5DJ8B

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8B01
4RAVB 3DMMD 2DLEA 1JBJA 4WTZA 2XN9A 2DQCH 1ZT1B 4ZFGL 4PLJD 3WNKA 1MJ7H 3ZKXB 3MQIA 1W8NA 2ARWA 1BZQK 1P84J 4LSTH 4P59H 3TZVC 5HYQA 5I30L 1GXEA 1QFPA 1UH3A 5GGUA 4FNLH 3L3JB 5JZ7D 4HGMA 1YEKH 3O6FC 4L8BA 3WIFB 1XR9A 5B8CC 3NZ8B 3LKOB 4N0UA 5JPMA 3O3DA 1NFDB 2CGRH 4TPRH 5F3BB 3B9KD 1IMHC 1YEEH 4OQTA 3MCLL 1DANU 1KTDB 3H3PL 4QRRA 5CMAB 1NCBH 1X5FA 3TPKA 3W2DL 5B22A 3N85L 2VDOL 4Y4KB 3U0PA 4N8PA 4QXUH 4OD2A 3MX0A 4I3GA 1HILB 1CU4H 3AREA 5JR1L 4H0IA 4U3CA 4XPFH 3U6RB 4K07A 3CSBA 3H9YA 1YDPB 1G6RL 1OARH 5DJYA 1KGCD 3VFVB 3EYUH 5T5NG 4JPVL 2WWMC 4KH2A 5TF0A 1R24B 4OZHF 3V7AE 3TWCH 2DIBA 2DRUA 1ZGLM 2Q7NA 2GK0B 3FQRA 5ANMB 3E1F1 4J7RA 4XPGL 5LCVL 4S1SL 3VXQB 2W9EL 4NC1C 4R90H 5FM5O 4F9LC 3ABZA 4KMLB 4R4BB 1NANH 2WINA 5CJ8A 4O2EA 2HT2C 1I3UA 1IEBA 1WC7A 2X5PA 5DT1L 2AJVH 3TIDB 3IDNB 3LRSB 4PRNB 3LHPH 2F74A 2HFTA 5IIEB 4OD3L 1PW3A 1NDMA 3RGVB 4XMPH 5ITFB 3PP4H 1BMGA 2V5YA 4ONHB 3VW3H 4H88L 5EOTA 1W8OA 5GGTL 1EMTL 2WWKT 3WFDH 1EZVX 2FECI 3NCFB 3L9RA 2CDEA 5KSBE 1JPTH 1MWAH 5CSBA 2BMKA 3HZMA 5DMGC 1OF2B 5K93A 4O51B 3AUVA 5SWQB 3TBTA 1FSKB 1C08A 3QCVL 1B4JH 3VD4A 2CH8A 3K3QA 4HJJH 3HRZB 1AFVL 2BFVH 4D0BB 4HBCH 3RA7L 3C6LA 5FO8B 1Q38A 5C0CA 2RB8A 4OFKA 2CJUL 2X9WA 2HFEA 2XN9B 1ZLSH 3CUPB 3FOMA 1RQ5A 4AK1A 2I26N 1Y0LA 1INEH 4WFHE 5LAXA 3MRBB 1FFOB 1GVIA 3CZFA 3IS0X 4OF7A 4EI6A 3P4OA 5FYJD 4R96A 4LARH 2PYEA 4N9GA 4O5LL 1A7PH 2IAMB 3D9AH 1MJJB 5E4IA 1EPFA 4MXVE 3IAQA 2NXYB 5JOPD 2EYRA 1KB5A 5H94B 1U8JB 3MROB 1HXYB 1Y18A 4X6DE 4DFIA 3DXAE 4P9HH 1G0XA 2NW2A 5GSRB 2BNQE 5DUPL 4JJ5B 3L7EA 4KRPD 5CZXD 2EC8A 5EU4B 2YD6A 3U0PB 1KN2L 3MV7D 4R0LA 5INCA 3BKJL 1JGUL 4NQCA 2APBA 3O4LB 2WM0A 3S36X 1CGVA 1M1SA 2OQJA 4F9PC 1AGBB 4YLQT 3DRTB 1MFDL 3IKCB 4OF0A 2AXGA 4TNVF 3H0TB 4F8QA 1U8OA 1IEBB 2D2OA 4MA7L 4TVPH 3CDGA 4S11A 3CH8A 5D1QB 1Q9WB 4YHKH 5SV3A 2I9TB 5CKGA 1AHWA 4Z7WE 1B6UA 3EOTL 1XZ0B 4PYHA 4PJCF 2H3NB 3OF6D 5F96L 1N4XH 1UACL 5I2IA 3FAWA 4JRYD 1CLCA 3CGTA 3I3BA 4QOKA 4YXLL 5A2JH 5B38G 1E4KA 2JIXD 2ZOLB 3UYOD 1CGXA 4TTDC 2NX5E 5CBEB 1I1FB 1VFAA 2P1YA 4N0RA 4OZIE 2IGFL 4M8VA 3WNLA 4KKAC 1SHMA 2DMBA 3OR6A 4YWGL 1YJDH 4QKXB 2IPUG 2P5EE 3D6GA 2D0GA 3BIBX 1FAIH 5CMAA 4XI5D 3MNWB 5E1AA 2X05A 3MGOB 3X3FL 3EDDA 4AIOA 3QDMA 2J6EA 2NY7L 4G9DA 3C09C 3ULVE 4N1HB 4JM2F 2VO5A 4U6VH 1AGFB 2OTWA 2W9DL 1IC4L 4XMKL 1JNHB 5J6GA 2ESVA 1DSFL 5JO5B 1WWWX 4EUPB 1AGFA 2CDFB 4P2QA 4WHDA 3QQ9C 4ZFOA 3KYMB 3WFBL 3L5HA 5SWZA 3MC0A 4WWKB 1ZS8A 4RAHA 2AABL 4DCQB 4K3JH 1IC4H 4XMKH 4PJFA 4U49A 4F7CA 1FGNL 1LO2H 1ZOXA 3G5VB 1I7TB 3S88H 3C5SB 4JJ5A 5HYIA 1XIWC 4UU9A 4G7YH 2X7LA 1F45A 3ARBA 3TV3H 3QI9C 4YUEH 1LMKA 2YKLH 4EN3C 2RCSL 1U8JA 1NFDF 1IGJA 1NUDA 5EO9A 3DI3B 3KYKL 5LQBL 2XG5A 1CDGA 3CLEL 3T4YB 2PO6C 4KJWC 4JKLA 4YDJA 3HC3H 5L2KE 1X5HA 1A9EA 1D6EB 1WEJH 1CE6A 1WBXB 3O3BA 5F3HB 3SBWA 2XXCB 1CXEA 1VADB 2CRZA 4NQDB 2Q86B 3F8UB 5EOQL 5CFHA 3T4YA 4HD9A 1VFBA 4JFDA 1I4FB 2R23B 4TRPL 5KVFL 2W91A 1S7VA 5F6IC 5J4MA 3KPSD 3MRBA 3W0WA 4L8DA 4XNQA 5MHSE 2R0ZH 3H0TA 2AXGB 1SJXA 3GI8H 4I0PC 2QSCH 4OM0L 3UAJD 2MTPA 1NBYB 3VXNB 4CMMA 1QRNE 5T3XD 5HBBA 4M1CD 1SVCP 2X4NB 4PRIB 3SGKC 4GXUM 2V9TA 4Y16C 1J8KA 3VXTB 3BRGC 4NWUH 2NLJB 3PDOA 3LV3B 4NQEE 3VFWA 2IH3B 3U0TB 1XF2A 1XFPA 3TBVB 5GHWL 4HG4K 1V3LA 3REVA 3UYRH 4YFEA 4H25A 5FA3A 1LP9A 2ED8A 3UJTH 3QULA 5DD6A 4ORGB 2P8PA 1T03H 2VXTL 3WD5L 4DGVL 2AV7A 4OD1L 5ECJE 2A1WH 4OFYA 3GJEA 4DW2H 9CGTA 5CILL 3KS0H 4TTGA 2BNUB 3RBGA 1TTUA 4RGMC 2P49B 1BVLB 4K3EL 4TUKL 5ICZA 3GMNB 3M17B 3U7AA 4JFDD 1TZGH 5E9DA 3V5HB 1EO8H 3GDBA 2VXVL 4V1DB 1T7WA 1M71B 3BOVA 2DYPB 5HVGB 4UDUA 3RX7A 4LCWA 4MDJA 4NWTH 3IU3A 4KK5C 5ESVA 1OAZH 1ZT7B 2P24A 4D2NA 2DQEH 3O4OC 2BVQB 3STLA 1NLBH 1WAAF 3NCBB 1MIML 1UXSA 3BAEH 1JPST 3ARFC 2ZJSL 1A4JA 3LEVH 2D3VA 3ULUD 2E7BA 5HYJE 2ICWA 2XTLA 2HRPH 2VL4A 1D6VH 1MLBB 3SCMB 1AO7D 3DJ9A 5DMIL 1VHPA 5I0DA 3NZHL 1ITBB 3QEUB 4UI2A 3LRSA 1X3DA 1XGRB 1GOFA 5DS8B 1KIRA 4JEGB 4OF6A 4J3XA 2ARJA 4HWZB 1E4XH 1UJ3A 2J8UF 3QISA 4PD4K 2EICA 4KAQH 4APQB 1ZV5A 4NCC2 1CFVH 1HQRB 4U4BA 5C1MB 5CJ5A 3ARQA 5ANMA 1NGZA 1GPOH 2G2RB 4EUPG 5H2BB 2ZCLL 4QT5B 1OT2A 1XIWD 2F53B 1MCPL 4J6RL 3CC5A 5GSVA 1KOAA 3S34L 3GIVA 3K8KA 3S98A 4Q6IA 3LOWA 4DOHE 5CHNB 1S7UB 4Y19B 1SQ2N 4NSKA 1AR2A 4YC2C 4KV5E 4R96B 1HHHA 1QSFD 1V5JA 3JTSA 4LVEA 1VDGA 2CLVA 5IMOA 4X6BA 3NFSH 4HEPG 2AW2A 2P8PB 4P4RB 3IKKA 1GYAA 2C3WA 4GT7A 3ZYJA 1GGBL 5CUSH 2GKIA 1CFSA 3HHRB 3WXVL 4QHLA 4UTAH 5J3HD 3JWDL 4LCYB 2E7LC 5LXGH 2UWEB 3ZYOA 3TIEB 1ZLUH 3KPSB 1U8KA 5DD6B 1RAMA 5JW4M 4NBZB 1N7MH 4TUOA 3HB3D 4LVOC 3DSNA 3I3DA 3LPWA 4NZRL 1QBBA 2NXYD 2Q8AH 1WAAA 1FVDA 3HI1A 1C08B 4BSJA 1XF3B 1T2QL 3AAZA 2E9JA 4AYFA 4X9GA 4L29B 1F3DJ 2JCCA 3NCEB 5BXFB 3VH8A 4ZUTA 1J1OH 1DQDL 4PRID 3ARXA 4UNVA 5JMOC 1BECA 3V6OC 5HDBF 5B38A 1HHIA 4L8DB 2VKWA 3F12A 5IGXL 5DVOA 2DTMH 4MVBC 2DBLL 4OZ4B 2EE2A 1XGTB 1IAKB 4MVBD 3RNKB 1RZFL 4JB9L 3HG1E 4YBLB 3IJSA 4OTXL 2J8OA 3QDJD 4B41A 2WBKA 1K4CA 4K94C 1FN4B 5IFJA 2FJGB 3JUYA 3F7VA 3HG1B 3KHOA 5FCUH 1ZKAA 1ORSA 2W0PA 4XHJC 2JCCE 5CZVH 4MQXD 3WDIA 5HYSG 4ZYKB 4PLKC 5I0ZA 1TVBB 3BKJH 2BJMH 1CL7L 3CVHA 5DI8B 4DQOL 2VQUA 3VU2A 2CLZB 3QUZA 5ENWA 3SE3C 2R8SH 2X10A 2VZOA 5E8NB 4M5YH 1RZ8A 2DQJL 4GRLC 1T20A 5F89B 3OKNB 5TF1H 1QR4A 3MRGB 1QFUL 3C6LD 1QBLL 1CN4A 4HF5L 3B2VH 2X2YA 1UA6H 3N1PC 3NCCB 4G7VL 5FYJE 1T22A 3TF7C 4R0LC 2NW3A 3P0VH 1UXWA 1HH6A 5IK3A 2BNRD 4U1JB 4X5WB 2VN7A 3BZEB 1FNFA 4OV6F 4WFHD 5BZDA 5CEYA 3FB6A 1BBJB 4FTVD 5FGRA 4Q58C 3UTSD 3PWVA 4KUCF 2XA3A 1KBGL 5GRWA 1AKJA 3SE9H 5J13B 4K7PY 4HJ0D 4UQ2B 2DL2A 3G6DH 1A14L 1HEZB 4KKCC 4LKXA 4G5ZL 4JPIA 2X40A 5LBSL 4E41D 4KV5F 4OLEA 3Q6GL 1JZ7A 3ULVD 2EDWA 4NN6C 3SKOB 2FHBA 3TNMA 1RZ7H 4N0CC 4YK4B 3MLPA 2J1KA 1U8IA 2Q76A 1IZJA 1EEYA 1G1CA 1A6ZA 2R4RL 5FGSA 1YMHB 5SX5H 8FABB 3IRPX 3O3UN 5DZOA 4Y89A 3OG6B 4UBDC 1PZUB 4HT1L 3UXFA 1J1OL 1QBMH 3DX9B 5BS0D 3IJSB 4U6XA 5C0EA 3JUZA 3KGRA 4UNUA 3IGAB 5C0BA 3ZTJH 4UINL 5IWLA 1QO3A 1UYWH 3KLAB 3UTZB 5D1QA 1YA5A 4QRQA 4LSQH 4Z95H 4HCRA 5C0FB 5C09E 2GY5A 1LDSA 4JAMB 5F7DB 3A6BL 4ZSOE 4POYA 2L4OA 1IQWH 1NCDL 3IDYB 5B4MD 5EIQA 2MPAL 3IDJA 3FZUD 4KRPB 4HK0A 1ZGLA 2IG2H 2FZ3B 1W72L 1NGPH 5C9JB 5IFAL 4WWKA 4FABL 2B39A 3KJ6L 2CDGA 1QRNB 2AKRA 3K2UH 3CH1B 1X7QA 2JCCB 3QDGB 2VR5A 1AQKH 2UWEA 5EUKA 3B8YA 5HI5C 3BDYL 1KB5B 2HLAA 3MODH 2VXVH 1QACA 3F6LA 1IGIH 1TZIA 5HHME 2BRRH 5DC9B 1CDJA 1G7QA 3FOLA 4JY6A 4O9HH 2ZG3A 4YR6A 2ZCHL 2FEDC 4LEOB 4YFDB 4TUKH 1PY9A 3IAGC 3SO3B 3QWOB 1Q94B 4GKNA 4S1QH 4WY7H 4HPOL 4PY7A 4YZFE 2W0FB 5SWSA 3MJ7B 4YBLC 1C5CH 3UC0H 4F37K 1E6OH 5K9QG 3KPRE 3QUXA 3O2DH 4P2YA 1G7IA 3FMGL 2W07A 4MCYB 3DXAA 1K8IA 4OFIA 3NZHH 3CJJA 1A2YA 1MH5A 1A6TB 1VFAB 3G9VA 5SX4I 2IQ9L 5EUOF 3MREA 2ICEA 3NFPA 3RNQA 2VLJD 4QCIA 2VDRH 1IC5L 4ZOEA 1SMOA 3Q1SL 5IJVA 4HG4J 4QRPB 3IDGA 1P5VA 4MWFB 3GIZH 4LLQA 3LDBC 4IRSB 5GGVY 4PGCB 4ERSH 1U93A 1MFCL 5ACLA 1A6UH 4WWID 4OI9A 2IFFH 5GGVL 4Q9RH 1EO8L 4HMEA 4PGCA 4TNWF 3B4NA 4JZJA 1D5MB 5I1LA 2CGRL 4RGOL 4MXWH 5DJZB 2Z35B 3MLTA 4P2RE 4ETYA 1FZMB 4R0LB 4PUBH 1FFPA 4MDJB 3T08A 4X5XA 5I1KH 2BHUA 4XPHH 1DTUA 3RZCD 3DTXA 4FA8A 5E2JA 2WBJB 5EORL 3FJTA 5IFHH 2I25N 2P5WB 4XPAH 4ZNEE 5ESVB 1XF5A 4PRAB 3V4UL 5ABDE 1EVUA 4GW1B 1J8HD 4RZCB 3TT1H 4RFOH 3RVVD 1QR1B 4OM1L 2RQ8A 3PL6A 4Q0XL 4Z7UE 4LVOB 2VLKD 2DWEA 4IRZH 4JFYB 3WDJA 5TGBA 2ZKHH 4HWNA 4ODTL 1OTSD 4QRPE 2NY4B 4X6CA 4WUUA 3V0WL 2MJWA 5D2NE 5GIRA 2X4TA 5B39B 1MCPH 1T5XB 5EBGA 2AJUH 4WDIB 4HIXH 1GPOL 4FMFA 3DV4B 4LLUA 2LABA 4ALAL 1MI5D 4JFFB 3MRNA 4UV7L 2AXJA 2Q1EA 3HC3L 1ZLWH 3L5IA 4KI5C 3IS1X 3VFSA 1DANT 1RU9L 2UZIH 5EN2A 1MJUH 5E2VH 4M7JL 1TQCB 4CMMB 5FHBH 1I75A 1QQDB 4JKWA 3W9EA 2F5AH 2D7PA 3FFDB 3VFGL 2X4PA 4ZYKA 1GZPA 1E4JA 2R1WB 3UP1A 2DDQL 2W60B 35C8L 3SDYL 4N9OB 2QEJA 4Q9CA 5JORB 4R3SB 1RMFL 2QTEA 3GSNA 1YECH 1G6VK 4L3CA 1G7PB 4K3DH 1WVZA 2YXFA 1JHTB 4UT6H 4HUVB 4CN1A 5E0QA 4JRYB 4JN1H 1T1XA 1IGJB 5D7JC 1D5BB 3PV6A 1P4BL 5BRZA 5IFAH 4QLRA 1CDCA 2H9GA 4UT7L 3RWEA 3GMLA 3RQ3A 5CINH 3PWJB 4OM1H 1OLLA 3GO1L 5C2BL 4CJ1A 4HKJB 1QKZL 5EBMA 2XWTB 1FVCB 4ENED 1DBBL 1RULH 4LSQL 4LPYA 5I9QB 3BZEA 2HA1A 3CFKA 1U58A 1OD7A 2MQCA 3FO0H 5IB2A 3KDMA 5CEZL 1FAKT 4LGRB 3LQZA 3ULSA 2GITB 3FFCD 4HT1H 2X4UA 4DAGL 1AO7B 2O5ZL 1C16A 4PJAF 4I48B 4WTXA 3FN0L 5ISZD 3QDAA 2YC1B 4Q7DA 4F2MB 1A6UL 4Y19E 5IEHB 4PRDB 5DMKB 5ENWB 2Y6SC 4ODHH 5I1AA 1YNTA 1DN0A 5I74C 1DSFH 5EH1A 1ZT1A 5A2LH 4B50A 1IM9D 1D5BA 1IC5H 4N5UA 5EPMB 4CVWA 4M6MH 1JYVA 2P5WA 4FZ8L 1OT1A 5AD0A 1JN6A 2KUTA 4Y5XA 5E2WL 5AYUL 3TBSA 4X5XB 5FKPB 2PN5A 1I1AC 3GSNL 1BFSA 1F13A 3FMGH 3JWDC 4KU1A 3M07A 4ODUA 1NGQH 3BD4A 4JZOB 5JHLH 3PP4L 3G5XA 1CR9L 4Y1AE 1W0WB 2DLFH 3U36A 1YEFL 3GHBH 4HF5H 1YMME 3EKCA 1PJ9A 4NKDB 5ADPH 2CLRA 3VA6A 3QNZB 2NMSA 5KS9E 3TVMD 1TXKA 5K9KB 5JLZA 3RUGF 3RWEB 4IRJD 1R3HA 1XF3A 1RZ7L 2BVTA 4KJQD 5LGKA 1RVFL 3LPFA 3RWFA 1RUPL 3KPQB 4Y2DB 5HDLA 5IQ9B 5EU4A 4ERSL 4L8CB 4OLXL 1F11B 3C60A 4RGNE 1PG7L 2FEDD 4JY5H 3CDCA 1AJ7L 5GIRB 3D1MC 2Z8VC 2IPKA 2IC2A 5HGGS 5HPOA 2EYTB 3EYFB 3J7HA 3QH3A 5F7HA 3B5HA 4K94L 1C1EL 3G08A 4NN5B 1F42A 4XRCB 4HC1A 3V0VA 4NYLA 3PJSA 2QQKH 1W0YT 4FOMA 4KI1A 4H26B 2GFBA 2X1WL 4PD4J 5FV1L 4GG8B 5T1LA 1LO0H 3P0VL 3F6IA 5EBWA 3S3JA 1XGYL 3CCHA 3DARA 5D71H 4RISL 4E5XA 1JMXA 4UIKH 2J88L 3F65A 1ERNA 2IEPA 3IFLL 2UZXB 1EHLH 1LQSR 5E00B 3UBXG 2AERT 1EXUA 1H3PL 1YEKL 4Z6AT 4LAQH 2BRRL 5HGHA 2EE3A 5IBLD 1KB9K 2ITDB 4NQCE 3BP4A 3BQUB 1T66D 1URLA 2HJLB 3PHOA 1JGDB 1MREL 2V7NA 4QRPD 4C58B 2HP4A 5CIPA 1Z0MA 3U9PL 4LNRB 3GB7B 1NAMA 3FRUA 3Q1SH 5TQ2L 5CUSL 3RKDC 4OZGF 1I8LA 1T2JA 4YNYB 1AGCA 5GRVL 2BERA 5I8CA 5LVEA 3MV01 1A22B 1JHKH 2JK5B 1ADQH 3WLWD 2Y4SA 3STLB 2VLLA 5IHZB 4N68A 1QBAA 3FQTA 5KZCD 3TBYB 1TTGA 4HSQA 1T1ZA 1EIBA 2BC4B 2EE6A 4JFPA 3O9WA 4EI5C 1SEQL 1U3ZA 3VW3L 1VFOA 4EJ1C 2UZYB 1FORH 1WTLA 1BF8A 2F8OA 3B2VL 2GT9B 3OAZH 3HI6L 4PJDF 3CZJA 3GMMB 4MD4B 1IGMH 5I8OL 3DXAB 4KMTH 4QXGL 3UTSA 2BVOB 1FL6B 4NPYB 3B2UC 2HFFA 2IAMC 1XGPA 1OTUC 1WF5A 1REIA 1R3KA 3E3QC 3JWNC 1IBGL 4PV9A 1FFRA 1J05B 4JN2A 5HHOD 2ID5A 4F2MA 5L7XH 1T2XA 4G6ML 2PTUA 1CFNA 1E28A 5I18L 4JVPA 5EA0H 3JV4A 5ICZB 1MCIA 4PJ7E 4PYGA 1G7QB 1W72B 1IE5A 1XF1A 2ESVB 4FZ8H 2VWEE 2IANE 1AGEA 5C0BD 1DBAL 2R4SL 4RAUA 2XQBL 2JF1A 4Q2ZA 1A6AB 3WSQH 2JJSA 1OAYH 3FB7B 4Y5XB 5KANI 4WJ5B 3VXTA 1HNGA 2E27H 1XEDA 1ZGLP 2VSDA 3K2MC 1MHCA 3HZVA 1CVRA 4BFBD 2NY4C 4OCWL 3MV8D 4XP5L 3UYPA 3RY4A 1TDQA 3TO4C 2MQ3A 2IANA 4K7PX 3C8HA 1ZHBB 4NP4H 5F1IA 4CU7A 5C3TA 4JDZA 4QGTA 1E4XL 3MLVL 5F72S 1L0XA 3BH9B 3C2SA 2W59A 2VXQL 4HZAA 5C0DA 3VI4E 1PVHA 3O6KH 2Z31C 3EFDH 1VADA 4OZHB 2PYFA 3WXVH 2ZNWA 5B21A 3AMLA 4X6CF 5M94B 1I9IH 2IADB 4HCRL 3B9DA 3E3QE 5KOMC 3WFEL 1VPOL 4DKFH 4ZO6A 2F19L 3D3VE 1HINL 1KJ3L 4NQXB 5C9KA 5CJOH 4OV5A 1KJMB 3KJ4C 3QEGL 2AJXL 3PWJA 5FHAL 3TN0C 3N1FC 5AEAA 3MOAH 1DVFA 3CMOH 4DK3A 1YEEL 3SGJA 5IP4A 4HHAB 4ZXBB 1X9QA 4QEGA 1BQSA 2EDKA 4YAQB 4NHCH 1KULA 4ZUVA 3TJHD 3AS1A 5L6YH 1SBBA 4FQ2L 4JO4L 4HMDA 2GAZB 2H2PC 5LG1A 4D9LH 4AJ0A 2UZIL 3V6BR 8FABA 5JIPA 1UZ6E 1ZTXL 2XKSA 5HGBA 4J4PA 3LKNB 2B4CH 1WZMA 1QKZH 1KLGA 1NUGA 3QIWC 3O9WC 2HRPL 4Z7UB 3WS6A 1WZ1H 3FONA 1DEEA 3C09B 5HHOE 2X89A 1F8TL 5C0CB 1XH3B 4C56E 2NR6D 3GIVB 1BD2D 2IBBA 5C08E 3F58L 1OPGH 3ULUL 5KSVA 3HMWL 2EZ0D 3H9ZA 4F80A 2X4RB 4OF5A 1AHWB 1UB6B 4I0CC 4QYOB 3DETC 2FJGA 2Z93B 1X6NA 3RDTA 2BC4A 3FN0H 1A3RL 3ET9F 3T2OA 2J8UE 3BEVA 1EZVY 3ILPB 5CD5D 4J4PD 3VG9C 3CFKB 1U36A 1YN7A 3V6OE 5F93C 2XTJD 1FQ9C 5CZKA 4HGWB 1T6WA 2EKJA 4WO4A 5C08A 1EH9A 5EU5B 1B0RB 1FBIL 5TH2B 1T20B 1WGOA 3CLFL 1J05A 4JN2B 1LE5B 4L29A 1I1AB 1KXQE 1RIVL 4G7YL 3CNKA 5INCB 1C5DA 1A6VH 3LEVL 5I15H 2YRLA 3ULUE 1JNJA 3T0EA 3V5DB 4Z7VA 3AFLA 4EOWH 5CEXB 3GMPB 4FG6D 1I8IA 1S7XA 1CD8A 4ODHL 3HTLX 3TA3D 1G7IB 1I9JH 3QUXB 5DYOB 4BQ8A 3HG1D 4Y4KC 2J2ZA 1QRND 2NZIA 2W0FA 3MLWH 1ETZA 3L3OA 3GNMH 3LN5A 1ZHNA 2HLFD 1NUNB 2X41A 3U9UA 1X5YA 4PGZA 3O3DB 3OZ9H 1S7UA 4NGHH 4U1IB 4JRXE 4OLZL 3HB3C 4IRSA 2NY3B 4MWFA 2QKIA 1CIUA 1DL7L 3REVB 3F62A 3UDWA 4WV1A 2OK0L 4YWGH 4FFYH 2FO4A 3JZ7A 1FVDB 5DK0B 4YHPA 3IYLW 5D7JD 1Z5LB 4JCLA 4WRLA 5F9WC 5DR5H 1FG2B 4RGND 5FDWA 2PW1B 3KPSA 1R3HB 1CXFA 5DF0A 1H0DA 3SDCB 3Q3GA 5FUCE 1N5AB 1X5LA 4TVSa 3C5ZB 4PTTA 4K7FB 5E6ID 4L4VE 4JO2H 4WHYG 4BQ9A 3LY6A 4K3HA 5HDQL 1OGTB 1KIPA 2RBLA 4WNQB 3BE1H 3QEGH 3LMJL 2XRAH 3QI9D 1DVFC 4FMKA 3BKML 3QUXC 4MJ6B 5F9WB 3V0WH 3W11D 4S0SD 5DYOA 5AWNL 4GRWB 3WXWH 3LSOB 4ODXB 1DBMH 1H15A 4JZOA 3TH4T 3X12B 1WC7B 1I1RA 5IBTH 2GK0A 5IJKC 2R4SH 1JK8A 5HGDB 2X6MA 2OR9H 5GGQH 4X80H 4LOUC 4XX1G 5L0QC 2OSLB 4R8WH 4PBVC 1V7NH 4ELMF 2VL5A 5F7KC 1CIDA 5CILH 4XXDB 4PBWD 4I8DA 5JA9A 5FOBB 4OZIB 2EIBA 5KW9L 3H7LA 1NMAL 4Y8AA 4YE4H 5F7YC 4KKLD 1TNMA 4FQXA 2WBJD 4FQ2H 1QFHA 1EEQA 3TEUA 3QPQC 1FJ1A 4F7EB 1RURH 3ARPA 3AXLA 1RV6X 4D8PA 3ILQC 3FQUA 4XNXH 1OP5H 3BMVA 4PG2A 4PJDE 1I8MA 5BZDB 4X99B 4XAWH 3B8SA 2R1YB 2GY7B 2VDNH 1MVUA 3LKPA 2KKQA 4LASL 5E8PA 2QQNL 1MCCA 3DX9A 4KJPC 4NZJA 4MX7A 3K2UL 5FKPA 4JDVA 3CFJB 3QNXB 2NLJA 4YEEA 4NNYA 3BUYB 4XAKD 2KDGA 1M05A 5MEND 3G6JF 4KTDL 3LEYH 5FYKH 5EOCL 3IU4L 4NO2A 2A6KB 3U2SA 1CCZA 5HHXL 5E8NA 2I24N 3L5JA 5D96C 3X3FH 5ILTH 1SJEA 3M17A 3D39D 3S3PA 3CLFH 5DI8A 1ZTXH 3V8OA 1BFVH 1Y6KR 1AKJB 4P9HL 4Z7WB 4ELMB 1JHTA 3MBXH 1PKQA 1CGUA 2YHGA 3ARTA 4L3AA 1BPVA 1D5ZA 4KQ4L 5TF1L 1AD9B 3IXTA 2FR4B 5ALCL 4UIKL 1BZ9B 1S9WB 2IPTL 2BNQA 4NKIL 4OI7A 5EO1A 1HH9A 2NY2B 2AJYL 2DKSA 2KPNA 1RJZB 3QHFL 3G5ZB 4LF3B 3DWTA 3F12B 3VRLF 4HHAA 1KCVH 3E2HB 4F7CB 4NZUH 1JF6A 4GW5B 4HIEA 1VPOH 4JM4H 2CJUH 2X09A 3WLBA 4X6FA 2EDDA 1KJMA 3MRLB 3QXAB 4EVNA 2L7UA 1A7QH 4X4MA 5HI5D 4PLKD 3PGFL 1BJ8A 5JTWA 1UZ8A 3GSRA 2DM7A 4GW5A 4JO3L 4Z76B 3BHBA 1J11A 4HUXA 2A6IA 1PG7H 1UB5B 3MROA 4HZLA 1KN2H 5C0AD 3U83A 1HSBB 1IGCH 5DJDB 5TE6L 3SPVB 1RUKH 3X3GL 4W6XB 3B6SA 1YJDL 3W5MA 3TBSB 7FABL 1H3PH 1YMHA 2A73B 1N6VA 4KQ4H 4OCXL 4PJ5B 5I16A 4L1DA 4MQ7B 1K2DA 3U4AA 3DV6B 2VH5L 3FO9A 4P57B 1MCJA 3QG7L 5DHVH 4TNWK 1JJUA 5F1SA 3EOTH 1M7IB 5FGBA 4Y5VA 3SCMC 3VJ6A 5DURB 5C0AE 5JA8B 3IFPB 5DJXA 3GGWA 4U6HA 2FEEL 1G6RB 2XPGA 2P5WD 4HW6A 4TVPL 5EU3B 1IJ9A 3GBMH 2B1HL 2WBJA 3DYOA 4I2XA 5DSCA 5KVDL 2AJSL 3ULVF 2I9TA 4J23A 4WTWA 4MNHA 3ZTJG 1LO3L 3BYYA 2X4OB 4APQD 3INUL 4HJJL 3TIEA 3JV4B 4OZFA 1NDMB 4C4KO 4H20H 4X6CB 4NN6B 4MZ2A 2MQ0A 4POZC 5A16B 3DX6A 1R3LA 4NCC1 4GAJL 1YEJH 3CXDL 1J86A 3O11B 5DRXA 4L3EB 1HZHH 4L5FL 1A21A 3BPNB 4PG9A 3QNYB 5KVGL 3TCXA 4BH8A 4QRUA 4NSKB 2EIDA 4I2XE 4J12A 4ZNEA 4X4YB 5DEGA 4Z7UF 1F6AB 5E6ZA 3SDXB 1N3NB 5DJ0B 4V2BA 3FO0L 4RZCA 1UM4H 1R5VA 5D8JH 5I2IB 1TJHH 1VSCA 4JFFD 5FUOH 2VLLB 2G60H 2FSEB 1MFNA 2Y7QB 4Y5XC 2MCPH 1K4CB 1FHGA 1T1ZB 5E8EB 4P5TD 5IV2A 5JPNA 2Z8WC 4M03A 4Z0XB 3DBXB 4ZD3H 1E4XI 1JV5A 4PGDA 1P84K 2QBWA 4WVRA 1UWXH 5F21B 5C0IA 1NAMB 1Z9LA 2P7TA 1QQDA 5F3BA 4LPVA 4G9FA 4NO3B 1ZHBA 5CJXC 4BJLA 3TO4B 3BEVB 2V6HA 3BUTA 3HA0A 1VESA 3AU1A 3DO7A 2D9CA 3IVKB 2IPTH 3DVGB 1RHHA 3I50H 5CIPB 4ZFZA 4X9FA 4K9EC 1OF2A 2ZG1A 3EHBC 4S10A 4OCXH 1CLYH 4G6FB 4P4KD 4P2OC 1MJUL 2AEPL 2XKUA 4FNLL 1NCNA 1CYGA 5D7KD 4WU7A 2XKNB 1R3JB 1MH5B 2XQYG 5J12C 4MQTB 2AK1L 3NACH 4RA0C 3L3DA 4P48A 5T1LB 5KANG 4EI6B 3DUUA 5I1GH 4V1DD 4PGBB 4RMVA 1Y0LB 2VE6B 2DQHH 4QGYA 1YYMH 4QHMB 4I13B 4MCZA 4OZFH 2DTSA 1Q0XH 4YHLL 4NRXB 4JPVH 5AYQA 5F1OB 2AV7B 2VIRA 5DD5L 1S9YB 4ORGA 2HFFB 3HC4L 4JJHA 2YD3A 3B9AA 3C60B 3WIIL 1T3FB 3BPOB 2DBJA 4IJ3C 4Q97A 5JDJA 2VDPL 2C3HA 4DUWA 3QFJD 3GM0A 3F58H 3CFDB 3QDGA 4WW2F 4ZFZB 4NM8L 5GS0L 5ISZE 3MJ8A 2NNAA 2NX5B 5DRXB 4PJ8A 1PBYA 4MYWB 4KVNH 1YNKL 1LWRA 3LRGA 2YXMA 1QZ1A 5I1LB 2Z91B 4M48L 2NY0C 2GTWB 3ULVH 5JHDB 1RUAL 4XNYH 1BFVL 4FXGA 1BBDH 5F7DA 4M6OL 1YY9C 3WMSA 3DVIA 1A4JB 4M1GL 4JO4H 1K8DA 1QEWB 3VWKA 4PUBL 4YO0B 1EAPA 1XGUB 4KFZC 4X7TB 1S7TB 4ZUUA 3UYRL 3VFMB 3DVNB 4LHUG 3U7WH 2WMPA 4Z7OE 4NQED 1LHZA 3MREB 1R6VA 1EEYB 4OQTL 3I9GL 5GS3A 4D0CA 2PXYB 4UT6L 3JWOC 1IRAY 4Z7WF 1ZE3C 3HKFA 1KPUA 5HY9A 4BSVB 1MNUL 2A6KA 12E8L 2EXWC 3BKYL 3U2SB 2VKXA 1J0ZA 3WO4B 5MHSD 5FM8A 3BWAB 3DIFB 4HBQA 3MJ7A 4JRXB 5J9PA 1HDMA 2QQLH 4OZIF 5EU6D 1ZK9A 1BIHA 5DEFA 3OX8A 1NC2B 5B4MC 1FV1B 5IEHA 4DJMA 2DQUH 3L5WA 3T4AA 5JW5B 1PKOA 4XMLL 1N59B 3G6JE 1FL5A 5EO0A 1IM3A 3WHE1 1MAJA 1LEGA 4HLJA 1TZHA 1WJ3A 3LB6C 4ZTPL 1JF1A 4FQXD 1JNHA 3TPUA 4I77L 2Y07L 1ZSDB 3MFFA 2A77L 2B4CC 4WFFE 4OLZH 1KUMA 5I75C 5JHDA 3CH1A 1K3ZA 3DMMC 1LEIB 3GJFH 3RUGB 1J0IA 3RWIB 3RX5A 3RWFB 3B9EA 2E7LA 3O4LD 4UUJB 2W1NA 5E8OB 1NC4B 5FUZH 4BKLA 4G8IB 2ITCA 1OP3H 4W70A 1IAMA 3AB0C 5ACMA 2FJHA 5GJSH 3FN9A 3SDYH 4XWGH 1KN4L 2VAAB 3BN9D 3WUWB 1LD9A 4U6XB 1FPTH 2IBGA 3EJZD 2GQHA 2JK5A 1TQCC 3ARWA 4Z7WA 3VRJA 1H9VA 1JPGA 4HUMB 4PRHE 4Q74A 5E2VL 1B0GB 1CLOL 3EHBD 3MUY1 3PQYD 4F57H 4U1GB 1J8HE 1FYTA 3PGCA 1Q0YL 4M3KB 4OB5H 4OJFH 1WWAX 4IS6B 1FO0H 3CLEH 4AL8L 3HAEA 2CLVB 4WO4C 4LSDA 5IMOB 5F9OL 3QXAA 4EVNB 3HZVB 4HUKB 4V2CB 2IH1A 1CI5A 2WV3A 1RPQA 4R4FH 4EIGB 1BF2A 1LNUA 1RY7B 3MUZ1 3ES6B 3MA7B 4XP5H 3RWIA 3I6LD 2ITDA 1QSZA 4EI5B 1MHHB 2J4WH 1FNAA 1UWEL 3B43A 5HGHB 5F96H 2D7TH 1INDL 2VDPH 3RL2B 2F54A 4G8EA 1G0YR 1KEMH 2F53D 3WDHA 4Z77A 5CKAA 3OPZL 4TUOB 4P9MH 4NC2B 1I85A 4ELKB 4H8WH 4KRMB 2J5LB 4RAUB 5GGSA 3TC9A 4KY1H 2QLVB 3GBNH 4R2GC 1FV1A 1P4LA 5FYKD 1AFVH 2BFVL 5D1XC 1NJ9B 1BZ7A 3QR2A 2ZNXA 4LVNB 4HFUH 1CXLA 4O2EB 5SX4H 2N56A 1CTNA 2H2SC 3P0YL 1WQVT 4MXQC 4M6OH 1J1XL 2PR4L 5DD1H 1B0WA 3LQMA 3VRIB 5J56B 2HFGL 5K9OA 4X6DB 3O2DL 5GGTH 2IBZY 5KSUA 2N1KA 2MWCA 1M05B 2OZ4H 3BDBA 4PJIB 4XWOC 3UTSE 2BVOA 1UWXK 5INDA 3PQYE 1EAJA 4CUCA 1NMBH 4K3GA 2FB4H 1IEAA 1EJ6A 1VGEL 4YXLH 4EDXA 5GGRA 3RWHA 4BZ1L 3H7BA 4R3SA 4XP9L 3Q6FA 3EYSL 4RNRA 3NIDF 5CSGA 4R90L 2EEBA 5SV4A 1F58H 2DS4A 4ZS7H 4S2SA 3V95A 5DQ9B 1U8NB 1J87A 1RZIB 2RR3A 4QF1B 4LMQE 4JZJB 2YD2A 3G6DL 1WTGT 4IDJH 3VXUD 4XPBH 1AGCB 2ZSWA 4JREC 1CVSC 4MSWA 4Y16A 1ONQA 1A1OB 3TO4D 1PEZA 1KCRL 3QZWB 2D0FA 1BD2A 2BSED 5D4QA 3RZCC 1G6RH 1OARL 5JW4N 5HYJB 2JLLA 1YEGH 3LH2H 4CADB 4DVRH 4JKPL 1B4JL 2X4RA 1VFMA 4P49A 5IVZB 3OKLB 4AIZA 4UAOC 5L7XL 1XF2B 4DUVA 5L8LB 5DHVB 4P2RA 5JOFB 4FFWC 4UDUB 4WHTB 2VSCA 4U2YA 1H8NA 3MRFB 4FQHA 4YDVA 2FL5B 1WUNT 3D25A 4LSUH 1EXUB 3S6CA 3I84A 2HH0H 3VD5A 3X12A 2NYYD 5K9OB 1CF8H 2R0WH 3QJHB 1PLGH 4MNQE 4KHTL 1VERA 4Y2OA 5D7JB 1YN6B 1FFOA 3CZFB 4HJGB 4QHKJ 1KCUL 1P7KA 3MNZB 1TQBB 2BNUA 1N2RA 2DYPD 4ZAKA 5T3XH 2BVPB 1I3RB 4A6YB 2HMID 2HLAB 2LVEA 3O8XB 2D7OA 1YPZA 3FOLB 3OKKA 1ADQL 5KBNC 4JO3H 2H26B 1KYOK 3LEYL 2E8ZA 4ZD3L 5A3ID 3LRHA 1DQJA 2NR6C 3MRCB 5SWSD 5AZEL 3L3IA 3MRRB 1TCMA 3JSSA 2QADC 5T5NF 4GUPB 4UTBL 3DVGA 1EBAA 3MR9A 3VG0L 4RDQG 3VD7A 1BD2B 1T7ZA 2CKBH 3PABA 4A2MA 1G7MA 1ZA3A 4NQCD 2HVJA 1PX3A 3KPNB 3T0EE 4WU5A 3S34H 1LGVA 3TCLA 1RSFA 4XNZC 1MFBL 3KR3L 1LO4L 5IESH 4GFTB 2YEZB 3ILPA 4PJBB 2D7QA 4NKDA 4WWKD 2X1XR 4O5LH 4GG6E 1CICC 5HYFA 5GGRB 1NMCB 3ARBC 3PG2A 1EGJA 4M5YL 3MRIB 1SEQH 5DFTA 4Z78A 3IXAB 3IDYC 1LO0L 1RD6A 1RUKL 2R2HA 4LLDB 1GHFL 4MB3A 4G42B 1NCUA 3MGOA 4HFUL 1J0HA 3WE6A 3PUCA 3WNOA 4HX1B 5DEFB 3WSQL 3GO1H 3N1QC 4FQIL 5HVWA 4WI7A 1YUHA 5D1XB 5DA0B 1LO3H 5DEGB 3SDXA 3PGFH 5BW7C 3KWWA 4H5SA 1BJMA 4OD2B 5IB5B 1KPUB 1MFEL 3NIDE 4PJEF 3S35L 3MRNB 3D2UB 32C2A 4ZUWA 3RZWA 4NWTL 1FYTD 4WUUE 4NNYB 5EA0L 4MAYC 5CSZB 3QPQD 2Q6WA 4ODWA 5SWZB 1I8KA 4U1JA 4JDTH 2AAVA 1F6LL 3NAAH 2QHRL 4L8SA 2K1MA 4DKDC 1CQYA 4EZMA 4OIIH 3VGFA 4ZUUB 3VFMA 1E6JL 1JWMB 1ED3A 1AY1L 4GXUN 1NBZA 4NQUA 4U3HA 5A2IH 5EULV 3T04D 4DAGH 3IFLH 5IM7B 1MFAH 4Z76A 4PJIF 2YR3A 5I1HL 3V4VH 5C07E 2BCKB 4HDIB 3C8KB 3KXFE 1RJLA 3QCUH 3F5WA 3D5OF 4NNXB 4U7KA 1CLOH 4PJ8B 1WFUA 3SJVB 5JW4Q 2BNRA 5JXEA 2I9LB 4Z7VE 2HTLD 3B5GA 5GSRA 4FQ1L 3DGGB 4G80B 4XCCL 5BVPH 5I16B 4XWGL 2HN7A 3V52H 3ZE1F 4HWBH 2WUBH 2ZZUT 3SDCD 1AJ7H 3O6MH 2W38A 4XP4H 5FF6A 4HUNB 1FLRH 3MRKB 2G75B 2B2XH 2EECA 5IHZA 4RRPG 2EKSA 1S7TA 5FA4B 1MRDL 1XGTA 4P2OB 5KTEL 2E8YA 1MPAL 1UB5A 5IEKA 3P4NB 4U6YA 5IQ7H 2PW2A 5E95B 1NPUA 4PFEA 2YEZA 5E9DE 5FYJH 1A1MA 3MRQB 1MHCB 4BYHA 3M8OH 2AXHA 3CVHH 4LKXB 4UQ2A 3F7YA 4F7MA 1P53A 2YUXA 2OYPA 3WJLC 1BAFL 3T77A 4ETQA 4IOIB 1NGWA 1BWMA 4WFEE 2YKLL 4GBXC 4EDWH 3LD8C 5E94B 4M48H 3SHSA 3VXUE 2VWEC 4Q2ZB 4XPHL 3FT3A 3SGJC 2H1PH 3O3AA 5FM4A 1EEZB 3OZ9L 3QIWB 5FYKL 4X6DF 1I8MB 4NQSA 2IMMA 3FQUB 4KJPD 5DVKA 5JHDD 4JN1L 3SE4C 2BK8A 1MCFA 3OB0K 4RA3A 3D18B 1CICD 1MLCB 2IALA 4OTXH 2EIZB 2DIAA 5ERWB 4S1RL 3RGVD 4MAUH 1XCTB 1OOAA 4JHAH 4NUJB 1A4KA 1MAML 4D0DB 1JGVH 4R97B 1UFUA 3CC5B 1JWUB 3GSQB 1F8TH 3QDGE 4PJEE 1SYSA 5EUKB 3AY4A 1CL7I 1L7IH 3OKEA 4LK4A 5GZND 2LU4A 3MJGX 2EH8H 2E5EA 4JDVB 4TOYL 1PSKH 4P5KA 3HRZA 4TSAL 1U3HA 3WNNA 4HLZH 4LHQB 5DS8A 3O2VL 4P46B 3GMOB 3KLHD 4BH8B 3U6RA 1MRCL 5A3IC 3L9RB 1HOCA 3AVEA 4YUEL 2JIXA 4MHHI 3N06B 2ZUVA 4XNUH 3H9SD 1A7OL 1JFQH 5C2BH 1MHPL 1XIWA 2HTLC 1AQDA 4QF1A 4TSCH 4ODUB 3C08H 3QUXD 4ACPA 1TNNA 1NKRA 2AP2A 4IJ3B 5E2TL 1GGYA 1UH4A 1NBVH 1D9KC 1N8ZA 2ZUQB 4Y1AD 4BUGA 5IJVB 3DROB 1RMFH 2Z92B 2ZUSA 1Z9SA 1ND0A 3MV9A 1CXIA 1AR1C 3CSGA 1X4XA 1T3FA 1JK8B 4Y2DC 5HGDA 3T0EC 1A4KB 2DQHL 3OKEB 3KPPB 3QCTH 5F8RC 3UJJH 3RTQB 2UUDK 5DEZA 2J6EH 3QXWA 3MUJA 3P77A 3GJFB 3FONB 4RIRB 4ZXBD 2C3XA 2WQ8A 5D7SL 5T3ZL 1S7SA 4Y4KA 3MBEC 4D3CL 4P3WA 3OKDA 4PLJC 3TN0D 1XGQA 3KLSA 5GGSB 1EEZA 4YBQD 2HFEB 4L5FH 3VXMA 1XR8A 4M93C 4JY6B 2HJLA 3BAEL 3CU1A 1NFDE 1U6AL 2O5XH 3BSZL 3RBSA 3O4LE 1OWWA 4HXAH 1F4WH 2E27L 1AXTL 5EB9A 3L6FB 3VFOA 4Y5VC 3OKMB 3QEQB 3WFBH 4QOKE 4B7LA 1NBVL 1ZXQA 1SBSH 3T2PA 5C0CD 3LV3A 1BGXL 3HE6A 1C5BH 1MF2L 3QQ3A 1QSED 2WWMD 3C60C 3F7YB 5BV7L 4X8JA 4J8RB 2IG2L 3MFGB 4N0CD 1G7HA 5ACZA 43C9A 3QSKB 1ZHNB 3U1SH 3FQNA 1U8NA 1CLZL 4KC3B 3B3IB 2XZQH 2R69H 3LEXA 3E6FA 5EC2A 1S7VB 5C6PB 2QADB 5DJ2B 2H32B 5JORA 5MEOB 2RCSH 1G9MH 1A6ZB 4OLYL 3BP5B 1D6EA 2VR4A 5DRZA 1QLRB 1PKQB 1OM3L 1QLFA 3EYVB 1KELH 1A7PL 4OZ4A 4OF8A 2E6PA 4OCMC 2CK0L 4G8GB 3P9MA 4FFVC 5DJ0A 4U0QB 1QFWL 1OP5K 3THMH 2Y5EA 1T1WB 4DKEH 1KJVA 4G6AC 5A2FA 1VGKB 4JGUA 1F4XH 3SE8H 43CAA 4EUPH 4Y4HC 4M1DL 4YDKL 3ULUH 3MRMB 4XZUB 3FTGA 5TPWL 4J2XA 1NBZB 5E4EB 4WI5A 4OZFB 1D7FA 5IVXE 3P9LA 3VXRD 3WIHA 1QOKA 2A9NL 1MI5E 5CEYB 1JNLL 5DVMA 5FA3B 2J8UB 1XGQB 4H25B 4ZSOA 4LSVH 2VDOH 3L3HA 4DWHA 3NIFF 3QO0A 5H8DA 4YPGB 3MYJA 4JG1L 5ICXA 5FO7A 4JFHE 1CFNB 1E28B 1S7SB 4HKJA 3WEXA 1NCAH 3DPBA 4RIRA 2AGJH 5E70A 4RWYH 3GSXB 4KMTL 5BJTB 4DN4H 1MIEL 2F53E 2EC9T 3S37X 3BZFA 2Q87A 4LSUL 3QIBA 5IQ7L 2OP4H 2NY2D 1T89A 4O2CB 4CRPA 5D7LD 4OIIL 3QPXL 3MV9B 4CMHB 4G8GA 3EGSB 3BKCH 1U8HB 3P11L 2O5YL 1K8DB 3FRPG 4JFPB 3KNBB 3HC4H 5CD5C 1FZKB 1XGRA 3V6FA 5DVLA 4OFVA 4LPUA 4Z7VF 1HSBA 2V2WA 3TP4A 2ICWI 1YYML 4NZTH 3T3MF 3UDWC 3MBEB 3BQUD 3RPIA 4CDGC 3O6KL 4N0FB 3ZE1E 5I18H 1F58L 2DQGL 1G7HB 5ACZB 1AC6A 4JLRA 1P5UA 2HTKD 3QA3A 3MRRA 1RZKL 3QFDA 5A1AA 1Q9KA 2XQYK 4C4KT 1M4KA 4ZPVB 3HI6H 4OUUB 3DUHA 3RUGE 3AAZB 3CFDA 1PD6A 1XR8B 7FABH 3ZE0E 1LO4H 5IESL 1JI2A 4EUPA 3MRCA 5FYLE 1XGYH 2DOCA 2EDLA 4IOFD 4JG1H 2BOCB 3UZQA 2W9EH 1EFXA 3MV7A 4LSVL 1IM9B 4NRYB 5EZLA 1L6XA 4MJIB 1YYLL 3DUUB 3ECBB 4R8WL 5E6IC 3U9UB 3ZE2F 1HHHB 1IL1B 4H26A 3D18A 5MENE 3HPLA 1QYGH 5HDBE 1IM9A 4NRYA 5EZLB 2OBGA 5T33L 3SGEH 3OR6B 2R2CA 3RU8H 3MOBL 5C0GA 3R0NA 4CN4A 5D1ZD 2V2TB 2A38A 2H8PB 3BVNB 4G8GD 1QVOB 4LP5A 5E94A 3E6HA 3Q5TA 3D39A 4NJ9H 4HFWA 4CADA 4ZFFB 4WEUD 4QT5A 2YZ8A 2JCCF 1FFQA 3QIBD 3QG7H 1UJ3B 1U8MA 1TZGL 1B2WL 5C07B 3T1FB 2BMKB 2HKFH 3ARDA 4PRPE 3O4OB 5MENA 1MIEH 5ADPL 1S5IL 3G5YA 2FH6A 4FQJL 3CXDH 4I5BA 5C09B 5JHLL 4Y1AB 1WFTA 1NMAH 3ZTNL 2VLKE 5LKNA 2GTWA 1KNOB 4IHOB 4OKVB 3G5YB 2F74B 1CBVH 2XTJE 4R4BA 4I3RL 1QHPA 5I1EH 4K8RD 4OZGE 4AM0A 2BVQA 4F33B 5LJYH 1GRWA 2GSIB 5FECA 3AMKA 5C2UB 1J1PL 4KDWA 3IFOB 1RUML 3ARZA 1U8HA 3FCTA 1CGYA 4P46A 5F7WC 2C7UA 3FQWA 3MCG1 5GISL 3DURB 4WI8A 3CDFA 1MJJA 1B4RA 2UYLA 4O02L 5DRWA 1DN0B 5ID1A 5HTSA 1LE5A 4PLOB 1I7UA 3DX7B 5I66A 3B9KB 5MEQB 4XNXL 2E3VA 5C86A 1GGIH 3G6JA 3WEXB 4L3EA 3MLZH 3PNWB 1CQKA 5ICYA 2F54E 1JZ5A 3LPGA 1S9VB 3KS0J 1K5NA 2F5AL 3PWLA 2WLZA 4R7NA 3ZKMC 3PF2A 1BLNB 4I3SH 4U1MA 3VFPA 1T2QH 5BW7A 4GMSH 2OZ4L 1X5ZA 2VLJE 5D5ME 2KQMA 3KDMB 4OT1L 4F57L 4XBPA 15C8L 2H2SD 2XPGB 4O00A 2R1XB 3K80A 3GGWB 4FQQA 1T83A 2VLMD 1T7XA 2FX8H 2YA2A 5CP3A 1HNFA 4N0YL 3D0VA 2PXYC 4JQXC 2QKIB 3ARGB 4JQIL 4WUKH 4NN7C 5AG8A 4PJCA 4ZO9A 4ZDHA 2B1AL 3VA2C 1AP2A 5ITFA 3JV5A 3OJDB 3V4PH 3ZE2E 1VFBB 3CPLA 3BPOC 2R2HB 1NAMH 3DV6A 3VFTA 3VXPA 3BQUC 1JNNL 1MY5A 2CMRH 4XNQB 5DMGD 4WENB 1UCTA 2BSRA 1S7QA 1U95A 2BOCA 2HKHL 1VGEH 3SKJH 3H9SE 2MHAA 2YPLD 1JN6B 1T1YA 2HN7B 1SYVB 1ADQA 4FS0A 3LZFH 4HS8H 5DTFB 3TN0A 2GTZA 3VWJD 4R26L 5D2LF 2VABB 4P2QD 1SJHA 4D3CH 3QQNA 3VWJA 2NY0B 2AEWA 1G7LA 1N7ML 1CFQB 3K46A 5LWYL 1PYWA 3P0YH 2C3VA 1PSKL 4PJ9A 1EUUA 1QSFE 5F1KC 1YNKH 4MDIA 3ARFA 1ZLUK 3EDJA 3CXHJ 3CX5K 1LEIA 1MCWW 3D0VB 3BGAA 3CFCL 3PWVB 2X70B 5F7MC 5J13C 2IJ0C 4KRNA 4M9OA 1MHEA 4K3JL 1WBZA 2EYRB 4D9RD 5JXAL 4JHAL 3TVMB 4YDKH 4WWKC 1MRDH 1T0MB 3KYNA 1YPZB 5IM7A 4JANA 3I9GH 4ELMA 3VCLA 1SMAA 2P43B 3VFPB 1F97A 3QDMB 3SKUD 3DI2B 4JO1H 4JQIH 3BPLB 4POUB 5F7FA 3QAZB 1NSNL 5ICYB 4XGZA 3PWUA 4KK6D 4H5SB 2CUMA 4YIQA 3X13A 4M1GH 3WCYA 3ZHLA 4KJQC 4XNMB 2R0LL 4JZNB 5J12B 1HYRC 3D0LB 1N64H 5BJTA 4AT6B 4GKSA 4Y4FB 4P4KA 3ELAT 4WHTA 3IAPA 1FO0L 3IJYA 4AL8H 1OGAB 1MCSA 4OLVL 4GOSA 3QBTB 3R0MA 2NY5H 4PV8A 1ORSB 2R1YA 2VXUL 4QOKB 4ZSOB 4MXWL 5GHWH 1AO7A 4O9HL 3IFOA 5A43C 5EOTB 3BJ91 4MX7B 4AENB 1KIRB 1LILA 3SGKA 2DQTL 1JRHH 1V3MA 2ICES 3TH3T 3MLUH 4MAUL 1MFCH 4NKMA 1RZJH 4GRLD 3WKML 4AMKH 1I3GH 1RZIA 2DLGA 5DJ6A 5DQ9A 2FWOB 1J5OH 1AXTH 4OLUH 3QIUC 4DKFL 2YD5A 3QRGH 3Q6FB 1HCVA 4WI9A 5F7EL 5HVHB 3K4ZA 2NNAB 3DX7A 3VRLE 1E0OB 1AD0B 1FSKC 1PYWB 3FFCB 5HI3C 4JFEB 1BQHA 4KKNA 2BSSA 3QZWG 4EI5D 2UY7A 4OT1H 1HH9B 4PJEB 2WIIA 1IAOA 1UM4L 3OR7A 3QQ4B 2OM5A 3DRQA 3PE9A 4APQC 3CVHL 1MQ8A 3ULUF 2NX5D 3UJJL 1A7NL 1NL0H 3I2CL 1P7KB 1N26A 2MOVA 4N8CH 5AAWA 5J1TC 1EV2E 1GZPB 2ERJC 2FX7L 3UTPE 4E41B 1QNZH 4XP6H 3ARDC 4C59B 3QFJB 3VGBA 1G9EA 1N2RB 1BJ1J 4X8JB 4E41A 3IRZA 3MODL 5CJBA 4HIHA 5BV7C 3H3BC 4Z7NF 3GB7A 3EYFA 4CBPA 1OTTC 1P6FA 2NPLX 5DZLA 2PTTB 2XWBB 5C07A 3RAJL 1UM5L 2IAND 5FO8A 4TSBL 2YUVA 3OSKA 2VLRD 3G04A 1Z5LA 1ES0B 5JUEL 3TESA 5JXED 3TBTB 2K7PA 1CD1B 3QA3B 3VGHA 5D1XD 4HXBL 1MCHA 3U82B 2NY4D 4EDWL 5LWYH 1NGXA 1AGEB 2V2XB 3SDCC 2D03H 2DB8A 4J1UB 1JTTA 1BOGB 1GJIA 4UAOB 2OLDA 3PGCB 5E99H 5IB3A 4NQDE 3JTTB 4HS8L 1QO3B 3KLAA 1QFUH 3V6FB 4GAGH 1R3KB 4QRPA 1XGPB 4KZDL 3ZT7A 4AG4L 3GFUA 4ZO7A 2DWDA 5FOBA 2I07A 2YPKB 3ROOA 4LSTL 4YHKL 2HTKC 2NZ9D 3WIIH 4I18C 5CLWA 4MNGA 5IMKA 4CVXA 4ZPVA 4QRUB 4HWEL 1LO5B 2I9LA 1H8OA 5I8KH 2Y06H 2VTFA 4KJYB 4L8CA 4R6UA 1FZMA 1T80A 3V2AR 2CIKA 2IQAB 5F97E 1KTLB 2B0SL 2EDOA 3SQBA 2FX8L 4GLRI 1PZ5B 1ZHKB 5T1LD 4QRSB 3V6ZB 1LVEA 3HUJE 2BVUA 5FUOL 1KNOA 4IHOA 4OKVA 4A6YH 4RGMB 5IROA 1U9KA 5TE7H 3HZYB 1OGTA 2VZ1A 2VYRE 2Z31D 5I17B 4NKIH 1EHXA 1JF1B 4JG0L 3IDIA 3QG6A 5CJQH 1IILE 5IWLC 3QUMB 3LQZB 4GBXA 2OI9B 3RNQB 1MCQA 3KNBA 3ZKSD 2AJZB 4KROC 5L88H 2PF6A 3VXOB 2YBRB 4F7MB 4LMQI 4L4VD 4JG0H 3I6KB 4NZRH 5JMRA 3IDJB 3VWKC 1EFXD 3NAAL 2ZPKL 4AEHL 1JPFA 5GRXG 5GS2D 3VXRA 4BZ2L 1YNLL 4G8GE 3U0WL 1TPXC 1TETL 5I1AB 4UTBH 4JKPH 3JWDH 2DLIA 1SEBB 3LVEA 1ACZA 5HD8C 1WT5C 2XQBH 1QLFB 1GSMA 4X7SH 3MRHA 1CDBA 2OL3H 1S5HA 3BIKB 4GRWE 4KKLC 1EFXB 1CU4L 5JR1H 1TVHB 4NNPH 5T1KA 5DURD 1D5IH 3F7VB 3VRJB 1Q9WA 4NKOA 2Q7YB 1Q8MA 2EXYD 3SCMD 3MRPB 2VLRA 1DVFB 3O0RL 5IW3A 2C3GA 3U0TA 3FQNB 3FFDA 5TFSH 5TDPB 4HUUA 4EXPX 1QNZL 3WNMA 3FKUS 2GYSA 4JCMA 3OMZA 4P23C 4XWOD 3A67H 1MHEB 43CAB 1E4WH 3C8KA 3O3EA 4OCWH 4PJCB 3QHTC 3SKNB 3VXUA 3KHQA 5FO9A 5TH2A 3E8UH 1ZEAL 2BZDA 1A6WL 4M5ZH 5ISZA 3BESR 1QSFB 4UT9L 5D2LE 3FT4A 2ZSVA 1R3IH 3CFBB 3MLSH 2ATKB 3MV7E 4PIRF 5E2UH 1UCBH 4LVHB 2X1PA 5I9QC 5CINL 2XZCH 3VE0A 5BS0B 2NW3B 5DRNA 4IRJC 4JHWH 2PYFB 1UVQB 1CZ8L 1A7QL 1SYVA 2F8XC 4WUUB 1F5WA 4WGWB 2CO7B 5E1AB 1SEBA 1IM3B 4B5EA 5SX5K 4AY0A 5HHQA 4M4PA 1ZHLA 3CVIL 3H42H 4ZO8A 1I3GL 1QPXA 4CVZB 1RIUL 4LP4A 2GUOB 3LMJH 2R9HC 3QIBB 4LFHD 1AE6H 2JELH 4PPTA 1KTRL 4YHNB 4WEBL 4XNMA 2CXKA 1IC1A 3EIFA 1TIUA 3DURA 1QBLH 2GW5A 4H1LB 5B8CA 3ARGA 1FIEA 1Q72H 4K7PL 5FHBL 5IHBA 3QUMA 4GBXB 1CR9H 2FBJL 2PXYA 3MBXL 4JQXA 5CIPH 2DI9A 4NM4H 5HGBB 2YBRA 4YO0A 5H35A 1OTTD 5I1CL 2Z4QB 3C6SB 3WN5B 3BGFB 3ZDYE 2A83B 1M6OB 3QZWA 4PRHD 4P59L 2P45B 1W2KT 1IGCL 3V9FA 1ZLVH 2OL3A 1U8LA 3DYMA 3HC0B 4OZFG 4CGTA 1FJ1B 4F7EA 2EH7H 4U1MB 1RIHL 3FO2A 1NSNH 2B0SH 2FLRT 5IR1A 1QD0A 2VC2H 5D72H 2E9WA 4KZEH 2FLBT 4PS4H 5DXWA 1VB9A 4AQOA 2JIXB 3GZKA 3KJ4B 1A3LL 1T1WA 4NZUL 4NO0B 4EBQL 1NDGA 4ZFOL 3QHZL 4DKEL 2E9IA 5J1AB 2G5BB 3W0WD 5HDQH 4MS8C 3ZT6A 4I4WA 4UDTB 4GRMA 35C8H 5J1AA 1DBKL 2GT9A 4FHBD 1IT9L 4GRWF 5I15L 4DZBB 2VLME 4M7LT 3MRDA 1RURL 4L3EE 5DUBB 4ODXA 1XCQA 2J8HA 4QHMA 3UTOA 2WBJC 1Z9MA 5ELIA 3ROLB 2Y5TB 3B3IA 3UTTB 3NCYS 4JFED 3BH9A 1L0QA 3ULVL 4JY4B 1GOGA 3DRTA 2E7HA 3VGAC 5D6CB 1QG3A 4OAWA 1XIWB 4U1KB 1U8LB 3MXWL 2DM3A 1JGDA 4L9LA 4DVBB 4NQCB 4TN9A 4K94H 5ID0B 4ZFGH 4LOUD 2YD7A 5ESQA 3L7EB 1S78D 1ZVHA 1IQDA 1GGTA 3O3AB 4LCIH 3OKLA 1HHGB 4F8TA 3VI4F 5EU3A 4L9DA 3UMTA 3L6FA 3VFOB 3VD3A 1IQDB 3EOAA 4TNVK 5HVHC 1RJCA 4OFPA 4KVCH 3ARYA 1O7VA 3OGOE 5JXAH 1ACYH 2X42A 3MSPA 3EYSH 1PX4A 4OGXH 4LCUB 5MI0C 4KZEL 5ITBH 4MB4A 3DYPA 4N0YH 4PJ7A 3P0GB 4YZFF 1AIFB 1GC1L 2EH7L 1NMBL 3EO1B 2H32H 3GMQB 1CG9B 2J12B 3KLDA 3H6JA 3P77B 4QXTB 2V17L 3P4MB 5DUBA 1QSVA 4OD1H 4QTIH 1JWSB 4KMQA 1IEAB 3ZKNC 3WUWA 5GRJL 4TSAH 3WJLA 3N0PB 4RBPH 3BX7C 2SEBA 2IPKB 1UEYA 3OF6A 4NQVA 4V1DA 3GUTB 1NGZB 2F5BL 1WZLA 4GKZA 5HVFB 1KN4H 3I6GA 2H45A 5GJTH 4LKCB 5DD3H 4H8WL 3WKNA 2IFFL 1GZQA 1P69B 3SEPA 3FB5B 3MNVB 3V7AG 1ZAGA 2XACC 3ZHDA 4LU5L 4X6EB 1U3HD 1S7RB 5I8EB 3MV8E 1O0VA 3R8QA 4YC2B 1XT5A 4K9EL 3SDXF 5IB3B 2B7DT 3LS5L 1FNGB 3EOYG 3QEHB 3MGTB 3QIUB 1UWEH 3QYCA 5IT2H 3PHSA 4RNRB 3CFCH 3L3HB 5IHUL 4DEPC 2R9HD 4NKMB 2Z8RA 3RWHB 2F54B 3VWKD 4PRHB 1NCDH 2AK4E 5IJKA 3X11B 5DUML 3U4BL 4LVHC 4TULH 1U3HB 3EBAA 5KSAD 3GKWH 1MQKH 1BBDL 2YSSB 4KKBD 5EPMA 3WD5H 4DGVH 1LEKA 2C1OA 1NUFA 1KGCE 3QIUD 3MV11 4M62H 3CK0L 4NCDA 4ZQKA 3UO1H 4HKBB 4MNQA 5DJYB 4K7PH 4R2GD 1SJVA 5IB5A 1U8PA 3GHEL 4H1LH 1KEGH 3BZFB 3FO9B 4XGZB 1T89C 2CLZA 3QUZB 5M7QA 1DUYB 5ITBL 2KH2B 4PP1D 5MERA 1FE8L 1P4BH 1M7IA 2I60H 1Q94A 2VERN 1FDLL 1I4FA 2XZAH 4Y8DC 1MLCA 5CGYC 3PWUB 4N8VB 2BY3A 4MQ7A 3NZ8A 1RFDL 2EZ0C 3RU8L 3B2UD 4P0DA 3IDIB 4Z8FL 3QUKA 1N6QH 4J3WA 3HLAA 4HZLB 3QQ4A 5HHPA 4PJBA 2DL9A 3AROA 2X70A 2YD8A 3P9LB 4X7CC 2MCPL 5TDNA 2AKRB 2APVA 4YK4C 3EAKA 4KK6C 4PJFE 1K4DA 4NIKB 5E8OA 3MA7A 3ZDZF 2ZUWA 2A9MH 4HIEB 4F3FA 5D1ZA 1U3JA 2P8MB 2ZUUA 3NFNA 4Z95L 3OQ3B 1DLHB 2YN3A 4RAVA 2VZ3A 3AS0A 2BSTB 1CLYL 1G7PA 2H9GB 4P2QB 3L3IB 1INQB 3CVHB 2VXSH 4XP1H 4PY8J 3PHQB 3VFRB 4G42A 4GAJH 1QFWI 3DLQR 3OKKB 3W82A 3MJ6A 4N1EA 2O93L 2WP3T 2Q7YA 4EEEA 3W0WE 5IFJB 3LQAH 3MLRL 3EGSA 3D87B 3IB4A 4YGAB 1A7RH 2VE6A 1ROWA 1OPGL 4WNQA 1I7ZB 3SKMA 4P46D 4BKLB 5CZVL 2EE9A 3TA3B 5F1IB 4KHXL 4JM4L 1I7TA 4XI5C 1J1PH 1E4KC 1AP2B 4HKBA 4JFXB 2UUDH 1Z2KA 1YY8A 2BCKA 4PLNC 2B4CL 3WBDA 1U2HA 4X98A 4NO2B 5TDNB 4IMLB 5H2BA 3ZT5A 5T3ZD 1ZVYA 4LQ1A 4UINH 4WV1B 1BEYH 1G0DA 3MMEB 3O2WH 4LHUB 4XVSL 4GO6B 1RHHB 3GRWH 4NT6A 4HIJA 3OXSA 4APQA 1E4WL 2DQDH 1IGML 4IDLA 1DQQA 1W0VB 3KYOB 1PLGL 1K5NB 2ARJB 4HWZA 4CJ0A 4DKAA 3SKJL 4NHCL 1U8OB 3VXMB 2GHWB 5IB2B 3BPCB 5I66B 2NY6D 4GRLB 5MEQA 3LN5B 3G6AB 2R8SL 1CK0H 5GGVH 1TJIH 2ADFL 4JQVC 4U2ZA 4N90E 3MNVA 3ALWA 3P73A 1R5IA 4HUWA 4KQ3L 4PJDB 4QRRE 3UJIL 3QP3A 3WYRA 1HINH 1MJ7L 4ONOA 3WN5C 1F3JB 3MRDB 5CHNA 1G7JB 1I1FA 4JREB 2VITA 4P23D 3CFEB 1VENA 1LEKB 3MLYH 1JYWA 4Z7QE 3KPSE 2BVEA 3S5LG 1VEMA 4LLDA 3UEZA 4RQQB 4HUVA 3QCVH 4ZTOH 5DRZB 2VOTA 1QTYT 2BNRE 1JYXA 3MRIA 2VUYA 4G6MH 4ONGH 1UG9A 3VXSB 1JGEB 4NRXA 4M5ZL 1YEIL 1MAKA 3UBXB 3BZ4A 2OP4L 3HUJB 1H5BB 1JE6A 1A1OA 2AEPH 3IF1B 4FQJH 1MSPA 1AGBA 4NQTA 3RIAK 1QLEH 5IOPB 3LN4B 4FG6C 4DZ8A 4ZMAT 1MFBH 3KR3H 4WU7B 1HN1A 1G9NC 2BX5A 5KSBA 2ATPB 2Z31A 3QIWA 5H37G 1NGXB 1FNSH 4QYOA 4LRIC 5EWIH 5D7IA 4PJXA 3VG0H 3U1SL 3IU3B 4JKMA 3U46B 4MXQD 5BV7B 4KTDH 2P8LA 3HS0B 5DJXB 5CJXA 1NGPL 5GXBB 2VISA 3EFFB 2BHZA 4PRIA 2YOCA 3A0OA 3BVNA 3TO4A 1BGXH 3AY4C 5K9JL 4PJGE 3HPLB 2XZCL 4LCYA 4P9ML 4QXTA 4FQIH 1J5OL 1JWUA 3GSQA 4Q6YA 3GRWA 1KLGB 4R4ND 4P2RD 2PW2B 4AH2A 3DSFL 1HI6A 1CDYA 4M61A 1P4LB 2IMNA 5LGHL 1XCQB 5KVMC 3HCVA 1WZKA 4Q6IB 3T2QA 4OUUA 3T0EB 4GAYB 2J5LC 4JFZL 3LIZH 4RCAA 2CKBB 4I0PA 1NDGB 4W6YB 4WW1B 1GGCH 1JUFB 1N8ZB 1NQBA 4FP8H 2APWA 2FD6L 4OB5L 5KVEL 3UPRA 1HKLH 5DMIH 1T7YA 3RPIB 2DI7A 3S5LB 4Z18A 1V8HA 4QWWC 5GS2H 4KPHL 4FFWD 5DK2B 4TVPE 5KSAC 2XA8H 3B83A 4LPTA 4N0UB 2PO6A 4M4RA 1YEHH 3ROLA 4WV1C 1UT9A 3HNVL 2YUWA 3VFUA 4MNHB 1FNHA 2OJEB 4UV4H 3BKMH 1TJGL 1U95B 5EG6C 1JRHL 3U30B 1FDLH 2XZAL 5FK9A 3NH7L 1WCQA 2PNDA 3L5WB 4K55A 3MV9D 4Z7QF 2F5BH 5IB1B 1DQLH 1ZWIA 5EO9B 2A0LC 4RFEA 2VXSL 4NUGL 1C12A 3RVXC 4LIQH 1TCRA 4YIQB 3X13B 3H9HA 5CWSA 5ESAA 2BXZA 4Y4FA 4E0RA 3C2AL 3VMNA 1CFTB 1J1XH 2PR4H 2MKLC 5DD1L 4LNVA 2A6DB 2A9ML 4ZS6D 1CLZH 2YRZA 4O2FA 3ECBA 5FB8B 2ED7A 2GITA 1H8SA 3IXAA 5FIEA 1F4HA 1C16B 4U1SA 1KJ2B 4PREA 5IBTL 1RUQL 2CIIB 3BW9B 1WBZB 4OLUL 5I75B 3RL2A 4HWEH 3RVWD 3QIUA 3EZ8A 4FFZL 4BK5A 1QPPA 1WIOA 4PJGB 2XXMB 1IGYB 3BE1L 4EI5A 1FFNB 3EDFA 4LLWA 5E6IA 1QFOA 5HI3D 4X4XA 3O4LA 1HDMB 5D1ZB 5EBMB 4Y5VB 4PJIE 1HXMA 2E7CA 5D2NC 5DC0A 4ZOCA 3MA9L 3I6GB 1OM3H 4Y4FC 8CGTA 1D5XA 15C8H 5AUMB 4HWUA 3P2TA 3NTCL 4RFEB 4G43B 2MHAB 5C07D 1KCKA 1XF4B 2FNBA 3ME0A 5JOPE 2YMXH 4MD5A 5DHXB 2IGFH 1MCWM 3MRKA 4F33A 2A74B 4AEIH 2AS5M 4RRPA 3WHE0 4ALAH 4Z7NE 4JPWH 1X4YA 1P7QB 2VQ1B 3K7UA 2NY3C 1HIML 1S9XA 4PB9H 2ZUXA 1GGBH 5C0DB 3LEXB 4M61B 2IANB 2RFXA 1A3RH 2AABH 4P5TC 1OW0C 4FXKA 3RIFF 4PJ7B 2CK2A 4YXHL 3QUYD 4JDZB 3MPCA 4RX4D 5GS1C 3SKNA 4Y5YA 1DLHA 3KLHC 5CJOL 3ARDB 1DDHB 3VGEA 4J3TA 5C8JB 3MV8B 4YJZL 1NMCC 1YEDB 1OAXH 1RZJL 2AJ3B 4OM0H 4LLWB 3C08L 3TFKD 4GSDH 2O5XL 3VH8B 2Y23A 3KYMA 4I0PB 4WW1A 3WUZA 4U3XA 1WWCA 3GHEH 4HH9A 1S9WA 4RFOL 4XC1L 5CD3B 2N7BA 5IVXF 4X99A 1BLNA 2WQRA 3FT2A 1JWMA 4JM2B 4ODVH 4KAQL 2FD6H 3EYQD 3HZYA 4IIQA 5IKCA 1FVEA 3QEHA 3RI5K 4X6BB 3DECA 4LSSH 3AXLB 3SGEI 2Q20A 3KPMB 1IL1A 1P9MA 1CFSB 1CE1L 3I75B 4UV7H 3TIDA 2MFNA 5I1DA 1S5IH 3PL6B 4PGBA 4H8WC 1KIUA 2UYLB 4HQQL 1KIQB 4CL7A 1Y6MR 5GPRA 1MNUH 3BKYH 2WWKO 3BUYA 1ZWIB 4KGJA 5C0AB 1VKXA 4WW2C 1KJ3H 3K8LA 3BP7A 2M8XA 3GI8L 3QFDB 1A3LH 5HPMA 1NEZB 2G2RA 4CNIB 1I1AA 4K8RH 4X0KA 1YDPA 1JWSA 1MFEH 1FCGA 4J3OC 3T3PE 1D5MA 1JI1A 4PJHA 3W39B 5HYJA 1BFTA 1Z3GH 3D39E 1KFAH 2P48B 5JIKA 4JPWL 3P73B 4ISVA 3EFDL 3EO9H 3NVQA 3RL1B 3G5XB 2R0KH 3T3ME 3DXAD 4XPAL 4BSWA 1IBGH 5HI4C 4W68A 1EHAA 4M6NL 3ZKXC 3W11C 4ESKA 4MMZC 3O6LH 3ZL4L 2BY0A 1CGSH 5BQ7B 2ADGB 4HPOH 4P5KB 5TDOA 5DZNA 3H7BB 2VDKL 3UZVB 1WCBB 3QUYA 4P3CL 2FIKB 3VFNA 3WFCH 3WHXB 2FECL 1HXYA 1Y18B 5E8DL 1KJ2L 4RQQA 2BRQA 3DO3A 3TVMC 4X9IA 4OKDA 2XG4A 5ID0A 1QVOA 4H20L 3VFVA 1QA9B 5F9DC 4BH7A 2VZTA 3TWCL 1A14H 4IIQC 4XC3H 4A2LA 2Q8BH 1GOHA 5DQDH 1I9IL 4IS6A 2N4IA 5IKCB 1IC7H 1RJYA 1Z6JT 3MJ9L 3L95A 3RA7H 4MLSA 2YZ1A 2VC2L 1T4KB 4I0KA 3MRJA 5D2NA 3I85A 3WS3B 5A16A 2PYED 4GG8A 2V2XA 3GSOA 3MLSL 4Q9QL 5DRNB 5EWIL 4PJEA 2YMXL 3TBVA 1TJHL 2NTSP 3QO1A 1TJIL 4M43H 1BQHB 4UB0H 2P5EB 5KSBF 1I8LC 3RIFK 2Z92A 4TOYH 3FL7A 4JFZH 3RGVC 4WY7L 1E27B 1BM3H 5F1NA 3LZFL 4G8IA 4R4NC 4RMWA 5FO9B 5D5MA 4NUGH 4P5TA 3VFWB 5J89A 4MDIB 4KKAD 3ARDD 2HH0L 1UH2A 5DT1H 3IFPA 3L1OL 5BQ7A 3MACH 1BQUA 3QT2A 4ONHA 2P46B 2YK1L 3PL6C 5BRZB 4G9FB 3AC0A 4IOSD 3IDNA 5EC1A 3WNPA 1KG0A 1MLBA 1F6FB 3RKDD 2XTJC 3IETB 4OGZA 2OL3L 4EN3B 5T33H 2QSQA 3NMEA 4YHZL 4ZG1A 1SM3H 5LGJB 3RWCB 1NEZA 1RIHH 2FYYA 2KL6A 2R2BB 5I6XB 3DETD 2QSTA 3N85H 1O7SA 4NFBA 4M7ZC 3H3PH 3C2AH 5FYLH 3QPXH 2JJTC 2X4SA 1R0AH 4J4PC 4UUJA 3C5SA 2JTDA 1ZHLB 4Y16D 5I8OH 1KLUB 4M1CC 5DMKA 3NA9L 3GJEB 3C87A 1NGQL 4X4ZA 5I74B 4DK6A 1LDPL 2VDLH 4DGYL 4Q9QH 1LE9B 5K59F 4RMQA 2VDQL 1TFHA 1KENH 3OGCB 4OF3A 2XNAB 3LH2L 4DVRL 4FABH 5JIIA 5L2KD 1T5WB 2NTFB 4KHXH 2XA8L 3LDBB 1D9KA 2VQTA 3EYUL 4R7DB 1RZ8B 1CZ8H 1JF5A 4OV5B 2HJFB 3RX8A 3PP3H 3GMLB 1TCRB 1T6VN 1DUYA 5DO2D 1G9NH 2VZVA 4RGNC 4CDHA 4OCSL 4HUUB 3UJIH 1UKSA 2XI9A 1GGCL 3AM8C 3KYAA 1EMTH 1ND0B 2WUCH 3BEWB 3VD9A 4NKOB 3SOBL 3O81A 1JRHI 1X5AA 3U30C 5IUSA 4PJ5E 1MFAL 4RMRA 5J6HB 2EKSB 1NGYA 3K0WA 3DUSB 5DDHA 2XOTA 3X11A 3FHQA 4OLYH 3P4MA 1YMMA 2VLKB 4C56D 4FQXC 2ATKA 4MA3B 5GS1A 3OJDA 5C0BE 5FKAB 5HYSA 1V7NL 3MUHL 5FYKU 1RK1B 5HD8D 4LLQB 3Q3GB 5BXFA 1BOYA 4GS7B 4FQXB 4QHKI 3PHOB 5F7LB 1DFBL 2P5ED 5C0JB 2LTQC 4UBDD 2W9LA 2H26A 1MCLA 1SJHB 4XBPB 1RFDH 2UWEE 3SQOH 5C0ND 1MCRA 4QXUL 1ULVA 5AWNH 1A6TA 4ZOBA 1DCLA 3QHFH 4NQVB 3WKMH 5I73C 3U48A 3LN9A 4K8RC 4XCFL 3ZSSA 4U31A 4H1LG 5DLML 3IDXL 4D0DA 3MNZA 1ZANH 5EO0B 5LAXB 4AQ1B 2O5ZH 5BMFH 1NCWL 5D7JA 1JFQL 4DN4L 2NY5L 4MJ2A 1F90L 3BN3B 1CG9A 4JY4A 3D3VD 3RTQA 5J1SC 4G6KL 4BQ6A 4JHZA 2Y5TA 3RY6C 5L2JA 1J12A 2R69L 2O61B 5EIIA 4TULL 4ONGL 2NY6B 2J6EL 5D6DC 4NGHL 4MNQB 4HH8A 5MEPA 2FGWH 3GSUA 3EDKA 2PW1A 3OJVC 3V5DA 3MUGA 4GW4B 2CDEB 4WJ5A 4IM8A 4GG6F 2HMIC 3MJ9H 1H5BC 3L3GA 2FO4B 3FFCA 4UZGA 2Y06L 3MOQA 2ADIA 3JV6B 3RWDB 5J0BA 1OAQH 3QUZC 1MCBA 3QDME 5DA4A 3ZYZA 3JV6A 4DGIL 1ZLVK 1FE8H 5IG7A 1UXSB 3QUML 4JZJC 4EDXB 1RI8A 4LIQE 3UTTA 1NGYB 1GAFL 3Q5OA 3T3PF 5J6HA 3L3KA 3UTSB 3MXWH 5D93C 3GEWB 2YD1A 5JW4R 4AZ8A 3QXVA 4HIIB 5I76B 3O2WL 4U6TA 2FCBA 4XVSH 5JW3H 3T0VA 5KW9H 2AEQL 2DQIH 2G5RA 1ORQB 5T1MB 1PFCA 5EIIB 5C3LD 1A5FH 1Q0YH 3UJTL 5KSAA 5IBLC 4GLRH 5E4EC 3SDAD 5L2JB 4K71B 4EXKA 3R4DA 3FQXB 1HHJB 2DQUL 1RJLB 4UTAL 5C6TL 3RHWF 3HCVB 3ULUC 1R5WB 2R56H 2FGZA 2B20A 3P4OB 2HWZL 4PTUA 2OJZL 4HS3B 4YR6B 1P6AB 1KIPB 3RKPA 4J1UA 2ESVD 1MI5B 1ZT4B 4PJFF 3EJYC 4LASH 4FXLA 2GJ6A 3L3DB 1OSPL 3NABL 4ODTH 3L3JA 3OAUH 1T0NB 3WJJC 1N5AA 3CX5J 1HH6B 5IK3B 3QAZC 4YXHH 3R1GL 4X6CE 1F4WL 1R3JA 1RUQH 5HJ3A 1T0PB 4L8SB 2XIDA 1X7QB 4HS6B 3T0ED 5HYQB 1S9KC 1NGWB 3TYGL 3E6HB 3T0BA 4XB8A 4I2XB 5DSCB 1A1NA 4L1HA 1YEDA 5JLZB 1QRNA 4X98B 3O6LL 3VXUB 3ZL4H 1A1MB 3PV7A 4ETQB 2AEQH 1Z9OA 2DQIL 6FABH 1GIGH 3ES6A 3QNZA 2OTPA 3AU1B 1BREA 1ONQB 4Y7MA 2ZSWB 4FRWA 4Y5YB 5I6XC 1D6VL 1KPVB 3KXFB 4KVNL 2H41A 4OGYH 3EYOA 3VDCA 2YRPA 3G08B 1LP9E 5FEBA 1JL8A 3TJHC 3BT2L 3LS5H 3VXMD 4JFDB 3N1MC 4HKXB 2NXZB 4PJ9D 4G43A 4U1NA 3OAYK 4J3UA 3V4PL 2I27N 1VACA 3OPZH 4Z7VB 3PGDA 1D5XB 5DVNA 4MD5B 5HI4D 1FLRL 1YECL 1NKOA 4P3DA 2DQTH 1T04B 2V5MA 4GKSB 4ZXBA 4N8VG 1G7JA 1CFBA 5IHLB 5DJAB 1UZ8B 3GSRB 4F3FB 1H3XA 2EEAA 3ARFD 4UU9B 3RPKA 1RIVH 4UMGA 3TNNB 3RDTD 4QRTA 3MLXH 2CR6A 4WO4B 2ORBL 5KVEH 3KPRB 5IR1B 4OCLC 1JGLH 5FAAA 3DV4A 1A6WH 3HUJF 1K3IA 1LE9A 2AJZA 2CIIA 3S37H 1IGYA 2XWJB 2VLJB 1DBBH 4MGXA 4PJGA 4YQXL 3C5JA 1CDIA 3O45A 1J0YA 2X89D 3GSOB 4MJIE 4NO0D 2VLJA 3SDAC 3V7MA 3WIHL 3MZGB 1FPTL 1AD9A 5DGQA 3SOBH 4QY8B 4HPYL 5B3NA 3HNSL 5GJSL 4HS3A 5J7CC 4C57C 1UM6H 1OAQL 2EDYA 3OXRA 2GI7A 2FRGP 4U6HB 3PWNA 3SDAB 1UJ3C 3Q0HA 1KTLA 3QQ9D 3D25B 1I85C 3NCJH 1CFQA 4XTRD 4YDVB 3VGAB 1T04A 2PCPB 2R0ZL 1M7DB 5F88B 3UTTD 3Q48A 4XCYA 2R39A 4NRZA 5C7XL 1FLTX 2ENSA 3FQWB 1RUMH 4OCYL 3QO0B 4LLYA 1UCBL 4JFFE 1OSZB 4KI5F 1U3YA 5DJ8B 3VFUB 2J8UA 3ZDXE 3CMGA 2DWDB 4LDEB 1FN4A 1S7QB 4HK3J 1A5FL 1BIIA 4FP8L 2VLRE 2OTUA 3VWJC 4ENEC 2EDFA 4IMKA 6FABL 1VEPA 1KG0B 2WANA 3QWRD 2GJ6D 2V5TA 3QEUA 3VFRA 2OQJB 3IETA 4LIQL 4XCNB 3LHPL 3NGBB 4FXGB 3PABB 4I5BB 5C09A 4X7FC 4E9LA 4RGOH 3ZZ1A 1RZKH 2D31B 3O0RH 4OGXL 4Q9RL 4JFFA 3KPNA 4NJAL 3QEQA 3OAUL 1ZA3B 3P4LA 1F3DH 3P9MB 4L8SC 2R1XA 1DUZA 3L7FB 3V79C 5ALBH 4P5TB 3SDDC 4G5ZH 4O58H 3S4SB 2PXYD 3GIZL 3STZA 4L4JA 4N9GB 2HWZH 4X6DA 4L3CB 2E6QA 5D72L 1KIQA 1U41A 3O8XC 3U9PH 4HLZG 2NY7H 4XPTH 3TT1L 3MO1A 1JPSH 3N50A 2ZCKH 1F3RB 1HCFX 3CPLB 4OZGA 1NCBL 3W2DH 3QCUL 3CSYA 1GL4B 4OLWL 4LSPH 5E5UB 4KK5D 3FT2B 4JM2A 2RAMA 5KAQG 2LV4A 3QDJA 4BH7B 1CTOA 4C55A 4CMHC 1CF8L 2R0WL 1H0DB 3OR7B 3SDCA 2ZWLT 4XVJL 3PDDA 4M7LL 1R0AL 2KZ1B 3TO2B 1GGIL 4LARL 3E0GA 3I50L 3HNTL 3QNXA 2NY2C 4G8FA 4D0BA 2F58H 4MXVF 3IFNH 5FFLA 1J18A 1F4YH 3TO2A 2Z35A 4O4YL 3WHXA 5E8PB 3BGMA 1CL7H 3T65A 4XVUD 5GZOD 4AM0B 2BY2A 4PRHA 1EAPB 1XGUA 4M7KH 2IH1B 5IG7B 3RL1A 4RFNB 2OMBA 4TSBH 4FZEL 5GRVK 3RVXD 1KBGH 3KPRD 3MGTA 4L4VB 5E03A 3CCHB 4M8QB 5IV2B 5JPNB 3VDAA 1DZBA 3VXSD 5C0IB 2G60L 4X83A 1IQWL 1X5KA 3MO1B 3SCMA 2YPLE 3QUZD 3B5TA 1U8MB 1MUJB 1LD9B