3X1FA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans ng80-2
publication title Structural evidence of the flexibility of the CuM site
rcsb
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1fA00
1AG0A 5B3SB 2UXVA 1HAWA 2PPAA 1OCRB 3BQVA 2TSBA 3PCYA 2BZ7A 3CZUB 2VM4A 2H3XC 3ABMB 4DPBX 1ID2A 2HX8A 2FQDA 1JOIA 1OE1A 1AIZA 5B7EA 4JKNA 2AZAA 1E65A 4YSAA 1BQRA 2IWFA 3WI9A 1E67A 1AR1B 1BQKA 1X9RA 4G7RB 3NYKA 1A4AA 1BQ5A 1GS8A 2PPEA 3IE9A 1WS7A 2B08A 2JXMA 1KYAA 1XB3A 3FQ1A 2VW4A 3FQYA 1MG2C 1OOWA 1AQ8A 3NP4A 2BHFA 3FU9A 1A3ZA 5B1BB 1RKRA 5AZUA 2FT6A 3NSDA 1TKWA 2TSAA 3BVDB 3KW8A 4YSOA 1QHQA 1IKOP 4YVUA 2P80D 1DZ0A 2XX1A 2UXFA 3UADA 1R1CA 2HX9A 1A4BA 2GIMA 3NSCA 2W88A 2PP8A 3QJSB 3X1BA 4AKOA 3GDCA 3KW7A 1ZIAA 1FA4A 2BW5A 4GY4A 1BXAA 1AAJA 4BDVA 4YSQA 2IDQA 2BP0A 1QNIA 4GXFA 1WA1X 2XX0A 2GHZA 2JKWA 4DP7X 1ASOA 2FQFA 1PLCA 5E9NA 5F7AA 2X88A 4HCIA 3TASA 4E9TA 2AFNA 4AKPA 4CSZA 3NSYA 2YARA 3IN0A 1BYOA 2HZHA 3T6ZA 3EHBB 2VW7A 3FYIB 1QLEB 2YAOA 1KCWA 1WA0X 2MTAA 2A3TA 4WKXA 4DP2X 3UGEA 2MRYA 3ZX1A 5I5IA 3NT0A 2PP7A 1SNRA 2N0MA 3ZIYA 2PCYA 2VSKB 4AZUA 2XWZA 2H47C 1W8EA 2GB2A 3ASOB 4QKTA 4EF3A 4K9JA 3X1GA 2BO0A 1SF3A 3FU8A 2DV6A 2I7OA 4GYBA 3L45A 2PLTA 2UX7A 4BDVB 1SDDB 2BP8A 1PMYA 1PNDA 3CVDA 2P80A 3AZUA 1CYWA 2DYSB 2YAFA 1OE3A 4W1TA 1ETJA 3QJVB 1J9RA 1PF3A 3FPYA 1NIAA 2X87A 3NJIA 5I6LA 2XXFA 1BAWA 2VSMB 2IDTA 4F2EA 4P5SA 5F7BA 2YAEA 5PCYA 4F7KA 3S8FB 1J5CA 2FWLB 4NAJA 1L9SA 2GBAA 2DWSA 4E9RA 1AZRA 5PAZA 3OM3B 1ZDQA 2GSMB 2XXGA 4W9ZA 1JZIA 2IDUA 2XVBA 1AS8A 5B1JA 3WIAA 1AACA 1AOZA 5I6NA 2B3IA 4KNUA 4WTQA 3PAVA 2J57A 1KCBA 2ZXWB 4HAKA 3FT0A 1W6LA 5B7MA 2IAAC 4YSUA 1JZJA 4KO9A 4YSTA 3JTBA 3PAZA 1NDTA 1FFTB 2H5UA 2QPEB 2Y69B 1PAZA 1MG3C 4KOBA 2FQEA 4UAHA 3QPKA 1SF5A 4HALA 1EHKB 4BWTA 1ZV2A 2BZCA 4G7QB 2RACA 1JXDA 1OV8A 1JVOA 2FT7A 4HHGA 3QJUB 5I6OA 2GI0A 3UAEA 3DKHA 3AW5A 3RYMA 3U25A 2BWIA 5EHFA 2I85A 1J9SA 3S3DB 4YSRA 2PPDA 3WNIA 3EH5B 1BXVA 1SFDA 4YSSA 3X2QB 2AZUA 1E5YA 5A7EA 1WAEA 1GSKA 3ABKB 4GP8B 1MZYA 1PZBA 3FSAA 2XV2A 1B3IA 5I26A 2DY2A 4DPCX 2ZONA 5AKRA 2J55A 1J9QA 2DYRB 1KBVA 1IBYA 3HEIB 4N4YB 1GW0A 1MDAA 2PCFA 1UATA 3ERXA 2EINB 3CVBA 2CAKA 2FJSA 1OCCB 4UF7C 1OF0A 1KV7A 3AG3B 3PLYA 1XMEB 3T6WA 1J9TA 5I5MA 2YAQA 1L9TA 5B1KA 2BP0B 3NJNA 4G71B 1M56B 1ASQA 1PCSA 3ZDWA 1DYZA 2CBPA 1ET8A 4AKQA 4DP4X 4A68A 1N68A 5D4IA 1PZCA 3QQXA 3WKPA 1GS7A 2BW4A 1OCOB 2XUWA 2YAPA 2Y1AA 4E9YA 1M57B 3FU7B 1CC3A 5B7FA 3PXLA 2QDVA 4G7SB 4A67A 2XV0A 1KGYE 1W6WA 4YSEA 2EIKB 1SHXA 2HRGA 2I7SA 4X4KA 1X9UA 4KNSA 2WSDA 3PAUA 4BWUA 5D4JA 2XYBA 1SFHA 2DWTA 2VMJA 3MBWB 4GP4B 1BEXA 1JXFA 1BXUA 4G72B 1NPNA 4A2DA 1ET7A 1TU2A 3EH3B 3OQRA 7PCYA 1JXGA 4Q8BA 4E9VA 2CALA 3OMAB 3CDZA 2UXGA 1OCZB 4MFHA 1JZHA 3UACA 1GS6X 4E9XA 4YSDA 5I6KA 3IN2A 3N2JA 1AG6A 3SQRA 4M4RB 2OJ1A 4M3HA 2FTAA 1IUZA 2WO2B 1WA2X 2OCCB 3GXUB 5LDUA 1AZNA 1NTDA 2R7EA 2Q5BA 4DPAX 1PNCA 4KO5A 3NJLA 5I6PA 1AZCA 3T9WA 1L9QA 2YXWA 2HLEB 3FS9A 3X1NA 1CURA 4A2HA 2AANA 2YAMA 1NINA 1WS8A 3V9CA 4HCFA 4NB7A 3EH4B 1RZQA 2IDFA 1URIA 3NJFA 3CG8A 2EILB 3NJHA 5I5JA 1NZRA 4UANA 2CJ3A 3H4FA 4BK5C 3SBQA 3AG2B 1CYXA 2HXAA 1SDDA 3FYEB 1ADWA 1T5KA 2J56A 4DP5X 2NRDA 3NJKA 3JT2A 1A4CA 1AZBA 3AY2A 3H56A 3SBRA 2W8CA 3EF4A 3CDZB 4FAAB 4A2GA 1NIEA 1XB6A 3S8GB 1JZFA 2BWDA 2R7EB 1IC0A 2XU9A 1E30A 2CCWA 3NP3A 1RZPA 3UAAA 4KNTA 2IH8A 3AG4B 2FNWA 4KO7A 2OV0A 7PAZA 3WKQA 1NICA 1RCYA 1ZIBA 2VN3A 3ASNB 3D12B 1SHWA 5B1AB 4NERA 4YL4A 5TK2A 3IEAA 4KOCA 4G70B 1E5ZA 5AFAA 1VLXA 1M9WA 4JHUA 3QJQB 5IY5B 2Q9OA 5I6MA 2IWEA 3V9EA 4N8UA 3FSWA 4A66A 1AZUA 1NWPA 2IWKA 4DP8X 4DP1X 3TBBA 2IH9A 3GYRA 2IDSA 3ZBMA 1OE2A 1BYPA 4JHVA 1ILUA 2QPDB 4AX3A 3ABLB 2CUAA 4HZ1A 3QJRB 1L9PA 1AANA 6PAZA 3NJJA 2GC7C 1A8ZA 2UX6A 3T6VA 2LLNA 3NJMA 2PPFA 1PY0A 2WO3B 2ZOOA 1PLAA 3FQ2A 4PCYA 1XB8A 4KO6A 3TBCA 2EIMB 4FA7B 2ZWNA 3OMNB 2PP9A 3C75A 1NPJA 1KDIA 4E9WA 1NIDA 3OMIB 4YSPA 3FPXA 4GP5B 1TEGA 6PCYA 2FT8A 1TEFA 4DP0X 3N55A 1KDJA 5TK4A 1ZPUA 3MX0B 1MZZA 2QT6A 2J5WA 1GY1A 1NIBA 1FWXA 1V54B 2HRHA 2XV3A 1HAUA 1I53A 3T71A 3S3CB 3H4HA 3S3BB 3FSZA 1AS6A 5B1JC 2VM3A 4P5RA 3WG7B 3TU6A 5D4HA 1L9RA 2XLLA 2E86A 3G5WA 3DIVA 4TXVB 4BXVA 1PLBA 5ANHA 1J5DA 3SBPA 4HCGA 4E9QA 4PAZA 1N70A 2YAHA 4HHWA 1NWOA 4A2EA 3IBOA 2JFCA 3X1FA 1HFUA 3PPSA 3UABA 4BXSV 3QJTB 4A2FA 2VW6A 2YXVA 3OD3A 1V10A 4YVNA 3CVCA 1V55B 1JZEA 1GY2A 1ASPA 5I28A 2HX7A 5FC9A 3DTUB 4BWWA 2BP8B 3NSFA 3TA4D 2EIJB 1JERA 4DP9X 1PZAA 2AVFA 3T6XA 4F2FA 4YSCA 3HB3B 4Q89A 4ENZA 3WNJA 4E9SA 1YLBB 8PAZA 1CUOA 1NIFA 2UXTA 3AG1B 3FU7A 4ZK8A 2GC4C 9PCYA 1EZLA 4L0PB 1F56A 4AI7A 1ZDSA 4QLWA 1A65A 1AS7A 2FQGA 1JVLA 1ILSA 1GYCA 1GR7A 4DP6X 4CSPA 4RH4A 4HIPA 1ET5A 1JZGA 3X1EA 1L9OA 3FSVA 1IBZA 2PPCA 2YQBA 3NJGA 1KBWA 1SJMA 2QDWA 3ABGA
chains in the Genus database with same CATH superfamily
5AUMA 2OYMA 1M71B 3CMGA 5SWQB 1TTCA 3MUJA 4KRLB 1XAUA 2FD6L 1F8TL 1L6PA 3BQVA 4N28A 4W9DC 3CLFL 5DR5L 2H3XC 4GBXA 3N1MC 3IFOB 3IYLW 4NXSA 2JCCF 2UWEB 3WO3B 4NT6A 1J8HB 1QBLL 1QLEH 3LH2H 5CGBA 1AZVA 3DVGB 1A3LH 1WZLA 5D96B 3VH8A 3VSUA 4U1LB 1O6SA 2UVFA 4JFDB 1ZVNA 1RZKC 1FFRA 2BHZA 2NY2C 2FX9L 1LVEA 3HZKB 4Y9EA 5EWIL 2PUQT 3T3ME 3DX9B 1DBJH 3BQUC 4C83A 1M71A 5EU6E 5KJ4A 1GS8A 2D73A 1P5UA 1UWYA 3W0WD 3RGVB 1P6FA 1QATA 2WXJA 5DZNA 5I30H 3KYKL 3WUWB 3GSQB 4FCAA 3QRGL 1FO0H 2VQTA 5DJYA 1R24A 1ANUA 1RIHH 4AT6B 3BCFA 3JVFC 2WXOA 4NWTL 5EC2B 4XE0A 1DDHB 4HPHA 5EOCJ 1K5NB 3VJ6B 5B39G 4PJ7F 4MJ5A 1W72L 5C7ZA 4TRPH 4LLQB 4Z7WE 4DJMA 5HI5C 2PP8A 3NZ8A 2Q76B 1UQSB 5KS9E 1X4ZA 1U4EA 2JKXA 3WFZA 5JYLA 3HPJA 4GG6A 4H25A 4UQCA 1JYWA 3HC3H 3VNYA 4LCIL 2X9XA 4BDVA 4EN3C 5L6YH 1OSEA 4LPWA 3UC0H 4Z95H 2X10A 1DVFB 4Y19D 2IDQA 1BPLB 3MFFA 4OJCA 4AZ8B 4L3CB 5CR8A 2FWOA 3E3QE 5DMGD 4TS6A 3SN6N 5HPOA 2FBRA 5JNYB 3N42B 4PTUA 3SPVB 4G82A 3CLWA 1ETZB 3GS7A 5F1SA 4X5RA 1F45A 1OAXL 4HW6A 4AXWB 2AFNA 3MNWB 4IRZH 4GG8A 3VFVA 1WP6A 3OSVA 3OKDB 2E74C 2YOAA 3SQBA 3MRLB 3U6XS 2MTAA 4FG4A 3IKKA 3UGEA 1FC1A 5FECB 2MRYA 4OQTH 5KSUB 2NY7H 2WYIA 1B9KA 5TQ2H 1OAZL 1YEDA 3D3VD 2PCYA 4P06A 1J5IA 3ASOB 3Q1EA 1CGXA 1S7RB 3BHBB 5D1XC 3L3KB 5MEPB 2E46A 5KVGH 1L0YA 3L5XL 3CAFA 1W9XA 3DECA 5BCAA 4CILA 5E94B 2FHBA 3O6FB 1ETB1 1S7QA 3F85A 4UYQA 2YD4A 1N19A 2KBGA 1IC4H 2QQLL 1PMYA 3T3PB 3BWUC 3MPCA 5FF6A 3FO1A 1WD8A 1T6BX 1F00I 2WO4A 3HHRB 3IDGB 4XTRC 4LRNL 1IE5A 4LIQE 1K8IA 1JPTH 1NIAA 5A2AA 1I3VA 5HHVL 1X44A 2GFBB 1A6TA 4J3OG 3IJ9A 2VLLB 1U8LA 4QD2E 3ZTJG 4XVUD 4F7KA 2NT0A 3WIIL 4O00A 4JVWA 4NAJA 3I6LE 3ARDD 1CT8A 4Y7MA 3WIHH 2XQYG 5E51A 5C1MB 2IAMB 1KEML 4HPYL 1HKLL 2ITCB 1B88A 4JM2A 2NXYB 2Q8BL 1I1FA 4LHUD 5ACLA 3WN5B 3CBRA 1YAZA 3DX3A 3OWRA 3KEHA 2Q2EB 3GUFA 1IT9H 5D1ZD 4YXHH 5LBGA 5KANG 4OAWA 4LVHB 3C5ZA 3BE1H 4S2SA 3S98A 2EKSA 4PSRA 1R5IB 3WIFB 3KLKA 3QAQA 1TNMA 5DJZA 3E8UH 3KVPA 5JXAL 1EXGA 1IO4C 4D7BA 4I0KA 4YSUA 4F7MB 4U6VH 3U48A 4YXLL 2JCCE 1QVOA 2A2QT 2Q0ZX 2ZXGA 5E99L 3OZKA 5M95B 1AMXA 4M62H 3I50H 5C9KA 1PQZA 4S1DD 1A6WL 5C0IB 3V5DB 2NY0B 4N8CH 4G6AD 2CA4A 1BGXL 2YLKA 3HZ3A 3DBSA 3L5HA 1ZTMA 1KIRB 1QA9B 1U33A 4N2EA 2KERA 1P2CA 1AQMA 1R75A 1TFPA 4ZAKC 2CUMA 3JTTA 1XFPA 4FNRA 3BUBA 2AS5M 1VACA 4J4PD 3PL6B 4MJ6A 2IH3A 1MXGA 1KLGA 4HQQL 4I0CC 3AREA 4TQIA 3UZVB 3WU1A 3GJFB 4GW4A 4XWOC 3II1A 2VITB 1X5KA 4EZLA 4JN1L 3DGDA 1HX0A 5E56A 4WUUB 4M5ZH 4Z7NB 1TJIL 1B3IA 4ZXBD 3DHPA 3QCVL 1WBYA 2WLYA 4KKNA 4AMKH 1OEZW 3BP5A 4GIOA 5C7XH 5JQHC 1KLFA 2P28B 2DY2A 3FU6A 3PNWA 5I0XA 4XPGH 1AGCB 2W9DL 4OFIA 4ZUSA 4MZRA 3TT1L 1USZA 4Y4KD 4KJPD 5TDPB 5CIPH 2EE3A 5D2NE 4NC1E 4LL1A 2HRLA 3U46B 3AAZB 2CAKA 1QFHA 3MHZA 3TA3C 1UM5L 1X4YA 3D0LB 3VFMA 2J6EH 3U6RB 3NA4A 3GNMH 1F4HA 1ZLUK 4BGDA 1Z9LA 3BAEH 3LIZH 2BNQD 1FNGB 2Q7NA 4JN2B 4X5PA 4HIJB 1BVOA 2ROYA 3O8XB 1J10A 3FQWB 5SX4H 3MJ8A 1DQKA 4N24A 1NCWL 2EXWC 1MJUL 5INCA 2XJKA 1KG0B 4LVOB 5IOPB 3N43B 1HH9A 2WNGA 2ZX8A 3D18A 3IXTB 2X1PA 3L3OC 4JO4L 1HXKA 4NUJA 2DBLL 1T03H 3H7LA 4JFHD 3ECUA 2G2RA 1P7QA 1IQWL 4NO2B 1AJ7H 1F1DA 2XA8H 3PXLA 3ZTEA 5TFSL 1W6WA 1RV6X 2CRYA 2EIKB 2HRGA 1SYSA 2ZXBA 2WK2A 4C58B 5FAAA 4DQOL 2A38A 2Y3NA 4GW1A 2VH5H 2BCKA 4WHDA 1Z0MA 1KOAA 3P4OA 5D7KE 3LCYA 4JW3A 4X0KA 1LK3L 4KZDH 3BZEA 4F33B 5E7FA 5GPRA 2VRAA 3RWJA 3OKYA 5DEFA 4HBQA 4XNQB 5HHNB 4J8RA 5F7LB 1ZA3B 2QSQA 4BK4A 4W6WB 3WHE1 3V95A 1FYTE 1AY1L 3D5OF 3NACL 2OK0L 1U4FA 1UACH 4NNYB 1BD2B 3CQQA 2X9WA 2Q5BA 4JG0H 3PF2A 3Q8FA 4NO3B 3PWPA 2BRRL 2VTFA 4UIKL 5AQ0A 5A3ID 1T2QL 3HZKA 3V0AC 3AVEA 3UCQA 4KO5A 1KGCE 2FJFB 4QTIH 3NABL 3TA3A 2X1WL 3WNOA 4NQSB 2J21A 1P5UB 4MHHI 3UJTL 4UUJB 4C54A 2EDNA 4LOEA 3CN3A 2BJML 4R8WH 2X3BA 3DVFA 3MRPB 1RZQA 1KN4L 3LNGA 4N2NA 1A02N 4Z7OB 3KPLB 3VRIB 3EXJA 2WN2A 3B5GA 3BCDA 4LCCB 1QWUA 4DVRH 3UTOA 4G42B 3NIFB 3OVUB 2A6IA 5IVZB 3WE1A 1UC6A 3NJKA 4TN9A 4NQVB 2ZKYA 5FUZL 1JWMB 5C0ND 4W81A 4BFOA 2WVVB 1JV5A 4OCMC 3VE0A 5F6HJ 4OZGA 4S1QH 5GS0D 1BVLA 2Z35B 4O2CB 4MJIB 3FQUB 5HYEA 3CDZB 3EDFA 1OAUH 2VUKA 2XFXA 1CIDA 4WV1B 4YE4H 3QUXD 3HG1B 3FU3A 4I18C 2FLRT 2BNRE 4FADA 4GI6A 3O2DL 1TR7A 5J56B 1QFWI 5GISL 3T0DA 3WKQA 1W72A 2Q3XA 3GSNB 4JHAL 1UM4H 3ULVE 1NCCL 3MRIA 4NNXB 3LNIA 2MMXA 1FO0L 5K93A 4YPGB 5IMLA 1ZS2A 4LEOA 2WIIA 3L3OB 2IPKA 3MNDA 2E9IA 4IGBB 5JHLA 3FSWA 3NK4A 4A66A 4DZBB 2MHAB 4O2CA 2H8PA 4MXQC 5HHMD 1EO8L 2AEQH 3MRPA 5IQNA 4Z78A 4LHQB 3N43F 4TSCH 2C3VB 1FAIL 1IEAB 4ZDHA 1ZT7A 3DUHA 5J1AA 1M6OA 5LWYL 3TF7C 2UX6A 5FW6A 1F6AA 3U0TA 1N67A 4LVNC 1ZHLB 5ADOL 1I1YB 4XPAH 4U3CA 1U8PB 2Y7NA 2VL5A 3QUYD 2R51A 3TBCA 4BHUI 5I66A 4MCZA 4L8BB 3OMNB 2QGCA 3MJGX 4XNUH 3ILQC 5E6ID 5AVRB 2AV7B 2IBGA 3T3PE 2ZUQB 3BKYL 4L4VD 1LO3L 1IJ9A 2W91A 2Y1VA 3TP4A 4IRZL 4OCXL 3JTSB 5DD5H 1G6RB 4UT6A 2XY2A 2BFVL 1V54B 3MJ6A 4F20A 4JJOA 4NOBA 1A6PA 4Q58C 1PD6A 3V6BR 4OD3H 1ZKAA 1K72A 5DZ9A 4XNQA 1HAUA 2NY7L 3M17A 1URLA 1X6NA 4UT6H 2DQUL 1H6EA 5F6IC 4ESKA 2XWRA 2C9XA 4DN3H 4X4YA 4JM4L 4L3AA 3TBWA 3N6YA 2IXQA 3D69B 2BCKB 3IKCB 1RQ5A 2BINA 4HGWA 5F7FA 2DLFL 2VOTA 4NNPH 3Q8BA 4X0NA 2VDQL 1N8OE 2R1WB 3QFDA 1SXAA 2EVFA 3SDDC 2XOTA 4RIRA 4PHZA 2HYMA 5T1DL 4YVNA 2MQ0A 4HOMA 1ZV9A 4LRNH 1AO7A 1G1CA 4GKNA 4K7PX 2WB1A 5G4MA 4OF6A 5EZLA 3H6JA 2N1KA 4FLOA 3TA4D 1GAFH 4DP9X 5I76B 1IM3B 2EXYC 5DJAB 4F2FA 4U6HA 2CO4A 2MKLC 5AOJA 5J6SA 2EDLA 1NGQH 1HHKB 2DD8H 4LNVA 1VERA 5BVPL 1F58H 2AJ3B 8PAZA 3UPRA 5JIIA 1BA9A 1NIFA 5CBEB 1O7DC 4QRFA 2PYED 2OSLB 3I75B 2PCFB 1NL0L 5ACZA 5F9DC 1AS7A 1NDGA 2VXTH 3BUIA 4HX1B 3NZHH 4JY4A 2DJMA 4Y5YA 4CSPA 2XACC 4D9LL 3LN4B 35C8H 1DFBH 1JV2B 4MLSA 1NEZG 3H2WA 3L2NA 4NFCA 1M53A 1FJ1A 3NFPB 5SWSD 5KANI 5ILTH 3RL2B 5E99H 3L9EA 2KYIA 1BQLL 1OCRB 4Z0BL 4FQLL 3VQLA 2E56A 4CU6A 1RK0A 2PW2A 4NZDA 3VTMA 3SDAB 4LB8A 3L1OL 4P0DA 4HG4K 4JJHA 1FIGL 1ZANH 3C8DA 3GSOA 4U1IA 2ZX7A 3QHFL 4JRXD 3ZR5A 4DKAA 1DQMH 5LGJA 2XQBH 2MQGA 1UFGA 1YMHB 4YSAA 2Z3FA 3EOYG 3RWFA 5AB2A 4HV8A 4PV1C 2WLIA 1FG2B 3WIHA 4HISA 3SDCA 4Z7NF 5E6IB 1JI2A 3ISRA 3L3IB 4RESB 3DJZA 1OD9A 4KY2A 2CA3A 3ZRSA 1YMME 2W9DH 3NP4A 2BERA 5J6GA 3HNSH 4R7DA 1FI8C 1LL1A 1NH6A 1RXLA 2P8MA 3P73B 5KUKA 2XVKA 4W9HC 4YK4C 3NZUA 1A3RH 5I8OH 4C56B 1DL7L 1SVCP 2J6EL 2RA1A 1A4BA 4HV8B 1DQVA 3TGXA 1W80A 3DUSB 3PUCA 3W0WB 5CEZL 5JPMA 1E5UI 3RTLA 5I23A 3QYNA 4XNMB 4A38A 5C92A 4OTXH 3QG6A 2CHNA 1ZGLB 1FA4A 3GZPA 5EOCH 3TEZA 3DURA 1RSFA 1BJMA 3PNWB 4DWHA 1JGDA 5CZKA 4IKNA 4X4MA 4RVBA 5C6PB 2X3AA 3RX7A 3SE8L 3GPSA 2NY1D 4GXFA 1G9NL 2GSIA 4TQ8A 5D7JA 2FSEB 4GRLA 2OTPA 5ACMA 3WY1A 2CD0A 2CO2A 1RUAL 5EH1A 1T5XA 4Z23A 4OU3A 3V52H 4YHYB 2H2PC 3N1FC 1N2RA 2VDRL 1I3GL 3DRTB 3W1ZA 4C4BA 1JNLH 5T3ZD 2BOLA 1U8LB 4TSAL 4ETQB 3THML 3MLTB 1WCBB 4G1MB 2VN4A 1NAMH 1I85A 2WQSA 2I32A 5FA4B 4AVKA 4D0CB 5AG8A 3BPLB 2FX8H 3Q6GL 1MJJB 5HGBB 4MMYA 5F1IA 1OZTG 3SQOH 3BD3A 3OX8B 5E5MB 1B0GA 3FHQA 4G6KL 4KHXH 4NN7B 2BSDA 1R34A 2J88L 2X9YA 4TUUA 5F7KC 2XWZA 4AZUA 1JZ5A 4G6JH 4UQ3B 2V2TA 4AQEB 1S5IL 3A6BL 3PYCA 5F9JA 3OXSA 3DJRA 5D93C 2AV1A 1I1CA 2VAAA 5IB2B 4K5LA 5HDBE 2R1XB 2UY7B 1QBBA 3S4SG 1MRFH 4BQ8A 5IHLB 2ZCHH 3UAFA 1C5CH 5KOMC 4PRPB 4JG1L 4KVCH 4X6CE 2WLZA 3SDCC 4TVPD 1CR9L 5CXPA 3UMTA 5HYSA 1GGTA 1HCFX 1TZOA 2K0RA 3KLQA 4OIFA 3N5AA 5D71L 4FGMA 4CC4A 3D48R 5KSUA 1CYWA 3GRBA 5AL0A 4PWHA 1IFGA 3REVB 3ZE1F 2VABA 3GSWA 4JRYE 4F7PA 4F9LC 2QKIB 4ZMPA 4DKEH 3IGAA 3LD8C 5IV2A 2JIXD 4MMXC 4OFVA 2WXGA 1ZD6A 4U1IB 4O2FB 1EEZA 4X4XA 3BP6B 5H4YA 4Z0XB 2HT4C 5BW7A 2Z93B 2ZJSH 4PTUB 4JFFE 5PAZA 2BJMH 3B7RL 2BNRD 5DSCA 3BT2L 2PWHA 5AW0B 1DBMH 1HEZB 3DXAB 5DRNA 3BZFA 3RZCB 4C47A 4PY8J 1BZEA 4G83A 3ILEA 5DLMH 1RJCA 4Z5RB 1YMHA 4NM8L 4CVZB 5K1NA 1KC5L 5MP6L 1BMZA 3QIBB 4HIXL 4ZFFA 4ZMNA 5L2JB 1I8MA 4RLDA 3UPCA 3CLEH 4QF1A 1H15A 2X4OB 3CFKA 3ECBA 3IMSA 2F53D 2FVNA 2GTWA 1RK0B 3CFCL 1KPRB 2FQEA 3ARBC 3CLFH 4YE4L 3BZ4A 3OLGA 1UG9A 4H2CA 5E1GA 1X5IA 4AT6A 1XEDA 4YX2H 1TEYA 1ZV2A 4AGPA 4G7QB 4JFDA 3IFLL 1U93B 1TTGA 1CF1A 3LZFL 4HHGA 5EB9A 4EI5B 1UM4L 2N1TE 3CZFB 4GRWB 3MU3A 2A9CA 3OJDA 3FUKA 1WZ1H 4KUZH 1BQHA 3FU5A 1AQKL 1D9KA 2G5BA 4FC3E 1YEIL 3G5VA 1TETH 5C70A 5EWIH 4QXTA 3C87A 3VX0A 5FOBB 3S3JA 3ILQD 2F68X 3AU1A 5E6IC 3CZKA 3EGDB 3QFDB 1YA5A 3PP4L 3RY4A 3QISA 2WINA 4MCYA 3N42F 1OF2A 1MFEL 2EXWD 1FFPB 5EBWB 4DPCX 1PZ2A 5KSVB 2OKMA 1YEJH 1H3GA 1KB9K 1KBVA 3AC0A 2V7NB 5GSVA 4NWTH 2GT9B 1ZHKA 3NZ8B 1A7PL 1FZKB 2ESVD 2WOBA 2HFFA 3DJSA 1DJHA 2X1XR 1TYEB 3ERXA 4L3EB 2UZPA 1RPQA 4PWIA 3KJ4B 1WWAX 1F42A 4ZXBB 1DBKL 1J9TA 2YBGA 4LLYB 1IBDA 3B5TA 5D2NC 3IRZA 3FH7A 3UROR 5IEKB 4WIQA 5JOPE 1S3KL 1G9NC 4G8EA 2ATAA 2WC7A 3BAYA 3ILPB 1UEMA 2X4RA 4JAMA 4UB0H 4IKKA 3SPHA 3L3GB 5GRXG 2X2HA 1N68A 2DEYX 1CLOH 3EDKA 3F7KA 4HKJB 1NFDE 4L5FH 4NCC2 3BX7C 5FGCB 1LO2L 2AITA 1MY5A 3QZWA 5K9JH 2EE0A 4QHKJ 3QQNA 4AV0A 3SDYL 5I1HH 2ZXAA 3RY5A 5B7FA 3FT3B 1WAAE 2QDVA 3R18A 5CU5A 2E7BA 3VI3B 2EIZA 5E8EB 5D8JL 4D9QD 1M6OB 3GMPA 4KH2A 2UWEA 5D4JA 4OF5A 4R4BA 4RBPH 3T8MA 3GBNH 1NPNA 4A2DA 4AYGA 2MPVA 1MCJA 4UTBH 3GT6A 5IM7A 4X6CF 4X5WA 2X2JA 1EMTH 3VRJA 2NXZD 1AXTH 1U3JA 1C8QA 3MBEA 1YSOA 4IHOA 4YWGH 3S34L 1UEYA 5HHQB 2OMVA 1JZHA 1PVHA 2QVIA 4H26A 4H20H 4LCCC 3VG9B 2Y1ZA 1AG6A 1FPTH 2ZYSA 3VG0H 5A2LH 2VN5A 4M3HA 3RPIA 4M8RA 2DMGA 1INQA 4CAGA 1TVBA 1GPOL 3CH1B 3MRNA 2BVQB 3ZL4L 2XFXB 4KKCD 4NKMB 2AQSA 2LU4A 2PCXA 4HS6B 2Q6WA 4UOZA 3QIBA 3GM8A 4ODVL 4MYWB 4ELMA 1L9QA 2KDGA 5TE7L 3V5HB 4KKRA 3APDA 4XVUC 3WIHL 3L3DA 1NCBL 2OL3B 1UT9A 2EVIA 1URIA 3VFWA 5AVWB 3J8F7 4XN1A 3I9GH 2JLLA 4A6YL 1ZXKA 2CJ3A 4RGMB 4GRWF 4OJFL 5CAYB 5IB3B 1N12A 3V6ZB 3LTVA 4JFED 1I8MB 2YPKB 2ZKXA 4RA3A 1Y1DA 2OX5A 5HDLA 3L1OH 4X6DE 1JVKA 4LSQH 4JGNA 3QBTB 4GAJL 3AY2A 3H56A 2XZAH 4JKKA 2F61A 3ALWA 3VXRB 3RUGF 4YC2C 3DWTA 4G5ZL 2EH7L 2A74C 1JZFA 2ZQKA 5BNXD 3PGFL 4JY6A 2D03L 1KELL 3H9HB 3S37L 1WIOA 1IC0A 1DBJL 2CCWA 3K2MC 4LK4A 4P2QA 4IRSD 5G5DA 3TLRA 1FRGL 3U4BL 3HMXA 1HNGA 1GH7A 3PGDA 1IAII 3KYKH 1JYXA 2A0LD 1OZUA 2Z92A 2C9VA 3NTCH 1M9WA 1WBYB 5J57B 2Q87A 1OPOA 5FKPB 5BV7B 4N8UA 3EJJX 3EFOA 4L5FE 5F1IB 1MRDH 4KV5E 1W72H 5E1HB 4L8CA 4NBYB 1A66A 2IQAA 1SHSA 3OTTA 4DZ8A 2I5YH 3TYFA 4I8DA 4BCXA 4WTXA 4ELMF 1ACCA 4S1RL 3GMLA 4NCDA 1MPAH 3NUKA 2J5LB 5I0ZA 3P0VH 3QAZC 5CD3B 2DQFB 1OGAA 5C6WH 3MUY1 2W07A 1T0NA 1D6VH 1WV7T 1IBGL 3ZIMA 1IGYA 3UJJH 2N3JA 1WIPA 4P2OD 4DK5A 5IESH 5LLIC 3FCSA 1RHFA 1YEEH 3ULAB 2P5WE 3IPEA 5DHYA 4M61A 1KDJA 3BD5A 3RY6A 3VNZA 3CFDA 2DQTH 4AEEA 4WW2B 3KBEA 3W0WA 1WAAF 5DJZB 2O4EA 5I1DA 3OPZH 3BC9A 2CZNA 4LBAA 1IGIL 5C0IA 1XF1A 5C0BE 5INDA 1OM3H 4PD4J 3QUGA 3SYOA 1UWGL 4PJDB 1KGIA 5FX3A 1TUPA 1K9TA 2DKUA 3FOMB 1S5IH 3A6BH 4UOJA 5FFOA 3OB0K 5JA8B 1KPUA 4BFIB 4D9RE 1NWOA 2OMBA 4XGZA 3CPUA 5I8KL 3DC0A 3UABA 2Q7YA 5ESQA 4EI6A 2G60L 4NC2B 3PY9A 4IOIB 5IWLA 2BM3A 3I9AA 3UZVA 4IRSC 4QCIA 1JPTL 2D9QB 4GQ9H 1B0GB 1MCOH 4QYOB 3DSNA 2VZUA 1H8OA 2D31B 5IK3A 4P9HL 3U1SL 4KZCA 4XOBA 3WE6B 4DKEL 2JIXA 5FO8B 3T6XA 1QW8A 5CJBA 3P0YL 5EO9A 3EH1A 4HHAA 3MVSA 3UPAA 5F9JB 3L3IA 3D06A 1BFVH 1GZHA 3HB3B 3RVVD 4XBMA 4MB3A 3WNJA 3L7EA 4OZIA 2ZJSL 1D5ZA 4XVOA 4JG0L 3O4LA 5DUPL 4CVUA 4WO0A 4OZIE 5FGBA 2B8OT 5ITFB 5EU6A 5DD1H 4DOHB 2ZYHA 3HN8A 4PRHA 3UP1A 4YDKH 1OTTC 1CI5A 3NABH 2WP3T 1FN4B 4ZRGA 5D5MF 1MFUA 3FCUB 4APXB 1CF8H 5A1AA 5DF0A 1T1YB 3HTLX 3S5ZA 1MH5B 4JEGB 2EXYD 2Y9RT 4R8WL 3QEQE 2MOQA 1JSYA 1IU1A 1RJZA 3WY4A 1EGJH 5I1LA 3O4LE 4IKLA 4EI6B 3F3HA 2JKLA 3L2MA 3H7BB 4JO2H 3EYQD 3T1FB 3RIAK 4FFZA 1WPCA 2BVEA 4CADA 1AE6L 4K07A 4L3EE 5J06A 4OZFA 2MNWA 3I02A 3QSKB 4UIMB 3QQ3A 2PO6B 1ED3A 2VLRB 4X6BB 2FIKB 1R5IA 3NGBC 2D3JA 2PTUA 1OLLA 2F2HA 2OMTB 3QS2A 4XXCC 3KLSA 2WGNB 2XXCB 4ORZC 2XWDA 1LDPL 3C9NA 3CDCA 2FGWL 3V0GA 3AQYA 2UZXA 2K4WA 2WB7A 3CQPA 3H6AA 4KV5F 4YDJA 2R29A 4PJ5B 3D9AH 5BV7C 3LMJL 1A3ZA 1JF1A 5CCHE 1R19A 1LNUB 7TAAA 3FCSB 1K3ZA 1MRCH 4Q6IC 4R97B 4WNQB 2VRQA 5D6CB 3STBA 5GRJL 2A4ZA 4PN6A 4X8CA 4JY5H 3WEXB 4EJ1C 1TCRB 5EO1B 4OGYH 3NSCA 3KZ8A 1G6RA 2W65A 3EOTL 3OV6A 3ULUD 4ZTPH 1TO4A 5LWYH 2JK5A 2EH8L 3KYNA 1I4FA 4N0YL 2BW5A 1U92B 4HDIB 1S7QB 1L3WA 5C9JB 4UB0L 3RVWD 3SDCD 1NJ9B 3F7LA 2Q6WB 1PZ5A 4IQHA 5T8IA 4KAQL 4KRPD 4RX4A 2BP0A 3TA3D 4UOQA 5GZOC 2NTFA 2A74A 4JHZA 1YEDB 2PW1B 2GHZA 3RIKA 4JDZA 4U1LA 5I1HL 4P8QA 4E9TA 4IS6A 4RWHA 2XA8L 3PV7A 3WTUA 3PXHA 4XH2A 4ZNEE 3HRZC 3FFOA 2HZHA 3Q2LA 1QSFE 1DE4B 3C8KB 4ORGB 5IB5B 4EBQL 3MRMA 1CK0H 2WZ6A 3H55A 1WA0X 2G3MA 3N91A 2A3TA 3TO2A 2EO9A 4ZOBA 1NCTA 1T1ZA 3QIWA 4J3VA 5I5IA 3NT0A 3SKMB 3KPNB 1UKSA 5E9DA 1R0AH 5E1IA 2IAMD 5IT2H 1IKFL 4NNXA 2BO0A 5DUML 3RA7L 5EF0A 4AE0A 4CDGC 2DLFH 1RZGB 4H20L 4MS6A 2CO6B 3KNBA 5DYOA 3ZDYB 3ZZQA 4L4VB 4BDVB 3MRCB 5F7EL 1N59B 1ZSHA 2FB4L 4P4RB 4PJAA 2P5ED 4PJ9D 4UQEA 2FIRT 1DQJA 1YNTF 2B0SL 1OP3K 2BXYA 3N41F 4F9PC 5HVHB 4KK9D 4GB9A 5HJ3A 2O5YH 4Z8FL 1BAFH 2I25N 5CUSH 3U7WL 1RD6A 2BRRH 4MNQA 2OTUB 3A5VA 3QYCA 1CG9A 1O7SA 2NDFA 4I3RL 3LQAH 4M48H 1OXYA 1FNSL 2GJ6E 5HP5A 3TFKC 4WU7A 1CBVH 4Q56A 4HJ0C 1J1OH 4AVJA 1VGEL 3C6LB 4JFYB 3GK8H 4MNHB 1PZDA 2QHRH 3F58H 3WS3A 5L8JB 1QQDB 1ZDQA 2J25A 1A7BA 3BWAB 4HWEL 1AS8A 1G1KA 1TVBB 1N7MH 4A6YH 1DDTA 1AACA 4B9KC 4A7TA 4BUGA 4K8RC 4MCZB 3II2A 1DVFC 1ZHKB 2AF2A 3DHUA 3MLVL 4Q9CA 1MCPH 4X83A 1E90A 3QDJD 3VXTA 2F9BT 2UZYB 1O6SB 2HLFC 3MA7A 4ERSH 1QSEA 4HZLA 4IBLT 1ONQB 1V05A 1BZOA 1O9VA 2VDLB 3ISWA 1IL1B 2XIIA 5ILTL 4RDQF 1FFTB 1S9WA 3BFOA 4ICWA 5DJ0A 4LAQL 1IM9B 5ALBH 2KKQA 5GGTA 3RDTA 4U1KA 1JZ3A 1EO7A 2ZX5A 1SF5A 5D7LD 1G7QA 1RLWA 3ULVL 1DQJB 5GISH 1DBBL 3QCTL 5EHFA 4F8NA 5LO7A 3Q9PA 2OQJB 5D7LA 3UBXB 2IOMA 4LQFH 3RGVC 2ZKHH 3NTCL 4KMQA 3UG5A 2XZQH 3PHQB 4XWGL 1KTDA 1FVDB 2FX9H 3HHSA 4FZEL 2P5WD 3VA6A 1WAEA 3U36A 1OAKL 2DH2A 3QZWB 1Z9PA 4OT1H 1XR9B 2D0FA 3MRRA 2AQPA 3DMMC 2ORBL 1E43A 4QXWA 1Z5LA 2H9GB 5CSZA 1T66C 1YN6B 2IALA 1JYVA 2L04A 4B60A 1FE8L 1MQ8A 1S5HB 3HE7D 3ML9A 3NEOA 4MA1C 4PJDE 4WWID 5T5FH 3TIDB 4L3ED 2VJ0A 5FYKL 3ZRCC 1AYRA 1X9QA 3WSQH 1BD2D 3BEWB 3QFGA 1O7DE 1R3IH 1UASA 1BF8A 4XNUL 2LT9A 2D9CA 4X7TA 4N9GB 3MRMB 4WGVB 3ETTA 3BKYH 5DQDL 3KPPA 1CL7L 5E2VL 2J12B 3D34A 3TCLA 2VC2B 5FA3A 1S7UA 4XPFH 3G5XB 2Z4QA 5D4IA 5DJXB 3UC0L 1F5WA 4G8GB 2V37A 1GS7A 3WKPA 4DUWA 1RAMA 4HUXB 1YECH 3LKRA 5EIIA 4YHZL 1A25A 5HSFA 2GTQA 4E9YA 4NO3A 5E8NA 3FU7B 3JWDL 4ZS7L 2B5IC 5CEYA 2AJZB 1JNLL 3ZE1B 1S9KC 1GGBH 3GS4A 3TZVC 1SHXA 2C1OB 2PF6A 3CVHB 2M26A 4OFPA 1KENL 5EA0H 2O6CA 3VW3L 2FX8L 2WMPA 3BFQG 3QPQD 4WUUA 4AQ1B 4ALAL 3WXWL 4G72B 1S78C 3FF7A 4L1HA 2FEDC 5T1DH 3DPBB 4TV3A 2BSEA 4I48A 3KD4A 4DKFL 1GGUA 5GGQH 2A4EA 4N2GA 1MVFA 3HRZB 3LKOA 5D70L 1BFTA 1WFUA 2BIHA 4S11A 4B95C 4F9PA 3S88L 2JQMA 4P9HH 3TC9A 1PS3A 3V0VB 1KF9B 4DN4H 3IETA 1LO5A 3DDGA 5BQ7A 2AQ3A 1E3FA 4HJJL 5HGAB 2ZSWB 4WSKA 3KHQA 1NEZB 2CUIA 1LO4L 4OZGE 4NO2A 3QI9C 5D6DA 5FYLL 1DR9A 3KGSA 4MD4A 1ICTA 1T1WA 3CSPA 3D87B 3D18B 5I6PA 3DURB 4A6YB 1SYSB 1U91A 3NZHL 2BNRA 4KJYA 5AAWC 3KWUA 4YFLF 4HKZA 4IBSA 3U2JA 1SOXA 2AANA 5ELIA 3FT4B 5HHPB 3IFPB 2BY1A 5KBLA 4N90E 2OA9A 1A14L 4BJLA 2ICEC 4ZTOL 5FPIA 2JLPA 2AKRA 4LCUA 4Y16A 4WK4B 1NCIA 2EILB 3WXVL 3NJHA 2FX7H 4ZPVA 4UANA 3RDTC 5EEZA 1OB0A 2ED7A 3BE1L 4GO9A 1TCMA 3MCYA 3SKNB 1FGNH 4APQB 3P3SA 2FL5A 3LRSB 5KYUB 1T5KA 4NQCE 4AVHA 4LSRH 4HBCL 3ZT6A 4HU8A 3Q01A 3CZNA 4J6IA 3UO8B 4HHAB 4HIQA 3ZKND 2Y7OA 4FNPA 1NIEA 2J8UE 2OPCA 3CZLA 2R7EB 4JR9H 5KYYB 1JGUL 3JV4B 1I75A 5JW4R 3V0JA 4NQDB 4R84A 4ZUSB 3LYRA 1MJ7H 5CP3A 5HDRA 2C9PA 4AY0A 1VPOL 1VLXA 4P23A 4B5EA 1ZEAH 3PFQA 2N59A 1R47A 1MCIA 1PJWA 5IEHB 1IAOA 1AZUA 3P2BA 2OZ4L 3LKRB 4LCUB 4JN1H 4IHBA 3VD4A 4PJDF 3VFRA 3RTQC 3KPQA 2IDSA 3H9SE 4LOVA 4F8LA 4H8PA 4YGAB 2H3NB 1JWUB 5K39A 3IF1B 3QORA 2A9NL 2J72A 3TNNB 4ZTPL 3VMPA 3WYRA 1BCIA 4J27A 1GRWA 3DSFH 4OF3A 4P3WA 3GBEA 3TBSB 5I24A 1ZTXH 1U58B 4C56D 5CJQL 3VVWA 4P2RE 4LSTH 5EU6D 1DEDA 5DK2B 4XR8C 2FO8A 2EKSB 1XXDC 1H3UA 4KO6A 4N8VA 3RJOA 3VGHA 1HVXA 1R3HB 3ZDYE 3PGCA 1QRKA 3JV0A 3QNXB 1W0YT 2ICWJ 3LRHA 1H3WM 4E9WA 5J11C 2WP3O 5BO1H 1TQUA 4QT5B 3GIVA 4FTVE 4FL4B 3DHMA 5AOMA 1ZPUA 4R3SA 4JKMA 1IGCH 4FTVA 3T3MF 5I76A 4EBQH 4PRID 2WIMA 4OSUL 5CD3A 4NP9A 2XG4A 5IHBA 3FBQA 4CVXA 5HYQA 1XF3B 2E8YA 4IEFA 4RRPM 4WWKD 3DPBA 3CN2A 3MRRB 4GBXD 3RG1C 5I1EL 3SOBL 4NZRL 2FBJL 3S3BB 1IIIA 1OARL 4Z3EA 3EYOA 5B1JC 3WG7B 3M86A 2YA0A 4H0IA 5T1LA 5IT2L 1INDL 5FR3A 1U3NA 4FQXD 5D1QA 4OI7A 1MLCB 1HOCA 1TDQA 3SBWA 5KAQG 1S7WA 4R5TA 2C4FT 4FMKA 5E94A 4UTAL 2AC0A 1CR9H 3IXAB 2WTPA 1G43A 1KNOA 3GRWL 2CLRB 2O5ZL 1QX1A 2VW6A 3OD3A 1CCZA 1RZIA 4QXGL 1Z3RA 1ASPA 4Q0XL 3T04D 3D85A 4TVPL 2FYYA 4FEIA 4DIXA 4KRPB 3QPXH 1NKOA 1T5WB 5D1QE 3TVMB 1J8HA 5B39A 1PZAA 2XT1B 1AY1H 1GGYA 1TJHH 4RAVA 5LN4A 5IKCA 5K9OA 4Q89A 3L3KA 1YG9A 2HWZH 3R06A 1GOHA 2R0LL 5TJWK 3GDBA 2NR6A 3FU7A 3RLSA 4UIKH 1AXIB 1DBML 3TZVB 2RB8A 4IOFC 5TF1H 4NC1C 3F84A 1OW0C 4GS7C 1I8KB 3VDCA 4YPJA 3SGJC 1GJWA 1E3XA 3C5XA 3HOGA 3UTSA 4PJ5D 5C8JA 2X28A 4WU7B 3HBZA 5IB3A 5C0BA 4YOKA 5F1KC 4AMWA 5I71B 4HJTA 4KKLC 4TPRL 2DEWX 2MEJB 4NX0A 4P49A 5ALBL 5FFLA 3O4LD 3OKKB 4X9GA 2EYTA 3TBTA 1A64A 1OTUD 1KIPA 1T4KA 1YEHL 3PS6A 5IMLB 3P3YA 1CDYA 4KKPA 3S36X 5I2IA 1UQSA 4WFHE 2VISB 5D7SH 5T3XH 4EN3D 2BH0A 4S1QL 3WO4B 3O3AB 1NCAL 4LQFL 4R0LA 1V3JA 2NNAA 1BZDA 1YYLH 5GZND 5HPMB 4KUZL 1MI5A 5J11B 5DJ8A 4XC1H 2H1PL 1AR1B 3KL0A 4YNYA 3NYKA 3D05A 1BFOB 4HK0A 4NIKB 3K4AA 2L8AA 2UZYA 1MG2C 2OXHA 5EF3A 1JMXA 5ERWB 5HHQA 4L9LB 3GBML 3N40F 2BVTA 2HT4D 3L6FA 4L8SB 5ANMB 2BIOA 4N87A 1IKNC 5F0PB 3RVUC 1CBJA 4LXFA 5D2LF 2ROXA 4UM9D 2NZIA 4JGMA 2HX9A 2ADIA 1FG9C 3G08B 4UM8B 2K6ZA 1A6VH 5AUMB 2EDMA 3FQRA 1ZWIA 4JLRB 5CJXC 4NT6B 3BIBX 4K23H 3I6GA 4YHPA 6CGTA 3MV7A 4X9IA 5ID0B 2YUXA 2OZNA 1MCWM 4YAQA 1DFXA 1CG9B 1YNTB 2H32A 3G7TA 4KJWC 2AEIT 5EMYA 1RJYB 2HJLB 4AIZB 5BS0D 2VIRB 1UD6A 1N8ZB 4G2AA 3Q06A 2E5EA 4UMGA 1THCA 4MX7B 4FA6A 3CSBA 1D5IL 4DP7X 3V0HA 1AOHA 5E9NA 4HCIA 3FQUA 1SOSA 5EBGA 1K6QH 1UGKA 5F7DB 4OZGB 3QAZB 2I07A 3L9RB 4P4KA 3RIAF 3AQDA 3EHBB 4KQ4L 2IBBA 4LLYA 3FYIB 1KGJA 3VW3H 4QXUH 4HIHA 4OD3L 4DP2X 1SJHB 2K6WA 4QAMB 2ADJB 2X0WA 1U8IA 2O6FA 4U05A 4PJCA 4FHKA 3AS1A 1QLFA 1N18A 1DBAH 4WHTB 2PXYA 4X0KB 4BSWA 1C16B 4F57H 1I7TB 1R4XA 4QKTA 4UQDA 1MNUL 4K9JA 3O9WA 1I9JL 1RUPH 4IRJB 4LE8A 4P99A 4YWGL 3S34H 4ZUWB 2HVJA 1AGDA 1ZE3H 3MV8E 4AWJC 2I9LB 3F00A 2AABH 3VD7A 3MYJB 4IBZA 5CGYD 1D2PA 3LQZA 5MEOA 3CVDA 2A74B 2HFGL 3EOAB 3P2TA 4PCTA 1IM9A 1TJXA 5FLVA 2JJTA 3E3QC 4JCMA 4XVJL 5A43C 3ZL4H 4N1EA 3W81A 3ETBF 2WLLA 4OCSH 1VFMA 4GAYA 4OZHA 2K70A 4MA8L 1HH6B 4OZHE 3QXDA 1U93A 3LRMA 1XZWA 1PKQA 1FZOA 2EKJA 3LDBB 4Q6YA 1A14H 2V5MA 4FQHA 2XXGA 4RGMC 4DK6A 3GQFA 1SEBA 3QS3A 5DD1L 2F74A 4OM1H 3WXVH 4AL8L 2L0DA 4P48A 3GMMB 1EHNA 1PD0A 5TDPA 1KGWA 2YA1A 4JMXA 4B9CA 3M7FB 5I6NA 5KJRL 4WTQA 3DVNB 1QHPA 3MRQA 2VISA 4ZFOL 1F18A 4JDEA 1AGCA 1SEQH 3PHSA 4RNRB 5KTEL 35C8L 1DFBL 3DX7B 5GRZA 1NGWA 5IHHA 4PGCB 5F1NA 4F93B 3D0AA 1JZJA 4GIPD 2EUXA 2XTJE 3E1ZA 2CBMA 4H1LG 1NDTA 1NFDA 3CX2A 2VLJB 3EJZD 4G5ZH 4TUJB 4WUKH 3SGDH 1SJEA 3X3FL 2LABA 3LNDA 4IIZA 1NM4A 5E6RB 3QC6X 2Y7QA 1NCUA 4BWTA 1EANA 3M45A 3UG3A 3ZE0E 1DN0B 2ESVB 1N0XH 1DJWA 4LARL 1E7VA 4AEHH 2MKWA 5JIMA 1S7TB 2HCZX 1IQDA 5INCB 1DQML 1TQVA 4MRCA 3MJ8B 4HKBB 2X3CA 2MCG1 3QUZD 1Y6MR 3CXHK 4KY1L 2ERJC 2XJLA 3I74A 4H1LA 2VDNL 5EF2A 2ENYA 4AJWA 3IXTA 1MZYA 1QR4A 2GPZA 3OZLA 1QRND 2F53E 3CXHJ 3QUKB 4WW2C 3FCBA 1CICC 4ZZKA 2AP2A 4CGTA 1JD7A 1K2DA 5E4IA 2A9NH 2YC1A 1LP9B 3U9PL 1R3LB 3S36H 2GJJA 5DQJA 2A6JB 4XX1G 3WY3A 4UT9A 2XPYA 3MREB 2PO6C 5B4MD 1IAIH 1LLAA 5ITFA 4GRWH 2DQDH 2YKKA 3ZQWA 3DTXA 5I8OL 2UWEE 2R59A 4KI5F 2CLVA 5GS0L 5GHWL 4NBZB 3FTGA 1KNOB 2X4NB 4LVEA 1FH2A 3TT3H 2F58H 1CDBA 1T0NB 4MRBA 5SWSE 1RLBA 1WO2A 1X5MA 4G1MA 4J2QA 4E41D 4LCWB 1BZ9B 1PCSA 3E6HB 1UA6L 2AMGA 1FBIH 2YPVA 4M8QA 3KCPB 3UTTE 5CN3A 4HF5L 5HDQH 4U1GB 2N7BA 4OGZA 2OR8A 3HI5L 2ZUTA 3ES6A 3ULVF 3JWNC 4YQXL 1IVLA 3DO7A 5GGVY 4PJBA 5C0CB 3S37X 1U9KA 2GQHA 4NO5B 1XXFC 1A1OA 1I3GH 1VACB 1YJDC 3PG2A 5AW9B 3N41B 2IG2L 3RI5F 4LL4A 1P1ZA 2I7SA 1OTSD 4MZ3A 4X4KA 3D2UA 4Z3TA 1AR2A 5SWZE 5IFJA 2XTLA 4QR7A 3PAUA 2DL9A 5IF0B 1CK0L 3HA0A 5JOPD 4PJDA 4F2MA 3SQOL 1BXUA 1SZNA 2EJ1A 4TUKH 5E6IA 4A7UA 3WTXA 3EJYC 3ARBD 3VYNA 1J8RA 3CC5B 3D30A 1TT6A 2NCMA 3B2VH 4ZQTA 1NOLA 3B3IA 4HGMA 4TVPH 4R7DB 1JCVA 1AGFA 1MCOL 2IWGA 3MNMA 2LU3A 3N3EA 1EEQA 3OKNB 5DI8A 5KSBF 3GXDA 3OR6B 3RZCD 1PW3A 2B9BA 3CDYA 2IAMA 2CHWA 4GLRI 3EYSL 4GEJA 2HKHL 3T3PF 3BISA 1QUPA 3LD8B 3M1OA 3BGFB 1AP2B 2DLGA 3BMVA 3SPVA 5E8PA 3RWEA 1AZNA 5IGXH 5HJBA 2FBOJ 2BZDA 4EN3B 3DO4A 1C9SA 1RY7B 4OZFH 2W0FB 4PGCA 2XNAA 4NKOB 2Y23A 1S7XA 5IFHL 1SM3H 3BLBA 2ZXQA 3ZT7A 2Z31D 2H3KA 5DYFA 4BINA 2FAUA 5DO8A 5A6IA 5SWSA 5DC4B 2FLBT 4R90L 1S7RA 5MEPA 3MOBL 2Z0BA 1N7ML 5DS2A 5AVQB 5FKPA 3REWA 3RFZB 1DDHA 1S2EA 1D5ZB 2NY1B 2OSLA 3MLVH 3FB5B 4NGHL 1HL8A 1SMDA 3WFEL 1MVUB 2FSDA 3MRDB 1YEHH 2VR4A 4GT0A 4NKQB 4EPSA 2PNDA 5F70A 2YC1B 4WFEE 3AS0A 1NDGB 2P24A 3B7UX 3GMLB 4DGIL 1AZBA 5DVKA 2KL6A 2PYEA 3FHAA 3ZTJH 3MBEB 2W8CA 1MW0A 3HMWH 1U8JB 2AK4B 4N2OA 4AQ1C 2NY5C 5AW3B 3UEZA 4Z7OE 1E30A 5A3IC 4NM4L 1FFOA 1RZPA 3APCA 3K8LA 1LDPH 2EDKA 3HKFA 4K7PY 5EULV 5F8RC 3NCMA 3IMRA 3M6DA 3P4NB 3LB6D 1H6TA 3ZE2E 1FLRH 3UTTD 2X4TA 5I30L 3P11H 2VDRB 4AXWA 1NDMA 2DZEA 1RUML 1BBDL 1KLUB 3O9WB 1AQKH 4JHUA 1EX0A 3EF7A 4U1NA 1YDPA 3KPRD 4JJ5B 3FT9A 5E8DH 2XWBA 2FECI 5D2LB 1A5FH 2IH9A 3ZBMA 1EAQA 2E6JA 4FYRA 1C12B 2WZ5A 3ALXA 4DQAA 2QQKL 2ZOLA 3QC5X 1HHJA 4XAKD 3FFDA 4UV4L 1WWBX 3QUMB 2LLNA 3MUGA 4LKCB 5LBVA 2H7WA 5IEKA 3V6ZA 4OJAA 2NY1C 1KB9J 4GT7A 1AGBB 2CE6A 2ED6A 3F6IA 5CZVL 2X4PB 3Q05A 3DX9A 2DQCL 4EKJA 5JW5B 1A7QH 1WVZA 1FZOB 4GP5B 2NSXA 3ABZA 1QI4A 2XY1A 1TEFA 4G9FA 5KVFH 3H3BC 1SXCA 5DQDH 1C8PA 2DQGH 3NPSC 4N0RA 1G9MH 1NBVH 3US0A 1BJ1J 4PRDA 3QZBA 2EDFA 4IDJH 4PP2B 4PJAF 1FWXA 1ZWIB 4RFNB 4KQ4H 1IEAA 2AJSL 1EJFA 2J8UA 1B0RB 5E8NB 1TENA 3OHXB 3UYOD 2QZ5A 2ZWLT 3IJEA 4FXKA 2H8PB 3M8OL 4LP4A 1S9WB 5DJ0B 5E00B 5J13B 4M93C 1QFUH 1TQCB 4Z7UA 4I88A 5AVTB 3JBG7 4IGBA 1PIGA 2E86A 4YDVB 3MBWA 5EUOF 4GW5A 2C3VA 2TRYA 2CMRH 2GBUA 4WFFE 3M1BA 2UVEA 4PAZA 5C0DB 1BHGA 1DVQA 5KSBE 4HGKC 4OLUH 2G75A 3U4EB 3X1FA 1WG3A 3V5KA 1FDLL 4L37B 3MLYL 4H8WC 2X4PA 3EGSB 4BZ2L 5L9DH 1J0JA 4KPHL 4PJGE 4BWWA 2BP8B 3RNKA 4DAGL 1ACXA 1DLHB 3SYQA 4R0LB 4ODUB 1S5HA 1SXZA 3KGRA 5GGUA 2XETA 2AJYL 2AEWA 4NSKA 4ZXBA 3F8UB 1YLBB 2NR6C 3UEQA 1YQ2A 2W0LA 4HWEH 3QO1A 1OSPL 2RH0A 1A1NA 2NUTB 3K6DA 3QUML 5C0AB 1OB1B 4NQVA 2OMUA 3IJYB 4QHPA 3D4CA 1XH0A 4HIIA 4TUOB 4M9PA 4FQ1H 3IGAB 1CD1B 1KBWA 3QW9A 2XPZA 1SJMA 2QKIA 4Z7UB 4I85A 5HDBF 1YEGL 2ENSA 3C09C 3M1CA 3VD3A 1GXEA 4WUKL 5DEGA 1I9RH 1OQXA 5HGHB 1FYTB 1F11B 5ISZB 3P4LA 3FN9A 4HJGA 3BMWA 2BX5A 4R6UA 2G75B 3U4EA 3KBFA 1BGXH 2EEFA 5J1TC 5AAMC 4P23C 2B7DT 4ZNEA 3TPUA 4WEUD 1E4WL 4WHYH 3T0EB 2XZAL 3RPKA 1KY6A 3ULVD 3RIFK 3MRFB 1FNHA 3NOIA 3SGKC 1VFBB 4PBWD 4Y1SA 1TSRA 3QO0A 4P5KB 4C59B 4WI8A 2QL1A 1JGUH 2WVUA 3S3SA 3UBFA 1RULL 2R15A 2X89D 5L4JA 4NQTA 4PS7A 1WDAA 2NNCA 3FQ1A 4G11A 3WS6A 5C7XL 3ESPA 5EN2A 4TVUA 1I4FB 4LQ1A 4PP2A 3D6GA 2K9FB 5EDXA 4EI5A 5EU7C 2PO6D 1QLRB 2AERT 5IMKA 3FU9A 1JHTB 3QPQC 5B1BB 1RKRA 5D2LA 5FHBL 1T5XB 1XL4A 3T3MB 4KXBA 1QEWB 3WSQL 4BFBD 2JI2A 3HI6H 2FJHB 3QIUA 3DMMD 1O9WA 2XX1A 3E9TA 4R26H 4ZXBC 1UJ3B 4W6YB 3WEOA 4QJ5B 1EAJA 4L2YA 3T77A 3HJEA 4YL9A 4NWUH 2E9BA 5CIPB 5EU5B 5KG9B 2WXPA 4U6XB 1YMMA 4CA4A 4WQOA 3OR6A 4BZYA 4MNGA 2F0CA 5CGYC 5HBBA 1XSJA 3PU7A 2P8LB 3UJJL 1QNIA 4RAHA 2CDGB 2NXYC 4BKSC 1GTFA 3HE6C 3HI1A 4PJAE 1HL4A 2AQNA 5BO1L 3QUYA 1M7XA 3MYZA 1ZLWH 1NFIA 3JWDH 3TASA 3C6LC 3NDZE 2VB5A 3NCJL 1A22B 4UIMA 4A2MA 5A6MA 2YARA 3QZWG 5EBWA 1Q1PA 1UH3A 4JFPA 3T6ZA 4HIJA 3QZNA 3MROB 5IV2B 3OHMB 2V9TA 4JFQB 1HJBC 4XMPL 2FYYB 3HC0A 4PJCF 1N6UA 2VR7A 4KK6D 2O93L 2P52A 1OM3L 3WENA 4GNKB 3I6KB 1UWGH 1YPZF 3QJHB 1HXMB 3AQZA 4LHUB 3CU1A 2BC4B 3O2WH 4OLVH 2CPCA 3KWWB 1E27B 3QEQD 1PYWA 3KBHE 4CL7A 3DVIA 5CILL 4PJGF 4WEBL 4UQAA 1P2CB 5I74B 5CF3A 2CO3A 2IH1B 3HC2A 3V4VL 4WJ5B 3WKNA 3JT0A 1KACB 3VD1A 4NRZB 1WC7A 1KYUA 3GTVA 2CKNA 2FEJA 3FPYA 4MJ6B 5K59F 1JF5A 5F88B 1PZSA 3B4NA 1P7BA 3L7EB 4ZYKB 1S7SB 3JZYA 4PLKC 1YQVL 5IBLD 5IQ9A 4UBDD 5PCYA 3O2VH 4QOKD 4ETQA 4G8IA 2FWLB 4LFHG 2HWZL 3R8BB 3TURA 4NP4H 4AQAA 2DWXA 4N5EC 4TQHA 2N7AA 1H5BC 2XQYK 4Y4HC 3UTSE 2YMTA 4JX0A 3GSRA 5LXGL 4XNZC 3GJFH 3JUZA 4DCQA 3ATBA 4KTGA 3L08A 3MBXH 3WFEH 1OVZA 2O5NA 3VA2C 4LSRL 4HBCH 1MIEL 4X8XA 3KVDD 4YSTA 4GKZB 3PRZA 3VB8A 3FCTB 4HFWB 4P2AA 1G9EA 2YRBA 1YEKL 2RD0A 3OJMB 3ES6B 4F24A 2BZCA 3FT2A 3VG9C 4MWFB 4QRTA 2DL2A 2GTZB 2XN2A 1FLRL 2HJFA 3MLPA 3W11C 4YFEA 3L4VA 1NCAH 1MVUA 3MRDA 2EP6A 4OGQC 3TTSA 4ZYKA 1NOAA 4AUJA 2WCPA 5EU6B 2QTEA 4WUUD 1P7KB 1L9NA 4UI2A 4PRHD 2VDKH 4FHBD 1MHHB 4XO3A 4AQAB 2C9QA 1S9YB 4X42A 4QWWC 3PWNA 5GRUH 4FFTA 4PIBA 5DTFB 2V3FA 3HR5B 1XMWA 1LHZA 2C1OA 4GRWE 1KJ2B 4JZJA 4MWFA 4QRTB 3KM2A 3Q2CA 4YHOH 4F8PA 5HVWA 4Z7WB 1N2RB 3CZGA 2F54B 2WBJC 4FJ6A 3ECVA 4RFOL 3TN0D 3UTPD 5HGDA 1BVZA 3VXSB 1P7QD 2XWCA 1WFIA 1Z66A 2GK2A 2Y2WA 5F9WB 3EFOB 3RP1A 3L1GA 2VM9A 1THAA 2YEQA 4RMTA 2QPUA 1L9TA 3HC0B 1A7NH 4Z3IA 5DEJA 3BH8A 2EH8H 3FTYA 1ZVYA 4JFQA 4MMZB 3RWHA 3AUWB 4LGSB 3BPOC 3TS8A 1F6FB 2G5UA 1HILB 3QJHA 3BP4B 4PWKA 4JQIL 1C5DB 4WY7H 1CFTA 3Q8CA 4UOW0 3V0IA 4Y19A 4JO5A 2C9UA 2CM5A 3WTWA 1I1RA 2E6QA 3WJMB 2MHAA 4PWJA 2Y1AA 2GJZA 5JHDB 5CBEA 5EC1B 5D1ZI 3BQUB 3K2UL 5DUBB 4HIHB 5DQ9A 1L6XA 4PYGA 4YSEA 3X11A 5HD8D 2DQHL 4H88H 5J6GB 1AKJA 1PL3A 3P2DA 4GSUA 4B9GA 2UY6A 4BWUA 2ADGA 2Y36H 4C4KT 2EXSA 2A6DB 3D3VA 1Z5LB 2VDQH 1IKNA 5I8EA 3UTSD 3LS5L 4RISL 3CFEA 3QH3A 4YHIA 2IBZY 2HG0A 4Q8BA 5F96L 3CDZA 1HHIA 3KYOB 1U8OA 5BVJA 1DSFL 1PKQB 4HUUA 5D1ZB 4OZFG 1JPGB 4QHMA 1XGYH 4YSDA 5I6KA 4PGJA 3SY0B 3PWLA 5ISZE 1TQCC 1TJHL 3LKPA 5EBLA 5KSAD 1X5YA 2J8OA 2YGQA 15C8H 3EYUH 1H3PH 2B0SH 2R0LH 2GBTA 2DD8L 4APQD 5BVPH 1JPSH 4LHUG 4U4IA 4QRQA 1MEXL 3FH5A 3M17B 4YHKL 3P9LB 5DVMA 3WEAA 3K6FA 4QRRE 1QLRA 4M48L 3QO0B 2BMKA 3TO4A 4G8GA 3MCG1 4X5QA 2VE6A 1LXMA 4U6TA 1CBVL 2ZCZA 1ONQA 2VXTL 2FO4A 3FMGL 4G80B 3EGXA 4D9LH 3UAJD 3EW3B 4B9JA 2YAMA 3AT9A 4XP1H 3MGAA 1NINA 1BQUA 5L8LB 4XNBA 3EH4B 1MHCA 3C5ZD 3U82B 4F27A 1FYHB 5CU9A 1FC2D 1IV8A 2FHFA 3RWIB 4OCRL 2HJKA 3NJVA 1ZLDA 2OJZL 2F19H 3LSOA 2G2PA 1MCPL 4LO9A 2EDRA 1GJIA 1UA7A 4P2RD 5DZPA 1TTUA 1ZT7B 5J1AB 3T5WA 1BAGA 4GUPA 1A4CA 5D7SL 5T3XL 4RZKA 1DN0A 5ICXB 3EF4A 1AHWA 5D1XE 3ESNA 4V2BA 4W4OA 1KFAH 4XPBH 2FEDD 5CMAB 2E27H 4HJUA 5FO2A 4Z76B 1N64H 2QTVA 2XU9A 1U8IB 3QE5A 2QVFB 4YZFF 3UAAA 4KBPA 4M1CC 1XTLA 1E9PA 1U36A 1VENA 3B56A 5A2JH 2G30A 3ASNB 3SKJH 1C1EL 1ITCA 4M6AA 3ZXAC 4EZKA 3IEAA 2GCYA 5CZXD 3SGEH 3VFSB 2IXQB 1ZPLA 1J05A 5CWSB 3V0DA 2XZQL 4X98B 2YGNA 2RFXA 1JPFB 5FYJD 3QEHA 1EO5A 3EJZC 3T2NL 3KPRB 5IVXB 3G6DH 1TSHA 3ASWA 3FO2B 3HE7B 2QV2A 1NWPA 4M6NH 3SDXA 4NQQA 1G7IA 4J3SA 4R26L 2GHWB 5EUOB 1MHCB 3I3DA 1U8CA 3F5WB 4HZLB 2B15A 2V7NA 5D2NA 3N44B 5GSVB 5CEZH 3QWOA 3IJHB 1L9PA 5J0BA 2DKMA 4KXCA 2NT1A 2MIZA 3LQAC 2FRGP 1V3KA 4X7FC 4Y4KA 1BFOA 1IAIL 4HK0B 3C2AL 1UXSB 1LEGB 3WD5L 5I1IH 3DX2A 5AW7B 4Y2OB 4KK6C 1MHPH 4LGPB 3OZ9H 1E5AA 4ZSOB 1R3IL 2PP9A 1GIGL 2EC8A 2VDPB 3KPRA 1KT2A 4PJEE 2X6AA 1B4TA 1JG9A 4Y9GA 5GSRA 2KUTA 1SN5A 3FBKA 3BN3B 3CXDH 3V6OA 3WHXA 4CC0A 3AB0B 1CL7H 5E2VH 3CC1A 32C2A 1HOCB 3PWLB 4XPFL 5KYXA 4Z78B 4MCMA 3ZN6A 2P8PA 3A21A 5CN1A 4YQXH 3Q6GH 4HUUB 3UXFA 3IAGC 3PL6C 4YHNB 3B1TA 3E38A 1HYRC 2OTWA 1Q9LA 4IU3A 3QRFM 2P5EE 2J88H 3AUVA 5BS0E 1H15B 5KVGL 1L9RA 3SY0A 1NCHA 4U31A 5H94B 4LKCA 4TXVB 5T5NF 3ETBJ 1HCVA 4KMLB 3UTSB 4F7EB 4JRLA 4BE6A 4W9KC 1KIRA 1QA9A 4ALAH 1P53A 2AABL 4F37F 1J5HA 4BE5A 5EOTB 3L16A 3PPSA 4QDGA 3VFGH 1GGCL 4BXSV 3EJCA 1JN6A 4ZPTA 4AGOA 1T83A 3RWIA 4DKFH 1P7HL 2HX7A 5FC9A 1XCTB 1KGXA 5D1ZC 4IIQA 2C1PA 5IHZA 4JFFD 1R5WB 3GTTA 5C08E 4HAGA 3IDYC 3T65B 2OM5A 3IDMA 2VGLM 3K2KA 1F90L 3ALPA 2GG1A 2CJUL 5JORB 5L88L 2IANA 4Y5XB 3RVTC 1CYGA 2FDBP 2GJZB 4I4WB 5J6HA 2JNZA 4ECNA 3T1FA 4S1SH 1NCJA 1M1XA 4PGBA 4M6OL 3SB3A 2PWDA 3DK2A 5FO9B 1VDGA 2NXZC 3H53A 4KH9A 4L8SA 3QUZA 3DK0A 4PW9A 5ANMA 4DSYA 4UTBA 4YEFA 3P3UA 4JFEB 5KZCD 5DLML 3MBXL 1K4DB 3W37A 3X1EA 3CSTA 2V9RA 2PPCA 4XPHL 5MP6H 3DGGB 3DBXB 2F1AA 3ESMA 4UWQB 3VXRD 1E2ZA 2MSPA 3L13A 1HINL 4Y4FC 3RGVD 4AIEA 4WWKC 3UGXA 5HYJB 1CE1H 1HHIB 1QSZA 4YUEL 1D5RA 1Y18B 2F54A 3X3FH 4WNQA 1W2KT 4LLAA 1QNZL 1ZLUH 3GMRB 2E4FA 4X80L 2WNXA 2F54E 3ABMB 2P24B 3BEVB 3IXAA 2LV4A 4YX2L 5FYKD 4PJ5A 5C2BL 4N85A 5I5RA 5IMOA 3DX6A 1UWFA 3LZFH 1JOIA 3V55A 1RHHA 2WQ8A 3ARFC 4PVLA 2DQEL 4B96A 4YXKL 4QHUB 4HQQH 2QBWA 3DXAA 2BOCB 3OR7A 5D7JB 4JFFA 5CHNB 3QDGB 4OCYH 2VDKL 3MAWA 1MIMH 5AZ2H 3DV4B 5DJCB 5FO7B 1NDMB 4IM8A 3TBSA 5GRUL 5DDHA 4KI5D 3RTQB 2F08A 1LWRA 1J87A 4WGWB 3ULUE 3QDAA 4MD4B 4CSSA 3QQDA 3IGFA 4UQ2B 1KULA 4PJBF 5I18L 1FL6A 1NBYB 1T22B 4ZJ9A 3VXQB 1ZT4A 3SDAD 1IKOP 4ZO7A 1QG3A 1UXMA 1XH3B 2YKLH 4L05A 3CK0L 2YD0A 3T1WA 4XMTA 4ZUVA 4LLDB 1DO5A 3MRGA 2R1XA 2UY7A 3X13B 1J7VR 3EO9H 5T1LD 3V4PL 2QSCL 4NHUB 5CJQH 3NIGE 5I19L 1OHQA 3WNNA 2NNFA 4G7YH 4KXAA 4PRHE 1QZ1A 5G2NA 2EEBA 1N6QL 3RU8L 4WKZA 4MJ5B 5A2IH 3ARRA 3BQUD 5LNEA 4YC2B 3WCYA 4AGMA 5KVFL 3FONA 2X88A 3RNQB 3QEQA 1WTLA 1FZJA 1U8NA 1JGLH 2IPUG 3DA0A 5IQ9B 3LNFA 3E80A 4P4KC 1HESA 4L29A 4JQIA 3EO0A 1VAHA 4DERA 1BZ9A 4MCNA 4F80A 1NCDH 2R4SH 5C07E 3JV4A 2FWSA 3LS5H 4RISH 3SDDD 1BVNP 1L3NA 2Y5TA 1EJ8A 5C07A 3U7YH 3O6ML 4I13B 4U1MB 3FCTA 4CC1A 3FN0H 4YIQB 3X1GA 4MJHA 4U7SA 2BNUB 1NSNL 3MGTB 4GRLD 4MD5A 1WUZA 4GYBA 4PTTB 5F44A 4P9ML 3VXSD 3KPSB 3TCLB 1FVEB 3VXUE 3VXUD 4JFPB 4RMSA 4ZOCA 3EYSH 4XRCB 3K6IA 2XHNA 2V2WB 2VJ8A 4PY7A 3VXNB 3BRFA 1HIML 1GOGA 5KEZA 2VDKB 3Q6FB 3QUYB 3GPEA 3GSVB 4PBXA 2YAFA 4QXGH 2BDNL 4Y4HD 5T3ZH 4KPHH 1MEXH 1TQTA 5D93B 3MLXH 4H8UA 3GSXB 3W9DB 4Y16C 3VM7A 4K2UH 4L8SC 2YAEA 1U58A 2VWEC 4ODVH 1P4IH 2UYLB 1M05B 5GGRA 4UU9B 4GKSA 4MNGE 1L9SA 4L4VE 4UDUB 4K7PH 3U1QA 4XP5L 1CGUA 3GB7A 5IB1B 5DHYB 2JELH 3ULUH 4HU2A 5JZ7D 4FS0A 5CS7A 2LVCA 1CFQB 4WF7A 2ARJQ 1WC7B 3HN3A 2AXWA 3QZOA 4G7VL 3U36B 1NEZA 4BFGA 5LGJB 1CXLA 2WWMD 4F7EA 1U8HB 2GJ6B 3DBXA 2OQJA 1RU9L 3X12A 1EVTC 4MVBD 4LCWD 2ZAHA 4HUNB 4PJ7E 2G0LA 1P5VB 4PR5A 1I1AB 4BQBA 1AQHA 4Z7WF 4RAUB 5FUZH 4GAJH 3SDDA 4OUUB 1OP9A 2HSIA 4C83B 3PAZA 2FATH 4BKLB 4MAZA 3FB8A 1DN2A 4XN9A 2R69L 2H2PD 2ZWZA 12E8L 3DTXB 4FXGA 4JFXB 5DR5H 4OCNC 2OW6A 3LVTA 4LIQH 2WLHA 4WI2A 1EFXB 2BSRB 2EYSB 1ZRUA 4MJJA 2DB8A 2H2SD 5HGGS 3SKJL 5GS2H 1R3LA 1A3LL 1NCCH 4FX5A 3P11L 1QSEE 9CGTA 1RZJC 3V4VA 3SKNA 4PJHE 3QXAA 5JYMA 3K72B 3U0PA 1QYGL 3A67H 1O6VA 3ZT5A 3KJ4C 2P49B 3G6DL 3QIUC 4W9CC 4HWUA 4IOFD 4PH8A 1PZBA 4I9XA 1AD0A 1NC2A 2XV2A 1G84A 3FZUD 1IC1A 3RB7A 3A0OA 4CJ0A 5HD8C 4PLNC 4AJVA 1CVSC 4ZFGL 3N44F 5BZDB 1MPAL 3L2LA 5J7CC 3IGLA 4BH7A 3GS0A 2RTTA 3QFJE 5AW4B 3KAAA 1EJOL 3QR2A 2MNUA 5KJ7E 2LR4A 2EEDA 43C9B 3BUYB 1AR1D 1IBGH 1Z9MA 2HH0L 1A1NB 1J1PL 3APNA 2H6PB 1TU2B 2RFXB 4F7CA 5C0AD 4OGAD 2BIQA 5IESL 2Q7AA 1KTDB 3HHSB 2EAEA 2JJSA 1SYVA 2CGYA 2G3ZA 4NWUL 3RAJH 2DQGL 4CMMA 1M56B 5LGHL 3CPLA 4XOCA 2YHGA 3IETB 3LN9A 2CO6A 5DYOB 5C0AA 4HUKB 4OCXH 4A68A 1WITA 1QTPA 2CBQA 3BSZA 3INUL 2G9HB 4G5AA 4G8AC 5D1QC 1NCNA 4KJPC 1YC8A 2WBJD 2XUWA 1ZLVK 1BVNT 2AXHA 4LFHD 4Y2OA 4DVBB 1GA2A 2O6EA 3BH9B 4FL4C 4NO0D 3C6LD 4Y5XC 1R24B 3T0EA 4TNVK 3HLAA 1KIUA 3LB6C 3ZDXE 4LZKA 3K6NA 3H1ZA 4HZAA 3EGXB 4O2EB 5F9OL 3VVVA 4G42A 4E41E 5H35A 3E7JA 5BJTB 4OLUL 1GGCH 2D7NA 1P84J 3C60C 3G08A 4OZ4B 4QRPD 4UM8A 4N2CA 3OMAB 2QMJA 4F9LA 4GUCA 4ZI8A 3CVIL 2IAMC 1ERNA 4ZAKB 1CTOA 4KK8C 1P84K 1A9EB 3FUHA 5G4OA 4TL5A 2DN7A 4WZ9A 3LZOA 5CILH 1ORSB 5E8EA 4WWOA 3MA7B 2KS0A 3VFPB 3VI3A 2OJ1A 4EUPB 1KIUB 4XCFH 4JRYB 4ISVA 4WI0A 3DO3A 3FB8B 5IROD 4EIGB 4S1SL 4OCWL 2PWEA 2EZ0C 4K7FA 1PNCA 1CWVA 5IFAL 2IDCA 2CR0A 3Q5YA 3ILDA 1F4WL 4JQXA 4HWZA 1JHLH 1JPFA 4YDKL 2ADGB 1QFWM 3HLAB 3FS9A 3MLWL 1CF8L 1SVBA 3Q0HA 4FQXB 3KPMB 4A2HA 1WEJL 1CDCA 4DVBA 4ODUA 2XC8A 2VZ3A 3BPLC 1DVZA 4LPVA 4HEPA 1V27A 1CE1L 3AREC 4HPOH 2OMYA 2WBWB 4F58L 5LXGH 3GINA 2R1YA 4LASH 2HUEA 5FIEA 4MDIB 3ZKMC 4RAUA 1JE6A 3M46A 4KFZC 2J56A 1SEQL 4P2YA 4ANKA 2IIJA 3ZL2A 5IOKA 1PTZA 4IDLA 1NOFA 3G5ZB 4RSVA 4Y4HA 3CCHB 4JPIB 3MLSH 5K9KA 3NCWA 3EGDA 1U6AH 4KRMB 4N2HA 3S35L 1OP3H 1BZ8A 3GTNA 4AEFA 3S8GB 5GJSH 3EJUA 3V79C 2HJKB 4N8CL 4I18A 4PCKA 4UNUA 4E68A 4KJQD 1D3CA 3QCUH 1GYUA 3IGKA 2OV0A 5ETUA 3FZUC 1OTSC 3LKPB 5CSBA 5EBLB 1SN0A 4PRIE 4PRPA 4Y7OC 4YL4A 1DUYB 5I8CB 2FCBA 1HC1A 2VAAB 4ODWB 5IW6A 3ATFA 2EO7A 4O9HH 4ZUTB 3D9AL 3B2MA 3PWNB 1F4XH 5FWQA 1IM3D 2IBZX 2VN6A 1MRCL 3LV3B 5C09E 2EIDA 4XHQA 4FFVC 1XF4A 4F5CE 4K3EH 3DIFB 1JRHH 3QCVH 4MMZC 4XBPA 5C09A 1RP8A 2GSGB 4F5CA 4X6FA 4KX7A 3ABLB 3C12A 5I2IB 3RWGA 3SKUD 2GUYA 3T6VA 2BNUA 5EOCL 4PY8I 2Z31B 3QZPA 1OP4A 3ZZSA 4Y4KC 2WO3B 4NZTH 1ZGLM 3DSNB 3LHAA 1NGYA 4WI7A 5EC1A 3E0GA 1XR8A 4GSRA 3JWOL 5E2JA 1EEYA 3F65A 3SE8H 4IOIA 1OSZA 3WUWG 3NFSH 1GKEA 5DSCB 3VQ1C 1M7IB 3BAEL 4AC2A 4J3OF 4YSPA 5DC9B 4DKDC 3K3QA 2MCPH 2C3GA 2P44B 5EU7E 3ORJA 1JGLL 4JFTA 4PJGA 3MJWA 1KWKA 1KN2H 3FL7A 3PDOA 3QNYA 5CZXC 3D0VB 4HF5H 1M05A 1NAML 5D1XA 5HDQL 1E9QA 1K8DB 5JW4M 4JZNB 1GC1H 3X11B 2ZPKL 4WU5A 4BGLA 2F18A 3BKCH 4LDEB 3B3IB 1I53A 3HZMB 1KJVA 3QJOA 4HFWA 1IQWH 3C60D 5CKAA 5FEBA 4QHLB 1OK0A 5IHUH 4ZNCD 1UH2A 3J7HA 2DQHH 4H88L 4N8PA 3GGWA 4BXVA 1WWWX 2XG5B 3DXAD 1MRFL 4QRPB 1BDYA 1KB5B 5I0VA 2ETWA 1QTSA 4UQ3A 2V2TB 4G43A 1JWUA 1HFUA 4MD0A 5F93C 2ZSVA 4D7PA 2HT3D 2RJMA 1AI1L 2CLZA 2L7JA 3CVCA 1PKOA 5T3ZL 2BDNH 3LQMA 4AGQA 4ZMTA 4M8UA 4BA0A 3WO4C 5ICYA 5IMOB 1OGAE 5BOPA 3FOLA 3OKLA 2AW2A 4M4PA 5F88A 4TOYL 4NP4L 2C4FU 4OJYA 1VB9A 3STZA 3WGUB 4GG6F 1VEPA 2ADFH 4YHKH 1EZLA 1Q8MA 4Z1PA 4W70A 1X5XA 4JHWH 5ESQB 4ABUA 4G7VH 3V6OE 3KCPA 2QHLA 1JVLA 2YRLA 1S9VA 4I2XA 3FQNA 5JHLH 2M1KA 4HIPA 4UAOC 4GKLA 4HS3A 4NM8H 4FG6D 4X7SL 1T66D 4FLSA 3QQ9D 4QRUA 2Z6FA 4D0BB 1IFHH 2QDWA 3OC5A 3CLEL 4P2QB 4R90H 2V4LA 2IAND 4Y5VB 4KGJA 1ZVSA 4M43H 1Q1JL 3IRPX 3L4CA 1QZNA 4JFSA 3LV3A 3LN5B 5CGTA 3EKCA 1ADQA 2BVYA 2TSBA 3CZUB 3FU0A 3TJHC 4LIQL 3OLEA 1H3XA 1Y6KR 1G0DA 5IQLA 1CLYL 1PIFA 2OULB 4XX1E 4BFKA 4U6HB 3APMA 4DGIH 1H3VA 4LDLB 4P5TB 4H8WL 2AZAA 1UUSA 1EERB 3GXNA 2EVGA 3FQTA 3KPQB 3EOBA 1YO4A 1BQKA 3HBGA 4HEME 3TESA 4JG9A 3VO0A 1X5GA 3MV9A 4TUJA 4ODSH 4HKXA 1CICB 1VCBC 4JRXE 2ZSWA 1C1EH 2DQFA 3E8VA 1NGYB 2X40A 5D72H 2YFNA 1MDTA 2DOCA 1CXEA 2ESVA 3IU3B 3L3HA 1EAPB 4EI5C 1UTDA 1JZ7A 2BNQE 4ABWA 5D7IB 5DJ6A 4QHUA 5AW2B 3SGJA 2P46B 4YVUA 5MHSE 1REIA 2CK2A 2CR6A 1JFQL 5GS1B 3JWOC 4JPKL 4OR1A 4TSCL 5DEZA 2WLNA 4BZ1A 4PJ5E 2VUYA 3KW7A 4UBDC 2I60L 4AMXA 2ZTBA 4BH8A 1FH5H 1TIUA 4W9EC 3DLQR 4F91B 4WY7L 1LJMA 5E9DD 4TLUA 4YSQA 1MHPL 3CD4A 2XRAH 4IK7A 1LO2H 4LSDA 1U2HA 3WFDH 2GJRA 2WUCL 3BUQA 1WA1X 5DWUL 1HL5A 3SO3C 4RFEB 1HQ4B 5DU7A 1QPPA 5F7AA 4AGNA 1LO3H 2CH8A 3O11B 3PXJA 3TPUB 3K2UH 3ZTDC 4GKOA 4YBLC 3BDXA 5DD5L 1KY7A 2CG9X 1QTYT 2P26A 3GJEB 1YNLH 1E3ZA 3MKKA 4IDJL 4WFHD 4WSGA 3V8CA 4YLQT 2AJSH 4CNIB 2WHVA 3P1VA 3KM1A 4R96A 4ZQKB 1UENA 3T0EC 3CQFA 1QABA 4B3EA 5HVGB 4OF8A 1RFDH 3RHWK 1EMTL 4JQVC 3TWYA 4U1SA 1SF3A 3QUHA 4Q6KA 3S88H 1G7LA 1HK6A 3HPJB 4KI5E 4GG6B 2D0GA 2PMZA 1AIFA 2I24N 1CGWA 1S78D 1YEFH 1XCTA 2OYKA 4XCFL 3PL6D 2Y4SA 3MLYH 5E7BA 3U79A 4YDNA 1T21B 5FYLH 5IFAH 2IV8A 1MLBA 3ZKXC 3L3JA 5F7DA 1M42A 1FVCA 2ZP9A 2EDBA 1F90H 1T20A 5DA0B 2OSXA 1ORSA 1EDHA 3OAYK 3IMWA 2FECL 3SO3B 1FL5B 1AXSB 2YSSB 1N5YL 4GSDL 1F2QA 4ZQKA 3HE6B 4QXTB 3V0WL 2C5DC 43C9A 4GJTB 3EOAA 5HTSA 2Y7MA 2Y06H 1QHOA 4ZSOA 2MNJB 3VXMA 1I7ZB 2F19L 1AHWC 3IM1A 2AI0H 3BFWA 5KYXB 5ID1A 4IMKC 2BFGA 2KZ1B 1AGDB 3S96A 3WHXB 2DTMH 8CGTA 1ODAA 2OSYA 2QMKA 1U6AL 3HW7A 2NCEA 5KSAA 1ACYH 4YNYB 4IJTA 1CDJA 5HHXH 3PGFH 5DMKA 1X7TA 3BWAA 2C9RA 1EHKB 3GXTA 3CVHH 4BZ1L 3MODH 4FXGC 2AJXH 4ZFQA 2ADYA 4NSKB 3O3AA 1V3MA 2GI0A 3Q1SL 4A7VA 4BFRA 5JIQA 3DKHA