5DJ8B

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8B01
1Q94B 3HS0B 3MLWH 3OAUH 5A43C 4NBXB 3RL2A 2EEAA 2UY6A 1JVKA 5DGQA 4P48A 5CLTA 5I66B 3K4AA 2UZYB 4N0YL 3HB3C 4HK3N 2C1PB 4P46A 4YHMH 2VN4A 5JW4N 1J7VR 4HWNA 1RY7B 3AXLB 4K3GA 4WW2C 2P46B 4F58H 2VC2L 4MQ7A 4HWZB 1T66C 1EMTH 1P5VA 3S88H 4QY8B 3RVTC 2RFXA 4NFCA 3VW3L 3HUJE 4QCIB 1B88A 3JVGA 4NHUB 5IT2L 1CG9B 1DUYB 3WDJA 4CN6A 2MOVA 1N64H 5E8EA 3CK0H 5AZ2L 4XAKD 4MWFA 5EULV 3FZUC 1I75A 1F4YL 4H0HB 4YQXH 4OCNC 4PRDB 3R4DA 3JV4A 5MEQA 2DQTL 3LV3B 1U93A 4Z7NE 1MCRA 3RVUC 3M17B 1MVUA 1JPSL 1KN2L 4LCYB 5AEAA 3VDCA 5CD5C 1JYVA 1LK3L 3F12B 3IFOA 3V6BR 5I15L 4F37K 4KROC 5C08A 2VL5B 5E00A 5FF6B 4KUCD 1CLOL 3HMXL 3MZGB 3F62A 3MBEA 1EVUA 4OGZA 2LU7A 1R6VA 3PUCA 1Q9OB 1CF8H 4YDJA 1OGTA 5DSCA 3W0WB 1NBZB 3H0TA 1PBYA 4M7LT 1T7YA 3WFHA 4C83B 1IILE 1CK0H 2BY2A 2P8PA 2VLRB 3CNKA 1S9YB 1RZFH 5C3LD 4PRHA 3WS6C 4XB7A 4JDTL 4L8BA 2PR4H 5DJDB 5JW4Q 3WUWB 3F58H 2VXSH 3S3SA 2X7LB 1C12B 1T1YB 1XCTB 3KLDA 4JFEA 4Y19B 5D7LD 2YBRB 3VFTB 1RZGB 4FTVD 3BUYB 3QXAB 3NCMA 1W0WA 4XCFH 3SJVB 3Q1SL 3VGAB 5B8CB 3BH9B 2XT1B 1CBVH 3GHBH 2GY5A 4L29B 1KIUA 1INDH 1FZKA 4NM4H 1V05A 5L88L 3I75B 2CLZA 3MRBA 4XBGB 2A6IB 4ZOBA 4Y4HC 5J6HB 4D2NA 1UB6A 3KJ4B 3S35H 4QHMA 1AHWC 2YXFA 3D5OF 4Y1AB 4WWKD 3QFJE 1FNEA 2CKNA 2ITDA 5CGTA 5EIQA 2EXWD 2OL3B 1WAAA 4X9HA 2R39A 2AS5M 3BIKA 2AERT 4FFVC 1RUAL 3JTTB 2EDFA 3QEUB 3JUZA 2HJLB 1BQLH 3CLEH 5D5MB 3F7YA 3BPNB 3T2QA 5ESVB 2XPGA 1WV7T 1GIGL 4AEEA 5E1HB 4KTDL 4HS8H 3VGEA 3KPLB 4L9LC 4NN6B 4QT5B 4M1GL 4LSPL 1JWSA 4FP8H 4MS8D 3KPMB 5GGUA 5GS3A 2W9DL 3OXSB 4OF3A 4O2FA 3UTSD 2VDLL 2RBLA 2GK2A 4LLDB 4R8WH 3NIFF 4P2OB 2Y07H 3H3PL 3K8KA 2X4UB 5IWLA 1OGAD 1EGJL 5D1ZC 5D1QD 1Y0LB 3QUZD 4HUWB 4A6YH 1T0MB 1QFHA 3PWVB 4Z7UB 4TULL 4PLOB 1TTGA 5JDJA 5FM4A 1VFOA 5C3TA 4EN3A 3O41A 5D7LA 3FJTA 2N1KA 1VFAA 2X4PB 3NZ8A 4DQOL 1HXYB 2E27H 1XH3B 5IFHL 1F13A 1GRWA 1BZ7B 3MXVL 5E03A 1YQVL 4I0KA 4P57B 5JORB 3QHFH 4L4VE 1D5MA 3CSPA 1AD0B 1Z0NA 1X5GA 3OGCA 3AMLA 4UDTA 4Z5RB 1IAIL 1KB9K 5GGVL 5GGVY 5GRWA 2PN5A 1CLZH 3AAZA 4WENB 1KCUL 2GSIB 3I50L 5IIEB 5L0QB 3O6KH 1QHOA 1LO3L 4Y5YA 3GNML 4XNZC 1HI6A 2P49B 3KLSA 1I4FB 5EBLB 4NM8H 3PWPB 5DR5H 4TQEL 1G7MB 5I74C 4EOWH 4KAQH 3CDCA 5AYQA 5CSZA 4PRPA 4Y5XC 5DJCA 2DKUA 4N5EC 1NEZA 1BEYL 1JL8A 4M62H 1D9KC 4B0MM 1LWRA 2MCPH 5MHSE 3DVNB 4UIKH 3QIWB 3WL9A 4EDXB 5DXWA 4WTXA 2JJWA 1N4XH 2NY3D 1CDJA 4IRSB 2VQ1A 4JO4L 1K2DB 1G9NL 2D7PA 2EYTA 4GMTL 5ADPL 1M7IB 5JA8B 1KJ3H 1TJIH 4AMKL 1NJ9A 3BFOA 4PUBL 12E8L 4RIRA 3RGHA 2CDGB 4CDGC 1RJLA 1L7TH 2NMSA 3MLYL 5CJQH 1ERNA 4XC1L 1XF5B 4HLJA 1F45A 1NUDA 1G7JA 4WFEE 1OGAA 3ARDD 3C60A 5AYUH 1EV2E 3I6GA 3N9GH 3WBDA 3EYUL 5D70H 4LPYA 3QUZA 2ICWA 4R4NC 3CVHB 1X9QA 4LP5A 3MX0A 5HYFA 3BGFB 1OWRM 1RZJH 1CD8A 3HZMB 4KRPD 4UV7L 2UZXB 3SN6N 5C0DB 1HHKB 4RZCB 3FB8B 2IQAB 5D2LB 1E6OL 2Q3ZA 3FFCE 4WFHE 1MIEL 4GKZA 2WZPD 5E4EB 5B22A 5F7WC 4V1DD 3B5HA 2FZ3B 3FOLA 3VXPB 1JZ4A 1LDPH 3CUPA 4XCYB 4F7PB 3VD9A 5GRVL 1WC7A 4P5TA 3QDJA 5L9DL 4JFZH 2A6JB 2LV4A 2VDQL 1P4IL 5KANI 5HY9B 4UUJA 4OQ1A 5C07B 3W2DL 3VDAA 5F9OL 2EDHA 2AJXH 3TH2T 4P4RA 3TFKC 1NGZA 3AB0C 4UB0L 2NXZB 1MRCH 1TCRB 2DS4A 4NBYB 3I6LE 3RFZC 4MXQD 3HPLB 2CDFB 5TDNB 1KUMA 2VO5A 4Q9BA 3OKOA 1A6VL 1LVEA 5FM5M 4Y16B 5CBAA 3STLA 1I3UA 3ULUL 2I07B 3DURA 1R3IH 3LS4L 5DA0B 1Z5LA 2XKSA 1Q72H 2A83B 5CILL 3U4EB 2DBLL 4G9DA 1HINH 2XI9A 1Y6MR 2EIBA 2WWMD 3HFMH 3OL2A 2IALB 2OTWB 3L5JA 3WIHL 2EE3A 1KIRB 3QCTH 4OUOA 3ROLB 1TFHA 1Q0XH 2YMXH 4JDZB 1QZ1A 3IDMB 4PLKC 1OY3B 2OX5A 2FHBA 4UNTA 1OTSC 2XACC 4Y4FD 4N1HB 4FOMA 4TNWK 1G1CA 1XGYL 1XR9A 3NFNA 3H2WA 4WI5A 1MFNA 4P5KA 2AV7A 2ADFL 4YDIH 4LHUD 4P4KC 1JGDA 4HKZB 2CJUH 5J13B 3OXRA 4GRWH 3RVXC 3TBWB 1G6RH 4YBQD 1DBAL 4PJEB 3W0WE 1S7UA 5FM5O 2VR4A 3MJ8A 3MV7B 1L6XA 1T80A 15C8L 2AJSH 2VLRE 4OF6A 2A77H 3NTCL 3TYFB 3KDMA 3X11B 4G8GD 4WO4C 5FO7A 3QQ4B 3GMOA 3TH4T 2VXVH 2QKIB 3EFDL 5DD0L 4XP1H 3HE6D 2VLKD 4X6EA 5I6XC 4Y19E 4LU5L 2Q8AL 2BSTB 1N0XL 3WFBH 1W8NA 3SJVE 4ZNCD 3HC0A 3VMPA 2EDXA 5F3HB 2DI8A 2XKUA 5K9OA 3AREB 2Y25A 3P77B 1LP9A 2FL5B 4PJ8C 2XWTA 1N26A 3O6LL 4NRZB 1ETZA 2MQ0A 4ETQB 5MEOA 4TSAL 3F6LA 2IGFH 2J4WL 5C0RL 3PV7A 4R3SB 3RWIA 2H1PH 2W0PA 1EERB 2XZAL 5HBBA 4JPKH 5EZLA 4Y1AE 2J8UF 3KYMB 1N5AB 3RUGB 4JRWA 5BV7C 4NCDA 4NQED 2ZUWA 1PY4A 2H3NB 1JHKL 3K8MA 2UZIL 4RNRA 2MJWA 4K3EL 4NKIL 2YSSB 4LSUH 1LK2B 2M2DA 2FX7L 4I2XB 1CFSB 3LKOA 5D5ME 3K2MC 5HI3C 1BIHA 3VFOB 2VXUL 4ZUTB 4AJ0A 5DS8B 2YR3A 4CKVX 3OKNB 1XR8A 5T3ZE 4QWWD 3O0RH 1NLBH 3NZHH 2AEQL 3MBXH 3O2DA 3OAZK 3LKSB 2APFA 5B3NA 1CN4A 1WT5A 4OCWH 3IDJA 4KRLB 3ARGB 2BNRA 3DO3A 4DOHB 4FXGA 3QQ3A 1MHHB 3VD7A 5ISZD 1FLTX 3FT4B 3P30L 4P5MA 5I18H 5D7IF 3QG7L 1ZT1A 4YXHL 4P2CG 5TE4H 5D8JH 1LO5A 2PXYB 4Z7UE 1HHJB 1I9IH 3T65B 3PDOB 4HEPG 4DW2H 5FYJL 1MCOH 4HIHB 1NC2D 2YRPA 3S7GA 1GXEA 3PL6D 2VDPH 4NP4L 2F54A 1MFAH 5EPMB 4PY8I 1KB5B 1ACYL 3P9MB 5CZXD 2JCCF 4U1NA 4FFWD 4XCNB 1YQ2A 5EWIL 5HI4C 4XVSL 2VITB 3VG9B 4GQ9H 3HI1A 3QRFM 1A7PH 3IKCB 3B6SB 3FO2A 1H3VA 2DKSA 5L7XL 1A6ZA 1R5IA 1MCJA 1T5XB 3BGAA 5C0GB 4PJDB 4AM0A 4X0KB 1JIBA 4AH2B 2K9UA 3QXTA 1XIWB 3MROA 4M48H 3S9DB 5JR1L 3FQXB 4APQD 4F7EB 4Q9CA 43C9B 2CGRL 1EJ6A 1MLCA 2C7UB 3PWPE 4PJBA 2IADB 4UQ3B 4JQXC 4Q2ZA 3IFLL 4KZDL 3I3BA 1ORSB 2A6KA 2C4XA 1F11B 4NQXA 3RWGB 3T0EA 1A0QL 1KJ2B 4N8VB 5F7NC 1RK0B 4HJJL 3GSQB 3VFMA 3UPAA 5CIPA 4WU5A 3SO5A 3IF1B 5HHQB 1I1CA 1BJ1H 2DMKA 3TESA 2VDRH 1FDLH 3KPRB 2Y5EA 1HSAB 4I18A 3KG5A 5BXFA 4LVHB 2GIYA 3V6ZA 1MFDL 1HYRC 3GGWA 3V52H 2E9JA 4OCXL 4R2GD 1NDMA 4RFOL 2NZ9D 3T0BA 5KSBE 1DBML 3K3QA 3MA7A 1CCZA 5EDXA 2F8XC 3U0TB 3WD5H 4X7TB 4WW1A 1AQKH 3KLAB 2OMBA 4PLJC 3EGSA 3RTQA 2XN9B 1AP2A 4XBEL 2I9TA 1W0YT 2EDQA 4E5XB 2MQCA 4HQQH 1S5IL 4HXBH 1FZMA 1TTFA 3LEXA 4XP5L 1YUHB 3VFUB 1NC2A 4LCCB 3T77A 3L5HA 4P2RA 4TVPE 2HKHH 2VE6B 2IH1A 2IBZX 3SQOH 5D4QA 2X4SA 4JHAH 5T3XE 1ZLWK 3EOAA 2BSSB 4YXLL 4N0CD 4D0DA 1LEIB 2GITB 4KJYA 1IT9L 4FQ1L 1EEZB 3LN5B 4JM2F 1A1MA 1JUFB 1OSZB 3DV4A 4NBZB 5HVGB 4HUUB 1EO8L 4M6NL 5C07E 3H9SB 3RI5K 5GZOC 3GMPB 2PNDA 4RRPA 5DT1H 3TIDB 5AG8A 5B8CC 4ZQKA 1JF1A 2EE2A 4K8RL 1MRDL 3DSFL 5DURB 3OQ3B 1I1RA 3NAAL 4YFDB 3KGRA 1Q9LB 3TPUB 5IB3A 3MNZA 2W38A 1EBPA 4H8WL 2ERJC 4TVSa 2YWYA 3KJ4C 1PEWA 1KPRB 3UZQA 5CJOH 1BVZA 4YO0A 3HAEA 5GRZA 1A6WH 1T83C 5CEYA 3OZ9L 1YEDA 1A3QA 2EXYC 2ICEB 5BVPH 5EN2B 1AIFA 1P84J 1RIVL 1WBZB 4PYGA 5I1IL 4XXCC 4M6MH 4DKDC 3DECA 1HQRB 2H2PC 4M9OA 5B4MD 1X3DA 3PDGA 3BPNC 1KFAH 3PGFH 5HHXH 1Q1JH 5KSVB 2G5BA 2R2BB 5FYKD 3QNXA 3IGAA 4JPVL 1JRHH 4BSWA 1DQDL 4NN6C 4XMLL 1CWVA 2DM4A 2GHWB 4CMMB 1FL5B 4NRYA 1J1OL 4NQSA 2VOTA 2Q76A 4HK0A 2HT4C 1ORQA 5ABDE 4XX1E 3L3DB 5LWYH 1UZ6E 4WFFE 1FO0H 4PJEE 5ANMB 4TUJB 4P2OC 1CD0A 1X7QA 2WANA 5D96B 4BFBD 3U36B 1F3RB 3MV7E 3O4LB 2MWCA 1RUPH 4WEBH 4U1JA 5ID0A 2NY0D 4GUPA 1UCBL 4M1DL 1S7SB 3QWOA 3N1FC 1PKQA 4S0TD 4X4YA 2B4CL 4MA7H 4LASH 1JHTA 3DWTA 1R0AL 1KENH 2Y6SC 1XGTB 1QRNA 1T2QL 1ZTXL 4KMTL 2MMXA 4GKOA 3VWKB 2Y5TB 4JRYD 5JOPE 4HC1H 5HI5C 2CLVB 2IH3B 5DMKA 5GGSA 3ULVD 4LSTL 2VLME 5C0FB 4K3DH 4WI6A 3KWWA 5HYSA 1QLEH 4BK4A 3L6FB 1Z3GH 1OAXL 4L4TB 3U1SL 5L0QC 1ED3B 2ESVA 3VXOA 2JELH 4HZLB 4PB0H 1QNZH 3NMEA 3TN0D 5HHOA 1C5CH 2VXTL 1FIGL 5DYOB 5HHMB 4BQCA 4A6YA 3WNOA 3OHXA 4WEMB 5C0AA 3G08A 4QYOB 3OKEB 1N8ZB 3UPRB 1D3CA 1AGDA 4NPYB 4KMLB 3VI3F 1YNKL 1F6AB 4PJXF 2IPKA 4I2XE 5F88B 5I1KH 3EO1B 1WJ3A 3TVMB 3QIWC 4K9EC 5J12B 4IRSC 3NVQA 4I0PD 5LAXB 5KAQG 1SYVB 3BPCB 3INUH 5LCVH 1P7HL 1OF2B 1ZLVK 1JNNH 1QBLL 5I8EA 2VNCA 4P2QB 1V7NL 5JPNB 3TT3H 1T89C 3KPPA 1SM3H 1A14L 5KVEH 4DOHE 4EI6B 4OLYH 3LKPA 1ITBB 4QOKA 4G9FA 4FQXD 2R69L 4PJAF 2X1OA 3KPSA 4IIQA 5E5MB 1CR9H 1KEGL 3FHAA 1S7WA 4LRIA 3BGFC 1REIA 3VXUB 1AE6H 4X4ZA 1RQ5A 2WMPA 4ISVA 1B0WA 1YEHH 5ERWB 1R5VA 4P9HL 3GMMB 4NO2A 3HLAB 4XPTH 1GOHA 1OD9A 1CFNA 1UVQA 1D5IL 2NX5D 1YPZB 5DRNB 5F7KC 4QXTA 4HUNB 4M8VA 2MFNA 2DWDA 3QG6A 3U9UB 3KNBB 3QA3B 3WLBA 3C6LD 1QTYT 5FDWB 4ENEC 1J86A 3ZDZF 3T8XA 5IB4A 4WTWA 5BS0A 4UTAH 4X83A 1G7HA 1YECL 3WFEL 5IB1B 1DE4B 1PEZA 1NSNL 2NXZC 3QEGH 1YNTA 1DL7L 2GJ6B 5F96L 4BM7A 3BE1L 1TVDA 1BMGA 1YEKH 5J6GA 2YK1H 2PTTA 1RJZA 2EH8L 3FO0L 3GKWL 4Y16C 1ZEAL 3RIFK 2XG5A 1BBDL 1BVKB 4M6OL 5KANG 3LQZB 4GO6B 4XPHL 1YEIL 3C5ZD 5IMKB 3BMVA 5T1MA 3MOAL 3JWOC 4GG8B 3KPRE 1PX4A 3GSNL 1HNFA 4YLQT 5FUOH 1CL7L 5CGYC 2HP4A 4HW6A 2IAND 2JF1A 2JK5A 4NZUH 5I71B 2ZOKA 2QQLL 3BP4A 5JW5B 1I9JL 1S7VA 1NL0H 3N85L 3K7UA 3SKMA 3QEQA 4WW2F 4E41B 3UJTH 4PJGF 3W9EB 4FQXA 4JFFA 2HVJB 3DJ9A 2EECA 4KY1L 1IQWH 4I4WB 4N8VG 3WLWC 2XN9E 4UILL 5KN5A 1ZLUH 1KNOA 4G43B 4EUPB 2J88H 3QCVH 1HEZA 3MCKA 5J13C 5CWSB 3DUUB 4YX2L 3B2UC 2Q8BL 3BP7B 4JHZA 5E8PB 2WBJB 3SKJL 2IG2H 4PIRF 1OL0A 4NJ9H 4PV8B 3HZVB 4EEEA 4HAFA 4X9BA 1JWMA 1NCCH 4ZTPH 1NUGA 2C3VA 2MHAB 3L3KA 3QUXB 4E42B 3MCLL 2VAAB 4PJIF 3R06B 3V9FA 3C6LA 3O3AA 4NSKA 4E0RA 5B39B 2NLJB 1GYAA 1A9EA 5HDQL 3QI9B 3U7YH 5DQDH 5DD3L 3FTGA 3H9SE 4K07A 4DUWA 3D39B 4X5LA 5E2UL 2AK4D 1J8HB 1SEQH 2O5XL 3MRDA 2DQCH 2XFXA 5GZND 4WUUB 3AREC 2AV1B 4G6JL 5FO9B 1WSST 3PABA 2V2TA 4J23A 4K7FB 4ZO9A 3D48R 2OI9B 3EJZC 5FHAL 5IHUH 1U3HA 3CVIL 1DFBL 1IGYB 3CFEA 1X5ZA 1G6RA 3LB6D 4YBLC 4JPIB 4HS3A 3A6CH 2FBJH 4LSVL 4ZPVB 4N90D 1INEL 3SDAB 1N5YL 1S5HB 3L5IA 4GBXA 1CFTB 4YFEA 1KSRA 5GRVK 4M03A 3SGDH 5FAAA 5INCA 4O00A 3MR9B 5H94B 2XZQH 1GPOH 1AD9A 3B9VA 5I1GL 2G60L 3MO1B 1R3KB 5JW3L 1VADB 1QLFA 3PQYD 3L3GB 3LQAH 5HYJD 4RWYL 1J1PH 4IMLA 4ONFH 2FJGA 5DMIH 1AGCA 1ZT7B 2GAZA 3QDMB 5D6CB 5F7UA 2BRRH 4ODVL 1UYWL 3WSQL 3TZVD 2R1YB 3ARGC 4Z7QE 5DUBB 3BIBX 2XWJB 3EOBA 4N8CL 4J6RL 5ANME 5K9QI 3GMLB 2FATL 5EU5B 1G1YA 3L7FB 4HIXL 5KZCD 3O4LE 3QCUL 9CGTA 1NH6A 1ZSDB 2KUTA 3OAYK 4MAUH 2XTLA 4P3CL 2HYMA 1MJ8H 3B83A 3O6FD 5C0ND 3MLSL 5A16B 4QTHA 2R23B 4KDTA 4LLUA 5SWZD 1A4KA 1DBBL 5FKAB 3IB4A 5DJYB 1SQ2N 1IC5L 3W82A 3MRCB 5CFHA 2AK4A 4LLWA 1H0DA 3V0VB 4WDIA 3W5MA 3V5KA 5FYLD 4DKFL 1HOCA 4R96B 3QUYA 3ES6A 3QDAA 1RULH 1I1AD 3VG9C 1KPUA 5DC4B 1DEEA 1KTLA 2XZCH 3IDIB 1RPQA 4RMRA 5T1DL 2AK1H 5EU3A 1KIQB 4X4MA 3NIDE 1UEMA 1DLHB 1NLDH 5D7JD 5F89A 3MRGA 2F8VA 4HLZG 4LPUA 3SBWC 1QFWL 4L4TE 4MNQB 4GRMB 4Z0XA 4KTEL 3ROOA 1OCWL 4DVRL 4OTXL 1XIWC 1AO7B 4OBSA 1A1NB 5DJ8B 2ATPB 1J0YA 3PDDA 4PGDB 5HHME 4D9QE 4BA8A 2X4RB 5T5NF 2BFVH 2UUDK 5DC0A 3C08L 1ZVHA 2W0KA 4HGMA 4DWHA 3ZDYF 1FFQA 3EHBD 4YDVA 2XTJB 5E9DD 5D6DC 3D85B 3VH8A 3K1KC 4MNHA 2NTFB 5DUPL 5D7KE 2Y36L 1UH2A 1UH3A 4OSUL 2R8SL 3C5JB 5EH1A 4MCZB 1JJUA 1MHEB 4OLVL 3REWA 4G6MH 3EYOA 3MV8E 2R4SL 1NCWL 4P2QE 1Q38A 4LVHC 4MAYB 2D03L 3Q6FA 2DB8A 2AP2A 1P5UA 3WEXB 4JFXB 5DJXB 5EA0H 1VPOH 4HIEA 1OAQL 3JTSB 3RPKA 1X5KA 4KH2A 5EO0A 5IROA 4DK3A 5IESH 2X2YA 1IAMA 2HLAA 4JQVA 3VRLE 3MRKA 3HUJF 4YR6A 4KKCD 3T0AA 2QV2A 5SX4H 3SOBL 3GM8A 1HHHA 3RNQA 3VXUE 5I75B 5I73C 2K7QA 3LRSA 4LAJH 5DJZB 1V3LA 4LCCC 5I1LB 5J4MA 2BNQD 3GSRA 4NJAH 4Z7NF 4XRCB 4ELKB 2GJZA 2QR0A 1YC8A 3HC4H 1B0GA 4MXWH 4KWUA 5D2NA 3V4PH 5F6IB 4KJWC 1KIPA 1FE8L 2P8LA 5FUZL 3BWAA 4LQ1A 2WINA 1NGPL 2FJFA 5DLMH 4Z7WA 2XA8H 5E0QA 3GJEA 3D9AL 1MQ8A 4XBPA 1U8HB 4P99A 2XRAL 5K9KB 1CDYA 3WN5B 4U1IA 5KBNC 3N1PC 3FB7B 4MJ5A 1ZWIB 2GJ6E 2VH5L 4OQTH 3DMMB 3DX8A 1T0NB 1JZ5A 1GHFH 2J7LA 1BLNA 1A3LH 1ZV5A 2PW2A 2HH0L 2HFEA 3KYKH 5E9DA 5F44A 5ICZA 3TGXA 3QIBB 4R6UA 2VUOA 5DMGD 4KJPD 3P0GB 5C2UB 1WFUA 2G5RA 3GMQB 4FQPA 3BEWB 3L7EA 3WYRA 3QULA 4IRZH 1A7RL 4NO3A 1DQQA 4MS8C 3LSOB 4JVPA 1CGUA 2FCBA 2DRUA 2AXFB 1RVFL 1NC4B 4PRAA 2P43B 1KEML 1IGCH 4IJ3B 1MEXL 4UIMB 1NBYA 1RURL 3WFDL 5K93A 4S1RL 4JQIL 4PP1D 5BO1L 3O2VL 1R24A 4HJ0D 5AAMA 4E41E 3HI5L 3QHZH 3QQ9C 3VXMB 4X98B 5TE6L 4Y2DB 1YJDC 3NACH 3CPLA 4RAUB 5E1AA 3G5XA 3S36X 3O11A 1E4KC 2W0LA 4PGCB 1NFIB 2DQGH 5E24E 1WICA 1HQ4B 2FECL 3LEVL 5H2BA 3TT1H 4AL8L 3V7AG 4YE4L 1GVIA 2VLKE 4R4BA 3ESVF 1H3PL 3REVB 2FDBP 1T03H 2BMKA 1CFQA 3GI8L 3IDNA 3KS0J 3RU8L 1Z9LA 4DKEH 3FO1B 4GH7B 2YRLA 4XMKL 3NFSH 5AZEH 1RJCA 2X4QA 3S96A 1FORL 4PRIA 1EFXD 3Q3GB 3MREA 4EI5A 4GW4A 4OIIL 3C5SB 4YEFA 2VERN 4R9HA 3SPVA 1E6JH 3ZO0A 3RA7H 4L8CB 1QKZL 4KKLD 3IJSA 5EUKA 3WO3B 1ZHNA 1SBSH 3EYSL 3D25A 3S3JA 4QXGL 1FG2B 3D39E 4WNQA 5DO2D 2Q6WB 3VWKC 1YMMA 1MFCH 1J8HE 4D3CL 5ITBL 1G7QA 4NUGL 3PWNB 1MHCB 3CSGA 2V6HA 2VABB 3P11H 1LDSA 1MRFH 3FB6B 3OKMA 5I17A 1JK8B 2DQJL 2EKSA 2FGZA 5JZ7D 2PYEA 4LLQB 2RCSH 1A3RL 2FIKA 4LEXL 1INQA 2AJUL 1QACA 1X6NA 1ZS8B 4L4JA 2Q3AA 2VLJA 3RPIA 3MLXH 1LNUB 1CFVL 1ZKAA 3QH3A 4WI3A 1J9CT 1YN6B 3P40A 3BX7C 4PFEA 3Q6GH 2ENSA 2ZCLL 1FLRL 4X8JA 2CUMA 4PP2A 3VRIB 5F1NB 1K4CA 3BKCL 4X6DE 1TVHB 3OAUL 2HT3C 3AY4C 4G8EB 1EFQA 4R7DA 3H42L 1C5BH 2F74A 1SJVA 3EJYC 2A6DB 5HPMB 2P7TB 5FECA 5I2IA 5J12C 3CSBA 4MQXD 3PG2A 4HC1A 3DTXB 1JTOA 3VXRD 1LO4H 1QSEA 5ENWA 2J8UA 4R4FL 1HSBA 1U3JA 2I5YH 4Y4KD 3ZKMD 43CAB 2QHRH 3CFJB 1D6VH 4KRNA 4AG4L 3QDME 1YYMH 4XCCH 4F58L 3MRNB 1MJUH 1CQYA 3U46B 5I19L 1MOEA 1BD2A 2NPLX 3ARFA 5BZWB 3VD4A 3S88L 4XH2A 4PTUA 1OHQA 5BQ7A 3TO2B 2YUWA 2P24A 4TSBH 1JI1A 2EDKA 4NC0B 1MIML 4Z76B 1M6OA 3CK0L 1IKNC 1CXIA 5EU6D 4YQXL 3VFWB 4U2YA 1X5AA 2DQIH 4H25A 2YD6A 4BKLA 1RMFH 4LARL 4HLZH 2OTUB 1NANH 1U8MB 5JXEA 4ETYA 3H9ZA 2BC4B 3LIZH 1CIDA 2PTVA 3B8SA 5T1KD 4UT6H 4CVWA 4S1DC 3VXSD 1S9VA 5DFVC 4DGYH 5KG9A 2X89D 4MXQC 1MAMH 1FFOB 4PRNA 4P23D 4HSQA 3ZL4H 5KS9B 4NQVA 4KKBD 1U8NA 4K7PX 5KSAB 3NBNA 4OFYD 1WIUA 2R1XA 1DQTA 4CBPA 1G9MC 1FCCA 3LEYH 1CF8L 3MACL 4MNGB 1LD9B 4MNQE 4D8PB 3TNMB 4HIJB 4NO0D 5C0CA 3NPSC 1RUMH 4RA0C 5J06A 1CK0L 1SJHA 2Z31B 4X9IA 1AO7E 1RZFL 1WCBA 5D9SB 5LG1A 4O9HH 1YZZA 2PR4L 3BRFA 1FZOB 1JZ6A 4DAGH 3BDXA 3F58L 4TTDD 5C71A 2AXGB 2CLRB 1HWHB 4FG6C 1V5JA 3CXHK 2XTJE 1KT2B 5IJKC 4F9PA 2HFFA 4JM2D 2Z92A 3ULUE 1VACA 3GHBL 4S2SB 5HYIA 1INDL 5EZOH 3U30B 4Y4FC 4NM4L 2WWKT 3UTTB 1FJ1B 4ZS6C 1CL7I 2J8OA 3JWDC 5I71C 5IQ9B 1L0QA 1NCTA 5CKGA 4X5WB 5D1XB 4IOFC 4M4RA 3B8YA 4O2EB 5IT2H 3DETC 2FJHB 4OF8A 3ABZA 3D3VB 3WDIA 4AEFA 3BVNB 4L3ED 3SE3A 5FOJA 3P3YA 4JLRB 1F4YH 4N9GB 3RWHB 3LKRB 5B38B 1NKRA 1OW0C 3U6RB 3KPQB 1HILB 4QHLA 3CLEL 1NMCB 1T3FA 1UZ8B 1IGJB 4I13B 1PDKA 2NXYD 1LK3H 2ZG3A 5I15H 3Q0HA 5BCAA 3WIFB 3BD4A 1FFRA 3GKZA 4NFBA 5EOQH 4HS8L 4MVBD 3VXSA 1DQMH 3OR7A 4TUOB 1DQJB 1HXMB 1T22B 5GGSY 1GL4B 1HHGA 4FP8L 2VWEE 2Z8WC 1OTTD 4U05A 3ME0A 3UCRA 2CIKB 5GS0D 4XCEA 4J3WA 1B3JA 3VGDA 4R7NB 2EZ0C 3BH8A 3I9GH 1MWAH 3RL2B 5CJXC 4YK4C 1F90L 4LDLB 2QTEA 4MA3A 1GGBH 25C8H 4Q9RH 3QYCA 1ZLVH 1BFOA 3MUY1 5HHPA 1IM9A 3WE6A 3OV6A 2OI9C 5D71H 4M93B 1WZLA 2AQ2A 4MQ7B 1T1ZA 5L88H 4PY8J 2E27L 4IM8A 2GW5A 3QHFL 2OLDA 1VFBA 4JO1H 5IB5A 3SDAC 5E8EB 1RFDH 3RDTA 4MWFB 4YDLB 1AKJA 4AQ1B 3HE7D 4OD3H 5MEQB 1ODAA 3O6KL 1U93B 5JQHC 1MVUB 3VJ6A 5EZJA 1Z9OA 5IHBA 2EO1A 2HFGH 1RUAH 3BQUD 4NM8L 3IFOB 3SY0A 4KAQL 3BDYH 2ICWI 5C08B 4RGMB 1T7WA 1MCBA 3EBAA 1XF2B 3MBEB 5FIEA 1GIGH 4M5ZL 5JXAH 1G6VK 4XNQA 4YDJB 4MJ2A 4OKDA 4M62L 1OGTB 5DSCB 4UIKL 3H0TB 4M1GH 4LSPH 5CINH 1ZA3A 3WFHB 5D5MF 1MCCA 3RVVD 2P8PB 4PRHB 2VDLH 5C0BA 4JG1L 1OP3K 1U42A 3NH7L 4YFLI 3DVGB 2WLZA 2W60A 4KRMB 1L7TL 3H3PH 5CJQL 3WXVH 4LLMA 3TA3A 2AAVA 5CGMA 4JFEB 3S5LG 4F7TA 1DVFD 5CCKH 3IETA 1W0WB 2HMIC 3W11D 2C4FT 4HD9A 3N9GL 1XCQA 4J3XA 2C9AA 3UMTA 1FZKB 1K9TA 3FMGH 2C3HA 4U6TA 2RGSA 1RZJL 3JUYA 3MRBB 2CLZB 2WQ8A 3DBXA 4JRXB 3OF6D 4D0CA 5K9QG 4J8RA 3LRGA 4RA3A 1E28A 4Z7UF 4DQOH 5DFTA 1AC6A 2BY0A 1UB6B 3MXVH 5L2KD 2VISA 4QHMB 5E6ZA 2YPVL 4NFDA 1MCKA 3FQRA 1FNEB 2ITDB 4A2LA 5C6PB 1IAIH 1DSFL 5FB8A 1LDPL 1K3ZA 1I8KA 3BIKB 5E6IC 2VDKL 5CEZD 2GK0A 5MI0C 1UKQA 4U1GB 3DROA 3BI9X 2OR7A 5FM8A 3HE7A 1GZQA 5BZDA 3F7YB 1IVLA 2XTJC 2XPGB 5IW1A 3ZHDA 4HH8A 4NGHH 3IJYA 1OB1A 1JWSB 1ITCA 1BEYH 5GGUB 4IRJD 4QXWA 3KLHC 3D0LA 4O2FB 4OLXH 4KC3B 4MD5A 3VWJD 4JO4H 2VQTA 1CDCA 1G9NH 4JY4A 3QWRD 3IFPA 4LCWA 3D2UD 5GHWH 4MHHI 5KW9H 1R3IL 1MQKH 5IMMA 4LSDA 3VXTA 1BQHA 3HI6H 3RZCA 1HINL 4LHJB 4ZAKD 1QUNA 4NNPH 3HFML 1IEHA 5DJ6A 3CH1B 4N0CC 3C9NA 3WUZA 4W81A 5I75C 3LQMA 4OCSH 2EEDA 4EN3B 1PG7H 5D7LB 5DK0A 1A6UH 5KVMC 1CICA 1EXUA 1NCBH 3Q48A 5GGRA 3SDCA 4I48A 3P0VH 1VFAB 2M8XA 1F4WH 5KSBF 1Q0XL 4PJHE 1B6UA 3NZ8B 4UV7H 1FNSH 5J3HC 2IBBA 2W1NA 4QRQA 1D5MB 3RKPA 2VWEC 3OGCB 1MIEH 4UDTB 2EDOA 4LCUA 3LDBB 5KS9E 4PJAA 1T66D 4YDIL 1WWAX 1CXLA 3AAZB 5E8NA 2CJUL 1J11A 3RVTD 1G6RL 4Y5YB 4ODSL 1HI6B 2BXZA 1WIPA 2VIRA 3C8DA 1P4IH 4WY7H 3WN5C 2AJSL 3FZUD 1KPVA 5CSZB 4PRPB 3DMMC 2R1WA 5DJCB 3RVUD 5F9OH 3PHSA 1NEZB 4PD4K 4HGKC 4K71B 3DYMA 4XP1L 3GM0A 2CRMA 3WJLC 2OK0H 5CD5D 3TLRA 1VFMA 3QIBC 4UAOB 4KROD 3WL9B 3PIQA 2VQ1B 3WFBL 1WZ1H 4HXAH 1P9MA 2KQNA 2EYTB 5E95B 4M7JH 1BM3H 3ZT6A 1NJ9B 5DD1H 4NZRH 4YC2C 1GC1H 1R5WB 4RIRB 2EE6A 1RJLB 3ILPA 4NZTH 5EU7E 2YS4A 2HKFL 2E9WA 3SDXA 2IGFL 5CILH 1JNLL 2UYLB 2H1PL 2WWKO 1G7JB 3RHWF 3VFPA 1OGAB 5A2FA 3ZYOA 3C60B 3D3VE 3I6GB 3FOMA 3QXWA 3QUZB 2ICWB 3S8WA 3FCTA 2EYSA 4OQTA 3MJ6A 4QHKI 5E56A 2FECI 4OZIB 4JCLA 4D9RE 4KHXH 3OJ2C 4Y7MA 4GKZB 2JIXA 2ZCHL 4GFTB 3ARQA 1XGYH 1H3WM 4G7YL 2H8PA 5HGHB 1QSFA 7FABH 5MENA 3CUPB 4Y4HD 3ULVC 4WW2A 4NQDD 3ALWA 1WC7B 3I3DA 3QDJB 4P5TB 4PJGA 3O0RL 1NLBL 3NZHL 2D9CA 3MBXL 2R0ZH 2YC1A 4UUJB 4OCWL 1RJYA 4MD0A 3AC0A 3O3EB 5JMRA 2UUDH 5HDLA 3NTCH 5FDYA 4P4RB 1NGZB 1UZ6F 4FFVD 3ARPA 4PJEF 5I18L 3TCLB 3N1MC 5TE4L 1FVDA 3V0WH 1WWCA 2CUIA 5D8JL 4KK8C 3RY4A 5CAYB 2CDEA 3MLPA 1N0XH 3T3ME 3OKOB 4DW2L 1OVZA 1L6ZA 1MCOL 1QG3A 5CBAB 3CX5J 3SDYL 3T3PE 4NO5A 1CXFA 3STLB 5F9JA 2VDPL 1B4JH 4NOFA 1MFAL 3SDDA 3BGMA 3QEHA 1UJ3A 3DURB 5GGTH 5C09B 4W4NA 5K9JL 4G9DB 3VFVA 4GQ9L 3S3PA 4TSAH 1GGIH 2PUQT 2Y9RT 3BEVA 4BH8A 3K4ZA 3DRQA 2YN3A 3M1BA 1MCWW 4JZNA 4XB8A 3WS6A 4ZFFB 4IHOA 3DV6A 1L9NA 4NQCA 4KKAC 1RI8A 1AXIB 1T2XA 1QQDA 1YYLH 5C08E 1T7ZA 1XR9B 3NFNB 2CIIA 4P5KB 2AV7B 2X1WL 3BXNA 1D5XA 1WQVT 3PNWA 2BHZA 4JFDD 3OXRB 4U1SA 5I8CA 2AKRB 1S7UB 4Y8AA 5DRZA 1IKFH 2JTDA 3MJ8B 3LN4A 4ZNEE 5GS2D 1FDLL 4X4XA 4ZPTA 4PRHE 3KDMB 1T20A 4N9OB 5F1IB 3GMOB 4QHNA 2H41A 3V52L 3V8OA 4X6EB 2VTFA 1YEEH 2J1KA 3WD5L 3HC0B 1AQKL 2BVEA 4N5ED 2A9NH 2G75A 2MCG1 4POZC 1ZXQA 5K9OB 4C56A 1LP9B 2XWTB 4RBPH 1D9KD 4DZBA 5KSAC 1MSPA 1ETZB 4JRXE 4HQQL 1A6AA 1TNMA 4EVNA 5MEOB 5TJWK 1N59A 2VN7A 4CADA 4M3KB 3H7BA 1FYTA 1X5LA 3CLFH 3VGGA 3QHTC 4MSWA 3C87A 3PXJA 5EZLB 4YHNA 2HKHL 2Z31C 4MX7A 1WAAE 3SQOL 1VEOA 1YMHA 1X4YA 2LABA 1CDBA 4RNRB 2ZZUT 2YZ1A 4X7SL 4RISH 1D7FA 4H8WC 5D1ZA 5SWSA 4HIIB 4Z9KB 2VQUA 5DT1L 2GUOA 3DX7A 3QDGE 5DQJA 1A6TA 3SE4C 4Z6AT 2X1QA 3VFGL 1XR8B 3MXWL 3EYQD 3U30C 1B0RB 1I3RA 3G5YA 3J7HA 4FNLH 2HRPH 3OKDA 4HJJH 1BPVA 4JFDA 4X6CA 1J87A 1MAJA 3IDJB 2BNRB 5D1XC 3QQ3B 1ZA6A 2VZOA 5CJOL 4L9DA 5HGAA 1HN1A 3QUMH 4P5MB 4AT6A 1A6WL 4X8XA 5CHNA 1ZT1B 3T2OA 4Q9QL 5EOCJ 3ZYIA 1RV6X 2K7PA 1LO5B 1FPTH 4IDJH 4IEFB 2GQHA 4C55A 4M6ML 4LAQH 3TFKD 2YXMA 4UU9A 4PBWD 4AIOA 4MQSB 1X5JA 1KFAL 3PGFL 5HHXL 1Q1JL 1Z6JT 2F54B 4KVCL 3SCMA 3EZ8A 2N7AA 5KOMC 4ALAH 4U1NB 2Y23A 4M00A 2FEEL 2WLYA 2JJSA 3HI1B 3CFDA 3QFJD 3FO2B 1UENA 4QTIL 2Y72A 2X9YA 3M8OH 1A6ZB 1R5IB 4YWGH 3QO1A 3KYOA 4AM0B 2FLRT 5LWYL 4LF3A 2ZUTA 3NN8A 5FGSA 3MROB 4YXLH 3GDBA 4NN7B 5E94A 2BOBA 5DHVH 1RUPL 4FQ1H 4G3YH 4IMKA 4WEBL 4Q2ZB 2YPLE 3OKLB 4M6NH 4PRPE 4WCYL 2O61A 2NW2A 2A6KB 1S9WA 2IPTH 3F6IA 4MA7L 3K2UH 4NQXB 1NMBL 2RB8A 1WK0A 1Q9KA 4KI5E 3C8KA 3T0EB 4PLKD 4K8RH 2JB6A 3NAAH 5CIPB 4WU5B 5DDHA 4OZHA 4HC1L 2AQ3A 3DX6A 3IDYB 4P4KD 4I18B 4P3WA 3RVXD 2I60L 4K3DL 5BXFB 1M7DB 2C26A 1LGVA 3V6ZB 4BQ8A 1QLEL 4YDLC 3BRDA 1Z3GL 3FONA 1NDMB 3OZ9H 2JELL 4PB0L 1MWAA 3MA7B 1QNZL 3FQTB 4RGOL 4WO4D 4WHCA 4WW1B 5I1IH 1C5CL 3EGSB 4S1QH 2FWOB 1RK1A 3RTQB 1A47A 1F4XL 4RGMC 1BFVH 1AP2B 2DI9A 2I9TB 4HUKB 1VERA 3O6FC 1FZMB 3LEXB 3MBEC 4K23L 5DI8A 4Z8FH 2C1OA 4P0DA 1NC2B 4OZIE 4WHTA 3STZA 4OV5A 3EYVA 1QR4A 2BHUA 4XMLH 3T77B 5I1KL 4L4VD 4P2RB 5EOTA 3MZTA 4MA1B 3TIEA 5CP7A 3INUL 4IBLT 5LCVL 2IH1B 2X4SB 1P69B 4DFHA 3EOAB 3QDJE 1ZHLA 1FNHA 3TT3L 5HGBA 4KJYB 1A1MB 4P9HC 4WHYG 2V2WB 3DV4B 1SM3L 5TQ0H 5KVEL 1E4WH 4OLYL 4Z7QF 1MFEH 4ZQKB 1JF1B 1IC1A 5AAWA 1CR9L 4TOYH 1C08A 4XVUC 1ZGLA 5JIHA 1QR1A 1AE6L 5HI3D 5MHSD 1R0AH 5IB3B 5FA3A 3MNZB 3QBTB 1ZTXH 4YHIA 3EHBC 5E8DH 3UTOA 5BJTA 4XPTL 1ZHBA 4J3OC 4R26H 3JWNC 4YO0B 1HDMA 5C09E 5F7EL 5CEYB 1YEDB 2VL4A 1NAMH 1MH5A 1FBIH 4U6VH 1AIFB 1II4E 5AD0A 4WFED 1EO5A 1SY6H 4AIXA 2OSLA 3NIDF 4UTAL 1FIGH 2XQBL 4NKQB 2G5BB 5KVGH 3QNXB 3IGAB 4BSWB 4U6HA 2OM5A 2KH2B 1YNKH 3FFCD 4WFHD 5FGCB 4NQSB 3OJMB 1YEKL 5IV2A 3KS0H 3MV11 1JFQL 2Q76B 4U7SA 3IAPA 1TQBB 3CH8A 4HK0B 1ORQB 4HAGA 3PGDB 4PJ8A 4HFUH 4PY7A 3VMOA 2FIRT 1X7QB 4K3JH 3VA6A 5IWLC 4G6FB 5JDSA 4UMGA 4HBQA 1XFPA 3GRWH 1E4JA 4JFHE 4JJ5A 3UX9B 2EC9T 4U1JB 5FUOL 5ID0B 1IC4H 3RGVA 4PGJA 3CD4A 3QWOB 1HCVA 1PKQB 4NZUL 4X4YB 1G0DA 1C7SA 1OAZL 1JHTB 3HA0A 1NL0L 4NDMA 3I6LD 4WV1A 1KEGH 5FO8A 3GIVA 1U9KA 1IC7H 3T09A 1I3GH 1QRNB 2HTLC 3UJTL 1VGKA 4L8SC 4BFEA 4RFEA 5LKNA 5DMKB 5GGSB 1IQWL 4J3SA 1LP9E 3FAWA 5J8OA 4JZOA 3KWWB 5HYSB 3VRLF 2M1KA 2J88L 3FN0H 5JIPA 2ESVB 3VXOB 3N1QC 4Y5YC 1N0LA 2IG2L 4NJ9L 4JFPA 3H3KA 1YN7A 1XGPA 2DQUH 5HHOB 5ECJE 1NFDA 4A6YB 5JNYB 3OHXB 2AJVH 2BDNH 4JKPL 5C0AB 2NY7L 3X12A 3G08B 1YECH 2Z35A 3SKOA 3WFEH 4F7MA 3MJ9A 1AGDB 3H3BC 3OTTA 4K71C 5J11B 4EZMA 4KI5C 4JFYA 3R1GL 5J1SC 2IPKB 4PLJD 4UAOC 1IBGH 1MI5A 3O6ML 3OMZA 3SGEH 4Y89A 1SEQL 2DQCL 2EH8H 5KVDH 3FO0H 2CKBH 5I8EB 5HJ3A 1ZEAH 2FSEA 1ZK9A 1OLLA 3W0WD 1KBGH 4G80A 5IK3A 4M6OH 4DN3H 5I1AA 4ONHA 3KPPB 2VLRD 3MOAH 2X6MA 2COQA 4B7IA 4CN4A 2BNRE 2IWGA 3GSNH 3LKPB 2ATKA 1EZVX 1JPTL 4QOKB 3A6CL 3BW9A 3C60C 4G9FB 4XVJH 2Z93A 3KPSB 4IIQB 1S7WB 1WBXA 3X17A 4Y19D 2YA2A 3N85H 2APVA 2CD0A 4ISVB 5GZOD 1JYWA 3SJVD 1R5VB 5GS0L 4H5SA 4NO2B 1WUNT 1CFNB 2XZQL 3S4SG 4OI7A 4LHUG 2F53A 2F54E 2C1PA 4QXTB 5A2IH 5LBSH 1W0VA 4L8DA 3SO3B 3TO4A 1QPXA 2BJML 4IOSD 4P5TC 3DVFA 3LQAL 1J1PL 4RWHA 2DWDB 3QG6B 5DMIL 4E9LA 4Y1AD 3WLBB 2UVEA 3ARRA 3T8XB 5BS0B 5IB4B 1G7HB 3DHMA 5LQBH 1TXKA 2BY3A 2EXYD 3MRJA 2ZKHH 4N0FA 1AC0A 2F19H 1YNTB 5JMOC 1QP1A 3NGBB 5D93B 3LV3A 2H2PD 4N1CA 3MSPA 2WUBH 5J6GB 3R8QA 1SMOA 1MJ8L 4DGIH 2OBGA 2PTTB 1RJZB 2BK8A 3RIFF 2O5XH 3T0EE 5T1LB 5T3ZD 4QF1A 3OWEA 4OAWA 1KYOK 4OCRH 5T1MB 1AGBA 1BREA 5L8JB 1DFBH 2A73A 1RULL 2FO1A 1VENA 2HT4D 4YPJA 2XZCL 2AK1L 4P2OD 2JK5B 2WAHA 1EJOH 1FRGH 3QIUA 2ZOKB 3BP4B 3DGCR 4O5LL 1Z2KA 1S7VB 4I1NB 1I7RA 1WTLA 3BD3A 5DGRA 3GI9L 3SKMB 3K0WA 1T0PB 3QEQB 4NRXA 3DXAA 4ZXBA 4BH7A 1N5YH 4FQXB 1U8OA 4JFFB 4ZFGL 4GLRH 4LPCA 5KN5B 3VFTA 2Y6SD 1KNOB 3SJVA 2GTZA 1HEZB 3MCKB 5HI5D 3ZSSA 1KULA 4P2RE 5GISH 4X6DF 5DD5H 4LEOB 2X10A 4Z7VA 4ZUVA 5GGTA 2KZWA 1JWMB 4FQ2L 4XPAH 2C3VB 2D7TL 1AQDA 1UYWH 4G6ML 3L3KB 3WSQH 1RZ8A 5FEBA 4X7CC 4I3RH 4N8CH 3O3AB 5IVXA 4I0CC 4E0RB 2L7UA 2OL3A 1G7IA 5F7DA 1A9EB 3PWPD 4HIXH 1VPOL 1TZHA 3NOIA 3QCUH 3FTGB 4F33A 5F7LB 2V7NA 4XXCA 5C0JA 2FX8H 1FP5A 3RIAF 5IESL 2XFXB 5CEZL 1PZUB 3JXAA 3K74B 2AW2A 3PABB 5ESVA 4PJCA 1HHIA 4G8FA 2OZ4L 3QIWD 1U3HB 4NYLA 2PO6B 3AS0A 4IRSD 5K33A 5SWQA 3CFEB 1RZKH 4GRWB 1G6RB 4DKFH 2ZG2A 3S5LA 4HS3B 1XEDA 4NJAL 2ED7A 4N0RA 4JM2C 5T1DH 1A22B 3HC4L 3V4PL 2OP4H 1PAMA 1QFWH 1HYSD 4NC1E 5E70A 1NGYB 1AY1L 1JZ7A 3QNZA 4GBXB 5DLML 3S35X 5F6HI 1BJMA 2XA8L 3AS1A 4EQ2A 1WWWX 5HYQA 5INCB 4HUWA 5DJAA 5EUOB 2YD7A 1AD9B 1WZKA 4OCLC 2E6JA 5C9JA 5JHLL 4ODXA 5JTWA 1BBJA 4JREB 4OQTL 3G6JA 2GCYA 5FGCE 1A3LL 4IMLB 2FJGB 3HAEG 1AGCB 5DUPH 2GAZB 4OSUH 4TVPD 2R8SH 1WT5C 2DLFH 2FEDC 2D4DA 4PGEB 5AWNL 2EDTA 3B4NA 3EOBB 1QBAA 1UXSA 3QP3A 4OLVH 5T3XD 4OGAC 1CGSH 2R4SH 1JPFA 3O9WB 2D03H 3W39A 4IRZL 3S37X 1C16A 3ULUF 5HPOA 4ENED 3QAZB 2DLTA 5C07D 4JO2L 4TRPL 5JO5A 1OAQH 4U1KA 2DWEA 2MSPA 4OLWL 5IEKA 4QTHB 5E8OA 2NW3B 4LLUB 1PKQE 2DAVA 1A4KB 4YH6A 1F2XK 1P4BH 2NXZD 3ZKXB 2DJUA 5I1CH 4WUKH 1FL3B 4LLWB 1H0DB 1QRNE 4WDIB 3V5KB 1PVHA 1JRHI 3HNSH 3ES6B 2R29H 3QUYB 4QRSA 3NACL 4Y16D 1KPUB 4H88H 2FEEI 1W72L 1DEEB 3QIWA 1E4XH 1KTLB 4K3HA 2IMMA 3GJFH 3MNVA 1FV1A 5EU3B 3TT1L 5TPWH 3EDEA 5F89B 1K2DA 3MRGB 4XI5C 4ONGH 3WMSA 3ROOB 2ESVE 1Q9WB 1T03L 1WBYA 2P5EA 3DARA 1L7IH 1EHAA 3QUMA 4DKEL 5CGYD 5HHOE 4NN7C 1G9MH 3L3HA 3NFSL 5AZEL 5KSBA 2E7CA 1A02N 3D9AH 4OKVA 5C0AE 3QB7C 5DMYA 3WXWH 4YDVB 3T0EC 2XY2A 5A2JH 3VH8B 4MNHB 3WLWD 2VH5H 3SKUD 2Z4QA 4J4PD 4NN5B 1MFCL 1G9EA 2OXHA 2HLFC 3IDYC 3REWB 4I18C 3QRGH 4YHOH 3B2UD 3EYOB 4WFFD 3P11L 1MCFA 1MRFL 2V5SA 3Q6FB 5IB2A 4GAYA 2NY4B 3IXTA 1EBAA 2BSRA 2WIIA 3MV7D 5CSGA 4HIEB 3U7WL 4YIQA 2EDRA 5EO0B 3O2WH 1RVFH 4QOKE 4RMVA 1GCFA 5DHVA 4OFIA 4N68A 3VE0A 1KEMH 2HLAB 3RTQC 3MRKB 1MEXH 3KPSE 4YZFE 3F7PC 1HHHB 3RNQB 4NWTL 3QO0B 4ZUUA 5I1DA 3BESR 3LRSB 4ZO7A 3HI5H 5J56B 5JOPD 1TCRA 3WV0A 5TE6H 3ARED 2VLMD 4OCMC 1C5BL 3GSRB 4MA1C 2ZSWA 2GJZB 2QR0B 2WSKA 4EUPH 1CE6B 1B0GB 2A9MH 1LO4L 3EJZD 5D2NB 4KUZH 4YE4H 4QXUL 1KIPB 1NUNB 4QRPA 2ZUXA 3FB5A 2I5YL 5BW7A 3BWAB 4RMQA 3RU8H 2WINB 4BZ1H 2FJFB 2QHRL 4Z7WB 3NPZB 3V5HA 1ND0A 3GJEB 4CMHB 1YYML 4XCCL 1NGWA 5BS0E 4XMKH 2D7NA 1U91A 4XBPB 1FORH 3OB8A 2OTWA 3S36H 1FHGA 4U1IB 4YDKH 1O0VA 2X9XA 3W81A 1TVBB 2DYPA 5IF0A 3M07A 4MJ5B 3Q5OA 3HG1B 4MJIA 3BD5A 3DX8B 4TSBL 1BLNB 3ROLA 2PW2B 3TYGH 2HFEB 4R90L 5ADOH 1A2YA 4QXGH 4C54A 3UYPA 4O58H 2DQIL 5DWUH 5IUSA 5ICZB 3U7AA 2GTWA 1RMFL 4NUGH 2O5ZL 1E27A 4H0IA 2L4OA 4UT6L 1WGOA 3L7EB 3EO0B 1ULVA 2H9GA 3QULB 3U2SA 4UV4L 2DL2A 1UXWB 4NO3B 1DQQB 4NC1C 3ZL4L 3ARGD 4IRJC 5E5UB 3LPWA 4CU8A 2AJUH 4PRAB 3KVQA 4I8DA 5IKCA 1TITA 3X3GH 3MV7A 1UH4A 3LEYL 1NBYB 3JV6B 2F5AL 5EIIA 3KXFA 2CMRH 2B0SL 1R24B 3QEQE 3MV9A 1RUML 4PTTA 2PXYD 4JFFE 1FLRH 3CPLB 4O9HL 4ZAKC 5E1AB 5DUML 4PB9H 3G5XB 3BKCH 3O11B 4BSJA 4DAGL 4Z78A 3T0DA 2D2OA 1S8DB 3H42H 1U95A 4R4BB 35C8H 3RZWA 2LU4A 2BMKB 1CFQB 2ICES 3IDNB 2WBKA 4R4FH 4G5ZL 1NAMA 5EZOL 1QBMH 4GKNA 2X4QB 4AG4H 3S96B 4PRIB 4QRRA 3MREB 4EI5B 4GW4B 1DLFH 3SPVB 5JIIA 5I19H 3UJIH 5GS1A 3MLRH 1SY6A 1XIWD 3SKNA 7CGTA 3IJSB 4ODTH 3RX5A 2XZZA 1ZHNB 3CDGB 4KGLA 4AK1A 3D25B 2Q20A 1IEBB 3RJDA 2DQHH 1MIMH 3H6JA 4WNQB 1JZ3A 1KG0A 1YMMB 2YUXA 3BPOB 1G7QB 1BOGA 3TBTA 5D72L 1D5BA 4LIQH 4LARH 3OKMB 3EO9H 1F5WA 3ZTNH 1DN0A 2PYEB 1F6LL 1YEGL 4JFQA 4GRWE 3OX8A 1NCNA 3N06B 2Y1VA 5E2TH 1FO0B 1N7ML 2FIKB 3KPRD 1VKXA 1INQB 5EOQL 4OZGB 1DQML 2VLJB 5DK3A 4PJHF 4KZEH 3OKKA 1U8PA 2DLHA 3GRWA 3Q5YA 2QL1A 4HCRH 4FABL 3MACH 3WIIL 1IE5A 4GAGH 4PJ5B 4X8JB 2EC8A 1J0JA 3OPZH 4HFWA 5J11C 3HAEH 5KS9F 1K4CB 1F3DJ 4LPVA 4CVXA 3I9GL 1MWAL 4R7DB 2XN9D 3LHPH 2F74B 5EUOE 5I2IB 5EO1A 5FECB 1MCQA 2HJKA 3NCFB 4Z18A 4K7PH 1D6EA 1QSEB 3BN9C 2ZPKH 1GGBL 5ENWB 1M1SA 1ZVSA 4ZODA 1HSBB 25C8L 2XG4A 4Q9RL 3MFFA 3GO1L 4UI2A 1UM4H 1FVCB 5JUEH 5D71L 1G0YR 3FQUA 4KJWD 3IU3A 1BD2B 2A74B 3OBAA 3ARFB 3ZTJG 4HUXA 3QFDB 4R0LC 3S6CA 4XH2B 5HD8C 4PTUB 3SBWA 4MZ3A 4IIQC 5BQ7B 4LRIC 3MFGB 2P24B 4JO1L 1P2CA 1M6OB 3H9SD 1RFDL 1XIWA 2GYSA 3FQXA 4OD3L 3SGDI 2VR5A 3EYFB 4H25B 3SE8H 1GSMA 4BKLB 1OT1A 1XAUA 2FH8A 1Z9SA 4TPRL 2HFGL 4XGZA 1ORSA 1ZVYA 1P7KA 5TGBA 1CI5A 3BDYL 2C5DC 1S9VB 5JPMA 2CKBA 4HX1A 3SO3C 5KG9B 5IHZB 4PRNB 2KBGA 5D6DA 1U8NB 2ICCA 1NEUA 2R1XB 3GSQA 2ARWA 5JXAL 5JLZA 4X4ME 2OYPA 4JKWA 2D7MA 4ODHH 4TUKL 1P4LB 1HH9A 4AEHL 1BGXL 5CINL 1HSAA 3GSNA 4HHAB 1L0YA 5C0CB 1GJIA 1O5DT 4PJ9B 1SJHB 5ALBL 2D4FA 1WCBB 2YN5A 5MERB 2QSTA 3NGBC 5D93C 5HHVL 2DIAA 4ZOCA 5IMLA 1HCFX 2DQFA 5L8LB 3WXVL 1F90H 3QQ9D 5CCKL 2GT9A 2J2ZA 2HFFB 2C3GA 2Z92B 1KV3A 2ED8A 1VACB 4NC2B 4UINH 3HPJA 3VFUA 4PRBA 4J3TA 3FMGL 5I8OL 4P59H 2ARJQ 3CXDH 1IGIH 4FTVA 4FFZH 4KV5E 4PS4H 2X9WA 5EBMA 5FYKH 2UWEA 3T3MF 3O4LD 1ZLUK 2QLVB 1LEIA 1IGFL 5E2WH 2GITA 1OSZA 3MRMB 2X09A 3VH8G 1JV5A 4XNUH 5K59E 4WWKA 3S97C 4QHLB 2XWBA 1T3FB 3VWKD 2LQRA 4Y0GA 3ILQC 3WHXA 3LD8C 2QQNH 3CFIC 4FMFA 4GRLC 4NGHL 1C5DB 3OR7B 4M5ZH 4G42A 5D2NE 1ONQB 1HHGB 1D5ZA 4L4TD 1MJJA 4XPBL 4KDVA 1B4RA 4OLXL 3TCXA 2IAMB 1FC2D 4Z7WE 1CD1A 1FC1A 2HRLA 4XCEB 4HMEA 3ULVH 3BH8B 5HHMD 3IDGA 4JAMB 4JG1H 4D9QD 5EN2A 4OM1L 5GHWL 2GY7B 5KW9L 3NH7H 2X4TA 1MQKL 3CDYA 5KSUA 4MA3B 3UTSA 1JI2A 4X7DC 2NR6C 3HI6L 5F21B 4NNPL 4W6WB 3HG1E 5SX4I 1BIIA 1BFOB 2HT3D 3MJ9L 1IM9B 5D7KD 3TVMD 3WE6B 1BF2A 3EJYD 4G6AD 4OCSL 3IAQA 2PO6C 1PG7L 4LMQE 2LTQB 1A6UL 5D1QA 1NCBL 4NQUA 1PZ5A 2Q7NA 3P0VL 1T1ZB 1E4KA 3L1OH 1F4WL 4JFOB 4WU7A 3MV8D 4P2QD 1FNSL 2J12B 3HRZA 1MHPH 3EYQC 2FH6A 1VFBB 1T4KA 3L3DA 4FQQB 5IB5B 1TIUA 2YPVH 1CLYL 3RDTB 1AKJB 1Q0YH 5ALCH 4TNVF 1I7ZA 3MODH 1DSFH 2MQ3A 3O4LA 4U6XA 3GSOA 2NY5C 2CSPA 4I3SH 2VDKH 3VJ6B 5EZJB 3VXUD 5TF1H 3GB7A 4WY7L 2UVFA 1UQSA 3SY0B 4B53A 5C6TL 3P0YL 3WFCH 4JREC 1WAAF 2YEZA 1BWMA 3UO1H 1FVEA 4PG2A 4XNQB 4XNXH 2Z91A 2OK0L 2NXYB 3N50A 1U92A 4S1DD 5FYKU 3HR5A 1KGCE 5DFVD 1ZA3B 3K46A 4NCC2 2BNUA 3GK8L 2DF3A 1WZ1L 4HXAL 3O9WC 2OR9H 1VSCA 4M7JL 1BM3L 5C0BB 3FQWA 1KJMA 4QRUB 5DD1L 4NZRL 1GC1L 4PRIE 2W60B 3FT2A 2B2XH 1H3UA 4LLMB 4NZTL 3TA3B 3OR6A 5CJBA 5BRZB 4OUUA 5GSRA 4PR5A 3ZKXC 4KU1A 4F7TB 1EHNA 4OFVA 1OARH 1UADC 2GJ6D 3DLQR 4OD2A 3IETB 5HVHB 4GW1A 4GSDH 5FOBB 4MD4A 1XCQB 1YMME 3QUYC 3LRHA 4FG6D 5F88A 3H9HA 2NY1B 3DBXB 3GMRA 5DZOA 3VFNA 2W9LA 3VXNA 4D0CB 4J8RB 3RY6C 3ARDA 1E28B 4KHXL 1UKSA 1OF2A 2Z0BA 2PYEE 2VXQH 4OCYH 2VISB 4GJTB 3MV8A 3UTPE 2BVYA 3FQRB 1BZ9A 4ZS6D 4OZGE 5GRXG 7FABL 5FB8B 2VLJE 1I8KB 2GK0B 1ZMYA 5A2KH 2BVTA 4V1DA 4DJMA 2R0ZL 4IOFD 3DROB 4ODSH 2V9QA 3DETD 5DRWA 4E41D 2ADGA 5ID1A 5BZDB 4PJ5E 5GPRA 4FN0A 3RWCB 5T33L 3F7VA 2BVOA 3VXUA 4LK4A 4CN1A 5IW1B 1A7QH 1DUZB 4LNVA 3GSXA 4D0BA 3V6FA 4NN5C 3ZTJH 5ERWA 1F3JA 3P4NB 1OB1B 3NCCB 1QSEE 5DTFA 4NKOA 3V0WL 2W0FA 3GJFA 2WBJD 4ZD3H 3D0LB 4RMWA 4MD5B 2NY4C 2BVQB 4JY4B 3IFPB 4KI5F 2HTKD 4LCWB 3I6KA 1VESA 1B4JL 1MY5A 1BD2E 5GGTL 1UCTA 1WIOA 5IMMB 3VXTB 1H5BA 1KTKE 1UG9A 3UROR 1BQHB 3RZCB 2HKFH 1GGIL 3QI9D 5DJ6B 1JNLH 2EZ0D 5ESAA 4KJQD 2E7BA 3STBA 1DQLH 2ZOLA 3D39D 2OL3L 4Z95H 2OMNA 1J8HD 1KCRH 1CICB 1EXUB 5JHDB 2GJ6A 5GGRB 3SDCB 4I48B 3CJJA 3L5XH 2EYRA 2R9HC 4HG4J 1DJSA 4OI8A 5D2NC 4QRQB 6CGTA 1YYLL 5I8KH 4LCUB 2ZCHH 5IJKA 4LVNB 5IOPA 1RZ7L 4M6AA 1UWXK 3LQZA 3RWFA 4G7YH 1QLRB 1TZIA 2X40A 5F72S 3LKQA 4HULB 2AEPH 4Y4FA 4HKBA 4GG8A 5C0EA 5HYEA 4OZIF 5DRXB 1IKFL 5CD3A 1F6FB 3S4SA 2VIRB 5C0CE 3SDAD 2V17L 4LHUA 1A5FH 3CSYB 3IRPX 2VZ3A 1TNNA 1CDGA 1KPVB 3UAJD 5EIVA 4F9LA 2R1WB 2FX9L 1H8OA 1CE1H 4E41A 3ARUA 5EO9A 4JJHA 3MMEB 3KAAA 4O4YH 4YFLF 2Q86A 1YEEL 3CC5A 3S98A 4G8GA 3DVIA 1NANI 2FD6L 2LU3A 3PIQB 3KJ6H 1OW0A 1IM3A 3QISA 4N0UA 4EUPA 2A9NL 3HE6A 4LVEA 2VLKA 3QDMD 3MUHL 4L3AA 1JCKA 4J12A 3SDYH 3KHOA 2FYYB 2EIZA 3LY6A 3GEWB 1ZLSH 3OKYA 5C8JA 4XAWH 3B9KB 4NWUL 3SDXB 5K9JH 3CLFL 3VFPB 1I85A 3FO9A 3MRHB 1KLUA 3FOMB 4POYA 1PG7W 1U8QA 5EU4A 3FCTB 3BZEA 4HDIA 5I16A 4Z77A 2EYSB 3MJ7A 1F58H 3TNNA 4YHZH 1F2QA 3SHSA 2HMID 3DUSA 4RISL 3SE9L 4NQEA 1JPST 2JIXB 3EDKA 3MNWA 4CAGA 4X99A 5CS7A 3HN3A 3WO4B 4LVOB 2H8PB 1QFPA 1QSFB 1BP3B 2VKXA 3B5GA 5MENB 1U41A 5IBTH 2LAGB 3V8CA 4B41A 4EXKA 1ZHKA 4ZSOA 4MNQD 4FNLL 4NZJA 2DTSA 4K9EL 2HRPL 1FL6A 2WIMA 2IPUK 2YC1B 4CJ1A 5FYLH 3ORJA 1PYWA 1RJYB 1AO7D 5HDOA 5E6ID 3BMWA 4ZOEA 3SDAA 3QUML 2YD5A 3ZLQC 3BPOC 4CVZA 1FVDB 1XF4A 4MB5A 4X6DA 5TF0A 2XTJD 1FPTL 2R2HA 4IDJL 5H94A 1TJGH 5ISZA 3D85D 3I3EA 4YGAB 2CDEB 4LAQL 3ULUD 1HKLH 1LO2H 3BP5B 4KROB 3U4BH 1U8JA 4NO5B 2BXYA 5F9JB 3HCVA 3BGMB 3QEHB 1UJ3B 3SDDB 3V2AR 1BVLA 4MAYD 2PCPA 4ALAL 4Q58C 4HS6A 3KLHD 1WITA 1G84A 5D2LE 3T0VA 1QA9A 3VFVB 1BF8A 2R1YA 4HMDA 4OBRA 1QRKA 5L6YH 2DTMH 3PL6A 1EIBA 2FLBT 3BEVB 4BH8B 1UWEH 1LP9F 3DRQB 3IFNL 4TVPL 3M1BB 1U58A 3T4YA 3GMLA 4JZNB 3M8OL 4YEEA 4YWGL 1KCVH 1CTNA 5DK2A 4RDQF 4IHOB 3P9WB 3DV6B 4H0GA 4NQCB 3EIFA 3BZFA 3K1DA 5INDA 4BK5A 5H8DA 1U0QA 5A16A 3T04D 3NCJH 1G7LA 2BRQA 2ZWLT 4X7SH 4G3YL 3I85A 1QQDB 1OOAA 3VRJA 2YRZA 4AIZA 2CIIB 4ODBD 3BXNB 1T04A 4APQA 2IPTL 3PNWB 3VGAC 3K2UL 4U1SB 5I8CB 5J3HD 1TJHH 3VFGH 3MXWH 1CGVA 5DRZB 1U36A 2CQVA 1IRAY 2AJ3A 4M1CC 2IBZY 3ARFC 4ELMA 1RHHA 3D69A 3LN4B 2CRZA 4DGVL 2VKWA 3PJSA 2F9BT 4M7LL 4X4XB 4ZPTB 5C86A 4HCRA 5C0BE 4PJ7A 4HV8A 1T20B 1H8SA 2CXKA 3MLTA 4RX4D 1JMZA 4QHNB 2DLIA 3SGKA 5BRZE 2L7JA 1XGUA 2X5PA 3JWOL 5E6IA 5IM7A 4P3DA 4Q9QH 1B9ZA 3EDJA 1UWGL 4YPGA 4XP6L 3LKNA 3DMMD 4N8PA 3UZEA 2ZUUA 1NCAH 4L1HA 2G75B 4S1QL 4QNPE 1G7PA 4C56B 4G8IA 1BFVL 3L3JB 5F70A 3QIBD 1MLBA 4DUVA 2V5YA 1S7RA 3P4MB 1A6AB 3QXDA 1JE6A 4KVCH 4Z8FL 4EVNB 3C5JA 1N59B 4CADB 3H7BB 1FYTB 2ENYA 1U8IA 4MSWB 1I7TA 5EBGA 3RY5A 1Q8MA 3QNYA 4YHNB 1BJ1J 4PJ9C 1QYGH 4MX7B 4OZFG 1NC4D 2KZ1B 4QTIH 3UTZA 1LEGA 4XNYH 5DJXA 2KQMA 1YMHB 2H2SC 4AQOA 1XMWA 3PHQA 1WEJH 1GOGA 1JGLH 1MUJA 5HGGS 4UNVA 5D1ZB 5IQ7L 4GG6B 4FQIH 5SWSB 5TQ0L 1E4WL 3T1FA 5M94B 3IVKA 1MFEL 2H45A 3DX7B 5DQJB 4WCYH 4ZDHA 4F9PC 1I8MA 1A6TB 2X1XR 1I3RB 2YD1A 3G5YB 4TOYL 5TFSL 1NMBH 5F9AC 4M8QA 3MRPA 3ZE1E 3OKDB 3KYNA 3C2AL 4XRCA 1OAKL 4JFDB 4X6CB 5E8DL 4HKXA 4JANA 3FT3A 4U1HA 1ZA6B 4R26L 5CUSL 4LCWE 5HGAB 2I60H 4AT6B 1BWWA 3SE3C 1IAII 4F2MA 5CHNB 1Z9MA 1NAML 3HZYA 1FBIL 3E8UH 5FYJD 4U6VL 4XNZB 2O26U 1FH5H 2CRIA 1WFNA 4RGOH 2VZ1A 1SY6L 3QJHA 2PYFA 4MDIA 2P5WB 4UU9B 2FHFA 5LXGH 5I74B 2XKNA 3RUGE 2E9BA 3FRPG 5JHDE 3ZT7A 1F4XH 2L0DA 5BVJA 3SCMB 3A0OA 4KK8D 5KVGL 4K23H 5F9DC 1KLGA 4IOIB 4HT1H 1LILA 3CFDB 1DR9A 4XXDA 4YHKH 4BSVA 3W9DA 3I2CH 2IAMC 3FHQA 4GXVH 3BEWA 3U82B 3G9AB 1BQHG 5B3JE 3KYOB 4LF3B 3NN8B 4HFUL 2DMCA 5F1OB 4BELD 1LQSR 4K3JL 3RBGA 5E94B 2BOBB 3GRWL 1IC4L 1HYSC 4FS0A 2QADB 2O61B 1LEKA 1IQDA 2NW2B 2JB5H 4KKAD 1Q9KB 3V4UH 3T4AA 3RNKA 2JB6B 1IC7L 1I3GL 2JKXA 5DDHB 1I7UA 4XWOC 1MF2H 2IMNA 4OZHB 4TSCH 1UM6L 3DX6B 1GH7A 3C6SA 2WNGA 4RSVA 5E4EC 3VFRA 3RDTC 3FN0L 1KB5L 1OM3H 4JRYA 3FONB 5F7EH 3UC0H 4Y5VA 3SDXE 1MWAB 5TDPA 5DEGA 1TENA 3Q3GA 4W4OA 1RUQH 4ZFOA 2DQUL 4OF7A 5CZKA 1RK1B 1JYNA 4L8CA 2DLGA 1U3YA 2AJVL 1XGQB 2BDNL 2EDDA 4PJDE 3NA9H 3AB0B 2XQBH 4JGUA 5DI8B 3TN0A 3U0WH 2C1OB 1QO3A 4WHTB 3STZB 2MNUA 4POZD 3MRRA 1IBGL 4C59B 1HWGB 3B3IA 5EOTB 1KELH 3QJFA 5CP7B 3B2VH 5KSAD 3TIEB 1KN4H 3FB6A 1YA5A 1JFQH 1QSFE 2AI0L 2VUYA 4W68A 5KVDL 5MENE 2DDQH 2CKBL 1UA6H 4J3VA 1KJ2L 1ZHLB 1KBGL 1MCNA 4QO1A 5HGBB 4I0PA 4YGVA 4DN3L 2APXA 1A4JA 1P7QB 2Z31D 4K94H 2Y06H 4S11A 2DMBA 5HVHC 5LGJB 5KJRH 4R97B 1JYXA 2VLLA 4XVJL 2YHGA 4GW5A 3VRIA 4HH9A 1C08B 1P84K 1ZGLB 1OAZH 1QR1B 2NY6B 5CZVH 2NY1C 5EZIL 1C8PA 3VCLA 5FA3B 1BQUA 4UDUB 4YHIB 5BJTB 3D18B 1K3IA 2APTA 1ZHBB 4JZJA 5FCSH 1PFCA 1T2JA 5LGKA 2BERA 3OB0H 1HDMB 5J89A 4J4PC 3UTQA 3L3OA 5LBSL 5ICYA 1MH5B 3SGJC 1MNUH 4U3CA 2W65B 5AD0B 5D1XD 2NX5A 3B9EA 3D3VD 2OSLB 3P73A 1OT2A 2OJEA 1EEQA 5EC1A 1BOYA 3TO2A 5LQBL 4OV6F 2AEWA 4JKPH 2NY7H 2ZKHL 4NQCE 1KCSH 2F19L 5DD6B 4D9RD 3FN9A 5I6XB 3R1GH 2WUBL 4PJHA 5HGDA 2X70A 4DGIL 3O6MH 4YAQA 4PJ8B 4PY7B 4WHDA 2ZSVA 3ELAT 4OCRL 4X6BA 4O2CA 5JDSB 2O5YH 4PBVC 2Z8SA 4NOBA 3VI4E 3RZCC 4JJ5B 3MCG1 5IMOA 3RGVB 1DZBA 4HPOH 2C4FU 1EJOL 1FRGL 1IAIM 3C5ZA 2IPUG 1JPTH 3IYLW 4UT7H 1CICC 4NDMB 1B90A 4WV1B 3SDCC 5FO8B 3GIVB 2CR6A 1VGKB 3KPOA 2OJZH 1N3NA 4ODUB 4JGMA 4RFEB 2IANA 4PBXA 2AXGA 2AQ1A 5GS0H 3O3BA 2KL6A 4OZFH 1IAKA 4C56E 1K6QH 2B7DT 4JZOB 5ESQA 5JA9A 4LVNC 4YZFF 3O3DA 3W5NA 3OGOE 2D7OA 1HNGA 1ZT4A 3MOBH 1FYTE 3N0PB 3WNKA 3L9RA 2BJMH 5GISL 1EAPA 1FJ1A 4JFPB 1YN7B 5DD5L 1XGPB 5SV4A 1BX2A 1NFDB 4XPAL 5DJ2A 1KXTB 4X5WA 3MOQA 3X12B 5ELIA 2Z35B 3SKOB 4F7MB 4I3RL 4JR9H 3O45A 2D0GA 2E7LA 4JFYB 4GG6E 4QLRA 5SWSE 5C08D 4LLVA 1MI5B 5J9PA 2FX8L 2PXYC 3MBED 1P9MC 2OCFD 2WP3T 5HJ3B 3ALXA 2ZP0T 1MELA 2FSEB 3ZZ1A 1S9KC 1ACZA 4OIAA 4FXLA 4G80B 2LVEA 5IK3B 5I1AB 1RZKL 4ONHB 3B9KC 1OTUC 3MYZA 4OLUH 4X6CE 1KB9J 4WJ5A 4CL7A 4PRHD 2GSGA 4L1DA 1J88A 2OXGA 2ATKB 3BW9B 1CQKA 4HJGA 2Z93B 2WV3A 5JW4R 2OP4L 4O5LH 1WBXB 4R7NA 4EJ1C 4U6YA 4JFED 4UTBH 2IQ9H 3GI9H 5DVMA 4JM4H 3TBSA 4H5SB 5EBWA 2P5WE 4ZFGH 2DN7A 5CMAA 3WO4C 3GBNH 4XVUD 4LVOC 8FABA 2F53B 1AGEA 4JRXD 3P9LA 4JN1H 1W0VB 4L8DB 5T5NG 3TO4B 1EEYA 1NGXA 1J1XH 1FNLA 3BZDA 4AENA 1OP9A 5IR1A 1SJXA 1ZE3C 2DLFL 2NY2B 4FQ2H 1AFVH 4FQHA 3PQYA 4M43L 2D7TH 5HYJA 1V8HA 2FHCA 5EC2A 4YXKL 1CGSL 3MRJB 4N0FB 4JN2A 4XMPH 3TP4A 1S78C 3TZVA 3I02A 4U1LA 4JKLA 1FN4A 2Y7QA 5H35A 2FGWL 3QDGD 1O7SA 4PREB 2WUCH 3LMJL 1P4BL 1MJ7L 3CFBA 5FFLA 5I1CL 3BZ4A 5CEZH 4QF1B 3BKML 1I9RH 2VRAA 3DX9A 4WUKL 1N2RA 1NUFA 2WW8A 4OAWB 3O6FA 3SDDC 1XF2A 1UJ3C 4ZUSA 2OZ4H 1IGML 5CLWA 4OZHE 4WRLA 4JDVA 3FFDA 3HNSL 5SWZA 1AGBB 2F58H 2R29L 4NHCL 2A73B 4HBCH 3QWQB 1LO0H 4WFGE 3IKKA 1OLZA 4H88L 4LDEB 1E4XL 2BOCA 3RWEA 4X6FA 5TPWL 4X80H 4ZNEA 3QIUB 1YPZE 4XP4H 3IJHA 3TV3H 3BN3B 4ONGL 1I7RB 1I1AA 4NRXB 5TQ2L 1L0XA 4GRWF 4LOUC 3DXAB 1L7IL 3DVGA 4ZXBB 2HJFA 4BH7B 5FHBL 1AY1H 1U8OB 1S7XA 4H1LH 5D7JA 1G9ML 3AGVA 4EN3D 3E0GA 4FQCL 3TJEL 1U2HA 2HTLD 2GTZB 3WXWL 4NNYA 5JHLH 5EORL 1UWXH 1CXEA 2R0WL 1JGVH 2EH7H 4LNRA 4JRXA 1T1WA 2WK2A 4Z7VB 4ZUVB 3HNTH 2R15A 5EUOF 1WLHA 3GZKA 3WJJC 2ERJB 4PG9A 1CXHA 1AQDB 3KPNA 3QRGL 3BKJL 4YHOL 4RAVA 1RZ8B 2Z8RA 4ODWA 5AWNH 1VFUA 5F7FA 3UXFA 3BAEH 5IVXB 1G7IB 5F7DB 4RBPK 4MB4A 1A7BA 1TZHB 3WS3A 3V7MA 4KQ4L 3V7AE 1GGCH 4F33B 2YPLD 4JY6A 4HWEL 4FQJL 4PRPD 2V7NB 4JO2H 4TRPH 5C0JB 3O2WL 3PF2A 3JWDL 4OLWH 2VDMH 3WKMH 4KK6C 4KI5D 3MQIA 2P44B 4PJCB 1HHIB 4G8FB 3QDGA 2GEEA 2XY1A 4NYLB 4CUCA 5IBLC 5SWQB 3ZHLA 1T21B 3E6FA 4MLIA 5BMFH 4MJ6B 3QQNA 3S37H 4ORGA 3S5LB 1AJ7L 1EA9C 1W72H 1ES0A 1CDHA 3NA4A 2A9ML 3IXAA 1R3HA 3L3IB 4KUZL 3EKCA 3MGOA 5J0BA 1BJ8A 2BNQA 3QNZB 4BZ1L 4LRNH 1FGVH 4XZUA 5ETUA 3RRQA 3C60D 1KJVA 3E3QE 3LOWA 4HGWB 5D96C 5HYQB 5DJAB 3HKFA 5C0IA 3DNKA 3MGTA 3CH1A 3S36L 3BKYH 4RFNB 5C9JB 3MYJA 4ODXB 2X4NB 1OAUH 4YDKL 1BBJB 4JB9L 2CR3A 2OQJB 3G6JB 2GCYB 4WIQA 4XNMA 2CH8A 1EDQA 5AUMB 3TYGL 4L8SA 5ADOL 6FABH 2BCKA 1LHZA 4O58L 5DWUL 5IBUG 3KR3L 1JPGA 4HF5H 4WTZG 4RAHA 4GKSA 5TH2A 4HK3J 1UXSB 4WUUE 4YHLH 3VG0H 4P5TD 3QDJD 1ZGLP 5CEXA 1URLA 1JPFB 3W39B 1FAIH 2PETA 1C16B 4M7KH 1KXVC 1A7OL 4OGYH 5JO5B 4ACPA 4XTRD 4U1KB 5E2VH 2DWEB 5DEFA 4JGJA 3U7WH 5IEKB 5E8OB 3X3GL 2UV3A 4KV5F 2DQEH 1BAFH 2FO4A 4AYFA 2CMRL 1L9MA 3K8LA 3BUTA 2YPLA 3D87B 3ARBB 5F3BA 5M7QA 4PJFB 4NWTH 3SCMC 4ZYKA 1F4HA 4QRSB 4PB9L 2JJSC 1PG7X 3L5WA 3MNVB 1FV1B 3TVMC 1M05A 4G6AC 2DIBA 1JTTA 5C09D 5K59F 2X44D 4KVNL 35C8L 4QXUH 1WBYB 2R2EA 2P5EB 1GGYA 1R5WA 3QUMB 1NBVH 1TLKA 4ZG1A 1NFDE 3L3HB 4N1EA 1QBML 1XGRB 5KSBB 2GKIA 4IMKC 1UACH 2YA1A 2UYLA 4OKVB 2QADC 1J5OH 3RP1A 1DLFL 2EEBA 3UJIL 3HRPA 3MLRL 3RHWK 2VSCA 3ECBA 2FNBA 1FNGA 4ODTL 3ET9F 3QZWG 3MRQA 4Z7WF 1WFOA 4ZTOH 1EFXA 2V5RA 2Z4QB 3G04A 2DQHL 1RU9L 1MI5E 4R90H 4OZIA 1A1OA 1TQCB 5J1AA 4W70A 5F7YC 4QRTA 4M61B 1R3LA 4LIQL 4CW1A 1U8KB 3UJJH 4O02H 3EO9L 3G5ZA 3ZTNL 2O5ZH 3C09B 4NKMB 5HGHA 5IB2B 3EUUA 4GAYB 1ZOXA 4F3FA 1CIUA 3IXTB 1T1XA 2BSRB 2WIIB 1CU4H 2WP3O 5SX5H 4UV4H 5E2TL 4BYHA 4JFHD 2BVPA 1TZGH 2OR8A 4YIQB 3QPXL 5D7IA 5DHVB 4KZEL 3VE0B 3ALPA 3O3EA 4HCRL 1DANT 2F5AH 2O93L 2NNAA 3NIGE 2B0SH 4ZUUB 5I1DB 4GAGL 3OPZL 1GOFA 3V6OA 2F15A 2X42A 3TCLA 5GS2H 4OFPA 2I26N 2HG5A 4YHYB 1CVSC 2XIDA 3LHPL 5DUMH 1IL1A 4X9GA 1AI1L 2ZSWB 3X13A 2F53E 1K4DA 2JCCA 3RAJH 3SGEI 4K7PL 4K7PY 5B21A 2ZPKL 3GIZH 2DOCA 4QRPB 1VGEH 4CNIA 3FB5B 3KHQA 4OD1L 3PGCA 1UM4L 4X7EC 4HPYH 5C09A 5ICXA 5JUEL 4G5ZH 3V5HB 3VXRA 1ND0B 1H3GA 2HT2C 1NGWB 4NQTA 4ZO6A 1U91B 4KPHH 4JG0H 1LE9A 4Y4KA 3MRIA 3HHRB 5FKPA 3GUTA 4R97C 4S1SH 2CXGA 5F7MC 2DYPB 5IF0B 4MB3A 4OM0L 4OLZH 4ZFFA 5KTEL 3DIFA 4MJIB 2NY6C 2F8OA 5IGXH 3O8XB 3X3FL 1YDPA 1A2YB 2V5TA 3U0PA 3SE8L 2GTWB 3EOTL 4WGVB 5JOFA 5D72H 1C1EL 1E27B 2E8YA 3U2SB 2H9GB 5EU6A 3UZVB 3MRLA 1IEAA 2P8MA 3H7LA 2FEDD 1YEGH 2D31B 2AKRA 3PXHA 2BNRD 1N7MH 2WBJC 1C7TA 1I8IA 5T1KA 4OGAD 5IKCB 4ODHL 5HHNA 3E3QC 5EIIB 3UBXA 3KXFB 2X89A 4IS6B 3TF7C 4P23A 2HTKC 4FABH 1OP5H 5GRUL 5F1IA 3QUXC 3WIIH 3MV9B 4OFYA 3DXAE 4JY5L 4PTTB 2CK0H 5FA4A 2BVUA 2ZNXA 1CS6A 1V7ML 1MCEA 4RGNB 4OZGF 2NY5H 1TETH 3QI9C 1I8LA 4JEGB 4Z78B 4NO0A 1YC7A 4KJQC 1U95B 4KK5C 1PKOA 2F54D 3BP6A 3UPCA 2ITCA 4Z7VE 3DGGA 4UINL 4P46B 3GO1H 1NAMB 3AUVA 4GKNB 4D9LL 4P59L 3CXDL 4XI5D 4QRRB 1IGIL 2FB4L 4YBLB 3RGVC 2D3VA 4PV9A 4FFZL 3WUWG 4POUB 5GS1B 3FQNA 4PS4L 4JM2A 5FYKL 5IVXE 2RFXB 3MLVL 3SKNB 4FXKA 5EOCL 2ILLA 4WV1C 3KPTA 4XHQA 3VA2C 1KG0B 5E2WL 3ESUF 1BOGB 5AG9A 3TBTB 3JV4B 3UAJC 1YEFH 1D5BB 3T0ED 1MFBH 4HIIA 4GLRI 2W9EH 2ZUSA 4ZUWA 4NT6A 4XNUL 4PJCE 2YKLH 4KK9C 3IDUA 4TPRH 4X7FC 4L3EA 2WBWB 1DN0B 4F37F 3HNVH 4JFQB 1G9NC 3VXME 1KF9B 3OX8B 2H32H 2HLFD 1B0RA 2AJZA 4OJFH 1VKXB 4GXUM 1J12A 1FYHB 2QQNL 5E00B 1EPFA 2VYRE 3CX2A 2VDOH 5IJVA 3OKKB 1U8PB 4TUKH 1EH9A 1ROWA 1HIMH 4EIGB 4AEHH 1S7TA 4F7CA 1BGXH 3FL7A 4LBEA 5E5RB 2HVKA 4CGTA 3BPLB 4HFWB 4ONOA 5ALBH 3ULVL 4CVXB 5FCUL 4L8BB 3RTQD 1N6UA 4ZFOL 5EO1B 5HHVH 2AXJA 1K5NA 1EO7A 2HJKB 3HTLX 1D6EB 4YUEL 1ZVSB