1IM3D

Crystal structure of the human cytomegalovirus protein us2 bound to the mhc class i molecule hla-a2/tax
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PWFQIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESLKWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Antigen presentation subverted: Structure of the human cytomegalovirus protein US2 bound to the class I molecule HLA-A2.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 95
sequence length 95
chains with identical sequence H, L, P
ec nomenclature
pdb deposition date 2001-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1im3D00
1IM3D
chains in the Genus database with same CATH superfamily
1OAQH 5GISH 3QIWC 3ZYOA 3V6BR 3R8QA 4OT1H 3EO0A 1KC5L 3HI6L 1SJHA 3CN3A 5D5ME 4FNRA 5EFIB 1QP1A 4BFKA 3JVFC 3R4RA 4YXKL 2YMXL 1RI8A 2Y2WA 1CIUA 4MJ6A 4WWKA 4YSDA 4M4PA 5HHOD 5MERA 2EC9U 2AXGA 1JS4A 1U6AH 2DI8A 4C56B 3GF8A 3UAFA 5EO1A 5DHMC 3SPGA 3PGDA 5DJ0B 1A7RH 2ETWA 3EGSA 1PKOA 3VCLA 1CBJA 3HG5A 3MNDA 2CDGA 2Q7NA 4UTBH 1JVLA 2LTQC 5CM1A 4LKCA 2FYYB 3O9WA 1DJSA 4EI6B 5AB2A 4PY7B 3VGEA 4HP5A 3VD1A 2IBZY 4TVPL 3SYCA 3WFDH 2OZ4A 2JI3A 4RGND 5ES4B 3OF6A 2I9TA 3LN4A 3VVWA 3KGSA 3MUUA 5I1GL 1KEGL 1GS7A 1TZIA 2F68X 3B9KB 4MS8C 3AXLB 2IH1B 5JNYA 2P42B 4ZD3L 5F9JB 3RNQA 5DA0B 1UKTA 1A8ZA 3CXFA 5FDYA 3GMOB 2X38A 2GTWB 1D9KC 2NY5C 4G8EB 2V7NA 1WEJH 4Q9CA 3UDWA 1MELA 2D0FA 1TO4A 3LS4L 4FFWD 4MKTA 1YHPA 5MHSE 3A6BL 4XB7A 2APWA 3DX4A 1L0XA 2CXGA 2J71A 2TAAA 3N2JA 4RBPH 4Z7UB 3VDCA 1BQHB 3WL9A 5IWLA 5JLZA 4KRPB 5C09D 2DPKA 2MFNA 4J6RH 4AEIL 1IC7H 3X1EA 4ZRGA 2NQDA 3PWPE 3FQ1A 2AAAA 3GMNA 3M07A 4XHJD 1YEFL 3QWRD 1UM5H 2VXQH 3ARVA 2BY1A 3N1PC 1MAKA 4HS8L 1HHHB 1EO7A 1T2XA 2K9UA 3FTVA 4ZAKB 4YHYC 2I5YH 1XGTA 1PIFA 1HL4A 2BX5A 4TYUA 5T1MB 5EORL 3P3TA 3ZDXB 5LXGH 1FYHB 1BLNA 4LFHD 1UCBH 2PUQT 3P0VH 4Y16A 1MXDA 3BISA 2LAGB 3QEGH 3DVIA 3ZKMC 4BK8A 4EN3A 5E0QA 1KGCE 1W0VB 4NKOA 5HHME 4ELMF 2WO3B 3CK0L 4GEJA 4UT6A 1YECL 2Y36H 5F3BA 4HUVA 4MXQC 1NGXB 4Y4KD 3LZOA 4APQD 3PPSA 4LBEA 4M1GH 1CGXA 1F4HA 2LGNA 1UHVA 1DJXA 1JWSB 1R6VA 1XD1A 2QHLA 3AZUA 1XMWA 3DIFA 3BVVA 3LV3B 4NHUA 3C08L 3L54A 4POUB 2BERA 3D25A 2PXYC 4NUJA 3FUEA 4PS8A 3NRQA 1XQ4A 4Y9FA 3CHSA 5FFLA 2X70A 3S5LG 3CXHK 2XTSA 3QCVL 4QY8A 1K6QL 4ADGA 3KH3A 3C5ZB 4P05A 1Z9NA 5D1QB 2WY3B 3DGDA 3RGVD 1MUJA 3T4YB 2J12B 2DQEH 2GJRA 5C0RL 3NAAL 6PAZA 4WUUE 3ZE1E 1J5OH 1GIGH 1KJ2H 1N5YH 1Q9KB 3K4DA 4K8RL 3PG2A 4FMVA 4TSBL 5T3ZE 3O3DA 5F88A 2DEYX 3RA7H 5ESVA 4N8CL 3SGJA 4LSRL 1XB6A 4GBXD 1RIHH 3VWKB 4OF3A 2VN6A 3NIDF 5F0PB 5L0QC 3MLTB 3IGFA 2AJZB 1P7BA 2R9HC 5FA3B 3UTQB 3QR2A 1SEQL 3P1VA 3QXDA 5B1JC 2FLBT 1OSPH 1T2QH 2F54A 4KOBA 3VH8G 4OCSL 2GHZA 4FHKA 2VMJA 1C9SA 3UGXA 4W1TA 1G6VK 3CUPB 3KLQA 3C5JA 4XP4L 3Q8CA 2OR8A 4GQ9H 3MBEC 1OOAA 3KM2A 4BZYA 2A74A 3WSQH 4A04A 3WDIA 1CLYL 2JTDA 4WDIA 2W1NA 2K0RA 1L4IA 5JO5A 3VSTA 5SWSD 1ADWA 3KXFD 2JKLA 3P2TA 2B4CC 3EADA 5GS0D 4JCLA 4BSVB 5T1JA 3QEHA 3VRLF 4WTXA 1RZFH 5F9OH 4ZMLA 4AYGA 2BC4B 2BSCA 3WXVH 4G2AA 4M61A 3PJNA 4QRFA 2JK5B 4D0CA 4MCMA 1U8CA 2VIRB 3B9KD 2VL5A 4NN6B 2X1WL 3RILA 1T21A 3OAYK 4OF7A 4JFUA 1HE7A 2HFFA 2VUKA 3LZFL 1MAMH 5FKPA 3R06A 3TBYA 3WJLA 1KCSH 5IROC 1EUTA 4IIQA 5EDSA 1DN0B 2BSSB 3QWOA 2DBLL 1RIUL 1AR1C 2O5XH 5IMKA 1YYCA 1NMAL 2ALWA 3IN2A 5K59F 2XVBA 2VNCA 3LZQA 1IX2A 2G75B 1I7RB 4P4KB 4FOMA 4J4PD 5J3HD 2E9JA 4N9OB 3R0MA 1G1YA 4R6UA 4W4OC 5C0IB 2HX8A 3KEHA 2YSTA 4PJXA 5LXVA 3AREA 2IXQA 1YEGH 2MPAL 1PG7H 4NM4L 2JKWA 5IB4A 4QRPE 2DQTL 4UV4L 5B8CA 2I60H 4NN7B 1UA6L 1KBBA 2OTWA 3BAIA 5IMLB 3NIGF 2OXHA 4LSTL 3FO9A 4WJ5B 3G3LA 3FCSB 4UAOB 3NACH 4XNZB 2AJYH 2QDWA 1NLDL 1HSBA 4Z78A 1JF6A 5F0MB 2VUYA 4O51A 4YGAB 1FI8C 4OKVB 3TPKA 3FMGL 1QRND 1BVKB 5E8EA 3T0VA 3QRFM 3EF7A 2FX7L 4L3ED 1U2YA 2N3JA 3N91A 3WIIL 4P5KA 4NC2B 2QPEB 2ESVD 1NUFA 4JO4L 3KPSA 4PJFB 3QG6A 4MFHA 5FYKE 2IANE 3KDMB 2ENPA 3O3UN 1MF2L 3RTQD 4V1DA 1SJEB 5CGMA 5IJDC 1N7ML 2J88H 3D2UB 3NCFB 2O6FA 4B9KC 4LLWA 3L3IA 4I18A 4LARH 4D9RE 1FZJB 5ID1A 2Q86A 2YWZA 1AG0A 3L3JA 2JF1A 2OCCB 1ZAGA 3MODL 4PPTA 3TC9A 5J9PB 1IBFA 1V3JA 4N2OA 3L3GA 4WFHE 3ARBD 4HOWA 4MNGE 4HIIA 4R4FH 3QUMA 4UZSA 2HT3D 1C1EL 5AYUH 2BSTB 4DN4L 1MQKL 3HE7B 4Y5XB 5GGUA 2BP5M 1MRFH 5EU7E 1E5ZA 1XIWB 3ZE0B 5KVDE 1J8SA 4MJID 3AROA 4GAJH 4MD5B 4N2KA 4G6MH 4O02A 3VI4E 3ROOA 4DKTA 4L8DB 1ZJBA 2E7BA 5FHBH 4NIKB 5MEOB 2FJHA 1D6VH 1FLRL 5DRXB 2HRPL 3EKCA 4AC2A 4JANA 5JW4M 1AZVA 3PV6A 1AANA 1DR9A 2BJMH 4JDEB 4P9MH 2E9BA 1Z3RA 3CVHL 1AH1A 4XC3H 2H8PB 1II4E 4OFPA 2DTSA 5GJTL 1LO4H 3Q9PA 5FHAL 5HI4C 4QKTA 1PL3A 4F8OA 1GOFA 1L9SA 3KPLB 2WMPA 3VFRA 1R5IB 4K7PH 4LLQB 1A3RL 4P5TA 4LB8A 4OCYL 1KTDB 2ENYA 4EIUA 2BXZA 1MNUH 3W3BA 4XZ4A 4OCRL 5I73B 3TPUB 5D4QA 4R84A 3K8MA 3HG3A 3TA3B 3N9GL 5KVGL 2FYVA 4I4WA 2Z4TA 5DWUL 2KQNA 4ODVL 4QTHB 4L8SA 5E5MB 3M1OA 3IKCA 3W1ZA 3M7FB 1IGYA 4GKSA 4Z7NF 1I7ZB 2X9WA 3O8XA 1NCWH 4RGMC 1J9CT 1ZVSA 2LU4A 1DBAL 5D7JC 4A63A 3QXUA 4K15A 2AANA 2AABH 4AI7A 3L3DB 1Z9OA 4NQCE 1YQVL 4FHJA 1J05B 1TO5A 3MXVL 4X98B 1TKWB 4IU3A 4QRTA 5BS0E 5FDWA 5AKTA 2FBOJ 1OPGH 3TCLA 4EKJA 4F2MA 1O6SB 4TSCL 4JY4B 4KROC 1ZVNA 4CAGA 2BVUA 4OIIH 3HUJA 4PRDB 4LCYA 5IF0A 4R0LB 3MLSL 4H2AA 4CU6A 1AQKL 4K3EH 5BO1H 1U2HA 4AYEC 4JRXE 1HHKA 4WTQA 4LPXA 2NCMA 1YCSA 2ZOTA 3QDGE 2IWKA 4NI3A 4PUBL 3DO4A 4QRUB 4XP6L 4X2UA 4QT5B 2IPUK 1KWGA 4PJ9D 5FR3A 4LHQB 4V11A 1AGEB 5CZRA 1E65A 3X14A 3OKOB 4PJHA 1CC3A 2H3XC 4WK4B 3IJ7A 4WWID 4E68A 3O41A 4HJSA 4W9FC 3KJ4C 2VZSA 4OD3L 3UC2A 4KQ3L 3LQZA 1P6WA 2WLIA 5DTFB 4Z7WF 5T1LA 4HOXA 1DJWA 3NN8B 4U1KB 4OAWA 1MCCA 3QW9A 4P46A 1O9VA 1VDGA 1NFDB 4JPKL 2FTAA 5D2NE 5C0EB 4ZOAA 4GXUM 2WKLA 4OUUB 1QUNB 3SBPA 1MCQA 3LQAL 2L7JA 2F5BL 5D7LE 4FLOA 3HFFA 2ICWJ 2FVNA 1N4XL 4JN1H 3V6ZB 5JMRA 4HWZB 4FLHA 4PRPE 1AS6A 4AYDC 1QATA 2XFXB 5B1CA 2ZUQB 4HIHA 4LEEA 4MWFB 1WGVA 1C5CH 1EFXD 3WTUA 3SDCB 2KPWA 4X0KA 5HD8D 4YSSA 3ULUE 1MLBA 5DRZA 3VW3L 2OSLA 3BH9B 1USZA 5JA9A 1BYOA 5K1JA 4JFQA 3VSVA 4OCLC 1ONQB 5JUEL 4PREA 4U0RB 5F70A 3UTPE 1RURL 3RFZA 3A24A 3MJWA 5DK3A 1CMOA 2FEJA 5LG6A 4L3CA 2V2TA 3U2SB 4G80A 1WBZA 5DD0L 1N19A 3SO3B 3CHQA 2UXTA 4U6YB 5FO7A 1KN2H 3QJVB 1PLGL 4KNQA 3B37A 3H9YA 1KENL 5HHXH 2XZAH 2IH3B 2BXYA 3ROLA 3OJVC 2I9LB 4G8AC 5BVJA 3N43F 3PFUA 4NO0A 4UAHA 3VGHA 3LD8C 1T20B 2QDVA 3D0AA 3BPCA 1M4KA 3L17A 1WIUA 4OM1H 4XMLL 3I6LE 3WLWC 1GC1L 1MFDH 1U3JA 3P3SA 3RY6C 5I76B 3ZTNH 1ZGLA 3LNFA 3MXWH 2FHCA 2YD6A 2X88A 2JELL 5LAPA 3AY4A 1XV8A 5MHSD 4X4YB 3HZVA 1J9TA 5CP3H 4ABQA 1XT5A 3MA9L 4AT6A 1VIWA 3KNBA 1FGNH 4N3TA 1F13A 4C4UA 3IRZA 1XWVA 3IXAA 2X28A 2GK0B 2UXGA 2EABA 5HHNB 4M8QA 1JPSH 3BGMA 4AMKH 2WQ8A 3PWPD 3KWTA 2LE9A 4EUPA 3FT0A 2AJ3B 3TEXA 1AFVL 4PVBA 2CO2A 2NY1B 3ARFC 1VFAB 2YQ2A 3BPNC 2ORBL 2D7NA 2VB5A 3A22A 4HIXL 4NRXB 4WWNA 3OHXA 4DZBA 3BMWA 4FLSA 3GI9H 4EZMA 4FQJL 5KSAD 2HG0A 2WZ6A 5C07E 1T83A 2JB6B 2VDMB 4F9LA 5ACLA 2R69L 1B4JL 3GZOA 4L4TE 4DWHA 2JFCA 3HKZA 1BX2B 4HS3B 1KGCD 2HUHA 4YPJA 5HHMD 3S7GA 4P2RB 1AQHA 3AU1B 2AW2A 1GSKA 1U8NA 1PD0A 2DYRB 1JN6A 4PB0L 5KUKA 5IVXB 2CJSA 2BS71 4JFDA 1E9QB 1JDAA 1A6AB 5C8JB 1UKQA 1SY6A 3RWJA 4RGOH 1XZ0B 3FT1A 3LPWA 3P0GB 4H0GA 3K72B 4WU7B 1OCWL 3V0VB 3NTCL 4M6ML 4ABUA 3QP3A 1A7NH 3UIYA 1K5NB 1K4DA 1E2VA 4DK5A 3QDJB 3MKGA 2E7LC 1CGYA 2YFNA 3L6FA 2VZTA 3ALXA 5F9WB 3ZU8A 3THMH 1EAPA 4WUUD 5JXEC 4ERSH 3GHBL 2NY0D 2RBLA 5T3ZD 1N9PA 2KLRA 2XKNB 3G6JA 2K78A 3LKRA 4LDEB 1UUNA 3E9UA 5C0JA 1HJCA 2EUWA 4FNUA 1NICA 2EDTA 4H8PA 3UZVA 1AHWA 4BQCA 3T0WA 5GGSY 5K39B 5D72H 4EOWH 1REIA 3UYRH 2WBKA 4HISA 4PLOB 3K6NA 5EIVA 5L8KB 2BCMA 4X6FA 2QQNH 5AW8B 5CEXB 4QRQA 3U0PB 4ZMWA 5FECB 1GYCA 1IC4L 4F7CA 1A3QA 3CZEA 4Y5VA 3L4XA 1NGPH 2F8IA 4H5SA 1KTKE 4AUUA 1Q0EA 1JGLL 3BT2H 4UM8B 1BQ5A 1GGCL 1S7TB 4KDTC 4MQSB 1OSZB 5DRNB 3SE9H 2H2SD 2D8KA 3HR5A 1IGML 1BJ8A 2X4PB 3HC3H 5FA4A 4A66A 4ZMOA 1FO0B 2NR6C 4OCWL 3GSOA 5C09A 1CFBA 5CJXC 5KSBB 4ATTA 5C9KA 5TPWL 5J7CC 3C9NA 2IDTA 3QWRA 4BZ2A 3DK0A 2PCFB 2QVFB 1EZUA 3QEQB 1IFGA 5JXAL 1G43A 5GGTA 4YHIA 1NDGB 2WQXA 4PJXF 1E90A 1SLUA 1KTRL 3UG5A 4XR8C 1N59B 2IFFH 4I1NB 4PJIE 4ODHH 5C71A 4HF5L 1V3MA 3G6AA 2H2PC 3I02B 4OF6A 4HK3J 2UWEA 1LVEA 5EZLA 5E94B 2ALAA 4Y4KA 1G9HA 4F2EA 2ZOOA 4ODXA 1IIKA 3TZVC 5FGBC 3ARPA 4QRPD 5CS7A 2X42A 1MY5A 5DMYA 2I9TB 2AP2A 1NEZA 3T3PB 1TZIB 1UOWA 1ITBB 1M05A 5IREA 5E6ZA 3FQWA 2UZIL 3GDBA 3MV8B 4XNUH 3C8DA 4BBWA 4CVZB 3OKMA 1ADQH 1FZMA 3NFSH 5DHYA 2ZAIA 5IVZA 4ACPA 4FHBD 1VGEH 1MQ8A 1G1KA 3FQNB 5KG9B 3GSRA 3A67H 3RGVA 4NOFA 4KK9D 2QLYA 5J89A 2JKNA 2XSKA 3O11B 3VAEA 2HX7A 2OQJB 2W0FB 4M43H 4KX8A 2EZ0D 3NSJA 4NWUH 1ACZA 3CX5J 3QA3B 1FBIH 2OSXA 2GEQA 4F8LA 4HW6A 4CVWA 5JLZB 3O45B 5BZDB 4ALAH 2W07B 2Y7QB 1K2DB 4G6KL 4GBXA 3RDTB 1Z6JT 3DDFA 5F72S 5D6DC 2IAND 3GMNB 3TYFA 3D0LA 3TN0D 2NNAB 2PYEE 4KK5C 4XOEA 4L1DA 2QR0A 3KYNA 3FSZA 5BJTA 4GMSH 4N0UA 1IAIM 4D9RD 5EEZA 1G7HB 3FU8A 1TSRA 1S6NA 4XO5A 4PJ8B 1VADB 3QNXA 2H0JA 1J1PL 3V7AG 3DX0A 1X9RA 4WFHD 2A0LD 1U4FA 4XE5B 1T6VN 4JDZB 1WVZA 2GJPA 2DMBA 4XWOC 2V37A 3C75A 3TFKD 2CWRA 3HMXL 1HL5A 3UGUA 3EJTA 3VFMB 5SWSA 1S7XA 3FOMB 3KXFA 3MJ7A 2J8UE 4P5RA 4XPHL 4ZYKB 4K23L 5LBSH 2NY4D 3RHWF 2W8CA 1CE1L 4BXVA 2R8SH 1THAA 3VXNB 5FYLH 2O61A 2YUZA 1KB5A 4OLUH 4HLZH 4ONHA 3DROB 4RWHA 5E9NA 4I3SL 3GRWA 3OLDA 1IBGH 4QHKI 4NSKA 1SYSA 1T22B 3N0AA 4AIEA 1KF9B 1HNYA 4FQLH 1HS6A 3MUHL 2B16A 2P8MB 1OCZB 4JG1H 3QI9B 5LCVA 4PTTB 4R3SA 1HWWA 1ET7A 3DX2A 2QMJA 4AIZA 1SMAA 1JWUA 4YWGL 2A9CA 4NOBA 4HHAB 3S2AA 4APXB 1E4JA 1UH2A 3MLVL 3JWNE 3KL5A 1UWGH 3FB7B 4ZNEA 5I1IH 2MSPA 2ZKXA 3R4DA 1G5GA 5IHLB 2ZWSA 3S3SA 4N2AA 4OZHB 5AFAA 4I2XA 1YNKL 3P40A 1ET5A 4OFVA 3OGCB 4NKIL 5D7SL 2VRKA 2QPDB 3QXDB 1AC0A 3ARDC 3PHQB 2EECA 3TURA 4DEUA 4WSGA 2QVTA 4UNIA 3CFEA 3PRZA 3NJVA 5B21A 1GOGA 2BDNL 3C5JB 1J0IA 4NQCD 2DKUA 4QF1A 2AQ1A 4HX1B 2HAZA 3WNPA 2H0PA 1MHHA 4UNUA 5BS0D 1QRNA 1JPGB 4HUWA 2UZXB 4G8FB 2P5EA 1EEUA 4L3EA 2A38A 3D85B 3ZKNC 4GIPD 2NY7L 4HYTB 4LOFA 4QRAA 2VDOB 3MA7A 1G9ML 1LO2H 2BZCA 1D5XA 3WFBL 2ESVA 4Q58C 1ZPLA 3WMPA 4DJMA 4ODUA 4EDWH 3LMJH 4KKPA 3RTQA 4JRXD 3QORD 1S9VB 3L81A 2IDFA 4WV1A 4RMQA 3C6EA 4EZJA 4PJHF 2D7TH 2C9VA 2VZ3A 4PGJA 3BQUD 3QDGD 2IDQA 3WFCH 3NCJH 3FQ2A 4P57A 2ZUTA 4F5CA 3ZMNA 1W8EA 2V9UA 4L9LB 3RIAF 4JKPH 2ZPKH 3FRPB 4PJAB 2CLVB 4ZFOL 5I66A 4GG6E 2X2HA 1HT6A 2Z1KA 3ARBA 2BIQA 2HKFL 2J56A 2ZCHL 3GS4A 5E8NA 5DJXB 2DDQL 4WW2C 2J1ZA 4NZTL 5TE6L 1FGVL 3LRGA 4U7MA 1KJMA 1CTOA 4XTRC 5CILL 3UZEA 3SQOL 5IB4B 4MJIA 1NLBH 2MKLC 2ZAGA 3IDMB 5H37G 4LSSH 1H3WM 2CDFB 2ZKHL 2ATAA 1NIDA 3LVEA 3GMMA 2LFGA 1WA1X 3MFFA 5DJYA 3LSOA 1RL1A 4EXKA 1R5WB 4IBYA 4TQEH 4AJVA 5IT2H 5D7LD 3IEAA 2OR9H 3O6LL 5DXWA 3MPCA 3NIFB 4PRPD 1B0RB 1LNUB 3DI3B 2BW4A 1MFBL 4W9JC 3AS2A 3OZ9L 4NJ9H 4TSAL 4YC2B 4MB1A 3MOQA 5CBEA 4F7TB 2ZYRA 1IFHH 1ZPUA 3ULUD 3M1BB 4C57C 5IR1B 1NGQL 2BZDA 3QAZB 2EIZA 2VW4A 4ORGB 1NANI 4L29B 1NDTA 3M45A 2BOCB 2WXOA 3IDYC 2OPCA 4PGEA 1N12A 2Y7MA 3UTPD 5CBAA 3VDBA 4PG9A 1JUFA 4LEOB 3TJEH 3OVUB 3T2LA 4I18B 4UDUA 5CGTA 5EN2B 1LL1A 2IGFH 2NYKA 5FW8A 3KL3A 5C0AB 3RBSA 5AB9A 5CD3B 1EMTL 1ET8A 5L9DL 1BZ9B 3UTTB 2P5WE 1X4YA 5C0DA 4BH7B 2OMZA 1YEIH 2JJWA 2X9YA 1T3FB 4AQ1A 3NPSB 1F18A 43C9B 3CVCA 3BRDA 1TJXA 3V52H 3HLAA 1V3KA 4Y9EA 4QHPA 5KYWA 2EYTA 5AW3B 4OV5A 1U92B 5CZKA 1WD8A 3ROOB 3EJRA 3REWA 1OM3H 3D0VB 2BNQB 3HMWH 4PSPA 5HPMB 5GSRB 3I6LD 1R3JB 2QMKA 2AQTA 2GI0A 1Q9OA 2X9XA 4HV8A 1NAKL 2DWYA 4GB9A 5EBWB 3V0FA 3UL4A 2VR9A 1Y18A 3LKNB 2AITA 1CU4H 2WGXA 2EXSA 4DUWA 4PJ9A 3GSNA 2X4NA 3AS3A 3GBLA 4HJJL 4HUXA 5F0JB 4OCNC 1LILA 4W70A 1A6WH 4MA8H 4Y4FB 4YX2H 1I53A 3AQYA 1RHFA 1BVLA 2EEBA 1KDJA 2R29L 4IS6A 4P5TB 5DC9B 4N9GA 3R8BB 4IRJB 1O75A 2QSCH 5AVVB 4R26L 1AVAA 4K0OA 2H6PA 5C07D 1UADC 3OG6B 3QVAA 4JKWA 2VDML 3DHJA 4BFNA 4L4TD 1FG2B 2NUPA 3OKEA 4AEFA 4IMKC 5DUPH 1JMZA 1E4HA 5EA0L 1LK2B 4DQOH 2NZIA 4QXUL 5GGVH 5BMFH 1EFXA 4HOZA 4PP1C 1VFOA 4BFRA 1MJ7H 4HZ1A 1MY7A 3BSZL 4F2MB 1CD1B 3NFNA 4GAGL 4HFUH 5D5MA 4L3AA 2DQHL 1AD0B 4N2CA 4P2OC 2UYLA 3HUJB 3EZ8A 4MZRA 4H8VA 2OYLA 2P4AB 1A1NB 1UM4H 1HHKB 3E8UH 5BXFA 1CFVH 4PJCB 4E5XA 3QARA 2WTRB 1W0WB 4Z18A 3G6JF 4E0RB 3EG9A 4HULB 3V4VB 1LE9A 4UNVA 2ICEB 3BDXA 3KCPB 3BN9D 4YSRA 4UU9B 4AQAA 5DZNA 4NNPH 2ZUSA 5SWZA 1QACA 2D31B 3O41B 3EJZD 3ZE2F 4NUQA 3GIZH 2MTAA 1KGJA 1IAII 1YJDC 5ITBL 4YMPA 3PJLA 1UVQA 4ZX3A 3DX8B 4QYOB 2WB7A 5BNXD 2Q7YB 4U0QB 4FULA 1TZ8A 1ODAA 4RIRB 4HIJB 4I48B 4KH2A 2NNCA 3Q6FA 3QFGA 2GAZB 3LKSA 5IUSA 5IFHL 1AE6L 2VKWA 1JCVA 1HH9B 1MW2A 1X6LA 4I7ZC 3P0YL 4XC1L 2V33A 4WKZA 1DEDA 4P3CL 4XCCH 4DP0X 4JZJA 2R83A 3FU6A 2ISDA 3PXHA 4NT6A 4N8VG 1SOQA 4PW3A 1OE1A 1U8QB 3MCLL 4Y8AA 2NSXA 5L2KE 2R2BA 4M1CC 4ZOEA 1TVHA 3SDXE 3F62A 1FO0L 1P4IL 4Z0BL 4NO5A 2FQFA 4LLYB 3BWUF 3CX5K 3TWYA 1MVYA 1A6TA 2Q20A 3PWPA 4GSQA 4JFVA 5DRZB 4G83A 2V8MA 3STBA 1E2WA 4B5ZA 3QUXB 3FCTA 4JFEB 3ZT7A 4K94L 5HDLA 4KJQD 5ERWA 4QRSB 2O6PA 4DGYH 2CDEA 4PREB 5CD5D 5KSAA 5E6RB 1AGDB 1ZSDB 1JZ4A 3ATAA 2UWEF 4ZOCA 4QJ4B 5IVNA 3QJXA 4OJEH 4G80B 4RFNC 4FXGC 2R0KL 1HEZB 4WTZA 1T5XA 3CVDA 4JQVC 4Y4HD 3ZTJG 5TH2A 1JD9A 2W9EL 3US9A 1RH8A 2E6QA 1FN4A 3IJSB 4AEIH 2DWEB 5FO8A 1J1OH 3VFSA 1ILSA 3PWLA 3TVMD 1PX4A 1FV1B 2OZ4L 1PKQE 4KMTH 1OQOA 4MMYA 5LGKA 2VISB 5FKAA 4FX5A 4Y2DD 2OMTB 3V7MA 4FFYA 1RZJC 2X0WA 4W4NA 5CIPA 4DTGH 4WNQB 5FM4A 1F3JB 1G9EA 4F37F 5BVJB 3SODB 1F6LL 1JZEA 3IN0A 5FK9A 4RFOH 1HCVA 4IU2A 2ATPA 1X5FA 1JV2A 3QB7C 1NCUA 4AVHA 4L8BA 3E38A 3GJEA 1K8DA 5F7YC 4BCZA 3BH8A 2DH2A 3CBKB 4HC1L 1NIBA 2Q6WA 4BUGA 2BP8B 2FNWA 3OMZA 1L6PA 1J5CA 4WUUA 5K93A 3US0A 1TTRA 5GS2D 4KBPA 1S7SA 2WN3A 3OC8A 1LO0L 3N41B 2BNUA 4CN6A 4M8QB 1RULL 2G0KA 1ODUA 1DQDL 4MMXA 5DHVH 4B0MB 3HPJB 2ARJB 3HNVH 5JR1H 2PYED 3SGEI 3DSFL 3KVPA 3WIFB 5K33A 5TTRA 4ZSOE 3HIZA 3N50A 2YIHA 2X4TB 3MJ9A 4HCGA 1Z5LB 4NX0A 1OM9A 5LNEA 4ZXBD 5C08E 2J43A 4MQ7B 1EPFA 2VSCA 5FLVA 3TO4C 4XH2A 3CLEH 3MLXL 4LRNL 4QRRE 4W93A 2J72A 3CLFL 4K8RH 4ZUUA 1KIRA 4MAYC 5F96L 4J3SA 3QYCA 5KUMA 4EI5D 4UT6L 4N8CH 4KVNL 4QJ3B 1UT2A 4OFYD 4LEXL 1U8NB 3Q5TA 4JQIA 1KLFB 1DEEA 4TS6A 4JFDB 2ROYA 1GVIA 4A7SA 1SEQH 1I7TB 3O3BB 5IB3B 5DGRA 4OZFB 4OCSH 4X6CE 1DN2A 1PBYA 1QOKA 2J8HA 5DJCA 2ICES 4ETQB 4XP4H 4BK5A 2NSQA 4OIBA 3U30C 2P5WB 4JRWA 5JHLA 5I1LB 4POZC 1D7BA 1P9MA 3PGFL 3WD5L 4DCQB 1S9KC 1AACA 2TSBA 1P7KB 5IQOA 5A2FA 1G9NC 1I3RB 2E7HA 5A43C 3LKRB 4GAFB 4B7LA 2K8MA 1A2YB 1KXVC 1IKFL 1I31A 1OAKH 1OY3B 4QRPA 2PWHA 3UC0L 1KJVA 2TRYA 3DOSB 5GGRY 1QSVA 1DSYA 3IU3A 1A9EA 3ZYJA 2AC0A 1P5UC 3N40F 1P6AB 3KJ6L 4HWBA 1JHTB 1THCA 2DY2A 4OKDA 3EUDA 4PRBB 3G5YB 1JI2A 1DVFB 4QRQB 3JV0A 3G5XA 3RVXC 3DJSA 3I6GA 1DUZA 3LPOA 3SDAB 4DHLA 3UJTH 3DETC 3NJKA 4KK8D 1CR9H 3EDEA 4YE4L 2CZNA 3BUQA 2ZUWA 3M86A 4UUJB 3VXRA 3D51A 3OWRA 1CLOH 2ERJC 3CN0A 2P46B 4NM4H 4S1QL 3HOGA 3T4AC 4D9LH 1I1AD 4LSQH 2VDOL 3BP7A 4G43B 4H26A 2WYTA 5FYJU 2WUBH 3O2DH 2ICCA 4QIRA 4Q89A 5BV7H 4RZKA 2E5EA 3FTSA 2IANA 2VE6A 4DGVH 4LSTH 4YR6A 3TN0A 3TP4A 3MYZA 5IBUB 4L4VE 3IDUA 3LHAA 3HI5H 2E9WA 5H2BB 1C5DB 3L5JA 3NSXA 2EIBA 1ED3A 1NMCC 1MLCA 3Q0HA 1OB1A 4HT1H 5INDB 3VE0B 5FOBA 4PWFA 2PO6C 4MNGA 1NANH 4HJTA 3FQYA 2K3HA 2BMKB 2LU7A 3S97C 3RWCA 4LIQE 5FF6B 1CS6A 2ZP9A 3ZIYA 5D1ZB 4LL4A 5CCGE 4ADIA 3FN3A 1EDYA 5F1IB 2A6JB 3VI4A 4JJHA 1R4XA 4U33A 4JPIB 2XXCB 2DWDA 4KKRA 4J2XA 4D3CL 1MEXH 3BUTA 1JZIA 5HHVH 3PDDA 4G7SB 3RWDB 4ZMXA 5HVFB 3UPAA 4R7LA 3PGCB 2IDSA 4GS7C 2IQAB 2BFGA 1OTUD 3V4UL 4A67A 4UQAA 1E6OH 4DN4H 2QVKA 1SXCA 5KVEL 4AWJC 3BO8A 1F4YL 2IOIA 3EIFA 2H1XA 2E76C 3ISYA 2L0DA 3BWAA 5DR5L 1FE8L 1N2RA 4V2CB 1LO5A 3NSCA 3NCEB 5DO2C 3WN5A 1F11A 2WNGA 5DZ9A 4RFEB 1URIA 2XN9B 4M5ZH 4NKQB 4QCIB 2EDBA 1UXLA 5C0FB 5A16A 3HHSA 2WK2A 4KV5F 2IQ9L 1EA9C 1A1MA 1L9NA 5E6IB 1Z32X 1L9OA 4GXFA 5GQBA 2P5WD 2IEPA 3SCMA 4AYMC 2DYPD 5AWNL 4KTDH 3GSQB 4NQCA 3I84A 5L2KB 2GIMA 4RMRA 3VQMA 1FFOA 1LLAA 3FRUA 4LP5A 3G08A 8FABB 1FFPB 5BS0A 3EDKA 1COBA 3B43A 1BEXA 1J9SA 3IFPA 5EZIH 5JMOC 2IMMA 4U1LA 4GKZA 1JFQL 4ODVH 5F7DA 4ILDA 4N85A 2Z7YA 4LDOB 3WNLA 5GS1B 4WAFA 1LJMA 2HFEB 3QORA 2N7AA 1DBAH 2FUTA 3L3HA 3L95B 1B0GA 3BQUA 1AP2A 3QDGA 5AOMA 4GEIA 2CXKA 5IMOA 1U8JA 4W9GC 3HW7A 4O9HL 5J13B 2QKSA 1T04B 2EIKB 4A55A 4XMPL 3SDAD 2E6PA 1YQVH 1K85A 4CVUA 3AITA 5G4OA 2VQ1A 2XNAB 3OAZK 4LCCC 3ZR6A 1JHLL 1R75A 1CJYA 1TTCA 1RSYA 3TLRA 1CICB 1QVOA 2AEIT 4U1IA 4AQEA 2ENSA 5F1SA 1YLBB 2R39A 3MSPA 4I2XB 5D2NA 5AYQA 4M6OL 3UOAB 4XP6H 1H3PH 5I1HH 4A2GA 3GNMH 4CA4A 3T0XA 1NTDA 1NUDA 5D7LA 1KJ2A 5JDSB 4NKMA 1QASA 1IAIH 5D5MF 4H0LC 1MVUA 4HMCA 4PRPA 2ZOWA 1GYWA 2C3HA 2G5BA 3PY9A 1XH1A 4H88H 3ZKQD 2N56A 2YK1L 2K6WA 4NO2B 1TEFA 2VERN 3ORJA 4JHBA 4CGTA 2WZ0A 2H9GA 2VZUA 4IJTA 5CMAA 1KXTB 4AL8L 2EIEA 4WFEE 3GIVB 5F6IC 3QIWB 4KJYB 4LVOB 3MLUL 1TFHA 3IETA 1S3KH 4KMLB 3L13A 3QIUC 2BSRB 1BIIB 1EANA 4JPKH 4F33A 4IBTA 4MTMA 1ZLDA 4GMTH 3O2VH 1JGEB 2HFGH 4A6YB 1E4XL 3PWJB 2OJZL 1ZY9A 4UDTA 1T1XA 2WO4A 5KN5A 5HVGB 1PPIA 3EH1A 4M62H 3RL2A 3OL2A 4RETB 5GZND 1U95B 4P57B 2W92A 3V4VL 3EHBC 5DJ2B 4JLRB 1YO4A 2CM6A 1VCAA 3RJQB 1CG9A 4G7QB 5EMYA 3NJMA 3H9ZA 1N68A 3QUKB 3LX9A 5E1AB 3NGBB 2WQUA 5GRXG 4BHUI 2EE3A 3HC2A 1F3RB 1OAXL 3OR7A 1AYRA 1VRSA 3FT2A 4FQPA 2CM5A 2KZBA 3OJ2C 5T33L 4X7DC 4BCXA 1HU8A 3MRCB 2WWKT 2NQ3A 2YPLB 4ZW5A 3DNKA 3BHBB 3K0WA 3FQTA 1CVSC 1G1OA 4IKLA 1G94A 3GSVA 4ETYA 5I1JH 1EXUB 1A66A 3F7PC 4JY6A 3HE6A 2QPSA 4X6CB 4G5AA 2K6YA 1KB9J 3F04A 1TVBA 3UYPA 5CN1A 4FFVD 5TFSL 4FNLL 1GMIA 1AZCA 2NMSA 2Z64C 3IMTA 1SEBB 5JHBA 1D9KB 2DB8A 3JWDL 3QDAA 2COQA 4OGZA 1FRGH 4JK0D 1HI6B 4BQ8A 2WBJD 1P5VB 4FDWA 5CU5A 3LRSA 4V2BA 1IKOP 4XVJL 1KENH 2H32H 1SUHA 2FSEA 2DV6A 4NAMA 3QFJB 1CD8A 3VRIA 2GSIA 5D70L 2ZONA 5DF0A 3QH3B 2KZ1B 4J28A 4YUEL 2WGNB 1JP5A 5AOZA 1RZ8B 3WIHA 1BD2E 4WO4C 1KLGA 5EF3A 4XMLH 4LCWB 5ILTH 1S7WA 4HZLB 1FORH 2OMXB 3DTDA 3ECBA 1F97A 1T5WB 4KX7A 4NBZB 4PG9B 5CJQH 5JW3L 2JELH 1SM3L 4ZPTA 5C07A 4CGUB 25C8H 2H5UA 4HAKA 4YHYB 4G59C 3WTVA 3NT0A 1UT1A 4UDUB 3EJPA 1K4CB 4HXAL 1SJMA 3BGFC 1WH0A 3IDGB 2LU5A 3SGEH 3DURA 2AXJA 4AQ8C 3E6FB 4TL4A 3DKHA 1UASA 5CLXA 4Y0GA 5HHPA 1HE8A 1AFVH 4G7VH 2R23B 3KPOA 4I9XA 3S4SA 3VWJC 5KYWB 1Z9SA 5HDBF 4KH9A 5C7XH 4QRBA 4N6RA 4TTGA 3REWB 1MZYA 1OP9A 1UJ3A 2NY2C 2N0KA 1IQDA 3IMBA 3ZE1F 3BUPA 4X6DA 1Q9OB 5B4MD 2PXYB 4PI2A 3K8KA 1Y6KR 3MOAL 1FZKA 2IBBA 4KO5A 4O2FA 3QE5A 3FXIC 5DFWH 4IMLB 2WC7A 1WISA 4MA7H 4AENB 3M17A 1A14L 4J3OC 3OKLA 4HUXB 3J07A 2I7SA 4X5XA 4I5BA 1I3GL 3KPTA 1FH2A 3RPIA 3SQRA 2P7TA 2PP9A 3S36L 2X3BA 1DLHA 2LVEA 1GH7A 3SPCA 3V5HB 2GW5A 4NGHH 2MCPL 5EDXA 2FD6L 1PLAA 3U6RB 4KZ0A 9PCYA 4N28A 4WI8A 1F4WH 2XV3A 4OBSA 3OGOE 4H20L 2WCGA 1T1YA 3DRTB 5L0QB 4G70B 4KRNA 1HSAB 3QQDA 4Q9BA 2OJ1A 1ZLWK 4OU3A 4QAWA 4XXWC 2HWZL 5C08D 1DDHB 4DZ8B 1BFTA 1QBAA 4FKHA 4LHUA 4YDIL 3IM1A 4QRRD 4OZIB 3NSFA 3DV4B 1WIPA 4G6AC 2CU9A 4GRWB 5IB2A 1I8MA 1Q0YL 1NBYB 3P4OA 3VRJB 4AGQA 5I6MA 3MHZA 3VXUE 4ZFZA 4PG2A 2C3XA 5DD5L 4JGJA 3DDGA 2WD0A 3FQXB 4DEPB 2OW7A 4DKFH 1OT4A 1PD6A 3K74B 1V7NL 5AKVA 4AYBA 1SY6L 4ONGL 5DD1H 5DEGA 4ES9A 4Y19E 5CEZE 3CIQA 1H8SA 4MZ3A 3FNKA 1Z9PA 2J6EH 3ZYZA 4BKLB 4DPAX 1E3XA 1ERNA 4XZUA 2XG5B 4K8RC 4MS8D 3CV5A 4FQIH 1QI4A 4GRLC 4PJEB 4E5XB 2YD3A 1BZQK 5CSZA 4KZCA 5E23A 3LEYH 1H0DB 3O4LE 2IAMB 3P3UA 4PJIA 1HILA 2XVGA 2E86A 2Y6SC 4Y4HA 1AY1L 5T5FH 1M1XA 4AQAB 3OHMB 2Q9OA 3ZDWA 2CCWA 5SWZB 3MRJB 4QXVA 3RJDA 4R7XA 4K55A 2YSSA 2X12A 1YPZE 3HPLB 4MX7A 3LRKA 3TVMA 3MRFA 3UAEA 1YDPA 2CNYA 5TPWH 1BF8A 1BJ1H 2FGWH 3ZDZE 1DQLL 3HRZC 1ZK5A 1P4UA 4QXTA 3TNNB 1ZHBA 3VXQA 4YJZL 3UERA 5IQNA 2R4RL 4N2BA 3RFRA 5IUCA 3LXAA 3W0WE 3Q6FB 4N2MA 5CGYC 5ACZA 2RB8A 3H9HB 1A64A 3TO2A 2FIKA 1P1VA 3VXOB 2P49B 1RZGA 2K9FB 4JZJB 1M6OB 5HI3C 4JHZA 4M48L 4N0CC 1P7QA 3DC0A 3H9SE 4PB9L 1NGWA 4P9HH 1ETZA 4XPFL 1PX3A 3WDJA 4Z7AA 3TS8A 2ICWA 3SY6A 3ZKMD 3IMRA 4R7DA 4EDXA 1RHHB 2I26N 4NO5B 4UYPA 3VFPB 2Y3NA 2C4FU 3P73A 3UGEA 4OQTH 2A4CA 4BZ2L 2PYEA 1T66C 4MYWB 4JKKA 3KPNA 4L4VD 4RLDA 2YEZB 1O7SA 1MHCA 4MJ5B 2ZAHA 4ZXBA 4FXTA 3K1KC 3ARGC 2CIIA 1OTTC 3H8NA 1VZHA 1KG0A 4UTAH 3QQXA 4PJ7E 1T5XB 4ICXA 3U7WH 3WJMA 3K6SA 2JV6A 3VI4F 3EH4B 2X4QA 5H37H 4XNYH 1QR1A 4UWQB 2OX5A 4OFYA 2RCSL 1WF5A 4L5FL 3UYOD 5I8EA 3B7RL 3CFMA 1PF3A 2OA9A 1QRKA 2BCKB 1BPVA 1BOYA 3S37H 2XV2A 4JVWA 3UBXG 2NUTB 1KZQA 1PCXA 1RJZA 1JK9A 4MCYA 3ZHNA 2XG4A 2J5WA 5D1XE 3HZMA 4EUPG 2QSQA 2VM9A 5CN2A 3CE1A 2G3MA 4ZO6A 2R9HD 5E1HB 1TCRA 4L8BB 2UUDH 2ZXQA 3L1OH 3FN0L 3CU7A 3RWHA 2KT6A 1WUZA 1FPTH 4XPBL 4RRPG 3KL0A 5I6NA 3QJHA 2DZEA 2F74A 4DF9A 2WVTA 1B3IA 3IF1A 4OIAA 1U30A 4U4BA 3MBED 3WUWB 3VA6A 3EYVA 1CF1A 2WBXA 2HTLC 4ZG1A 4XHQA 3ZZSA 2BNUB 2VUOA 3SKJL 5EUOB 1U8OB 5BQ7B 4JAMB 2ZTBA 3QJQB 2YAHA 3BKCH 3T8MA 2X1QA 2WXLA 5T3XH 3L9EA 3MTXA 3O0LA 4NQQA 4PLKC 1ZT4A 1CBVL 1I8IB 4JCWA 4B50A 4GAYB 4JHVA 4PJ5E 4U7KA 3GM8A 3RVVD 5A7EA 4Y9GA 2P24B 5IROD 2EINB 4GW5B 5EBMA 4K3GA 1AR1D 1XZWA 3HBQA 5IOPA 3B2VH 4X80H 2YD0A 4ZOBA 4S1DC 2XV6B 3BEVA 4K3DH 2EACA 1I1AA 5KBLA 4JFWA 3ERXA 2D7QA 1G1CA 4JM2B 2R1YB 1DLFH 4N5UA 1YNKH 2B1AH 3UROR 5ID0B 1MW3A 4P4RA 3TXAA 4YL9A 2I32A 2VLJB 4YDZA 3VQ1C 5AYTA 2VYRE 4Y2LA 3QWQB 1BM3L 4LBAA 4MNQA 1YUHA 3GRWL 4Z7VE 5ETUB 1SN0A 4XMTA 5F7MC 2ATKA 4Y2OA 2CIKB 5MEQA 5TDNA 1AXSA 3OG4B 4GQQA 1LD9B 1BBJB 5LCVL 5HYFA 2X10A 4AEHL 1EEYA 2EDLA 2BLFA 4GG6A 1G4MA 3CFNA 3EBHA 4WI7A 4ODTL 1BM7A 1RZIB 4I77L 4M7KL 5GSVB 1YA5A 4ICWA 3KJ4B 4IRZA 2ZNXA 1FNEB 4FQCL 4CW1A 2EVJA 3MCKA 2NYYD 3PL6B 1JBJA 4AZ8B 2X4SB 1V54B 2VRAA 3TH4T 2VQUA 2Y7LA 4AV0A 3S36X 1OCOB 1KB9K 3QPQC 4YVUA 3WGUB 3WTTA 5LGHL 1A7OH 2NTSP 2YPVL 4TRPH 4DK6A 3ULUF 2DD8H 4UTCA 4G5ZH 3CFBB 3TBVA 4EQ3A 3QDMA 5A3IC 4X9GA 1OP3K 4LFHG 3GMRB 2XQYA 3KBPA 4QPEA 2Q3XA 5KYUA 2RFXB 2R0ZL 1FGVH 3T6QC 3WEXB 4UNTA 4WFED 4XCYB 3SQOH 4U3CA 4X8CA 2WQAA 1I8UA 5FCUL 1ZGLM 4MAZA 3FAXA 4PV8A 3UJIL 4ZFFB 4ES8A 3DX1A 5C6WH 5DS2A 3ZTEA 5TDOA 4A6YL 2JQMA 1LEGA 2CHWA 5CZXC 4PW4A 5MEPB 1NEZG 2HMIC 2WW8A 4LVEA 4P5MB 5C0BE 4BFIA 4CN1A 1S8DB 1OB1B 1X9QA 2COVD 2WO2B 5D4IA 2DYPA 4TSAH 5FOBB 3LKOB 5GRUH 2BWIA 1MJUH 1E8XA 4WHTB 5DI8A 1J1XH 2XWZA 2OLDA 3X1GA 1X5HA 4AM0A 4BA0A 4OI9A 3FO0L 3LQAC 3O6FB 3F85A 1QSZA 4RRPM 2WXFA 1FVEB 2Q10A 1T0MA 2WAHA 1P2CA 4AMXA 4U3XA 5EC2A 1BQLL 5AOIA 3FUMA 2NCEA 3KW8A 4OCXH 2BPBA 3OB0K 3LD8B 3H4FA 4KXDA 3ULSB 1TQUA 2Y1VA 5CEYB 4C55A 3ZQWA 3A6CL 2FO4B 4RQQA 4BDVA 5L9DH 3D39B 5IGXL 5I8CB 4X83A 1AIFB 3I6KA 2Y5EA 4Z5RB 3MRDB 5D7JD 2YGVA 1JFHA 3EBAA 2HLFD 3QXAB 5EO0A 3QC5X 3B2DC 3U36B 5ELIA 1R3IL 3IFNL 4LU5L 3LS5H 4D9QE 1BW8A 2FZ3B 1T89A 4PGDA 3AMLA 4PWKA 5EU6B 5BZXA 1JGDA 1INDL 1INEH 2Z35B 1ADQA 4YFLF 1BD2D 4OBRA 3KBFA 4IGBB 3WN5B 4KROD 3BJLA 4TUKL 1T4KA 1TJGL 2G5RA 3W0WB 1OTSC 1UD5A 2O5NA 3MAWA 1FJ1B 3ZTJH 2FWUA 2Z92B 1ZS8B 3BPNB 4JPWH 2Y1ZA 4DO5A 1BMGA 3HI1B 3MR9B 4OLEA 1UOLA 2PCXA 1GGIH 4AXWB 5CLTA 1WZMA 3Q1SH 4Z7OE 2ZCLH 4NRYB 4HKZA 4N90E 3SCMB 3L1EA 3PHOB 3QFDA 4I0KA 1LDPL 3CSYA 4YLQT 1FFNB 1PSKL 3V4LA 4XNMA 3W39A 3G08B 1WZ1L 4XWGH 1GC1C 2AQNA 1YG9A 4MDIB 5D93B 2BNRB 2G60L 4X6DF 3GBDA 2GEEA 2HB0A 4JO1H 2JLPA 1ZT7B 2Y9RT 2QADD 3DO3A 4YO0A 2VM3A 5LWYL 4O58H 3GLDA 1ZA3A 4G8IB 4AM0Q 1U58A 2HH0H 3PWVB 3L3HB 4TPRH 1NBZA 4KRPC 4NWTH 5DK2A 2NLJA 5GZNA 4MHHI 5KWYC 5EG6C 2YA2A 4B3EA 1X5IA 3GSNL 3UO1L 1OAJA 4W9CC 5EA0H 5I9QB 2IG2L 3RG1C 1IQWH 4KAQL 3S6CA 1F4XH 5LBSA 3UCRA 4Z23A 5JHDE 4NEHB 3BEWB 3LIZA 2WYHA 4RH4A 4XN1A 2DQDL 2WXMA 1X9LA 1DFBL 4TNWK 4X4KA 2DWSA 1JNJA 4B27A 1TQCB 1JZDC 4BFGA 3IXTA 3MV01 3AQZA 4U1IB 5E0FA 3ZGHA 3MJGX 4YSAA 4C54A 1Z0MA 1PTZA 3VFGL 3JTTA 5EC1B 4FG4A 5C70A 5HGHB 4PGZA 1PZ5B 2ZX9A 4PJBA 1AKJB 2YKLL 4OLYL 1VZGA 1KJ2B 4JDVA 2WBJA 4AW4A 1X5LA 2J4WH 4ZODA 3ABZA 5IG7B 5DUJA 2C1PA 3SDXA 2VWEE 4IEFA 2AKRA 4U2ZA 5CMAB 4AE0A 2X4RB 3VXUD 5CO1A 2BVQB 4GUCA 4QWWC 1DVTA 2JJVA 1HOCA 2SEBA 1WZKA 1I9EA 4RAHA 5ADOH 5EOCH 4GW4A 3MGTB 1GPOL 1EAJA 1OF2A 3BAYA 4MMZC 4G6FD 4Y19D 5CEZD 3GQFA 4PJIF 4DAGH 5D2LE 3Q2CA 4LNRB 4ODWB 4W81A 3LTVA 3BAXA 3ES6B 4FFZA 4O2EA 4L48A 3CVIL 3KR3L 1P4LB 3BVTA 2EDFA 1J9QA 3ABLB 4N8PA 1NC4B 3O4LD 3WLWD 3VWKC 3BZFB 3E1F1 4NQSB 3U46A 3QXTA 4M7JL 3T2QA 2NY3B 3ZO0A 3J2PA 4Z7QB 3NEOA 5JQIB 5DD3H 1P4IH 5EUKB 3TEUA 4WRLA 5E1IA 2B59A 1CTMA 2VDQH 1PKQA 2RQEA 2VO8A 3EYUL 3FQRA 3SPJA 5FV1L 2CJ3A 3UJJL 3VG0L 5HVWA 2VR8A 3MREA 1BXVA 2ADFL 2EKSB 2YRLA 1RJYB 3RKDC 3TZVB 4LCUA 4Q0XL 5KYXA 2HX9A 3GSVB 5ABDE 5E51A 3Q6GL 4JY6B 3D7PA 3HE6B 1J86A 5IEKB 3ARFD 1E4KA 1TVBB 3SE3C 4OM0L 1FL6A 1MPAH 1CDBA 5SV4A 1S7UB 4Q9QH 3B9AA 3UPRB 3AVEA 4R4BB 4TTDC 1CFNA 3H9SD 1T03L 3NJIA 3L4WA 3NJXA 3NSYA 4NN6C 3S34L 4CVXB 2QV2A 4TQHA 3FW6A 3Q3GB 2UXFA 1TQWA 1A7BA 2A6KB 2BOBA 3RWEB 3AUVA 1B2YA 1XCQA 1NIEA 2FECL 1EVTC 2F7IA 4JM4H 1KBGL 2UZYB 1HDMA 3O2WL 4YDVB 4P4KC 5G4NA 3OJDA 2MOQA 4ZSOA 4R8WH 4Z8FL 1S7WB 3BKML 1R0AH 3IJEB 3SY0A 3QQ4A 5C08A 2XCMC 4NUGL 2J8UF 1WBXA 2HLAA 3EH5B 3IDNA 2Q8BH 1WHPA 4QRRA 2G0LA 1G7LB 2QQKL 3E2HB 4X8GA 3WENA 3MUGA 3EUUA 2QKIB 2V17L 3FCGA 2D3VA 1UZ8A 3LZLA 1NCTA 4UAOC 2A5UA 2FJFB 4PBDA 5I2IB 1M56B 1A4BA 4XNZC 3L3OC 1TZHA 2ZSVA 1OGTA 4R2GC 2C34A 4AVJA 4NBYB 2DYSB 5IQ9B 4IK7A 3S4SB 2Z3FA 3WHXA 1LK3L 1TDQA 2WKGA 4N6RB 5D1XD 4RDQG 3RWIB 4I88A 2ZWKA 4OGXH 1MXGA 1RPKA 2Y4SA 5FYJL 5AVXB 2GUOA 5CLYA 1WS8A 3LNGA 1Z2KA 3JYCA 3MLXH 3UG4A 1YY8A 3DX9A 3IGAA 1XO8A 2AQ2A 3EOBB 2BFVL 4WCYL 1K5WA 4KTEL 4HKBA 3X3FH 4UT6H 5E7BA 4GQRA 4A2HA 3FQUA 4AOFA 4I5BB 3HAEA 4UT9A 1U8LA 4NQXA 4ZQKB 3T04D 1BWMA 3AQXA 1VJSA 4LO9A 3RKPA 1NWPA 1Y6NR 2NR6D 2OTUA 2FDBP 3FFCA 2MQ3A 1NJ9B 2DM7A 3FT3B 1OGAE 1I9IL 1NCDH 2I85A 3QRGH 4G7RB 4PY8I 4EVNB 5I0VA 3HE7C 2P45B 2XN1A 4PJ5D 4Y5XC 5KOMC 5INCB 3UCQA 3ULVL 1ZXQA 3CSGA 1LP9B 1YEHL 2MQCA 3ARDB 4LHUB 3CFJA 3PP3K 5IM7B 1ZVHA 2XQ0A 2WLNA 4YQXL 3VGAB 2G2NA 4FAAB 4KQ4H 2OMUA 3SDDC 1J9RA 1U8HA 5CSBA 4JQIL 3UC0H 3G6DL 4GY4A 2H2PD 2MKWA 1A25A 5C0ND 4F7TA 2Z4QB 4BSWA 1IT9L 1M2VA 1ZTXH 5JORB 1IO4C 4LP4A 4JY5H 4IM8A 2EEXA 2YS4A 1Y0LA 5AW6B 1I9JH 2EYRB 4LDCA 4HLEA 2QHRL 4L4VA 3HS0B 2NXYB 4GG6F 4I0PA 5CINH 1L9TA 4LSUH 4P3DB 3HB3B 2Q2LA 2IBGA 3WO4B 3FSVA 1GGBL 4P2QB 4R97B 1L7TL 1CDGA 5JHLL 2FCBA 5AZEH 5ICXA 2ZXEB 1U3HC 2X53A 2D3LA 3EGXB 4HD9A 1T1ZB 4XXCC 3FJTA 3SJVE 4AK2A 3LH9A 3BUYB 1LE5A 4OZGB 1PLBA 1YDPB 2VDRL 4G82A 4A7VA 2VMDA 4LHJB 5E8DL 2PW1A 4U1SA 3WFZA 4NKDA 4HWBL 1OANA 2AGJH 1QFUH 1VHPA 1FYTB 3C6LA 1B9KA 3QNYA 3L1FA 4Z3TA 1NC2B 4KK5D 3B7TA 4FQ1L 4PRHE 2ZXWB 3RDJA 1XCWA 4XBEH 3TO2B 2X6MA 1G9MC 4YFEA 5DUMH 5IQMA 4YGVA 1CPUA 2EE0A 1TZOA 5AW4B 2WINA 3KLDA 4W9EC 5KAQF 5ESAB 4WHDA 5IFAL 3SEPA 1JV5A 3CDGB 1U0QA 1XH2A 3MBEA 4UIKL 4WTZG 3B8SA 2CJUL 2O5YH 1UEMA 4XWOD 3I75B 1RXLA 5FXCH 1JNHB 4DT2A 3SKOB 3GBNH 2VITA 3HR6A 3BD4A 2VW7A 4KPHH 5C0BD 4YBLC 2KDYA 5EZOH 2BWDA 1UD6A 4JDTL 1MHCB 1A9VA 5HTSA 4HJIA 4PRIB 1E8WA 1O7DC 3ASOB 3V4UH 1E42A 4JKLA 3MROA 4OT1L 2QGCA 3QPKA 5E5RB 5GPRA 1SDDB 1VACB 1ZV5A 2WQWA 5KVEH 3QRLA 3BAWA 5L4MA 3LN5A 1SN5A 4L1TA 2X7LA 4M9PA 1YMHB 5DHEA 1A9BB 1KLUA 3MNZA 3PWUA 2JCWA 2VRQA 1AGFB 2VLRA 3IB4A 1U6AL 3L9RB 3GJFH 4MA1C 4E42A 1NCAH 5D1ZI 5ALCL 3B4NA 2ZUQC 1A7RL 4JS7A 2P52A 2P26A 4UTBL 3HZMB 3ZVVA 3SDCC 4HCRA 1HINH 4ISVB 4BFEA 2ZX5A 3C8KB 1QSEE 4H1LA 3P2DA 4LSDA 2XBDA 4IHOB 4OJFL 2PP8A 1ANUA 4HJGA 2EDNA 3KPPB 2ENJA 4QOKB 1IBDA 3QUMH 1G7IA 1AR2A 1KBPA 3AFLA 4JFXA 4U0RC 4QHLA 2IPKB 3CBRA 4D9QD 1VESA 1NEPA 4RZCA 1ORSB 3WEOA 5JPNB 4WTWA 4O02H 5DMKA 4OVVA 5E5LA 1I8KA 1PW3A 4XNXH 5EPMA 2J2ZA 1UQSA 2JKSA 1XEDA 3ZKND 4WI0A 3AG1B 4LLDA 4OFDA 1X5KA 2DLEA 4U1JA 3NPZB 1XDTT 2WXJA 1ZT4B 1E5UI 2EYSA 3NCYS 3UMTA 5IQ7H 4NUMA 3VFOA 1AZZC 2R15A 3H3PH 2XWJA 1O9ZA 4U6XB 4XBGA 4N90D 3IWUA 3FTGA 4PW9A 2CO3A 3AY2A 4J6RL 1A4KB 1IC7L 2N01B 4Y89A 4QHNA 4LCIH 1E7UA 1DVQA 1SFDA 1UM5L 2GJJA 2VXQL 1ID2A 1E27A 4TULL 5KSVB 2P8LB 2OMVA 3FFDA 1DQIA 5CFHA 4LOEA 2F7PA 4JUSA 4NIYE 3CXDH 4OTXH 4TNEA 4XTRD 2PTTA 4P2OB 1UCBL 1EHLL 4CNIB 3P0VL 2HVJA 4LAQH 4MNQB 4KKAC 1ZHLA 3QEGL 4FYQA 4I0CC 1AO7B 1TVDA 3MX0A 4GP4B 2X0UA 3F5WB 5EZPA 5TDNB 4WEBH 1KPVB 4H0IA 4NZRH 4F24A 2Y36L 2NY1C 2YK1H 4XB3A 3KYAA 2Z93A 3EAKA 1T7YA 4WY7H 2ODHA 4D0DB 3G5ZA 2XYCA 3NFPB 4HK0A 4M1GL 5JHDD 4Y1AE 5I6OA 1XL6A 3OXRB 4MKMA 1HESA 1I1YA 3RYMA 1M7XA 1Y1UA 2Z0BA 2B08A 4IKJA 1M53A 2W88A 4LKXB 3T6XA 3QUYC 1KCWA 3B34A 4PJBF 2HZHA 4FQQA 4DP4X 1HH6A 2NZ9D 3H6AA 4HFWA 5HDRA 2Y25A 1Q8MA 3QAQA 2APSA 2QPFA 4HIEB 3HN5A 3SDXF 1OE2A 3QIBA 3E6HB 1J5OL 1GIGL 1KJ2L 2JCCB 3C60D 1PDKB 1N5YL 4YIQA 5C7ZA 4OD2A 2BS8A 1DYZA 5I8OH 5CJ5A 5D7JA 3RA7L 2DAVA 2XWRA 2CGRL 2FB4H 4AW7A 3JV6B 1VFBB 3CFKA 2VLMD 4KVCH 3EFFA 4ZUWB 1GTNA 2IPUG 3VUAA 3HC0A 1GYVA 4LOUC 1T2QL 1BD2A 4K07A 1G0DA 1OGAB 2BY2A 5I17A 4PBWD 4N24A 3WXWH 5TDOB 2ED7A 3VO0A 4BYHA 2E7CA 3K91A 3MDJA 3B1UA 4GQ9L 1I3UA 3JWDH 1QEWA 4X4XB 3WSQL 4PIRF 3REVB 1N67A 3BVDB 4KFMA 3V8OA 4Z77A 1LHZA 4MQXC 3TIEB 5TQ2L 4RAVB 3MV9E 5IJBC 1NDMA 5T1KD 1KCLA 2A9NH 4RFNB 4FXGB 3JT0A 5F9OL 3VFVB 3WXVL 1YNTB 2CBPA 3DUUA 4IDLA 4YUEH 1OIOA 1QFPA 5DD6A 3PFQA 3GS7A 2BK8A 4UQ2A 2C3VA 3CGTA 3GMPB 1MAML 2AV1B 2VERA 3V95A 3VI3E 5HVHB 1KCSL 2XXFA 2Z91B 5E2UH 1BMWA 1CFTA 3T1FB 3ML8A 2O5XL 4S10A 4RAUB 4GKNA 5EHFA 3BP6A 3K4ZA 4K5MA 5B39A 2Y23A 1IEAA 1A6ZB 1URLA 1H9VA 3OM3B 4PCKA 4PM1A 5AVZB 2EUVA 1QSFE 2C1OA 3MGAA 3NA9L 5DJ8A 5BQDA 4HXAH 5CNHA 3RU8H 1XGUB 2IPTH 1F3DH 2WVVB 3CFDB 3TCTA 3V0EA 5GHWL 1FSKC 4S1RH 1EFQA 1YEGL 1PG7L 4J8RA 4MD0B 5DS1A 4WWKC 5EO0B 1F58H 3VXTA 4K94C 2I60L 2WNKA 4HH8A 4C47A 2DMCA 3K71A 2A1WH 2I27N 5IJVB 4HLJA 4PP1D 5I8KL 3NACL 5FGCB 4H44C 3DOIA 4P48A 2AJYL 3DK2A 4XI5C 5DJDA 4PJDE 5FB8A 2YXMA 1S9WB 4PRHB 4CSZA 5KSUB 1TUPA 4J7RA 5LGJB 2DQGH 3DVNB 3RP1A 1YN6B 2ZZUT 4YHPA 3CZSA 1UB6A 1A0QL 5DJAA 1A14H 3CSTA 2Q8AH 2EAEA 2FQDA 2VQ4A 1MIEH 3GSUB 1IC5H 2F7QA 3QZNA 3GD1C 2NX5E 1JTOA 4PV1C 3ZT5A 2EH8H 4NQEE 3TO4B 1DE4A 1Z9LA 1BDYA 3P11H 3TJHC 4AG4H 4X8JB 2ZIDA 3OXSB 3S88H 2OMBA 5AW9B 4EUPH 3UDWC 1D6EA 2YQBA 3VNZA 1JK8A 4RMTA 2J88L 2FO8A 3DXAE 2HN7A 4H20H 3IJHA 4LARL 4YO0B 2JWYA 4Y19A 1SHMA 3RWGB 3MLZH 4QO1A 2Y7SA 5IB1B 2DEXX 4QJ5B 2G9HA 4R4NC 3TF7C 3BP4B 5IFJA 5IWLC 2AXHA 4N5EC 2DQMA 4XCFH 5FO9B 2GKIA 3IDJA 3EFDL 1G4RA 1P53A 3O4LA 4R4FL 5AYUL 3RDTC 3VB9A 3W9EA 4M5YL 3EJYD 5E9DB 4FG6C 1MRFL 3BP5A 2GJZB 4ZBJA 3IKKA 1H15B 2GITA 4GAJL 4G6ML 1EEQA 2F53A 3VFNA 1YPZA 2G2PA 5FHBL 5FW7A 1D6VL 2OW6A 3PP4L 4M1CD 4PJ8C 3VM7A 3GUTB 3AWEA 4Z95H 4ZI8A 1KIUB 4P9ML 1ETB1 2BJML 4PN6A 1OGSA 1H5BA 4EN3C 4XC3L 4KKLC 3ARFA 1P5UB 1LO4L 3CMGA 5ITFB 5KS9E 3PU7A 3EBIA 2J3SA 4M4RA 4LVNB 3A4FA 1CTNA 3BYTA 4OB5H 3T8XB 4FA8A 5H94A 4TVPE 4U49A 4PEEA 1U3YA 3H9SA 1OSEA 1S7RA 4JO3H 3BKYL 1YRKA 4IEFB 1WCBB 1WYJA 4M8UA 5IIEA 1S5HA 1XGRA 2BZ7A 2ERJB 3DVGA 3LEXB 4JRYB 3RX7A 1GY1A 3CD4A 3QI9C 1NCWL 4XGZB 2JJUA 4GW4B 5A2CA 5I74B 1I4FA 4NRZA 3V79C 3VTTA 3S98A 3UZQA 5JIQA 5F1NA 2FJSA 2AABL 1SMDA 4QXGH 1FCCA 3GZKA 1VPOL 1AGBB 1J8KA 5M7QA 5KTEL 3GZPA 2V2XA 1QA9A 4YBQD 3FCUB 4KTGA 3MUY1 1NMCB 4M3HA 4PJ7A 2E7LA 4XPFH 1OPGL 3U46B 2PYFA 1NCCH 1IL1A 2OXGB 3F12A 4OIIL 3QO1A 4QTFA 3SJVD 3B8YA 4K3EL 2X41A 5BO1L 4LLMA 1GZQB 2AEPH 2RHEA 2IGTA 4KKQA 4Z0XA 3T2NL 4BE6A 3DBXB 2EDEA 2X44D 1U91B 5D1XA 3GB7B 5GGTH 2ITCA 3D12B 1OHQA 4PRHD 1F1AA 4ZX5A 4MB4A 5JIKA 4NBXB 2XYBA 4UMGA 1G7PB 3PDOB 5AB0A 4J2QA 2CO6B 4XNAA 1PQZA 5EWIL 3NMEA 4GRMB 4E9YA 4KZDH 1TMQA 1D5BA 4TUOB 2RCSH 2NT0A 2YD8A 3SPVB 1QLEH 2W80C 3B6SB 3OLEA 4GI8A 3WJLC 4JGNA 4MAYD 4JBSA 1CYXA 4UQCA 3IJ9A 4UANA 3GK8L 1XCQB 1CDIA 3KPRE 2NR6A 3V9FA 1AI1H 3OMNB 5CJXA 2FECI 2CALA 4JN1L 3TV3H 4BSJA 4MGXA 1ETJA 4PJ5A 3A21A 3K2UH 1W80A 2GTZB 4K9EH 4KGJA 4PWIA 3GHPA 2H32A 1VFMA 1C5CL 3C5XA 1IM9B 3A6OA 1WBXB 3RB7A 4MBOA 3MRQA 3OJMB 2APXA 1B2WH 3UX9B 4F57H 2P9RA 3MV11 1C12A 1W72A 2RH0A 1E28A 3WV0A 1I82A 2VH5H 4POZD 3ABKB 1TQTA 5DQ9A 3UP1A 1TZHB 2A9MH 5HYJB 1ACCA 2VR4A 1ASOA 1OGTB 1L6ZA 4IJ3C 4FCAA 2BY0A 5F7NC 5LBGA 5FGBA 3SYQA 2JIXB 2EKJA 4NO3B 5E00B 3VMOA 1QSED 4WO0A 1KN2L 1IJ9A 1QNIA 3MV9B 3MMEA 3DX9B 2GYSA 5B38A 2Y07H 2XZAL 4JNXA 3D4ZA 2ZNWA 5SX5K 3MLYH 4D94A 3CMOH 2WXRA 3DETD 3RGBA 5GS0H 3VMPA 1YMME 5JOFA 1YN7B 1RIVH 2DJMA 4I18C 4NQXB 3WMSA 1RZKH 1QKZH 1G7QB 2CA3A 2DQFB 1ID5I 1KB5H 4OD1H 4OM1L 2R2EA 5BOPA 5SWQA 2LLNA 1MFDL 3EYFB 3VXSB 3MXWL 3FFCB 1PG7X 3GRWH 3NZ8B 4X4ME 3O3AB 1Q0XH 3P9MA 3L5WB 2VLLB 4JO5A 4XAWH 1CE6B 2J5LC 3MRHB 4WVRA 5DDHB 4PGCB 4Q52A 1XCTB 5LCVH 1NL0H 3ME0B 2D3NA 1G0XA 1UD2A 3DA0A 2ADIB 4LL1A 1MHEA 4RWYH 2HPTA 3PQYD 1JPSL 3IVKB 1HQ4B 2NNFA 4M7KH 2OMUB 1BSIA 3QJOA 3RVWD 3FL7A 3VQ2C 1PG7W 1FNGA 2PO6D 2ZOLA 1GYAA 2HKHH 3QSKB 3ZMRA 1KNOA 4KY1H 2AF2A 3GI9L 4AIOA 2A83A 3JXAA 4FXKA 2NDFA 1WAPA 1KT2B 2BH0A 4MDRA 3IBOA 2HG5A 4Y4FC 3UTZA 4AX3A 1QO3A 2F5AH 2HRGA 5C6PB 4P5TC 5C0BA 3WS6C 2BRQA 3I2CH 4I0PB 1ZHNA 4KHXH 1NPNA 4JJ5B 4IRJC 1QPPA 3GMQA 4EAEA 2CRZA 5IHZA 1MFUA 3AQDA 3B5GA 5GGSA 2WUCH 4JZOA 3IS0X 4Y1AD 2EE6A 2F7RA 2I07A 1K8IB 3S5LB 3O8XC 2FATH 2OYMA 3ZZ1A 5BRZE 5FCUH 4RGOL 1DO6A 3EYOB 3WKMH 1NZRA 3DXAB 4OI7A 2AEQL 4IRZL 3SE4C 1A7NL 3VXME 2GY5A 1W8OA 3TBTA 4IDJL 4XO4A 3C6LB 3OPUA 4CMMB 4PVMA 2KPNA 1T0PB 1EK3A 3THML 1DUYA 1L6XA 1I1CA 4RMVA 2VL4A 3ZHFA 4ZJ9A 2GC4C 1Q9LB 4AL8C 4U05A 4ERSL 1KTLA 4N2DA 4WZ9A 1WFUA 1A7QH 4TNFA 5K9KB 2WINB 1Y07A 4B3VA 1FL5B 4TQPA 5H4YA 1PX8A 3ZSSA 2PWGA 3QJFA 4RNRA 4XRCA 3VH8B 1JV5B 1BZ8A 4AKOA 3H42H 4B9GA 5D72L 4NDMA 3WY4A 2YBRA 3IDXH 3UYRL 4FZ8H 4FXLA 4XN8A 3Q8AA 1ZTMA 2BM3A 3T65A 2HT4C 1N5AB 4K7PX 2AMGA 4K71B 2ICEC 4TNVK 5ISZE 1CLVA 2KERA 2QQNL 4M8VA 1U21A 5DUBB 1QEXA 3C09C 1P1ZB 5E1QA 3LXUX 4WO4B 2VABA 4JG9A 1NGPL 1ZHKB 2VGLM 1RK1B 3BT2L 4GLRI 4HPYH 4AITA 3SE9L 4HDIA 5E8OA 3KS0J 1JXGA 2EDDA 1E9PA 1M7IA 4DPBX 1MCEA 2BVOB 2W0KA 3HC3L 4MSWA 4WSJA 3CDCA 1JGUH 1HHIA 2G3ZA 3MROB 4ZX6A 1EBAA 2GJ6E 3Q2WA 1R3IH 3B3IA 4P46C 3L48A 4AYID 1NPUA 3T5WA 5A2JH 3F7VA 4OQTA 5KVGE 1XF5B 3GBMH 3P9LA 4ZDHB 1QMUA 2CLRB 4TXVB 1UD8A 4YK4B 4WW2A 4XBMA 4ELKB 2B2XH 4YZWA 2ZYHA 4E42B 4EIZC 4ACTA 4F7MA 3VWJB 1DCEA 2V7HB 5DURB 5ANME 3MNWA 1E8YA 1QSFD 2IFFL 3SYPA 4ODHL 5IW6A 2ODIA 3C87A 5IBTL 5DQDH 4DP6X 1EXHA 2LFEA 1LDPH 3QNFA 4CSTA 3SZKC 2WLYA 4C83A 2GFBA 4R90H 3QUXC 1U3ZA 3OKDA 5C0CB 3GPSA 4J12A 2ADGA 43CAB 1GRWA 4CADA 3DSNA 5JHDA 3FU5A 1DSFL 3FO1A 4QHLB 4WNJA 2V8LA 4YPGB 2DQIL 2G60H 5AOJA 1CYWA 1WFJA 2MHAA 1ZLUK 3RFZC 2FJGB 4ZUTA 4TM9A 4DP5X 3SGKC 5DMKB 4XNUL 4N8UA 5KVFH 1ADQL 3NFSL 5BOZG 3SKMA 1QW8A 2GCYB 1IVTA 1WC7B 1VGEL 1TCMA 1EHKB 1ZA6B 2XU9A 4M56A 1Q94A 2VLKE 4WI0B 3V0DA 4CRPA 2OMWB 3A67L 3F58H 2J6WA 3QIUD 4G1EA 4W6YB 3AADB 4YFDB 4P23B 2AERT 5DMGC 1CI3M 4M43L 4NWUL 3C60A 2XWJB 2C7UA 2YR3A 1FBIL 4BJLA 4ZO8A 3RL1A 4ZMYA 3KLHC 2NX5D 3BW9B 4MZIA 3EHBD 4NQED 4ALAL 3MZTA 2X40A 3IFLH 5IHHA 5DHVB 4PJGA 2F58L 5BZWB 4WI3A 3DXAD 3FFDB 4F7EB 3AY4C 1XD0A 4GMSL 3ZSTA 2QTEA 1BXUA 5AUMB 4UM9B 4UF7C 4B60A 3KGTA 4D8OA 4NNYA 5D2LA 2DWXA 2PMZA 3QULA 3PS6A 4IRSB 2PW2A 1RY7B 2DI7A 2X4UB 3H0TB 1J8HE 2W95A 1KIQA 3BIKA 3LJ3A 1MNNA 1OZTG 3MX0B 1LEKA 4Z3JA 4X99A 1YPZF 3KWWB 3SBWA 1B9ZA 5AB1A 2AK1L 1GGUA 2NNRA 2B5IC 3ZDZF 5T1KA 2A9DA 1PZUB 3PJSA 5LBSL 3J7HA 3OHXC 4KY2A 3TT1H 3FPYA 4U2YA 2R8SL 5B1BB 3I9PA 3LIZL 4NC1E 5IMMB 5FYLL 4A7GA 4OLUL 3LQMA 2NTFA 4FGMA 4BEIA 4C56E 4TKWA 1IBGL 1HXYA 5ESQA 1QLRA 4FQLL 2WANA 1M3JA 3EO9H 3MGOA 3HRZB 3MRRA 4JG1L 4WFFE 3ILPA 2WZPD 1KEMH 3CVIH 1VA9A 5JPMB 2WV3A 5KAQG 2CKBA 2D9CA 5J11B 3RQ3A 3FB5A 1HHJB 1IAKB 2VXVH 4LGRB 4YNYA 2H4EA 4Z3IA 1N8ZA 1UWGL 3BZ4A 3ZN6A 2A73B 1QTSA 1ZE3C 5ANHA 5GRJH 2F8XC 1XGPA 1NCHA 2VN5A 1ZANH 4IMKA 1R3LB 2O1AA 4E9XA 4JFFB 3B7UX 3VG0H 5I5IA 4A37A 1R17A 3RUGB 5E5UB 3IJYA 3GUFA 5DC0A 2EVHA 5ICUA 2YD2A 1I1FB 1M7DA 4Z3EA 2E7MA 4PJ7F 9CGTA 1EEZA 1AS8A 3GI8H 3GXDA 3T0AA 4Z7UE 2D2CC 2DRUA 2DN7A 2NY2D 2BP0B 3D5OF 4RGNC 1V8HA 4Z3GA 1AHWC 5J6HA 3T77A 3S3BB 4G42A 1D5MB 4JJOA 4R7NA 4FERA 4QMEA 4J3OD 5BV7B 5KBDA 1JPFA 1IE5A 1DVFC 4NQTA 4EDWL 3LMJL 2LR4A 5JIIA 2W9LA 2D7TL 1IM3D 1T0OA 2C5DC 3F65A 4N0FA 3IFOB 3ZDXE 3WFCL 3NCJL 3ZL4H 5DVPA 3FB8B 2FSDA 3DRQA 3U0TB 4EJ1C 5JW5B 1DQJA 1FZOA 2XWTA 4GJTB 4JKPL 1LM8V 4RMUA 4XNDA 3OAYH 4ZPVA 4UQ3B 4NUGH 3FH5A 3BCFA 2RACA 3QJZA 3ILEA 5D7IE 1IEBA 4UOZA 2EXWC 3MCG1 5HXMA 4GQZA 3OQRA 3J8F7 5IBUG 2B7DT 3DPBB 2CD0A 2Y0SA 5EU5A 2W0PA 4K5PA 3QCUH 2HVKA 4U3SA 1UXWA 4AYFB 3VXTB 1KGWA 1NLBL 1XBDA 1W9XA 3F6IA 4LSSL 4G6AD 4ONFH 4P2YA 3MRNB 4FFYH 5CIPH 3KPRD 1SBSH 3B7YA 4TQEL 5LVEA 3NK3A 5CZVH 5IT2L 3L4TA 4LPVA 2OR9L 4NYLB 5CKAA 5D1QE 5FB8B 3S8GB 3LRHA 1XF4A 5J6GA 4KI1A 5F3HA 4I9WE 4OSUL 2JKIS 5DYOA 3IPFA 3QEUB 3WUZA 2H0FA 5D1ZC 4GOSA 4NJ9L 6FABH 4TQ8A 3D3VB 2FL5B 4F9PA 4GRLD 4YFLI 1IFHL 5CJOH 7PCYA 5T3ZH 3QRBA 4S1SH 2ZKMX 2VAAA 1L5GA 1G6RA 4WU5A 1BZOA 2WLKA 1C5BH 1DE4B 5GRYA 5LAXA 2Y6SD 4G7YH 4JQVA 4Z7VF 3JTSB 3QCTH 1HJBC 2Q76B 3R1GH 3D18A 4S0SD 2YD1A 5CU9A 1UB5B 3FU7A 3TJEL 3RGVC 3CVHB 2NW2A 2VDKH 1H19A 1I9IH 2XTJD 4YE0A 1T80A 5I6XC 4PTUB 1B0WA 2IGFL 1BAFH 2AJUL 4NNXA 3MJ9H 4RA0C 2VSKB 3EYQC 1PY4A 1GW0A 1XF3B 1YEHH 1NFIA 1FAIH 1YEIL 4LF3A 3ARXA 4XCEB 5HGDB 4CC1A 4CJ1A 3FK3A 4ANXA 5AVTB 2VSDA 4JRLA 3W9EB 3ZTDC 1MI5A 2XETA 5EULV 3L4UA 2Q5BA 4JQIH 3BP5B 4Y1TA 1YMMD 2FBJH 3EO1A 5HI3D 3VXPA 4N0CD 3MYJB 3SJVA 2AV7A 2F53B 3O3EA 3VFNB 1OM3L 1A3LH 1PYWA 3CHOA 3HMWL 3MV7B 1KPRA 2ZE0A 3MUJA 5E6IC 3T8VA 3V6FB 4DKDC 2RIKA 1JZ8A 4J6IA 1OP5K 2X6UA 4JN2B 1NWOA 1CU4L 1F1DA 2WOBA 3K6OA 4NPYA 3BX7C 2WWMC 3RURA 1SMOA 3ZRFC 3E3QE 1ORQB 1A6WL 4MA8L 3N44F 3DMMA 4V33A 1OWWA 4Q2ZA 4NP9A 5FPIA 2ZSWB 4WUKH 2YC1B 2FEDC 3MRMB 1TU2A 4HGWB 3RZCB 4XP5H 1BFOA 1QNZH 2DL9A 3ARGD 4KX9A 1HZHL 3AU0A 2OYPA 3STLB 4EBQL 5JZ7D 2QSCL 2G2RA 1OLZA 1HWGB 2VDRH 1JTTA 4MAYA 5DEFB 2FWOB 4IK6A 5E8DH 3HEIB 4HWUA 3AT8A 5IBLD 1HYRC 3TCXA 1QBMH 2XX0A 2NW3A 1MDTA 1S78C 5IP4A 4FQHB 4LVHB 2KYIA 3UZQB 3BUDA 2EDMA 2EEFA 2JKRM 3WE6A 3QQ3A 5DUPL 1UWFA 1XH0A 3FZUC 2PCPA 1CICC 4WHYG 1ND0A 3KBHE 4DQOL 4Q6YA 3X11A 1UXSA 5GGVL 3KPMB 1MDAA 3GMLB 5BMFL 3QUZB 5MENB 3L1GA 3CCHB 3HS8A 1NCNA 1P84J 3ESPA 2YMOA 2PYFB 1T0NB 2R51A 4CKVX 3CQQA 2CJUH 4W9HC 4TNWF 5BRZD 5DEZA 5AOLA 2BSDA 4B96A 3W5MA 1CURA 1YNLL 5FYKH 3C5SA 1UM4L 1ZRUA 4P99A 3E8UL 5EH1A 3VXMD 1CFVL 1TYJA 1XF1A 2HTLD 3NK4A 2CA4A 1W91A 3CDZA 1GZHC 1QHOA 3ZO9A 5BUAA 3CPLA 5EOTA 2J1KA 1QSEA 1AZUA 4NNPL 4LVOC 2H3NB 1BVNP 4PMFA 3QQNA 1ZMYA 5G5DB 3GIZL 1HVXA 4KHTH 5HGAB 3ZE0E 4MA3A 6TAAA 1L0PA 4FTVE 4HKXA 2EVFA 3KYMA 4NZUL 4OLZH 4WV1C 4HCFA 5DJZA 4PV9A 5KVDH 5AAMC 4ELME 5E2TL 4YHNB 3F00A 2ENQA 5I19H 4N3UA 5HDWA 4S1DD 3TBSB 5L8LB 1BA9A 1JNLH 2ICWI 5ALCH 5FW6A 3T4AA 5ISZD 4YSEA 1CLCA 3DUSB 4Z7OF 3NGBC 2E0PA 4Z6AT 4JO8A 4CDHA 3IBEA 4P04A 2D7OA 4XCCL 3UAJA 4XOAA 1RP8A 2JXMA 4BH8B 1JPEA 2VN3A 4OJFH 3AAZB 3RAJH 2OYKA 1MJ8L 1A1OB 5ENWB 2H32B 4TLSA 3VFTA 4AJ0A 3HZYA 3T0BA 4ZQTA 1A6VH 3PQYA 4WW2F 2GJ6D 5GXBB 5KYYA 4ZO7A 3FO2B 4K5LA 4N1CA 2JKJA 3G7TA 2PO6A 4GUPB 3MLWH 4Y5YA 1WGOA 4L05A 4TQIA 3HAEG 1F1GA 4DGYL 1QWHA 4G72B 4WIQA 5JHMA 3U4BH 2W60B 3NIDE 2A6IB 3C6SA 3T2PA 4HS6A 1VGKA 2FHFA 4L23A 1AQDA 1MH5A 1YC7A 1S9YB 1JVKA 4BD4A 5LN4A 1I8AA 1J1OL 3CZFB 1AIZA 4M3KB 1KIPA 4KMTL 4ZFGL 1IGTA 1HFUA 5DC2A 4LDLB 1H3TA 4Y1AA 4MJJA 3WBDA 4DTGL 4TULH 3WFHA 2VAJA 2IVFC 1FUNA 2ZP0T 4RFOL 2F15A 3TGXA 2W81C 1G7JA 3TL5A 5J1AA 1T7XA 4FNPA 4BM7A 3VRLE 2VLKD 4PWEA 4JPQA 4AGOA 1EHLH 4H8QA 4H8HA 4KXAA 4AQ1C 3T0EB 3Q9QA 1FNLA 1KN4H 3APNA 4FQXD 1R34A 5D7IB 1TYRA 4PJGF 3RWFB 1WFOA 1HHGA 4TUUA 4IOSD 5KANI 3NCMA 5GS3A 3MRBA 2K3TA 3DTXB 2IADA 1BECA 1MCWW 1JDCA 2UVFA 3F7LA 4U6HA 1BWWA 3RY4A 4H2CA 5D2LF 3HNVL 5JR1L 1RUAH 1NFDE 1EH9A 3OX8A 4LLAA 1JF1A 3ARYA 5E4OA 4OGQC 4FXKB 1KYOJ 4F3FB 5KZCB 3F6JA 3EGDB 4M5SA 1ZWIB 2OMYA 5F97E 3BPLB 4MMZB 3NIGE 1N3NA 1J8HD 3CLEL 3L4CA 4G1MB 1CGWA 3PREA 2QV4A 2XV0A 2GT9B 5JDJA 3WY1A 1ULVA 4A7GF 1NKGA 2CGRH 5GRVL 4M7LT 2D9QB 5GGRA 5BPPA 3HG1E 2AQSA 4FQ2H 5IW3A 1F6AA 1N0LA 1OT2A 3ULUH 5L6YH 4BZ1A 1SFHA 4HHGA 4LCCA 1EERB 3R7RA 5F2FA 1YSOA 5HHQB 4C56D 32C2A 3VI3A 1CWVA 2H7WA 3T0DA 1FVCA 3GO1H 3NEXA 1FIGH 1TR7A 4Q7DA 4WFFD 3X12A 1SUJA 2QGDA 4Z76A 2WWNA 3IMWA 3KYOA 1QSFA 3BD3A 4AK1A 1OTSD 3ECUA 2VN7A 5TQ2H 3EF4A 2ZUUA 4P59L 4DEPC 4Z7IA 5HD8C 1NCGA 3K80A 1BQKA 3WS3A 5EZJB 2WQSA 1PJWA 3EH3B 3SSGA 4UB0H 2ZWYA 1JPST 4UIMB 4TV3A 1OAKL 2C7FA 1O0VA 1U8KA 2A6DA 1L7IH 4P2AA 3QJFB 4BQ6A 1RAMA 5JA8B 2R0WH 4JPSA 5C0GA 4UILL 4EXPX 5HYEA 5DS8B 2CLZA 2IAMC 5AW2B 1PAZA 4PJDA 3P77B 2DI9A 4FEIA 3QIUA 2K4WA 1F2XK 1AAJA 3DPDA 3OZKA 1CR9L 1IBZA 3NA9H 3UJTL 4BINA 1ZV9A 2UY6A 2W5PA 3VJ6A 2Z0UA 2ZOUA 3C8HA 2IDCA 1F42A 2MQGA 5GHWH 4DKEL 1JHKH 4F8TA 1M7IB 2LHAA 3FFOA 1CLOL 4KRPD 4CSPA 4D9LL 4DETA 3U7YL 1CFQA 4LSQL 4MSWB 3HRPA 3MRIB 4XVOA 5J0BA 3EJQA 4OLWL 4H1LG 2UY7B 3MLRH 2WUBL 3O2DL 4NQEA 5FM5M 4WW1A 5BV7L 4LGPB 4ZMZA 4DGVL 2YPKB 4E41B 4N22A 3P9LB 4ZAKD 5I8KH 3WLBA 5LDUA 2JKXA 3Q5YA 1JZ2A 3WIHH 1RP9A 4L37A 3L3OB 4LLVA 1NAMA 2YJQA 3HI5L 4JZJC 3CH1A 3GXIA 4X7TB 4R2GB 3KWUA 1WBYB 2PN5A 2R2HA 4HT1L 4B9ZA 1KPUA 3M88A 4FKEA 5L2JB 1A0QH 3TH3T 4AQOA 3W9DA 2VOTA 3I50H 4P2RE 3W5NA 2YXVA 4U1MB 1FCGA 1T6WA 1C08A 4Q97A 5CP7A 4LE8A 5F1OB 4PP2B 5IVXE 1TIUA 1XX9C 3LEVL 4FF9A 5C6TH 4CADB 5EU3A 1GAFL 3TNMA 3GJFA 3NOIA 1R3KB 3BZEA 5T1DH 4ANKA 4F2FA 5F7HA 3IWVA 3TBCA 4OGYL 3QDJE 4J1UB 4QWWD 1MEXL 5FM8A 3C5ZD 1Q4NX 4B41A 5D1QD 4NPKA 5HHVL <