6A 2YMXL 4P3CH 4GO9A 1NINA 5T5FA 2ID5A 2NY2C 2OJEA 2CLZB 4MZ2A 5I74C 3HE7D 3N50A 4LOFA 5EC1B 1KTBA 1JTTA 2CBQA 5FF6B 3L5IA 2ICWB 4FQ2H 4CMHC 3I74A 4JPVH 4EI5A 2DJUA 3GI8H 4L8CA 3NFSH 4NZDA 1OSZA 3BVNA 3H6AA 2B9BA 5I6OA 1NCAH 1KB5B 2D31B 4K3GA 5GZND 5MHSE 1HYSC 2O61B 3DJZA 3VXRE 5C08A 3S5ZA 1WHPA 3EH3B 1V8HA 3IRZA 4Q6IB 3UDWC 1I8KA 3BGFB 5IQ7H 2BXZA 1OK0A 1NLBH 3D39E 2V2TA 2J25A 3SE8L 4NQCE 4FFYA 4I77L 4XP9H 4ZAKD 1DQQA 3UO1H 1HXYB 1XGQA 4YX2L 2EIZA 4G83A 4DP4X 1CDGA 1EAPB 2OKMA 3RAJL 4OD1L 4JY5L 5AKSA 2Q8AH 1U9KA 2HX8A 4RISH 4QMEA 3B7RL 3M6DA 5L88L 2YAHA 4PJIF 3SYQA 1RZKC 5AALA 3WNOA 3AQZA 4XCYB 1CDCA 1CT8B 1L7TH 1C7SA 3MJ9H 3OXSB 3X13B 2N7AA 3BEWA 2EDMA 3HR5A 4QYOB 2X05A 4ZFOL 3Q8FA 1EEUA 1MCNA 1JGLH 2WQWA 1A1OA 3EOYG 4XMZA 2IBZY 2X88A 3IPFA 5TDPA 5HTSA 3FF8A 3DMMC 4JHUA 3RWFB 3TZVA 3VAEA 4P23C 3ZTJG 5EU5B 1KYOK 4LCIH 4XCNB 3DHJA 1UXWB 4N2BA 4ELMF 2UWEB 2BIPA 2DLTA 4R7NA 3KXFB 2AP2A 2KS0A 1NBVL 3GS4A 5AL8A 4QJ5B 3L54A 1KZYA 4QRSA 2F53A 2JQZA 5DDHB 4CSZA 4A2LA 5KYWA 3SD5A 4UQ3B 4IOFC 5DQDH 3MRCA 5ISZB 3C87A 4Z7UA 4ENEC 4JFPB 3H42L 4YBQC 3EUDA 4OU3A 1INEL 1NCDH 3AWEA 1TYRA 2VLJE 3CMGA 5FO7B 2HX7A 2YOAA 3CHQA 3MA9H 3TN0B 3VGAC 5DEFA 3RDTC 5KS9B 2P5WD 3BOVA 4PJAA 1A14H 3T0AA 2NX5E 4Z18A 3JXAA 2IADA 2J12B 2QGEA 3VTMA 1R3IH 3L3KB 3HFML 1QBAA 5CZRA 3VXQA 4XB7A 4D3CL 4N2IA 1SLXA 3SY0A 2QADB 4BCYA 5AB1A 4PJ8C 4Y9FA 1V3MA 3BWSA 3L1EA 1L3WA 3RNQA 4LSSL 3N1QC 5ADOL 1VADA 4NKOB 3RZCC 1RZGA 3U1SL 3V0EA 3BKML 3TV8A 3KYKH 1T1ZA 2C5DC 2DAVA 4PJBE 4ZO8A 3IJYA 4K3EH 3F7VB 4QJ3B 3CZJA 2OMWB 2H8PB 2CWRA 5C6PB 5KBDA 1PPIA 3SDDA 3QQ9D 4NWUH 2F1AA 2IPTH 4YE4H 1JV5A 4XBGA 3RDTB 5SWQB 2LTQC 1DBML 1L6ZA 1HX0A 2P7TA 3LZNA 4NKMB 1BA9A 5T1KD 4IIZA 1IE5A 3ILPA 1HXKA 3WFDL 2AJUL 3O6FA 4NZRH 5DHEA 1M57B 3VA6A 3U2SB 4AE1A 2FD6L 2W60B 4WFFD 4G6ML 2E56A 5L0QB 3JV5A 2H9GB 4HKZB 4LVHC 4LEOA 4P9MH 5KVEE 1PTZA 3O3BA 32C2A 2OTWB 2WYHA 4QRPA 3WIHL 4NQEA 3HI5L 5HJBA 5FYKL 1MCCA 1TEYA 3UJJH 5E8NA 1BQLH 3OKLB 1LE9A 4GKSB 2WM0A 1IGYA 5HGHB 3VCLB 3NN8A 3WELA 1HKLH 3VXMB 2XRAL 3LZQA 3B2UC 3NZ8A 4MDJB 2ED7A 1UA3A 3KPPA 3WV0A 2HT2C 3BW9B 5FA3B 5HHMB 4HGWB 1NPJA 2EKSB 2AV1A 5EUKA 3V2AR 3ULUF 3O45B 3QDJA 2Z7YA 1R34A 2BDNH 4R90H 3L17A 5AFAA 1GYAA 3F85A 4E9SA 3A6BL 3HUJF 2IG2L 2JKTM 2XJKA 3QIUC 3TCTA 5I0DA 4P5RA 2ZKHL 2IDCA 2FECI 5C07E 2XN9A 1BVZA 2VOTA 3H56A 3ROOB 4GQ9L 3TPUA 4BHUA 5IR1A 3AACA 3DSFL 5AW3B 5EBLB 5FFGA 3ELQA 3G08A 1KFAL 3QEHA 5FUZL 4NJAH 3GMRB 4GYBA 5BUAA 3KYAA 1NBZB 5ICYA 2HJFA 2JQAA 1M4KA 4YPJA 4HT1H 2J2ZA 4ABWA 3U9WA 5J3HC 5I1GL 1IC1A 2VMFA 5KAQG 2VRAA 4XP1H 5FKPB 5BPPA 1OQOA 4QUOA 1CQYA 2Z8VC 3A24A 3I02A 4K3JH 4NERA 5E1IA 2PW1B 4AV0A 4QTHB 4YN3A 2OMZA 3LKOB 3MNVA 3HZKA 4WLCA 5FM5O 2IGLA 2VISA 2XTSA 3HTLX 1PW3A 1G7MA 3FTYA 3F12B 5B1AB 3QZWA 4MCNA 3WTXA 1NFIB 5K9QI 3O4OC 2Z31B 2ZUWA 3V4UL 3LIUA 4FYTA 1OCWL 4QOKD 3IWUA 4GT0A 4U6VH 5HDQL 2HT4C 4J1UA 3H2WA 4PREB 1KNOA 2YHGA 2EACA 2DRUA 4NI6A 3U48A 1ZIBA 5HGAB 3RYMA 2PCFA 4KK8D 5GISH 1KIRA 3ZK0A 1YC8A 3W38A 1Q0YH 5EBWA 3AM8C 3IAQA 4F33A 3PQYB 4P57A 1YN6A 4AW4A 2QQLH 3DDFA 3PHQB 3IJSA 4GFXA 3TIEA 1UGKA 1J5IA 3NP4A 1RP9A 1JPSH 3CSPA 4MA8L 3KM2A 1GS8A 1OF0A 2CPCA 4LSRL 3RU8L 2DEWX 2MSPA 4DVRH 4OZ4A 1HJCA 1NC2B 4PJ5B 1XHHA 5BVPL 4WFFE 2OZNA 5HHXL 4Z23A 1KWKA 4UQAA 2E27H 2BHZA 1GCFA 2EE9A 1TTGA 2AK1L 3ABKB 1JGUH 3LRSA 4JHWL 3AABA 5GSVA 5J7CC 4YDMA 2WY3B 2DQGL 4C58B 3NZUA 3KPQB 1I1AA 3O6ML 2AHIA 4MA1C 2XV2A 1OGSA 3MRHB 3UZVB 4BSVB 4JO4L 4KKBC 4NQDA 4NN5B 2WINA 4XP5H 4FD0A 5F3HB 5HI3C 5B1JA 4XO4A 4AZ8B 3QUXA 3I9GH 1P7QD 4FHJA 4X83A 4Y5XA 3T0ED 2ZXBA 4ANWA 1JZ4A 1EK3A 1IQWL 4LE8A 1IM9B 2Y7QB 4FNQA 3QULA 4LARL 3KYNB 1H3WM 1FG9C 5C0AD 1KY6A 3TM6A 1OTTC 3SSGA 1T2QL 3WJJA 4YE0A 1XL6A 2JWYA 3G6JF 4FKHA 4KPHH 1UURA 4Y1AB 5D5MF 4Q2ZA 3WFEL 3A47A 1FN4A 5D1XB 4AW7A 3R8QA 3UC0L 2NY3B 3MLVL 4LSQL 2D03H 4MD5A 2HWZL 2Z93B 4ZFOB 4AQOA 2QKSA 1OKEA 2A6KA 3OLEA 1BAFL 1U8NA 1QOKA 3QFJB 4O58H 4AK1A 3NDZE 3ATEA 4Y2OB 1MNUH 1OAQL 1XF1A 2JJTA 4M48H 3CFBB 4QNPF 4HMCA 4JQVA 3FQXA 3DJTA 1T0NB 4NPKA 4WWNA 3WOVA 3D06A 2YC1B 3BMWA 4Q7DA 5IIEA 1EFXD 1YJDH 3BXNA 4PRPD 5I8KH 4Z76A 5I1LA 4EZJA 3MNZA 1F5WA 4NKDA 5EU6D 4DGIL 3ECUA 3HE6D 3NAAH 4UWQB 1BEYL 3IETA 5AVZB 3TOPA 1V55B 2WGXA 3UG3A 5KBNC 5DHYA 1LVEA 4XAWH 5AB0A 3V5DA 4MXWL 4DKEL 2WN2A 2XHNA 5ALCH 3QWRA 3IAPA 5ESAA 4M93C 2E4TA 1CG9A 2UUDK 3RWJA 3LH8A 2W92A 5JHDB 3GBEA 3HBGA 3JV4B 4FQJL 4XN8A 3EOBA 1QR1B 1OP5H 3LRHA 2R29L 2V4LA 5AWNL 1NAKL 3D3VD 4LASH 5BZWB 2XIBA 5F8QC 2BCKA 5LCVH 2R8SH 1NGWA 3IRPX 1JERA 4NLHA 4JPQA 4JFQB 2CGZA 4PRDB 1QLEH 3IMWA 3CVDA 2YQ3A 3ARDD 4DGWC 4U1HA 3ZT5A 2Y5TA 5CD3B 2ENQA 3HPJA 1UWXH 4Y9EA 5I15L 4XXCA 3P30H 1UT9A 5DYOA 1A6WH 1ERNA 1KPUA 5K59F 5DZOA 2GFBA 4HIEB 4WWPA 3V9CA 2WZPD 3N44F 1LEIB 3WY4A 4DEPB 2M1KA 5CP3H 3BZ4B 5I1KL 5CXPA 5KVDH 4FI8A 2KYIA 4ELDA 3Q6FB 4P06A 5T33L 2CLZA 4ABVA 1IU1A 5EC1A 2ZYRA 2NYYD 5FF6A 1E4XI 2ICWA 3IDGB 3PDDA 3LSOA 5DMIH 2C4XA 1ZIAA 5KOVC 5C0AE 2NCMA 4L4JA 2O61A 3UIYA 1KB5A 2D31A 1A4BA 4WNQA 1DVFD 4DEWA 3UP1A 1QTYT 3GSNL 1PLAA 3O3EB 4G8IB 1PYWB 2GPZA 2VB5A 2WO3B 4O2CB 1WWWX 4Z7QF 4XPHL 5D1QD 3O6KL 5AZEH 5DZVA 1MWOA 1YPZE 4M02A 3WS3B 3U25A 4B0MM 6TAAA 1HXYA 3F04A 3OHXC 5HVWA 1H3PL 1NFDF 1F4YH 4MX7B 4F57H 2QV4A 1EAPA 2QLYA 1MXDA 2G60L 5EU6E 4YO0B 1JVKA 5DMGD 3WUWG 4AGLA 2FIKB 4JJHA 1I3VA 4JO2L 1MCPH 4PM1A 5E99L 1BZQK 1CT8A 4XBMA 4ZSOB 3OXSA 4OFPA 4I0CC 3X13A 4AGMA 5EEZA 1DJHA 3GZOA 4NUGH 4QYOA 4A7GA 1KPRB 4JDZB 3RWFA 1IAII 1TU2B 1UWGL 3GSXB 1WZAA 5EU5A 3EDFA 4XCNA 1G9EA 1UXWA 5GRJL 2IF7A 2UWEA 2EDNA 1I3RB 1HOCA 1X5KA 3KXFA 1IFHL 3DKHA 4CC4A 4TQPA 2YSTA 3FBQA 3C6EA 2OMTB 3MZTA 5HI5D 3RHWK 5JXEC 5FCUH 4C47A 2IOMA 3A4EA 3OL2A 1E28B 1PZ3A 5DDHA 1KN4H 5E6YA 2V5TA 1J0KA 4NQSB 4P05A 3BLBA 3HR6A 2MFNA 5I2IB 2E7CA 3T1FB 3VXRB 4YK4C 3A4AA 4PWEA 2CO2A 1I9IH 1FYTB 1YYLH 2Y6SD 4JFPA 2A9CA 4F9LA 4H25B 3MUGB 5AVTB 3B43A 5DMJB 3ULUC 4LLVB 1HIML 3ETSA 3F2LA 5F7WC 5FO7A 1GGBL 3TN0A 4X9GA 3D39B 2OQJB 2DH2A 1F56A 1RZ8B 4JN1L 4NQCB 4PHXA 3T0BA 5KS9A 4XO5A 3LNDA 3WE1A 2FWUA 1BJMA 1W8OA 1JRHI 1S2EA 3TA3D 1FZJA 4M5TA 4YGVB 3MOBH 5K5YA 3CH1A 1DSWA 3L3KA 1P5UC 3PGFL 1INDL 2Y1YA 3NIFE 1CQKA 1MIEL 3ZYOA 1AMXA 4P3CL 4X50A 1EX0A 2J71A 1P0SE 2P26A 2O6PA 3DUUB 4Y4KB 1Z5HA 3HRZC 1NCHA 3DV6B 4FQ2L 5D70L 3UTSD 4TNVF 4JPVL 3GI8L 1URLA 4ES8A 2XYCA 3F7VA 3O8XB 1OXYA 1CD1B 1M6OB 2OMWA 3GLDA 4MYWB 2H8PA 4N68A 5LHDA 2F08A 5C2UB 3GLAA 4OVVA 5JW4R 4U1IA 5E2TL 1JHKH 3HE7C 3QRFM 1J48A 4RWYH 5D1QE 2R69A 2NPLX 4PJEF 3DIFB 5SWQA 3VDBA 4DSYA 2C3VB 2FTAA 2AGJL 4JQXC 4WO4D 4NKMA 1NLBL 3OZ9L 5A7BA 3U2SA 5GZNC 2DYRB 2CO4A 3ZHKA 4XP9L 3FHQA 3NJJA 2W60A 3HPLB 5FOJA 3UO1L 2GUOB 4G8GA 4HKZA 3V4VH 3N41F 2OTWA 2OZ4H 1WCBB 3KAAA 3PP4H 1MCSA 4LL1A 1G5AA 4L18A 4H0HB 5IHZB 2VLJB 4TL5A 3OKLA 2Q8AL 3EKCA 4GKSA 3LAFA 5HGHA 3VCLA 1B0WA 2WQVA 4KOCA 3HRZB 4HGMA 3VXMA 3EH1A 1QFPA 2NX5B 4MDJA 2ITFA 5CSBA 3KNBA 3BW9A 5FA3A 1DDTA 4HGWA 2EKSA 3O45A 4NRYB 1KGXA 1YECH 1KDIA 1IQDB 1OSPL 2AJYH 2VT0A 4YHLL 3I9IA 4LCIL 1AO7D 2LQRA 3L1FA 4QJ4B 2C7FA 3ZLQC 4HHWA 1KELH 1J5OH 2OSLB 4BWTA 3ROOA 1OGAD 5HYEA 2H2SC 3LZRA 4FFWC 4PJBB 5EBLA 3CNKA 3TWCH 1U8PA 4UV4L 5DQDL 3GMRA 3C2SA 2XTJE 1NBZA 5TE4H 3B2VH 4NAJA 1N8OE 3AQYA 4PGDB 4ZI8A 4CRPA 2EJ1A 2WWOA 1ZHKA 4F58H 4JKWA 5ANHA 3BDBA 3D34A 1OSEA 2HRHA 3WKYA 4ZAKB 5FKPA 3MA9L 1FL6A 1EQWA 2NY1D 2PW1A 3K8LA 4QTHA 1I4FB 2ZXAA 3TO4D 1A14L 3GLEA 3ARFD 3LKOA 5BCAA 4YDVB 3S2AA 1SBBA 5A2JH 3F12A 1R3IL 5BS0E 4GXUN 4N0CD 2CM5A 1NFIA 1NGQH 2ATPB 1J7VR 4X6EB 4HH9B 1H6UA 2Z31A 5FWQA 3ATDA 4KKRA 4LAQH 4RBPH 4ZW8A 3ZL1A 1P4UA 3FL7A 4QAMB 4ZO7A 4LMQI 1QQDB 4MMZC 3M7OA 4JGMA 4QY8A 2ZYSA 1TQWA 1GTNA 4PREA 4QT5B 4MAZA 3UTSE 2ZOLB 1LTXA 3GBDA 3K4ZA 2CO3A 3CX5K 4L48A 4TSAH 3IAGC 4JFZH 1DJXA 5HGAA 2YD1A 3KYKL 3BN9D 5CINL 4PJFF 4MMYB 1U3HB 3I2CH 3FK3A 3PQYA 2DLIA 4K3EL 4KUCF 1J88A 4PP2B 2EXWD 5CHNB 3PHQA 3O9WD 1EUTA 3DYMA 5IHLB 3BD3A 4O02H 4XH2B 4NWUL 1E67A 2IPTL 4WWID 4YE4L 2BP8A 1MOEA 1J11A 4J6RH 3CZGA 1PZBA 2P5ED 1NC2A 4PJ5A 5E5MB 1C1EL 1MCHA 4HPYL 3ALPA 3KYMB 1ZHNB 4WGWB 4K71B 1R3LB 1BVKA 2DIAA 4LLMB 5GRWA 1KN2H 3UJJL 2VDLH 4U3HA 3GSNB 4B27A 3KPQA 1BQLL 2P47B 1QFWH 3QCVL 1FFTB 5MI0B 3B9AA 3P11H 3UZVA 4BSVA 4XPAL 1HKLL 4X8GA 4JCWA 5F3HA 1SYVB 3JWNG 2MQCA 4GB9A 1AO7E 4H8WH 1BIHA 3P2BA 1IM9A 2BDNL 2Y7QA 4QTFA 4ALAL 4Y5YB 1ZE3C 5ESVB 5HGGS 4QXGH 2VDRB 5KVDE 4E2OA 3OAUH 4Y1AA 1QW8A 3ZE0E 3TFKD 3ULVH 4AK2A 3D69B 4UI2A 5D1XA 3WDIA 2PABA 5CJXA 5IGXL 3FZUC 4KI1A 5KSAC 3PS6A 1OE2A 2Y1AA 4RAVB 1PLGL 1YEKH 4ZFOA 2MKLC 3DJRA 4OZGF 4YEFA 3ZT7A 5A2FA 3VRJA 3S88H 2FECL 3QFJA 3ESVF 4G80B 2H45A 4LRIA 1NMBH 2EDFA 1F90H 4Y2OA 4EO5A 3REWB 2R27A 4OV6F 5EWIH 3WSQH 3CFBA 4YXHH 1ZLUH 1WT5A 1T0NA 2AEQH 4A2HA 5T1KB 2YC1A 4FTDA 4MCZA 4WFED 1E5UI 3D4YA 1EZLA 3AY4C 3NCBB 1SVZA 2WKOF 1AZNA 2VSCA 4QYAA 5C0BA 2ERJB 1MRFH 3UBGA 1CVSC 2N01B 2OXGB 3NTCH 3PFQA 3FQ2A 3DXAD 3BPCB 4I9XA 4HGKC 5JHDA 2Z4QB 3I75B 3JV4A 1QR1A 2G9HB 1PQZB 4OI9A 4ZMYA 4XCCH 3W0WD 4EI0A 4AM0B 5BZWA 3GSOB 3T9WA 5INDB 4KZDH 1PKOA 3KVDD 1E65A 4TOYH 1Q0YL 4GIPD 2N7BA 3T4YB 3ZU8A 4JFQA 4YBHA 3S8WA 1PSKL 1TOXA 2CRIA 4PRDA 1MJJB 4LB8A 5CD3A 3FTUA 2P5EE 3GMMB 1JPSL 3ABGA 3IFNH 4N2NA 1UACH 1X4XA 4XC3L 2C34A