3X1FA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1fA00
3G5WA 2BP8A 2JKWA 3FU9A 1X9UA 3KW8A 1JVOA 1DYZA 1ZDQA 3JTBA 2BZ7A 3QJSB 3ZX1A 4A66A 4L0PB 1SNRA 4DPCX 1NTDA 3SBRA 1GY2A 1NIAA 3S8GB 2X88A 2VW4A 4HIPA 4YVNA 1IUZA 2VW7A 4M4RB 1GYCA 1J9SA 3V9EA 3X1BA 2YAPA 5TK2A 3AG4B 1TKWA 3NP4A 3EH4B 1WAEA 1V54B 3FSAA 1URIA 3IN0A 2OJ1A 1ASOA 5B1JC 1V55B 2IDSA 3BQVA 4HHGA 3WIAA 3SBQA 2EINB 4G7RB 3OD3A 3NJIA 2HZHA 1QHQA 3TU6A 4UF7C 3ABLB 4BXVA 4DPBX 3T6ZA 3H4HA 1CC3A 2IWEA 2PP8A 2VSMB 4KNTA 1BEXA 4DP4X 3MBWB 2YAMA 1L9QA 1F56A 2QDVA 3CZUB 3V9CA 1HAWA 4DP8X 1CYXA 1KDJA 2GIMA 5D4IA 3DIVA 1L9TA 3ERXA 3L45A 1OE3A 5B1AB 7PAZA 1E5ZA 1X9RA 3CVDA 1PNDA 3FS9A 2W88A 5E9NA 1NPNA 1SHWA 2UX7A 2UXGA 3CDZB 5I6LA 3WNJA 2XX1A 4E9RA 3ASOB 1N68A 1R1CA 4HAKA 1RZQA 2GC4C 1AQ8A 1EHKB 1NIFA 4E9WA 4P5RA 1GR7A 3IN2A 2B08A 3T6WA 5AKRA 4DP1X 1JZJA 1PF3A 1MG3C 3NSYA 5B7EA 1PLAA 2VW6A 2ZONA 5AFAA 2CBPA 3UAAA 2JFCA 3ZDWA 2I7SA 1E5YA 1NINA 3BVDB 3S3CB 3NP3A 4E9XA 3NJNA 3T71A 1ASQA 1NIBA 2BO0A 2W8CA 2IH8A 4NERA 2BW5A 1M56B 1M9WA 4P5SA 2YAHA 5I26A 5I6PA 2EILB 2GB2A 1NWPA 3WKPA 5I6MA 2X87A 2LLNA 2H47C 3AG3B 2BWDA 2Q9OA 3TBBA 2I85A 3FQ1A 4YSUA 2OCCB 3NYKA 2RACA 3CVCA 4G7QB 2FWLB 8PAZA 1NIEA 2FT7A 2BP0A 3NJFA 3NSCA 2XXFA 1AANA 1BXAA 1MZZA 4AKPA 2PPEA 2IH9A 2PCFA 5EHFA 4PCYA 5A7EA 1SF5A 2FNWA 4YVUA 3FPXA 4ZK8A 1L9PA 1ZV2A 2CAKA 4W9ZA 2BW4A 2HX9A 2B3IA 1JZHA 2UXVA 4G71B 4GYBA 1N70A 3UACA 3MX0B 1J9QA 3AG1B 4YSSA 3FSWA 1IBZA 3N55A 4KO9A 3KW7A 3T6VA 3NSFA 4AX3A 1AZRA 3HEIB 2Y1AA 1QNIA 3CG8A 3TASA 1OF0A 2HX8A 1M57B 1PNCA 4WKXA 2R7EA 2PPCA 1BQKA 1OCZB 3DKHA 4DP6X 4A2DA 1JZGA 2EIJB 3WKQA 2IDTA 2HRHA 1JXDA 3AZUA 1RKRA 4FA7B 2XX0A 4HALA 5IY5B 1AR1B 4BWWA 4E9YA 2QPDB 4GXFA 1TU2A 5I5IA 1ET7A 4JHUA 2AZUA 5PCYA 1YLBB 2BWIA 3ABMB 3OMAB 1ZIAA 1E67A 1KCBA 4UAHA 2IDFA 5I5MA 5ANHA 2XV0A 3FU7A 1JZEA 2FT8A 1IC0A 1CYWA 2UX6A 1OE2A 1GS6X 1JZIA 3QJVB 2ZOOA 4BXSV 4CSPA 2TSBA 3NJHA 4KOCA 1BAWA 3GXUB 1WA1X 3UABA 1A4CA 3EF4A 3ZBMA 1SF3A 4G7SB 4DP7X 3X1EA 2MRYA 3PAUA 9PCYA 2JXMA 1A65A 1PLCA 2UXTA 1XMEB 1EZLA 3ZIYA 1OCCB 3WNIA 1KCWA 2AZAA 3QJTB 1AZCA 1V10A 4YSAA 3SQRA 2QDWA 1PY0A 1W6LA 2VM4A 3ABGA 3S3DB 2J57A 4PAZA 2DYRB 4AKQA 4G72B 1OOWA 2FQGA 1KDIA 4HZ1A 2YQBA 1NDTA 4A2FA 2XV3A 5B1KA 5B7FA 2MTAA 1CUOA 2IWFA 2Q5BA 3JT2A 1A3ZA 1A4BA 1AZNA 3S3BB 2J55A 6PCYA 3S8FB 2GSMB 1PLBA 2J56A 2QPEB 1JVLA 3IEAA 2AANA 1TEGA 4Q89A 4EF3A 1GS8A 1B3IA 2DY2A 4BDVA 4YL4A 2WO3B 1MDAA 1ET8A 2PPFA 2PCYA 1OV8A 1PZBA 3IE9A 3NSDA 2YAOA 1L9SA 3C75A 1E30A 1WA0X 4AZUA 3UGEA 2N0MA 3WG7B 1AZBA 1KBWA 2XYBA 1BXVA 1IBYA 1AACA 1NPJA 2ZXWB 3NJLA 1A8ZA 1ZPUA 2PP9A 1AOZA 2AFNA 1BXUA 3CDZA 1XB3A 2BP8B 2XWZA 1BYPA 1GS7A 5LDUA 2VN3A 1JERA 2DV6A 1SJMA 1DZ0A 3EHBB 2YXVA 4BWUA 3PLYA 1VLXA 1L9RA 3HB3B 2DWTA 3FT0A 3X1NA 5B7MA 2FT6A 1JOIA 3RYMA 1J5DA 1W8EA 1BYOA 1ZIBA 2IDUA 4KOBA 2HXAA 4A68A 2YAEA 2VMJA 2A3TA 2PPDA 3ABKB 1ZDSA 4KNSA 3AG2B 1SDDA 4W1TA 3CVBA 4HCFA 4DP5X 3GDCA 3OMNB 4HCGA 5TK4A 1GW0A 3X1GA 3QPKA 4YSCA 2I7OA 4ENZA 3FPYA 3PPSA 3QJUB 4FAAB 4BK5C 2GHZA 1PAZA 2HX7A 3NJGA 2CALA 1J5CA 4M3HA 5F7AA 2P80A 2H5UA 2YARA 2YAFA 4GP8B 1OCRB 5D4HA 3GYRA 4QLWA 4GP5B 2HRGA 1GSKA 2HLEB 2FQDA 3TA4D 1GY1A 1A4AA 1NIDA 7PCYA 4DPAX 4E9QA 1AAJA 2FJSA 4YSDA 1ILSA 4DP9X 1KV7A 3WI9A 2IDQA 1TEFA 1T5KA 3AY2A 5B1JA 4YSRA 4A67A 2PPAA 4HHWA 4NB7A 4BWTA 2PLTA 2XXGA 1XB6A 4MFHA 2NRDA 2CCWA 1ET5A 2BZCA 1ETJA 2ZWNA 3ASNB 3H56A 1PZCA 5I5JA 1MZYA 4Q8BA 2PP7A 3X2QB 2FQFA 4E9VA 3T6XA 3TBCA 2TSAA 4F2EA 1OE1A 1KBVA 5PAZA 4BDVB 1JXFA 1RZPA 3PXLA 1NICA 1NZRA 3UADA 3PCYA 3QJQB 4YSOA 4F2FA 1JZFA 2XLLA 1WS7A 1CURA 2EIMB 1AZUA 3IBOA 5I6KA 4A2GA 2QT6A 3NT0A 4KO5A 4JKNA 4TXVB 4G70B 2IWKA 5FC9A 3H4FA 4GP4B 2XV2A 2BP0B 1FA4A 2CJ3A 1IKOP 3EH5B 1FWXA 1I53A 4KO7A 4YSTA 1AS6A 2YXWA 1SFHA 2XU9A 3DTUB 3FSZA 4KO6A 1MG2C 1SHXA 3UAEA 2Y69B 1HFUA 2WO2B 2FQEA 2EIKB 1BQ5A 1PZAA 4X4KA 2OV0A 3NJKA 5AZUA 1AG6A 3SBPA 2J5WA 4UANA 2VSKB 1ILUA 2YAQA 2DYSB 3OMIB 5I28A 1AIZA 1AS8A 1BQRA 3PAZA 2VM3A 6PAZA 1E65A 3N2JA 4KNUA 3FYIB 1AS7A 1J9RA 1QLEB 2DWSA 4N4YB 3PAVA 2R7EB 1SDDB 3EH3B 1RCYA 1PMYA 5I6OA 4AKOA 1FFTB 4A2HA 1KGYE 4HCIA 3NJJA 3X1FA 3OQRA 4DP2X 1HAUA 2FTAA 1ID2A 3D12B 1W6WA 3QQXA 1WS8A 2CUAA 2GI0A 5B1BB 3FYEB 5F7BA 3OM3B 4WTQA 4A2EA 3U25A 4E9SA 3AW5A 1ADWA 4CSZA 2XUWA 3FU8A 1XB8A 4GY4A 4F7KA 3FQYA 3FU7B 4YSPA 3FSVA 3T9WA 2WSDA 4N8UA 2UXFA 1OCOB 1PCSA 4E9TA 5I6NA 2GBAA 2XVBA 4AI7A 1UATA 4DP0X 1KYAA 1L9OA 1JXGA 2IAAC 1WA2X 2BHFA 5D4JA 3FQ2A 5B3SB 4RH4A 2E86A 4K9JA 4YSQA 3NJMA 1NWOA 2GC7C 4QKTA 1SFDA 3QJRB 2P80D 4NAJA 4YSEA 2H3XC 1AG0A 1ASPA 2AVFA 1J9TA 4JHVA
chains in the Genus database with same CATH superfamily
4L3CB 1GGIH 2JKWA 3I50H 2JWYA 1IM9A 4GKOA 3SDXA 2QGDA 4JY5H 4F7PA 3QHZL 3QFJB 5BV7B 2ILLA 2J72A 5MEOB 1Z9MA 2ISDA 3X13A 1S6NA 1HSAA 4CILA 4MJ6A 1RJZB 1CXLA 4XNYL 3EHBC 4QHUA 2AK1H 4GT7A 5IVXA 4A2LA 3VYOA 1S7XA 1ZY9A 3RWCB 4F7EB 3MRFA 3OGCB 5SWQB 1V5JA 2EEAA 2Z65C 3K6NA 2NTFB 2P48B 3DV6A 3MLTA 3RGVB 3UP6A 2NUPB 5AOZA 5KS9A 3WFHA 4HIJB 1Y6KR 3TVMD 4PM1A 4ZG1A 3MNZB 5IQ9B 4E5XA 2OJ1A 1ND0A 1ASOA 1TVBB 3VX0A 3DO4A 3FW6A 4B7IA 5DTFB 1M6UA 35C8H 2HRLA 5CN1A 4QYOA 1XBDA 3QUXB 5C0DA 4DZ8B 3P1VA 1E28B 5IV2B 3P73A 2YMOA 3R7QA 4O4YL 2X0UA 4GAGH 4LARH 1KLGB 2E27L 4KXDA 4PJ7F 1CS6A 2PP8A 5AW3B 1RULL 3NIGB 1N0XH 1DE4B 1PKQE 2YD0A 3ULVD 1C5CL 1A6ZB 5E2UL 3AT9A 3B2UD 5DXWA 3PWPB 3V9CA 5HHPB 4O2CA 2ZCKL 5D9SA 5ICYB 2J8OA 4KJPD 4KITB 1KJ2L 4RWYH 1O6VA 4JJ5B 5DVMA 3D30A 4NHCH 3FKUS 4NNXA 3C9NA 1WHPA 1OT1A 4XPFH 1F3JA 4JDZB 1M6OA 5E9NA 1CE1L 5KVDL 3TV3L 5AUMB 2WN2A 3DO7B 4UQ2B 4JM2D 1I3UA 3R1GH 4LSSL 4I9WD 1UT2A 2OR9H 5DURB 1FO0A 5AD0A 1OGAB 5L8JB 1KGWA 4EI5A 1GMEA 3G6JA 2RA1A 2QFRA 2AQNA 2XWBA 4O2FA 3V0AC 2F7QA 1E5CA 3GSQB 1E5YA 1NINA 3ZYOA 4AXWB 1SGKA 4ELMA 1JRHI 5KSBF 3G5VA 5ICZB 2CBQA 2AXHA 4LCYB 1GC1H 2YQ2A 4ELDA 3V4VB 3RL2B 3C2AL 3CN2A 4NKIH 4K15A 4OQTA 4YXLL 5HHNB 4X6FB 3UX9B 3US1A 4KDVA 2X87A 2VWEE 2M26A 4PY7B 1ZLUK 4KROD 2K6YA 5BOPA 4IW4C 4PW9A 1VF5C 4FNRA 1HEHC 1BVNP 4G7QB 4KWUA 2IXQA 4GXVL 5DHYB 4FKHA 3T3ME 3BP6B 2WXGA 4AG4H 4S11A 4GSDL 3S88H 5J3HC 5HYEA 2ZWYA 4NN5B 4P4KA 1INEH 3DVGA 3P4OA 5EHFA 4Z7VE 5FYJD 1P5UB 3PP3K 3DNKA 1TYJA 5INCA 3SDAD 3WENA 4AQ8C 4BA8A 3ULAB 1I1AC 3TF7C 1BMWA 1QA9A 4H8VA 4G7YH 3GMMA 3ATAA 1JD9A 1NUDA 1RLWA 4Y4KA 3BKMH 4IOFD 3VI3A 3GSUA 2UUDK 4XR8C 3ARDA 3B6SB 4RMQA 3N1PC 1AZRA 2O6CA 4MNHB 4J3VA 2XYCA 3GMQA 2Y1AA 3O0RL 1UYWL 3G6DH 2PWFA 3ZQWA 5T8IA 2A9DA 2ZX5A 4D94A 3CHRA 1ETB1 1WAPA 3JWOL 4R96A 5BOJA 5IKCA 1EDYA 1AFVH 1B6UA 2W59A 3BRFA 4J28A 2GK0A 1RP9A 1XR9A 1EUTA 2HFEA 5GRXG 3GIVA 1KCSH 3QG6B 3SYAA 1EAOA 1T1WA 3BJLA 1GGTA 3LZOA 3ECBB 3U7AA 4OFPA 2NZ1A 5GGQL 4A7QA 1JHKH 4H1LH 1ET7A 3F2LA 5PCYA 1KCKA 1BF2A 3BGFC 1KXQE 4TUOA 4CJ0A 3QFDB 1JV5A 3HFFA 5I8KH 1DVFB 3EGSA 2WQXA 3ZXAC 3F7KA 3A5VA 4KK5D 2KBGA 3TJEL 1CYWA 4YHLH 2O6EA 4ILDA 4QXTA 3HNTH 4XN5A 4XHQA 4L1BA 4B97A 2J6EH 4JRXD 5FIEA 4NUJB 1L9MA 1XV8A 4M8VA 3D7PA 1H8NA 3JYBA 4YO0B 5CJ5A 3D06A 4X9FA 1JTPA 3EH1A 1CLOH 3FTWA 1DQJA 3DYOA 4S1DD 5CO1A 3CVHB 3ZBMA 4G7SB 1SHMA 2MRYA 1JYNA 3PAUA 3OLIA 5ILTL 3LB6D 1TZIB 3OVUB 5J1SC 4YS4A 1H3WM 3OR6B 2EE9A 1KCWA 2AZAA 1LILA 3QJTB 4N25A 2C4FU 2QDWA 5CGYC 2UVEA 1CK0L 3QPQC 1WAAF 1CFTA 2FEDC 3ESUF 1KBBA 3LPFA 2P8PB 1QNZL 1X7QA 2J71A 3OG6B 3FUJA 4BJLA 3OXRB 5AOKA 4JNXA 4U1GB 1BD2E 1YY9D 2FO4B 4LMQE 3IGKA 2IH3B 3U7YH 5IW3A 3RDJA 1DUZB 5IJKA 1R9FA 4PJDA 2HAZA 3MLWL 1BZ9B 4HYTB 3O11A 3VE0B 1VPOL 2R0KL 3S8FB 3SYQA 4WJ5B 4KTDL 4OB5H 3GMOB 1CD1A 3KMDA 1DCEA 4YUEL 3ASWA 5AVXB 4EI6B 3QRGH 1WBZA 4WW2F 4OZHB 3U79A 3DROA 5J13C 3CFQA 3L1OH 2MPVA 3V4PL 1H15A 4TTDD 2PCYA 3UG5A 4ZX5A 4WAFA 5INDA 2HPTA 5K1VA 4PRIA 4NN7B 5CM1A 1QWUA 1BBJA 3MBWA 2WXKA 5EUOA 2N0MA 1FL6B 4U3SA 4Z6AT 5D2LE 4NC1C 4FQQB 1A6VL 1AZBA 2RBLA 4X5XA 3DX1A 4WFEE 4HMDA 4NKOB 3K71A 3U82B 3HE6C 4KXCA 2K9FB 3G5YB 1UH2A 4ZFOA 1MHCB 5EU6E 4OLWH 4N5EC 3DBXB 4HS8L 1ZT7A 1S78D 2P24B 3K1DA 3KYKL 3QWQB 4Y1AD 5F9OL 4G8IB 4OD3H 5E51A 1BX2A 4W9JC 2DAVA 4FQXA 5JQ6L 3UTPE 4EDWL 3TV8A 5J0BA 5KVGL 2Q3AA 3QNFA 1IX2A 1VLXA 3GI9L 4MD4A 5DMIL 4AYFA 2OX5B 2NX5B 5CKAA 4P2RD 4LQFL 4LLUB 1HNFA 3BWUF 3QSKB 5HGBB 3A3YB 3KLSA 4FMKA 1NDGB 4WW1A 4F15B 1X4ZA 4CC0A 3H0TB 3WD5L 3MUUA 2XA8L 1W16A 4JGMA 4AIXA 1T7VA 4NP4L 2EH8L 3NRFA 3VSUA 4EQ3A 1DQQB 4DP5X 4O5LL 4FKEA 4OV5A 1U2HA 1T04B 1UA3A 2CO1A 3BYTA 4ONOA 1DJZA 1OZTG 5DUMH 4Y1TA 2CDEA 4FC3E 4PJHA 1EJOL 2Z7ZA 2Z92B 5ADOH 5J11C 3AREB 4MAYC 2B4CL 3PV6A 1CR9L 3C5JA 4N1CA 3RFRA 4P57A 2N1TE 1LD9B 4UZUA 2HG0A 2VH5L 3DSNB 4KMTL 2IALA 2P80A 1DQIA 5DSCB 2O5ZL 3BLBA 4PJ8A 4JRYD 4TNWF 1E4XH 4L18A 3VXME 3QQ4A 4BH7B 4ODHL 4S0SD 3KLLA 1OO2A 4P2AA 4H8QA 4QLWA 3MNDA 4N8VB 1KB5A 3F5WB 1OZUA 1RMFL 1HE7A 3SO5A 1WCBB 1NCAH 1WZ1L 5GRZA 4Z7NE 1X7TA 3MRBB 5HVHC 3BAXA 3P9MB 1Y18A 2FJSA 2A4EA 3JTTB 1GZQB 3HC4H 5BRZB 3RWIA 1MVYA 2D73A 3AS3A 4YFLI 3SDYL 3ETTA 3IFLL 4G82A 3UOAB 1T5KA 2WY3B 2I5YL 1D7FA 2IAMD 1JDAA 2KI6A 5HPMB 2QPSA 1QABA 1MRDL 4KHTH 4X5PA 4P2QD 1IQWL 4FFYA 4E9VA 2G5BB 2EIDA 1PJ9A 1IGIL 4J12A 1O7VA 2PO6A 2TSAA 1YO4A 1M7UA 2IGFH 2ZWSA 3VU2A 1SDAB 2VRKA 4YLBA 1RZPA 2AGJL 1MFEH 2X4UA 1SUJA 2Z93B 4OCXH 4NKMB 4HQQL 3HN8A 3FRUA 4RFOL 1DQML 1SOKA 2ZYSA 3HKFA 4PRAA 4Y4FA 4V2BA 3II2A 4Y9BA 2WYIA 4B96A 4LEOA 4OCWH 4UMGA 5TQ2H 5FC9A 2OL3L 3NJVA 5I8OL 3ULVC 3BH8A 3H4FA 4GP4B 4HSAC 1AJ7H 4HWUA 4XMVA 3C6EA 1JK9B 7CGTA 1TZOA 5CMAA 3B2UC 4OJAA 4AQEA 2XG4B 4HEPA 4XOEA 1QTSA 1E40A 3ARUA 4FQIL 4Q9BA 4KJPC 3IGUA 3K6FA 5EN2A 3FSZA 4PJAF 1SHXA 2BP3A 1PZ3A 5IROA 3KG5A 3NN8A 4NZUL 4AJWA 2COQA 2BSCA 4L8CA 1DN2A 5IHUH 1T1ZB 5I66A 4JM2C 1G7LB 1AO7A 4RQQB 3FNKA 3Q43A 3X14B 4EXPX 3MRQB 5I1AB 2RHEA 4Z7OE 1YEHL 1CGWA 5HSFA 4Z0BL 3C09B 1DFXA 4DOHE 3ZE1E 1IAIM 2DD8H 5A7BA 3C5ZD 3SKOB 1XQ4A 2Z8SA 3SZKC 4MA8L 4P23A 3ZR6A 1IGJB 5IOPB 3LH9A 2R7EB 3PAVA 5B8CC 4TUKH 4ZT1A 1RK7A 4YNYB 5JDSB 5JW3L 1TVHA 2PXYB 4NHUA 4RBPH 1L5GB 4JPVH 2GFBA 1XGTB 1ZCRA 2JH2A 2WCGA 4OW6A 1DBJH 1ID2A 3JWNH 3SGEI 4BGLA 1I8KB 4E41B 2QVIA 2ATKA 5DVPA 3WNMA 2ALWA 3RPKA 1A7NL 4W6XB 1UQSB 3EG9B 1ZLWK 3PDDA 1A4JA 3FQWA 3M8OL 3MRPA 1QO3B 5I1JH 3JWDL 2X7LA 5EC2A 4MB5A 1I9JL 2ITDB 4X0NA 2YPLA 2K8QA 4GY4A 4HZLA 1IVLA 3ZLQC 4R0LA 2JJUA 1S8DA 3FTXA 4G8FB 4LGRB 5ALCH 3RPBA 4IKKA 5MEQA 1F86A 1MCIA 2DLEA 1S9YB 3SDAC 2V2XB 3EADA 2XN1A 1H3PL 5IVXE 2PYFA 3Q48A 3NEXA 2WXOA 2OFQA 5J06A 2NQ3A 5GZOA 3CXDL 4D8PA 4IJTA 4K3DL 4IBYA 5KS9E 4IOFC 1HC1A 2YO3A 1MY7A 2X2YA 2XTSA 4Y2OA 1OQOA 5J7CC 4R7NB 4X5QA 2FATH 3LCYA 2OTUA 1UUNA 1AP2B 1S5HB 3KW8A 2P42B 3QWOA 2WOYA 2X38A 4I77L 3MV7E 3REVA 3V0FA 3A4DA 3QO0B 2HT2D 3B3IB 4XNZC 3GLEA 2APVA 1NLDH 4WSGA 4WWKD 3MRIA 3OAUL 4UINL 4F8PA 1GYAA 1BEYH 4NO0A 4XGZB 5JUEL 2ZP0T 2FVNA 1IUZA 1PZDA 1I31A 2CO6B 2QHRL 3MXWH 4MDJA 5D7IF 5JORB 2XKSA 3ZN6A 1IC5L 3NH7L 2VNCA 3FT2B 1EEQA 4IIQA 3K3QA 3ZZ1A 4Z7QF 2YAPA 4L8BA 3L9RA 4KRPD 1E43A 4NLAA 3EH4B 2R1WA 1R3HB 4OIAA 4QRPE 2DTMH 4UT6H 4HJEA 1CT8A 2V5MA 4OLXH 3L7EB 5I1GL 2AQ1A 2BS71 4P9MH 2F74B 2RH0A 2WBJD 3SQOL 3DIFA 4WFGE 5H2BA 1EXUB 2LU4A 5GGSB 1ZHNB 2ZPKH 4MX7A 4XNMA 4DPBX 3LQMA 3IWVA 1OAXL 1X5AA 1DJYA 5DZJA 4QRFA 1DLFL 3B7SA 1UADC 2VLLB 5LN8A 1G9MC 4DP4X 4HWBH 3QI9C 1OK0A 2Q3ZA 3QJHA 4Y89A 4JVPA 1BLNB 5ICXA 4S1DC 1CYXA 1N2RA 2Z1PA 4ELME 1UXSB 1T3FB 3QXDB 3OKMA 1JP5A 4JDVA 1KPUB 5D5MA 1SEBB 4FZEH 4WO4D 4B6ZA 3K72A 3KCPA 3LB6C 3TP4A 2O26U 5E1AB 1X9RA 3LHPH 3KL5A 1UOVA 4L37A 3VTTA 2R59A 4F91B 2OMNA 5T1KD 4HP5A 3WNJA 2OQJB 3CDCA 3T0ED 3ASOB 4E9RA 1HOCA 3BKJH 3UTTA 1AQ8A 4PR5A 2ZJSL 1Q1JL 4LPWA 2YMXL 4P5RA 3CH1B 2ESVE 3RWFA 1YY9C 1DBMH 4LVEA 3APDA 3K81A 2NSXA 1UFGA 4XNYH 3JUZA 2JFCA 4YZFF 2I7SA 4XPHL 3SDCD 3WS3A 5EOCJ 3QZWA 5KVEE 1L0XA 1OSPL 2DOCA 3MRKA 3UBXA 2IH8A 1HDMB 5EDSA 3MMEB 4MGXA 3ZE0B 1HHHB 4P2CG 3U9PL 5IQNA 3GF8A 1FYTD 1J12A 1OT2A 4N2HA 3UAFA 3L3KB 3TO2B 1WISA 3B9KB 4TTDC 3UAJD 2BWDA 3IFPA 3TBBA 4YHZL 3NYKA 3CVCA 4Y4HA 4F58L 3MFGB 4PJIB 3V4LA 4NO2A 4O4YH 1M71A 3WJJC 5AAWA 2FSEB 5JHBA 1DN0A 2FH8A 1J0YA 3ARBD 3AABA 3L1GA 4NYLA 1RK1A 1S9XB 1TPXC 2PCFA 5M94B 5IT2L 4I88A 4ZUWA 1IKNA 2ZCKH 3QZMA 4FTVD 1M7DB 2K8MA 1S78C 1OHZA 3CQFA 4M48L 5JNYB 1E6OH 4HLZH 1OP5K 1JBJA 1MI5A 3PNWB 1KBGL 2BOBB 5IK3A 3TV3H 3UZVA 4XVJL 5CEZH 3WS6A 3GUTB 1J88A 1UB6A 4WKZB 2W07A 3LD8C 4XCFL 4JO1L 1VKXA 3DGGA 4FHBD 4UWQB 3V0WL 4UTBH 1IC1A 4X6CA 3BAYA 1IC4L 1EVUA 2YRLA 3UJTH 5GGTA 1ADQL 4W9IC 1AHMA 4PBVC 2JJSC 2AJ3A 4K94L 4XO3A 3LKQA 2R69A 1Q9WA 5HJBA 4HXBL 1KB3A 4XP5L 3HPLB 3UEZA 2A9ML 1JYWA 3LRMA 1BBDH 5FX3A 3RY6A 4XWOD 2EACA 1IT9L 3KLDA 3U36B 5HYSB 4JHUA 4YXLH 2CIIA 1ANUA 4FNLL 4Z5RA 1E2WA 1S9WA 5AB0A 5CBAA 1S7RA 2VLRB 3CXFA 5LB1A 1FZOA 1H3VA 2VXQA 3NIGF 1YRKA 1I7RB 5AVQB 5EZOH 4CMMA 1VEOA 2VN4A 1P4LA 3RURA 4N3UA 2EZ0C 4XCCH 2H9GB 4GSDH 1AR1D 4PRDA 1W8OA 4N20A 3MNWA 2AK4A 4Z18A 4ALAC 5EBMB 5D7JD 4H7VA 1DDHA 4KOCA 3KBPA 2F7OA 3B7TA 4PJDE 1G1KA 1IBBA 2OZ4L 3T2NH 4IBQA 5FO9A 5HDBE 5HHOD 1Y1DA 4JG1L 3F8UB 4HUMB 1T21A 4LSUL 2JVUA 3GZKA 4OZFH 1PKQB 2MNWA 2LOEA 4IGBD 5HTSA 3P3YA 3ZIYA 1OLLA 1DUYA 1TJGL 2BNUB 4ODTL 1JZ3A 3TBVB 4YSAA 3RNQA 3MJ7A 1IM3A 1W6LA 3IRCA 3EDEA 3LN9A 3O0RH 1MCWM 3BPCA 4PWEA 5DLMH 2EDRA 1AD0B 4G72B 2ZNWA 3MJ6A 5DJDB 5FLVA 4BHUI 2KDYA 2WAHA 4JFZL 6FABH 1HQRA 4KVCL 3JWOH 4H5SA 1YJDC 4XN8A 3PDGA 5EUOE 5I8EB 1H5BA 1CUOA 1AZNA 2IOIA 3MRNA 3QZBA 1ZVSA 5G5DA 1QSED 3D51A 5JHLH 4QRUA 1F11B 2NY0B 5C0CA 4FERA 2F61A 4G8EB 3WFDL 1ODUA 1D9KB 2AANA 2Y3AA 1BMZA 3NPZB 4HH8A 5GGQH 4MMXB 1JFQL 1IAKA 4HF5H 4U6XA 3DC0A 3BZEB 3TBYB 3VYNA 2ADJB 4QTIH 2ZOLA 5JMOC 5CFHA 1XEUA 4LCCA 1A6UL 1I1FB 1HNYA 5KVFL 3Q8EA 4PJ5B 4CVWA 5B3JF 1CICB 4UTAL 1LP9E 2JKXA 3CHPA 4JO4L 3SY6A 4PJXF 5C6WH 1F4YL 4M7KH 3ZRCC 1EJ8A 5ABAA 4H20L 2DJSA 3L5IA 3T3MB 1A1NB 1TT6A 2KPNA 4PWFA 1BXUA 3CDZA 3EJRA 4HC1L 5ILTH 1OY3B 3L5WA 2YRPA 2ED6A 2AV7A 4F8LA 1JGIA 1GIGH 4YDLC 5CGMA 3D4CA 1BFVL 1R5WA 3KCWA 3C5ZC 3EHBB 4XVUD 4PJHE 1NMBL 1CK0H 5C09A 5ELIA 2APTA 2FX7L 4ZO7A 5IIEA 3OL2A 3WY4A 1P2CA 3L7FB 3VFVA 5C6PB 1RPKA 5C2UB 3RYMA 1PYWB 2DB8A 3T1WA 1QBML 3RI5F 5DJAB 1S7SA 3FH7A 3GPSA 5E2WH 1Q72L 3P11H 4NPJA 5JPMC 2HTLD 1ZDSA 3BO8A 4DUXA 4F1SA 4D9LL 4WENB 4M1DH 4OM0L 2Y25A 1UXMA 4G43A 1GW0A 2X70B 2KZWA 3DX8B 1D5RA 5T1DH 1PS3A 4YUEH 3A47A 5CUSL 1KYOJ 5KUKA 5AZ2L 3FPYA 1SHSA 4OGYL 1S7QA 5DC0A 3SIKA 1U36A 4XPTH 5ISZA 2GIYA 3KJ6L 3NJGA 4S10A 5DEZA 5JIDA 4V1DB 1D5ZA 3TONA 1DQDL 2H5UA 2JB6A 2JIXD 1XH1A 3G08B 3WEXB 5FW8A 1JRHL 5DMKA 3K8MA 1E3FA 1ML0A 1QPPA 3BEVB 4RGMC 5D1ZD 1R5IB 2FQDA 4ZNEE 1A4AA 2D7NA 4PGCB 4DN3L 5CJBA 1U93A 3CHSA 1YYML 1GZPA 1WZMA 3BIKA 1OPGH 1GCYA 1XEDA 2HT2C 4K23H 4XBMA 4L4VE 2JK5A 4OLUL 4ZS7L 5TE4L 4WWKC 1UGNA 3MRCB 5I0DA 2OMZA 5FUCC 2ICWB 3HMXA 3MLZL 1MCWW 1NCWL 4A67A 5JQ6H 5DJ6B 4AVKA 4EDWH 1MFCL 1BM3L 2PW1B 4PWIA 2CCWA 3S4SB 1SN2A 1EA9C 3RUGA 4D3CL 3FU0A 5J6SA 5A2CA 3F3HA 2FEJA 3D18B 3PWUB 3MRLA 4KRPC 1V7MH 2EDWA 1DBBL 2XVLA 1QFPA 3GLZA 3J27A 5EO1B 4O2EB 2ADGB 4HD9A 1KBKA 3WD5H 2X0VA 3HE7A 4BZ1A 4ELKA 4ZAKD 3D39B 2XXCB 3IGFA 3O8XD 2EH8H 2GTZB 4TVPL 4TUJA 4WGVB 1BD2B 2X0WA 3T4AA 4J5VA 2XACC 2XLLA 4JFEA 2YOAA 4O5LH 4LRNL 4OZHF 3CQQA 4QHNB 5DZ9A 2IOOA 3GRBA 3VRLE 1AO7E 2GUYA 5F7EH 5SV3A 4A2GA 3DRTA 3AU1B 1FLRH 4TQHA 4K71C 4XCYA 4G9FA 5FYLL 3HRPA 4RA3A 2EKSA 3WUWA 3WDJA 4K5OA 2WLZA 1QHPA 4P5TA 5EU4A 1P4BH 1N26A 1DBAH 4XP9H 3U48A 3H85A 5DRZA 1YEDB 2VXTL 1FWXA 3U4BL 2RCSL 4N0FA 5AKVA 4KMTH 3B2XA 1CWVA 1Y6MR 3D4ZA 2O5ZH 3E8VA 4KO6A 5C2BH 2AJXL 4GQ9L 3TCLA 2LTQC 5T3ZE 3GSOB 4OQTH 3ZKND 3VG9C 1KCVH 3VA2C 4I4WA 2NY6D 2BNRE 4N9OB 2JKTM 3T0EC 3SHSA 4XNUL 3J07A 4TSBL 4I87A 4TULH 5D2LB 3ZKXC 1NDMA 1J0JA 1UKTA 4JGJA 4LLVA 4OJCA 3N2JA 4R90L 3S4SG 4LCWD 2YPLE 2OZNA 4XP4H 5KG9B 1MAML 4LSRL 3WL9B 1W0WB 1KYOK 2ZSWA 1T0MB 1F58L 2IQAB 3D34A 2JELL 2VLJE 5GIRA 1GC1C 5BZWB 3WLBA 1E50A 1A8JH 1AHWC 3SDCC 3MVSA 5LWYL 1WEJH 3AQZA 1MRDH 2WK2A 5FDWB 4O02L 2V5TA 2B9AA 4DP2X 5LUMA 4RIRB 5ESVA 1KN4H 4U1NA 3HFML 5IEHA 2WLIA 2BMKA 3CLFL 3EFDL 3MLVL 3MUY1 3QHTC 2OA9A 4PW3A 2WXQA 1QUNA 4XHJD 1I4FB 5EOTA 4WI5A 4RMRA 3UAJC 3QXTA 3U25A 2IBZX 5ITBH 3S97C 1DQMH 2X4SB 3NG5A 4DUVA 2XN9A 2FWOA 4WFFD 2DWEA 4JM4L 2WBXA 5E4OA 1A7OL 3L13A 3ARBC 1X3DA 5CIPB 3P2TA 3VI4A 1U2CA 1TO5A 5I8OH 3ATEA 1FG2A 4XB7A 2Z91B 1MREL 4M8UA 4TQEL 3K8KA 1A02N 2WUBH 2WMPB 2O6FA 3KPTA 4NENB 4L5FE 4OJEH 2WSPA 1W72L 3UO8B 2R39A 3QJRB 3O9WB 4NAJA 4OF8A 5IJVB 4PJBF 2FBOJ 3P77B 4PMFA 2XNAA 4YX2L 5IB1A 2YN5A 3EDDA 4FDWA 3FN0L 4ZFQA 3IE4A 4HIHB 4Z7WA 2YC1B 3QARA 3QAQA 5K9JH 2X3CA 1XCQA 2EC9T 2WUCH 4OD2B 3C5SA 5BPPA 5LGJB 4YIQA 3IGAB 4YAQA 3CNKA 5F3BB 4F7CB 3WTXA 4CC4A 5DZLA 1S9VA 4MA8H 2HFGL 5CGTA 3QRBA 3ZHDA 4Z7NB 3ALXA 4ZUUA 4GUQA 4KQ3L 2R23B 1CDJA 4MMYA 3AS1A 1V54B 2F8VA 4W9LC 3VVVA 3RBGA 2XBTA 5D5ME 4XWOC 3WMPA 4Q6IA 5J13B 4ZOBA 4Z9KB 4MS8D 5D93B 2HVKB 3GBNL 4TL4A 1A7NH 3N5AA 4LGPB 4NS0A 3S36H 3ULSA 2UZYA 4GQQA 4ZUVA 3TU6A 4R7DB 2YN3A 1I9JH 1E3ZA 3UTTE 3LX9A 5C08D 3QUML 4XC3H 3SGDI 4ZFGH 1UM4H 1BEXA 3CSYA 1OAUH 4JFXA 1KSRA 3CZUB 5D7JC 3Q01A 3L5HA 3O4LB 4JVUA 4LVOC 5I9QC 3VD2A 4N26A 2OTPA 3PWLB 1GMIA 4P2OD 1N8ZB 4MJIA 4QTHA 4QXUL 8CGTA 1AIFB 4FTDA 4IGBC 1MRFH 1ZLSH 1Q94B 2OCJA 5HVWA 1Z3GH 3LHAA 1SHWA 2OK0H 3GSWB 2R51A 5JLZA 4WI6A 2JI2A 3H1ZA 2CKBL 1QSFA 3O81A 2MHAA 1A64A 4F24A 3EFOA 4E9WA 1NIFA 4M43L 3APNA 3W0WE 5FUOH 4J8QA 4IRSA 5E8EB 2X4QA 2XKUA 3FL7A 4MKMA 4AGPA 1MEXL 2AI0H 1QACA 5FGSA 1HQ4A 1QBBA 5KYYA 2VXVL 3NJNA 1SN5A 4Z7OB 2ZYIA 1ZSDB 3MC0A 3IMWA 4U1KA 4DOHB 1JF1B 2W8CA 1U3HA 2VC2L 1F4XL 4NFBA 3ZE1B 5D2NA 4BH8B 4IDLA 4EIZC 2JJTC 3AC0A 2E9WA 3WKPA 2QTEA 3E3QC 4IOSA 1WZAA 3SJVA 1MI5E 1EERB 5CZXD 3RIKA 5J11B 5HHQB 5DO2D 2Q9OA 5T33H 3FQ1A 1IU1A 2HLAB 4WFED 2NY1D 2EXYD 3VFSA 1M05A 4JHAH 5SX4H 2X1WL 4KI5E 4YHOH 4GW5A 2B3RA 1M7XA 5EU6D 3HZKA 1UJ3B 2PCXA 3HG2A 5I1IL 3CFUA 3I6GA 3PUCA 2XTLA 1KCLA 1OGTA 4K7PX 1D5MA 1DQVA 5HGAB 3I2CL 3FO0L 1KJ2A 1RZGB 4HIEB 1T89A 2UXVA 4S1QL 2YKLH 5D7HA 4KMLB 3UTPD 1CIUA 3GXPA 5D71H 4AV5A 4A1RA 1AI1L 2J5LC 4FZ8L 5CP7B 4XVUC 3RQ3A 5KSVB 2VDNL 2VM9A 4GKNB 5KYXB 4HX1A 2NZ9C 2F19H 1Q1JH 4N1EA 4DO6A 3E7JA 4G6FD 1KF9B 3S3SA 4AZ8A 2F2HA 4BK5A 3MV7B 4IBSA 3FB8A 4UM9D 2ADIB 2AK4E 3HC3L 2HTLC 2P5EA 1H0DA 3FU3A 5C0DB 5IGXL 2O4EA 2CK0L 2WZPA 1ORQA 4BWWA 3VFPB 3O2DA 1OSPH 1A1MA 4YBHA 3EOAB 3GXMA 1UOWA 5EO9A 4JKPH 1I1YB 3EGXB 2DLHA 3VD7A 1AYOA 2OXGA 2FAUA 4OCSL 4UAHA 3FUIA 4B53A 4QRPB 3VFMA 3VXMD 2DQMA 5DUBA 3TZVA 2X2IA 1IC0A 2AEPL 4W9CC 3ZGHA 4F58H 1C08A 1AZVA 1ZTMA 4AENA 3IVKA 4YZWA 4M7LT 4L8DB 4GMTL 3TNNA 3WKYA 1CFSB 1TTRA 3TESA 3W9DB 3H3KA 5E9DE 5EZIL 2IC2A 3ROOA 4NQTA 3L5XH 4JM2B 4X7EC 2OMXA 3H9SA 3N0PB 5C0CE 3VRIB 5DK3A 5IHLB 2QZQA 3GDBA 1BZ8A 3DJSA 5K9OA 4TRPL 3TO4B 1KBGH 5EULV 3W39A 4BD4A 4HZAA 3KYOA 2CR0A 2YKKA 5I1DB 2RQ8A 3DMMB 2MOVA 3MV9D 2X89D 1KDIA 3KH4A 2YQBA 3MQIA 4ZQKB 4A7GA 4A6YL 3NDZE 1UWEL 4E2OA 5B1KA 5CKGA 4L1LA 1JTTA 1AGDB 1CZ8H 4OIFA 3WXVH 3V4UL 3L6FA 2X4NA 2D3VA 1ADQH 3Q8BA 4ZAKC 5A2JH 2WIIB 3O8XC 4LEEA 2C9VA 2I9TA 3GBMH 3ZE0F 2ESVB 4OZGB 4XP5H 4QLRA 4ODSL 3D85D 5IHZB 1L3WA 3VXRE 2ENYA 1HOEA 4HHAB 2Z7WA 4KU1A 5AAMA 3GJEA 4XMWA 2Z8RA 1WK0A 3CWGA 1G9EA 4HBCH 1JPST 3GSRB 3ZOAA 1FFQA 5I19L 3EH2A 3VFWA 1KWGA 1D5XA 1TJXA 3S37L 5EZLB 1I8LC 1AY1H 1I7TA 2XN2A 2YBRB 1CU4H 3ARDB 3GMNB 4U3HA 2NOYA 2ADFL 3DHMA 3H8NA 5ANMB 2CO7B 1U3ZA 3FONB 3ZKNC 5G4MA 2QGBA 4LL1A 5IMLA 3E8UL 2NY6C 2GCYA 4KDTC 4L4TB 3U7WH 5E99L 5EU7C 4XNZB 4CBPA 4Y5XB 1GS7A 3IU4H 4Y2NA 5JXAL 1HHKB 1KTJA 1VGEL 2VDQL 4YHIB 2GK0B 3LTVA 3KPPA 3S34L 4PBDA 2Y6TE 3PLYA 4LSPH 2WXRA 1SJEA 3EOTH 5ISZE 4UV4H 1I8IA 2R29A 3II1A 1NFDF 2NLJA 5FB8B 3EO9H 1MCPL 3B2VH 2DLFH 2EC9U 4HJ0D 3JWNC 3LNEA 1IRAY 1J5DA 2VWEC 1JNHB 4Y5VC 3MRHB 5LN4A 1D6EA 2AXFA 4RVBA 2VE6A 1IM9D 2RTTA 4XHJC 4EN3A 3LKSA 3TEZA 4Y19E 3U4AA 5CR1A 2FJGB 2Y0SA 4DVRL 5JIIA 5I75B 4LIQH 3HLAA 2F54A 5IEKB 3WFDH 3QPKA 1J87A 2DMCA 3EOYG 3VD5A 2EE3A 1Y0LA 1T1XB 1JFQH 1YY8B 2HLFD 1FLTX 2I27N 2XPZA 4I1NB 2G5RA 3QI9B 2HX7A 1MPAL 2R0LL 1R24A 4OFDA 2Y5QA 1K6QH 2HTKD 2AXWA 4XNQB 5EEVA 4L5FH 3RUGE 3WJMB 2XWJB 1ZWIB 1RIVL 1UB5B 4N2AA 1V05A 1M2VB 2VQ1A 3OLEA 4UTAH 5KTEL 4PG9B 2WQVA 3FJTA 3HCVB 5FHAL 3INOA 5F7MC 1F4YH 4Z3IA 4DPAX 2FL5A 4IMKC 1SJHB 5DRNA 4ANVA 3PL6C 3K6SA 2W81C 4M7LL 3W11D 3DOSA 1XCTA 1F4WL 2CBOA 4JFEE 3DHJA 2BP5M 1C5BL 4ZTPH 1OCWL 1CE6B 1UA6H 3QJZA 4RFEB 4Z77A 4WI7A 3B43A 5DD1L 1EX0A 2IDQA 3O2VL 1BFVH 2CGYA 3R4RA 5HDBB 4G9FE 3QWRA 1WGOA 4K5LA 5I73B 2ZOUA 2Y4SA 1QTYT 2B77A 3DURA 3WNLA 1TETL 2E7MA 3CHXA 2EYRA 3EZ8A 5CZRA 4N9GB 3I6LE 2FJFB 4XNXH 4AEIL 1DEEB 3G9AB 1FP5A 3BFWA 3GMRA 1QBMH 4WFGD 3FO9B 5KN5A 3FF7A 2EUZA 2FWSA 4M8RA 1Q72H 1YPZB 3Q44A 3CZEA 4MS8C 2AV1B 3T0WA 2JF1A 3KPOB 2FUQA 4OFYA 5AVTB 4JR9H 4MXWL 1X5IA 3PP4L 4EI5D 5F89B 4F1ZA 5BCAA 4FEIA 3MUZ1 4PV9B 4U1JB 2KERA 3L3OC 3LH8A 5CUSH 7TAAA 1D2OA 4W93A 5T1MB 3T0VA 2BNQA 5D70H 1P1ZB 1I7ZB 3KPQA 4LKCB 2DQFB 3EJJX 3QQNA 1G5GA 4N2IA 4UV7L 3S2CA 5BXFA 3NPSC 3BX7C 4HXAL 1MN4A 4XNDA 1PW3A 4P2OC 1SXAA 5DDHB 2HKFH 3NFNB 2EDDA 3BPOB 1JPSL 1RXLA 2BRQA 3BOVA 2GBTA 5D7SL 3ZIMA 1LQBC 4QRTA 4GRLA 1N7ML 2YAQA 2VYRE 4DN3H 4AYFB 4PLOB 2VDPH 1MRCL 2VLKE 1U8LB 1LP9B 3LD8B 1HX0A 2GKIA 3VFTA 3E2HC 4OLUH 2OMVB 3IDXL 4P4KD 4AYBA 2XN9E 3GNML 1AS7A 2PCPB 1BJ1H 4N28A 2JE8A 3QULA 3OV6A 1IAMA 2VO5A 4MB3A 2EXSA 1MFCH 4L2YA 5I0WA 2I26N 1K8DA 3JV6B 2GTWA 3FT3A 4Y4KD 3NCFB 5L2JA 3DV4A 1AXIB 5DK0A 3ULUD 3BVTA 4N2EA 4KMQA 4UNIA 4HKJB 4AW4A 2IOMA 3ZSTA 1YC8A 3I9GH 1ZE3H 3O3BB 5CZXC 4JFSA 1QKZL 4NI3A 5DUJA 3AB0C 5DO2C 1IZJA 1XSOA 4JFUA 4OJFH 3CFBB 2ITFA 2KZBA 4PJEB 5IFAL 1L6ZA 2YLHA 1NMAL 3EJZD 3CVIL 4QF1B 2NY1C 1TCRB 4Z7WE 5FECA 2QSCH 3FQYA 4NT6A 4GUPB 4OKDA 1IE5A 4DN4L 1NOLA 4JY4B 5L0QC 1KY6A 3IM1A 3E1ZA 1E8ZA 1MW2A 2H32A 5CLTA 5DK2A 3VSVA 4AI7A 1VCBC 3JZYA 1NGZA 2VXTH 4K5MA 2RCSH 2R69H 2ZP8A 1HNGA 3RWIB 2IPUG 1O9ZA 3MRRB 3FQTA 3V0VA 1SFDA 2AJXH 1S3RA 1IBDA 3MROA 1TZHA 4JDTL 2DI8A 2ZUQC 4P0DA 5DHEA 3V52H 2EADA 5C9JA 3BP4B 2RB8A 4X8CA 4J39A 5AL0A 4AC2A 1N67A 3DWTA 1EHLL 2CIKA 4U0RC 3ESNA 3VB8A 1ZDQA 3J2PA 4XNUH 2VXQH 3VFNB 2BFVL 4XXWA 3EJCA 1NGYB 4YDKH 1SXBA 3RVWD 2GAZB 4N8PA 1PSKL 4QT5A 3F7YB 3P30L 1LEKA 3S8GB 4JFVA 3BZFA 2BPBA 5J5EA 4W6WB 2F53B 4LSRH 5HDQH 4L9LA 3FQ4A 3IJYA 1AXSA 1SOSA 4JFDA 3SE8L 4L4VB 3ZYIA 1CGUA 5I16A 1TKWA 2UYLA 4IKLA 4Y5YB 4O02H 4G1EB 1CTNA 3AMKA 1TZGH 2E9BA 4UIMB 4FFZL 4FLQA 4GMSL 4GT0A 4UDUB 5B1JC 4KKZA 3I75B 4JFWA 2EVHA 5AZEL 1LK2A 1AKPA 1A0QH 2CHNA 3GSNL 2C26A 3UTSA 2EIZB 2R2BB 3EDKA 4MA1C 2VIRB 4ECNA 3G3LA 3WMSA 4PV8B 5A2KH 3Q6GH 1F6FB 3KL0A 4DW2H 4BKSC 2CXKA 4UM8A 5FA4A 5ESQA 5F71A 1I9RH 1MHHB 2KC0A 3T4YA 3NCMA 5AG8A 3ZKMC 1MREH 4OVVA 1AO7B 1GJUA 5GHWL 32C2A 4TQEH 4LNVA 1OF2A 5D4IA 1PBYA 1NC2B 1X6NA 3NIDB 5AB1A 1W72H 4RRPM 1U8NA 3BWAA 3FB5B 3FCBA 2FIRT 1PNDA 4OBRA 3L9EA 4IKNA 2UXGA 4YX2H 3K2UL 4PRID 4IOIA 5EBWB 2ICWJ 1X9LA 3PF2A 4TF4A 1TVHB 2DQGL 4ODXB 3RDTC 3SJVE 3ZL4H 5EEYA 2A6IA 2YEQA 3BP7B 4P46A 4CBZA 3FHEA 2VRQA 3NVQA 1TENA 2VJXA 1XGQB 3T6WA 3ES6A 3T2QA 3FQUB 2BNRB 3QG7L 3C6LA 3ZDWA 3BVDB 3D5OF 3DO3A 1A4JB 5LQBL 3KDPB 1LHZA 4H8HA 3GM8A 5F72S 4JFFA 1Q9KA 1KNOB 3KBEA 2M2DA 3LMJL 3UDWA 3NAAH 3NABL 3PHQB 4FQXD 3VD3A 4B9PA 2VLJB 4G8AC 5I1KL 5MENE 1G9NL 3GBNH 3NZHL 4Y0GA 5F9JA 1G7QA 2AABH 3QRLA 1OARH 3Q3GA 2OCCB 3ZYJA 4B9GA 2ED8A 5EUKA 1HZLA 1JPTH 1P9MA 5ADPL 2SEBA 8PAZA 2B59A 4BIKA 2GSGA 3RTQB 3OAYK 3QUMH 4AV0A 1U91A 1QFOA 5CP3A 2ROYA 1R3JA 1KT2A 4JRWA 1NCIA 4W68A 4NRYA 5J6HB 3MUHL 1TDQA 2FX9L 3QWOB 3R19A 4F33B 4ZYKA 4NZDA 3WFBL 1HCZA 1N12A 1TJHL 3SPVA 2BW4A 2P5EE 3NTCH 2B3IA 3IMSA 3B9VA 4WU5B 4ORGA 4ERSL 1KN2L 2WNXA 1PD6A 4NO0B 3V6ZB 4ANXA 2R83A 3I6KA 2ITCB 3V5HA 4XWGL 1ITCA 4PJ8D 1UWGH 2WXMA 4WWNA 1NGXA 5CSZA 5E2TH 3WXWH 1HILB 2C9SA 4FGMA 4HJ0C 1D5BB 4M43H 5I71B 4EBQH 3HG0A 4Z78A 4B0MB 1GVIA 5DYOB 3KWVA 4PBWD 4CVZA 5KSBA 5GRWA 1LDPH 2R1YB 3PGFL 3TX4A 2A83B 4R83A 5E1IA 1U58A 4CRPA 5B39A 2PWDA 4HCRA 2IANB 4ZMVA 2OLDA 1F4XH 1OTTC 2LFEA 3I6SA 4HLJA 3H9SE 4Y2DD 5FO7B 5L8LB 3RZCB 4C59B 4KGJA 4F9LA 1Z5LB 2N7SA 3BIAX 4PTUA 4AT6B 1P7HL 2HLFC 3LPPA 5TF1H 4BEIA 4OZ4B 1A9BA 4J6IA 1Z6JT 4M93C 5ICXB 3ETBF 3FU7A 4GLRI 4EOWL 4HS6B 3LH2H 1TTCA 4IBUA 2CO3A 2HSIA 4FG6D 5C0RH 2HTKC 2PO6D 1IEHA 5EFIB 2WXIA 4EDXB 1DZBA 3Q2WA 5I1LA 1CLVA 2JCCB 2LTQB 5IVOA 3GT6A 1IGYB 2CR3A 2H1LM 1CN4A 3BDBA 3GXUB 2E3VA 1U8CB 4V33A 3SN6N 4AM0A 3I2CH 4Y4FD 3FO0H 3CMOL 4CL7A 2BK8A 1G6RH 3W11C 1XMWA 3U6XS 4S1QH 5BQ7B 2Z31A 4EI0A 4X9IA 3LIZH 3T0XA 5T1LB 5MP6L 3IMBA 4X6DB 4JO3L 4JPIA 4QRAA 2ARJB 4KPHL 4M7ZC 4H26A 1TITA 3CQPA 3TYGL 2AJZB 3CZFB 1O7DE 4YHNA 3D48R 3RNKA 1YEKL 4AITA 2X1OA 4JY6A 5FWRA 2YRZA 1CGYA 1AHWB 4R4FL 4XMTA 3MRKB 1LO5B 4G6JL 4HZ1A 4HBQA 3L5JA 5IROD 4A2FA 1QFHA 4JHBA 5AW8B 2XV3A 5H37H 5DEFB 4MNQA 2VMEA 2CR6A 4TLUA 2P46B 2ZAIA 2XQYA 3HHSB 2NNAB 4N0UB 3PHAA 1H6UA 3HC3H 1CVRA 2Q86B 3HS0C 1KGUA 3L3HA 3JUYA 1I3GL 3W0WB 5AW7B 5IGXH 3L4ZA 2CK0H 2VGLM 1PLBA 3NZUA 4JPWL 4EI5C 3MA9H 4KK6D 5F3HB 5LDSA 1G9HA 4P23D 2H4EA 3ROLB 15C8L 3HNSL 4KV5E 3PJSB 5E8DL 4H13C 4PLKD 1PDKB 3BVNA 3C75A 1MJJB 3RRQA 2VSDA 2BSSA 2V2WA 4HJGB 3ECUA 4LL4A 5EWIL 2AEPH 1JWUA 2CGZA 1Q9LB 1P6WA 3FQNB 4PREA 1F6AA 3SODB 2YPVL 3UL4A 4P07A 3RHWF 3KPRB 5IK3B 2V37A 5IB2A 1MVUB 4FNQA 3V5KB 2OZ4A 1BIIB 2XY2A 1WFOA 4LNRB 2ZCZA 2YPLD 3J7HA 4J4PA 4JPKH 1BREA 4G3YH 5C71A 2BJML 4P4KC 2L8AA 3SOBL 2X5PA 4GKSB 4JO2L 1VIWA 4MWFA 3RWDB 4PHXA 5AW1B 2PYED 4TRPH 4FJYA 2YXVA 5FHBH 5KYUA 3QYNA 1FC2D 1OK8A 2L7EA 3CN0A 3CV5A 5GZOD 2G60H 1GPOL 5CCJA 4Y4KC 1NLBL 4KNQA 3ULUC 4FQCH 3SE9H 3MCKA 5JHDA 4NFCA 3CZJA 4X9GA 3VG0H 4AVHA 1OAKL 1BFOB 3KR3H 3ARRA 3V4UH 4MB4A 3UC0L 4N3TA 1FN4A 4ZXBD 2EUWA 2FR4B 1O7SA 1YNTB 1FZOB 1U33A 3P9WB 2BSRB 2N7BA 3MFFB 5TK4A 2XBZA 3EJZC 2VR7A 1AGBA 4ODSH 2UY6B 4NZ8A 3VXUB 4QGTA 1MF2L 4N22A 1FFPB 4WW2A 3VX1A 4CGTA 1IKFH 4FAAB 2VO8A 3D25A 3WE6A 3L95A 5A40E 4BINA 5KVGE 5I9QB 4JHWL 1D7CA 4XXCC 2K7QA 1NL0L 4NKDB 4L0ZA 2YJLA 3FXIC 3ALWA 2ADFH 4JM2F 2QSVA 3RNQB 1KG0B 4Q9RL 1EFXB 1PGRB 2W92A 2CLRB 3G5ZA 2ZKWA 1FDLL 5EMYA 5TGBA 1XGUB 3VNYA 1J7VR 2QADB 3H2QA 3QPXL 4K3JH 3TFBA 2QQKH 4FA6A 3A6BH 4MJ5A 2Z4QA 3GEFA 1TIUA 1U8PA 4NQEB 3RVWC 1ILSA 1XX9C 4ZTOL 5JXAH 5DC4B 1SYSB 1VGEH 5E9DB 2XG5B 2VR8A 3S34H 1I8AA 2PPAA 3IS1X 3OSVA 4BWTA 2IFFH 1MH5B 5C0CB 3GPEA 1E6JL 3GRWL 5FS5A 3LNGA 4DIXA 3E6FB 3QAZC 1J5OL 5T5FH 1FH5L 1VGKA 1IAKB 4OZGF 1I8MB 2H0FA 3MJ8A 4I7ZC 3I3EA 5BVPH 2OMUA 2BIPA 3A6CH 2O5YL 5E2VL 5CEXB 3UTTD 3UJIH 5ID0A 2MIZA 2YHGA 4QHPA 2C1PB 3ARXA 3O3UN 4MAUH 12E8H 4UZGA 5FCSH 4CC1A 4PIBA 1QLFA 2B39A 4TXVB 1OM3H 1R3LA 2ERJC 1ZHKB 3VVWA 5K69A 3SKNB 4LFHD 4PB0L 4NWUH 1MPAH 4QYAA 1IKOP 4RAUA 5KJRL 1ODAA 2WQUA 3I85A 3K4ZA 3HOGA 3VXRB 4WJG3 4YSTA 1OAQL 3NCEB 3BUBA 1NGWA 5HYJE 2VT0A 3M1BB 4B9YA 4R8WL 1RUQL 2EDJA 5A2IH 3GJFK 4L3EA 1NGPL 5F0JB 1CFVH 3ZDYE 2P4AB 1ILUA 1ZA3B 4Y4HD 1CFQA 5B3NA 3MZTA 4BGDA 2G9HA 1W2KT 3EBHA 1F4WH 1BQRA 4APQA 1RHFA 3FFCD 1A7QH 1NOFA 1OCWH 4X99A 4Z7AA 1S7SB 4EKXA 3RE0A 1YN7B 5KJ4A 3O2VH 3LSOB 2A0LC 4X6BA 1UT9A 3GSVB 4JMXA 1U8KB 4CU8A 3LV3B 2H45A 4KJQD 1VRSA 4C56D 1BQLL 1MI5D 5ACZB 1FV1B 2P7TB 1QYGL 4IMLB 2IBZY 4FQXC 5C3TA 1BGXH 1EQWA 2R1XA 4PS7A 3MLYH 2QHLA 1MHEA 2FLRT 4ZSOA 5F97E 4O51A 3R7RA 2MMXA 1V3MA 2R2EB 4KI5D 4OLZH 1GXEA 3DX4A 1LWHA 3PP4H 5GGRY 3NGBC 4UOW0 4F7KA 1YUHA 3NFPB 4J1UA 4TOYL 4CU6A 1JWMB 3ARSA 5D6DA 1FRGH 2UXFA 4Y19B 1OCOB 1K85A 2WXNA 1NBVL 4W4OC 2GBAA 4HAFA 2DQTL 3G5XB 1XR8B 3UXFA 3S36X 5FCUL 4UV7H 2A74A 3D4GA 3FBQA 4XO9A 1RZIB 4JFDE 5KZCB 4HXAH 5IESH 3O2DH 2GC7C 1X5FA 4YSEA 2OMZB 4DK3A 4ZDHB 1KTDA 1JXKA 1J9TA 5B7MA 4NRZB 4JHVA 3J8F7 3DX0A 5D7SH 1UZ8B 5FW6A 2GT9A 3BGMA 3FFDA 5SWZA 4I0PA 3TC9A 1AGCB 2O6DA 1OTUD 3HR5A 5C8JB 1NMCB 4PJ8C 1MRCH 1UXWA 1YZZA 4DPCX 3SBRA 3M07A 2D9CA 1LEGB 2AK4D 5CSGA 1BZOA 5CCKH 1MLCB 4ZUTA 2VW7A 3V5DB 1AMXA 2DQ6A 3MKGA 3OKKA 1ZV5A 2YGOA 3X1BA 2DH2A 2BSTA 3OWEA 3P9LA 3VQ1C 3GS7A 1YPZF 2DQUL 3IN0A 2WO4A 1FFOB 4Y2DC 3P3TA 4G9FB 4GBXB 2HVBA 4M5YH 1IM3D 2B16A 5DWUL 3RBSA 1T5XA 5I2IB 1RURH 4F92B 3D2UB 5T3XL 3RWGA 1U6AL 2YWZA 1MCJA 5C0BA 4IJ3B 3U46A 3VAEA 2UWEB 1NMAH 3HUJA 2L0DA 1JGUL 2CHZA 2IADB 2PO6C 2VJ0A 3CDGA 1OB1B 3P0VL 4TN9A 3SYCA 5TE6L 2DQIH 3FCUB 5LNDA 4DWHA 1HINL 3TNMB 1GGBL 4HUXA 4O9HH 2HJLA 3PE9A 1E27A 3KGTA 2MTPA 1ICTA 2DW5A 3QEQB 1C12B 3PGCA 4ZPTA 5HDWA 3DIVA 3VD9A 5EEUA 5GS0H 1MCCA 3BT2H 2F1EA 2JSFA 4JFFE 4LKXA 5GS2H 3LKRA 4G7VL 3P54A 1FSKC 3LS5L 4YDVB 4ZMXA 4PRNA 4F7MB 1MJ7H 1Z9NA 3QNXB 2OS7A 1FFNB 3QZLA 3QUZA 1NBYA 4M3KB 3OKLA 4LOUC 3D3VA 4FCHA 1B9ZA 4WNQB 3VCLA 3QJFB 2WXJA 3RA7H 3G6AA 5BJTB 4FP8L 2AQQA 1NM9A 2JQZA 3C8KA 1JZJA 1PF3A 3P30H 4FE9A 2DWDB 4XOBA 5IROC 4PJ7E 1E8XA 4LPTA 1IV8A 1KTRL 1HKFA 1WD9A 3BJ91 4WI4A 2VLKB 3NP3A 1WT5A 4NQVB 4JGNA 3RX9A 3SE8H 2VUKA 2XN9B 5AVWB 4R26H 3STBA 4WI9A 5I26A 4KK6C 4P23C 2H8PA 4PJEF 4ADJA 5C09D 4DQOH 4FYTA 1QFUL 3RFZB 5GRUL 4BFGA 2EDXA 3AG3B 4PLKC 4RGNE 1J1OL 3TT1L 3QFGA 2P26A 3GSNH 4YSUA 5JOPE 4XN4A 2P5WB 4B9CA 3ORJA 1UD5A 3OX8A 3FMGH 2A6JB 3EYVA 4K7PY 2VB5A 2WQAA 1AANA 1AD9A 1XIWA 1KXHA 3EUDA 4TQPA 4TSCL 3K8LA 4KKAD 5JW5B 5A7EA 3O6MH 4YVUA 1IFGA 4RZKA 4QJ3B 3LXBA 3SDDB 5F96H 4PWHA 5F0MB 1URLA 1MNUL 3PL6B 1NJ9A 1HEJC 4X5RA 4UNTA 1CO1A 2XIIA 4R0LC 3DXAA 3ZY7A 3N55A 3DVIA 5ISZD 1KEML 3NSFA 4YAQB 3T6VA 2EEBA 4MD0B 4AX3A 1U0QA 2W60B 3VTAA 3K2UH 1QNIA 3JWNG 4MA3A 2J8UB 3LZQA 4MRCA 3TASA 4P3DA 5GZOC 3VRJB 1PNCA 3MUJA 1D3CA 4AIZB 3ILQD 1JG9A 2VDLL 3UZEA 2FD6L 3CFDA 3GKZA 4MQSB 4DZBA 1U8IB 4KFZC 5GGSY 4BZ2A 4ZXBC 2FE0A 3V6BR 3GKWL 3KVDD 4WWID 3D0LA 3LRLA 5LQBH 2B9BA 5IB5B 3IJ7A 3ZR5A 1F3DH 5T1JA 5IQLA 2ZXEB 1FL3B 2IF7A 3BKCL 5C08B 5D1QB 3CSYB 1OEZW 4K3EL 3VH8G 3STZA 5I1KH 5E0QA 5DR5L 3IKCA 2JI1A 1G9NH 3ARQA 4UT9L 3LVTA 4HDIA 3FTUA 2DQDL 4IIQC 4MRBA 4NZRL 2VDML 1OE2A 2FIKB 3QZNA 4W9KC 3EYSL 1JYVA 4X8JA 2K9UA 5GGVL 4UNVA 2GJ6B 2VUYA 3HE7D 4PH8A 2EXTA 2VDKL 5J56B 4EIGB 1BAWA 5F7YC 4MNQE 3NIDF 1R17A 3UTZB 3DARA 1F02I 3GMPB 1JUFA 4JFED 1DFBL 4BFRA 3UTQA 2JKJA 4LDOB 1PY4A 3IXAB 4L3CA 1WFIA 1NCDL 5EG6C 4C83B 5G55A 1KN2H 1EZLA 5HI4D 4P5TD 3RVVD 3BSZA 3ZRSA 4BM7A 4UB0L 1ETZA 5MEOA 3HS8A 1E5AA 5GS3A 5MHSD 3QIBD 1N18A 3I6LD 1A7BA 4ZOEA 3QVAA 4NPYB 4QTFA 1TXKA 2ZX7A 5ITFB 3Q9PA 1RJZA 4AGMA 1A9EB 2WXPA 1MWAL 1KULA 4IDJH 4JN1H 3RWCA 4F7EA 1G84A 3UYPA 3OGCA 5SWQA 3F62A 4XE0A 4I9XA 3RGVA 2NTFA 1A3ZA 2NUPA 3SJVB 4WJKB 3EYUL 1HVXA 1T2XA 2W1NA 3VO0A 1TOXA 4I3SL 4QAWA 4HIJA 3NRPA 5IQ9A 1NGQH 3MNZA 5F88B 4A55A 6PCYA 3HBGA 1TVBA 3GHEL 5FFGA 2OMWB 3QDJE 3GGWB 5DTFA 3VXOB 2J20A 2JTDA 3OB8A 5A2FA 4AQZA 1NSNH 3QHFL 3NBNA 3QUXA 4XOCA 1FAIL 1CCZA 1NCCH 3DGCR 4DZ8A 1E28A 4LSQH 5IV2A 3QA3B 3IE9A 2BVOB 3DRQB 1KLGA 3QUYB 1E30A 1WAAE 3KXFB 1DE4A 3LEXB 4LHUB 4NUMA 1AHKA 1A6ZA 3D9AH 4OTXL 2F9BT 3IDIB 5DJ0B 5K1NA 5MENB 3WG7B 1ZTXE 3K2KA 3THMH 3PWPA 5FUZL 5HHPA 3U9UB 1IBYA 4QIRA 2BH0A 3MAWA 5ICYA 3CPLB 3UERA 3CHOA 3M1OA 2F1BA 4FXGC 3L08A 2IEPA 4EVNB 5F1IB 2N7AA 4Y4HC 5ALBH 1AOZA 3LEVH 4EO5A 1MFDL 2EO9A 3BE1L 2R0ZL 5AAWC 5FA3B 4OUOA 5AUMA 4UQ2A 3MLUL 5MP6H 2ZD0A 5DD6B 1IILE 2MPAL 4KPHH 2VDOH 1NFAA 4JQXA 5A16B 4BWUA 1BOGB 1OGAA 4YHYB 5CBEB 1N6QL 1YECH 1RZJC 1H9VA 3B37A 2NY4B 3UBFA 2YUXA 1VAHA 3QCUL 4U31A 5LGHL 1LK3H 3GSQA 1JOIA 5D96B 3CDFA 4HIIB 4AXWA 4AIOA 4KJQC 5DU7A 5KVFE 1E4JA 2QVFB 4OM1H 1ZE3C 2EH7L 5ICZA 1MLBB 4LCYA 2CKNA 2A3TA 5DJCB 3ABKB 4NZTL 1ZLUH 4JFHD 1MCSA 3V4VA 3RL2A 1SDDA 2ZICA 3WS6C 3V79C 5K39A 3GDCA 1I3GH 4X6FA 5HHNA 5TTRA 4NSKB 4PY7A 3ULVL 2BVUA 2I7OA 1MUJB 4CDHA 1ROWA 3UPRB 4LHUG 15C8H 3HNSH 4IRZH 4LCVA 4D0BB 3PP3H 3V95A 3BP6A 1GOHA 4PJGB 5DC2A 5C0AB 3FDWA 2XWRA 2JCCF 5FDYA 1U8MA 1WICA 3H54A 2DEXX 1EO8L 5EOCL 1FL5B 1A14L 3LRSB 2UUDH 2YPVH 2OP4L 3GIZH 2WNGA 4RSVA 4GJTB 4MCYB 1NC4D 4W9GC 1FI8C 4MA7L 1S3KL 3B6SA 4X6DF 3CH8A 4LASH 1P4UA 3RDTB 5E5RB 4PJCB 2Y07H 1IL1B 1E4XI 4MNHA 3GD1C 1T4KB 4XMUA 3I3DA 3FULA 5SWSD 2BJMH 4S1RH 5L9DL 5I23A 2IWGA 4DP9X 1FCCA 1VEPA 4JO2H 5D7LB 1K4CB 5AYTA 2ZT9C 2AVGA 4HS3B 1UKQA 2X2UA 3UZQB 2V17H 1S46A 4IIZA 2ZWNA 3SGDH 2EDQA 1NCUA 3IJEA 1GPOH 2BSDA 4MJID 3FAWA 1GYVA 3GRGA 2I60H 2DQCL 3CLWA 3QG6A 2NQDA 3ECBA 3GJEB 1FPTL 2X1PA 1QSFD 5FFLA 4LRIA 3UC0H 3UADA 4L3EE 4MD5B 1QUPA 3VXQB 4YMPA 2X4PB 3F7RA 3UIZA 3MLPA 1JZFA 4GS7B 4MXQC 2A7BA 4Y1SA 1F4AA 3MLSL 1A6WL 4IRSD 3QFDA 3O3DB 3VGAB 3GXNA 1DVFA 1H5BC 5FYJL 3ARFC 1T22B 5DZVA 2Z7YA 4F8OA 4LBEB 2ZQKA 4HUCA 2ZCLL 3C60A 5E8NB 1U3HD 2VAJA 1OSEA 4BUQA 2OMTB 4JHWH 3BCDA 1F1DA 1BVKB 4YO0A 3GBEA 1HFUA 3IAPA 4MAZA 4FL4B 1KCRL 4IOSD 2V7NB 2AJVL 3CVHA 3KPPB 2OV0A 3MV8E 3WV0A 4KJYB 1AG6A 3W3BA 5C0EB 4PS4H 5CN2A 1GJIA 1TZIA 3RGBA 1SJEB 3SE3A 5H4YA 4B0MM 2DYSB 3OR6A 1CMOA 4H0LC 4TVPE 4B27A 4ZSOE 4FABH 3CLEH 4HISA 3MHZA 3WFEL 2VM3A 3TEWA 3TN0C 1YEJL 2E9GA 3QNZB 4OFIA 3FYIB 2P8PA 5D72H 5EC1B 2VE6B 5CP3H 2A1WL 4OLVL 3OXRA 2B2XL 2WN3A 2ZUYA 5FYLE 5DUPH 2WINB 1PMYA 2FO4A 4OFQA 3HG5A 5EIIG 1MIEH 1E6JH 1DUZA 2LE9A 3GRWH 1BFTA 3LYRA 1JSYA 1Z3RA 3HAEH 1J5OH 1KXTB 2X4TB 3RWJB 3UBHA 1BZ9A 2EO7A 3VE0A 1A3LL 1Y0LB 4PJAE 2H3KA 1YNTF 2VISB 2CRMA 4WJ5A 2A9NH 3V4PB 3GMOA 2BDNH 1T80A 5ERWB 3OKDB 5LJYH 1VENA 2O5YH 4EI6A 4OZHA 4IU3B 2EYTB 5SWZE 3CN4A 1BPLB 1G9ML 2WWNA 2CNZA 3U4EB 1OALA 1XB8A 4DK5A 4G9DB 3UEQA 3S98A 3H42L 5JHAA 1BP3B 2Y9RT 4UZSA 4UIKH 2FYVA 4E9TA 2P5ED 4RMBA 1DJGA 1FL6A 1M1XA 1O6SA 4KKAC 2WM0A 1WTGT 1UATA 4FQQA 4YK4C 3GZPA 1QP1A 4NM4H 1I82A 3P0YH 1VADB 1OAQH 3BAJA 3G5YA 4HCRH 5KUMA 5TH2B 3IDGB 4QKTA 2YD8A 1AG0A 3DBXA 5I15H 5BW7C 4KI1A 2QV2A 1BG1A 1NGPH 3BFOA 2J12B 3TZVD 2CZNA 4G8IA 4OQ1A 3VJ6B 1RUPH 2VZTA 3KD4A 3KM2A 5C70A 1KZQA 1VHPA 3VDAA 1GY2A 4BFKA 1RERA 3ILQC 3NK3A 3ZDXB 3FO1B 3SY0A 2CJSA 2OX5A 2NX5A 2YXMA 3MLXL 4LLUA 5HGBA 1RK0B 2NY3C 4N2GA 1NDGA 2YK1L 3H9SD 3HS0B 2CLZB 3H0TA 1PLGL 3SO3C 2BIIA 1URIA 3K6OA 3G04B 4ZTEA 3GSXB 1DQQA 2QVTA 5L7XL 3O41B 4U05A 5FYJU 3MKKA 2HG5B 1T04A 1EANA 3KPQB 4I3GA 4RA0C 3FT1A 2EJ1A 5JA9A 2CBTA 2XI9A 2HZHA 3PQYD 3LY6A 4UQ9A 4P2YA 1T7ZA 3WFCH 5EA0L 4XCNB 2Z92A 3AREA 1CXEA 2P44B 3D3VE 4OAWB 2IWEA 1LD9A 2Z0UA 4KNTA 3DSNA 4M6MH 3RY4A 2GJZB 3HE7C 3TEYA 1NUGA 5DSCA 5DS8B 1JNNH 1JGLL 5D7IE 5FM5M 4BH7A 2ZX6A 4EZKA 5GS0D 2OI9C 2YMTA 2CMRH 3ET9F 3OHXB 4N8VA 4Z7QE 3F5WA 2NYZA 2B20A 1WCBA 4PJBA 1MFMA 3FS9A 3MRBA 1S9KC 5HI4C 2BLFA 3P9MA 2D9QB 3RVVC 1ES0B 3JTTA 5BRZA 3QIBC 2AEQL 5DEJA 2IMNA 4DJMA 2GTWB 3FT3B 2ED9A 2RIKA 4P5MB 5HYJB 5DFVD 4AQAB 5MI0C 1GRWA 1ZS8B 5HPMA 5IBTH 3LN4B 3ZDYB 1PLAA 1UTDA 2G5BA 1F8TH 3SKJH 3T71A 4QHKJ 4N6QA 1QVOB 1FFRA 2E74C 5LBGA 4U6VH 2Z93A 2BW5A 4U1IB 4BFFA 4NKMA 4F57L 4JK0D 4JPSA 2OL3B 1NWPA 3AROA 4OVUA 2OAAA 3DXAE 1BQHB 2YA1A 4ESKA 1ZEAH 4M29A 2H32B 1OAYL 2Q76B 3MOAL 4MQTB 1TQUA 2W65B 3M7FB 1HWWA 2Y6SD 5FFOA 5T3XH 1IJ9A 4BUHA 4D2NA 3TL5A 1NAML 1BHGA 2B5IC 2FWLB 5JW4N 4ALAL 4ZMAT 1LO0H 3Q05A 3P0VH 1JK9A 2IPTL 4YQXH 2XG4A 5H94B 3QUKB 4XO5A 5TE6H 4DTGH 4S0HA 3T65B 4EN3D 2NSQA 4YHMH 3ZL1A 1X4XA 2G4EA 2F54D 2CAKA 2DYPB 2ZUSA 3V0JA 4N90E 4ISVB 4WK4B 4M5SA 1O5DT 1P7QB 4B3VA 1T1ZA 1SY6L 5IJDC 2IH1B 2OULB 5FV1L 2CCLA 2W0FB 1G7LA 3GC3A 4RQQA 4AL8H 4G7VH 3X14A 4GUOA 3U2SB 4ICWA 4WK2B 3MRQA 5I1AA 2QLVB 5LGYA 5M7QA 1BCIA 4LVNB 5FF6B 4LDEB 4S2SA 3RTLA 1YJDL 1OF0A 3SKOA 1WFJA 5IOPA 1IGJA 1V7NH 2R7EA 3TH4T 2XT1B 2J88H 4YNYA 5JDSA 2CD0A 1DBKL 1ZVNA 2DQHH 5I18L 1LO4L 1L5GA 5DQDH 1VFAB 1EZVY 3DX3A 3D52A 1XGTA 1YEGH 1ZLWH 1RKRA 1L9NA 1I8KA 4E41A 3N9GL 1FE8L 3S5YA 4LSVL 3L4UA 1BQHG 4IKIA 1RUMH 2QPDB 1UQSA 3EG9A 5FA4B 5A2AA 4U6HB 4BUGA 2KS0A 1OT4A 1QO3A 2CBMA 3QWRD 2DDQL 2C9UA 2UWEF 2ITDA 3GB7B 4RNRB 1WLHA 5C07B 1RZ7L 2NQCA 3QORD 4R2GD 2ALAA 4M1GH 1PEWA 4WFHD 5GRYA 4G8FA 2LVEA 1Y7VA 3CMGA 1S9YA 4OU3A 3QJVB 2ZOOA 1A3QA 2V2XA 2CJUL 4JJOA 3BZ4B 4G1MB 5F2FA 2XTJD 2GW5A 5ES4B 3HG1B 3CBKB 4OUUB 4PIRF 4BRJA 2PR4L 4PEEA 2O5NA 4P46B 4XPBH 1TJMA 3UPAA 1MNUH 2KDGA 4R7NA 3FH5A 5DVKA 1AP2A 1S5HA 2BNQD 4JKKA 1EGJA 3C08L 1JFHA 1MFAH 1KEMH 2RMNA 3QO0A 4AJ0A 3WO4C 3CFEB 1U30A 3B3IA 1CBVL 2CM6A 1BQSA 4FI6A 2J57A 4XGZA 1T7YA 2V9RA 1P0SE 5IJBC 3NIGE 4XX5A 5TFSL 2CO6A 1TZ8A 5JORA 3TS8A 3FT2A 2OJEA 2VDLH 3PWPE 3MGOB 4GRLD 4YHPB 3BEWB 3ZHNA 1R3HA 1QEXA 2NR6A 3VXNB 1U8JB 4K4KA 1HXMB 1YAIA 3ZJAA 4RAVB 3L7EA 3U0WH 2CG9X 2M8XA 4PJ7B 4UQ3B 1JVLA 2F74A 4P49A 4IRSC 3SBWA 2V3DA 3WN5B 4MMZB 1R3JB 1EXUA 5E8PB 3WTVA 1THCA 5GGSA 5H8DA 1ZHNA 1HT6A 1WFTA 4ZYKB 4UILL 2ZXDA 3OZ9H 2Y72A 1RH8A 1OGAE 3SPVB 2VLLA 3EJYD 4HK0B 5D2NC 5I0VA 4C4BA 3EYSH 3QIUB 5FKAB 1BLNA 4JY5L 5DC9B 4YWGH 2J4WL 1UXSA 3NRQA 5AYUH 1T3FA 3QXDA 3UC2A 2QFPA 2VDKH 1KPUA 1KY7A 1SEBA 3I6KB 4UDTB 4PMEA 5E1AA 4HKBB 4PGBB 2AFNA 2G5UA 5DD5L 4HUVB 1NCDH 2XWZA 4ZBJA 2OQJA 1F1GA 4Z78B 2X6CA 2J8UF 4KZEH 3EUUA 4CVZB 3QUGA 4XP1H 1YNLH 3CH1A 3KDMB 3LDBB 4GRWE 2H0PA 1T89C 35C8L 5FOBB 3VFGH 5F6IB 5AENA 4HD5A 1BYOA 1TNNA 5B3JE 4TNVF 4D9QE 3DYMA 2NXYD 4ZFZB 1ZS2A 4GAGL 3EYOB 4LARL 5I30H 4PJXE 3SB3A 4I3SH 4TNFA 1N0XL 3BH9B 2EDBA 1E4HA 3MMEA 4IEFB 2N4IA 1HHHA 1AGEB 3OMNB 1CLZL 1Q0EA 1E4KA 5EV7A 1L4IA 3L3KA 4WHYH 3TO2A 3B9KA 1J9CT 1QWHA 3EJSA 3HB3D 4ENZA 3QJUB 3FTZA 4BK5C 4RWYL 2PTTB 3FFOA 1P69B 3SCMB 3IWUA 1I75A 4JFDD 4NHCL 3WAJA 4X4YA 1T83C 2FSEA 3LAFA 4XPFL 4KY2A 1DVUA 2UZXB 5JW4Q 2D7PA 2BOCB 1S9XA 2AXJA 4YGVB 2V9UA 3R1GL 3N1GC 4NEHB 1H8OA 1LVEA 2E6QA 1OP5H 1M53A 3FO2B 1FQ9C 3UTSD 3CE1A 1HXKA 3P4MB 1SBBA 3TZVC 5JNYA 2Q8AH 4UYPA 2WBWB 3N1QC 1SBSL 2BOBA 2DL2A 1KIRB 2R0ZH 1N5YH 4XN1A 1UEMA 5KAQG 4AK1A 1I9EA 1GC1L 4YJZL 3GUTA 3WI9A 2KQNA 4WKZA 1FNEB 2WZ6A 1N4XL 2FECI 4GIAA 3F7LA 4TSAH 2VR4A 2PP7A 4E42B 1TSRA 1N0LB 1BVLA 3LS4L 3QDGE 3OKEA 3HPLA 4WU7B 3PXLA 4AG4L 3S88L 4NZTH 5FO2A 4OF3A 3U36A 1INEL 2HWZH 4ES9A 5HYSA 1QW9A 4OCRL 1XZ0B 4JG0H 5FGCE 1CURA 1I85A 4GOSA 3IBOA 2D4FA 1QBAA 2WQSA 3ABZA 3ULVH 2VLRA 3C5XA 4P05A 1TJIH 3RVTD 3C6LD 3S96B 1FNLA 3TJHD 3KLQA 3GLAA 1I7RA 3RU8H 3ILPB 1K8IA 2PTUA 3BKML 2YD6A 3DGDA 1FG9C 3WNNA 5IB2B 3QDJB 1SLUA 4EUPB 2NY5C 2NNCA 4JANB 2HKAA 3NACH 4JFFD 5GS0C 4PJ9D 1SFHA 4DKEH 1MCHA 5EOCH 2FCBA 4NC2B 4I0CC 3JSSA 5DQ9B 3UAEA 1O7DC 3E38A 1BQ5A 4G8GB 4Y8DC 5AAMC 3JVGA 5AOIA 4MLSA 3ESMA 2IMMA 3D08A 1PKQA 1S7TB 2PYEB 1AFVL 3FCSB 2C4XA 5BS0B 1CGTA 1RLBA 1S3KH 2BNUA 3NCYS 4N2NA 4DT2A 3OMIB 2RJMA 1TTBA 4OZHE 1JDDA 5DFVC 2WZ0A 3LN5B 5K59F 4KNUA 4POUB 4H4NA 3WBDA 1AD0A 4B9KC 5L9DH 5DJDA 5HY9B 2EDHA 2X9WA 4PS3A 4AUJA 2BHYA 4FXKB 1FFTB 5L6YH 2NXZD 5I8KL 4K7PL 2F68X 3OQRA 4WW2B 1PFOA 5KOVC 2DQCH 1F11A 1LNUB 3QQXA 4RGND 1WS8A 2W0KA 1PQZB 5JOPD 1FPTH 4G8EA 5B1BB 4LVHC 4CN4A 2J6EL 3VTMA 4WTQA 4FCAA 3CFIC 4MMXA 1IC7L 2Y6SC 4F3FB 2DZEA 4TPRH 5I8CB 1R19A 3BZEA 3RG1C 3TBYA 2ADJA 4CVXB 1K5NB 4PJGF 4LU5H 2IPKB 5B1CA 2GUOB 3C87A 5SX5H 1I1FA 4GQZA 4BKTC 4EN3C 2X4OA 2W94A 4PJ5A 3WEMA 1C8PA 4UQEA 4MCZB 2ZOWA 3KLHD 1G5AA 2G30A 3TIEB 2K4AA 3T09A 1GCFA 1ASPA 3HBPA 1A1NA 3ZYZA 5LNEA 1T5WB 4PJCF 4PLJD 3TA3B 2V4LA 3U7YL 1QASA 4ZW8A 2AITA 1DYZA 3WNKA 1X44A 3QJSB 2DKUA 3ZX1A 4ZO8A 3LXAA 2QKIC 1SNRA 4D0CB 1NTDA 1VGKB 2Y24A 1U8HB 4LXFA 1MWOA 1NEPA 2QR0B 4OSUH 1OTSD 3L7FA 2A1WH 2B2XH 1PYWA 3QRGL 2BCKB 3VWKD 4ZW3A 3ESPA 3L3IB 5C86A 1KCUL 4KH9A 3UCRA 2RR3A 2Z31D 4WSKA 3WIIH 4OCNC 5IB3B 3HBQA 3HJEA 5K9QG 2FEEI 3K2IA 3T8XB 2F5BL 4MB1A 4PJBE 1MFNA 2AQRA 2X70A 3BSZH 2EXWD 3DX8A 5BV7H 1FIEA 3DJZA 1DVQA 3NJIA 4XO8A 3QORC 4R2GC 3W82A 2M1KA 3QUHA 5JIPA 5JYLA 4FFTA 4OR1A 1XO8A 3ECQA 5J1AB 1AVAA 8FABA 1J1PH 4MNQD 2IBBA 4V1DA 1AE6H 3H42H 4GH7B 2CK2A 2WHVA 4UYQA 1M3IA 1R46A 5BRPA 5EEXA 2ZAGA 4N68A 3G08A 2XTJC 2AJUH 4FXGB 3WEXA 3IU3B 1LXMA 4BE6A 4KV5F 1KDJA 1WTLA 1WDAA 1J8RA 3BEVA 2ICEB 2VERN 1R5IA 1UACH 1L9TA 5IQMA 5ID1B 4PGCA 1M42A 3K5SA 1WBXB 4U7KA 3NQIA 1ZGLM 2XX1A 2R0WH 3BP5A 1MXDA 3JVFC 4ONFH 1T20B 1R1CA 2AJYH 1P4IL 4HAKA 5HGGS 3M7OA 2ICWA 1ETA1 2BXZA 1L6XA 3BDYH 2ZWKA 4FI7A 5DJ6A 1JV2B 5H4ZA 3IMRA 3MV8B 1NEZB 3BPNC 4OD1L 3S4SA 4DP1X 1S4IA 5JQHC 4TUUA 1P7BA 4EIBA 2MQ3A 4GRLC 4FHKA 3B4NA 5DUML 3PWUA 1CDHA 2VR6A 4QOKB 3DPBB 2F7PA 2LHAA 1EIBA 1ASQA 1FZKB 4GSRA 4O2EA 2ADGA 2YXFA 5ADOL 1C1EL 3D39A 4YDIH 3PREA 3CC5B 4OFVA 2GTZA 1BD2A 1NQBA 2VERA 4KY1L 3VDCA 5TDOB 3QZWG 4MVBD 4QHNA 3REWB 1E4XL 1Z9SA 2Z1KA 3AU1A 2K0RA 1H9DA 2A74B 3BUYA 5AB9A 1SXZA 4HMCA 4PJAB 5BZXA 3EJYC 5JHDD 1R34A 2FNBA 3AGWA 1YEDA 2WWMD 2PPEA 3QCVH 3FAXA 3HC4L 1WBYB 2PWEA 1MSPA 4ZK8A 4MXVF 3QS3A 3ESVF 5E56A 1CQYA 1ZV2A 3QO1B 4W9ZA 3GSOA 5SX4I 4X9YA 1R3KB 4E41E 4XMZA 2PW2B 4FQHB 3FQRB 3KYNB 3L1FA 3PU7A 1BFSA 4PS8A 4CJ1A 3HZMB 4H8WH 4QHLB 3SD5A 1YMME 2IGFL 1NEZG 2CH8A 1RD6A 3TWCH 2ZNXA 1XD1A 1YG9A 2YD5A 5KG9A 3C8DA 4O02B 4RMUA 3WL9A 1MFEL 1W0WA 3ZDXF 2EYSB