5DJ8B

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8B01
3OGCB 2B1AL 3IRPX 2A83A 4ISVB 1CFTB 2EC8A 5T1KA 1WIOA 3V5KA 4ZXBC 4JO3H 2XWBA 2OYPA 3P3YA 1F11B 2F15A 4MQSB 5IESL 2CGRL 2JJSA 4PYGA 1UM6H 4YDJB 5DUBB 4O4YL 3SJVB 1DQDH 1QSED 4Y8AA 3IF1A 3FT2B 5FHAH 3QNXA 1ZLWH 4D0CA 2A6JA 1QEWB 3QCTL 4YXKH 1AGFA 2H8PA 3T8XB 5JPMA 4OLYH 3WS3B 1FNHA 1Q0YL 3GSXB 2VZUA 5CGYD 5ANME 4U1MA 2FSEB 4HQQL 4LPXA 4MJ5B 4UTBH 5IWLC 1A6VH 5ID1A 3GJFB 4K9EC 4F37F 2HFFB 5E95B 4JHBA 1AGEA 5F7DB 1FL6A 2RJMA 5CZVH 4CU6A 35C8L 1K2DB 4QOKD 3TV3L 3T0EE 4L8CA 1ROWA 3H9ZA 5CGYC 4YX2L 3WIHH 4JJ5A 4EJ1C 1FZOB 4O5LH 4ZODA 1CU4H 1XGUA 3WHXB 6FABL 5J9PB 3QXAA 2HAZA 4OIIL 1UB5A 4LEXL 4OGZA 5IROA 1EO8H 3QR2A 3O3DB 1GL4B 3OKEB 1NBVH 1VDGA 1G6RH 1S9XA 2IH3A 3EO9L 3UTSE 1WVZA 1F42A 3HE7A 3NA9H 5E5UB 2IBBA 3SDCA 2MQ0A 4FQIH 3QUML 4UNUA 1CLYH 2JB6B 4G42B 4LEOB 2CUIA 3R06A 3RZCB 3VFVA 4R4BB 4XXCC 3RGVB 2WBJD 4WU7A 5E9DD 4YDKH 1F8TH 2CUHA 1UB6B 2JLLA 2UY7A 1B9ZA 4J7RA 4XPFL 1S9YA 3IAQA 3QWOB 1T89C 1I9RL 4JFZL 1NGZA 3B3IA 5GGSA 5SX5K 1LGVA 2FYYA 4FTVE 2KL6A 2WBJC 1U8KB 4P59H 1MCPL 5LXGH 5FV2A 2YXFA 4ZS7H 5EPMB 5C0BD 3HC0A 5TF1H 3L3DB 4BKLA 1SYSA 2C3XA 5F1OB 4JHAL 3L3GB 1HQ4A 4LK4A 3MRHB 3KJ4C 4OF6A 1NLDL 3BP7A 4C56E 3FJTA 1DP0A 1S7QA 4NKDA 4X9IA 5T1DH 3OKKA 3L3JB 4RWHA 1OM3L 4NN6B 1CDUA 3MV7B 1OGAB 2ZUUA 3DGGB 2BXYA 2JIXD 1RSFA 3TN0A 2Y72A 1OTTD 2IFGA 4R97B 3HI1B 5DT1L 2J4WL 3CUPA 4OD2A 2JK5B 1G7MB 3IGAB 4G8GA 1K8DB 1GH7A 4GG6F 3S35H 4LPYA 2Y36L 1XMWA 5F3BA 1GYAA 4LU5L 4GSDH 3ES6B 2HRLA 3P0YH 3DO7B 1FGNH 5DZOA 2YA2A 3ARPA 3DX6B 3C5SB 1SYVB 2IANE 5I76A 1U42A 1M7XA 1OTTC 4FXGB 5SWZB 3RWIA 1K5NA 2HVJA 3UTPD 2D7MA 3F7RA 3FQXA 4GXVH 5CP7A 4Z7WF 3DBXA 3GRWH 2ZOKA 5H35B 2ED9A 5DURD 4NT6B 1RZKH 1AHWA 3DIFB 4UILL 4JKMA 5DMGD 5DQ9A 1CBVL 3S97C 5D70H 2Z93B 1DN0B 5LCVH 1FN4A 3O3BB 4PJ5A 4HIEA 1NCTA 5B8CC 3WSQH 2G60L 1CN4A 3BZEA 3EDEA 4OFKA 5F93C 3AM8C 5C3LD 2YA0A 3RWJA 1IC4L 5IW1A 4W68A 3TYGH 3X13A 4OV5B 2I9LA 3QG7L 4MX7A 5IG7B 3BRGC 1Q9LA 1EJ6A 2LTQB 4Y4KA 5DMGC 5DEZA 4DK3A 2F74A 4NZUL 4KI5E 3CVIL 1EEYA 2NCMA 4KH2A 4GUPB 1ITCA 1DL7H 4RDQG 4HZAA 1MCOL 3U30C 2W60A 3IKCB 4MXWH 2FLBT 4P4KB 1U91A 5I0DA 3PWPA 3VFRB 1Q9WB 1I7RB 4O2FA 3ZKQD 2EH7L 1MAJA 1BVZA 5J12C 3NA4A 5IEKA 5FHBL 3S98A 4NZTL 1ZT1A 3JSSA 4WUKL 1X7QA 1T7XA 3OKDB 3G5YB 4Z8FL 2RFXB 1DBKH 3WD5H 2A73B 3IFLH 2FD6H 3T0ED 4WEMB 2QHRH 1I1AB 4KV5F 2BFVH 3O3EA 5JHDE 1A21A 3SGDH 1JZ2A 5C0ND 1QSZA 2V5YA 3H0TA 4IRZH 4U1KB 4M7ZC 5I71C 2A2QT 3HPLB 2X1PA 1TNNA 4JDZB 3ULUE 3QDMB 5J7CC 3BH9B 5AUMA 3RIAF 2JJTA 3OKLA 4NZRH 2W65A 3BQUD 4WENB 3FOMB 4QHKI 4H8WC 4QKXB 1G9MH 2EYSB 3RWCA 3K8LA 3O4LA 5F1KC 2R1WB 3T0EC 2G5RA 1IZJA 5CJXA 5ADPL 3UTSD 1KCUL 5C0NC 3MUHL 1RUPL 3PUCA 1H8OA 2DIJA 1DUYB 1FL5A 5C0GA 1A1NA 3BP4B 5TDNA 4P9HH 3D0LA 4LLVA 4BH8B 1FZMB 5F9JA 4YFLI 4LHUB 3BQUC 4UDTB 4BUGA 4JKKA 3PWUB 5EZLB 1H15A 4HIJA 3BDYH 4K2UL 5HJ3A 4W6YB 1B0RA 3MV01 3S5LA 2NY5L 4P46A 4OBSA 5BS0E 4Y5YB 4L5FH 3JWDL 3FRPA 2IQ9H 4FTVD 5SX5H 4YQXH 1HH6B 3HZYA 2Z8VC 3TIDB 4JZNA 4F80A 1AI1H 3DYOA 3V0WH 2NY3C 3NABH 2Y07L 1J0HA 1QTYT 4JREC 3MZGB 1I3UA 4LARH 5HYJD 4PJDA 5FYLH 3F5WB 43CAB 4C56D 3P30L 4PJCE 2DQDL 4FQPA 4NO2B 5AZ2L 3QO0B 5ACZA 4UI2A 4Z7UE 5CKGA 4L3ED 4PJ8D 2HMID 4GW5B 4XB8A 3OBAA 2NR6D 2C9AA 2VOTA 3SY0A 4TNVF 4YR6B 1YEGH 5HTSA 1IGFL 1NAMH 4G9FE 1OT1A 1P5UA 2LE9A 4N1EA 4U6VH 1ACYL 2VE6A 4PJ8C 3STLB 2HMIC 4I5BA 3I6LE 1A3QA 1IKNA 4KMQA 1F6FB 4G6JH 1WK0A 2DI9A 1JNHA 5E1AB 1KB9J 4Z7NF 4KU1A 1KYOK 1OP3H 1NLBH 5ICYB 4HDIA 2NR6C 5ENWB 3CCHB 4KZDH 2BZDA 3GMLB 1U3ZA 1VPOL 4EI5D 4V1DE 3NCMA 4R8WL 3SGJA 4JLRA 1F02I 3VFPA 2VC2L 1EEZB 4XMLL 1I3RA 4X6FA 2AKRB 3WKNA 3KYOA 3QQ9D 3SE8H 2XWTA 4GQPH 1R5VA 2B0SL 3VH8B 2IG2L 4UAOC 4FXKB 4OIAA 3U4EB 3MLTB 4EI5C 2A9ML 4OCLC 3VD4A 1XGYH 1K8IA 1EHLH 1S7RA 4NQDA 5CBAA 4PJHB 4KHTH 5E8NB 4M8QB 4LKCA 3N06B 3QQ9C 3BO8B 1CK0L 4U1HB 2FDBP 5K59E 4KI5D 3KR3H 1LEIA 2JKXA 3MRQB 5FYJL 4NQXA 4R26H 1FNSL 1UVQA 2MJWA 5D2NA 3MRJA 3J8F7 3MXVL 5I1CL 1KTDA 4FQXD 4U1GC 4XPHL 3OR7A 1PG7X 2D31A 4AM0A 4H0IA 2A9NH 2AJZB 3CLEL 1LK2A 4ELMF 2EKSA 1SEQH 5CHNB 2XWJA 4D3CH 4KI5C 3SDAA 2E8YA 4GAYA 2FHFA 4NQUA 2IPTL 5IFJB 1I7UA 4HULB 4LLQB 2GCYB 1G9NL 1VHPA 1BF2A 5IVXE 5CEZH 5JHDD 1HIMH 3LKRB 5AYUH 1Z9SA 4X6EB 1OP9A 1F97A 3MO1A 4FQXC 3U6RA 1CDIA 4F7MB 4XP9H 1FO0A 5F21B 1NAKL 2R29L 3KXFD 4HFWA 2P47B 3LKOA 3ULUD 2NW2B 5C86A 5T1MA 5E94B 1BVKB 5EORH 1T5XB 1MHHB 2H32H 4S1QL 4R0LC 2PR4L 5MHSD 3MCKB 1MRFL 5EU5B 3RNKA 5INDB 1ES0B 4HK3N 5J1AB 1E27A 1RJLB 2GTWA 4GKZB 2JCCE 3ULUC 3MRFB 1IE5A 1U41A 1VGEH 4AEFA 3NCJL 1QUNA 4ZFFA 3Q2CA 4IHOA 3CPLA 2VLJB 2DWEA 4U2ZA 3MRNA 2X9WA 5SWSE 3GSNA 2DAVA 4WV1A 4OZ4A 1E6OH 3REVB 1U0QA 4LL9A 4LRIA 1F45A 3LQZB 4ZTPH 2KZ1B 5DFWH 4H26B 5HHPB 5BS0D 4JY5H 2FEEL 3TFKD 5ALBL 4HJJL 2VUOA 5I16A 2PTTA 3TBVA 2PXYB 3RY4A 3GIVB 4JAMA 4XNMB 2CKNA 2FJHA 3WNOA 4K07A 4MA8L 5I19L 3N0PB 3FB6B 4DZ8B 4XXDA 3OAYK 5B39G 3VFNB 3SKMA 3IYLW 1AD9B 4POYA 2MTPA 1QP1A 1QR1B 4LNRA 1ETZA 5FCUL 3G5XA 3VFTB 1ZLSL 4JPKH 3TFKC 2P5EB 3S36H 4B5EA 3OHXB 4UV7H 1U8NB 2VDOL 3RVWD 2CO7B 5ID0A 2FO4A 5EWIL 3CH8A 1V7ML 1CD1A 1IM3B 4FFZH 1D6VH 2DLIA 4M5YH 1NMCC 2IFFL 3W0WE 5BVPH 4IOFD 5I30L 3BXNB 3TBSB 5JDSA 3G6DL 3ISWA 4YBHA 4P2CG 3W39A 2QQNH 2BOBA 3T65B 1LO3H 1MLBB 3RVWC 1ZK9A 1XGQA 3VFMB 4D9LL 5HVFB 1T4KA 3BESR 1CICA 2VUYA 4G9FD 5I8EA 3GIZH 4IOFC 2BSRB 4R90L 4U0QB 5JA9A 2PYFA 4PJAE 4FG6D 3CLFL 4FFWD 2EDOA 3I6LD 2D03L 4PGBA 4OTXL 4XH2A 3QHFL 3DUSB 1T20B 4PJIA 4JRYB 4HWEH 2ZJSL 4RGOH 4WWKD 3KYMB 1LO5B 4YC2B 4NQTA 4DTGL 4QLRA 4FG6C 2BVTA 4FFWC 1KCSL 2DYPA 2GYSA 1K4CA 3SO5A 5I1GL 4GKOA 3LKNB 5FUCE 2ERJB 4WI3A 3QI9B 4ODSL 4HKBB 2AGJH 3FQUB 4NHUA 4YUEH 1Q9KA 3C6SB 4WWKC 4LSQL 1P4BH 4GRLD 1T03H 4JFQB 5DHVA 4X99B 5GRVK 3MLWH 1SJXA 3WFHA 2IADA 5IJKA 4JY4A 3MLZL 4M5ZH 3BUTA 1NGXB 5MENB 4H25B 2ARJB 3AXLA 4MJ4A 3SCMB 4HKJA 5E2VL 1QR4A 4GRLC 4I48A 1IL1B 4K7PY 1CLOH 1HHJA 2NY0B 4QRRA 4G3YH 2ITDB 3FO2B 3ZTNL 1C1EL 3T1WA 4HEPG 5JXAH 3TZVB 3WN5A 2VLKE 3ZKMD 2YPLB 1HXYA 3P40A 1R0AH 4MYWB 4PBVC 1QOKA 4QXWA 5EC2B 5EU6A 5IB1A 4ETQB 3RWHA 3M07A 1HHHB 3U82B 4KZEH 5DUMH 4WY7H 3FCTA 2VH5H 5F7LB 3RGHA 1WZLA 3O2WH 5JQHC 5F1SA 4F7TA 3QDGA 2OL3B 2P8MA 1KIRB 3U9UA 2QSCL 5ESAA 4K3EL 3LS5H 3ARRA 2Y5EA 3ZKMC 5F9OL 2FATH 5IBTH 4LCIH 2X1QA 4ODVH 4PRPD 4PUBH 1Z5LB 4DN4H 3U36A 2AXGA 1JHKH 1VCAA 4XP4H 2C3HA 1MFNA 5HHME 2V5SA 5FYJD 3QQ3B 3BW9A 4XVTH 5IB2B 5C2BL 2GSIB 3SOBH 5GQBA 2DF3A 4XPTL 2ZUWA 2KQMA 1FVCB 4X4YB 5EO1B 4NRXA 5DD1H 4KKLD 3ARGB 2FWOB 3U7AA 4DOHB 1L0XA 4LAQL 2ITCA 4B53A 4ZOCA 4YDVA 3UTZA 4BQBA 4JPVH 3ZKXB 4EQ3A 1JPFA 2UWEE 4GBXB 1N2RB 2NY7H 2XZQL 4U7SA 3HRPA 3VXSE 1QBAA 2OTWB 4DCQA 3O2DH 2HKFL 2W07A 1GZPB 5B4MD 5DUBA 5FM5O 3SDXA 3WXVH 4KKLC 2PO6B 4DKFH 4NUJA 2Q8AH 3EYOA 1C08B 4PGCB 3GBNL 2C1OA 1KTLA 2F5BH 1HINH 1KJ2B 1YNTA 4YXLH 4RIRA 2AQ1A 3SDYH 3W9DB 5B4MC 4WFGE 2O5YH 1SJEB 1RJCA 5A40E 2ZUQC 2PCPA 1J5OH 3TYFB 3ZMRA 3OR6B 3UEZA 2CXGA 3UTTB 3K2UL 3VXNA 2A77H 1MJ8H 2VSCA 3DJ9A 3SGDI 4R9HA 3NIDE 1CGYA 4EUPH 3W0WD 1ZANL 4KVCH 3HAEG 3O6LL 3MFGB 4D0BA 4MA7H 4LCCC 1QRKA 5HHOB 4HUXB 2CMRH 5A3ID 3U0TA 2BSSA 4P23A 4YEEA 2Q76A 3LKSB 1G7PA 5FGSA 2UY6A 3MRGA 4TNVK 5EOTA 3FB7B 3UBXB 1RURH 1JGEB 5I75B 3WL9B 3QYCA 2CLZB 4GS7B 5HI5D 3MODL 4MSWB 1P7QB 3SE9H 1D5ZA 2XZAH 1W8NA 5A3IC 2AXFB 1ZA3A 3VCLB 3ROLA 3ECBA 1PYWB 5DMJB 5HGBB 2WW8A 4JRXB 2FH8A 3MLRH 5GS0H 2BJMH 1IGJA 1VKXA 2K3TA 1FL3A 4P5KA 5HI5C 3PQYB 4N1CA 2A6IA 5L0QB 1T04A 5MEQA 3D3VA 4U6TA 4HCRH 5IKCB 3BPLB 1IGTA 3U9PH 4LKXA 1LE9B 3C2AH 3VG9B 2XN9E 3DVGA 3AU1B 2DJUA 4RAVB 3NOIA 1BD2A 3L3DA 2WZPD 1QSFB 1AXTH 4CN1A 3MRPB 5SWQA 1W0YT 1XCQA 2BVQB 3EW3B 2C4XA 1CTOA 3QQ4A 3GRWA 4S1RL 5BW7A 4AIZA 2BNUB 1BEYH 2R0ZH 5DC0A 4KY1L 5MEOB 2G75A 5FUCC 4CMHB 2V7NA 5D7JD 4EBQH 5HDBE 2VDLL 4RMUA 5HBBA 4JO4H 3QUYD 4LSRL 4QHNA 5IIEA 4Z77A 1RHHA 2IWGA 3Q6FA 2QQLH 4I77H 4JZOA 4LIQL 1F4YH 3TIEB 5E08H 3V6FA 3BKCL 4O2CB 4ZOBA 3QXDB 1R3HA 3EOAA 5HDQL 5CGMA 3BEVA 3O45B 4FNLH 5D7JC 4Y4FA 4OCNC 3LHPH 1X5KA 3HUJE 2WLYA 4I13B 3DX6A 3QUYC 1MCWM 3QIBD 1T3FA 2R1YB 4FHBD 2BHYA 3FB5B 5EBMB 3PGDA 4TVPL 4MCZB 3HE6D 4R7NB 4Y16B 4MNGB 1U3HB 2H45A 1YECL 4JKPL 4WTXA 3X11B 4G8GE 3INUH 5JXED 4GAFB 5H35A 3MGOB 4H20L 3QISA 1M7DB 2YRZA 3QIBC 4PRHB 4Y4HA 1MFAL 1UWXK 2XFXB 3W11D 1A0QL 1ZOXA 3C60A 3WO3B 2VITB 3L3IB 1D6EB 1ODAA 1LD9B 5IB5A 3HE6C 3VXRB 5E6IB 1J8HA 1PKQA 1MEXH 1FIEA 3ORJA 4PJEB 5SX4H 1QG3A 3TT3L 4GH7B 3NCYS 4L4VB 5JXEC 3KLAA 2HG5A 1GOGA 5FYKL 1JCKA 2NY1D 1AXSA 1H3WM 3TO4A 3P2TA 5CILH 5JR1L 1AD0B 3W11C 3ET9F 2BVPA 4P3CL 1XF5B 3EJZD 4NO0A 1L0QA 4KQ3H 1ZLUK 3G6JB 5CUSL 1TETL 3F7YA 3IFOB 2XNAB 4XPBH 3JV5A 5GGUA 2GIYA 4PJ5E 1AY1L 4MB3A 3OAUL 3QHZL 4EOWL 4HKZB 5H37G 5FYKU 3VWKA 3DTXA 4PTTB 2E7LA 5DJDA 4C59B 2X7LB 4ZPTA 3KYNB 1SHMA 1TVDA 4RNRA 2JELL 4IDJH 3BJLA 1MCEA 3EJZC 4WFGD 2ED7A 1JPSH 2FGWH 2X2YA 3S96B 3GKZA 1OLZA 3DSFH 1S5IH 2OJZH 2F19L 3H9SE 3HNSL 3GMNA 2DD8H 1U2CA 2W9DH 5ILTL 2X09A 1QA9B 2EH8L 1AGBA 3T77B 1A7OH 1T2XA 5IQ9B 1FCCA 2VXVH 1JGUH 3IAPA 1VFBB 4NPYB 5D1QB 4Z7VA 4X5XA 2WANA 5DMIL 1IM9A 2YD8A 2ZG2A 4K23L 2MPAH 1NJ9A 4DGVH 5HYQA 2R1WA 3HC4H 2JJSC 3E6HA 4DVRH 1Z9OA 2B4CL 1JE6A 1F3DH 2P4AB 5AAMA 3VDCA 2AVGA 1T5WA 2BP3A 3ARWA 3CVHH 4PJ7E 3GMQA 3NMEA 4OJFH 3GBMH 2GUOB 1JHLL 5DEFA 4NGHL 1P1ZB 4MJ6B 4JFEA 5JW5A 3P11L 4G7YL 5FB8B 1HNFA 2O61B 4OD3H 4M43H 2Y9RT 5D7IB 3HE7D 3EYUH 5FGRA 1CXHA 3WUWG 3WDJA 3SDCD 1NAMA 3EHBD 5KAQG 2FX9H 3VFWA 3QRGH 1SBSL 5AD0B 2ICWJ 4AQOA 2WBWB 2Z35A 4L8DA 4U05A 3V5DB 2O5ZL 2C7UB 2ICEB 1YPZB 4X6BA 4N0YH 5DHYB 4ZUSB 5IROC 5DRNA 5F88B 3IDUA 4MDIA 1QQDA 2RBLA 4U7KA 3SQOH 2PKDA 3PDOB 3WEXB 5ITFA 3HE7C 1TZGH 4AZ8A 2O26U 1U95A 1MAKA 3SDCC 1B0GB 3QFJB 2BNRB 3EDJA 3FO0L 4NQEA 2ZKHH 3EHBC 1BHGA 3DMMB 3IDNB 4M62L 5CCKL 4POZC 2FZ3B 4RMRA 5DFTA 2CR6A 5ETUA 1DFBH 3MA7B 1FC1A 4AH2B 4KDWA 1NFDE 4XCYA 5T3ZE 2VZOA 3B2VL 1A6TA 3PXJA 1T2QL 2GJJA 3RWEA 2OZ4H 3DRTA 4MA1C 4PRIB 5FK9A 1I4FA 3P0VH 4PGEB 3RUGF 4WTWA 4IOIA 4AT6B 1DLHA 5E5MB 4XCCH 3LRSA 2HKHL 1HHGA 2EDTA 1I9IH 3HI5L 3PGCA 1AP2B 4G7VH 1FNEA 4ZXBB 4NJ9H 2KPNA 1CFSA 3GO1H 2FEDD 4UQ3A 2A6KA 2IF7A 3K80A 5GGTH 3CCHA 3NACH 3PWLA 4KRNA 3PWJB 4G8GD 1IBGL 1VERA 4YDLB 4HS6B 5C0AA 4LLUA 5BRZA 5ESVB 5LGJA 4CKVX 1JL8A 3JWOH 1B4JH 1UWXH 2FEDC 3FO9A 1J86A 2EDDA 4HFUH 4JFFB 4QXGL 4W4NA 1OARL 5EZJA 3DARA 1DQML 3I02B 1DQQA 1I8KB 3ARXA 4OZHF 2X4PA 3AGVA 1T1WA 4KI1A 2UYLB 1FPTH 3MNWA 2H32A 1Z9MA 5BV7H 5CEYA 2HN7A 4PJBB 1CGXA 2ZOLA 3GMPB 3PV6B 3DROB 1ZLUH 4QOKB 3FTGA 4MQ7B 4Z78A 5EU7C 5I1HH 4XP6H 1RZ8A 4FZEH 5GGVY 2GT9B 4PJ5D 2EE9A 5FA4A 1OF2B 4LASH 1Z3GH 2ESVE 1KEGH 2QQKH 5FUZL 3QJFB 4OQTH 5ESQB 1JGLH 1FFNB 1FO0L 4XCEB 1NFIA 3GUTA 1NUFA 4X80L 1PX3A 2YR3A 1AHWC 2J88H 4EXKA 3HMWL 3H9SD 4Y4KD 1XR8A 3MNZB 4XBGA 4NKOB 3ZE0E 2Z92A 2X4NA 4OCMC 1UG9A 4P3DA 4UOJA 4AMKH 3OX8B 3IDXH 3OB8A 4NQSA 1TMCB 5D2NE 5JQ6H 1CD0A 4K3GA 1JYWA 5L7XH 4TUOB 3MV9A 4X8JB 2VL4A 3UYRL 2H3NA 4HS8H 5DK0A 1YMMA 3MLSH 4MDJA 1ZSDB 4LCWB 4M48H 4Y4KC 4FZ8L 3MRCB 5KSBB 3JTTB 1TZHA 3U0WL 4TULH 3GMOA 3LSOB 5E9DB 1QNZH 2B1HH 3MLXH 5IR1B 2EDYA 3CC5B 1WBYB 4NNXB 4O9HH 4M1DL 3EOYG 5JW4Q 1IKFH 1FSKC 4JFYB 4OUUA 3D18B 2NW3B 3D1MC 5CJBA 2Z8SA 3V8OA 5ACLA 1LK3H 1OAXH 4Z76A 3D69B 5GRXG 1CT8B 3A67H 4F7PB 4WVRA 1DQTA 5C0IB 4OM1L 4PJFB 5D93C 1FNGB 1J0ZA 3RKPA 1HZHH 1VACB 5I1JH 2IGFL 4QRTA 1CXKA 4Y5VA 5LQBH 1IC5L 3I85A 3TVMB 2Z31A 2APBA 3KYAA 1A2YA 4HAGA 3QIUA 5EFIA 5GIRB 4OM0L 2GAZB 4Y88A 4OZIF 4CJ0A 3VMNA 2CIKA 2YBRB 5LGKA 5E5RB 5FV1L 2BK8A 3M8OL 5F7MC 2F53E 2Q7YA 3HHRB 5CJXC 5CJOH 3TCLB 3GSVA 4LOUD 1EVUA 1BZ9B 3OB0H 2XA8L 2CDGB 4KXZH 3BISA 2CKBA 5JTWA 4P46D 2DBLH 3GSOB 4LSUH 3TPUB 1IARB 1EJOL 1IGML 1KULA 1KBGH 4QRPA 2PUQT 3MLPA 5DI8B 1GPOL 2D7NA 1KIPB 5FO7A 2F5AL 2HYMA 3P77B 3VRJB 1XGTA 2L7UA 1U8MB 4DGYH 3PL6D 3HCVB 4LOUC 4EIZC 5I1EL 4JN2B 5EOCJ 5HD8D 2X4TA 3DVFA 2YKLH 4P46C 4IS6B 5B8CB 3H6JA 4DW2L 4L9LA 2D4FA 1FG2A 5T5NG 2N56A 2C26A 4XX1E 2YZ1A 4AYFA 4X0KA 4EDXA 2PYEA 4GRWF 5GSVA 5JPNB 3S88L 4YPGB 4P2RA 5DURB 3CX2A 3K8MA 1X9QA 4I4WB 4NM4H 3PL6C 5GRWA 4JG0H 2HTKC 1LNUA 2X4OA 3IETA 1NUDA 4OZGB 4QT5A 5HD8C 4JRYA 3FFCB 5EOQH 2XQYK 3CFCH 1YYLH 3U30B 1MHPH 1KPUB 3LV3B 4ZSOB 1RK0A 2DL2A 2X4RB 3C5ZA 2QHLA 2GK0A 2AP2A 5J12B 4NKQB 5DK2B 2M8XA 3TT1H 3V7MA 3ZT7A 4F8TA 2DICA 2HJFA 4HGWB 1WCBA 5GRJH 3LKNA 4FFVD 5C0CE 4TNWF 3WIIL 3DX7B 2PW1A 4KRPB 1SEBB 2ZSWA 4PJIE 4M6MH 3VW3L 1EAPA 1AGDB 3VWJA 1CFVL 5JOFB 4JPIB 2R23A 3QCUH 4X99A 4XPGH 3DETD 1AKJD 1NBZB 1EDQA 3V79C 2WK2A 2I24N 4ALAH 4FFVC 1JWUB 5D1XA 4BSVB 4JFXB 4F7EA 3JTSB 2ADFH 5L8KB 4JO3L 1DQJA 5CSGA 3OXRB 5B39B 1UM6L 1L7IH 2ESVD 4JB9H 3RWGB 4NHCH 4O2EA 1DQDL 2ITDA 5FHAL 5L9DH 2HJKA 3DETC 4YXKL 4GLRH 1BJ1H 3GGWB 4L8BA 4OLYL 3L3KB 3CMOH 1O7SA 2YWZA 5IB4A 2APFA 5H94B 1MWAH 3O2DA 4UTBL 3REWA 2WINB 4U6YB 3MSPA 4HWZB 1A6VL 1M1SA 4XGZA 3WIFA 4NDMB 4CADB 3LB6D 3RU8L 2A0LD 5D7LA 4MJIA 5CZVL 4GG8B 3J7HA 3B2UD 2MCPH 2IH1A 4RZCB 3AS2A 1R3LA 5GRZA 4JM4H 5LG1A 3WIHL 4ONHA 1UXWB 4QRRE 4NN7B 1PG7H 2HRPH 3L6FB 2Q86A 4G6KH 4O5LL 3TGXA 4X4XB 3SDAD 5F8RC 1BBJB 4OCSH 1CU4L 5DO2D 3V6ZB 3O3AB 2FJFA 4NQVB 2A0LC 2NY3B 3DX8B 4R7DA 1FVCA 5D2NC 2BSTA 3B2UC 1EO8L 1NBVL 1G6RL 2ZCHH 3QNZB 5LAXA 4EUPA 3NA9L 3IXAB 5SX4I 1I3VA 3LDBC 2W0FA 4G80B 4FQIL 3NBNA 4PJXE 5IESH 3SDAC 4ZNEE 5DO2C 1CLYL 4YAQB 5DXWA 2VZVA 1A6WH 4LNVA 2VZSA 3E1F1 2YUZA 3IFPB 1FE8H 5J3HD 5F1IB 4A6YB 3HLAA 4HJGA 4NC2B 1YYMH 5HYJB 4XCNB 4GG6A 4ZO9A 3QUMB 1GSMA 5KSUB 2VLLB 4PJGB 4YDKL 1NGYB 1F8TL 2JJWA 4U1IB 1URLA 4UUJB 1ZWIB 5GGRA 4WUUA 4FQHA 1S9VB 1D9KD 4Z0XB 4MD5B 3HZKB 1DDHA 1WITA 1EUUA 1BQLH 2F53D 4L3EB 2ZP0T 5KG9A 5J3HC 5E00B 5E56A 3T1FA 5JW4N 1CDGA 2Y4SA 1E0OB 3GSRA 4P59L 5LXGL 1TQBC 2V2TB 4ZS7L 4JVPA 4HH9B 1KJMB 3LY6A 5TF1L 4APQA 4LFHG 1D9KC 3UYPA 5TE4H 3SEPA 1JJUA 4Z7WA 3L5JA 1YQVH 1X4XA 5FO8A 5H2BA 4HCRA 2CRMA 3NFPA 4JJHA 1YC7A 4WV1C 3E2HC 1A4JB 4KUZH 3VXTB 1FV1A 5DRWB 5T1DL 3RNQB 1IAII 2E8ZA 4UAOB 2ID5A 1DVFA 1PBYA 4J6RH 3HRZB 4EI5B 2GY5A 1LO0H 2DMBA 2R1XB 2YEZB 1T0MA 2VLRB 2OS7A 3T2PA 4WW2F 1X5JA 3TBWA 4HAFA 1AJ7H 5CWSB 2EYRA 2R15A 4FQLL 3S35L 1G7HB 4FOMA 2WWKO 5DS8A 4PY7A 4JCLA 4GSDL 4WI4A 3P0YL 1FGNL 3U4AA 2ZUXA 4JANA 1I1YA 4Q9CA 1JHTB 4JG1H 4JFZH 1A6UH 4LPCA 2EEAA 4D9RE 1CICD 4YBLC 4GXVL 5IVOA 4P5TD 3GRWL 4QRQB 5SV4A 3EO1A 3PHQB 2JB5H 3S5LG 4WI8A 1UJ3A 1RZKL 1E6JL 4CNIA 5IEHB 4LLWB 2BC4A 4JM2D 3FRPG 5T1LD 3EAKA 3WMSA 4PTUA 5D70L 1A6ZA 3LD8C 1JPGB 4FQXB 5LCVL 2BVQA 3AS0A 1HNGA 2BVOA 1CICC 1EXUA 3WJLA 1CXEA 3WSQL 3ARDD 3KLDA 3QBTB 1XCTA 4P5TC 1FJ1B 3OV6A 1XGPB 3TYGL 4O51B 2Y25A 4JFDA 1OAQH 4M6OH 1D5IH 3RAJH 4MXVE 5EA0L 2RHEA 5JMOC 3D25A 5D6CB 3CH1A 3QEUA 4D0DA 4NWTL 1KPVA 5F8QC 3SO3B 3KXFB 4JEGB 1BD2E 2AW2A 3JBG7 1UCBH 5C0EB 4YHIB 5EIVA 3ARDC 4KMLB 4LU5H 1UKSA 4MXWL 1AO7B 1M05B 5DTFA 3P4MB 3P4LA 2ATKB 3O41A 1MPAH 3DRQB 3HI6H 1QPPA 4ZPVB 5I6XB 2CJUH 4D8PA 3AMLA 2R69H 3MV7E 4X9HA 1DBKL 3WD5L 3IFLL 2DJ4A 2FD6L 1JNJA 2BERA 1R5IB 5GS2D 5A2LH 2QHRL 3U0PA 2BFVL 4EI6B 3U7WH 4QRRD 5EO0B 4GRMA 5CBEA 5C0FB 2HLAA 5CJ5A 3N85H 1QRNA 1RMFH 3CFIC 4M00A 4YZFE 5FF6A 3QUXB 1X5FA 5T3XE 4C4KT 3HR5B 3L7FA 1EERB 4NZRL 5EU6D 3R1GH 3PABB 5F97E 1G9ML 3K4DA 1WISA 2G60H 2LU7A 2OR8A 5BS0B 3VE0B 4EN3D 4M3KB 5KN5A 1MQ8A 5EH1A 1PEWA 1DQLH 1IC4H 3CGTA 5HPMA 5SWZE 2G5BA 1TTGA 5EUKA 1I8LC 1NMCB 1TVHA 4P9HL 4QNPF 4QTHA 2P24B 5FOJA 3A6OA 4W81A 1HOCA 2EEBA 4HWUA 3IRZA 1RJZA 1Y0LB 5I66B 4RX4A 2ICWB 2X05A 4EN3C 3OKOB 4LSSH 3BDYL 3EFFA 1VADA 1LEGA 1MFBH 4FP8H 3Q1SH 3QSKB 1BFSA 3G08B 3CVHA 5FUOH 3RY6A 2X7LA 3O8XA 4L5FL 1EGJA 3ZLQC 4Z8FH 3W9EB 1P7KA 2IQ9L 5AWNH 4YQXL 4WFFE 2ZSVB 2C1PB 4ODUA 5LWYH 1ZA6B 5IMOB 1NCWH 3MROB 3GI8H 3V0WL 1QO3A 3NIGF 1KT2B 3NABL 4P99A 4AK1A 4XNZC 5MERB 4LARL 1U93B 2BX5A 5FYLL 3IB4A 2AK4A 4UDUA 1QHPA 4UBDC 4X6DB 5CSBA 1N0XH 3JV0A 1S7WA 2XTJE 1XGRA 1JMZA 4NCC1 1YMHB 1PQZA 1R24A 1IC1A 3B9KB 1A7BA 3R4DA 4G8IA 3RPIA 1ITBB 1PLGH 1NEZG 3L7EB 4WWKB 1UA6H 1XF1A 1I8IA 1S7VB 3V4UH 2EYTB 5DFVD 5DJ6B 4MS8D 1YEGL 3QDME 1NAML 1H5BA 5ICZA 4ZO8A 4PJ9B 4U6VL 2OZ4A 2FLRT 2NY5H 4KJQD 1LEKA 4G6JL 3FAXA 5DDHB 1ZVYA 4GRLB 4R96B 1NLBL 3GNMH 2XY1A 4JQIH 3JWDH 3UO1H 5IJVA 4N9OB 1PZ5A 5DFVC 1IZKA 4HIHA 4OF0A 4KZDL 1UWEH 4MS8C 4ELMA 3P9WB 3LZFH 1YEDB 2YK1H 3BPOC 3ZHLA 1HH9A 3RZCD 5JZ7D 1D5BA 4TNWK 2IALA 5J6HA 4HHAB 3SDDB 1A3LH 4KJQC 1W0WB 1PEZA 3BVNA 4JFPB 3NAAH 1NBQA 3D39B 4FFYH 2FL5B 1A7RL 3EKCA 3MRBB 3QJHB 4X6CB 1EAJA 4Z7QE 3C9NA 1JUFB 3KS0J 4DUWA 5E99H 3IDNA 1XGYL 1EHLL 2NLJB 3VFUA 4XVJL 3RZCC 5JZ7C 1PFCA 4KHTL 4E42B 5IVXB 4XRCB 5KS9F 2EDWA 2NTFB 4P9MH 3H9HA 5HGGS 2DMCA 3WFDH 3KR3L 4XCFH 1BD2D 1HI6B 4CMMA 3S37H 1JRHH 4R26L 5D5MF 2VDQH 4PRPB 2AEQH 3SKOA 1UFUA 2ATPB 1ACYH 1UENA 2A9NL 2VJXA 3EZJB 4AIXA 5KSAA 1SEQL 1DR9A 1ED3B 4XNYH 4RWYL 4BZ1H 4Y1AA 4WWID 4D3CL 4PRBA 3DXAB 3MV7D 3BAEH 3BIKA 3QP3A 4OFPA 3LKQA 3RI5K 5EUOB 3RFZC 2CRYA 1J11A 1FFOB 5CEZL 1HIML 5AYUL 3ZYOA 3ULVH 4OQTA 1IEAA 3NFSH 4XP9L 5BW7C 2OL3H 4ODBD 2BY2A 3QEQB 1RZKC 4OZIB 4Y4FD 3RL2B 1T83C 3GSUB 5EORL 4NN6C 2ADGA 3QH3A 1FCGA 1YDPB 5JMRA 3CU7A 2ZUQB 4DUXA 4HPOH 3CZFA 5DJ8B 1MCRA 1U3YA 3EBAA 1FVEB 1E4KA 1C5DA 1VGEL 4G43B 1CK0H 2IQAA 2N4IA 4Y4FC 4ZUVA 1NCBH 1J0YA 4ONFH 4LCCB 3WUWB 3I75A 3TP4A 5HGHA 4HBQA 1E6OL 2OLDA 3UJTH 1R3JB 3C60D 4X4ZA 1AQDB 5I1CH 2IPKA 3AMKA 3LMJH 5I15H 1J8HD 4S0SD 2X6MA 1DANT 5ERWB 2N7BA 4GW1B 4JY5L 3KWWA 1JGDB 2CLRA 1QLFA 4CVXA 4PJHE 5DD0H 1G7QA 3E6FB 4WFFD 1G9NH 3B5TA 1TITA 4GLRI 4BQCA 2R0LH 3UXFA 2RCSH 3C60C 3H7BA 4ONGH 3PIQB 4QO1A 3VXQA 5C9JB 4JO2H 1Q72H 1Y18B 1YEIH 4E41A 1CF8H 1WIUA 5BVJA 4Y0GA 3ZE1E 4WRLA 3FT3B 4JPKL 3S36L 4UV7L 5DVLA 1ONQA 1BOGA 2HP4A 5C07B 2VISA 4S1QH 3L5XL 2Q6WA 1NC4A 4FFZL 1MRFH 4YH6A 1D6VL 2XTJD 4M5YL 1G9MC 3VFOB 5L6YH 4GKSA 5BVPL 3GZKA 4EEEA 4L3CB 4LCUA 3M17B 4ORGB 2Y5TA 1I1AD 3QDJB 4XNQB 3G04A 5CP3A 1WBXA 2QQNL 3QG6B 1LO3L 4YNYA 3ZHDA 1L6XA 2SEBA 1QZ1A 4GRWH 5DEGB 5FECA 2XTJC 3DX9B 3QDMD 2P7TA 1KB9K 4X7SH 4P57A 4FN0A 3GIZL 4NRYA 5FOBA 3NTCH 4PV9A 4AEIL 1IM9D 2J6EH 4N9GB 1EV2E 1IFHH 4PG2A 2C3VA 1I1AC 5E8DL 4P2QB 3UJIH 4ZFOL 3OJMB 4J3WA 1SM3H 1K4DB 4HWEL 4MA8H 4RGOL 1NDMA 1XF3A 1CFNA 3U1SH 4WHYG 2VTFA 1YEFL 4LHUD 2VLJE 4KVNH 1A3RH 5D7JB 2E6QA 1ZHLB 2BSED 2Q8BH 4UB0H 4GKNA 1VGKB 5FCUH 2PNDA 1YEHH 3S35X 5GS1A 2I5YH 5E2UL 1N6VA 1YUHB 3IJYA 3KHOA 2AGJL 4YUEL 3GSOA 5ITBH 3VI3E 4YHMH 2WQRA 5E8EB 2QR0A 1P4BL 1I1RA 5DC9B 4B7IA 2FJGA 5JIIA 1T03L 1RZIB 2H1PH 1XH3A 4WHCA 1S7TA 3QIBB 3MLWL 4M5ZL 4K8RH 2CDEA 3CIQA 3BE1H 4Y5YC 4A2MA 2NXYD 5DMKA 2A74A 2P5EE 5C09A 3KGRA 1GZQB 1EPFA 3MJ7A 1ZEAH 1CLOL 1T7VA 4OGYH 1AGCA 1A14H 1MFDH 4G3YL 3STZB 3T2OA 4DGIH 5JXAL 1DUZB 1P2CB 1R0AL 1N5AA 5DJZB 3C6LA 5CIPB 5F96L 1OCWH 2XTLA 2A6DB 2G9HB 4OAWA 1FYTB 2NXYC 3V6OE 4KZEL 5DUML 1KPUA 4WY7L 2VH5L 3O2WL 4RA3A 5BO1H 5FKPA 4JQXA 1D5XB 3LS5L 2UWEB 4I0PB 2FATL 1TLKA 2BDNL 3CFDB 5IBTL 3RVUC 4ZYKA 4LCIL 4ODVL 4PUBL 4LPTA 2D9CA 1MWAA 1CFQB 5HGAB 4PRAA 1JHKL 3UZEA 1DTUA 4XVTL 2AEWA 4JFOA 1Z2KA 4MA3B 3AY4A 3HPJB 3SOBL 3P73A 4JRYE 5FDWB 5MEQB 5DZLA 4YHOH 1EEQA 5ADOH 1WJ3A 5F7KC 5IFAH 5DD1L 3O6MH 5C0AD 1MUJA 5E2VH 2A83B 4U1NA 5BRZD 5T1KB 3VD3A 3V5KB 4UOW0 4JPVL 2XWBB 4JFXA 1PY4A 2WLZA 2NY7L 1FIGH 3O2DL 4AENA 1G7LA 3V52H 3IF1B 3PWVA 3ZTNH 3QNXB 4KMTH 1JTPA 2UUDK 3WXVL 4D0CB 2A6JB 1VFMA 1ZGLP 1AGFB 4MLSA 4DKFL 4YXHH 2AERT 2H8PB 2W59A 3CFJA 2Q8AL 1N64H 3BKYH 5K9KA 4UQ2A 1KPRA 2E5EA 2ARJQ 2P44B 2F5BL 2WP3O 4WO4A 1HINL 2VXQH 3MNVA 1AGEB 4YXLL 1FL6B 3SDYL 2O5YL 3L95A 3SKJH 5F9OH 1J5OL 1WC7A 4L8CB 4JJ5B 1JNLH 2A77L 1MJ8L 1E28A 2EE3A 3LRHA 2OJEB 4M61A 2YPLE 1XGUB 3RWFA 4KVCL 3QXAB 1UB5B 3EOTH 2P5WA 4MA7L 4I1NB 1CD8A 2CMRL 4ELKA 3MBEA 1S9XB 2IH3B 4X9FA 1DZBA 1BQHA 3HE7B 3RDTA 3H7LA 3SDCB 1A47A 5BQ7A 3LN4A 3U48A 4TQEH 1RURL 2CLVA 1YJDH 2DS4A 3G5VA 3BD4A 3MV9D 4FQ1H 5FFLA 5E2WH 2HKFH 3R06B 3BZ4A 3VFVB 3BX7C 5IM7A 4CJ1A 3SE9L 4WU7B 3BD3A 2YD2A 1K6QH 3F6IA 1C16A 4F3FA 5I2IA 4DKAA 3MLRL 1S9YB 2BJML 2VLJD 1NGZB 2DQJH 3B3IB 4PJCF 5D1ZA 5GGSB 2VO5A 4DOHE 2FYYB 2M26A 2E9BA 4OKDA 4UIMA 4HCRL 1BFVH 3X14A 4YEFA 3BIAX 3U9PL 4Z7UF 3NPZB 3C2AL 3VGAC 3WCYA 3WBDA 3HC0B 4BKLB 1SYSB 4HBCH 4HH9A 4HIXH 5D2LF 4F57H 1HQ4B 4GMSH 1JF6A 4Y19A 5EU4A 4C55A 1AXTL 3C5JA 5GJTH 2KBGA 2Z31D 3BP7B 3DURA 3IU3A 1S7QB 4NKDB 4QHMA 4HLJA 3KYKH 1BEYL 2R0ZL 3OKKB 3SE4A 5GRVL 4M8VA 3DI2B 1A64A 4HJ0D 1PY9A 4MAYA 4EBQL 5JO5A 1WFOA 4JO4L 3TN0B 1ZVHA 1CDHA 5EIQA 3CUPB 4OD2B 4I77L 1YZZA 2YEZA 4G8GB 4Y5VC 1INQA 4OQ1A 1F4YL 1H0DA 2Z31C 5E08L 4U6XA 3UTTE 3MODH 5F3BB 1DCLA 4PP1D 1BAFH 5F9AC 4HJ0C 4FNLL 3OJVC 3LHPL 1OAUH 3KLSA 5I76B 1T80A 5HHOE 5B38A 5E1HB 3B8YA 3NPSB 3MREB 3LQAC 4P2OA 3RWIB 2VN4A 1K5NB 2HVJB 3FFDA 3IJSA 2LAGB 1JNNH 4RMVA 1HHIA 3FQXB 4PP1C 1A1MA 4XHQA 5CP7B 2PYED 3DBXB 4KJWD 4YGVA 2ZOKB 4C57C 4S2SA 3INUL 4CU8A 5IQ7L 1KTKE 1AHWB 2PF6A 5IHUH 5DQ9B 3V6OC 1FN4B 4M3JA 4PJ5B 1HDMA 4HIEB 3TM6A 4JRYD 4MHHI 1JPGA 4K9EH 4TVSa 3BZEB 5LGHH 1HWGB 1LP9F 1WTGT 4JRXE 5D7KE 1MEXL 4NO5A 5DJYA 4KJWC 4PP2A 4PRNA 5IW1B 3RWJB 2YRPA 4OZFH 4NOBA 1GC1H 3C5ZD 3X13B 2I9LB 3D85A 1HYRC 1NDGA 4MX7B 1N3NA 1Q9LB 5LBSH 5LVEA 3EFDH 1YNLH 3IJHA 4Y4KB 4I2XA 4PBXA 1B2WH 2F74B 4NN5B 1EEYB 4Z7OF 4XC1H 4KQ3L 2J3SA 2W0LA 1QFOA 2W60B 1IGIH 2UUDH 1U91B 1EMTL 4XPBL 1QFWH 4YC2C 1JRHI 3PWPB 2X41A 2X5PA 3C5ZC 4O2FB 4KJPD 2I27N 3KPRA 3KNBA 5IEKB 3S4SA 1J8KA 1ZT1B 1PSKH 1X7QB 1EK3A 3S6CA 1KCVH 4IDJL 4TVPH 3K7UA 3SCMD 1ZHKA 5D1XD 3HAEA 2F8OA 1XF2A 2HH0H 2MMXA 1JPSL 2FGWL 3BUYA 4X98A 3BWAA 5D93B 1S5IL 3O3EB 1FNLA 3H0TB 3NH7H 3BRFA 4UV4H 5BZDA 1HHKA 1YN6A 2JCCF 4KJPC 4PB9H 1N6QH 2DD8L 2W9DL 4M4PA 1MFAH 2J8HA 2YPLD 5AUMB 1I1CA 1UWGH 3OKLB 3VG0L 3AB0C 2W65B 2VXVL 1JGUL 2AQ2A 1EFXA 3ZYJA 3SCMC 1NANH 3DHMA 3I50H 5D1XC 3RWCB 3O4LB 5FA3A 3ZHKA 3GJEA 2MPAL 4WEBH 25C8H 4DGVL 3HC4L 4DVRL 5C6WH 3CSBA 2YC1A 2WUCH 4HUVA 2I25N 4FQQA 1FL5B 4QCIA 5C0GB 4K3HA 1A1NB 5TDNB 4MJID 5FCSH 2F9BT 1CIDA 2GTZA 4Z95H 3D0LB 4LLVB 3F8UB 1ND0A 5F9JB 4B50A 3CVHL 1H15B 4HIJB 4OJFL 3S36X 4DQOL 4PRHE 5CS7A 2XKUA 3GBML 4Y2OA 5HJ3B 3RUGA 1T1ZA 1AY1H 1B0RB 5BXFA 5J8OA 3IT8D 4PV8A 3S5LB 1MCFA 4P46B 2G2RA 4W4OC 1HKFA 2NNAA 4OD3L 4ZG1A 4FQCH 2VDRH 4M43L 1RY7B 4E5XA 5E7BA 3EYUL 5HPOA 1T21A 3HZYB 2FX9L 3QRGL 4JZNB 3I6KA 4R3SA 1H3GA 3D0VA 4XC3H 4WIQA 3W5MA 4M6NH 5FGCB 1IQWH 1BWWA 3UPAA 3G6JE 3AROA 4F9LC 3VGGA 4PJDB 3SQOL 1TZGL 3VXOA 1U93A 1JI1A 1TTUA 4GFTB 4WUUD 4XI5D 3ZKXC 2ZKHL 2A38A 4HS3A 4P49A 3BN9D 5ACZB 5GXBB 4PJAF 4ZTOH 2DQGH 1DFBL 3G5ZA 1DBJH 3UJJH 4Z7NE 1OLLA 2OZ4L 1WWAX 5GS0D 3P0VL 5FO9A 4OZHA 3UTTD 3B8SA 2J8UF 3SY0B 4BK4A 1J0KA 1PDKA 3FOLA 3PWNA 1J10A 5J1SC 4TOYH 4XCCL 3EYVA 3BN9C 5KJRH 1I9IL 2DLHA 4ODWA 4XNUH 2VE6B 3VGDA 5HHQA 1UKTA 4I5BB 4G7VL 1JNHB 1UM5H 3QRFM 4NJ9L 4LSVH 5JDJA 5I1DA 4HDIB 3GO1L 1CGSH 1DVFD 1SY6H 1FFRA 5GS0C 5GGTL 4CGTA 5L88H 1WICA 1ZT7A 4JLRB 3VFPB 1KGCD 1P53A 1MCQA 1I3RB 4UIKL 4X6FB 3S3JA 5J6GA 4OLUH 1P7QD 3KYOB 5JORA 2Z4QA 2XWTB 5DF0A 1R5VB 4G8FA 3JWOL 1B4JL 1DVFC 1N0LA 4QXTA 2ARWA 2AV7A 5GZND 1J0IA 3X12A 5INCA 3U79A 1SVZA 4JRXD 5D7KD 1K8IB 1LO2H 1S7RB 4MAUH 5I75C 1BQSA 4NQDB 5CBAB 4GOSA 5D7IE 4N8CH 4WHTA 1S9WA 3W5NA 4TRPH 4LKCB 3L3OA 1FZJA 1Z0MA 3OJ2C 3MYJA 2VQ1A 1FPTL 3FQNA 5CSZA 5GZNC 4MJ2A 1LEIB 1U8HA 2FO1A 4ACPA 4NQXB 1YPZE 1UVQB 2E7CA 4MLIA 4H8WH 5D2NB 3MRJB 3OAZK 4QHLA 4XP6L 4FZEL 3HI5H 4UU9A 3OR7B 2D31B 4N8VA 4AM0B 4CVZA 3QFJE 2BNRE 1Z3GL 2ZZUT 1KEGL 1LK2B 2B5IB 2EKSB 2QQKL 4OQTL 2XWJB 3BPLC 4RGNB 1JGLL 4GT7A 3WLBA 1TNMA 3SDAB 1C7SA 3VG9C 1XIWA 4GAYB 4UNTA 4JFDD 1CDJA 1I7UB 1UJ3C 2J88L 1KG0A 4XMKH 5D9SA 2FR4A 4ODXA 1IGYA 1XZ0A 3ARSA 3MUGA 1MFCH 2IJ0C 3F7QA 2YUXA 3MO1B 4PRIE 3U6RB 1X6NA 1RZGA 3BYYA 1RU9H 1FO0B 5HDLA 4HFWB 4N8PA 1DLFH 3LKOB 1WT5A 3WJLC 5T1MB 5E8PA 1ZHBA 4AMKL 1S5HA 3IDXL 1HSBA 5F9DC 2EDJA 3QNYA 1LWRA 3UTOA 5JQ6L 2DIAA 5L7XL 4XBPA 3NZHH 5EBLA 3RNKB 2YD4A 4M48L 1FRGH 4LF3A 1E27B 3BWUC 4PS4H 5F7HA 4TULL 4I3RH 2YA1A 1JF1A 1QNZL 3ULSA 4M4RA 2B1HL 2GQHA 1U3HD 3MLXL 2FECI 4ZFFB 1E4XL 3CPLB 4IHOB 2DWEB 2RQ8A 3WJJA 5CEXA 4O9HL 2EDBA 2R0KH 3QUZA 1IKFL 1G7JA 1T7YA 3MRNB 1QRND 3GSNB 1T0NA 4OZ4B 3E2HB 4YFDB 1LK3L 1G1YA 3BFOA 2UVEA 1OAXL 5ALCH 3A67L 4JFFE 1U3HC 1DSFH 4NQCA 5I16B 4UINH 2PTTB 3TBVB 1HZHL 2W9LA 4WI9A 5IOPA 1HXMA 5I1JL 3AREA 4A6YH 5LQBL 4JAMB 2FJHB 3NIDF 5DWUH 4XXDB 4UMGA 2J6EA 2AJSH 2X4QA 1CE1H 3SKMB 4WW1A 1A7NH 1BZ7A 4PJBE 2PW2A 4RX4D 4LNRB 1ETZB 3G5XB 5CJOL 3FT3A 1NC2A 5ID0B 2FO4B 2YD5A 2V2WA 1CD1B 3I2CH 4F58H 4BSWA 2DBLL 4LSUL 3BN3B 3O8XD 2V9RA 1KBGL 3IXTA 1OQOA 5J13C 5JDSB 1DBAH 3EO0A 4HZLA 5HYFA 2I60H 1ADQH 2ZUSA 2OXGA 4DGYL 3W39B 2P49B 1FFQA 2BOBB 4WTZA 1KCRH 3CSYA 1A9EA 1XGQB 5IVZA 3LD8B 1T4KB 4L8SA 4MNQA 1CICB 2YKLL 1GIGH 2BNQA 3RY6C 1G6VK 3O8XC 5I8EB 4RMSA 3VMPA 2PYFB 4O02H 1HN1A 2EDHA 2KQNA 3TBYA 1SJVA 3H42H 4V2BA 4PGBB 4XH2B 1DEDA 4NM4L 1F5WA 2OR9H 4LCWE 4JG0L 4EUPG 1OTSD 4OFYD 3K4AA 5T3XL 4WFHD 4ZUTA 3QB7C 5EOQL 5I17A 1YYLL 1MHPL 5HY9A 4DWHA 4EZMA 3I3DA 2ICES 4PR5A 3ZL4H 2DYPB 2EDKA 3RX5A 4HSQA 1KCLA 3TT1L 5DRXA 1K4CB 1N4XH 4LGSB 1OD7A 3FZUD 1OTSC 4HT1H 5D6DA 5HDBF 4N0FA 4NNPH 3ZYZA 2P8LA 4NHUB 1Q9KB 4PLKD 4PJFE 4OF8A 4U1LA 5IMMA 2C4FT 4WI6A 1QVOA 2NX5A 2PETA 4X7CC 1WEJH 2FX8H 2VMFA 4WEUD 4M6ML 5DHVB 3WFHB 3Q48A 1C5CH 2IADB 3MOBL 1TENA 3QCUL 4JY4B 4U31A 1PAMA 4XPGL 2IC2A 1NGQH 1C5BH 2OMNA 3AXLB 3HUJF 1YQ2A 4HKJB 3EYSH 4BQ9A 8FABA 1WV7T 1JK8A 4PLKC 2ADFL 4I48B 2JJUA 5ISZA 2BRRH 1HHJB 3CFKA 4QRRB 3QFJD 5D7SH 1L7IL 1LDPH 4JB9L 3DMMD 3K8KA 4NHCL 3WN5B 1HXYB 3ULUH 5L9DL 5DJ0A 4DKEH 4WGVB 3L1OH 5EU6B 5IB1B 5IW6A 3RWHB 3V95A 2AJYH 3CMOL 5A1AA 1G7IA 4TN9A 3DVNA 3N1GC 4KQ4H 4YHNA 3P9LA 4PRID 1MWAL 3FCTB 4DJMA 4I3GA 3QDGB 2P8MB 4F7TB 5F9WB 3U9UB 1JTTA 2WUBL 1TJGH 5ESAB 5DVKA 3MV8A 4N0RA 1NGWA 2M2DA 3UPCA 1CZ8H 3CXDL 1IT9H 3R0MA 5C09E 2MCPL 1WCQA 3U36B 4OCYH 5E0QA 2AXGB 4JM4L 3KHQA 4OI9A 3BMWA 3ZDYF 5KSAD 1PG7L 3LN5A 3BW9B 4G6KL 3C8DA 3RTQA 4OZGE 4KRMB 1SMAA 5D2LB 3FFCE 1F6LL 4NRXB 2NY4D 3MYZA 4L29A 1X5LA 3CX5J 4IIQA 1VFAA 4XNZB 2ITCB 2ZCHL 4ZSOE 4YDVB 3UTZB 3ZYIA 5BV7C 1JPFB 5KSAC 2ADIA 3L5HA 5TJWK 5BOPA 2YZ8A 4BH7A 4DCQB 3GMMA 1J18A 1A6WL 4JFFD 2H2SD 3SDXB 4QTIH 2NY4C 5CMAA 1FE8L 3O9WA 4NUJB 4WW2A 2R39A 4YDLC 1HK6A 1YYML 3EYOB 12E8H 1OWRM 1QFWI 3NGBB 3IVKA 3EYFA 1FVDA 1OAZH 1OGTA 4XWGH 2C1OB 1KTLB 4BM7A 1M6OA 2QQQA 5GZOD 1YNTB 3WNPA 4RIRB 1T1XA 3Q0HA 2KDGA 5E4EB 3RU8H 1BQLL 1TJHH 2H2SC 2BY3A 3BEWA 2PCPB 3JXAA 3HG1A 1K3ZA 2DQEH 3BP6A 3KPMA 3LS4H 4HPYL 3T0BA 3T3MF 4U49A 1HCFX 1JGVH 1FYHB 3VXNB 4CU7A 1DE4A 4YGAB 2OJEA 5TE4L 3GMRA 3HN3A 5GZOC 4D0BB 3F7PC 3BPOB 1YQVL 4PJ7F 2VQUA 1NANI 3U0TB 2BSSB 2C3GA 1U8QA 1WFNA 4KUZL 4P23B 3U2SA 2VLMD 1IAOA 1CGWA 2Q76B 3QWRA 4X4MA 1G7PB 4XAKE 4E41D 3MRGB 5EOTB 4J6RL 5I18H 3VGBA 5AG8A 5DQJA 1LO0L 2ADJA 5IMLA 1ZS8A 3SE3A 1AJ7L 2X42A 3FO1A 1D5ZB 4LCWD 4L4TA 5ELIA 1ZA3B 3HMXH 4NBXB 3ROLB 3ECBB 3EOBA 1UH3A 3D9AH 1RFDH 2GEEA 3DV4A 1IGJB 1WZKA 4LSTH 1VKXB 1SVCP 4JG1L 1MY7A 3NN8A 1A6UL 1FL3B 4P5KB 1ZGLA 2A6IB 1T04B 3D3VB 1ZVSA 4W70A 3RP1A 1IGTB 4LKXB 3AUVA 1UACH 3QA3A 1NFDF 4JZJA 3DVGB 4U7MA 2APTA 3T2QA 2JB5L 1BD2B 5TE6H 2QADB 5AYQA 1LO4H 5SWQB 1XCQB 5C08A 5I1AA 5HYJE 3AAZA 3TVMD 3QQ4B 4PJGE 2DMKA 2V6HA 4AIZB 3KPNA 3BH8A 4KRLB 2G75B 4YHZH 2V7NB 3KPOA 4HUMB 4X9GA 4PG2C 4L3EE 4HUWA 4N68A 4QHNB 5IIEB 1OAQL 4Z77B 1RHHB 5C1MB 5IHLB 3Q6FB 4JZOB 5IWLA 4M6OL 1D5IL 1HKLH 5H37H 3RAJL 2D4DA 3BDXA 1KEMH 3V6FB 4FQLH 3TVMC 1QSEA 1R3HB 2HLFD 1AC6A 3EOAB 1IAMA 4OZFA 1UCBL 5C6PB 3BEVB 3LEYH 4PREA 4Y4FB 4TPRH 1CLCA 5KVMC 1MOEA 1T3FB 5GS1C 3OKNA 3VD9A 3PGDB 1MPAL 3HI6L 3MREA 2CJUL 1MRCH 2HFGH 3QEGH 4NNYA 2E7BA 3O2VH 3CNKA 2HLFC 2R69L 3B43A 4JPWL 4NO3A 1ZTXH 1CE6A 4DVBA 2ZG3A 4ZDHA 5CGTA 5C09D 2VLRE 3U7WL 1T1YA 4Y4HB 1E6JH 3N85L 1F4XH 1RMFL 3OJDA 3C60B 3C6LD 1BIHA 5IB5B 3R1GL 3FFCD 1J8HB 1PKQB 3EJYD 3QT2A 5EIIA 4XXCA 3V4PH 2J8OA 5I0ZA 4HLZG 4XP1H 1DQLL 3RA7H 3KLAB 2HG5B 5I74C 1AXSB 3TO4B 3HS0A 4EIGB 4ZD3H 5EA0H 4JRWA 2VDPH 2BVPB 3C6LC 3DV6A 3KPSA 4KGJA 3RZWA 1NCDH 2ED8A 4NWTH 1BF8A 4NO0B 1IQDA 4OT1H 3EJYC 3VFSA 3F7YB 4KRPD 2WBJA 3MRIA 1H8SA 4LSSL 5GGUB 1NSNH 3MRMA 1MFBL 3VWKB 1KXTB 5C3TA 1R3KA 3DTXB 3Q1SL 4FP8L 3ESVF 5DJDB 4QGTA 4XMPH 4ZPTB 2XTJB 4X8XA 2V2XA 4RNRB 5FUOL 3TA3A 1INEH 1IAIM 5KANG 2XZCH 3D87B 3CFBA 5DA4A 5EO9A 1KJVA 4X7DC 1CCZA 5AWNL 1C7TA 4LLYA 4KRPC 2PTVA 1FLRH 2LABA 1RZFH 5LWYL 1CWVA 2X89A 5CJQL 3AY4C 1MVFA 1ORSA 1NCWL 3GMNB 3GI8L 1AGBB 5EC1A 3KXFE 3T2NH 5KVFH 3LAFA 4M03A 1EBPA 4Z7VB 3T0XA 1AO7E 4X5XB 5EOCH 1IM9B 2AJ3A 1NJ9B 4KROD 5HYQB 1MELA 1LVEA 5MHSE 1N0XL 4X7TA 2GITA 3E6HB 5JA8B 4WI5A 4WO4D 2IBGA 1EZVX 3VJ6A 4KUCD 4XAKD 3FAWA 3TF7C 1BBDH 2X9XA 3HC3H 2JIXA 1PLGL 4WJ5A 2WMPA 2F54A 1T5WB 1UA6L 3GMQB 2AEPH 3V4UL 1TVBA 3NCYP 1UKQA 4KROC 4OFVA 5KS9A 1T22A 4G6MH 4WO4C 3SPVA 4LBEA 5HYIA 1LDSA 1A4KA 5DEFB 3C8KA 4JFEB 5JW5B 3S7GA 2NY3D 5D5MA 3WE6A 3CFEA 3P4OA 1EFQA 2E9JA 4LVEA 3RDTD 1NAMB 3GNML 4JQIL 3UO1L 4NN7C 4JR9H 2OCFD 3VFWB 4IMLA 1UWEL 5F71A 2Z35B 4L8DB 2ENYA 4L3AA 3LZFL 3AM8A 2EIDA 2YK1L 3MA9H 3MFFA 4X6BB 2EXWD 1HSAA 5DRNB 4MDIB 1QQDB 1SY6A 2CH8A 1A3LL 1EVTC 2NXYB 5ITFB 3NAAL 3RDTC 4FFYL 1U95B 1VB9A 4NQEB 4BZYA 5EBGA 3VXUA 3WKMH 4WFEE 3WDIA 4J4PD 5E99L 5ETUB 4BELD 5CD5D 4XCYB 4H5SA 2EXWC 1A6TB 3TBTA 3RWEB 3DRTB 5FK9B 4XAWH 3QULA 1CYGA 1I4FB 4P9ML 5A2IH 2X70A 3WFDL 4O58H 4IOIB 1M71A 4XCFL 2XXMB 1JI2A 1DLHB 3E8UH 1JN6B 4QRUA 1YY9D 3LRSB 1RIUH 3S37L 1JRHL 4J4PC 1HHGB 5ANMA 2VDQL 3PGCB 5CD5C 4M7JL 2AEQL 4X6DE 1FNEB 1U9KA 5IB3A 1KACB 1CFSB 4UQ3B 1BFOB 2A6KB 4MAYD 3QDHA 3GI9H 2PN5A 4XNYL 4BZ1L 2OQJA 3IDMA 3BAEL 3PWLB 3ARYA 1YY9C 3T0EA 4OF5A 5GS3A 2VLRD 4JM2F 3TO2A 4F33A 3OXSA 4OZHE 5C0AB 4LLUB 4RAUA 3ULVL 2YS4A 2R2CA 3NFSL 3MQIA 3I84A 5BRZB 4GQ9H 1QFHA 3ILQD 5LGJB 2OL3L 3SE4C 2IEPA 4YFEA 3FO9B 3BQUA 1A7RH 4MAYC 3BGFC 5BZWA 3UDWA 3TNMA 3F62A 3VRIA 5EZJB 4OCWH 3O4OB 5CLWA 4XVJH 3UTSA 4P2OD 1DQQB 2CD0A 3ZT5A 2X4PB 4HPOL 2IAMA 3OF6D 3MOAH 1T1WB 2C3WA 3ILQC 1AR2A 3MNWB 2WWKT 2H32B 4J8RA 5CEYB 2HN7B 3RIFF 1NCBL 4ONFL 2ZOLB 1IAKA 1JWSA 3FTGB 1Q38A 3SKNA 4Z78B 5E6YA 1RZ8B 4P2OC 4HMEA 3L5WA 3UJTL 3LEXA 5FA4B 3D39E 1MCKA 3LMJL 5I15L 4I8DA 4G6FD 4X6CE 1NFIB 5DD6A 3GUTB 4RWYH 3MMEA 4FTVA 5DD0L 3ZDZE 1XR8B 2R0LL 4XBGB 2X9YA 3QIWA 2Z92B 2X4NB 1A6AA 2IPUK 3D2UA 4LHJB 4X9BA 2RCSL 2YXMA 4ONGL 1F2QA 4P3DB 4JO2L 3JUYA 3JV4A 4XBEH 1Q72L 1YEIL 1CF8L 4NQSB 3LH2H 1AO7D 1NEZA 1EO5A 3MV9B 1F3JA 4PRPE 1MCHA 4C56A 2H3NB 3KPRD 5A16A 4JQVC 5DK0B 1YMMB 4MDJB 4PJXF 1V3KA 4KDTC 1CS6A 5FYJE 5L6YL 1P6AB 3UCRA 1TZHB 3GMOB 4DUVA 3DXAE 2V9QA 3SO3C 3VGAB 4PJ8A 5GJSL 5F89A 5EUOE 3NCFB 2CSPA 2QSVA 1UZ8A 2R2HA 2H26A 5KOMC 2XY2A 1NBYA 2YN3A 3GSQA 3I3EA 4OUUB 3OL2A 1ZLVK 4Y2DA 2YPKA 5I9QB 5TGBA 3QUXD 3MRDA 1PVHA 5I6XC 3QEQE 1ADQA 4HMDA 4X7SL 4Z76B 4OZIE 1KNOA 3NTCL 2IANA 2J6EL 3C09C 4TSCH 3FQWA 1IFHL 2BVEA 4PIRF 1KXQE 3OPZH 4QRTB 3UJIL 4Y5VB 4E0RA 1GGYA 3IFNH 2Z31B 1SM3L 1A2YB 4U2YA 5DD5H 3QIUB 5EFIB 4KK8D 5DRZA 3QUXC 2H2PD 3O11A 4J3UA 3IDYC 1YNKH 1Q9OA 3U1SL 1JPTH 4KVNL 2CIKB 1A3RL 2CDFA 2YN5A 4U6HA 2Q7YB 1BLNA 2Q8BL 4UB0L 1BECA 4XVUD 4AEEA 1DEEA 2ZNWA 3GSVB 1YEHL 2CPCA 2I5YL 1HILA 1YEKH 3L5XH 5D8JH 2R4SH 4PB0H 2CKBB 2YOCA 4WFED 1S7UA 4KK8C 4QRPB 2O5XH 5ITBL 2H2PC 2CIIA 4YHML 1TZIA 5FO7B 4AL8L 3W2DH 1UYWH 1XGTB 3BYTA 5D96B 2ICCA 3QUKA 2H1PL 4ZQKA 2K1MA 1GGTA 1JMXA 3PDGA 4XVUC 3TJEH 4IRSA 2P45B 4K8RL 2X4TB 2QV2A 3BPCA 4D2NA 1N8ZA 5J11B 5B3JF 4L9LB 3BE1L 1FG2B 4EDXB 4X0KB 2PYEB 5GSVB 4H1LH 5C2UB 1FFPA 2CK0H 4P2RB 4AEIH 5C07E 1J1PH 1ZEAL 2GJ6A 4OGYL 1MFDL 1A14L 4DGIL 1R5WA 5E8DH 1BQHG 1U8PA 4M7LH 2NY5C 1LNUB 4NC1E 3MR9A 5F7WC 2X4OB 3IETB 4QT5B 3B9KD 1JWMA 1KN2H 2NMSA 4R0LA 3X3GH 1S7XA 3GHBH 1OCWL 3AS3A 3JWDC 3GB7A 4BFBD 4BSJA 5JHDA 3QDJE 1YEFH 4BA8A 2R0WL 1RK0B 1JZ3A 3C5ZB 2GK0B 3F7VA 1JFQH 5F3HA 4QXUH 5BO1L 3BD5A 4AG4H 2YD3A 4LSPH 5E2UH 4PJ9D 2HJFB 3O6KH 1WCBB 3B9KC 4QEGA 1MFEH 2PW1B 3W82A 2EKJA 1MJJA 1UXSA 2BMKA 4RSVA 4P2QE 2ZSWB 1EAPB 3VWJB 2FECL 1H3PH 2R23B 5A2FA 4YHOL 5ADOL 1MQKH 5IFAL 4PJ9C 3BKJH 3AB0B 3O6ML 5D1XB 4F7EB 3SDDD 3QHTC 3A6BH 1DQJB 2J2ZA 1BX2A 1WLHA 3D39D 3KPTA 5EULV 1OPGH 3C8HA 1FIGL 4O2EB 5HYEA 3V52L 4QYOA 4KMTL 2HJKB 3JZ7A 4AEHH 1DJSA 3MLUH 4YXHL 5GSRA 4L8BB 1NCAH 5F96H 2BHZA 5IB4B 1N64L 2XPGA 3BKYL 1KELH 4YZFF 3SDDC 2BXZA 4BQ8A 3REWB 1F6AA 5IMKA 5FIEA 2FGZA 4AY0A 4XGZB 5TPWH 3WIFB 1BREA 2VXQL 1KC5H 5D7LB 1BJMA 4MJIB 5L2JA 1G1CA 3SKJL 2BDNH 5TFSH 2IH1B 3I9GH 1R3LB 4PJCA 3E3QE 1AFVH 5B38G 4ONHB 1N7MH 1W72H 2VAAA 1JNLL 1D3CA 3RL1A 3V5HA 4IMKC 1WAAE 2Q86B 3VGHA 3P4NA 3AS1A 1X4ZA 1XIWD 4Z7UA 3DXAD 1GRWA 2FJFB 1UGNA 3EOTL 1EIBA 4M9OA 4R7DB 5D2LA 3VXMA 2BSTB 1BJ1J 1G9EA 4CW1A 2AJXH 3WIHA 3IDIA 3RY5A 1FYTE 4EVNA 5LAXB 4EUPB 5EZOH 3IAGC 1ZLVH 2W0FB 1GOFA 1PKOA 4G9FA 2R2BA 2RB8A 3V0AC 4TQEL 5FXCH 3QEQD 1RULH 1YJDL 3MV11 1XIWC 1XF4A 3DPBA 4FQ1L 5E2WL 1A1OA 2A1WH 1Q94A 3MJGX 5EZIL 3SN6N 1G6RA 1NCCH 4X5WA 4XPAH 3HLAB 1MIMH 4HJGB 3DECA 3WHE0 3UTQA 4GG6B 3NCBB 5F6HJ 1WT5C 4V1DA 1K6QL 3Q6GH 5GGRB 1KB5H 4WUUB 4FQHB 2FBOJ 1ZHNA 5SV3A 1RVFH 3QUZD 1G9NC 5CZKA 1DDHB 4PYHA 3OAYH 1M7IA 2DQJL 32C2A 2X4SA 3HMXA 1VEMA 5T3ZH 5KG9B 3LKPA 3ZKSD 3FRUA 4NM8H 3KS0H 3T1FB 1BFVL 4Q9BA 3GSRB 4U3XA 1MIEH 4KK6D 1RJYA 3S4SG 4APQB 2WSKA 4HBCL 4NQCD 4HIXL 4HUUA 1TCRA 4OLVH 4F57L 3WJJC 5FKAA 4Z7WB 4GMSL 4BK5A 3QUZC 3OSKA 1YEJH 4I9WE 5FO8B 5H2BB 2OXHA 5GJTL 5C70A 3NFPB 1CXLA 1X6LA 1QACA 2EDXA 4HG4J 4Q58C 1FV1B 2XYCA 3KYKL 4G5ZH 3OGOE 2QBWA 4CVUA 4DK6A 1DVFB 5BJTA 4KK6C 4CN6A 3JWNC 1LP9A 1BVLA 1UEMA 3WFEH 1T0MB 4J3SA 1MHCA 2GY7B 3TBWB 2EYRB 5C07D 2VXUL 3VDAA 1KXVC 3L3HB 4MCYA 5DS8B 1BAFL 4PY7B 4DZBA 1KLUA 3FT4A 1BIIA 5I8CA 4MWFB 3A0OA 4OD1H 1OAUL 4JANB 5GGQH 1I1YB 1XR9A 3QDJD 3RX7A 4LLDB 3Q5YA 4BZ2H 4Q0XH 4JHWH 4J23A 1JNNL 1MH5A 3LOWA 4NC1C 4Z5RA 3EO1B 1GVIA 3KVQA 2Y7QA 3S37X 3M1BA 1UJ3B 3TWCH 4CNIB 4TSBH 1QLRA 2BC4B 3P9MA 5IHUL 4P2QD 2ZNXA 4PTUB 1A6ZB 2JCCA 3G6AA 5HGDA 2BVOB 1EXUB 4K9EL 4OBRA 2Y23A 3PJSA 5GGRY 5LGHL 1I8MA 1WBZA 1XCTB 1AE6H 1OSZA 3V7AG 5SWSA 3VD7A 1GC1L 2EIZA 3RIFK 1LHZA 3FONA 1CTNA 4JFDB 2YSSA 5IV2A 1SBBA 5LBSL 2GHWB 3EFDL 1YNLL 3BGAA 3D25B 3CH1B 3QEUB 4D0DB 4TYUA 1B2WL 4HGKC 5HHXH 1KPVB 3GSWA 7FABH 4XC1L 2PTUA 1IGIL 4KJYA 4MHHG 2V9TA 1QFWL 5DTFB 4GXUM 4IJ3B 3O41B 1CFBA 2VIRA 4RFNB 4U4BA 1LMKA 1PSKL 4QY8A 4D8PB 1KCVL 3QFDA 3HB3D 1P5VA 1ULVA 1MHEA 3HTLX 2HH0L 4F7CA 3U0PB 3PNWA 3NH7L 4UV4L 5TE7H 4GRMB 5CBEB 5IQ7H 2HLAB 4PB9L 2VXSH 1N6QL 1QRNB 2GJZA 3LIZH 1ZKAA 1PJ9A 2OSLA 3W0WA 5FF6B 3RWDA 3H2WA 4GW4A 1UWGL 3L7FB 4ENED 4EDWH 3HB3C 4NWUH 3I50L 3I3BA 4PPTA 4LIQE 4RFOH 5KN5B 4WEBL 25C8L 1FYTD 4YLQT 3E3QC 5EU7E 1Y6NR 5HPMB 2WUCL 2G5BB 2VL5A 1W2KT 3MV8D 4JN1H 5EUKB 2WQ8A 1Z9LA 4Z95L 1TVHB 4QTHB 4I0PD 4PJAA 5J13B 4LLMA 4ENEC 1HOCB 1TDQA 4PJHF 1RJZB 3VRLE 1Q0XH 1RK1A 3S8WA 2XG5A 3GSNH 3EFFB 1EMTH 1VADB 3RTQD 1LEGB 2J8UA 4ESKA 1GAFH 1I7ZA 1S8DA 1TQCB 3NIGE 4B41A 4OCXH 5DSCA 1NUNB 1EHXA 3CVHB 4I0PC 4YDIH 1KSRA 3O8XB 4FQCL 2VDRL 2P48B 1P7KB 5T1KD 4U1JA 4PG9A 4ODUB 4YHLH 4N8VG 3RTQC 2ZCKH 3IS1X 3GJFK 4POUB 1MAMH 4XC3L 5KVEH 5KTEH 1QO3B 4M6NL 1IQWL 4HC1L 4IOSD 2EICA 5J1TC 1OB1A 4I9WD 3VG0H 5FYKE 1I7TA 3UC0H 2AK4B 3PWPE 4UDUB 1T7ZA 5DR5H 4UTAH 1S7WB 2P8PA 3RRQA 4H88H 1F4AA 4NJAH 4Z0BH 1XGRB 3KLHD 3ETBF 1PQZB 1R24B 3RPIB 4ZTOL 1BGXH 4G8IB 2DQGL 3VI4F 4YHYB 1OD9A 2LVEA 3QUYA 3BRDA 1DBJL 4P0DA 3O9WC 3Q5OA 2L7JA 4WW2C 3UJJL 3EGSA 3LPWA 3O6FA 1I8IB 5E03A 3TNNA 3GBLA 2VLKA 2HFEA 4DQOH 1H5BB 1P4LA 4TOYL 5ICZB 4OGXH 3KLHC 2FIKA 5KJRL 1ZXQA 3K1DA 1J12A 5C0RH 2VERN 4XNUL 5TQ2L 3O4LE 3WXWH 1LEKB 1N59A 1S7SA 1RI8A 1UM5L 4C4KO 4LSVL 3QWQB 3QWRD 5IJVB 1CGSL 1QLEH 1SY6L 1PZ5B 3HE6A 2NZIA 4HIHB 1GXEA 1OQXA 3ARFA 4ELMB 5L88L 4POZD 3MJ9H 3R8BB 1CQKA 1E4WH 3ZT6A 1HH9B 1AIFB 4U1SA 2AK1H 1D5BB 5AAWA 2IALB 5J6HB 4ZAKA 4OLUL 3ALXA 4BYHA 3BVNB 4D94A 3C9NB 4RFEA 5D5ME 1B90A 2I9TA 3MRRA 5IK3A 3VFUB 1LO2L 1B3JA 4MAUL 1VFOA 1S78D 2BCKA 4WI2A 1T6WA 4N8CL 3LQMA 2M1KA 3KPQA 2VDKH 4TRPL 2BY0A 3H9HB 3VXSA 1BJ8A 3QEHA 1BP3B 4NUGH 4YWGH 4CMMB 5FGCE 4M1GH 1U8IA 5JOEA 3NZ8A 3RJQB 1JN6A 4H8WL 1RUKH 4Q74A 2V17H 3SKOB 4PJDE 4RA0C 1S78C 4J3VA 1W0VA 5BV7B 2DI7A 4WTZG 5KSAB 3RVVD 3FHQA 2D7QA 4Y1AB 4JZJC 2VDNH 4LVNC 1BFOA 4PRBB 4TUKH 4GAGH 3BIKB 3LKQB 3U46A 1EO7A 2DLGA 3TN0D 2D7TH 4XMKL 5IHZA 2NY4B 3UPRA 1MFCL 4QF1A 2VDMH 4B0MM 4UIKH 1IEAB 1RU9L 1UZ6F 4WDIA 2VR5A 3BJ91 4N5ED 1WGOA 1DLFL 3N9GH 5HHNA 4RRPG 3RVVC 1RZJH 3X3FL 2ADGB 3QH3B 3HZVA 2H9GA 3NZHL 3TN0C 1T0PB 3V0VA 1U8OA 5KW9L 4RBPK 4HX1A 5BMFH 5I73C 1FRGL 2DQIH 3CZFB 1F3RB 5EBWB 4PS4L 1Q1JH 4N5EC 4PGDA 4I3RL 4N0CD 4YK4C 2YPVH 5CINL 1KJ3H 2VABA 1GC1C 1L7TH 4HV8A 1C5DB 1F2XK 4YBQD 2QKIA 2IQAB 4KKCD 1MREL 4ZUVB 4LMQI 4R4FH 2R0KL 4MMXC 2APWA 3BKMH 3I75B 4TVPD 3A6CH 5HGHB 5K93A 1DN2A 3NPSC 1A6PA 2IPKB 4P4RA 5ALCL 2GK2A 4N0CC 2ZUVA 4G8EA 4I3SH 4WHYH 2DWDA 3KWWB 4YBQC 4ONOA 1CL7H 1DSFL 3FQTA 2EC9U 4UOW1 4KKCC 3B83A 4KTDH 4UINL 2CLRB 4NQDE 1JYXA 1QLFB 4A6YL 4CVXB 1MVUA 1G7QB 4Q9RH 5DWUL 4M6AA 1X44A 2R9HD 3H7BB 3KPSD 2AJSL 2XN9A 2CUMA 1GGIH 3VXQB 1CE1L 3MOQA 4WU5A 3JV6A 1A7NL 3GJFH 4KGLA 4E41B 5BVJB 5C9KA 5FYKD 3QCVL 3ULVF 2AS5M 1ONQB 1BOGB 3MRLA 3PWPD 2VISB 2Q6WB 1NC4B 1ERNA 3I2CL 1MF2H 4F58L 1P9MA 4OUOA 2ORBH 5AZEH 1P69B 3TA3D 4F9PA 2R9HC 4K7FA 4LFHD 4GKSB 4RGNE 5L2KA 1CQYA 4NN5C 1DBAL 4NFCA 5IBUG 1O5DT 4F2MA 2X44D 2I60L 1ADQL 2Z8WC 4LCUB 3BHBA 1A02N 2Y5TB 4ETYA 3G04B 1E4XH 2X89D 1WBXB 3ALWA 4YNYB 1KCRL 5E24E 1C12A 2SEBB 3WFZA 5TH2A 3KAAA 3T0AA 5FECB 2P7TB 3Q3GA 1GIGL 3TA3C 2ZG1A 4P57B 4NRYB 5FOBB 3HUJA 4O02L 3ILPA 4PV9B 2EDLA 3O4LD 3H42L 2C3VB 5K9OA 5C0JA 3MLYH 2DM3A 2OR9L 3QO1B 5I8OH 4H1LA 1NDMB 1XF3B 4OGAD 2F54D 1H3UA 1CFNB 2JJTC 3MCLH 5JW3H 4AQ1B 4C83A 1YC8A 4D9QE 4GKNB 4ZFOA 3ZL4L 5K33A 4I18A 3QXTA 4OKVA 5GS1B 1N4XL 5JNYA 2HJLA 1KN4H 3X17A 4HT1L 3IJYB 3FQRA 4NNPL 1OP3K 3VXPA 4NKIL 4OGAC 1UQSA 3AFLA 1RAMA 2QR0B 2FCBA 2FJGB 3FMGH 2WAHA 2HT4D 1GJIA 1XH3B 1WEJL 2FX8L 2B4CC 1S7TB 1U8LA 3C87A 1C5CL 4ODTH 2HTKD 2CDEB 4ZFZA 1NGQL 1C5BL 3EYSL 1IEBA 3N1PC 4OF3A 3S3PA 5DMKB 1I9EA 4HWBH 2A74B 5C09B 3NFNA 3MJ7B 1EZVY 2DQTH 4LCYA 4TUJA 2BRRL 2HT4C 3LRGA 3VXUD 1AGCB 5D7SL 5I74B 1JV5A 3P0GB 4NRZA 1LDPL 4X7FC 2L0DA 5JUEH 1OWWA 3ULUL 1N5AB 4DKEL 3C6LB 5T3XH 1BQUA 5F1NA 3L1OL 2GSGA 2XG4A 1CDYA 2AJYL 3H9SA 4KQ4L 4OAWB 1D5MA 1J1OH 4YIQA 4KTYA 3HR6A 2YMXH 2YHGA 5FKPB 1TJGL 4MD0A 3K81A 4ZYKB 5ICXA 5F44A 1CZ8L 1IT9L 2DLEA 1MWAB 2RIKA 4OCYL 2D3VA 2GJ6E 4PRAB 5HYSA 1IEHA 5TDOA 4L1HA 4Q9QH 4RBPH 4JFOB 2EC9T 3ZO0A 3P73B 3MOBH 2DKSA 2VZ1A 2P1YA 1W72A 4PJ7A 3TH3T 1KLGA 1MUJB 1L0YA 1II4E 4U1NB 3BZDA 1UH2A 1DBMH 3BIBX 5TQ0H 2R2EA 1IKNC 1HQRA 2LAAA 4WNQA 5TDPA 4YO0A 1CR9H 4AENB 1G7LB 3PWVB 5E6ZA 3GM0A 4QTIL 5B3NA 3SGJC 4NQDD 3QZWG 2IAMD 4IDLA 3CFJB 12E8L 5K9KB 5T33H 4UQ2B 1KPRB 3T3PE 2QL1A 4KROB 1OAZL 4XWGL 4GO6B 4OLZH 5EDXA 4WO4B 3MNVB 3UDWC 5FAAA 3RI5F 4OZFG 2WUBH 2EXYD 1TJHL 3L95B 3MLVH 2W9EH 3AVEA 4F15B 2NQCA 2DQEL 3CXDH 1MLCA 1WC7B 3LS4L 2IAMC 1KB5A 4QHUA 5GISH 1JGVL 3KPLA 1E28B 4M61B 4RGND 3RWFB 1CGUA 4Y8DC 1NFDA 3SGKA 1FZKA 5HXMA 1J05A 3BPNC 2X4UA 2P5WB 5EU6E 5DQDH 2EXYC 4ELKB 3PL6A 3QIWD 4IRJA 3MBEB 3D2UD 1N5YH 5EG6C 1BQHB 3RDTB 2FIRT 1MCJA 3KPPA 3QDGE 2EEDA 5BQ7B 3LN4B 2B5IC 5I18L 2CLVB 1EA9C 4PJEF 4RGNC 1SJHA 3G5VB 3MGTA 3KG5A 3ARTA 4G9DA 2NZ9D 4NIKB 3BZ4B 5IM7B 3BMVA 4FQJH 3QIWC 2CR3A 3ARBA 1FORH 1GHFH 3HMXL 5DYOA 5BCAA 1C16B 3G6JF 3BGMA 4HMCA 4MNHA 5D2LE 4F3FB 5I2IB 3VXME 3D9AL 1RFDL 1NMAH 2HVKA 4LSTL 4P48A 4BFIA 5D1ZB 3T0DA 2NZ9C 4Y2DD 3F12A 4D9QD 4LSDA 2GI7A 5C8JA 2F8VA 4MMZC 4UIMB 4KFZC 3X14B 2DLFH 3O0RH 4HPYH 3IDJA 3ROOA 2EZ0D 1UACL 2IAND 5HHVH 3ZDXE 5MEPA 1JZ5A 5TE6L 3SDXE 5IFHH 4HKXA 1LO4L 1ZT4A 4Y19B 5EU4B 2OK0H 3C5JB 3B5GA 2DRUA 1ZGLM 4Y2DC 2YD6A 3DURB 3IU3B 3FN0L 1YY8A 4ZUWA 4P5MA 4QHMB 2QSQA 1P84J 1AKJA 4E9LA 4YHZL 2V7HA 4LRIC 2EZ0C 1CI5A 4MAYB 5JO5B 3BGFB 2XV6B 3IDGA 2D0FA 2RR3A 3I6GA 4JO1H 5J57B 2H41A 5M7QA 3ALPA 4OB5H 3CXHJ 5CD3A 1HKLL 1INQB 2FH6A 1H0DB 4U6XB 3L5IA 1KEML 2ESVA 2GFBA 1U58A 4HK0A 3L3HA 3F58H 5DJ2A 2D0GA 4GAJH 3LEYL 5I1LA 1NCUA 1QHOA 2J5LC 1TIUA 2VZTA 3BZFA 4K94H 4TPRL 4MWFA 3WFBH 5B38B 1OAKH 4IRSD 1WTLA 2XKSA 4PGJA 3KDMA 3VDBA 4P2OB 2DL9A 1LE5A 4LLDA 4UNVA 1MRCL 1MY5A 2HFGL 3QEGL 3FFDB 3IJSB 2XT1B 4MD4A 4Y5XB 3O2VL 1HHIB 1LP9E 1A1MB 2UZIH 4JDVA 3QPXH 2AV1A 1ZTXL 3HNVH 1OAYH 4YGVB 1OP5K 1A9BA 4LLAA 2OTUA 4S2SB 4URTB 5D7IF 4HWNA 2GJ6D 4RQQA 4N0UA