3X1FA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1fA00
4M4RB 3CVCA 1W6WA 1EZLA 3FU8A 1TU2A 5B3SB 2CUAA 4BXVA 1HAUA 3CDZA 1A4BA 4YSTA 3MBWB 1OF0A 3QJSB 3CVDA 1GS8A 1OE3A 1AOZA 5I6KA 1KCWA 4AI7A 2XV0A 4HCFA 2PLTA 1GY1A 4A67A 1IUZA 1JERA 1NPNA 1AACA 2EIJB 1PMYA 2UXGA 2HRHA 1MDAA 5I6MA 2UX6A 4F7KA 1A3ZA 1QNIA 1NIBA 2WSDA 1RZPA 4DP5X 3AY2A 4E9TA 1GSKA 1MZYA 5TK4A 3TU6A 1KBVA 4MFHA 2CAKA 2P80A 1BQ5A 1JZIA 2ZONA 1NWPA 2CCWA 1CC3A 3EH5B 4JHUA 3X2QB 4UF7C 3WKPA 5D4HA 3QPKA 3S8FB 1FA4A 1QLEB 1X9UA 2YAEA 1GW0A 1ET8A 1OCOB 2I85A 3CZUB 1L9SA 3OD3A 2AZUA 2FQGA 2GI0A 2AVFA 4AX3A 3NJNA 1NZRA 2VM4A 2VSKB 3WKQA 1OCRB 4YSPA 1QHQA 1ETJA 3DKHA 3T9WA 4CSZA 3FU7A 9PCYA 1E30A 2YARA 2OCCB 2IWEA 3ZIYA 2YAMA 3FPYA 3T6WA 3FQYA 2PP8A 1PZAA 2VW6A 2XV2A 4A2FA 3FSAA 2PCFA 4G71B 1AQ8A 4HAKA 1E5YA 3IBOA 4KNUA 1BXVA 2FQDA 4DP1X 4P5RA 3UAAA 1KDJA 3OMNB 3T6VA 1NWOA 1JXDA 1UATA 1PNDA 4E9QA 1V10A 2FQEA 2J55A 1V55B 4E9VA 4GP4B 3DTUB 3BQVA 2DV6A 2YXWA 1ET5A 3KW8A 3NJGA 3ASNB 1NTDA 1PLCA 2WO3B 3HB3B 2IWKA 1JVOA 3ABGA 3V9EA 4DP7X 3SBPA 2XUWA 1OCCB 2W8CA 2Y69B 1J9RA 2OV0A 4AZUA 2QT6A 1ZV2A 2X87A 1A4AA 4HHWA 1NDTA 4GP5B 3D12B 3GDCA 1ZDSA 1XB8A 1AZBA 2FT6A 5F7AA 3S3BB 1BXAA 1JOIA 1XMEB 3ABLB 2XX1A 4NERA 4YSDA 4GY4A 3WNIA 6PCYA 1AG0A 5I6NA 3OMIB 4CSPA 4YSUA 2I7OA 7PCYA 1E67A 3WI9A 1KCBA 5I6PA 3ZBMA 2NRDA 1SNRA 5PAZA 1L9RA 1SDDA 3QJRB 3TA4D 4DP0X 3GXUB 2PPAA 3PAZA 3GYRA 5B7FA 3QJVB 2FWLB 4HIPA 4UANA 2DYRB 2GC4C 3N55A 4L0PB 1L9QA 3JTBA 2XX0A 4G70B 1I53A 1TEFA 1CURA 4PCYA 2BO0A 2DY2A 2J57A 3TASA 2BHFA 3SBQA 2IDQA 3IE9A 1GR7A 2H47C 4F2EA 1JZFA 3H4HA 3N2JA 5I5IA 5A7EA 2A3TA 1W6LA 1M56B 2CJ3A 1MG2C 4KO6A 3S8GB 2XWZA 1WA2X 1J9SA 2CBPA 3H4FA 1FWXA 2DYSB 1KYAA 1AS6A 1W8EA 4DP4X 1RKRA 5D4IA 4RH4A 2W88A 1A4CA 3CDZB 1L9PA 3T71A 4DP8X 1A65A 2Q5BA 1SHXA 4YVUA 2DWSA 2PP7A 4EF3A 1NICA 4YSEA 4BWWA 3NJMA 3FS9A 4QLWA 1PLAA 3NP3A 4WKXA 1AANA 2VW7A 2YAQA 1RZQA 4JHVA 1AZCA 1TKWA 4KNSA 3NSYA 3FQ1A 4HHGA 1BYPA 2JXMA 2BP0B 2ZOOA 3T6XA 2EINB 3NSFA 1RCYA 4M3HA 4F2FA 2QDWA 4WTQA 6PAZA 2HZHA 2IH8A 3PAVA 3UGEA 3HEIB 2QPEB 3FU7B 3SQRA 3QJQB 1SHWA 1F56A 1PAZA 3NJIA 1IKOP 2HX8A 1GS6X 1HFUA 1AAJA 1CYWA 1OE2A 2FTAA 4ENZA 3QJUB 4E9RA 1PF3A 5B7EA 1ILSA 1IC0A 5I28A 2YAFA 1NIEA 2HX7A 1NIFA 1WAEA 4YSCA 2H5UA 1YLBB 1X9RA 2FJSA 4KO5A 4DP9X 1NIAA 2BWIA 5B1BB 1FFTB 7PAZA 1AZRA 2WO2B 1NINA 2IDSA 2UXTA 4YVNA 3X1FA 4TXVB 4YSOA 4YSAA 2FNWA 1HAWA 2IH9A 3IEAA 1ASQA 1J9QA 1JVLA 4KOBA 4YL4A 3UACA 1PNCA 3FSVA 2UXVA 3ERXA 2UX7A 4DPCX 1JZHA 4A2EA 2GB2A 3PXLA 4G7QB 2GC7C 2UXFA 4BWTA 1N68A 2EILB 4BK5C 3SBRA 1M57B 2IAAC 4YSQA 2YAPA 1GYCA 3NYKA 1DZ0A 2MRYA 1J5DA 3AZUA 2VM3A 5E9NA 1XB6A 1WS8A 1ADWA 1SFHA 2QPDB 1M9WA 4YSSA 5F7BA 3ZDWA 1ET7A 1BAWA 1SFDA 2EIMB 1EHKB 2VSMB 4N4YB 4G7RB 1ASPA 2IDTA 4W1TA 3V9CA 4DP6X 5AFAA 2PCYA 5ANHA 3EF4A 2OJ1A 3KW7A 4GXFA 2DWTA 3X1EA 1WA0X 3T6ZA 4A2GA 1A8ZA 3FYEB 5AZUA 4BDVA 1AIZA 1CUOA 1IBZA 3UABA 4E9WA 4AKQA 2GBAA 1WA1X 1BQKA 1N70A 3FT0A 1OCZB 2IDFA 3OQRA 2Q9OA 3UADA 4A2DA 3DIVA 5I5MA 1PZCA 1PY0A 3C75A 2EIKB 2LLNA 2AFNA 4N8UA 2BP8A 4AKOA 2GIMA 3ASOB 4YSRA 4G7SB 1JXGA 3MX0B 1KDIA 2AANA 1MG3C 2FT7A 3AW5A 2YQBA 3X1NA 4NAJA 4A68A 1OV8A 2IDUA 4E9XA 3NSCA 3TBBA 1CYXA 3PLYA 5I6LA 5EHFA 2YXVA 3AG2B 4Q89A 1WS7A 2B08A 2GHZA 3EH3B 1XB3A 2HX9A 3WIAA 1NIDA 3NJJA 4Q8BA 4JKNA 1BXUA 2XYBA 2I7SA 3ABMB 1SF3A 4HZ1A 1GS7A 1ZIAA 3WNJA 3FPXA 3PCYA 4A66A 5B1JC 1PCSA 3IN0A 4X4KA 1PZBA 4QKTA 2GSMB 1SF5A 3AG3B 4BWUA 1PLBA 2ZXWB 3H56A 1SDDB 1IBYA 1JZJA 2RACA 3ABKB 3EH4B 2J5WA 2VMJA 2XLLA 5FC9A 2XV3A 2XXGA 1BQRA 2XXFA 4AKPA 3TBCA 1E5ZA 2PPFA 2QDVA 1L9OA 2YAOA 3IN2A 3NJHA 3NSDA 2IWFA 1DYZA 4E9YA 5LDUA 4HCIA 2VN3A 3NJLA 1J9TA 4W9ZA 1JZGA 2X88A 2YAHA 5AKRA 2PP9A 1ASOA 1URIA 1AS7A 4NB7A 4E9SA 4A2HA 4BXSV 2FT8A 2B3IA 2J56A 1SJMA 2FQFA 5I6OA 3PAUA 1AS8A 3AG1B 1AG6A 3OM3B 3JT2A 4G72B 4KO9A 1ZDQA 3UAEA 5B1KA 3ZX1A 2N0MA 2BP0A 3FU9A 1NPJA 3FSZA 1T5KA 3RYMA 2BWDA 2E86A 1J5CA 2CALA 2VW4A 1BYOA 4PAZA 4ZK8A 1KV7A 1JZEA 4FAAB 3BVDB 1ZIBA 3QJTB 3QQXA 3U25A 4P5SA 3G5WA 2BZ7A 2HXAA 4KNTA 5I5JA 2BZCA 3WG7B 2XVBA 1L9TA 4KO7A 1KGYE 2HLEB 4GYBA 1AR1B 1GY2A 1VLXA 1BEXA 1AZUA 2XU9A 5TK2A 1E65A 3FQ2A 1ID2A 3NT0A 1KBWA 2MTAA 3S3DB 5D4JA 2PPCA 5B1AB 2BP8B 4HALA 4UAHA 3NJKA 1ILUA 3NJFA 1OOWA 3FYIB 1JXFA 1MZZA 2JFCA 1V54B 2ZWNA 4FA7B 5I26A 2HRGA 2PPEA 1AZNA 5IY5B 2H3XC 3EHBB 4HCGA 1TEGA 3OMAB 5PCYA 5B1JA 2R7EA 3L45A 2R7EB 3FSWA 2TSAA 3CG8A 4K9JA 3X1BA 2BW4A 4KOCA 2Y1AA 1OE1A 1ZPUA 4BDVB 2AZAA 3AG4B 2JKWA 3S3CB 4GP8B 3CVBA 3X1GA 4DP2X 1B3IA 2TSBA 3NP4A 8PAZA 1R1CA 2P80D 4DPAX 2BW5A 5B7MA 2PPDA 3PPSA 4DPBX
chains in the Genus database with same CATH superfamily
5AZ2H 2X44D 5EOCH 3BZFA 5LBVA 3HI6H 1EZLA 2CM5A 1T2QH 1BZOA 4LRNH 2VDKB 3P4OB 4N3UA 1M3JA 3IMWA 4RBPH 1GZHC 2H0JA 2CCVA 5AVXB 5CHNA 4HCFA 2PLTA 1NC4A 4P2OA 4RGOL 4N0UB 1WD9A 1ZK9A 2ZCZA 2PYEA 4B41A 4U1LB 4RRPA 4Z7NB 2J2ZA 2HUHA 1NPNA 4PRDA 3CMOL 4WGKA 4PGEB 4PI0A 3L3IB 2MCMA 4EN3B 1R17A 5H2BA 5EOCL 3IDMA 1IAOA 1E9PB 4UDUB 2MIZA 3FN9A 1Q72H 3J2PA 3C6LA 2X6UA 3RL2A 3DX6A 3QYNA 3W9EB 5F3FA 1TZGH 3FQWA 5IJKA 3NABH 4HG4K 1WBZB 4LOUC 2APVA 3TJHD 4LLAA 2X4UA 4KMTL 1BQ5A 4JREC 1T0NA 3R1GL 1JPGB 2YUXA 5ANMB 3BC9A 1M4KA 3D4GA 4LOFA 1KIQA 4YN3A 2AQQA 3SBWA 2EH7H 3L3GA 1JYWA 3MV8A 4X6BB 2WCPA 3WJJA 5LBGA 3DUUA 1SQMA 4GW5B 1NOAA 2JJVA 2ZKHH 1YAZA 1MHCA 1S7TB 1A7NH 3IF1B 3HNTL 1QX1A 1FNHA 1S7WB 5DJ6B 4HZAA 5I18L 3L9RB 4KMTH 2A6IB 4N9OB 5E8NB 4HMEA 2A9CA 2JV6A 1NFIB 2NR6C 4YSPA 1ETJA 1CD1B 3VAEA 2XZQH 3BW9B 2E7CA 3RVWD 4DVBB 4HUUB 4RBPK 4NWUL 3BAXA 1WC7A 3AAZA 4D9QD 3H0TB 2V7NB 5KVEL 2YARA 2FWOA 4GSDL 2OR9H 2ZX7A 5E1HB 5BS0E 4ONHB 1JYVA 4LKCA 2OMUA 3JVGA 1XGRB 5FF6B 3T8XB 2Y6SD 4UM9B 3IJEB 1HEZB 2XPZA 2WWMD 4WY7H 2F1BA 2QPSA 5DHVB 2FQDA 2CU9A 4ODSH 1G0DA 3DGDA 3GSOA 4IOIB 1C7SA 1UC6A 4N2NA 4R3SA 3HMWL 5EMYA 4NWUH 3W0WB 5HVGB 3SYOA 3ZDYB 5IMKB 4GINA 5KSVB 2R0ZH 2YXWA 1Z5HA 4XVUD 5HGHA 1FIEA 3FUKA 3GHEL 3IJYB 5BVJA 3FDWA 3S3PA 5F7UA 2NNAB 5ABZA 2KZKA 4GBXB 3J27A 4PSRA 5KBNC 5C6WH 3TPKA 5IW3A 4YDKL 4YHLL 1IARB 2OV0A 3DDFA 5D1XA 5K59F 2X87A 1CL7L 1UWEH 1QQDB 2ZUTA 2CGYA 2A73B 4X7CC 3QAZC 4B27A 4Q9QL 3W57A 2FT6A 1AZBA 4N0YH 1Z0NA 3MLSH 4WF7A 1CTNA 4OD1L 5CLYA 1KXQE 2IXQB 1MIEL 1O6VA 5IROC 2ZKMX 5C0JA 3MJ9A 4Z7VB 1OP5K 1E67A 3HR6A 3VD1A 2H45A 4PTUB 5JIPA 4HK3N 3QH3B 5I17B 1SJEB 2Y1ZA 1ROCA 1T21A 3MLPA 3VWKA 4R4ND 5E6IC 4Z7UF 4F91B 3QUMH 5T5FA 3DOHA 4OIBA 4OVUA 4BH7A 3GO1H 1I9RH 2D4DA 1E3ZA 4LAQL 4QRRD 2EO9A 3KYKL 3UPAA 5I5IA 4NKOB 4KZ0A 3WV0A 1FLTX 2J25A 2CG9X 1J05B 4HC1L 1WISA 1W6LA 1MCOL 4WI8A 5DJYB 4MA7H 3N44B 4NQVA 5IOPB 2YPLA 4NQVB 1SGKA 5D7KE 1RPQA 1FWXA 2VIRA 2XFGB 4HIIB 1DVUA 3BZ5A 3RX8A 4UOJA 4F5CA 4F24A 2VLKB 5EZLB 1F4XL 3VH8B 3SPCA 1N59A 2XY1A 5I73B 1KC5H 3EKCA 2A9BA 3WIIH 5FOJA 1FE8H 1CWVA 4YZWA 1K5NB 2R2CA 1F02I 4KK5D 4MXVE 5E4OA 4IHOB 3P30L 3QH3A 1YMME 1IAKA 1OKEA 3NZ8A 5I17A 3S7GA 4ZS7L 4NWTH 4FZ8H 3RJQB 2O6CA 3BP4B 1XXFC 1VPOH 4U1JA 3RIAF 3AWEA 1O7VA 5IB5A 2VW7A 4KH2A 5JOEA 1RZQA 1GGYA 3B5HA 3MRGB 3T4AB 1FL5B 5KSAD 2Q8AL 3TFKC 5CZRA 2JCCE 1D2OA 3GS7A 5T1LA 5E99H 1R5VB 5GRUH 2VXTH 5DHVH 2GEEA 4NQXA 2QPEB 15C8L 4F7TA 5IJVB 1F1AA 3FNKA 5EWIL 4Z95H 4JPKH 1OB1B 3MV9E 2VKXA 2WXIA 1QI3A 2X4QA 3QWNA 1FV1B 3HG5A 1F90H 4LP5A 4AL8C 1HYSD 2X9WA 4LIQL 5I74B 3EDKA 1NBZA 1XGUA 1UB5A 1YUHA 4HUCA 5I28A 5GS0L 1MJJB 1FO0H 1EO8L 2BCMA 3GKWH 2FL5B 4HCRL 1X9RA 1K4DB 4QRQA 3WN5B 3P11L 5AVYB 2G3XA 1FBIH 5J6GA 4KQ0A 1IGJB 1KB5H 3JZYA 1P5UB 1E90A 5DUJA 2P5EE 4ZOEA 3RI5F 1IZJA 1S3RA 4R5VA 2Q3XA 3UPRB 5I0WA 1J1OL 2XACC 3PP4L 2EZ0C 3MLWL 3O9WC 4YL4A 2EDJA 3QBTB 3N41B 1G6RA 5E94B 3SKOB 3QQNA 4HPYL 2IC2A 3O4LB 5EA0H 4KHXL 5GISL 3FTGB 3D85B 3O3DA 4CADA 2PWGA 4X99A 1I8KB 2ZF8A 1YG9A 5EUOB 3VTTA 1JE6A 1YEGL 2BVPA 2OZ4L 3JTTB 5I0DA 1KB5L 1GYCA 1PG7X 1FV1A 2ZG1A 4JY5H 4L1HA 3LKQA 1W0YT 4ZMLA 3S97C 1HIML 3AZUA 4N2CA 2UVEA 4MCNA 4YQXL 3EYFA 4PJXA 3KR3H 1OAUL 1UFGA 4Y4KD 2GT9A 1I7RB 4HLJA 5CD3A 1QYGL 2EICA 4I7ZC 3C2AH 4I1PA 4NM8H 1DQLH 2DI9A 4LMQI 3ESMA 4JPWH 5J57B 2PN5A 4XPHH 5CEYA 1NANH 5LGJB 2X4UB 1YEEL 3IK2A 2ZTBA 3BIAX 3T6ZA 5D6CA 1A8ZA 3PNWB 4IM8A 4FTVB 4JFEA 3LHPH 2V4LA 1CLZH 4FTVE 1QQDA 3BI9X 1BWWA 1NBZB 2DTSA 1IM3D 3C6SB 3MAWA 5D5MF 1KYOK 4MS8C 5DMIH 2JLLA 3HLAB 3B2PA 3GI9L 2ZP8A 1B4JL 3K5SA 5IW1B 2ZUQC 1AI1H 1NC4B 1AZZC 2EYRB 4C4BA 4A37A 3ESPA 3KYKH 3GSOB 3QORA 4GQRA 3MX0B 3PY9A 2PW1A 3CC5B 3U6XS 3CNKA 1ZHKB 4PJ8B 3W38A 4U0RB 2WZ6A 4JFTA 4K7PY 3IKKA 4LCIL 4OFVA 4PJ8D 3HI1B 1OM9A 1QBLH 3L5XL 4ONOA 4X7SH 3RGVA 4MQTB 4Q89A 4MVBC 1QI4A 4HUXA 5AEAA 3ECUA 2X1WL 2ED6A 1J1PH 1L7IH 2AEPH 3U7YL 4A66A 1T1YA 2MHAA 3GIZL 1CZ8H 4NZFA 3QIUB 3RGHA 2YEQA 2OXHB 1LMIA 2V9QA 4H1LA 4JNXA 1LD9A 4L8DA 3RURA 4O58L 3ROLB 3SDYL 4DK5A 1PZBA 4JZJC 2N0KA 3P77B 1HN1A 1JZDC 2MJWA 3V9FA 1IBYA 1HU8A 5ESAB 1I8LA 1RHHA 4FFWD 1N59B 3MLRL 4NQDE 4MLSA 4GQQA 4N2HA 3FO1A 3WJLC 5IEKA 1HXYA 4PJFA 2I69A 4XHJD 3T04D 4UINH 1JF1A 1YEIH 2CGRL 2Z8WC 2WGXA 2K1MA 5JQIB 2CHNA 2Z93A 3Q6GL 4HA1A 4BZYA 1BWMA 5AZEH 3T0EB 5HDLA 4MX7B 3GRGA 4BYHA 3F6LA 3MRLB 5AKVA 2FAUA 1MSPA 4RFEA 5GHWL 2WZPD 4MJIE 5AKRA 2CK0H 2J4WL 1AKJA 5AOKA 1FVCB 1D5MA 1JHKH 3HLAA 3DJZA 4E9SA 1RLWA 4ODXB 4BXSV 1JWSB 4KHTH 3HBPA 3IJSA 2OQJA 5I6OA 1DEDA 2F61A 1UD2A 3OM3B 4HD9A 3BP7A 4HWUA 2ZWZA 4IMLA 1XL4A 2R2BB 2DL9A 2XA3A 2HFEB 1OP4A 3UTPD 4EZKA 2AXGA 5I66A 3FC8A 3DLQR 2GY5A 5C0EA 1I8MB 3GMRA 4P23D 4XBPB 3MRQB 4G9FA 4LPUA 5K1NA 5KWYC 4PJHB 4NN7B 5I5JA 4X80L 3DRQA 1FAKT 4IU2B 4ZX4A 1U3NA 3DWTA 3GFUA 4MJID 4EN3D 3MO1A 5FHAL 4XCEA 5JPNB 1GGTA 2OR7A 2H2PC 3NUKA 3OLDA 1Y0LA 4Z7UA 2BP8B 5FDWB 4YXKH 4NI3A 4X5QA 1XH2A 2GY7B 2DQDL 2PCPB 4MB1A 3ARVA 4G2AA 4KK9C 4ACTA 1F6AA 1EVUA 1RFDL 3HE6D 3NG5A 4RESB 1AGEA 4YHOH 3UTSB 2WWNA 3US0A 3MLUH 4TUOB 1H8NA 1TEGA 1U58A 4KUCD 1IEAB 2YOCA 4ZUVB 3T8XA 1AXIB 1A6AA 3RWEB 4PY8I 2R7EA 3SY0B 2ZICA 2X1OA 3QIWB 4KXBA 3BISA 2VLJA 2VUYA 2HN7B 5IMLB 4G6AD 2XTJE 2BVUA 4FQJL 3ZE2B 1Q9WA 2OTPA 3MTXA 3BT2L 3OAWA 1FN4A 3A23A 1BOGA 4QT5B 1F2QA 2BW5A 4FI7A 3RPIB 1R3LA 4DZ8B 5E51A 1B0WA 4H25A 4MXWL 5LBSA 4MCMA 1G9MH 1MCPL 2WANA 3LCYA 5L7XL 4YHYB 3DJRA 5A2AA 2X10A 4L3EE 3S37X 2VLMD 2XN9E 3HUJA 5I1AB 1FYTB 2P5WE 3I85A 3W56A 1IILE 1KIQB 2EDWA 3KLDA 1HNYA 5HHPA 3IMBA 1CDUA 4PJAF 2X6VA 3MBEA 3TC9A 3WFEH 3IDJA 3D7PA 5L9DL 5E70A 3MJ8B 1FNEA 1IQDA 2CKBH 4TSAL 3ELQA 5J13B 2ZYHA 3OXRB 4ZUUB 1IUZA 3B5TA 4ODXA 4CA4A 1QHPA 2P48B 1EFXD 4M93B 3WUZA 3KS0H 1YEFL 5E9DE 5DJAA 5HGBB 1QSFB 3IRPX 1HJCA 3BP4A 4U1JB 4B53A 1JFQH 1X4XA 2Z1PA 4E42A 5C2BH 1J1PL 1L7IL 2QHRH 3BKCL 3QUYB 4XPBL 4ZS6D 2BWQA 5FYLE 5IG7A 5IJBC 1NCCL 1RZPA 1NFKA 4JFFA 1MZYA 3EZ8A 3VRIB 3IETB 3L1GA 4FFVC 4X8GA 2JIXA 2GAZA 5DZOA 1VFAA 4U2YA 1AE6H 3L3KA 4XNYH 3L3KB 3F2LA 2SEBB 2J8UB 1JGLL 1S7QA 3EH5B 2E9JA 1CD8A 3TNNB 3S8FB 2N3JA 1FA4A 4ZAKD 5CCKL 1TQSA 1X9UA 4FG6D 5FS5A 5IQ7H 1JMXA 1JNLL 2X28A 2VSDA 2ZXQA 3OD3A 2AJUH 2IAMA 3N1QC 3B9KB 3QVAA 3QJFB 4XI5C 5EC1A 4F37K 2GITB 2ZSVA 5IFHL 2RHEA 5AYTA 4K7FA 3T9WA 1UURA 1FZMB 4NLAA 3W0WD 4MMZC 3T2OA 3FPYA 1XR8A 1F4XH 2P26A 3WUWB 3IDJB 4MNGB 1JGVH 2A99A 3BCDA 2IPUK 3EBAA 4HP5A 5CZXC 5DHXB 2AJUL 4UQBA 3S0PA 4HAKA 1U8LA 3HE6C 4MMYA 4PRIB 3IMTA 3RWGB 5IQOA 1KDJA 3CQQA 2AJYL 3OMNB 4G6JH 1F5WA 4HV8A 2O6DA 4A55A 3BP7B 1NSNL 4WV1A 1BD2E 3HBGA 4D0BB 3ARFD 1SXBA 5IBUG 1Z7JA 1XF2B 3ZE0E 4C56B 3NJGA 4JG1L 4HKJA 4F15C 4Z7NF 1WLHA 3IJ9A 1BDYA 25C8L 4YPJA 1NLBL 4DH2A 3HZ3A 2YPVA 3HUJE 5I18H 3MACH 2P43B 1J0JA 3P3UA 1G1OA 4RA0C 1RPUA 2QT6A 5FCSH 5GRUL 4AJ0A 3U7WH 3LXUX 1GGCH 2NNXA 4UT7L 3S35X 2VLLB 3ZTJG 5C70A 2OJZL 2NZ9D 2AAAA 5FO7A 1EV2E 1BAFH 3FRPA 5EOQH 1PLGL 1TJGL 3CGTA 4KU1A 3LMJH 4XGZA 4CSPA 5J8OA 2AV7B 2NY6B 2EE6A 4XN4A 1SNRA 1DQDL 2W59A 4QHLB 1LK3H 3KDMB 5I16B 4UDTA 2WW8A 2DWEB 1T5WB 4B5ZA 4ANVA 3VD2A 1MAMH 3LDBB 3P11H 4ZFGL 1N5YL 4PJGE 5FYKH 2R39A 4P4RA 5LJYH 2WZ5A 1D3CA 4POYA 2J57A 1TQVA 4NLHA 2GTZB 1FRGL 1OAXL 2WQAA 3QS3A 4OCYH 2H47C 5JW5B 1JZFA 4Y8DC 3QT2A 4JFWA 4IIQB 3GMRB 5A7EA 2IMNA 3H55A 5ILTH 3BT0A 2VLRA 4KKZA 5J1TC 5IVZB 4GG6A 2BVQB 4PVLA 1C1EH 2HKHH 1MY5A 2FL5A 4WW1B 3S96A 2XWZA 1FL6B 1DN0A 2DIJA 5GZND 4H2CA 3NZHH 3BOVA 4JB9L 5D7HA 3CXHJ 1XCWA 1YC7A 4HJ0C 3K74B 3ZO0A 2ATKA 4W9DC 2WINB 1ZSHA 3INOA 1X4ZA 3MJ9H 2GABA 4IKIA 3VFTB 2IBBA 1ETA1 1AMXA 1RZ8B 2EQDA 1SY6H 3NCBB 3JTSB 4OLEA 1LHZA 1WUZA 1U8QA 1J10A 1NFDB 5ICYB 4BWWA 3LAFA 3WLBA 4K2UL 1H5BB 3NJMA 4K71B 4R26L 1QSEB 5DFAA 4HU2A 4L29A 4F2ME 1SOXA 4G9DB 4CRPA 5K1VA 4OKDA 1MLBB 2FD6H 4K5NA 1R4XA 2Y1VA 1BSIA 1PG7H 1EAJA 5HDBE 5IB5B 3FQ1A 3DI3B 4RRPG 3TO4C 3QDMA 1MAKA 5CJ8A 4NHCH 4IS6B 4ELDA 3WIHH 2EINB 1DFBH 2AABL 2QSCH 3Q0HA 5D1QA 1INQB 4PGCB 3PWVB 1KF9B 4M7JL 3OKEA 1GHFH 4BFFA 4QF1B 2V5TA 1PAZA 3GI9H 2BOCB 3LPGA 1NMCC 3MV7A 4JG5A 5DUPL 1VZIA 5E2VH 2GITA 1OE2A 2YKKA 3CVHH 3MYZA 1IVTA 4OD3H 1RP8A 1Z9PA 5FYKU 5BUAA 3QXTA 4Y4KB 3UJIL 1YZZA 3TCLA 4MKMA 5TE4L 4P06A 1WAEA 1L6XA 5H8DA 3U4EB 3ATEA 1R24B 1YLBB 3TJEH 5J1AB 1ZSDB 4G1MA 4AIZB 2JH2A 4J7RA 4PW3A 1NINA 5FUOH 3SYAA 1KB9K 4JDTH 2AXHA 2E59A 3SD2A 4AL8L 4CBPA 2Y2WA 3U7AA 2WZ0A 5LN8A 1F3JB 5A16B 2W0FA 1ASQA 4OD3L 3ZOAA 5FM8A 4OFIA 4TNVK 1KEML 4N8VG 2A9NL 2DTML 2MPVA 2UXVA 1EZVX 4KI5E 4JDZB 2G2RB 4NAMA 4AK1A 2F53A 2R29H 1GKOA 4AVKA 4BK5C 2R0WL 3UTZB 5K9OA 4YSQA 2IH3B 3NYKA 5FUOL 1JWSA 4HBCH 5FCUH 4JDTL 4F37F 4XAWL 3LN4A 5D7LD 3BH8B 4TYUA 4UV7L 5IJCC 1JDAA 1NCJA 1WS8A 3ZY7A 3UO8B 4J39A 3RUGB 1SN0A 1U8IB 2QPDB 3VXRA 4NCC1 5HYSB 5F7BA 3DO4A 4AIEA 2EDBA 2NTFA 2A9NH 1ZOXA 3AB0C 4X0NA 1IGIH 1P7KA 4WK0B 3HPJA 3ET9F 3BWZA 4PLOB 3V4PH 1LJMA 4BFNA 2DBLL 3JWOC 5I76A 1JHKL 4GBXA 5T3ZH 2YD4A 3A6BH 3IKCB 3UYRH 5T5NG 5HYEA 1WA0X 5FCUL 3T3PE 4G42B 1AY1L 4XMKL 4CN1A 4H8WH 4LBAA 4DZ8A 2V2WA 1UQSB 4QDGA 2K7PA 3X14B 4AQ1A 4LSQH 2C3WA 4BH8A 4X4YB 2QKSA 4YFLF 3PNWA 3FT0A 4KY1L 4I89A 4WJG3 2DQHL 4L8CA 2O61A 1MCKA 1TCRA 2HVKA 1PZCA 3C75A 1L0XA 2WBJC 2NNRA 3TWYA 4B9IA 2XC8A 5F7YC 4XNDA 2LLNA 5HVFB 2VAAA 1EZUA 4NM4H 4IKNA 1KIUB 4KZEL 3FQNB 1G7LA 3UP1A 3L4ZA 4JAMA 4ZAKC 1MN4A 2PNDA 2YZ1A 2NZ9C 4DETA 1BZ7B 2E5EA 5IIEA 4RIRB 1U8PB 4IRJD 1WG3A 3VXPA 3OLEA 2V7HA 1ZTXE 3BVUA 1T1ZB 2PW1B 3CC5A 4JQIA 5E5MA 2XZAL 2EDOA 1V3JA 5I19L 3MRIA 4ETQA 4XWOC 2Z91B 3V5DA 4BFJA 2JB5L 3PCYA 5DO2D 5EUOE 5ICXA 4ANKA 2FB4H 4LNRB 1AJ7H 4CU6A 4N2OA 1U8NA 3D25B 2WWOA 1CLZL 5I0VA 4P2OD 2CDEA 1NMBH 3STBA 3IMSA 1NMCB 3QDAA 2ARJB 1YRKA 3WFCH 5IMOB 5AAWC 3BO8A 3QZOA 4Z77B 1ZANL 3GZQA 3SDAA 5FIEA 3F7YB 1MNNA 3VFOB 3OVUB 3VXUB 5IOKA 3D3VA 2APFA 5E4AA 4L4TB 2JI2A 3D3VB 4DQAA 2VMCA 1FNSH 4YXHL 2D3LA 3NJHA 3CHPA 3HZVB 4QOKB 4UQAA 5DD0H 4C4KT 2W60B 4MQ7A 3X14A 1R3KA 2ENSA 1XGQA 4KKNA 1JPST 4N1HB 3WIHL 2NX5E 4RMRA 1IGCL 2X9ZA 2X88A 5FM5O 3WN6A 2Q87A 2PXYD 3TLRA 3T0AA 5C0AD 1URIA 1Q0YL 4P5KB 1D5MB 3BPNC 4JRXE 4L5FH 3ZE0F 3DARA 4LSUH 1F6FB 4R0LB 5ICXB 3RWCB 3B2DC 4PBWD 5HHME 1IGTB 3MXVL 4IRJC 4ZW7A 2CDGB 4DGYL 2CR6A 2R51A 1NBYA 3VI3E 5HI4D 1ACXA 5B1KA 5FGCB 2JKXA 1BM3H 1CF1A 1MFUA 1ZKAA 2VE6B 5CMAA 5DHVA 4CMHB 4URKA 3HMXA 4CC0A 2CALA 2Y7OA 4RIRA 1J5CA 4PP1D 4XB8A 2OMNA 2GVYA 5JO5B 1CBVL 4HFUH 4L37A 2RMNA 3ULUL 2FSEA 1BZ9A 4ONHA 2BZ7A 4NSKB 2QKIB 3QE5A 5AAPA 3FB5B 2CGRH 3BZDA 3HI5L 1UJ3A 4F5CE 5KG9A 1TCRB 5F96H 2JVUA 4QRQB 3DJ9A 4U6VH 2AVGA 4MA1C 5F7KC 3CK0L 3FQ2A 3L9RA 3CFCL 3O6FD 2PPCA 3ZGIA 2KHAA 1FGVH 1V7ML 4W4OC 4F33A 2EDTA 4HJGB 5FHBL 5MHSD 2Z8SA 4KHTL 2JFCA 5CCJA 2ZWNA 2BNRE 5C0JB 1BMWA 3AS1A 4X7DC 2X7LA 4I0PB 1ITBB 4AE1A 4MRBA 4MNQE 2YGPA 4AXWB 3KL3A 1VADB 5E8EA 4HUWB 2F7RA 1S5IH 2G3NA 4HXBL 4LPXA 4ODWB 5DD3L 1NBQA 3AACA 3RNQA 5DMKA 5CGYD 5D72L 2K9FB 2HRPH 3LKPA 3BH8A 4LF3A 3S3CB 4H26B 3LS5L 3MRKB 2E0PA 5E8PB 1CJYA 2FGZA 5IQNA 1LK2B 4JKKA 1GIGH 1BQHB 1R1CA 4PBDA 1NGWB 4F7MA 4XX5A 1E9PA 1OGAB 1ZS8A 2ORBL 2W94A 4U33A 1DQQA 2ETWA 3B7TA 3HJ0A 5F7FA 1DN0B 1FNGB 1RUAH 4HF5H 4JFFE 4JO4H 4ZXBC 3DOIA 1V7NL 2Z35A 5LGJA 4UQCA 1YYLL 3QEQB 4OUUA 3E9TA 4OJYA 4MMXA 4M6MH 4JQVA 3HG4A 3DBXA 2JKIS 3CBJB 1VGKA 2HB0A 4KQ3L 2ITCA 5JW5A 3SCMB 3EFFA 3HE7A 3VW3L 1D5RA 3VGFA 3H0TA 4LU5H 3CXHK 1Z9OA 2CA3A 4JEGB 1HHIB 3CN2A 3FOLB 1SJHA 4LHUD 4PCSA 3ZRCC 2Z31C 4ZOAA 3OC8A 4K3EL 5FYJE 5E6ID 3WDIA 5C6PB 4M1CD 4O5LH 3TH3T 1GZPB 1VERA 2V8MA 1GGCL 1RERA 1E3XA 3LEYL 3REVA 4LBEA 4A6YH 1SBBA 5TFSL 3L4XA 4M6ML 5C7XL 5KVGL 3HS8A 3PGCA 4ZMOA 3VWKB 2A6KB 3EDJA 1NMBL 5A2FA 1NCNA 5CZXD 3S3SA 5HTSA 3UC0L 1BBDL 3AGWA 4TNGA 4Q52A 1DFXA 5IFAL 5E8DH 3SEPA 2XFXB 1ZANH 1BBJB 2GBTA 1BJ8A 1U8OB 3MI6A 4JJ5B 4MGXA 4LSDA 3SE4C 1T0NB 4ANWA 4MXQC 4TVPD 4JE4B 4M6OH 4KFZC 3UTQA 1KBPA 4G9DA 5C86A 3EZJB 5BV7C 3QWOB 4APQC 2J88H 1NAMA 2VDLL 3L3JB 1FRGH 3TO2B 3GTNA 3ZKQD 3IXTA 3ARPA 1RJLA 2I5YL 3QUZA 4Y19A 5EORH 3VNYA 3VMOA 4A63A 1S7SB 1X5ZA 2QKIC 2WTRB 3KYAA 5TE6L 1RZ8A 1CICC 2KYIA 3NA9H 3QZWA 2R0LL 4PJ9B 3UAFA 1XCXA 2MPAL 4MAYA 3KYNB 1KIPA 4MDRA 3SGJC 2Y6TE 3HRZB 4YDLC 4OCXH 4HPOL 4HS8L 1OCWL 1E43A 3X12B 4J2XA 1M7IB 3MUUA 1NGQH 4H0HB 4WW2B 4XBGA 2YD6A 1B0IA 3I74A 1IAMA 3L5WA 3PJLA 3K80A 5D2LB 3TBVB 2G5BA 1E4XL 1K8DA 4IKJA 1ZLSL 3UZEC 4FLOA 5AVWB 3WIHA 4HQQH 3X13A 1JGDB 3UTZA 3W1ZA 1OANA 5K9OB 4K3JH 2IH3A 1HQ4B 3QJFA 3PUCA 4E9QA 3AB0B 3U1SH 1C5DA 5DS1A 4BCZA 4AM0A 1UXSB 3CPUA 3P0YL 4O2EB 4K3DL 5IB4A 4TOYL 2NUPB 5KVFH 4XN8A 4HIHA 4HT1H 3VH8G 3ZUCA 2TRYA 1SLVA 2CKBA 3II1A 1OTUD 2A83A 3DC0A 3V9EA 5IHLB 4KRPD 3LYRA 3P1VA 3UBFA 1OK0A 2DWDB 1ZHNA 3SE6A 2A0LD 4IRSB 4AIZA 1MRFH 2I32A 3IU3B 3N04A 4GY4A 4TVPE 4NFCA 2OBGA 3KS0J 4J3WA 2ZSVB 1NJ9A 4NNYB 5F0MB 4YSUA 3QEGL 2Z4TA 1VESA 3M86A 4JMXA 3NK3A 5JZ7D 1QVOB 3D4CA 4XAKD 3GXUB 2PPAA 4BH7B 4HZLA 1TKWB 4ZZKA 1VFOA 5DVKA 2WXMA 4QF1A 1KGCD 3ARQA 2FYYB 1WFUA 3W37A 4W81A 2YN3A 5F71A 5LG6A 1KELH 4IIZA 3TASA 5HI3C 1MCJA 5H4YA 3UTTA 4ISVA 3FCGA 1NEZB 3QFJE 1ND0B 3VU2A 2EE0A 4LDLB 5KZCD 2W5PA 4QXGL 3QDMB 4QCIB 4HIJB 1BQHG 4JG9A 5FLUA 3ZKSD 5EZOL 1XD0A 3STLA 2KH2B 3X11B 2BRRH 5TE7L 5HJ3B 2CIIA 1JFHA 2GJJA 3S88H 2BIQA 1TJMA 2AGJH 4K73A 3BAYA 5DJAB 5HGBA 4HK0B 5D4IA 3QSKB 3UTPE 2FNBA 4L2YA 4KKAD 4OI8A 2ADYA 4WWPA 3DHMA 5D5ME 3MOBH 4Q2ZA 3T08A 1V8HA 4WGWB 4BUGA 2PMZA 5DC2A 4UYPA 2YD2A 1KTLA 1HH9A 5IVOA 5FYLL 2BRRL 4QLWA 1CICB 2VC2H 1PLAA 1A7NL 3G6AB 3DO3A 4IBLT 2ZOKA 3UYRL 1KB3A 2Q1EA 1GMIA 1YN6A 1FFQA 1NGZA 3IJEA 3WTTA 5CILL 3K6DA 4KUZL 5BRQA 4XOBA 4Z7VE 2BSED 3GDBA 3QXVA 2JCCA 1A5FH 3BVXA 2ZWSA 3LIUA 2ZX9A 4PYHA 3ARZA 3ESUF 2XT1B 4Z78B 1HQRA 1VA9A 4ZTOH 4UTBL 1HILB 3UZEA 4O2FB 2ENPA 3QCVH 3IM1A 1NBCA 1PW3A 4JPSA 5AAMA 2UZYB 3QNZA 4NM4L 4OCWL 2ZXGA 2F0CA 2GJZA 1KENL 1DDHA 2B0SH 4LSSH 5B7EA 1UM4H 4NQUA 4WJKB 4H88L 1MWAB 4NQDA 4OZGF 4HOZA 4BBWA 4F92B 1JZ8A 4S2SB 1P7QA 2XXCB 4MAYC 3RDJA 3IVKB 1WGOA 3VFNB 5I1HL 1CICA 4K8RL 1XTMA 1SOSA 3LQAH 4Y89A 4YNYA 5GRJL 4JFHD 3X1FA 3QUZC 4YSOA 2FNWA 2J12B 3IEAA 3MCLH 1AFVH 4FP8H 3L5JA 1JVLA 2XIIA 5I15L 1UCBH 3B9AA 1ZLSH 3EBGA 2YD7A 3FZUD 4JO2H 3SE8L 3MV11 1AD0A 2LU7A 4FQIH 3SE4A 3U36B 2ITCB 4PVNA 2RQEA 4AG4L 5IP4A 1SYSB 1BQSA 1T4KA 3MLXH 1D9KD 2P42B 4JM2C 5EU7C 4R7NB 3O9WD 4QRAA 3X11A 3IU4L 1HEJC 3DV6A 4AGOA 4TMPA 3F6JA 5JIDA 1NFAA 4YHML 4MMYB 3D0VA 4MMZB 5GGRB 3V6OC 1UM5L 3LPPA 5FUCC 1RULL 5IMLA 2VO5A 4M43H 3IFLH 4O02A 4CBZA 4P3DB 5I6XC 5GGSY 1FPTH 4NXKA 4V2BA 1LO5A 5C9JB 3T2NL 3BZEA 3G5XB 2ZT9C 4EI5C 5EDSA 3HBZA 2WUBH 3MRMA 4MZ3A 2QPUA 4R7DA 3BZ4A 2ARWA 5AZUA 2D0FA 4EN3C 3HE7C 1TCMA 2OP4L 3QI9A 4JM2F 2EUWA 4BFIA 2VABA 4BKSC 3MDJA 5JPNA 1DJGA 3OKLB 1CN4A 3KG5A 4V1DB 4NUGL 4LL9A 4MKTA 2Q9OA 2XPYA 3UADA 4AENA 2P24B 5F21B 4DK3A 3DIVA 4F8QA 4ZXBA 2BVOB 3Q3GB 2A6DA 2R27A 3FCSB 5SWSE 2WC7A 2CHDA 4EKXA 4A7TA 1D9KB 3I6SA 4W70A 2E76C 2YS4A 2KLTA 5IW1A 4Z0BL 1FZKA 3BAIA 3HC4L 4IOFD 4NN5C 1UGNA 4X6EB 3EH2A 4PIBA 4E9XA 4FLQA 5E1QA 1N0XL 4FXKB 2HUEA 3TN0A 3LXCA 4UTAL 3HHSA 3EOTL 4C56D 3JWNH 1SF3A 2FZ3A 3CFMA 3JV4A 4BUQA 3BVNB 4CMHC 3ILEA 2VDRH 5AW6B 1JHLH 1CLYL 5DLMH 43C9B 1A6ZA 2D03L 4J5VA 4UT6H 3CFEB 1E8YA 2VLJD 5GIRA 4PRID 5D7LB 4NENB 3MR9A 4AYEC 2APWA 2EYRA 2R69L 1I8UA 1P6AB 3VXSE 4NI6A 4LHUG 1Q4NX 2K4WA 5A2CA 1RMFH 4I0PD 3L9YA 2XXFA 4RFNC 4JCMA 2QDVA 3UGXA 2GJ6E 1T3FA 1AH1A 3GIVB 3CVIH 2UYLB 4Z18A 1KGJA 3CLEH 1X7SA 1J9TA 1I8KA 1E6JL 1M53A 4MQ7B 2WXPA 5A2BA 3VJ6B 3QRLA 3B2XA 3KPLA 3WGUB 2ADIB 3ROLA 4OJFH 3LKNB 4BK8A 2HT4D 3FBKA 1MRCL 1QBBA 4JRXB 1EFQA 3UAJA 3BKYH 2XG5A 3CSTA 1W9XA 3MRRA 3N5AA 3HFFA 4P2QD 2Z7UA 4DGIH 4KQ3H 3KLQA 5F7WC 1LM8V 2FH8A 2HKAA 1ZLVH 1JWMA 4TQIA 2BP0A 3FSZA 3P9MA 3VFGH 1J8KA 1J5IA 3QRGL 2HH0L 5F1IB 4LL4A 1QI5A 1AD9A 2WV3A 1NGXB 2L7QA 1AGCA 4DEPB 2P3YA 5DRZA 1ZIBA 5CUSH 3PFUA 4FYRA 2X1PA 2BSSB 5LN4A 1G87A 1IIIA 1R6VA 3OKMB 3KR3L 1J0YA 3WG7B 4H8WC 3ZSTA 1A66A 3ZE2F 1X5AA 3PWUB 5DK2B 5BO1L 1AR1B 2Q0ZX 2XU9A 4JPWL 1UYWH 3FHEA 5HGAB 5CLTA 5E8DL 4ZTEA 3MUGA 3QDJB 1IX2A 1Q9OA 3SDAC 5HJBA 2A74B 2O5ZL 4OZHB 1P5UA 3QNYB 3N40P 4FQQB 3Q44A 3OAZK 1A0QL 5DJ8B 1A9EA 1BECA 3CSYA 3I6GA 1M71B 2Z31B 3LHAA 2F7QA 1S9WB 2Z4QA 1F13A 3NQKA 1PZ5B 4HLZH 4G42A 3IDNB 1XF5B 2Y1AA 1P5VB 3AQXA 3O6KH 3OJVC 1SLXA 4FFZL 4PBXA 4ZUTA 2ODHA 1CG9A 1OL0A 3QFDB 4LF3B 4NQCE 4Z7IA 4UOQA 4H26A 4QO1B 5K39A 4OLUL 4WFED 4E0RA 2CO6A 1HHGB 4NRYB 5DQJA 2XN2A 4KAQH 1RAMA 3P54A 3T77A 1HWGB 4DN3L 4OZIA 2WBJA 4S11A 1M42A 2WXRA 4Q0XL 4UU9A 2LW3A 1JF1B 3GJFA 2GBVA 5KSBA 3KD4A 4L48A 3H85A 4C83A 3LZFH 2VNCA 3NRQA 4MA8H 4PLJD 4XNQA 1KCWA 2QVFB 4UUJA 1BPLB 1HCZA 3V0FA 1NUNB 1M3IA 1EZSA 3VXME 3GZKA 2XJLA 2NY6D 1NGYA 4V1DE 4GBXC 3D2UB 3ILPA 1PMYA 2FH6A 3BWAB 2ZP0T 1MDAA 1QHOA 4WAFA 1WZMA 2NY0C 1U92A 1DBBH 3KGRA 2F6AA 4OTXH 3E7JA 3BPCA 1H6EA 2P1YA 3EGXB 4TS6A 1OB1A 4IRZH 4X5XA 1GJIA 2XQYG 5JO5A 1NA8A 3KPSA 4H1LG 1P69B 5GGVH 3AC0A 5JW4R 4XHJC 2CBMA 1U36A 4DW2L 2FYVA 1P4LB 3CN1A 1RK1B 3L4TA 4PJXF 3LZOA 2ZOLB 3FCBA 2BY1A 2BOCA 3MV7B 1FSKC 5FEBA 4AE0A 1NL0H 1OPGH 3VX1A 3S98A 4ZPVA 3J07A 2ZD0A 1XH3B 4JX0A 3JWDH 3NIDB 3H53A 1NM9A 2IVFC 3QUXB 5F9JB 2VM4A 4QI3A 2NSMA 1K5NA 1PJWA 4HMDA 3NCFB 1BF2A 1A7QL 5EU4B 5BJTA 4K5MA 1I31A 4UM9A 5KW9L 3KYMB 1I75A 1MCLA 1LEGB 4K9EH 4WI7A 2HPTA 5A43C 4AC2A 3FQYA 3S88L 1NFDA 1BBJA 2AXFA 3CAFA 5GRXG 2WGNB 3DTXB 1I7ZB 5CIPH 4TNFA 3UROR 4PJXB 5TGBB 3T0BA 2MMXA 3VFRA 2ZCLL 1KJMB 1M1XB 1XCTA 2DW5A 3FUEA 2YUVA 4XX1G 4EI6B 1RZKC 1A7QH 5F9DC 4YHIB 4UTAA 1KLUA 2X0VA 4G8FB 3K8KA 1VCBC 1J8RA 3HLKA 2OMYA 5LQBH 2A9AA 5E2TL 1U41A 1EH9A 1IU1A 1F41A 4G8EA 4RDQG 5D2NA 1HXMA 3FO0H 4M9PA 4DEWA 2YJQA 5GGRY 4FQXD 5I1LA 1B0GB 1R5WB 4Z7AA 2ZCLH 5AENA 2V7NA 1U2HA 4PWIA 3S3BB 2PR4L 5B3NA 1C5BL 4NERA 4BFEA 1XSIA 4A7UA 4UDTB 1GVIA 1YJDL 2ZWLT 4FKEA 3FRPG 3HG3A 1W0VA 4XOEA 3TJPA 4OLWH 4HD5A 2GJ6A 4OCMC 1LK2A 3VXRE 5IHHA 3OJMB 3RVVD 4V11A 3G08A 4HWEH 1AXTL 3GRBA 3JTBA 5I76B 2IALB 2VMDA 2GUOB 2BFVH 5C08B 2L3BA 2WLLA 3T4YA 4BFBD 4AJYV 5DA0B 1S7UB 1VKXB 1REIA 4GKSB 3WAJA 4U4BA 2BHFA 2QQNH 4KPHL 3BXNB 1UH3A 4TULL 4YHNA 3RGBA 2F8XC 1VADA 3QYMA 5HYSA 2B1HL 3U0WL 3KCPB 3KLSA 4BEIA 4QHKI 4C56A 3IRZA 3H4FA 4HJEA 3GM8A 2B5IC 5B38G 3C6LB 2P7TB 2Z7YA 3V6OE 1QBML 4UYQA 1MKFA 3SOBH 4XR8C 1FP5A 3THML 3N42F 1IAKB 1RD6A 2WOBA 4WQOA 1BFSA 4D9LH 3G5YB 4GG6F 4L3ED 3CDZB 3VG9C 3BUQA 1MI5B 5DT1H 2AQNA 4G6MH 1EEYA 5DJCA 1IGYA 1G43A 1WDAA 3V6FB 3F5WA 3Q8CA 4N6QA 4EF3A 3PWJA 3WUWA 2WSKA 4WUUB 1ODUA 3UIZA 4P05A 4GKNB 2VT0A 3BVTA 3KMDA 1YYML 4L37B 5TF1L 3BKML 3AADB 4LLWA 2A6DB 4YDMA 3HCVA 1Q90A 5LWYL 3SE9H 1XGTA 3RVUC 2G3ZA 4R96B 4IBWA 1R24A 4HZLB 1QLRA 1DJZA 4H20H 4Z3EA 5KBMA 5HYQA 3HVNA 4D9LL 4KZDL 3RWJA 5IFHH 1G6RL 1R3IH 2ZOOA 1NEPA 2L4OA 2O6EA 1V3MA 2Q3ZA 3PL6C 4R9HA 4WV1C 5F9AC 4BQ8A 1IEBB 3DVNB 5CD5D 6PAZA 1G7QA 4WO4C 5I2IB 1T4WA 4M7ZB 3UGEA 1M2OA 3HEIB 1MFAL 1DJIA 3VGEA 1KN2H 2X2JA 1YQVL 3HE6A 2EE2A 4R7DB 4HX1A 2YPVL 4QRPE 4RGOH 5IBLD 5CJ5A 3LKOB 4PW4A 3W11C 2HVJB 3C5ZC 3GSNH 3P2DA 1C9SA 4LO9A 1MJ7L 3MOQA 3QJUB 1BQUA 1LILA 3IJ7A 3R4RA 2R69A 4JFOB 4OQTL 4PD4J 3MOBL 1R3KB 3K81A 3D0VB 4MMZA 1EEYB 5DJCB 4LARH 1NIEA 1ZE3H 2EDMA 2BVTA 4HMCA 4GKOA 2X2UA 4F8LA 2FJSA 2KI6A 3NDYE 7PAZA 5IB3B 5L8JB 1FFTB 1TZ8A 1H3TA 4Q9RL 3L3DA 2D7TH 2VRAA 3HAEB 3KPMA 3F7YA 3LXBA 1BP3B 3EOTH 3OR6A 1KB5B 4LIQH 4ADJA 3CFDA 2B14A 4PLNC 4L0YA 2P5EB 3SDAB 5DUBB 4XPTH 1Y6KR 2R1WA 1XBDA 3GSNL 3U4AA 3BVWA 1OSPH 2N01B 1WIOA 4NRXB 3DPBA 1MI5E 4FABL 3B2VH 4JZNA 1QRNB 4UT7H 1M9SA 1LDSA 4JPIA 4OT1H 1T7YA 3SBRA 5DJ2B 2IPTH 2QGBA 5GRVK 2ADJA 4LCUB 4ONGH 1DLFL 2AK4A 4LPVA 5DK0B 1RUKL 2JLPA 3DJSA 3G5ZA 5E6YA 3KBHE 2AKRB 3DYOA 2BVQA 2JKNA 2OULB 5AW1B 5JOFA 1UT9A 1R3LB 4G8GD 4L3FA 3JQOB 5I8OL 4MD0B 3CJJA 3VXSB 1MF2L 2Q7AA 1G7HA 5I24A 3QNZB 3FTVA 4OFQA 3X3FH 4EUPG 3RFZA 1IGFH 2GSIB 4J3OG 4ECNA 1KZQA 3QDGD 3QG7L 2OJ1A 4I8DA 4NP4L 4OJFL 5GRJH 4AQAB 4RGND 3C2SA 5DC4B 3STZB 5H35A 1NFIA 5ESVA 1IQWH 3FYEB 2NW3B 3WBDA 3EYQD 1R5WA 1W8NA 4PGBA 3HMXL 3K1KC 2NX5B 3MBEC 2AV7A 4HJSA 3PDOB 4WEEA 3D2UD 4GSUA 1BQKA 3LNDA 5E9AA 5MERA 4DQOL 4BE6A 4M8QB 4U1NB 1NMAL 3JYCA 3MLZH 5DZJA 4B50A 3AFLA 3ARGB 2BRQA 4NN6C 5AW2B 4Q97A 2E4TA 3P69A 4LCUA 4OV5A 3ETBF 4JHWH 3GHEH 1V05A 2BP8A 2AV1A 4LL1A 2QQNL 5AW5B 5SWSB 5FDWA 1SVZA 4KPHH 5C0ND 3CPLB 2KDGA 1ZLVK 4ZDHA 5CWSB 1HHIA 3FOLA 5B39G 3X1NA 4A68A 5KS9E 4LLDA 5A7BA 1MCSA 4H8VA 1GZQB 3HJEA 3IPBA 3KBFA 4AH2B 3EOYG 4E5XB 1A4KA 3FT3A 1KGXA 5HHMD 4ZD3H 3BSHA 3HNSL 1WVZA 2CO1A 4F57H 2WNWA 1PQZB 2EC8A 2CJSA 5ALCL 4PTTB 1XD1A 5C07D 3WMPA 3V4UH 1QKZH 2AABH 4B95C 4HIJA 5TD4A 1L0QA 1DSWA 1KCSL 3KLHD 5JNYB 4CDHA 3TT1H 3MRCB 1E9QA 4YDIH 4XXDB 4BINA 3BH9B 2AEIT 3JUZA 4FYQA 2XV3A 5EZIH 2A9DA 4AKPA 2WBWB 1YEJH 1JHTB 1PX8A 1XH0A 2J1ZA 3DIDA 4PRBA 4HUKB 5JHMA 1J88A 1BLNB 1LLAA 4GG8B 3OPUA 5DEGA 1AGBB 3VA6A 1XZ0A 4X4XA 5T1DH 2X12A 1CE6A 4XNMB 2WO4A 3IFNH 4HHAB 2EAEA 4JREB 4G1EB 1OK8A 2IFFL 1QO3A 4M6NH 3GI8L 3QPQC 5EZIL 4OI7A 5BZXA 4UM8B 4DO6A 4HFWA 3ZR5A 3JT2A 2Y6SC 4G72B 4KO9A 1T83A 5GHWH 3PWLB 2EC9T 3JV5A 3RYMA 4WWOA 1EQWA 3VXQA 5CBAB 3IETA 5FKPB 4NZUL 3G5YA 4JLRA 2WCGA 5HHOE 4P5SA 1OHZA 2V5RA 2XPGA 4ESKA 3CZNA 5ADPL 1JV2A 2PR9A 2QFPA 1EAPA 2DMCA 5B3JE 4PJEE 4GRWF 2R23A 2KQMA 4OJDH 3TT3H 3VGHA 4X6DF 1PIGA 2HFFB 4RSYA 1GGBL 3IPFA 4NUPA 4TNEA 4WI5A 1KT2B 4NUMA 2G5BB 1AZUA 1A6WH 1P7QD 2G60H 2VB5A 2L7UA 3PWNA 3WJLA 5M7QA 5B1AB 3ALPA 5DEFB 1AHWA 4WWKA 2HFGL 1I8LC 5AL8A 4B9GA 3D6GA 4GMSH 1V54B 4TPRL 4Y16A 5G4NA 3UTSE 3VXUE 4JZJA 3KYNA 4LE8A 1OPGL 5FHAH 3CZEA 5CN2A 3I6KB 1IZKA 2I25N 3EOAB 3OMAB 1W0VB 3VGGA 1EEQA 3VXOA 1BFOA 3ATAA 4N87A 3F7VA 2ZXDA 3GEFA 1PZSA 5F7DA 4OBSA 3I6GB 3VGAC 1T1WA 1D7DA 2B1OA 4U3XA 5IGXH 2K6WA 1S2EA 4EXKA 2XZQL 2XVKA 2HFGH 3SDXE 3WFDL 3GMMB 1DSFL 1XO8A 4U1HB 1SHSA 1B3IA 4TPRH 3X17A 3QQ9D 3QORC 5TDOB 2N4IA 2A74C 1G7HB 5B7MA 1MUJB 4FLSA 3UC2A 2EEXA 3GSXB 1DANT 5F7EL 4GRWH 2O6PA 5D2NB 2D7QA 5D2NE 4MXQD 3US9A 3SJVB 1TZIB 3TCTA 1OAKL 5AYUH 3M1OA 2VJXA 2WKOF 3EHBD 5BQDA 1JPSH 4YSTA 1AGFB 3CVDA 1J0KA 3G6JE 4GW1B 4RGNE 4X8CA 5DLLA 3V5DB 1K5WA 3AY4A 3L17A 1QSEE 2RJMA 2IAMD 1VEPA 4RDBA 5I1IH 3AS3A 3L9BA 1T80A 3KPTA 3O2DH 4OCRH 1ORSB 5E2TH 2F8IA 5JDJA 5TGBA 4XCEB 2H9GB 3TESA 3CXDH 4N3TA 2Y06H 4PS3A 3O41A 5DUMH 3L8QA 1L4IA 3O6KL 5KVFE 4MDJA 2V17L 4QRRE 1FCCA 4BELD 4EXPX 2IANE 1HNFA 1BMZA 2ZG2A 2EJ1A 2PO6B 5D96B 5IHWA 1KBBA 4XMPL 5CIPA 1MFVA 2CBOA 3RZCC 3L4YA 2CAKA 3L4CA 3S4SB 4FQCL 1DVYA 2DJMA 4DN3H 1WWAX 3LZRA 4UBDD 5SWZE 4NNXB 5IJDC 4MZ2A 3VI4E 3ULSB 3OKDA 5I30L 3O6MH 3ULUD 1ES0B 4M48L 4JCLA 3LZFL 2CLRA 3OKKB 2VN6A 4DGYH 4EPSA 3ARBC 1AYRA 1I1AD 1CU4H 4A6YB 1OCOB 3W5MA 1IAII 2VUKA 2YZ8A 1P1VA 1KEGH 3IB4A 3VTMA 3D69A 5IVZA 3LRSB 2ZSWA 2FBOJ 3DGGB 4KVPA 4TUJB 3BN3B 4DGVH 1KSRA 2DKSA 4I0PA 3L6FB 3FMGH 3WNNA 1ZA6A 1WFOA 4N5EC 1RZFL 3FB7B 3NGBC 4OTXL 1E30A 4FEMA 3WHXA 1TITA 3P3YA 3ULVD 2VDML 1MRDL 5MEPB 2V2XB 5HHNB 1N67A 2PTTA 1FO0B 5IF0B 3ZTCC 5KSUA 4YIQB 4L1LA 4F7EB 4H8HA 3RU8L 4GNKB 5BZDA 4G6ML 1EFXB 2OXHA 1UENA 4DKFL 1YY8A 2BNQA 4WWNA 2E7LC 5ACZB 3ZE1F 1J8HA 1PNDA 2JTDA 3E8UH 1T7XA 4JM4H 1V55B 4MWFB 1DP0A 4ORZC 2DV6A 5TF1H 1GGUA 2Y7QB 2CO7A 5CGBA 1JGDA 1GCYA 1NTDA 2P4AB 2CR0A 3GJFB 1XF3B 1YJDC 3QO0B 4N0RA 1CL7I 4BSWB 2J5LB 5KSBE 4XP4H 4DP7X 3HC0B 3KXFE 3TO4B 5DZPA 1I3UA 4NO5B 1OP3K 4P9HL 4HHWA 3FT1A 3EJCA 5C0AA 3D12B 2J71A 1QASA 1XB8A 2GBUA 5C6TH 3BZ4B 1HWHB 4R0LA 1KN2L 3WNIA 1YQVH 1NLBH 5EWIH 3GNML 4ZYKA 4FXTA 4WTZG 4WTXA 5E9DD 1P5VA 1H8LA 3LRMA 1BOYA 1IM3A 3E2HB 4FFTA 1CDHA 1NAKH 1SOQA 5FGCE 4GI9A 1PKQB 1VHPA 3QIWD 3VSTA 5BV7L 5CJXC 3ZDYF 4FTVA 1SYVB 2EEBA 3K3QA 5C08E 4JFYB 5EOQL 3U4BH 2ZKHL 4EVNA 5C6TL 4XE0A 1CURA 2DY2A 2NDGA 3BAEH 1F11A 2WIIA 4AEHH 2IDQA 1SYSA 4FG6C 3ISYA 1XIWD 2QLVB 1DVSA 1E2WA 4ZFZA 2K9UA 1BIIA 4DHLA 3V4VB 3MKKA 2B3RA 4R8WH 1MG2C 5SWQB 3VWKC 1N7MH 3GPEA 4XMTA 1XVSA 2OMYB 5CJXA 5EH1A 2KMWA 4K8RD 4KRMB 4RAUB 4OT1L 4R3SB 2EIZB 2ODIA 5TDPA 4UTBA 4XN1A 3W0WE 5GS3A 2CDFA 1O9ZA 2OAAA 5E5MB 2Y1YA 4RH4A 4R84A 2NQDA 2YIHA 4HK3J 1HIMH 4WY7L 3GD1C 4NC0B 2WLNA 2MNWA 4L4JA 4LT7A 4LVOB 4R0LC 4D0CA 4YVUA 4WCYL 5DUML 4JN2A 3ALWA 2LOEA 1WFJA 5FF6A 2PP7A 2XJKA 4PP2A 3NZHL 3HMWH 1MXGA 4FFYL 2X42A 2K3HA 4AMXA 3GJFH 5J6GB 1DBML 4ES9A 3H7BB 4DVRH 4G43B 4DIXA 2HVKB 4KMQA 1T1WB 3II3A 4ODHL 5JXAH 3IGAB 5GGTH 4PJDA 1Z32X 2EE3A 3LSOA 4KNSA 1GYWA 3UCQA 3EO9H 5HDBB 4AYDC 5L8KB 2NY4C 2JXMA 2WZPA 4UNUA 4I3RH 3KJ4B 3G5VB 3NSFA 2OK0L 4F2FA 5I30H 1DQJA 2R4SL 3K2UL 3OBAA 3QNXA 4JFSA 1BVKB 2E7LA 3FONB 3PQYB 4P4KD 1F56A 4F1ZA 3FJTA 3PWPD 3OXSA 4AY0A 1FFPA 1KTDA 4B7LA 1B4JH 2CKBL 3FU3A 1X7TA 3O0LA 3VXRD 2X70A 1RK1A 1FUNA 3Q5OA 3TVMB 1KEGL 5I1KH 1IVLA 5DT1L 4HKZB 1U93A 4YOKA 2EKJA 1I7UA 2DF3A 3WS3A 2MNUA 1EBAA 3ME0B 2YA1A 4LHUA 1GGIL 4I0PC 1LO3L 1NIAA 4QKXB 5CJOH 5B1BB 1H8SA 4HK0A 2NR6A 1M6OA 4QTIL 1NKGA 2VDQH 4YGAB 3D0AA 3O2WL 2AP2A 1EJOH 2UXTA 4TSCL 1MRDH 1KGCE 4YSAA 2K6ZA 3MUHL 5ELIA 3ZDXF 1XBRA 3EYVA 1USQA 1X5XA 5TQ0L 3NTCL 1J9QA 2F53B 3CSGA 3RP1A 2AHIA 1X5FA 3ZHFA 4EZMA 2VZUA 2F58L 1PNCA 3ARBA 3RU8H 5C0CB 4ZRGA 1HHKA 1AXSB 2UXFA 1AQDA 4ILDA 4WFFD 5AZ2L 3U4KA 2OYKA 4GUPA 4YIQA 1ZVSB 1PKOA 4PUBL 4PRPD 4KWUA 4YXLL 3ES6A 4A2LA 5L2KB 2MRYA 2Q10A 3QEGH 3R7RA 3RZCA 2AJSL 2AS5M 2VM3A 5HVWA 5ERWB 1YEIL 1ADWA 1SFHA 5CSBA 3WOVA 2HMID 4JVUA 3OZLA 4FEIA 1PDKA 2RA1A 2F58H 3H54A 2A2QT 4L2LA 4YR6B 3T77B 1ZGLM 2EIMB 3E6FA 1NBYB 1A22B 5EU6B 4AQZA 1E8XA 3C5SB 4K4KA 1X5LA 4L4TE 5K39B 3ZZ1A 3OMZA 4RZKA 4XPTL 3I3DA 5KYXB 1SJEA 2OI9B 3O3EA 2QR0A 4RA3A 5SV3A 3AY4C 4JUTA 3BEVA 1ECZA 3LV3A 5TE7H 1GZHA 2GW5A 1G7IA 3HZVA 4F15B 2XV6B 2DIEA 4JDEB 1MQKL 2VWEC 4MJ6B 2Q86B 1C5DB 2P28B 4FQQA 4KH9A 4M1DH 2DIBA 3EYSL 5EU3A 5KVEE 2A74A 3QZPA 4Z77A 4GW4B 1UKTA 2OLDA 4Y7MA 2NW2B 4B9ZA 1F45A 2BJMH 4QRRA 4NFDA 4QHMB 2A0LC 2X1QA 2ZOUA 4HJTA 1AR2A 1RUPH 3HA0A 4N9GA 5DQ9B 4ABVA 4C47A 4ABUA 1VRSA 1F0LA 4AW4A 5J3HD 3O11B 2HX9A 4XNAA 2HMIC 2WKOA 3TV3H 1A7PL 3AS2A 4HJJL 4GKSA 1ZIAA 3QIWC 5EUOA 3W9DB 3WENA 5DSCB 2JQAA 3FZUC 3O81A 4QAMB 1VIWA 4OGAD 1WZKA 3AU1A 4NBYB 3WTYA 4MYWB 4YC2C 1P7QB 1MAJA 2DQCL 1A5FL 1SF5A 4MJJA 2AERT 2NZIA 3NESA 4W9KC 4Y16C 4J3BA 1XFPA 2FJUB 2VISA 2VR8A 4WWKC 1AHWC 5IFJA 4JJHA 1P2CB 3L81A 3KPOA 3MMEB 3B2UD 2FBRA 4W93A 1HS6A 1YEGH 3TCXA 3QCVL 4LB8A 4ODSL 5JMRA 3O0RL 4R7LA 5FC9A 3L5IA 1TOXA 3QJZA 1KACB 1M7DA 5J11B 1T5WA 2XG4B 4HPHA 2NLJA 1X5HA 4ELME 4FULA 4F58L 1AO7D 2J8UF 1NBVH 2VN3A 4M00A 4U1IB 4U6YA 1SJXA 4PHZA 3VVVA 1E9OA 4I3RL 3PABA 5B22A 5L4MA 1CGYA 1TPXC 1J0HA 1R9FA 5EO1B 2R1YB 5T1MB 3D0LA 3KPPB 4NB7A 1MW1A 4TNVF 5DK0A 1BGXL 5D7IF 2PCPA 1HHHA 12E8L 1S46A 1T83C 2DZEA 3TWCL 3VE0A 1NDMA 1X9LA 1KULA 3R0MA 1D6VL 1KLGA 4PGDA 1IBDA 1SY6L 4NQEA 3RE0A 3PJSB 4YUEL 4AQ8A 4TLSA 1T5KA 4HWBL 4OZFA 1OD7A 2CLZA 1BYOA 2F53D 3P4NA 1X5IA 3SYCA 4ZK8A 1H19A 1QUNB 4YHZH 5FWRA 2A4CA 3PWPE 2DLIA 3IU4H 3MRQA 3CSFA 5E0FA 2IEPA 1LEGA 1HDMA 2G0LA 3QZNA 5C0NC 2IAND 4HEPA 4NKDA 3IFPA 2DM7A 1YEKH 4HV8B 4PV1C 3V4VL 4PRDB 1I1YA 2ARJQ 5IKCA 4NIYE 3CHSA 3QNFA 3ZTEA 4UQ3B 4XPAL 2H26B 1NGWA 1BMGA 2AEPL 2YBGA 1UWGH 3D18B 3KPRB 4HALA 4KXDA 2EXYD 4LCYA 3GXIA 1T7VA 1QNZL 2IFFH 1JXKA 3FO2A 1R75A 2FYYA 3KWWB 2E8YA 1N64H 4YLBA 5IY5B 1DHKA 3EHBB 3ECBA 5BV7B 3C5SA 3AT0A 3RNQB 1USZA 1KXTB 3POHA 1FE8L 1IE5A 1EK3A 4KI5D 5J6HB 2AXWA 3WMSA 2Z1KA 1H5BC 5FHBH 1T5XB 4NZUH 4PJBF 4NNYA 1E4HA 4XPAH 1H3UA 1FNAA 2AZAA 1YC8A 4FJZA 5CEZE 1HK6A 1ZEAH 3RB7A 4CU8A 4U3SB 2C4FT 1NEZG 2BHUA 4NYLA 2Q76B 1EXGA 3EFOB 2A1WH 3AQZA 1XR9A 1E9QB 3ZT6A 1FGNH 4E36A 3CHOA 1XEDA 2F9BT 3PPSA 2JIXB 3OJ2C 2R59A 2GAZB 1WK0A 4DPBX 1H9VA 1RIHL 2XG4A 4XCNB 2GJ6D 5GZNC 1RUML 3Q6FB 4B9PA 3NFPB 4TVSa 5ID1A 3COOA 5KN5B 4EBQL 2ITEA 1HDMB 3QQ4B 1EJFA 4M7LT 5ICYA 2VJ0A 3RGVB 1SXCA 1KGIA 2WOYA 3RTQA 4LLQA 4AH2A 4GT0A 4Z7NE 1M6OB 5DQDH 5ACLA 2ZIDA 4HWZA 1YECH 1IC1A 3L48A 5HYJB 5JPMA 4CC4A 4CGTA 3L5WB 1FO0L 2ATKB 2ADGA 1H3PH 1OEZW 1F18A 3WNPA 1SEQL 3U7WL 5FA3A 3KWTA 3KWVA 4YNYB 4EBQH 5C08A 3MV9D 2BS8A 4XO4A 3G08B 4XX1E 4KRPB 1ZY9A 3TO4D 1KIPB 2HCZX 4U7MA 4JN1L 4PV9A 1WHPA 5AWNH 3ZYJA 2AMGA 4W9FC 2J6WA 4RISH 2QVMA 1DBAL 5AB1A 4GFTB 1M7UA 4K23H 3Q8FA 1K8IB 3QXWA 4PJAA 4W9LC 4CILA 4OF7A 1NAMB 3NK4A 3AT8A 1D5XA 3QPKA 1Q9WB 5LKNA 4ZMPA 1T89C 2Q7NA 3VFOA 3F7RA 3H7BA 3PV6B 1NC2B 3RUGE 4KDTC 4AEHL 2EYTA 4P5MA 5DJXA 3EBIA 3V5KA 5E08L 1J5OL 1Y6MR 3NJNA 4LCCB 3NA4A 4D0CB 2CUMA 1J8SA 1S7TA 3V0WL 1OTSC 2P52A 2AEWA 4TUOA 1X4YA 1UCTA 3M1BB 2PWHA 5DXWA 5BZWB 2IF7A 3FU7A 5BS0D 1TTGA 2X3AA 3MREA 3D3VE 4M1GH 4UT9L 1Z0MA 4M3KB 1IJ9A 4PV8A 5GJSL 4BK4A 3ZIYA 1O6SB 4DEUA 1S9VA 1X7QA 4H1LH 4P8QA 2J6EL 4KROB 2HP4A 3EYOA 3QUGA 7TAAA 2WK2A 3C5ZA 1PZAA 1XCTB 5FA4A 4DZBA 4I2XB 1EEUA 3GMQA 1QZ1A 3U2SA 5SWQA 2ZUWA 4YE4H 4XTRC 4L3CB 3CQPA 2NY1D 4OM0H 4DP1X 1EEZA 2FX9L 4NRZA 4RAVA 4XMVA 4ZPTA 4M48H 4WO4A 1CL7H 4QNPF 1NCIA 2CWRA 4R4BA 3PL6A 4M1GL 3KEHA 3BP5A 4S0HA 1DBMH 5IFJB 4EVNB 3NCWA 5DCCA 2JELH 3ULUE 3ASNB 2EUVA 4NJAH 4PW9A 5JHLA 1YY9D 4OD1H 1EJ8A 4Q7DA 5HI5D 2J1WA 1EA9C 5SX5K 4EQ3A 1MI5D 3V7AG 2JB6B 3OGCA 1PL3A 2N7SA 1WWBX 1OAZH 3B3BA 4OM0L 5I9QB 2FX7H 4UNVA 1RZFH 1FIGL 4HOMA 5ISZA 5C07B 1NCAL 3MRKA 5C09B 2E3VA 4AVIA 4JE0A 4MTMA 4HUVA 4LASL 4BUHA 1TQCB 1BM3L 3KPNA 4RQQA 3GHBH 5I1DA 4EQ2A 3CZFB 2WLHA 4XVOA 4XN5A 3LN9A 3RUGF 1CGXA 2D7PA 2EABA 4DKFH 2GEQA 2ZUUA 3DX1A 1ZA3A 1B4TA 4IBSA 1DQMH 1UG9A 3MRHB 3IDIB 3K1DA 2BHYA 4RDQF 4UIKL 4HIPA 4MS6A 2GC4C 4F8NA 4MNHB 3TPUA 3WKNA 4LSVL 4EJ1C 1BFVL 1JGEB 1NCAH 1Q9KB 2FZ3B 3ES6B 4QRBA 5DWUL 3FAWA 3FO9B 4WUUA 1WICA 3MJ7B 1EXUA 2QADC 2QSTA 3I02A 3Q6GH 5IWLA 2D0GA 3BSZH 3NH7H 1N6QH 3H2QA 3ILPB 4GQ9L 1AOHA 1OD9A 4HW6A 1WA2X 4I85A 4MDIA 4WKZA 1YVLA 1TTAA 2AF2A 1YNLH 1U42A 4NQEE 2F8VA 2W65B 2YFNA 4UIKH 1ZT1B 4HJ1A 3GSRA 5DC0A 3MA7A 2Y7SA 5JIIA 1FJ1B 5I75C 2MTPA 3PREA 4LLMA 1SUJA 1FH5L 3K0WA 4DTGH 4APXB 4BGLA 3VXTA 1DUYB 4LCWB 3UMNA 3L6FA 2CSPA 1ZXQA 2WBJB 1KY7A 1NAKL 4PYGA 1TJIL 5IR1A 1CIUA 2BMKA 5LLIC 2OPCA 4W9JC 3MJ8A 1IGIL 1PYWA 3UJJL 4RWYL 3W2DL 5DFWH 3FS9A 1JI2A 5EF3A 5D2NC 5CO1A 4A39A 1TNNA 2OL3B 2QELA 3BUIA 3MXWL 1DVXA 1MY7A 4GXVL 3A6BL 2K3TA 3P2BA 1NCDL 2VDOH 4OLXL 1FH5H 2CLRB 4DTGL 4X5RA 1S7RA 5LGHL 1T03H 4HF5L 4JO4L 1UT1A 2WQVA 3O4LD 4U1SB 4M56A 4M3HA 3BRFA 3MTRA 2JF1A 2I07A 1W72B 1F11B 1A21A 4YFEA 5KW9H 3WY4A 3CWGA 5CIPB 2DQJH 3QJQB 1MQKH 1SHWA 2QADD 2DQHH 4F93B 4F7PA 1GS6X 4GQPH 4P9MH 4W9IC 3EYSH 5T3XE 3T0EC 3RHWK 4AMWA 2IH1A 2XY2A 4KJYA 1BQLH 1J5OH 3CUPA 1I7RA 1HXMB 5DFVD 1CDCA 2YAFA 2J8UE 2P8MA 3O41B 4QIRA 3MBXL 2WQRA 1RUPL 2MH4A 4M62L 1N5YH 2C9RA 2BWIA 3GXTA 3AXLB 4X6FB 5HGDB 4PRPB 1UD5A 4X6CA 4HULB 2IANA 1MCCA 5E23A 3ZPDA 1WIPA 1A7PH 4HJJH 3K91A 1HAWA 3BYTA 4FG2A 1O9WA 3ZTNH 1HCVA 2QTEA 1NGXA 1BBDH 4JDVA 2R2EB 5FFLA 3UACA 3UG4A 1U8PA 3CMGA 3EGSA 1JGUH 1OAUH 2Y7MA 2VQ1B 2R4SH 3K2UH 3RDTB 3OKYA 3WXWH 2WN3A 3FTYA 4GXUM 1SDAB 2PO6D 2XETA 4R2GD 3BH4A 4Y9BA 4IOSD 3SGDH 5JHDB 4N2DA 4N25A 2J88L 3O8XB 4L8SA 1NC4D 2FECI 2F54B 3EDDA 4U1HA 5HHOA 1TJXA 1QSFD 1GJUA 1SXSA 4GRWB 1D5XB 1XH1A 5TE6H 2YSSB 5EPMA 4PWHA 5DD0L 3T0WA 2VR3A 4Y1SA 4AG4H 4NEHB 3E1F1 3ILQD 4R6UA 2H32H 5SWZA 4JKLA 4PRPA 4OLVL 3V9CA 1OGPA 2DWXA 3GT6A 4MB4A 4NO2A 4PV9B 4E41E 1CO1A 3O6FC 1NCWL 3B9VA 3QEQE 5SX4H 2QHRL 1P0SE 2NY3D 3UGUA 5DRWB 1JL8A 3UTOA 4QOKE 3MRHA 1OQXA 2E74C 5DMKB 1A1OA 3M7FB 2R0KH 4PI2A 4QRUB 5B38B 4E9WA 3B2MA 1IKNA 4NO5A 2NY3C 3UG3A 3DRTA 2WN2A 4P4KC 3QFJD 1IL1B 1QBLL 3L5XH 4X7SL 3RWDB 1G7MB 1GH7A 4P2RB 1AHMA 1QSFE 4YXLH 2XSKA 3GBNL 2IOMA 5DWUH 2OYLA 4UAOB 1RZJC 2BIPA 1ADQA 1KDIA 1NGPH 1XWVA 1DBJH 2Y23A 3FRUB 3BFOA 2VERA 3A0OA 4PRHE 5AKTA 1KGWA 1T7ZA 5I0ZA 4G80B 4KK6C 1NPUA 1VEMA 1F4HA 3ASWA 4I87A 3ZKMD 1U21A 4RNRA 3NJJA 4IEFB 4JKNA 1BXUA 1U3HB 1UD4A 4JPVH 1V7MH 3ABMB 2QLYA 1BZ9B 2AK4D 3F12A 1YPZB 4YDNA 1PCSA 1BVLA 5JHDE 3K6FA 2DEYX 1EEZB 4RAVB 5J1AA 1Q94B 2YGNA 4UINL 3APCA 3DUHA 4DK6A 4NHUB 1Q94A 4QKTA 2RH0A 4X9HA 1G7PB 5GS1A 1F97A 3CHRA 1SDDB 5JHBA 3KM1A 1KOAA 3AWGA 1P5UC 3WGVB 2EEFA 3DJTA 3BD4A 4Y19E 1CD9B 3CSPA 3OJDA 4WVRA 1DL7L 4BSJA 5L2JA 4HXAH 1BD2B 4HBQA 1J8HB 2V3DA 3SDCB 3CFUA 3OSVA 4H5SA 5FDYA 5FM4A 3II2A 4M1DL 3N0AA 1ZEAL 3ECWA 3TBCA 3BPNB 4LVEA 3SKNB 1DYZA 5KOVC 4PGCA 4LARL 1KCLA 3T3PB 4JG1H 3BP6A 4QYOA 4AVJA 5HPOA 3HAEG 2YD8A 4JY6A 1IFRA 1UOVA 2UY6A 1OLLA 2ORBH 1VFAB 4MCZB 3TNMB 2ZE0A 4Q9RH 2QMJA 1I8IA 4OB5H 4MJIB 3ZQWA 1ZA6B 2WB1A 1IL1A 1RUMH 1CDJA 2AGJL 4FHKA 3SO3B 4URTB 2FT8A 2PKDA 3SN6N 1SJMA 2FQFA 1KLFA 1QLFA 3PAUA 3AG1B 1AG6A 4JHAL 5E00B 3I9GH 1ZDQA 2KL6A 3F83A 1EVTC 3I50L 1N10A 1OY3B 3UAJC 5JQ6H 5KS9B 3D48R 3WCYA 1NCTA 4FE9A 5EEZA 3W81A 2E7MA 4ONGL 4M5YL 2Y4SA 3M1CA 5IMKA 1X5GA 4AEFA 2E4FA 3ARXA 3ULSA 2FIKB 2WLIB 4KZEH 5EBGA 2BMKB 5DZAA 1NBVL 1E2VA 1RH8A 2XDHA 5A6LA 2HH0H 5KANG 5BVPL 4HWZB 1F8TL 1JRHH 5HYJA 5T1LD 3X3FL 1CVRA 2B15A 4MQXD 3Q2WA 1MNUL 5CM1A 3VD7A 2ZAHA 4RISL 1DBAH 3KPRE 5BRZA 1JVKA 5DI8A 1MVFA 4YDJB 3B37A 2OZ4A 4U1MA 3PHSA 2A77H 3G9VA 4HCGA 2LLLA 3VXNA 2OCJA 4Z78A 1FFRA 3QUHA 3C5ZB 4YUEH 4DZBB 5IUCA 2HJFB 1UB5B 1YUHB 2B5IB 5I16A 1OXYA 4DUWA 2R7EB 2W07B 4NOBA 1ACYH 1ZLDA 4MD0A 4MXWH 2XZCH 2BW4A 5I1HH 3LRGA 3OWEA 4UM8A 5MI0B 3TN0C 1NGZB 2ADFL 4HH9A 5CU9A 4WFEE 2O5XL 3CFJA 3HPLB 3QHZH 1YSOA 2P8MB 2AK4B 4GP8B 3X1GA 1RP9A 4WUUD 5EEYA 1MVYA 3GGWA 2Z65C 1JI1A 4IRSD 3HE7D 1KCVH 2QGCA 2BIIA 32C2A 2ZKYA 2YN5A 3ROOA 1R5VA 1VGEL 4FXGB 3QJOA 2CQVA 1RJZA 1JHTA 1HAUA 2VRQA 3QZWG 4YDVB 3WDJA 5JZ7C 1CGSL 4CVXA 5JXED 5DU7A 5JPNC 4PPTA 4UIMB 1I9IH 3FT9A 3F7VB 1INEH 2LQRA 4JKPL 4O51B 4Y2OB 5AW4B 5C2BL 3BKCH 3QI9C 4XPBH 5JUEH 4WJ5A 4K3HA 4EN3A 3EAKA 1UA7A 3VXSD 3WJMB 1CGTA 4MJ6A 1U8LB 4PRIA 3PHQA 2UXGA 4C58B 3KLKA 1AR1D 4OZFH 4EI5A 5K69A 1OTSD 5CZVH 1K4CA 2WXLA 2UX6A 2XNAA 3N1MC 4HLZG 4QY8B 4UM9D 4XNBA 5DFVC 5FECA 3PL6B 2FX7L 2VLKA 3ARDB 4IKLA 5JLZA 4UCFA 3V6OA 3VB8A 4XB7A 3QDGB 2XQ0A 4LEOA 4E9TA 4X7TA 1GSKA 3P4OA 3PDDA 3FOMB 4PB0H 5CCKH 3VXTB 4MFHA 1E8ZA 1EJ6A 4B9FA 2P80A 1LE5B 4JM2A 5IVXE 4FXGA 3FW6A 3VI4B 4KTEL 4HUWA 3QQ4A 1FGVL 2C9AA 2IWGA 3D07A 1JNHA 1IEHA 4HCRA 1U91B 3ARFB 3S36L 1VCAA 4S1RL 1A2YA 1U6AL 1JZ7A 3AROA 1XEUA 3IU3A 3BIKA 3TNNA 3VYPA 3QQDB 4DUXA 2J8UA 2I85A 5EO1A 2FX8H 3L3OC 3N1PC 3MU3A 1G7JB 2HPOA 2WY3B 1YECL 3GM0A 1YDPA 4IS6A 3V5KB 2JCCF 3WKQA 1OCRB 2I27N 3VVWA 4OZ4A 4CSZA 2E27L 3DSFL 1OGSA 5EG6C 4S1RH 3WKYA 3PGFL 3ZHNA 3U1QA 4EMZA 3QULB 4N22A 3OC5A 3U82B 3ZL1A 5KS9A 1LE5A 1FC1A 1AY1H 3DX7A 4XMKH 5AAMC 2G60L 3FSAA 2YD3A 2R69H 5FB8B 4N8CL 4NPYA 4FFYA 2IOIA 2PTUA 3MACL 2VSCA 5D7LE 3CD4A 1AYOA 1DBKL 4XXDA 3M07A 4B5EA 3B1TA 3RWHB 5TPWH 3TA3D 1VACB 4HS3B 5I8EA 4GP4B 2CUIA 1SMAA 3PE9A 4C56E 4H0IA 3PGFH 3MXWH 3HB3B 2ED8A 5FK9A 2WKGA 3NQIA 3KGUA 3ABGA 5AW7B 1F8TH 4B9KC 1QPXA 4NKIL 4QHMA 4IBZA 4L3EA 3SBPA 1ZHLB 1RLBA 3UX9B 2W8CA 3AQDA 2R9HC 5SWZB 1YMHA 1YNKL 1XT5A 5C3LD 5SX4I 1DQDH 4ETYA 4QOKA 4A6YL 3VWJB 1SBSL 5C0RH 4KHXH 3D8MA 5GISH 1JOIA 3UTQB 3GEWB 2NY5C 4UBDC 2ICCA 6PCYA 5FYKL 4FQHB 4MD4B 2JB5H 2DQEL 2FB4L 1AJ7L 4BV1A 2WLZA 4PGDB 1X44A 2APXA 5L4IA 4PLJC 3BEVB 2QMKA 4DKEH 3DTDA 1WPCA 2YLKA 2C1PB 3IJHA 4LK4A 4GMTL 3K8MA 4GB9A 4QTFA 1CPUA 2FX9H 2QL1A 4FNTA 4CVUA 3LOWA 5B4MC 2BFGA 3SKNA 3LVEA 3MGTB 1JF5A 4EKJA 2O5XH 3MGTA 3GBEA 1TFHA 1G9NH 3D06A 4YHIA 1JK9B 2BVPB 3BD5A 4G8FA 4YGVA 2JELL 3JV6B 4GQZA 2WCSA 2W07A 1D5BA 2HG5B 3H42H 3H9SA 2ERJB 3BDYL 1KPRB 4KKQA 5DJ2A 5EIIA 1KCVL 4W6XB 4L9DA 4JW3A 4ZUWB 4CN6A 5M94B 2UZPA 1ZLWK 1I7TA 2DJUA 3OV6A 3VXPB 2QZ5A 3KVQA 3CLFL 2CJ3A 4D8PA 4KO6A 3S8GB 3PG2A 4JFDA 4R96A 4D94A 4NO0D 1I3RB 1PZ2A 1OT2A 3KYOA 5DMIL 3KLAA 3INUH 3NAAL 4NQCD 4TUKL 4OFPA 1FVDA 1ROWA 1T0PB 4L5FL 3RZCD 1I3GH 4FNQA 1G9MC 3B83A 3OKOB 2VH5H 3D4YA 2Z35B 4P5TA 3DXAD 1A4CA 3K2MC 5LCVL 1UA6H 2Q5BA 4LDCA 1FLRH 3T3MF 4RMVA 3J8F7 4GSRA 5D1ZA 3EYVB 5AD0B 1P84J 1QRKA 4PWJA 5CZVL 4ZT1A 1UT2A 5IHBA 4BKLA