3X1FA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1fA00
4DP2X 5I6PA 5I5IA 3N55A 3T6ZA 1SDDB 5B1JA 5I26A 4PCYA 1JXDA 2VN3A 3OMIB 4DPAX 2MRYA 2UXVA 4AI7A 1ET5A 3UADA 2ZONA 4N4YB 3IE9A 4BK5C 2HXAA 4KO6A 3OM3B 1PNDA 2JXMA 2YARA 1SHWA 2DWSA 3FU8A 3JTBA 1SF5A 2BP8A 1J5DA 3FU7A 1DYZA 1PLBA 1ZDQA 1WS7A 2FNWA 1E5ZA 2OJ1A 3DIVA 1EZLA 2AZUA 3S3CB 1E5YA 3NJGA 3EH4B 5I5MA 3CVDA 1W6LA 5ANHA 1OV8A 2CAKA 4YSSA 3NYKA 4UANA 2XXFA 4GY4A 5FC9A 4A2EA 1JVOA 1PZBA 1L9SA 3EHBB 1V10A 1E30A 5EHFA 1WA1X 2P80D 1RZQA 1IUZA 2I7OA 2XV2A 3JT2A 1BXAA 1NWOA 6PCYA 2B08A 1OCOB 2HRGA 2WO3B 2VMJA 1NDTA 3FQYA 1RZPA 4HCGA 1N68A 2FT7A 1L9RA 3NSCA 4BXSV 2BP0A 4DP5X 1AZRA 1IKOP 3NJJA 1RCYA 1ASQA 4KOCA 2IDTA 3FQ2A 1ILUA 3CZUB 5D4IA 4CSPA 1SF3A 2GBAA 1JZEA 1CURA 3G5WA 2Y1AA 4WTQA 2NRDA 4W1TA 1NIBA 1PF3A 1AZCA 4NAJA 3T9WA 4G7SB 1SJMA 1L9PA 4YSEA 1AS8A 3MBWB 4GXFA 4YVUA 1N70A 3HB3B 1L9QA 1BQ5A 2YQBA 3FPYA 1ET8A 1PLCA 2MTAA 4HZ1A 3HEIB 2Q5BA 2PPFA 2FQFA 1NPNA 1GS8A 3FSWA 5D4JA 3V9CA 2IDUA 2AANA 2BHFA 5B1AB 1EHKB 1R1CA 2HLEB 2IH9A 2UX6A 1ID2A 2VM4A 8PAZA 5B1KA 3L45A 6PAZA 4JKNA 1ZIAA 1L9TA 3NJFA 4Q89A 1DZ0A 2LLNA 1BXUA 1MG3C 1XB8A 4GP5B 1JZJA 2P80A 4YSDA 2BP8B 2ZWNA 3FU7B 2DWTA 4ZK8A 2B3IA 3H4FA 3UABA 4G7QB 1CYXA 5TK2A 5B7MA 2GB2A 4ENZA 2QPDB 2VW6A 3SQRA 1AZUA 1V55B 4HIPA 2HX8A 2WO2B 3ZDWA 2PPEA 1WA0X 1OE1A 1WS8A 2HX9A 2PP9A 5E9NA 1NZRA 2I7SA 3FPXA 3D12B 3U25A 3IN0A 3BQVA 4BDVB 1OCRB 4WKXA 2BZCA 4P5SA 5I6NA 1NIDA 2GC4C 4MFHA 2BP0B 3C75A 1KCBA 1QNIA 3CG8A 3TA4D 4DP7X 1URIA 3AY2A 1FA4A 1PMYA 2N0MA 2CALA 3NP3A 2QDWA 2GSMB 4A2GA 1CYWA 4CSZA 4KO5A 1JVLA 4YSUA 2PCFA 1ETJA 3SBQA 3S8FB 3OMNB 3MX0B 2R7EA 2CUAA 1ET7A 4M3HA 4QKTA 2DV6A 4FAAB 5D4HA 3NJNA 1JZHA 1ZPUA 1E65A 5B3SB 4DPCX 1JZIA 4G70B 5I6KA 3V9EA 1NPJA 1TEFA 4BWTA 2TSAA 7PAZA 4YSAA 4KO9A 2BWIA 2XXGA 1KCWA 3AG2B 1BAWA 1AZBA 2QT6A 4DP8X 3ZIYA 2XVBA 3UAAA 4P5RA 4HALA 3TBBA 3OQRA 1KYAA 1GYCA 3WG7B 2AZAA 2PPDA 2FT8A 1SFDA 1OF0A 1M57B 4KNTA 1GS7A 4HCIA 2IDFA 3GXUB 1KDIA 4YSOA 3QJRB 5PCYA 3WNJA 1KBWA 3CVBA 4JHVA 1HFUA 1PNCA 4HCFA 3EF4A 2Y69B 2RACA 1JOIA 4YSPA 1E67A 1GSKA 3EH3B 3PAZA 4G72B 1JXGA 3DTUB 4DP4X 5F7AA 2I85A 1W6WA 2FQEA 3BVDB 1FFTB 2GC7C 3KW8A 3PLYA 2H3XC 3QPKA 3FSVA 2IWFA 3NSYA 2IDQA 3NJLA 4E9VA 1SDDA 2DYSB 3T6WA 4K9JA 4G7RB 5B1JC 3FSZA 4YSCA 2XLLA 1A4CA 1RKRA 4AKPA 3S3BB 1JZGA 3T71A 3S3DB 1PZCA 3SBPA 2ZXWB 1SFHA 4TXVB 4GYBA 5B7FA 3ASOB 4A2HA 3FYEB 4DP9X 3H4HA 1GW0A 2J56A 4A2FA 5I6MA 1IBZA 2Q9OA 2QPEB 3ABKB 3PAVA 4PAZA 5IY5B 2VSKB 1ZV2A 1PAZA 1XMEB 3ERXA 3NSFA 3T6VA 3WKPA 1KV7A 1PZAA 2VM3A 2ZOOA 3FT0A 5I6OA 4RH4A 3FQ1A 3S8GB 2XV3A 1BEXA 1NTDA 4F2EA 2YXWA 1XB3A 4A66A 1OE2A 1AACA 1BQRA 2UXFA 3T6XA 1NWPA 3IEAA 2PPCA 3NJHA 2HX7A 3QJUB 5I5JA 5F7BA 2BWDA 1J9SA 1KBVA 5I6LA 4FA7B 4YSTA 2YAMA 2IWKA 2XV0A 2GHZA 3FSAA 2A3TA 1J9TA 4YSRA 1V54B 2PLTA 3QJQB 3NP4A 4GP4B 2BO0A 1HAWA 5A7EA 2H47C 1GY1A 1X9RA 4NERA 3WIAA 3SBRA 2YAQA 1NIEA 3ZX1A 1SNRA 2YXVA 1A4BA 1BYPA 2UX7A 4GP8B 2FT6A 1I53A 2PP8A 5AKRA 3NJKA 1BXVA 4E9WA 2AVFA 7PCYA 4A68A 3ABMB 3QJSB 1GR7A 1QLEB 2TSBA 5I28A 3WKQA 3FS9A 1VLXA 3PXLA 2H5UA 2W88A 1AG6A 3UGEA 1TU2A 2OV0A 1AQ8A 4NB7A 2JKWA 1A65A 5B1BB 5TK4A 2EIKB 2EINB 1HAUA 1A3ZA 1NIAA 4HHWA 2CJ3A 2FQDA 3ABGA 1AS7A 2UXGA 3CDZA 1ILSA 2YAPA 3AG3B 1BQKA 4KO7A 1TKWA 2HZHA 2CCWA 2EILB 2FWLB 4UF7C 5AZUA 2FJSA 4DP6X 3AZUA 1T5KA 3CVCA 1JZFA 2YAOA 3PAUA 4L0PB 3UAEA 4E9SA 1J9QA 2PPAA 2W8CA 1JERA 4QLWA 1MZYA 4A2DA 1KDJA 1AOZA 2XWZA 3TBCA 5AFAA 1TEGA 1CC3A 4KNSA 4YVNA 2IAAC 1FWXA 3FU9A 2EIJB 4HAKA 3AG1B 4JHUA 1OE3A 1UATA 2IWEA 1X9UA 3ABLB 1OCZB 3AG4B 1AZNA 2UXTA 3X1NA 3X1FA 2X87A 2HRHA 1IBYA 3NT0A 4M4RB 1YLBB 4W9ZA 2IH8A 3N2JA 1KGYE 2FTAA 3X1BA 1IC0A 4BDVA 3QJTB 4DPBX 1NINA 4KNUA 3OD3A 2EIMB 1L9OA 1AG0A 3WNIA 3GYRA 1AAJA 4AKQA 5LDUA 1SHXA 4YSQA 1A4AA 1AS6A 1CUOA 1GY2A 2GI0A 2YAFA 4E9TA 3KW7A 2FQGA 2XU9A 1AR1B 3QQXA 3NJIA 2PP7A 3WI9A 4AX3A 2AFNA 2QDVA 2BZ7A 4F7KA 3ZBMA 2BW4A 4KOBA 3FYIB 4X4KA 1XB6A 4A67A 1PLAA 4G71B 2E86A 1J9RA 3TASA 1JXFA 2IDSA 9PCYA 1M9WA 1ADWA 1W8EA 2DY2A 1WA2X 3GDCA 1WAEA 2OCCB 2XX1A 3OMAB 3ASNB 3NSDA 1M56B 3AW5A 4E9XA 2R7EB 3PPSA 4E9RA 1NICA 2YAHA 3RYMA 1MDAA 3UACA 2X88A 4YL4A 4E9QA 1ZIBA 4EF3A 4N8UA 3X1GA 2BW5A 2XX0A 3CDZB 1MG2C 3QJVB 3PCYA 4Q8BA 1MZZA 1ZDSA 3DKHA 4E9YA 2J5WA 2CBPA 2JFCA 3IN2A 1AANA 3H56A 1F56A 2XUWA 1OOWA 5PAZA 4DP0X 3TU6A 4AKOA 3X1EA 1PCSA 1NIFA 2J55A 4F2FA 2XYBA 1AIZA 4AZUA 2WSDA 1ASPA 1QHQA 2J57A 1GS6X 3X2QB 4BWUA 1ASOA 3EH5B 4UAHA 1A8ZA 2GIMA 2DYRB 4HHGA 4BXVA 3IBOA 4BWWA 2YAEA 2VW4A 4DP1X 1OCCB 1PY0A 1B3IA 5B7EA 2VW7A 2PCYA 3NJMA 1J5CA 1BYOA 2VSMB
chains in the Genus database with same CATH superfamily
3FQUA 3L6FA 4WV1C 2WLMA 1A4JA 1KCKA 5EZOH 1ES0B 3BQUD 5L7XH 1QSFD 1P4IL 3T2QA 4YHZH 3WO3B 5DJ6B 1ZVSB 5H37G 1J05A 2RBLA 1UACH 4RESB 1SOSA 3E6HA 1G9ML 3OPZL 4N4YB 4TQ8A 5KG9B 3PREA 1M4KA 3ENEA 3MNZA 2JV6A 4PG9B 3BZEA 2XDHA 3M1BB 4HMEA 1HYSD 4Z23A 3US0A 1BJ8A 4X98A 4AGQA 5HVGB 3N43F 4MNGB 4S11A 4EI5C 3SCMA 1A1MB 1AKJD 4X5RA 5JPMB 3Q1EA 5DD6B 3TO2A 4QO1B 2IF7A 3RTQD 1E5YA 3OGCA 5C97A 5I5MA 3CVDA 2X1XR 5ANHA 4XWOD 5DURB 4HGKC 2YGQA 4EN2A 3QUKA 2CAKA 2NDFA 3QDAA 2VXTH 3C5ZA 5FHAH 2AJ3A 3LKNB 4ABVA 4RFOL 3RJQB 2LGNA 2HTLD 3ROLA 5LGKA 5DRZA 4QIRA 5EHFA 4TL5A 1E9OB 1VCAA 2VC2H 3EAKA 2OR7A 5CEXA 3L48A 1NBCA 2CK0H 2JH2A 3QP3A 4O5LH 4ONOA 1T7ZA 4DSYA 1IQDB 1DFBH 3JWOL 2X70A 3V0EA 3MV9E 3Q48A 4HGWB 4V1DD 4Q52A 1HEJC 3CH1A 3EYOA 2BP0A 4UQCA 2VITB 3ARGD 3O6LH 4NQQA 4NBXB 1A6ZB 4A7GA 1EJFA 3Q3GB 3CXDH 5JW5A 4KKRA 4EN3A 2EDDA 3N40P 4NX0A 5HYFA 1S8DA 3G5WA 1XH3B 1M6UA 1J11A 1I8IB 2NW2A 4F8OA 1HCYA 2VDOH 3E1ZA 2GEEA 1INDH 4B9PA 4G80B 4AH2B 2A9NL 1QAWA 3BT0A 3PWNB 4G7SB 4G9FE 4HWBA 5K9JL 3MODH 1L9PA 3KM2A 4QRRE 2JJSC 5FUZH 1AS8A 5GZNA 5H4YA 2RQEA 1L9QA 1NGXB 2R2HA 1IX2A 1E3XA 3BZ4A 4AJWA 4H26A 2CKBL 2F9BT 2VUKA 2Z8SA 3IETA 5EO9B 3F58L 2E9IA 3DXAE 3QWNA 2WBXA 2Q3AA 5DJAB 1C5CL 4LAQL 5KSAB 4BKSC 1FLRL 1WO2A 3K2KA 5MEOB 4IDLA 4QXVA 2A6IA 3SDCA 3UEZA 4M02A 3QG6B 3GKWH 3T8XA 3F2LA 4ZO7A 5F71A 1KF9B 3D51A 3PQYE 1QFWI 2H1PH 1XSIA 2PXYA 3NN8A 1BQSA 3RL1A 5IVOA 1D2PA 4XP1H 3ZKSD 3ZL4L 3FQRB 3MGOB 1H15A 3RKDD 4FXKA 5IHZB 3ZRCC 3IJYB 4O4YH 5CN3A 1NCBL 3MV9A 5TDPB 4AQ8A 4E36A 1CN4A 3UTSD 5CGTA 1J0ZA 1KY6A 5T3ZH 3TBWB 5JO5A 1ED3B 1AYRA 4GG6B 1UOWA 2OMVA 2WXLA 1OT1A 1FSKC 2ADGA 3F7YB 4AEEA 1RVFH 1SJHB 4TLKA 5ISZB 3TBYB 4AYFB 5E4IA 3DHPA 1N5AA 3MRNA 5LN8A 4N8VA 1NBYB 3FB5B 4KRNA 3TIEB 5IF0A 1TCRA 2A9AA 3QAQA 1RUKL 1P53A 5IK3B 3CLFH 4I89A 4MSWB 3RWFB 5DD0L 1PMYA 3OB0K 4G9FA 3QIBB 4X7CC 3SKNB 1XGPA 4QRRA 5CCHE 4P2RE 2FWOA 1S9KC 3LPPA 2ODIA 3T2OA 3DO3A 5F0LB 2WKOA 1JRHH 4G6AC 2ICWJ 3S8FB 4N90E 1JTOA 2CJUH 2CUAA 5H94A 3PL6B 1KXQE 1JF5A 5IB2B 3S2AA 2VNCA 2B2XH 5D6CA 5IFJB 1JF6A 1JTPA 3L4VA 2XWTA 4G70B 3LIUA 3H0TA 1FZOB 1XF4A 2H7WA 1EXHA 2YA2A 4B60A 2VXUL 3PQYA 4GJTB 5ENWA 3HC0B 1O5PA 4E41D 3T4AB 1DANT 1XGYL 2C3HA 3B9EA 4M3JA 4TL4A 3O4OC 3GJEA 1SGKA 1ZK9A 4NLAA 4YC2C 5FYKL 5C92A 2ALWA 1AGBA 2DYPB 1DVFC 1QHOA 4F1ZA 5C0JB 2DD8L 3I74A 3KHQA 4KJPC 1IQWL 1FO0H 2PPDA 4I1NB 3BDYL 4KNTA 1RZIA 1FAIH 5HGBB 4Z6AT 3NFSH 3O0RL 3NACL 1PZ3A 3TCLB 3UO1H 4U7KA 1AD9B 1KGUA 4HIEA 3ULUE 5E24E 4MA7L 3V52L 1CXIA 3JV0A 3RUGF 1X7SA 1Z9MA 4NQVB 4U1IB 3DV4B 4L3CA 1FFTB 3V7MA 5JLZB 1F1DA 2C9PA 3CFJB 4UQ2A 5ABZA 1FORL 4B9KC 3DX6A 1P5UC 2VDQB 3TM6A 2VERA 3F7QA 5I0DA 1KN2H 1U8LA 2HYMA 5L2KE 1ZD6A 1IM9A 5K33A 4P2RA 4QY8A 2PR9A 3SYQA 4H8WH 5AOLA 5H2BB 3H7BA 1UT2A 1AQKH 4BUQA 1U92A 2F7OA 3TZVB 5LVEA 4LHUB 3LRGA 4NQCB 4OCWH 1IGML 4WENB 2CMRL 2NZ9D 1KXQA 3NIFE 1MCFA 3QNXB 4IGBA 2J56A 3DX4A 2IAMA 3QIWC 1NMAH 4ZTOH 5DHYB 1CLYL 4JG9A 5DVLA 1G43A 4CU7A 5BV7B 4K3JH 1HH9B 5K39A 1W80A 3B2UC 3FT0A 3PNRB 1TIUA 3U79A 5KN5B 5FGBC 4F2EA 3H53A 5E23A 2HG0A 4YHIA 1WAAE 3WFDH 4KZDH 3DPBA 5GRUL 4GSUA 4OZFA 2DLIA 3AXLA 4WCYH 1G6RA 4F15C 3C5ZD 5JMOC 5BJTA 4HQQH 4NIYE 4HPOL 4MB4A 1BM7A 1MCWW 1PL3A 3L5IA 3OJVC 3GSNL 2GFBA 3KLAB 4WI3A 3V8OA 1D5BA 3POHA 1KCRH 1PG7H 3HI6L 4YDLC 5BOJA 4R4FH 5EBWB 1KZYA 1J0HA 2PR4L 3X17A 4PLJC 2Z4QB 2RH0A 2Y7QB 2OKMA 5J1AA 1Q9KB 4Q9QL 2EEAA 1WISA 5IJVB 5L2KA 4XNAA 4OJFH 4S1QH 4M48H 1CVRA 4OB5H 4PCSA 5DC4B 2ADIB 4FFYL 3WN5C 3UG5A 2JKWA 5IW3A 5A16B 4ZDHB 2WTRB 4P46A 5F9WC 4MNGE 5E9DB 1EFXD 4U1HA 1DLHB 4WGKA 4YFDB 2IADA 2FQDA 3RHWK 4ZQTA 5JIMA 2J71A 1BZEA 2CWRA 3VG0H 5FA4A 5ICZA 3U46A 1ZHLA 4NO0D 3OR6A 1ILSA 3QPXL 4NUJA 3VRLF 3MJ9L 4FXGC 3NIGB 3OKOB 4UQEA 4WNJA 3VGEA 1E4KC 4BGLA 5F3BA 4ZMOA 3FHEA 2Q7NA 3MUZ1 1D5IH 2CO1A 1BWWA 1FYTB 4WFFD 1JXJA 5E2WL 1UURA 4YXKL 3OHXB 1ZT7A 4P59H 5AFAA 3VXUB 2NY3B 5I1KL 1DDHA 3CFBA 4XGZA 2OX5A 1K2DA 1A64A 1PZ2A 2DM7A 1R46A 5JIHA 4FG6D 4UBDC 2QGBA 4HIQA 5EZIL 1QSVA 5D9SA 4Z7AA 5D93C 3QUMA 1QZ1A 1T7VA 5E70A 4M4RB 1QW9A 1KPRB 2VDQH 2VLMD 2XZCH 4PJBB 3WNNA 4RIRB 4XXCC 3T0WA 4CVUA 3QJTB 2IBZY 4HV8A 3OPUA 4L0YA 4KNUA 4KJQC 5JXAH 1RZGB 4MLIA 3W37A 2D73A 3ARUA 4GLRI 2MNJB 4TVSa 3MV9D 5DJ6A 4BZ2A 1ZVSA 3FTWA 1AS6A 1MFAH 1P1ZB 5DLMH 1WHOA 3KVQA 4GUOA 1YN7B 3EJCA 1YY8B 3I6SA 4NOFA 4OCRH 3KW7A 3WFEL 3QIUA 2J8UB 3M1BA 3NJIA 4N1EA 4NJ9H 3LEYH 1NANH 2VDNB 4JB9H 4F20A 5BV7H 4I87A 5D1ZD 2AEIT 4AGPA 4N2EA 3NPZB 5GRWA 4BM7A 4HLZH 3HBPA 3ZR5A 4J3OH 1S5HB 2CSPA 2DTML 1T7XA 4LEXH 1LP9B 3IDGA 4ZFGH 4P4RB 5C86A 2ESVD 1EDQA 1NFIB 3AT9A 4QRRD 4KV5F 1XF2B 4ZPTB 1MRCL 2DOCA 3LKNA 2QLYA 3RB5A 1I3GH 3H2QA 3LRSB 4KQ3L 3DXAD 1NQBA 3RDJA 4R3SB 5ESVB 5KANI 4XTRD 1WDAA 4IRSD 3BKYL 1K5WA 3OXRB 2PTTA 2VITA 1EXUB 2VRKA 1NC4D 4NXKA 4Z7WF 4LLDB 3S96B 4GG6E 1OAZL 2XWEA 1RZ7L 3JWNE 3Q3GA 2W9DL 3OAWA 4WF7A 5ISZE 3WLBA 2ZUSA 1FLTX 3FQXB 4PYGA 5C6PB 1E40A 4OLYH 2R1YB 1WIOA 1XH3A 3IMWA 2OK0L 2QHRH 3MBXL 5DHDA 2WZAA 1U33A 5ETUB 1PTZA 4P99A 4OCSL 5IQLA 1YUHB 3BAXA 2PWHA 4AQ1C 2O5ZH 5CN2A 1VENA 2N7SA 4XI5D 1B3IA 2XY1A 1NGXA 4LEBA 1X6NA 4LSSH 2NTFB 2MOVA 2R2EA 4N2CA 1CVSC 4JANA 3FTXA 4U2ZA 1I1YB 4JRFA 4PCYA 3SHSA 1KCUL 1IFRA 4MMXB 3HE7C 4ENEC 5LLIC 5KBMA 1ETZB 5EO9A 1NKOA 2A73B 3I3EA 5MEOA 4HJTA 1K8DB 1VB9A 5ERWB 3VGAC 2OJZL 4YO0B 3Q1SH 4BFIA 5IBUB 3NH7H 2XWCA 4OF8A 3SPIA 3O4LD 4ZMXA 3BP4A 4HSAC 1WCQA 3VD1A 1DQLH 4G6KH 3QJFB 4N90D 1YYMH 3ESPA 3D8MA 4JM2D 1A9VA 2N1KA 3GHPA 4JFDA 5IHZA 1UA3A 4Q2ZB 3IJYA 4MAYC 2IAMD 2UZXB 1RIVH 3VRJB 5TDPA 1KIQB 2OMXA 1WFNA 4AYID 4F5CA 4OFYD 3TBWA 4P5TA 5I18L 2QQNL 3HS9A 5GGSA 1E3ZA 1XFPA 1I1RA 1VACB 1IUZA 2EADA 3VGBA 5DCCA 1RV6X 4K7PL 5KYUA 4AYFA 5EUOF 3CPLA 3DLQR 1WJ3A 2FGZA 3HG0A 3FB5A 1L9RA 3FQ4A 5HVHB 1FNAA 1AHMA 4MD4A 1DQJB 4X4ZA 4LLVA 3A3YB 1AR1C 2QKIB 2NY7L 4S1RH 3RGVA 1CGTA 4BZ1H 2YK1H 4MSWA 3RWFA 4N5ED 4XCFL 5HYSA 3QIBA 4KAQL 1QBAA 2DLTA 3SKNA 4FF9A 1KMGA 1QTPA 5GJSL 1EZSA 1RUQH 4ZFFB 3P54A 3TP4A 2HT4D 3WXWH 1Y7VA 4JRXB 5AOMA 5KYWA 4HETA 1T1ZA 4NQCE 4CNIB 2IGFH 1Q9WB 4M7ZB 3PL6A 5IB2A 2QMJA 4PGEA 5HDWA 3T9WA 1X6LA 4ZFOA 5IFJA 3IWUA 3P0VL 3FBQA 1Y0LA 2O61A 2Y06H 2X4QB 4M6AA 1UJ3B 4DEUA 4TVPD 4AM0B 1S7UB 2KI6A 1Z3RA 3WKYA 3QQDB 1A0QH 3QWOA 3T3PB 3V9CA 1H8NA 4GMTH 2M83A 3QHFH 1ZTMA 4ZUSB 3TV8A 5C0JA 2E7LC 3QG7L 4NHCL 2IOOA 1R1CA 3ZE0B 1HCZA 4I18A 4HWBL 5T5FH 5HGBA 4GBXD 1S3RA 3CN4A 5IT2L 3RIFK 3T2NL 3RBGA 5TE7H 3IRZA 2O6EA 3JWDL 5EIIA 3TCLA 2BP8B 1AD9A 5CD5D 3VDBA 2G30A 1KEGL 3BUIA 1CICD 5LCVL 3V5DB 3H4FA 1TFPA 3VW3H 2GB2A 5C0BB 2ZKHL 3G5YA 1BM3H 5F9OL 3EO9H 3FXIC 4NQVA 1KJVA 2LV4A 3DV4A 2ORBL 5K5YA 5J13C 3BP7B 3BJLA 4MZRA 4XE0A 1HDMA 3TT1H 1A66A 3HNTH 2GIYA 2BCMA 1NZRA 2DQDH 2X3AA 4Y16B 5DD1L 3DHJA 2KPWA 4XMKH 2DMHA 1F1AA 3DVGB 2I26N 2Y7OA 2R4RL 3CMOL 1V7NL 4KK6C 4UIKH 2YHGA 2PWFA 1MHPH 2ZXBA 4L9LB 2AABL 2E9JA 4LHUA 3TZVA 1CBJA 3QNYA 3D18B 3WDIA 3N44B 5T3ZD 2CNZA 5E9DE 3PUUA 1GYAA 1HCVA 3NSXA 3RZCD 3MXVH 3ML9A 3QNXA 3L9RB 3LKRB 4O58L 5DHYA 3R8QA 5E8PA 4FKHA 1X5FA 2BY0A 3D39A 4HWZB 4BSVB 5C9JB 5I19H 2XZQL 2E7CA 1DBAH 3NIGE 3OXSB 4Y5XB 2ITDB 3VRIB 3OMNB 4HS6B 3WFCL 4U1SA 5KN5A 2VAAA 1FYTE 2CH8A 4FAAB 5GGVL 2K3TA 3OC5A 3VXUE 2KLTA 1KPVB 3KLHD 4FEIA 3R1GH 3V5HB 3VXQB 1FE8H 2WPGA 3HJ0A 1HJBC 5DK3A 4GAYB 1JZ2A 4GI6A 2NUTB 4DT2A 1Z3GH 5F7YC 3SB3A 1GC1H 1GOFA 1F8TH 4HF5H 1VZHA 5C0ND 3P4LA 4NAQA 1XF1A 2Z91A 3LS4H 4PJBE 5HJGA 5I2IB 3FU6A 2YGOA 4J28A 5FYLL 1T7WA 2BVYA 2N0KA 3M1CA 2YKLL 4K73A 1Y07A 5EBWA 1RHHB 2J88L 2NZ1A 2Z4QA 2Y7QA 5F1IA 3U9PH 1FYHB 4G42B 3BH9B 3BKML 4RMVA 4Y5VC 3VFWA 3FU3A 2F53B 3N85H 3N9GL 3GSQB 3FJTA 4X7TB 3HVNA 3MRJB 4F8NA 2J8UE 4PBXA 4DP4X 4DVRH 3GNML 3BVDB 3UTPE 3ZTJH 2NX5A 3VNYA 3VMNA 4ZDHA 2WTRA 4OFKA 5CJXC 1XIWD 5DO2C 1RFDH 3HKFA 1AHWB 4Z0BH 4FZ8L 5E9DA 5F88B 3D3VB 1DQTA 1R5WA 4KXAA 5I76B 1FIGH 3E8VA 1A4CA 4I3SH 4HC1A 2FO1A 2CR3A 4OGXL 2YOAA 5K93A 2FBRA 2OJEB 1TTRA 2RQ8A 3GJFK 3PGDB 2D03H 1IBGH 5HGAB 5EZJB 1O7DE 4LIQE 4KHXH 5EF1A 1RK0B 4JKWA 1FYTA 3E3QE 4HUXB 4HUUB 3QFJD 3OHXA 2ZOLA 3VXUA 3X14B 2XPZA 3ZKXC 2VRQA 2CGRH 1J87A 1M6OB 3HN8A 3NAAL 5KSAD 3CFDB 2VZSA 1XMEB 4JFSA 4L3FA 5BRZD 1D9KC 3ARFB 5I73B 1ZA6A 4JFPA 2ITEA 4XBGB 4PB9H 1EAPB 2GBUA 1CF1A 5L7XL 1Q9LA 2E74C 4YHZL 4BYHA 4M4RA 3IPFA 3IYLW 5I15H 4A66A 4CGTA 1KPRA 1UACL 1JNHB 4PJBA 3IEAA 3K8LA 4OIBA 4L1LA 1BZ7A 2H0JA 2ARJQ 4WNSA 4X6DF 4ALAC 4Z3TA 5IMOB 1RZGA 3HC4H 4NQXB 3CN2A 2HJKB 3QJQB 2D7OA 4OF3A 3NP4A 2BFVL 1UTDA 4XZUA 5A1AA 3TEYA 1AH1A 2K3HA 2VE6B 4NIKB 3VYOA 3VQ1C 1EAOA 1BVNP 1AGCB 4XX1E 3TEZA 2EXSA 2ZKYA 3C09B 3W39B 2VN4A 3JTSA 3W0WA 4UQ3B 5ISZD 4M8QB 1IAKB 1A6VL 3GXPA 2HLAA 3L4YA 5L4IA 2VXTL 5GJTH 4QPEA 3TESA 1BXVA 5FHAL 4JAMA 3A6BH 1B6UA 4ZUUB 3U30C 4AXWB 1S5HA 5GS0L 2X12A 2O6FA 2TSBA 3P4MB 4PHZA 1LP9A 1TJGH 1G6RL 4MTMA 4PWIA 4P4RA 4PCKA 1UD6A 1AXSB 4JDVA 5HGHB 2CK0L 4XNBA 4I85A 3WTXA 3ULUL 4W9JC 3RVWD 4KRPC 2APSA 3BPLC 1DFBL 3OKEB 3TN0C 4KX8A 3I9PA 3LDBC 2NCEA 5HYQA 5AYUH 1K8IA 4HHWA 2JB5L 1WCBB 3O6LL 3LRSA 1J1PL 4IRJA 3PL6D 4FI6A 2LAGB 2UXGA 5L88H 3EJPA 3UZVA 3K6FA 3PFUA 3SZKC 5ESVA 4H25A 1AI1H 3WIIL 3AM8A 5J6HA 2P3YA 1YN6B 1JPSH 2XQYA 2ZOKA 4NNPH 1WYJA 3OXRA 2HB0A 1SYVB 4LLDA 3O6MH 3OVUB 3BT2L 3MHZA 3P3SA 4AOFA 4CADB 2B5IC 1T03H 3TBCA 5MHSE 2NNAB 2WP3T 4TNGA 3MA7B 2H2PC 1U2CA 2DYPD 3MODL 5HGDA 5J6SA 3SOTA 4GRLC 5A2JH 2R1YA 3W9EA 4ZO6A 4AYBA 5GIRB 3GO1H 3VO0A 1TITA 3IJSB 3ZKNC 4P4KA 1G9EA 2FL5A 1FNFA 4MJJA 3HI1B 1YUHA 3REWB 4L9DA 2Q7YA 1UKQA 2HRHA 4PJXF 5E7FA 2QHLA 3MLVL 3E2HB 1PD6A 4L1HA 3V55A 1XEUA 4CW1B 2NTFA 1QO3B 3DSFL 3INOA 4JRXE 4LFHD 1J0YA 3HZYB 1F2QA 1I1YA 1ORQB 2WLNA 4DPRA 3DOIA 5JORB 5DYOA 4MMXA 1I1AC 3OB0H 3CFEA 1JNLL 2A73A 5LDUA 5KW9L 3ZYZA 2AK1H 1C5DB 5BCAA 2JB6A 4TM9A 5ERWA 1U95B 4XP1L 3ATEA 3QEQD 2YD2A 2FQGA 1G7JB 3QUML 4OGAC 1PAMA 4FHJA 1MRDH 1R47A 2DQCL 2OTUA 4POYA 1RU9H 4I8DA 1TQCB 3RWHB 4G71B 3W11C 3QHTC 2NDGA 4Y4KD 3T3PE 3SGJC 4JKPH 4NQCD 5JW4Q 3ZE0E 3RPIB 4XCCH 5CEZH 1EHLL 1WA2X 2XC8A 5DSCB 1RVFL 1S7TB 3RWJB 1I9RL 5I0ZA 2UZXA 1AY1L 3QS2A 3VRJA 3BFQG 4X0NA 1KIQA 5DZ9A 3N1FC 3WE6B 1S9VB 4H1LG 4O51B 2HT2D 2E6PA 2Q86A 3KWXA 1A3LH 4CVWA 4MLSA 4Z7QF 4DKAA 1NC2D 3LRKA 4J3OD 1VACA 5CKAA 5C0BE 3HBGA 4I77H 5JQ6H 4KK8D 3QXAB 3W9DB 4G3YH 1YDPB 3P0YH 4ZOCA 2FWUA 2K4WA 3F85A 4EIUA 1PIFA 3IN2A 3QXDA 2QKIA 5PAZA 2YC1B 2CJUL 4KI1A 1M3IA 4Y4HB 3X1EA 4BINA 1KCLA 1DJXA 1AIZA 2B2XL 4LARH 2VYRE 3SE8H 2WSDA 4BUGA 3X2QB 1GS6X 1NLBL 1IFHH 2ERJC 2IFGA 1VGEH 4PG2C 4G6FB 4CNIA 4Z3HA 3T09A 5TQ2L 1Q9WA 3UC0L 1JTTA 3ZKMD 2AV7B 4ZMYA 2DJUA 3ZUNC 3TBTB 3CHOA 3H9HB 4DJMA 2QTEA 1XCQB 2IG2L 4YDZA 3ARBC 4W9EC 5L9DH 3QORC 3WKNA 4OZGB 1IGTB 4PRDB 1BDYA 1MREL 1U8MA 4LSQH 5F7LB 3V0GA 5HD8C 1XL6A 4AM0A 3VI3A 1FAIL 3BYYA 1NCCH 2D3NA 3SD5A 3L4TA 4KXBA 1SN0A 1SXBA 3PJNA 5IB4A 5TF1H 5BVPH 2A6DB 3BAYA 3SSGA 4TSCL 2ED6A 1RPUA 5KSVB 3AREC 4XN9A 4KUCD 1QFUL 4JDTL 2RJMA 3DETC 3GS4A 3IE9A 4JFHE 3L3IB 2OCJA 2YMTA 1VPOH 3NK4A 2ZUTA 3ZTEA 3L4WA 5DU7A 2HMIC 2BP8A 1EJ6A 4G8GB 4GT0A 3HPLB 3PHAA 3P0GB 3QJZA 1OK0A 1R3LA 2B20A 5C0BA 3UBXB 1KN2L 5JHDA 4F7MA 1GJUA 1KUMA 4IKLA 2VO5A 2X4UA 1ZEAH 3HAEG 3A67H 3BP7A 1W91A 2FSDA 3ECBA 1EUTA 3O9WB 2AXJA 1YCSA 4B6ZA 4OCWL 4B5ZA 4KQ4H 4Y16A 1YEDA 4KITB 1I3UA 4APQB 4W4OC 3DVGA 2F53E 3ES6B 1DSFL 3IFNH 4ZTOL 4LCIH 2B08A 3TH3T 5I0YA 4U1MB 4L9LA 4K3JL 1SLVA 3UAFA 3PG2A 4JG5A 5BMFH 3D3VE 1F3RB 2F1BA 2DM4A 3CMGA 4ADGA 3U7WL 3LKRA 3T3ME 1FI8C 3GPEA 5T3XH 4LZKA 5CO1A 4E9LA 4CSPA 4I3RL 2G9KA 3EBIA 3VXRA 4HWZA 5GRJH 3MXWH 4BSVA 3ZSTA 5EIQA 5C9JA 1MCOH 4KZDL 4JFOB 2GSGB 4Y5XA 4WNQB 4QEGA 3VTTA 4HS6A 4BFFA 2IEPA 4U05A 3UTPD 2BRRH 5FGCB 4NAJA 3VE0B 2K4AA 1XXDC 4NKQB 4ZZKA 5CLWA 5E56A 2JJUA 4PGDA 1B2WL 2P44B 1KPVA 2WSKA 1UB6B 4U6VH 1QRNA 5GZOD 4N28A 1E2WA 1QLEL 1BFOB 4UZUA 4FCHA 3D33A 3GMQB 3KPPB 5CILH 5KVFH 2IDUA 3GF8A 1HESA 5D1XC 3MLZL 4JFWA 1JPFB 5FOBB 4OI9A 4PLNC 4MBRA 4UTCA 2M1KA 1H3VA 4OJFL 4M48L 4HMDA 1PGRB 1TKWB 5KZCD 1I85C 3U4BL 2JELL 4X7DC 4OB5L 1MG3C 4AZ8B 2FYYB 4MXQD 2WP3O 3NCXA 4G42A 4PJCB 1I8LC 4W6XB 1ADQA 2NYYD 4ENZA 4FZEH 2X0VA 4X7TA 1WBZB 2H6PB 4XO9A 3TEXA 2R0ZH 3ETSA 5C6WH 1ZY9A 3VFRB 4KDTA 5KAQF 3B8SA 2LU7A 3O11A 5EN2B 5F88A 4K15A 5T33L 2FX7H 2B39A 5I76A 5AALA 2AJVL 4NUQA 3GKZA 3FN0H 3GHEH 1WUZA 1N0XH 4P59L 1JD9A 2K8MA 4OV6F 2CRYA 4NQEA 5DI8B 3PGDA 3C6LB 3VSQA 1IL1B 1PJWA 3T0DA 5HGAA 5EZJA 1AO7D 1KCBA 2F61A 2JSFA 2ZCHH 1H3PH 5DJZB 1J8RA 5T1KB 2EDJA 4HUXA 4ODWA 4QR7A 4PJ6A 4WFEE 1QTYT 2CALA 1OTTD 1E4WH 3L3OC 4HCRA 5FK9A 5INDB 5E5RB 4L8CB 3X14A 5KVGL 2CLVB 4A2GA 1TO5A 4HLEA 1M6OA 1SJEB 3CFDA 3C5SB 3KBFA 2EDXA 3VXNB 4XVUD 2ZPKL 5JIDA 2H9GA 3WEMA 1ET7A 1F2XK 5JXAL 2L3BA 3QXUA 4WJG3 5MP6H 2FR4A 1UZ8B 3QZOA 1OARH 1JIBA 2F8VA 1NJ9A 3C8KB 3CTTA 1JNHA 4HKXA 3HA0A 1HWWA 4FI7A 3PWPD 1KIUA 4X80L 4MB3A 1X9QA 5IMOA 2XXGA 5H4ZA 3WHE1 1LDSA 5EWIH 2PYFB 4JB9L 4NQXA 5BV7L 2HJKA 1TYRA 3UJIH 1BZQK 4X8JB 3ATFA 1U3HB 2YPLB 2VE6A 1LO2H 2I9LA 4OKDA 1P4UA 1JHKL 1LK2B 1AGCA 1XGRA 4G6JH 2AZAA 4K94C 4LEXL 2Q6WA 3GI9L 1SFDA 3W39A 1M57B 4YHPB 4F9PA 1CGWA 4UQ3A 2E9GA 5MHSD 1IAKA 1KY7A 5IEKB 5E8EB 4JN2A 1LK3H 5F0MB 2NSMA 2B4CL 4R2GC 3STZB 2H2SD 2VJ8A 2MH4A 4JL1A 1VKXB 3P4MA 2WV3A 4PJ9C 3OZ9H 1KT2B 1WP6A 3EH3B 3ISWA 1AXSA 3BN9D 5HGHA 5F1NB 1WWWX 1SY6H 4RGNB 2KDGA 2IWFA 4OV5A 2NY2C 1SDDA 4JRXD 4FQLH 4PJ7F 5T3XE 5JUEL 3PDOB 4KTGA 2JK5A 5B1JC 1QWHA 3UFIA 3ZN6A 2C9SA 3L5WB 4J3XA 5FCSH 3O6KH 4GXUM 4UIMB 3S35X 2DZEA 3P77B 3V4UL 5M7QA 1SFHA 4NQDB 2X6BA 4FTVB 2ZUQB 2P24B 3FAXA 2IALB 4OLYL 4HUNB 1YNKL 4OF7A 3CX2A 1FVCB 1SYVA 2QHRL 4Z95H 4J2XA 5E8NB 2AJYH 4LDCA 4A2FA 3EYQC 4CADA 4M7LT 4PJEF 5JQIB 3VWJB 2NNAA 3LYRA 1BVZA 3MA7A 5KAQG 5AVUB 4YHYB 1ZV2A 3APMA 2Y1ZA 1HT6A 5GIRA 1KGWA 4Y1AB 4NWTH 3QCTH 5I16B 5FYJU 4OAWA 3RNKA 1NL0H 2FD6H 3REWA 4IW4C 5C0RL 4M8UA 1T5XB 1T0NB 1OE2A 3LB6D 1BPVA 1V7MH 2DBLL 2K6YA 3N1PC 4H4NA 1QO3A 3FBKA 4U3HA 5GGTA 4DOHB 4MNHA 3Q1SL 2W60B 1ZE3H 3HZYA 1L7TH 1ORQA 1YSOA 5JORA 4CU8A 3ULSB 1KWGA 2PLTA 1PX4A 2BO0A 4G6KL 1GY1A 1R6VA 4URKA 1CR9H 3SBRA 4OZGE 1U95A 2VJ0A 3ZX1A 1J1XH 1G7JA 2F8IA 2UX7A 2BH0A 2D3VA 3C2AL 4IRZH 3ZT5A 3ESMA 1MCJA 2G0LA 1T0MB 2PP8A 1RIVL 5TE6H 2JJTA 4RMUA 1OSEA 3B43A 3RWHA 2XTJB 4NCC1 3QXTA 1CGSH 3C60C 4HJ0C 3R0NA 2OR9H 4R7DB 2VDKH 4HUVB 5KSBB 4MQTB 4M4PA 2BXZA 4GS7C 3RPIA 2FZ3A 3FS9A 3VWKA 4FFZH 4FHBD 1S7TA 3RWJA 2NW3B 4Z1PA 4ZBJA 1QR4A 1MJJA 5ICXB 3U0PB 1UM5H 4M93C 1VEOA 3ARQA 2EVHA 1OSYA 4GQRA 5C6TH 3WY2A 4CAGA 5AB9A 2LU5A 3MUGB 3D07A 2W5PA 4AL8L 4PP1C 3WTTA 4S1RL 4G8GE 2VDNL 3GJFB 4NC1E 4C4KO 5AAMC 1TCMA 2GK0B 3FZUD 2WBJC 3LCYA 4KH2A 2VR3A 4P8QA 4NPYB 2MMXA 1RUQL 4U6YA 1AOHA 3SIKA 2X4NB 4YHLH 3WXWL 2W38A 2G5BB 3NEEA 4JFHD 5LNGA 5HHVH 4GIPD 1JZFA 5JR1H 5L8LB 2IGFL 2YC1A 5IBTH 4HJEA 5AW4B 1MZYA 1BW8A 1AXTH 2QQQA 4LIQL 5D2NC 2P5WB 2FAUA 1F4WL 4PQXA 3S37H 1G5AA 2GT9B 4UB0H 2Y36H 4JHUA 4C54A 1J48A 3KPMB 2R9HC 1AZNA 1IBFA 2AV7A 3TBTA 3G3LA 2XA8L 4MNQB 4ZXBC 1XCQA 1A0QL 5SWQB 1H5BC 4GMTL 1L3WA 4ORZC 3QHFL 1KB5B 3A4FA 4K8RC 5HDBF 2OXHA 2ATPB 2XRAL 3ZIMA 4KY1H 3VI4A 4LMQI 4U3CA 2AXHA 1L7IL 1RZJC 1JZDC 2F53D 5SX4H 3CJJA 3OD3A 3T2PA 1C5BH 3GMPA 1CT8B 1JPEA 4FQCH 2CQVA 4GW1A 5BQDA 5FGCE 1XHHA 2A6DA 1A4AA 1J0JA 2G75B 3VXPA 2XICA 4L1BA 2FH8A 4F57H 3GGWB 5IMKA 3VM7A 4R97C 3D3VD 1CLOL 2ZAGA 4G2AA 3VW3L 4UNVA 4OM1L 3EJZD 2XU9A 3SBWC 5B4MC 4KK9D 2AFNA 2FLRT 5HI3D 4R5XA 3W2DL 4Z8FL 3FYIB 3NEOA 3IU4H 4XPGL 2JIXA 1JXFA 3HNTL 2J3SA 3DPDA 2R2BA 2BIQA 4G8GA 2FHBA 3HPLA 2FIKB 3CBKB 9PCYA 5JZ7D 3UBXA 4NPJA 3FT1A 2NYZA 3OMAB 4U6HA 1KC5H 2LTQB 2C7FA 5B8CC 3ZHFA 1A7NL 3F6LA 3O9WA 3LEVH 5CLZA 2XN9B 2UWEF 4GFTB 3UACA 1MDAA 1XD1A 1EEZB 1N59A 3D0VB 4M6MH 4MX7B 3ARFD 1DQQA 2C9XA 4PJCE 4XNXL 3JUYA 1ZVNA 2Y6SD 5CEZD 1OPGH 4QHUA 2Q0ZX 2ALAA 4G43A 3L9YA 9CGTA 3IGAB 5I75C 5AKTA 5I19L 3B6SA 3DX7B 2VWEC 5K59E 1DBAL 4X9BA 4YUEL 1SDYA 5D7JC 4OD1L 3FUFA 2G2NA 4HS8L 5TPWH 1R5VA 1PCSA 2Y3AA 1NIFA 3BZFB 5L0QB 1JL8A 1OTSD 2XWBA 2XBDA 1QHQA 2BVOA 4BWUA 5BW7C 1KJ3H 5EBLB 2V8LA 1A8ZA 1ECYA 3DGGB 4GH7B 4WNQA 4O2CA 2DIJA 2WZ5A 2WQUA 3PF2A 5I6XC 3SE4C 1CDUA 2V7NB 3VE0A 3DVNB 3OF6D 2JCWA 2OMTB 3JXAA 2NNRA 2DI9A 1GC1L 3UDWA 3G9VA 5A6IA 4ZOEA 1J86A 3GJFH 2VW7A 1SY6A 2H0FA 3LS4L 4MKMA 2AC0A 1R33A 3MLTB 3ZYOA 3WYRA 4XWGL 1BFOA 1YEKH 2VN3A 4Q6KA 3N1MC 4M56A 2YZ8A 3GHBL 3GMQA 3KPPA 4H0LC 5F1SA 3RL2B 4PJ8C 5I17B 3HZ3A 2ZONA 1HQ4B 3DOSB 5E6IB 1SOXA 2EACA 1HHHB 5B38A 3SGKA 4UOW1 2D7TL 4O2EA 1PNDA 1DE4A 2YQ2A 3RBSA 1ZT4B 1JAEA 4AVIA 1ZMYA 2WMPA 3S7GA 2WAHA 3P69A 4DVRL 4TQHA 3GIZH 4PRPA 4AZ8A 3B5HA 1LXMA 4G5AA 4PJDF 5GRZA 2O93L 1XX9C 2JNZA 4K5PA 4HH9B 3MROA 1JPGA 4U1NA 2OJ1A 4Z0BL 3I6KA 3VU1A 4PRAB 1EAJA 1W72H 1OPOA 5AB1A 1VEPA 1GCFA 4G6ML 1WBZA 2H6PA 1DVQA 1Q1PA 1VRSA 1KLGB 1KB5H 3B1UA 4ZW6A 3II3A 4DO4A 4Z7OF 1JE6A 3BISA 2D03L 2L0DA 5FF6B 2FECL 5EN2A 5I8KL 4KHXL 2R4SH 2P80D 3EJJX 2HRPH 4BFKA 4N0UB 3U6XA 5DQJA 3BDBA 5IESL 4FADA 4QGTA 2PCPB 2WO3B 5DI8A 4PJ5B 1UOVA 3TA3B 1MFDH 4RGNE 1IL1A 3KAAA 5EO1A 1TENA 5C2BH 3MRLB 2KMWA 2QELA 3DI3B 3NJJA 5GQBA 1J10A 5DJZA 5L6YH 1RCYA 1MRFH 4PB9L 4ESKA 4XZ4A 2O30A 3QJXA 5INDA 3CZUB 1MWOA 2ZCKL 4IRZA 2ZD0A 3IMBA 2CLVA 4XBEH 3QEHB 3T4YA 1SJEA 4NQDE 2K9FB 4XN1A 3C5SA 3DROB 4FTVE 3VXNA 2CBQA 4OLUH 5JXEA 3VFPB 1MCCA 1HWHB 5FM4A 3SY6A 3S48A 3HC4L 1UZ8A 5DVOA 2BPBA 5A2LH 3C8KA 5T3XD 1A22B 4P5KA 2GJRA 5IJDC 3Q2WA 2V9TA 5I1HL 1H0DB 5D1ZI 2OMUB 2A0LD 1FVEB 3OLEA 5JOEA 1JFQL 2P5EB 4Y1AE 2PPFA 1MCIA 2PYFA 5FM8A 5GJTL 2AW2A 4X8JA 1FBIL 1U3HA 4XHQA 2YPLA 2WQSA 3ZUCA 1IAIH 3V95A 3A6BL 1W8OA 3OLIA 1LK2A 1H8LA 4UTAH 1E8ZA 2HG5B 3QXVA 1TJGL 4DOHE 1XCTB 1NCIA 4P2YA 2C1PB 5DVKA 5ITFB 4AEHH 1EZVY 3NJFA 5E8EA 3ARDD 4WUUB 2AXFA 1J8SA 5CR8A 3WO4B 2PYED 1QKZH 2HPOA 1KTBA 3STZA 4EZKA 4BGDA 3CXHK 1VKXA 1QZNA 3E6FB 1VFUA 3WY4A 1KT2A 4Y4HD 4AK2A 3U9UB 5F1NA 3IMTA 3O8XB 5IKCB 2HX8A 2UZPA 3GM0A 1S7QB 1TTBA 2E27H 2W65B 5DUBB 3TJHC 1OE1A 4QXUL 3OR7B 2XTJE 4Q14A 1U8NB 1YY9D 2DQGL 3PDOA 3RB7A 4G6FD 4PRHB 5KSBE 3RY6A 2YO3A 1J9CT 1M2VA 3NZHL 3U25A 3L5WA 4EDWH 1IE4A 4HVBA 5DMKB 4AYSA 4Z5RB 4BDVB 1I1FB 6TAAA 4UIMA 4WKXA 3P77A 4Y4FC 3CVHB 4JQXC 4NQDA 4YPGB 2X6CA 4FTVA 2DKMA 1VFOA 3MRBB 2IALA 1ZS8B 1XXFC 1DBMH 3KEHA 3II1A 1FVCA 3O2WL 1G7HB 1NKGA 3HR5B 5IFAL 1Z5LA 1TSHA 5CKGA 3VWJA 3VA6A 4R9HA 3LQZB 2ZF8A 2DH2A 3IJHB 2QQLL 1D5RA 2W0KA 3SE9L 1U8OA 4QF1B 2R56L 4Y1AA 5F6HI 2AVGA 5D96C 4XN5A 3SDXA 1MFNA 1A14H 1N18A 4HFWB 2QVKA 1QA9A 5F9DC 1ITCA 1T0NA 2N01B 2P5WE 3VXMB 3VXSB 3QUYC 5DK2B 2VN7A 2XG4B 3MRQA 2Y6TE 4NS0A 2AEQL 1OP5K 2XNAA 4JEGB 4BWTA 4ZAKD 4HCRL 3QCUL 3P30H 3QQ9D 4ONHB 5KUKA 2J1WA 3MR9A 4J3VA 3JVGC 4PUBH 3D85B 3UZEC 3ISRA 1NCNA 1C7SA 1RU9L 1SUHA 3VH8G 2XVBA 4DCQB 4G7YL 4MNQE 1RAMA 1T83C 3BWAB 4JKPL 3HUJF 4PB0H 5GRXG 1WIPA 3L5XH 3P9MB 4K3HA 2CO7A 3S5LG 4APQD 4M6OL 3FUIA 3U7YH 3DUUB 4JO3L 3LQAH 1T0MA 3EYSL 4YSOA 5PCYA 4JHVA 4Z3JA 3I2CL 4FC3E 4PD4K 5AVZB 1VFBA 3O3EA 4UUJB 4HUVA 5IHUH 4UT9H 4GO9A 1A3LL 4JY5H 3BOVA 3PAZA 3Q44A 2O5YH 5K1NA 4I77L 2NW3A 3O2DA 4ABWA 4G3YL 5FUCC 3P1VA 3CC5B 3KW8A 1P5VB 3DMMD 4YE0A 5ICXA 3U0PA 3AY4C 2E7HA 3HB3C 4ZZFA 4OLZH 5IGXL 1YEFL 3T0EC 3LD8B 3MLSL 1JYVA 1BZ9A 1BAFL 1YYLH 2P49B 5LGJB 4YSCA 3GJFA 3BSZH 4XNUL 2GBTA 4HKZB 2GK0A 1TETL 5F3FA 4OLWH 4UM8A 5C0FB 4TXVB 2D3LA 4IOIB 2X4NA 1MHCA 2G5BA 2VZUA 1IFHL 2XN9E 2HA1A 4M7JH 3L9EA 4W9LC 3HS0C 4FYTA 4WO4D 1NMBH 3NCYS 5AOKA 2P5WA 2Q9OA 3GT6A 1KV3A 3IMUA 5I23A 1VADA 1XGQB 2YEZB 2VSKB 5LQBH 3JWOC 1PAZA 3WUWB 2GT9A 5C0CB 2OMYB 4KKBC 4NLHA 2PETA 1NA8A 2ITCA 3N0AA 5I1IH 3BPNB 3NCMA 1NCCL 1H6EA 4JDZB 4MNQA 5TF1L 1UD3A 3B3IA 5SWQA 4HH8A 3QK0A 1XSKA 3LN5B 2ATPA 2ISDA 3B34A 4C56D 2YAMA 2X3CA 1T4KA 3GMRB 2E7MA 1VPOL 3CVHH 1CT8A 2QQKH 4ZT1A 5B39G 3FCGA 3IDXH 1KXHA 4Y9FA 5IBLC 2RCSH 2G75A 2WXHA 4DQOH 4GAGH 4LB8A 1IRAY 5L2JA 1EO8L 2A9MH 4DGYL 4I0PA 4YS4A 3RNQB 2MOGA 4P9HH 5AVQB 2WQRA 1ZEAL 5LBSH 3L3DB 3DX9B 2KPNA 3BUQA 2GTWA 3LOWA 1AQHA 2AVFA 4C47A 3C6LD 1UZ6E 2OXGB 3L54A 1IGIL 4ONGH 5GGTL 4KI5F 3RVUD 2AI0H 5GRYA 4NZTH 1JZ8A 2YS4A 3QJSB 5D7KE 2ZOUA 5BQ7A 3L3GB 4HJ1A 5DJYA 5C71A 2W07B 4MAUL 5T1KD 4RMRA 5F7UA 1VEMA 3K3QA 2W88A 4JRYD 3CZGA 3KR3H 3VD4A 4U1GB 3IFNL 4N0CD 4NB7A 4LCIL 1O6VA 3QXWA 4KROB 4N1HB 3H9ZA 3QUHA 2XN9A 3ZMNA 5KYXA 1I9IH 2EIKB 4LXFA 1HAUA 2P8LA 2VABB 4TNWF 1CDIA 3D0VA 2CCVA 4Y19B 4MX7A 5CFHA 2WTOA 3GXDA 2KT6A 1IBBA 1ZLUK 4Q7DA 3RLSA 3L9BA 3TJEH 4H40A 3WKMH 4FA8A 2NY1B 3BCDA 2ROYA 3QZLA 4FFWD 4NRZB 3FB8B 2CCWA 4PJHB 3EG9B 3UH8A 3DX7A 3HS8A 5J3HC 2YAOA 4ERSL 2R0WH 1AXIB 4KTEH 3KZ8A 4YHMH 4MQ7B 3MLPA 3TO4B 2G2RA 4LCUB 2OP4L 3AGVA 3VNZA 4N0UE 2LVCA 1JRHI 3G6JB 4ODHL 2A38A 2IGLA 1D6VL 2W0PA 3FQTB 4PJ5E 4JFZH 3TVMD 3DX3A 3DGGA 5CZXC 1CFTB 2OBGA 2XOTA 3FB7B 5AVWB 2BVPB 4L3EA 5I8OH 3I9AA 1PQZA 4LLUB 3X1NA 3GLAA 4XC3H 2OMTA 5CILL 1KCSL 3BEVB 4DEWA 2EC8A 4HHAB 1Y6KR 1MAJA 5AOIA 3A6CH 3ZU8A 3N50A 3BKJH 1NINA 4ANKA 1ORSA 1F4XH 1USQA 2ZZUT 5LWYH 1DO5A 2MHAB 3GYRA 4NBZB 3ELAT 4LPVA 1BEYH 5I17A 4XR8C 5CSZA 3MV8B 3OSKA 3DOSA 1NGWA 3LN9A 2FYVA 1HIML 3MREB 3IMRA 3UTQB 4FZEL 4NNXA 3ZT7A 5D7LB 4DZ8A 5F9JB 1G5GA 2ZF9A 3TFKC 4HJUA 1DUZB 1HYRC 1DJSA 2KC0A 2P5EE 4ES8A 2W9EL 2R0ZL 3CIQA 4WI0A 5I71C 2EIBA 2Y7LA 4R8WL 2IDSA 4HH9A 4GMSH 1AMXA 3T0VA 4FYSA 32C2B 4PRAA 3FB6A 1SOKA 5DGRA 1HH6A 5AW1B 3N6YA 3FN0L 3P3RA 3GHEL 2NY6B 5D70H 5E8DH 4WUUE 1YAIA 2DQMA 5FF6A 4ONFL 5E1IA 2GJZB 2GYSA 2IQ9L 1ZLVH 3GLZA 4Y1AD 2OMNA 2ZCHL 5KS9A 2WC7A 3W56A 3PNWB 3CLEL 3BUDA 3DGDA 1E4WL 2B59B 3QJVB 2APTA 2PCPA 4PJ5A 4Y89A 2IOMA 3MCKB 1YMHB 4RETB 3TA3A 4PYHA 5IP4A 2OAAA 4MAZA 1Q8MA 1HL4A 3D4YA 3DV6B 1VCBC 4IS6B 2NY0B 4OIIL 3WTSA 4PRHE 2J43A 2VDLB 3WCYA 4KUZH 4GI8A 2R29A 1O7VA 3VGDA 3HMXA 3QEHA 4L2LA 3EZJB 1DQIA 3DROA 1W0YT 5IROD 1Y6NR 2K78A 2O5XL 2VMDA 4RMBA 3VFPA 4HHGA 3TYGL 2GUYA 4BXVA 5E08H 4BWWA 4ELMB 4G8FB 5CJOH 5EWIL 2OQJB 2P28B 2ATKB 5DXWA 1OCCB 2XTJD 4X8CA 1ML0A 1U6AH 3KLSA 4PJFB 4YLCA 5B7EA 1JDDA 5HHXL 4HDIB 2QVMA 3V0IA 3ROOB 1W15A 4IOFD 1H0DA 5IJBC 3LZLA 2OMUA 2A1WL 1FVEA 1KEML 5EOQH 3S36H 2Z92B 3GUFA 2P5EA 5EPMA 3Q6FB 3ZHKA 5GHWL 1N0LB 5J1TC 3PHQB 1WQVT 3ARVA 4OTXH 1NGQL 2EYTB 1OGSA 1NCJA 5JDJA 5E94A 4JZJB 3VXME 3VXSE 3HW7A 3NCWA 4WU7B 3ZE1F 4P48A 4BK5C 1OGAB 2HG5A 1X3DA 1G9NH 3MFGB 1GGIH 3GBEA 2C1PA 4J2QA 2FUQA 1S78D 2PCXA 4Y9EA 3ZZLA 3S4SG 1BF5A 1SY6L 3K2UH 2WLZA 1SF5A 1PLGL 4NN7C 4FQLL 5CLTA 1HOEA 4KTDL 1E5ZA 4AC4A 2Z7ZA 5GGUB 1SHSA 3EH4B 1W6LA 5J06A 3NVQA 1R3HA 1BF8A 5EA0H 3O6KL 4WSGA 4LSVH 4XAKE 2KHAA 4K3EH 5G2NA 4X8XA 1L9SA 1U8NA 3AUWB 3EHBB 5MI0C 4TLSA 3NIDF 2X6UA 4UM9D 1HSBA 1C12B 4Z95L 1TTCA 5L4MA 3QC6X 2ZWSA 5DMKA 2AJYL 1F5WA 1I1FA 2WKGA 4ZG1A 6PCYA 5E1GA 2E76C 4XVJH 1G7MB 2B9AA 3LN4B 5I66A 2Y72A 4IM8A 3IDIB 5DVNA 3MRBA 3KL3A 5J12C 1GXEA 2VXSH 3FO9B 4KY2A 1MF2H 1QP1A 4YNYB 2Y4SA 2BIMA 4HKBB 4NWTL 3PPEA 3D08A 3MRRA 1G7HA 3HR5A 3LRLA 4Q9CA 4A7GF 4KOCA 5TD4A 1NL0L 4U1LB 1KBBA 4NP4L 1JNJA 3KHOA 3SDAD 5JYLA 2VLKD 4YHNA 3MOBL 4I48B 3LQZA 4KI5C 2BIIA 2IH1B 2EO1A 3IJHA 3P11H 4RRPM 5AUMB 4FCAA 1OW0A 4XCYB 3RGHA 1DLFL 4QF1A 1WAPA 4OW6A 3N41F 4KX9A 1IJNA 2NRDA 4OBRA 4GXVH 4N0YH 5BVJB 2FH6A 2H32B 2HWZH 3ABZA 2E8YA 1CG9B 3U36B 2NMSA 3GSUB 1E2VA 2Y2WA 2APXA 1TQTA 3LXBA 1DJYA 1ZHNB 3NJVA 4YSEA 3VXSA 4M5ZH 2F5BH 5DK2A 3FUMA 1PFOA 2FJHB 3AXHA 4FLSA 4WGWB 5C0CE 4LL9A 2V2WA 4IRZL 1T5WB 4FNPA 3NG5A 3D85A 5TE6L 4C8XA 4ZMQA 2N3JA 4IBWA 4CMMA 3DK2A 2OW7A 2AANA 4JHZA 3GRWH 4DCQA 5ID0B 2XN9D 3SO3C 3BWAA 2IH9A 3SOBL 5CBEB 3QBTB 1NANI 2IANA 4B9YA 1TNNA 2VDLH 4FFZL 4EUPG 1ZIAA 1D6EB 2LLNA 4E41A 3EOTH 1N9PA 2B1AH 5GGQL 3QA3B 2A9CA 1OM9A 2M2DA 3BX7C 4UUJA 5D1QC 4APXB 3FUJA 5A2CA 4F9LA 3WFBL 2FSEA 2I07B 2YRPA 5FYJH 4C56B 3BUTA 2Z65C 3CC5A 4HUWA 1P5VA 3ZDWA 3FCTA 3KCPB 1GA2A 1ETB1 4YHLL 2VGLM 1QI4A 2Z93B 4K0OA 2HX9A 4RDQF 4TULH 5AVRB 5HHVL 1IT9H 2Z7UA 1JWUA 4YFLF 5C0FA 4K7FB 3T65A 2D9CA 1FSKB 2CKNA 4P2OD 1TZHB 4KRLB 3FH8A 4LNRB 4UB0L 4DP7X 1QRKA 2BHZA 3B3BA 3MA9H 1V3JA 4UNIA 2NXZC 1A7PH 3OV6A 2V17H 3KPSB 4JPKH 3UZQB 4NCDA 3U2IA 1EHNA 1XGQA 5E6ID 5D7KD 3FTGB 1U9KA 3WUWA 5C0CA 3Q9QA 2OMYA 1A6UH 1MJ7L 4G8IA 2L04A 3KPNB 4IK7A 4PJHE 4PMFA 3UYRH 4ES9A 4EZLA 1P4BL 3CBRA 5D6DC 1RK7A 2GG1A 4HG4J 4M3HA 4WK0B 1IGCH 2EICA 1MELA 1ZHKB 4JDZA 3U82B 3VA2C 3G6JE 4JHWL 1FAKT 3EYFA 5C08D 4N26A 1I9JH 3SYOA 3LN5A 1MQKL 4LRIA 1YEEL 5EF3A 3HNVH 5F44A 4YSAA 4KO9A 2XFXB 2QT6A 3L2MA 5IVZB 3BVNA 3B2VL 3X3FL 1G1OA 2YA0A 3KDPB 3MNDA 1IKNC 4MJ6A 5IV2A 1OF0A 3O4OB 4GRWH 1EZVX 4AK1A 2IFFH 3RNQA 1GS7A 2P46B 4OJAA 4YC2B 1HE7A 3MLUH 1KC5L 3L3DA 3II2A 2OMWB 3OL2A 2OI9B 3ET9F 1CXFA 2Y5QA 4X5PA 2OXGA 5H35B 3OTTA 2Y69B 2C9UA 3MV8E 4JQVC 4PV9A 3L3GA 1E67A 4WRLA 4XP4H 2W07A 3ARPA 2YD4A 5D7LE 1E9PB 3O6FD 2TRHA 1CI3M 1GW6A 3QCVH 1HXYA 4OLXH 3WD5H 3ILPB 2IMNA 4ANUA 4M61B 3MRGB 3ZQXA 2VABA 3L4CA 4Y19A 3D4ZA 4QHMB 4DGIL 1OAUH 4TUOA 3MNVB 1H9VA 1JWMB 5TPWL 4OGQC 1ZS2A 1P5UB 2YPKB 3FQWB 4NRZA 2VQ1B 3SPVB 2X9ZA 2ZNWA 4A2HA 3EG9A 3FYEB 1QSZA 4BQ6A 4AJVA 3U0WH 3H4HA 4AW7A 3O2DL 4LQFL 2P5ED 4NC0B 3HR6A 5A2FA 4MQ7A 2FX8H 3A21A 3TO4A 2VL5B 4ORGA 1MIMH 3SCMC 1UM4H 2QZ5A 3IM1A 5CUSH 2WGXA 4RDQG 2IDCA 1C1EL 3ERXA 5H37H 2YJLA 1Z9PA 3H55A 2ZOOA 1CFTA 3JV4A 3N43B 3DX8B 3FB7A 2XVLA 3QIWB 5E6UB 3TNNB 3N42F 3C5ZC 1WZ1L 2IJ0C 4LLUA 1IEAA 4WUUD 2JKRM 3BLPX 4N8VG 1BIHA 3CQQA 3BEVA 1LEGB 4QDGA 4YHKH 1KLUB 4OKVA 2AXWA 4HHAA 3T04D 1J9SA 4GAAA 1BFVH 5J5EA 3F83A 4PW3A 2GHZA 2A3TA 3NCBB 3VFGL 1RJCA 5F21B 4BJLA 1BQHG 3LZFH 5DEFB 2MHAA 4HIHA 4XVOA 3O8XD 1EXGA 3TT3L 4ELME 2WWMC 1YVLA 4EZMA 3FO2A 1Q0XL 3ZRFC 4A7SA 3ULUF 1INEL 3MV8A 5FYJE 5JPNA 4PJFE 3MSPA 3MREA 4PRHD 2YJQA 5C09D 4LL4A 1SNRA 4WGVB 3UTQA 3MBEB 1RZKC 2GUOB 5F9JA 2FT6A 4Z7VB 2YD6A 4EN3C 1DUZA 2ZX6A 3NJKA 1KB5L 5B22A 2H6OA 4J4PA 1FCGA 3EZ8A 5JW4R 4WSJA 4U3SB 1BLNB 4A68A 1KTKE 1FFPB 4Z78B 32C2A 5I28A 2R4SL 3TBSA 2HRPL 1OGAE 3G5VB 4Q74A 4R6UA 2PO6B 1MCEA 1SLUA 1MNNA 5GZNC 2WOYA 5DD3H 3JWDC 4W70A 2VO8A 2V4LA 2APBA 5C2BL 5L6YL 4DN3H 2J20A 4NNYB 3KLQA 5BUAA 1AS7A 3PNWA 4XC1L 4UDTB 3RDTB 2B59A 5KJRH 5ILTL 1RXLA 3QISA 3VXMD 3MCKA 3S2CA 1L9NA 2EEFA 5ACZB 1NAKL 1M1SA 1RUMH 5C7ZA 5LDSA 4IS6A 3LS5L 1DBKH 3K5RA 4MDIB 1FVDB 2PXYC 2GJ6B 4QLWA 2XWXA 3K8KA 3L8QA 3QUZD 1AOZA 4R84A 1CB4A 1UXMA 2AJUL 3A23A 2AAAA 5IB1B 3GZKA 1FWXA 4PRID 4ZX5A 5A3IC 4TQEL 5FGSA 5AB0A 2R8SL 3HI5L 3QJHB 4FXKC 2WZPD 1OIOA 1X5MA 1X9UA 3AG4B 4L8SB 2Z35A 3MYJB 4I2XB 4AQ8C 3E0GA 2WYIA 3QNFA 3GPSA 3N2JA 4PJFA 3GXIA 4DEPB 2Z31A 5I1EH 1IAIL 4TUKH 1CLZH 4UTAL 2X4PA 3FQNA 1XZ0A 4XOBA 2PWGA 1AQDA 3TTSA 2FK9A 2AJXH 1FG2B 2ARJB 2EYTA 4CILA 4W6YB 4JZJA 4Y1TA 2YR3A 3RA7H 1CQYA 3AABA 1OGAA 1U8IB 3EFDH 1ZT1A 2E47A 1QLRB 3WI9A 1U4EA 5DHVB 2EKJA 2UUDK 2Y07H 3QVAA 2E27L 2BFGA 2I69A 2ZTBA 4K71C 1MPAH 3ARRA 4LCCB 1UFUA 2A74B 4OZFG 2DY2A 1NCWH 3FHAA 1LWRA 1E6JL 1WAEA 5GGUA 1OP5H 5I1AA 1UWFA 2DF3A 4HZAA 3MRPA 4RX4D 5C07A 4KJWD 2H0PA 1KWKA 4LPUA 2R7EB 5BO1L 3CN3A 3STBA 2XPYA 3MLRH 4LVNB 4YQXH 4HEPA 1BD2B 3ARZA 5EORL 1O6SB 2IV9A 2X9XA 4U1KA 1FUNA 3BESR 2F8XC 4GG8B 2K6ZA 1ZIBA 2XA3A 5SWSB 3HG5A 4MQXC 3K71B 1GGCH 3LIZA 3WU1A 1OCWL 1G7MA 5DO8A 4C56E 3LN4A 4RLDA 5D5MB 3VGFA 1MLBA 2UY6B 2X2UA 4PRNA 3S0PA 4ZD3H 5ID1B 4RCAA 1T89A 3INUH 2DEWX 3FO9A 4YNYA 3LHPL 2XUWA 3ESOA 4HKBA 5TQ0L 1JJUA 1MVYA 5I9QB 1ACCA 1WTLA 1UCBH 1A14L 3OJDB 4UILL 5IMMA 5FFOA 3IFLL 2GSIA 3NCCB 4HOXA 2IH1A 3PGCA 3HG1B 2X0WA 4MA8H 4AMWA 2H32A 4WI5A 3K5SA 2ENPA 3GSUA 1BVLB 4PUBL 2NR6D 4AIZB 3BH8B 5DWUH 1QVOB 2NSXA 3UAJA 3L1EA 2VM9A 2XZAL 1PFCA 2C8NA 1T1XB 2QADB 2B77A 4MCYB 3MJGX 3ZL1A 4AQ1B 1SBBA 3CSPA 1FN4B 3RX8A 4MDJB 2EDNA 1T5WA 2JKXA 5KYYA 2LLGA 1HKLH 4G5ZH 3R8BB 2RFXB 2ZP9A 3KGRA 4PLKC 4KQ0A 5CBEA 5IHUL 5KJ7E 4R90H 3HBZA 2MEJB 4IGBC 4JY5L 1XH2A 5DFWH 5K9QI 2IAMC 4F93B 5T1LB 2QPSA 3UOAB 4ZMWA 1D6EA 5B21A 2MIZA 5FXCH 4TKWA 2WAQA 5CJQL 4MGXA 3QA3A 4NENB 4Y8AA 2KL6A 1ZDQA 2VSCA 1ZRUA 1WS7A 5JIPA 4APXA 4E2OA 1YYLL 5D7IA 3NJGA 4DQAA 4GQZA 4H8HA 1TPXB 25C8L 1T0OA 4YSSA 4GAJL 4G1EB 4OY9A 1TYJA 4W9DC 3HRZB 3UMTA 4C56A 3KCPA 1F00I 2VR8A 2DQFB 4H8QA 3RVTC 5GS1B 1H3WM 2Z93A 1DSWA 1IKFH 5GS0C 4MAYB 4M7JL 4F7TB 1Q38A 3H42H 1TQSA 1KN4H 1QFWL 1KGCE 3FC8A 4ZNEA 3QEGL 2J1XA 4WO0A 2A9BA 4K7FA 3S34L 3ULUC 2VMJA 3RURA 4X7SL 5LQBL 2YWZA 4ODVL 1U30A 4PIBA 4X6CB 3KS0H 1MAMH 4DP5X 4PJIA 1GAFH 3VD0A 2P8PB 2R23B 3T5WA 4B9GA 4UYQA 2ZXQA 3KPSA 4NO2A 3UZQA 2X3BA 4WUKH 3QI9B 5CINL 3OJ2C 1VZGA 2NY4C 3S3JA 4JKLA 4WEMB 43CAB 1Z6JT 4IK6A 5D7LD 2DL9A 3VD5A 4XB7A 3VACA 4PJ7A 2C4XA 3CVHL 2QQKL 1ZHKA 2GQHA 4LPXA 2ZYIA 1ZLUH 3IDXL 1J5OL 1SJMA 4N2DA 1EFQA 4UT6A 4P46C 4EQ2A 2R27A 5IEHB 5ADOH 4JZOB 4DQOL 4U1JA 3P2DA 4ZUTB 3FPYA 2VH5H 1T2XA 2CU9A 4KKNA 2PKDA 4M8VA 2XFXA 1HZHL 3BC9A 1EH9A 5C7XH 3WY3A 2XWJB 1NPNA 4YBHA 1I75A 1MN4A 3A22A 2NY6D 2DQTH 4ZMVA 1N67A 3LZPA 4ONGL 4FL4C 4BFEA 4F24A 3O41A 4ETYA 2JLLA 1NUFA 1NAMA 3QRGL 4ZS6D 2VM4A 4KKAC 6PAZA 2DIEA 2ZCLH 1PJ9A 5E7BA 5AD0B 1U8CB 1MCSA 2G4GA 3RFZC 3NPSC 4N2GA 4XMPL 1VDGA 2X7LB 1BREA 2V8MA 5DJ0B 5GSRA 4AV4A 5AZ2L 4EIZC 4F37K 3KPRB 4G7QB 3GXMA 4JFQB 5ITBL 4W9HC 1EGJA 2G9HB 2FEJA 5AVXB 3VGHA 1ZLSH 3TJEL 1IV8A 4PI2A 4Z7VE 3S88L 3KXFA 2WO2B 4YXHH 2PPEA 4MJIB 4BH8B 3BYTA 5F3HA 1BHGA 5D8JH 5DQDL 4J6RH 4M61A 3MRGA 4GFXA 5GISL 4BKLB 1SYSA 4LGRB 4KTEL 2I7SA 3CZFA 3O81A 2EZ0C 4QHMA 5J13B 1DBBH 1JWMA 5AWNH 3ZRSA 4JO4H 4C59B 5FYJD 1NIDA 5ACLA 3FQWA 4Y2DB 4I5BA 3SPVA 1A47A 2YUWA 4JFZL 2HN7B 3C75A 3FH7A 3KYKL 3QIUC 4L0ZA 1RP9A 3MNWA 5FFGA 4G1MB 3QZPA 3O3UN 2XY2A 2ZSVA 2V9UA 4PY7B 5HHQB 3RZWA 2VL5A 2N0MA 5EOCH 5TFSL 4XC3L 4TRPL 1R75A 2QDWA 1WGOA 3KLKA 2FRGP 3PHOB 5JPMC 1HSAB 3BPOC 3H9SA 3OLGA 1TJHH 3BQUB 1QSFB 1BVKA 4JQIA 2A77L 4RWYL 1OGAD 3JWNG 3DX8A 4HK3J 1F4XL 2VN5A 4J3OF 2HJFB 3TNNA 2PW2B 4QRQB 5FHBL 2V6HA 2GJ6E 3NJNA 4HJGB 5I8EB 4MRCA 3F7RA 1JZIA 3ALPA 2YD1A 1S7VB 4PTTB 3R7QA 1NCOA 4D9RE 5HYSG 7PAZA 1FGNH 1FGVL 2C1OA 7TAAA 3FHQA 2RHEA 4EI5D 5ES4B 4MBOA 2C7UB 2CIKB 1AZBA 3CN0A 4DP8X 4I2XE 1SHMA 1DANU 1F13A 4S1SH 1BCIA 4CC4C 2GW5A 3P4NB 1QBLL 4AV0A 1F6FB 3MBEA 1LILA 3QYMA 2GUOA 2N7AA 4Z7VA 4F8QA 4RMTA 4JREB 3ETTA 3WS3A 3CVBA 1MUJB 1OF2B 2AKRA 2F0CA 3SDYH 1A7BA 3GSXB 2D2OA 3FRPA 2IVFC 1JDAA 3P3YA 3Q0HA 5ABAA 5EC1B 3DJ9A 5FA3B 1LMIA 4Z78A 2ICEB 4N2MA 2X9YA 3BZ5A 3S35L 4MWFB 2V5TA 1KZQA 4UT7L 2PO6A 5FFLA 2FQEA 3ARGB 5F7EH 3MVSA 3CUPB 5AKVA 2BOBB 4IYKA 2DYSB 2DTSA 5DS1A 4LOEA 3PY9A 4UINH 1UG9A 3C9NB 1S9YB 1RURH 2WQWA 3GBMH 5EIIG 3RDTA 4AEIH 5E99L 1B88A 1N19A 1KYDA 5LXVA 3J07A 4YR6A 4I9XA 3KJ4B 4AYGA 1WBYA 3L5HA 4DP9X 4AWJC 5I0VA 2QVFB 2BNQD 3WEOA 5A6MA 4FQPA 1BD2E 3CVIH 1GW0A 4MDIA 3SQBB 5E08L 1FVDA 5CJOL 3DIFB 5HYJA 5SWSE 3MOQA 2EJ1A 1K6QH 4FP8L 3ZYJA 3HN5A 5JTWA 1GKEA 2WVVA 1OO2A 4MXWH 1G1YA 3LXAA 1FHNA 3LMJL 2DWEA 3IDUA 3MV7A 2EH8L 5D5ME 4JJHA 2J7LA 4HAFA 2X53A 3K46A 4L8SA 5I6OA 4J5VA 1YNLL 3MYJA 4JFEB 4PH8A 4RH4A 4WFGE 1ZTXH 2E4TA 2BCKA 4K2UL 4TNEA 1AACA 2UXFA 2YA1A 3B9DA 4LHUG 4P5TC 2AQ2A 4PJBF 5I5JA 3TL5A 5J56B 3GUTB 1KBVA 4K5MA 3JWNC 4TVUA 4PW4A 1OM3H 3HG1E 4D9QE 3K2IA 3DSNB 4YSRA 1N5YH 5EO0B 4PJGB 5JMRA 2EEXA 5DHMC 5EULV 2WUBH 2ARJA 2R69H 4QRSA 1NUDA 5E1AB 3Q05A 4FQIH 2GHWB 4NERA 5EUOB 3RGVC 3HE6A 1ACYL 1U8IA 2YXVA 3QIBC 1HQRB 4OBSA 2W91A 4P2AA 3OAUL 5DHVA 3RJDA 5F93C 5ICUA 2Y5EA 4Y5YA 1JF1B 1B0WA 5F70A 1E27A 3Q2VA 1DVTA 1T6BX 4LCCA 4FMVA 2A74A 2E4FA 2KS0A 3QUXA 3BKCL 5E2TH 4AMKH 3PL6C 1LP9F 4OZHB 4WI6A 5KVDH 4NWUL 3SJVD 2NOYA 1U8HB 4J8RB 1AQ8A 1F4HA 4FQQB 4XVJL 3IJ9A 3U30B 4HWEH 4QRPD 3Q8EA 4KMTL 2EIDA 4PP2B 1E8WA 4Z7IA 2DKUA 2AQPA 1F02I 4XN8A 3PP4L 5KVMC 4GG8A 4X9YA 3TN0B 2RAMA 3K71A 2X44D 5H8DA 4EXPX 3LDBB 4G6AD 1XBRA 2YAPA 1BQLH 2Y2YA 4N9OB 1BQKA 5D5MA 4I18C 2JF1A 3W57A 4Z3FA 5C70A 3F04A 4NYLB 3G5XB 3V5KB 2HLFC 4M1DL 4GXVL 4PWEA 5TTRA 3UAEA 1WC7B 2AQNA 2J25A 3L16A 1PSKL 2NQDA 3OJDA 3K80A 3UJTH 2EVJA 3LKOA 3EJYC 3WL9B 4MA3A 3TYFA 2VXQH 2XZZA 4G8EB 4IBSA 1RMFH 1MHHB 4ZW3A 1DJWA 3EXJA 3ABLB 4HIIB 4UCFA 2V2TA 1S7RB 1SBSL 4FLQA 4QJ4B 1DVFD 3MUJA 1BBJB 1NSNH 4UQ9A 4AIZA 1NFDB 4FMKA 4KJPD 1KNOA 1A3RH 2EE2A 2F5AH 4RRPA 4Q9RL 2WB1A 3LRHA 4GB9A 1T1XA 4DPBX 1I7TB 4MCYA 1KGCD 2HFFA 2FBJH 3BE1H 2BMKA 2EIMB 4MDJA 5C0IB 2J6EA 1LLAA 1TFHA 3QSKB 4FFVC 3MJ7B 2RFXA 3TZVC 4H88H 3U6RA 2ZCZA 3OGOE 1C7TA 2NUPB 2WYZA 2JI2A 2X2IA 1Q4NX 2FBOJ 4S2SB 4XPTL 2QMKA 1TVBB 1R19A 3D25B 2AP2A 5T1LA 5FYJL 3BEWB 3B7SA 3CE1A 2FWSA 2P7TB 3AU1A 4PR5A 2E86A 5BV7C 4NENA 1YPZB 1C9SA 4TULL 2GI7A 1UADC 5DT1H 1P6WA 5E2UH 3KMDA 4HKJA 4ZX3A 3VRLE 3UEQA 2Q8AH 1TU2B 3MACH 3HRZA 1QX1A 4LP8A 1S46A 4XMUA 1YECL 3BPCB 1FNGB 2B4CC 2BVEA 3QFDB 2DQHH 5GS1A 3RYMA 3UBGA 3CFUA 1MJ8H 3UCQA 1EUUA 3QIWD 3UGUA 3MA9L 3KPRE 4WWKA 4OD2B 5DZPA 5HI4C 2HKAA 4HK0B 4XPBH 2XX0A 1B4LA 2MQ0A 1NCUA 4ALAH 1X5XA 1YEGH 3B2UD 1UA6H 2DLGA 5DMGC 4HBQA 4H2CA 4X6CA 4DGVH 1TQUA 2IO5A 4MJIE 3K0WA 2LE9A 2X4RA 2YGVA 3BN3B 1MFCH 3UYRL 1PG7X 3BVVA 1OP3K 4GRMB 3BO8B 4MMZA 2EDHA 1RP8A 3SE6A 4FG0A 2A83A 4CMHB 3JTTB 3QI9A 1COBA 4UAHA 4A39A 1SMOA 2X40A 4NKDB 4Q4IA 1CDGA 3MBED 2ZICA 1JPTL 3R19A 1TR7A 1JVKA 3O3AB 4A04A 3X11A 3MGTB 2X38A 2XQYG 1XGTA 5IEHA 3EGSA 4E68A 1V3KA 3FCSB 4KU1A 4JZNB 1LE9B 1T3FA 4KMLB 4ZUTA 3RIKA 5I1DA 2DIAA 1QSFE 5I5IA 4L5FL 2DM3A 3P4OB 4PLJD 2IFFL 3ARBB 5ESQB 3QORB 2PO6D 3MLUL 2EC9U 4XNZB 1ET5A 1UD8A 1OL0A 5KVDE 1GIGL 1UH2A 3ZE0F 4MASA 1IC7H 2HXAA 4KO6A 4XP4L 4JFYB 1LM8V 3GZQA 3OHXC 1JHLH 1FL5A 5CU9A 5LNEA 5AD0A 3AREB 4MCMA 5FGRA 3CBJB 5IJKA 2NY3C 1NFKA 2X4TB 1SXZA 4TSBH 1BVNT 1OANA 2APFA 1J5DA 2X7LA 5DJ0A 3CK0L 3EO1B 5BO0D 4RGOH 3SPGA 4XXDB 4NO0B 1SLXA 4CJ0A 3NFNB 1OAUL 2G9HA 2GJ6D 4IBTA 4YLBA 1EQWA 4LSPL 1GZHA 2EECA 4N0RA 1CBVH 2UYLA 3T8VA 4MJIA 4BH8A 4DFHA 2CDGA 4BKLA 5CM1A 3OMZA 3D87B 4D9RD 1SPDA 2YD7A 4GAFB 3L1GA 2CXKA 4NZUH 5IBUG 2BSRB 2I7OA 3A47A 3GI8L 4XN7A 1L4IA 1MLCA 1FDLH 2FX8L 3LQMA 4X4YA 4Z3IA 1NWOA 3SD2A 1E0OB 3FQYA 4XCEB 1NDTA 3HZKA 1RZPA 5A43C 1TMQA 2XXMB 4Y2DA 5CUSL 3LH8A 4HFUL 3ZE2B 1JGUH 2O72A 3MTXA 3MFFA 4AL8C 3N44F 4YDVA 1NGYB 4LE8A 3TURA 4G1MA 5ACMA 3LKSB 4PY7A 1UQSB 2WNGA 4H1LB 3ZKQD 1QBBA 1GGTA 3HNSH 4Y0GA 1SF3A 2GBAA 2A2QT 1M7IA 1DQMH 2WNWA 4KJQD 3BQUA 1QSFA 3I6GB 4XPHH 4OZ4B 1BFVL 5FO2A 2JQMA 2ZP0T 1RIHL 3RRQA 2HJFA 5KVEH 1PF3A 2PW2A 1GPOH 4G7VH 3DUSA 5GGRA 1O7DC 3T8MA 1NLDH 2LHAA 1O9VA 5SX4I 4M1GH 4YVUA 1A9BA 1YEJL 3DWTA 3PWJB 3EFOB 4IRJC 5ESAB 4NFBA 1JD7A 5E4AA 1DQDL 3LEXB 2MNWA 4PTTA 5DJ8A 5E4OA 4J3UA 5D1ZB 1JHTB 1IARB 1R9FA 1AKJA 2FQFA 4EOWH 3D2TA 4JFEE 4ECNA 1X5LA 1UXWB 1F3DJ 3AM8C 3RTQA 2G4EA 3MUHL 3Q01A 2X6VA 4YEEA 5FDWB 2DEYX 1EHKB 2ESVB 3P4NA 4KK5C 3CXHJ 4PGZA 1BD2D 1CF8H 3Q13A 4HLJA 5D55A 4LF3A 5E0QA 4R0LB 2BS8A 35C8L 1T4WA 4JKNA 5SWSD 2LR4A 7FABL 2COVD 3MLWH 5I8CB 1BXUA 3MYZA 1MUJA 4GP5B 5DD3L 1KFGA 4PJGE 4YX2H 3O0LA 4CBPA 1D7BA 5AEAA 1KELH 4JHAL 4P4KC 5FA3A 3UABA 2VOTA 2IBGA 2ICEA 4Z7UA 4HIJB 4FLOA 5EUOE 3ESNA 1Q9OB 4DN3L 3VU2A 5IMLA 5EC2B 4V1DA 5IOPB 4UI2A 1CK0L 1B0IA 3LVEA 3ARGA 5IFHL 3CUPA 4LGPB 1NAML 4P3CH 4K5LA 2BOBA 3V4VB 4HBCH 4NJAH 3V4PB 1NEZA 3HG1D 4D9QD 1S6NA 5LHDA 4RAUA 1RUML 3UPCA 1SJVA 4MMXC 1DBKL 4RSVA 3TH2T 2ED8A 4FFYA 2WANA 4OZHE 5EF0A 1OCRB 1B4JL 1QABA 3NRPA 5JQHC 2UUDH 4ABUA 3L81A 4JDEB 5JNYB 1OHQA 2R39A 3BCFA 4JPQA 1V3LA 1X7QB 1EGJL 1MCPL 1QR1A 5G5DB 3TJPA 1GYUA 2DH3A 2W0FA 4EI6A 5LXGH 5T1DH 2YGPA 3D0AA 1MEXH 5I1EL 4U7SA 4YIQB 1CLZL 2Z3FA 5E9AA 4RQQB 3OKNB 3V6ZA 1U8JB 3HE7D 4LPYA 3FW6A 1HEZA 4B0MB 4ENED 3L3OB 5F7HA 2WIIB 1W8NA 2CDFB 4PY8I 4K23H 5HJBA 5D4HA 3NCJH 1OLLA 3EGDB 3LKPB 5FCUH 4WI8A 1ZPUA 3ZL2A 1YUKB 4N9GB 3GUTA 3KPQB 4QYAA 2YLKA 2B3RA 3O4LB 2A5UA 4PRBA 3PJSB 5J7CC 2YGNA 1U93A 4UTBA 4M62H 1E28A 3VTMA 5DHXB 4NM4L 4N2HA 1AJ7H 4NUMA 5EO0A 4PJGA 2E75C 5DEJA 1FFNB 3WDJA 1NFDE 4PD4J 1HNGA 4P5RA 4JM2B 2H2SC 5HVHC 4N6QA 1GC1C 4KHTH 2QKIC 1FH5H 1E43A 1JWSB 5DRXB 4MAYD 3DHMA 1NCWL 4H1LH 4UV4H 3VFUB 1ZV5A 1HQRA 3UTSA 1OKEA 4GKZB 3ZGHA 1DCLA