3X1FA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1fA00
3MBWB 4GP5B 2VM4A 2UXGA 3BQVA 3FQ1A 2PCYA 2J56A 3TA4D 8PAZA 4HHGA 1IBZA 1BYOA 1PZBA 1ILUA 5I6MA 2AFNA 2I7SA 5I5JA 2I7OA 1CURA 4BWWA 2FT6A 1GS7A 1PCSA 4G7SB 3X1FA 2GIMA 1HAUA 1SDDB 3FSAA 2GC4C 3NJJA 3FU9A 9PCYA 5D4IA 1PZCA 1NTDA 2WO3B 1R1CA 1VLXA 2DYSB 1HAWA 3NP4A 2EINB 1IBYA 1L9TA 5B7EA 3FSWA 2R7EA 2H47C 1J9TA 3FPYA 2LLNA 1JZFA 4PAZA 5I6PA 2FJSA 1ILSA 3QJSB 3NJKA 4YVUA 3WKPA 3UACA 1PMYA 1BXVA 1N70A 1A8ZA 1XB8A 4WKXA 1KGYE 1ET8A 4X4KA 2R7EB 4NB7A 1N68A 1NIBA 4YSEA 3WI9A 1W8EA 2IDQA 2GC7C 2FNWA 4DPAX 1JXFA 1PNCA 1AR1B 1E65A 1ZDSA 2BW5A 3HEIB 4A2EA 2XV3A 4YSDA 4GYBA 2UXVA 1ZPUA 5B1KA 1FFTB 1PF3A 3H56A 4P5SA 4DP8X 5F7AA 3QJUB 2Q5BA 1XMEB 1RZPA 2ZWNA 3FU8A 3NSDA 4HIPA 1PY0A 3WNIA 3AG2B 1SNRA 3L45A 2AZUA 1NZRA 4W9ZA 2TSBA 3EHBB 5I6KA 1IUZA 1AG6A 4HALA 4E9TA 1KBWA 1OCOB 2CAKA 1NIDA 2I85A 3OQRA 4F7KA 3QPKA 2BZ7A 3ASNB 4A2HA 3NSFA 1JZGA 1L9OA 4RH4A 2CALA 2QDVA 2IDSA 4G72B 1BYPA 5EHFA 1JVLA 4E9SA 1OV8A 2XXGA 3RYMA 4YSCA 3KW7A 3X1EA 4HHWA 4JHUA 4DP9X 1SJMA 4L0PB 5B1JC 2DV6A 1SFHA 4E9XA 1E67A 1PNDA 3GYRA 2HZHA 1ASPA 5I6NA 6PAZA 4WTQA 5B1JA 1DYZA 3EH3B 3H4FA 2AANA 1L9PA 1PLAA 4BDVB 1I53A 3NT0A 5AZUA 3WKQA 5FC9A 3FS9A 4N4YB 2E86A 2OV0A 1ET7A 2OJ1A 2N0MA 5B1AB 2ZOOA 3S3BB 3ZDWA 4DP4X 1NIFA 4E9RA 2A3TA 2XWZA 5D4HA 2HX7A 1MZYA 1AANA 1RZQA 4NERA 5TK4A 4DPCX 3AG3B 1V54B 4E9VA 4KNUA 1V10A 4YSUA 1OF0A 3IN2A 2GI0A 3IBOA 2H3XC 3NYKA 4KO6A 1ZIBA 3V9CA 2XV0A 7PAZA 3U25A 1E5ZA 1PZAA 1AQ8A 1ASQA 3IEAA 3NJFA 3EH4B 1A3ZA 2ZONA 3NJLA 2FQGA 2XVBA 2IWEA 3T9WA 4BDVA 3QQXA 2IDTA 1WS8A 1X9RA 3OMIB 1CYWA 1JVOA 1V55B 1A4BA 2VMJA 4W1TA 1JXGA 3KW8A 3AW5A 3WIAA 2FQEA 2YAFA 1GY1A 3UGEA 5LDUA 4FA7B 3S8FB 2EIMB 1A4AA 3TASA 2BWDA 2HX9A 1UATA 1NPNA 3CDZA 1PLCA 1NIEA 2Y1AA 4BXVA 4G7RB 2IAAC 4G7QB 4JKNA 1AS7A 1AZBA 2JKWA 3S3DB 1KDIA 2HLEB 3ERXA 2VM3A 4TXVB 1CYXA 2BWIA 2FQDA 3SBRA 2BP0A 2GBAA 1MG3C 5B3SB 2UX7A 2AZAA 1J9QA 2DWSA 3IE9A 3NJGA 3NP3A 4E9WA 1JXDA 3NJIA 1GYCA 1DZ0A 5E9NA 2YXVA 4HCIA 3NJNA 1GSKA 3SBPA 2Y69B 1BQ5A 2YAQA 4Q89A 3NSCA 2IH8A 4Q8BA 5I6LA 2MRYA 4JHVA 4KO7A 4AKOA 3IN0A 1OCCB 4AKQA 4UAHA 1KCBA 2DY2A 2JXMA 3CVDA 5B7MA 1OE1A 1F56A 4GXFA 3MX0B 3X1GA 5AKRA 1W6LA 2J55A 3TU6A 3FQYA 2XU9A 1TKWA 3WNJA 1L9QA 4PCYA 1BQRA 1YLBB 2BP8A 5AFAA 2YAOA 2UX6A 4HCFA 2RACA 4F2EA 4KO9A 2B08A 3BVDB 4HAKA 3PAZA 1AS8A 4QKTA 1BAWA 2VSMB 2W8CA 4AI7A 1EZLA 3ABKB 3AG4B 4F2FA 1NWPA 1WS7A 2PP7A 1JZHA 2WSDA 4YL4A 1TEFA 4M3HA 4DP5X 4UANA 1SF3A 2YARA 1NWOA 1JOIA 2YQBA 5IY5B 2NRDA 2PP9A 2VW6A 1OCZB 4E9YA 3V9EA 2J57A 2VSKB 1SFDA 1MDAA 2VW4A 4N8UA 1EHKB 1FA4A 5D4JA 4DP7X 4YSQA 1E5YA 3T6XA 2W88A 2JFCA 3X2QB 4ENZA 2YAHA 4A68A 1BQKA 4QLWA 1NICA 2BW4A 3PPSA 4CSPA 4GY4A 4GP8B 1GR7A 2DYRB 7PCYA 2IWKA 1URIA 2IDFA 1AZCA 2X87A 4YSSA 1JERA 2PPDA 2FT7A 3SQRA 4DP1X 4KNTA 2PPCA 5PCYA 3SBQA 4NAJA 1MZZA 2GHZA 1KDJA 1QHQA 2HXAA 1PLBA 3AG1B 3S8GB 3ASOB 3NJHA 4AKPA 4BWUA 2BO0A 3ZX1A 3CVBA 4A2DA 3HB3B 1KCWA 1M56B 2EILB 5TK2A 3FT0A 3DTUB 2FQFA 4ZK8A 2QPEB 1AZNA 4A2GA 4E9QA 2P80D 1GY2A 2P80A 3FSVA 3N2JA 1SHXA 3NJMA 1ID2A 4MFHA 3ZBMA 5A7EA 3S3CB 1M9WA 3OD3A 2UXTA 1A4CA 3UABA 1SHWA 5B7FA 1XB3A 4BK5C 1AG0A 1W6WA 5I28A 3T6VA 1ET5A 3FU7B 4M4RB 4AX3A 2BHFA 1X9UA 1ZIAA 3DIVA 2PCFA 3UAEA 1J5CA 4KOBA 1TU2A 3OMAB 5F7BA 1JZEA 1AAJA 2XUWA 1CUOA 3DKHA 1NIAA 3GDCA 2GSMB 1WA1X 2QT6A 1M57B 4G71B 3FSZA 2IDUA 3PAUA 1SDDA 3WG7B 2XXFA 3EH5B 2ZXWB 4FAAB 1B3IA 1TEGA 1ZV2A 1ZDQA 1AACA 2XX0A 3ABGA 2EIJB 2GB2A 3TBBA 4KOCA 3FPXA 1AIZA 1CC3A 3ABLB 4YSPA 2XYBA 3FQ2A 2QDWA 1NDTA 1GW0A 3D12B 2CBPA 1QNIA 3CVCA 1ADWA 3OMNB 1RCYA 1PAZA 5B1BB 4UF7C 1KYAA 2WO2B 4YSRA 3T6WA 1BXAA 2PPEA 2CUAA 4DPBX 1XB6A 3X1BA 1OCRB 2PPFA 3PCYA 4K9JA 3H4HA 2YAEA 4A66A 4P5RA 3NSYA 5I26A 1T5KA 2CJ3A 2FT8A 4AZUA 4A67A 3PAVA 1HFUA 3ABMB 2HX8A 2AVFA 1QLEB 2BP0B 1L9SA 1J5DA 3PXLA 5I5MA 4KO5A 1BEXA 1NINA 3C75A 3UAAA 3EF4A 4A2FA 2HRHA 5ANHA 3CG8A 4DP0X 3PLYA 3UADA 4DP2X 2X88A 2QPDB 1WA0X 1OOWA 2YXWA 1L9RA 1FWXA 3JTBA 4YSAA 1BXUA 4HCGA 2B3IA 3GXUB 3CDZB 2J5WA 2IWFA 1J9SA 1KBVA 3N55A 3AZUA 1ETJA 1KV7A 4YVNA 2UXFA 1RKRA 3JT2A 2FTAA 5PAZA 2MTAA 3FYEB 4YSOA 4GP4B 1IKOP 2OCCB 1E30A 4KNSA 3ZIYA 2VN3A 1OE2A 2HRGA 2H5UA 4EF3A 3T6ZA 3OM3B 6PCYA 3CZUB 3FYIB 3AY2A 1JZIA 1OE3A 4BXSV 3QJRB 3X1NA 1AZUA 5I6OA 2YAPA 1MG2C 3QJTB 3QJVB 1IC0A 1GS6X 1NPJA 2XV2A 1AOZA 2TSAA 2Q9OA 4DP6X 4G70B 4YSTA 2BP8B 4HZ1A 1AZRA 2DWTA 1GS8A 3T71A 2BZCA 2EIKB 2YAMA 3TBCA 3QJQB 2XLLA 2CCWA 2IH9A 2PLTA 1WA2X 2PPAA 5I5IA 1A65A 1J9RA 1JZJA 1ASOA 1SF5A 2FWLB 1WAEA 3G5WA 2PP8A 2VW7A 2XX1A 4BWTA 1AS6A 3FU7A 4CSZA
chains in the Genus database with same CATH superfamily
2AK4D 2JLPA 3WY3A 1EA9C 2OBGA 3CMOL 3EO9L 3W11C 1FFNA 1KYUA 1MFCH 4IIQB 5ID0A 3IGUA 1MI5D 1KLFA 4NKMA 2ATPB 3ULVD 4PHXA 3A5VA 4LNRB 3VWJA 1DBBL 1BZOA 2LLLA 5IESL 1BSIA 4I2XA 5D4IA 4GBXB 5F0LB 2QADD 5EPMA 3RG1C 3M8OH 4UOZA 3UDWA 3QI9A 4JPIB 4E42A 3L3JA 4DIXA 1T2XA 2XWRA 2ZKWA 3OXSB 4RFEA 3MRJB 1FJ1A 4HCRA 4JFXA 3KH3A 1RV6X 4PJIF 4DZ8A 4JZJB 4Q7DA 5F0MB 1X4XA 4PJAF 1VIWA 4ZSOA 3QDAA 3FPYA 3BUBA 4D3CH 5DZNA 3AQDA 3EFFA 5L4IA 4LVNB 2GK0A 1UGNA 3CJJA 4PR5A 1BMWA 3KPMB 4ZTPL 3C6EA 3LNHA 3QEUA 5EIIB 3TIEB 4AUJA 2BXYA 3CLFH 4MDJA 4P9ML 4EIZC 4WKXA 1KGYE 1IARB 4C59B 4XPTL 2A9NL 5LXGL 4AIZB 2X44D 1F97A 5SWZB 1HJCA 5TE4L 2VL5B 1EERB 3ARTA 3QWNA 4MB5A 2BW5A 5KSAC 2WQUA 3P54A 3HG1E 2DWEA 1DQKA 2AQRA 4EVNA 1S7WB 1FFTB 2VDOB 1IGFL 4IK6A 4X7CC 3H56A 4LGSB 1AY1L 3QJUB 4IRJC 5TDPB 5E2WL 2GQHA 2W60B 1P1ZA 2F5BL 1R5IA 2TSBA 1AIFB 2VUKA 3C08L 1U8JB 5BMFH 3JV6A 5KW9H 2P46B 3KPMA 4OCXH 1HDMA 4PGEA 2AAAA 4HQQL 3P0VL 5ADPH 3KXFB 1A6VH 1Y6KR 5C0CB 4NS0A 2HKFL 4IDJL 1Y1DA 4XMVA 4D0DB 3P11L 4YHIB 4AEHL 1FDLL 1RY7B 1RZJC 3E8UH 2H2PD 3ML8A 5DMKA 1A9BB 1QHOA 1J48A 3LEYL 3UTSD 3BPLC 2BRRL 3T8MA 1H3XA 4MD4B 2Y5QA 4ZD3L 1MCBA 1U36A 2DM3A 4YHNB 4M3JA 1I8MA 4KJWD 5B1JC 3R7RA 1I7UA 4IU3B 1IGJA 3HBQA 5IOPA 4TUKH 4R8WH 1WF5A 4XCFH 4GXVL 3EH3B 2AANA 1UOKA 4K8RD 7CGTA 5D5MB 4HDIA 2BSBA 2F7QA 2P9RA 5FFLA 3ECBA 4J3OH 2E8ZA 5GRVK 3D2TA 3U46B 1U2CA 5E1AA 4H20L 1B0IA 2GTWA 2QV4A 1TZHB 3EJCA 4PJ8C 1E4WL 1KLFB 3WFBL 2GBTA 2IVFC 3ZDWA 1G6RA 2PW2A 1L0QA 5D4HA 3L1OL 5FKPB 4QF1B 5D93B 5ICXB 1AANA 4KZCA 4NERA 4Z7OB 1J5HA 3FCTB 2VDQH 3MROB 2XFGB 1CICA 5T1MB 4PJGF 3L4VA 3Q8CA 5CFHA 5IROD 1S7UB 1RJLB 3KDPB 3FO2B 4X5RA 4M7ZC 1ZY9A 1ED3A 1RZ7H 2CM6A 4AZ8A 1OKEA 2IMNA 3FCSB 1JS4A 4GQRA 7PAZA 4P4KC 4UBDD 5DCCA 4Z1PA 1Q0YL 1X5AA 3EJYC 3WIFA 3T3PB 4OCRH 1IFHH 3EDFA 3SB3A 1K8DB 3ILQD 5CEXB 4NT6A 3F7KA 1NFDB 3C8HA 1SLVA 2EYRB 4PJIA 1ES0B 3H7LA 5FCUH 5AZ2H 3MLWL 2WNKA 5DVOA 1F4WL 1IAKA 1ND0B 1I3UA 4D7BA 3ZOAA 3MACL 3NCXA 5ACMA 3DIDA 5T5FA 3AW5A 4LHUD 4P4KB 4UMGA 5DJAA 4UNUA 5KWYC 5H37G 1BJMA 2J8UF 3ARED 1NMCC 1Y0LA 2NTFA 4NQEE 4PJ6A 5T1LB 2P8PA 5JHMA 3SPGA 5DRWA 2A4ZA 4MAUL 3TASA 5L6YH 4BBWA 2I07A 2KPNA 1QLFA 4PJHB 1Q1JL 3QG6B 4TRPH 4PJEE 1JV2B 1MI5A 5IG7B 2HVJB 5DWPA 2DH3A 2K9UA 5I1GL 4F7MA 5EOQH 4ODTH 4U6HA 4D8OA 4LMQE 5DQ9A 3J2PA 1LHZA 5EF0A 3EYQC 5GJTL 3KZ8A 1THCA 2Q76B 5SX5H 4OGZA 3MLWH 4J3OC 1J7VR 3SGJA 3IE9A 3NJGA 1ZT4A 3ARDA 5FDYA 4AYFA 2O93L 2YZ1A 3PGFL 4GKNA 4LNRA 5CN3A 1B0GA 1ZCRA 1GYCA 2W0PA 4M1CC 4RZKA 2GT9B 4AQ1A 2GTWB 3ME0B 1F6LL 1QBLL 5ID0B 1Q0YH 5GRVL 5EU5A 1KBGH 4PJDF 2VC2L 1G0XA 1QKZH 1IKNC 3NSCA 5JTWA 5B39G 2B14A 3U0WH 2WBKA 2LVCA 4DJMA 4J1UA 1T7WA 1FO0B 3V0AC 4WF7A 3FRUA 1PKQB 1NCWL 5EOCL 4WU7A 5B7MA 4ICWA 3I75A 3SE6A 4X8GA 2X2YA 4G8IB 3TN0C 2BP5M 4JREC 1ZSDA 2B5IB 2EXYC 2ZE0A 2UUDK 3IB4A 1QZ1A 5I8EA 3K81A 1DANT 5CEYA 4ZUSA 5IQLA 3PJNA 4QRRA 1L9QA 4PCYA 4AENB 4XCCH 2BP8A 2HT2C 2UX6A 4C56D 3MFGB 4LLQA 3D2UB 1JSYA 1HH9B 4MJJA 1P7KB 4K7PL 3GTNA 4WTZG 5F96H 2JJVA 4J23A 4LLAA 5JZ7D 2O5ZL 1CGYA 4IDLA 1R5VA 2I25N 3VJ6A 2FEDC 2VJ0A 3IJSA 4P4RB 2DH2A 2OLDA 3O6ML 4Y4FA 4JFFA 2P47B 4K3EH 2Z93A 5IBTH 2JF1A 3LZOA 1QI3A 2WZ5A 3QORB 1AH1A 4NAQA 4YE4L 4ONHA 1CDGA 3NCWA 4N2CA 4ATWA 4L8SB 4F9PA 2JMRA 1E4XI 4NP4H 1J1OH 4ODHH 2VL5A 4HBCH 2NZIA 5JHLL 2GI7A 2Y06H 5HDBB 2F74B 1RJYA 2F15A 4ZAKB 2VSKB 3HUJA 1OOAA 4FLSA 1EHKB 1S5IH 2E9IA 1QW9A 4FI7A 5CNHA 3VI3A 2CBOA 3AREA 3DSFH 2DAVA 3DX7A 4ZOCA 2EDEA 4JM4L 4CSTA 5CLWA 3TURA 1T5WB 2WKGA 2N0KA 4JKMA 4KXAA 1BIIA 1JWMA 4JMXA 4WNQA 3UX9B 4ZPTB 1TTGA 2A4CA 1TVDA 3QPXL 3BUYA 3NIFE 4M1DH 5FYLL 3CZLA 2IQAB 3WHXA 4YSSA 5DRZB 4ZXBC 4RIRA 3ALXA 4XRCA 1F4YH 5AW7B 1A4JB 1C7SA 2A0LD 2GABA 3QRFM 2UYLA 1QHQA 3UZQB 5T33H 3FT3A 4RFOH 2XQ0A 4JPWL 3O8XD 4UQDA 3BH9B 2XV6B 3MRKA 12E8L 3L3GB 1M71B 1UT2A 2J6EH 3HB3B 4Y16A 1PD6A 1E2WA 2C9XA 3IWVA 2AS5M 1AC0A 2ENSA 4PW4A 3CXHK 1NOFA 4K8RH 5JLZB 4JPVH 4ADJA 4Q9CA 5HGHA 4FJYA 1P4LA 1RUPL 3HI1B 4XVJH 1RUQL 5DEFB 5C0AA 4NKMB 1CLOL 4CN6A 2FSDA 3N1FC 3PL6C 2J4WL 1YNTF 2PNDA 3PP3K 5IMOA 4TUOB 5TPWL 4XOBA 4CVWA 3CZGA 1YEHL 2RGSA 3L5XL 4IOFD 3VFUA 4LSRL 4OT1L 3UTPD 2BRRH 4BSVB 1NA8A 3EYSL 2WSPA 1HL8A 1HKLL 5DEGA 3ZDZB 2HVBA 1XT5A 4GRLB 3GBNH 2EECA 2A9CA 1WA1X 3FFCE 2YEQA 4S1SL 4BV1A 1JG9A 4KX9A 2Q8AL 3FTXA 5SWQA 3TA3B 2GJ6B 1ZV2A 1W8OA 2UZYB 3VD4A 1E8XA 3QG7H 5E9DB 1FZMA 3JVFC 4KPHL 4KOCA 3WS3B 1R0AH 1AIZA 1CC3A 2QQQA 3MRRB 1NM4A 2FBOJ 2NDFA 3GBML 3LS5L 3GFUA 1PTZA 4FYQA 4M4PA 5IFHH 1SVZA 4GJTB 1EMTL 1RCYA 3MLVH 2UY7A 4AEFA 4DN4H 2C7UB 3EW3B 4H5SA 2WO2B 2YXFA 4FJZA 5LXVA 1BXAA 3C2AL 3FQXA 2Z92B 1XCXA 2XACC 2HT4C 1A1NA 3CGTA 5TQ2H 1IT9L 3V0VB 4J39A 3RFZA 3IXAB 1BVKB 3ARDC 4N90E 1R3IL 2CO2A 3EJPA 5E6IC 3V4UH 3L48A 5DVLA 2WQRA 4FTVA 1KIUA 3TPUB 1XL6A 1B0GB 2YGVA 4NEHB 2BNRD 3MRIA 3FFCD 2MNJB 2YJLA 2XIIA 2ZCLL 3W0WB 4IQHA 3QFJE 1L9SA 3PXLA 4BA0A 4WFGE 4A2FA 4OD3L 5I1HH 1U92B 2AJYL 1IGJB 2RCSL 1Z7JA 4FTDA 5IJVA 2BVEA 1EFQA 4AYSA 5I1AB 1LP9B 1KPUA 1HNFA 1RQ5A 5HGBA 1SYVB 3LVEA 2WWMD 2VITB 3BP7A 4KJYA 2D7NA 5ADOL 4FFVD 3JVGC 3AZUA 4NUGH 3GEFA 2P8PB 4MCZB 3MX0A 4PGEB 3HNSH 3HHSB 1UUNA 1FFOA 2PWHA 4DF9A 1QNZL 1IAII 3WD5H 4GQZA 1UWEH 4DZBA 2Y07L 2F54B 4P2QE 4QXUL 4TKWA 1QR1B 1TZGL 3Q6GH 3RIFF 3AC0A 1G5GA 3LKOA 5FUCE 1RXLA 1LQSR 4LKXB 1FSKB 4YIQB 5AW8B 4N8PA 2IXQA 3JYBA 2YPKA 1YNTA 3VDCA 3VCLB 1JRHL 2V5TA 5HYQB 3HR6A 1J0ZA 2LTQB 4KRMB 1N19A 5HGDB 4R5VA 5D7HA 4YFLI 4MQXC 1JVKA 4R4FH 3GI9H 2EIKB 4LCIL 4XNYL 4LSTH 1X5YA 1EXUB 4P2OC 2PLTA 3AXHA 1XH3A 3EF7A 4QCIA 5E7FA 4MQ7B 1J9RA 2DJSA 1ASOA 4RBPH 4H8WC 4UDUA 3GWJA 5T3XE 1MW0A 2JTDA 1JHTB 2Z64C 4IBLT 5HGDA 5EEYA 3QIWB 4LEBA 3H0TA 1YNTB 1NC2A 3L3JB 5FX3A 5ADOH 2AFNA 2YEVB 5GRJH 4Z3IA 4L8SC 2G30A 3NOIA 1CBVH 1N0LB 4XOAA 4ABQA 2ED7A 2JKXA 3OJ2C 1E2VA 4N0FA 2UWEA 4CN1A 4OLWH 3VWJB 3K71A 2FDBP 2QSVA 2NNAB 2RH0A 4NKIH 3X14B 4U31A 2WLMA 3CH8A 4P2OD 1HAWA 3OKNA 4XB3A 5F97E 5HHVH 1W91A 3P2TA 4N3TA 3BSZL 1LL1A 1J0HA 2CD0A 1AGDA 2AXFB 4L23A 1V05A 2R2EA 1RIVH 3F12A 5GJTH 4IJTA 3TX4A 3KPNB 4PAZA 2KPWA 5ISZE 1N2RA 4KDWA 5DJCB 1OGAB 1E2ZA 3UERA 3IM1A 1JNNL 4FXGB 4ZO6A 3S5LB 5MERB 4G6KH 1S9XB 4U0RC 2A6JB 5J1SC 1ET8A 1Q1JH 2DQIL 5SV4A 2YPLA 4RQQB 1JI1A 3NIGB 2H32A 3VCLA 3DOIA 3VXSD 4JANB 3VFMB 2OMXB 1PNCA 3EO1A 1BDYA 4NQVB 1EJFA 2HFGL 1QUPA 1PIGA 4P46D 4OQTH 2QHLA 4KQ4L 4QHUB 1BWMA 3K74B 3NEXA 4DWHA 2Z92A 1A4JA 2D03L 3FO0L 4GI9A 4Y4HB 5EF1A 4LRIA 1P5VB 1MJ7L 4NWTH 4KI5F 4M61A 5LG6A 5DS8B 4HH9B 4HH8A 4RA3A 1NFDE 3DPBA 1Q90A 1ZLVH 3F85A 1XR8B 2V7HA 3VXRA 2OXGB 1ACCA 4LNVA 1N5YH 3O11B 2DM4A 2NZ9D 4OH2A 3DXAB 1ANUA 2VXTH 3HAEB 1VZHA 4KKCD 5C0CD 2QDVA 4M4RA 4K55A 1IGMH 3TVMC 5AD0A 4KROC 2P42B 2QGDA 4U6YB 4NHUB 5KSAD 2XXGA 2YRZA 4U05A 2K8MA 2R83A 3LKPB 4R2GC 5EBWA 4CW1B 2DKMA 2D7OA 4OTXH 1OAYH 3PHAA 4N6RA 4Y19A 4XPBL 3C60B 4JO3L 1WCBB 5CN2A 2HZHA 2BPBA 3MKKA 2DQCH 4EIUA 3EJRA 2IC2A 5B1JA 3QP3A 3CXDL 1X5JA 4OI8A 1TNNA 4PWJA 3RWFA 1IGIH 4ZZFA 3ZR5A 5B8CB 3NT0A 1RUPH 4WTZA 2NX5D 5SWZD 5AZUA 5C2UB 3N1MC 3APNA 4XZUB 1RURH 2CLVA 3ZRFC 2RQ8A 4PJGE 1JGVL 4GINA 3FFDB 5LBGA 1YPZF 1OK0A 3GT6A 4HT1L 4JJ5B 4LGPB 1YHPA 2OMVB 2BSEA 4XNBA 4MZ2A 2W91A 4JCMA 5I1GH 3HZKB 2DQDH 3FZUC 3HMXH 4JY6B 1ACYH 4RMRA 4YSUA 3O4OC 4KTYA 4M7ZB 3BKCL 4PB9L 5FFOA 5SV3A 2X42A 4PJFB 2H8PB 1W16A 5EB9A 4WUUD 3S36X 2XV0A 5IMMA 2UWEF 1KPRB 3S35L 1F3JB 3KPOB 4LHUG 1Z9NA 1SYVA 5DR5H 4WHDA 4P2RD 2EUWA 1NMBH 3CLEL 4OGYH 4DOHE 3GSWA 2ARWA 3DSFL 2PKDA 1IGTB 3LRHA 4Z7AA 5IHLB 4Y4KA 4ZFZB 3K2KA 3IDNA 3VQ2C 3OMIB 2VDPB 3ULUC 4MVBD 4QTIH 1EEUA 4N0CD 4XZ4A 3C9NB 1DEEA 4BYHA 3QWOB 2F1BA 2MFNA 3QEHB 4IU2A 1WWAX 4PYHA 2W95A 5T1LD 3F8UB 2A9NH 2D3LA 5FWRA 3F5WB 2XIBA 4MRBA 5C70A 1PLCA 1VB9A 4M6NH 1T1ZB 4QAMB 4G7RB 2IAAC 5LBVA 2VZTA 4JKNA 1AS7A 3OKLB 3CZNA 3QDMD 1S4IA 2Y72A 3QG6A 4F3FB 5ES4B 1AO7A 2HLEB 4N90D 4A7GA 1QI5A 2QVMA 3ZYOA 3QEHA 1YPZB 4IU2B 4GEJA 3HI6H 4LEXL 3OPUA 1UWGL 2YS4A 4Y1AE 3APFA 1HHKB 4WK2B 1A9VA 3HBGA 3PWLA 5GRZA 5IQMA 2EE2A 1DE4A 2NY5H 3E9UA 3FMGL 3KBEA 2F61A 2VXTL 4IGBC 1AXTH 1XX9C 2VUYA 4DEPC 4G8EA 2D3JA 4BH7B 3D4ZA 3NTCL 5GS3A 4GIPD 1MIML 2VN5A 1SGKA 4XHJC 5A2LH 2CKBL 4LL1A 2OR9H 3BEVA 4MJIA 5MEND 3RX5A 2FX8L 4F8QA 1YQ2A 1SMOA 1XV8A 1KCBA 3VI3F 4F91B 4G6JH 3RWJB 2WIMA 4JAMA 4PGCB 4NHCL 5HHXL 4DKEH 4MD5A 4AQ8A 2E27H 3GF8A 3HLKA 1I8IB 4KQ3H 4LPUA 4MX7A 4X6DF 3ESPA 3UBXA 3B2DC 3VRLF 2YPVH 1BAFH 4L4VE 1V7MH 1RZKH 4JZJC 1E27A 2B08A 3N40P 3A67H 5L2JB 4HT1H 4UQ9A 2CK0L 4KKBC 4XMXA 2YC1B 1MRDL 3F6IA 4Y4HC 4HC1H 1ZHBA 4LCCA 4PCKA 3TZVC 4AI7A 1DEDA 5C0FA 1J8RA 5DZ9A 3MJ8A 2R0WH 4GG8B 5T3ZH 6TAAA 3ZT7A 5C08B 3RWIB 3TYFA 4WCYL 4P4KD 1B0WA 2IV8A 3G5XB 2DQCL 4GMTL 4R0LA 4HFUH 4Z7NB 3DVGB 1XGPA 5C9JA 3E7JA 1C08B 2R0LL 3ISWA 4LVOC 5I74C 1Z0NA 1LTXA 3QHFH 1RI8A 1NC2D 2PXYC 4GUCA 1L6ZA 2Y22A 5GISL 2BIMA 3G5VA 4Z77B 4MDIB 4FXGC 4D3CL 1WIOA 1FA4A 3TC9A 4LSSH 2OXGA 1ZA3B 2DKUA 2X2UA 2X3BA 1A6PA 4K23H 3SCMB 3IJYB 1JPTH 3QISA 1F4HA 1NGZA 1B2WL 5LNEA 4B96A 5HY9A 4FXLA 1CGSH 2IDFA 4NRZB 5CHNA 1KTCA 1WEJL 3WV0A 1XGTA 1Z2KA 5TF0A 4R26H 1XF5A 3LJ3A 1AR1D 4A38A 1J05A 2GHZA 1KZQA 3EYVB 1EJ6A 3AG1B 1F18A 1PLBA 5B38A 2VLLA 2ZKXA 4AKPA 4ZUTB 3ZX1A 4OV5B 1HHJB 3EYQD 1KB9J 3Q1SH 3GHBH 1LK3H 4PJHE 4HOMA 1KEML 4KKLC 4I3RL 4OAWB 3IKKA 1TJGL 3FQUA 4UOJA 1SHXA 3TBYB 2G2RB 2PCXA 3HS9A 1UKSA 2K70A 2VMDA 1QSEA 2VRKA 3GLZA 3Q2LA 3DHJA 4J3XA 1W6WA 5EWIH 1XGRB 1CDBA 5C0ND 1UB5A 1XO8A 3WNPA 3UTSB 4PIRF 5F6HI 4FEIA 3DETD 3HMWL 1LXMA 3HZ3A 2LV4A 3QXDB 4C47A 4CILA 1P5UA 5BZXA 2VMCA 4Z7VE 2NX5E 2YQ3A 1PJ9A 1CZ8H 4I2XB 4IHBA 2APSA 4OM1H 1C5DB 1OAKL 1OARL 2DYPD 2IDUA 3K4AA 3KPQB 4J2QA 1TVHA 2D9QB 1A2YA 4MJ5A 4DGIH 3CFDB 4DGUA 1A21A 3PWPE 2VABB 3L5WB 3MRIB 4Z23A 3QG7L 2A6DB 3ABGA 4L5FL 4HIJA 3IGKA 2IAMA 4FTVD 1P4BL 4FFYL 4YSPA 4MZRA 3KLHC 2ZT9C 2XYBA 2ZOKB 3V0IA 1C8PA 3A22A 1II4E 2H9GB 4X6CF 3I6SA 4A2LA 4KROB 3VXPB 1J8HE 1FCGA 4PHZA 4S1DD 5C0NC 3MTRA 2EACA 2NY0B 3IXTA 4JO4L 1MQKL 4O02H 3ZYIA 4EDXB 3CVIH 4UQ3B 4AVKA 4GRMA 4U3SB 1UXWA 3U48A 1FIGL 2WGXA 4M6ML 3ULSA 1KYAA 3FRPG 5EC2A 1AGBB 3QNZA 2V8LA 2GITB 3SDXF 4X50A 1KSRA 1U8NB 1QD0A 3BUIA 3TT3L 1IT9H 1XCQA 3U4BH 1A7OH 1H3UA 3PCYA 3QDMB 2J2ZA 3C5SB 1OTSC 4ZYKB 3U9PL 3LN4B 2KDGA 1I1FB 5HJ3A 3TLRA 2C3VA 2J88L 5H4ZA 1TCMA 4ANUA 2BP0B 3S48A 2NW3A 1FO0H 1KEGH 4POZD 2JJUA 4U0RB 3HHSA 3PLYA 1TZOA 3LH2L 1UWXH 3T2OA 4LEOA 3B6SA 1NCUA 1MCKA 2XKSA 1B6UA 1MFEH 3O4LB 3ZYJA 4O2CB 5DMGC 2P5EA 1FYTD 1SOXA 4Z78A 5DD6A 3VXMD 5DHDA 4UT6A 1SN2A 4JG0L 3WGUB 5D1QD 3T0DA 3ZZ1A 1RPKA 1T66C 1TZIA 5JPMA 2VXQL 5J57B 4XN9A 1WVZA 4HK3J 3ABZA 1RSYA 3CX5K 4WWKD 4FCHA 2J8HA 1KEGL 2WHVA 4JR9H 3T6ZA 5KYXB 3NK4A 1J88A 2V2WA 2E74C 4XP1H 4Z7WF 4GS7C 4GOSA 4N6RB 2F9BT 1JYXA 1M3JA 3FCBA 1MH5A 4KKQA 2ZKYA 1DJXA 3EAKA 3VXTB 3SDXB 1WPCA 4YXHH 3Q2NA 4K3EL 2D7PA 4EEEA 1BQHB 3DBXB 3M07A 5BUAA 1LNUA 4RDBA 1HQRA 4GIOA 2BS8A 3IJHB 3I9GL 4X80H 5DMGD 4EOWH 5A3ID 3QCTH 3TPKA 1X5XA 2XLLA 3O3DB 4P23A 4BUGA 2G2NA 5D2NC 2QSCH 4M3KB 5GXBB 4L3EB 5CP3H 3D34A 4X0KA 1NUDA 4TVSa 5CBEB 1VFAB 5A7BA 2BY2A 1E6OL 4GAGH 5C6TL 5DEZA 1AS6A 4JL2A 9PCYA 4P2QA 2HSIA 5DJDB 1RIUL 1S3KH 2OTUA 3CBRA 3QO0A 4L5FH 4MSWB 4JFEE 4YL9A 2C8NA 2NQDA 4HJTA 4ZAKA 3TO4A 2BWQA 1MQ8A 1MSPA 4FLQA 3HZYA 3MREA 1CD1B 4KK8C 3T65B 2BX5A 2C9VA 2DD8L 2H3KA 3SIKA 3UG3A 3H9SA 3ZO0A 5DJ2A 2AMGA 4CVZA 2YKLL 5D7SH 1M4KA 4UDTA 3QORA 2LFEA 4Q97A 3W39B 2HJKB 4GQ9L 2OP4L 4PBVC 1FV1B 5J5EA 3RGVB 3VFVB 5I0DA 1NCDL 5I30H 1Q0EA 1PZCA 1IAIM 3QIBB 1ORSA 1CL7I 1FFNB 2XOTA 1I1YA 1R3KA 2R69A 5E5UB 3VXNA 4N8VG 4CMMB 3MXWL 4L18A 5CLZA 4AM0A 4HWZB 3JV5A 3QO0B 3OZKA 4MSWA 1R5WA 3BKML 2FH6A 2VOTA 3NAAH 4OM0L 1TFPA 3PNWA 4MAYB 3NIFF 3NGBC 1UD2A 1QASA 4R96B 2DF3A 3HCVB 1ETB1 2R1WA 5DMJB 2ROYA 5A2AA 5LO7A 3MLSL 1VHPA 2PWEA 2NUTB 5C0GB 1N68A 2FEEI 2IQ9L 2XNAA 1HN1A 1FFQA 4MAUH 5E03A 2UYLB 2Q2LA 3UZQA 3S88L 4H40A 1ZDSA 2VTFA 3ZE2F 2HFEA 4RRPM 4GO8A 3FH8A 3E0GA 3EDKA 5AG9A 1OO2A 3PWLB 5K9KA 4UQEA 4KX8A 3RWFB 2DWDB 4OLXL 3IE4A 4X5WB 3ARDB 1AZZC 2KUTA 3QUXC 1OGSA 2YA0A 4IKLA 4JFOB 1ITCA 4EDWL 2APXA 3T0EB 1IE5A 2YGQA 1BQLH 2H4EA 5GZOC 1I3GH 1QSVA 2BZ7A 1SJEA 1U8OB 2Z7YA 5GS1C 1YN7A 4U6HB 5T5NF 4ZX5A 4OZGB 4AC4A 5JUEH 3KLAB 4MMXB 3UAJC 3AGWA 2X7LB 1YVLA 3GO1H 2GUYA 3R06A 3DNKA 1NGYB 2FATH 3SJVA 5IKCB 2I5YL 2AW2A 1MWAL 1SJHA 2OJZL 1MNUL 4P57B 5HYJE 4LOUD 3V4PL 3VFSB 4NX0A 4Q9RL 1Q9WB 2XTJD 1ASPA 1KCVL 3G7TA 3SKUD 1KTLB 3K2IA 3RVWC 1IRAY 3L4CA 1FNGA 2QGBA 3T0VA 2WQVA 1LO3H 4A55A 5F3HA 4OB5H 1BJ8A 5L6YL 1Z1WA 4ZTOL 5FO8B 4RRPA 1U91A 3TBVA 2OPCA 1UT9A 4NN6B 4DP4X 5IHUH 5BS0B 2E7BA 4K7PH 5J6HA 1DVFA 1R3LA 4O00A 2V3DA 1KZYA 4PJAA 4BD4A 5AKVA 4HKXA 5FKAA 1SEBA 2AJXL 5JXEC 2FX8H 1D5MB 4JFZH 4DESA 4NQEB 2FECI 1KBBA 3HZKA 1WAAE 2GI0A 3SGEH 4Q6IC 4PLKC 4P49A 4WO4B 5D1QA 3QPQC 5FYJH 2C1PA 1CGUA 2GJZB 3QCUL 2JJSC 5E9DD 1JNHB 3G3LA 2QVTA 1PY4A 3D18A 4MS8D 5DDHB 1BFOB 4WWOA 2CIKB 3ETTA 3S8WA 1SXBA 2VC2H 3QH3A 4RMBA 5D9SB 2IWEA 2XZQH 4DGVH 4WV1A 5DRXB 2Y7OA 2ADGA 4QRAA 1DVTA 1X5GA 5I1KL 2YQGA 1A4BA 2QQNH 3BVWA 2E5EA 4XO4A 3WFCH 1IGFH 4XNDA 3DV6A 2ZKHL 3R4RA 1G0YR 1OT2A 4NQCA 5ACZA 1BZ9B 2DQGH 4W9DC 3DYOA 3LKSB 4TNVF 1UOWA 1SBBA 4KUCF 4AQOA 1BQSA 3VFTB 1P0SE 1A4AA 4ZFFB 2HG5B 3DUSA 2WPGA 2WP3O 35C8L 3C8DA 4A7SA 4AQAA 4BZ1H 3BAJA 4NKQB 4P04A 1F4XL 5C0CA 3B6SB 1A9EA 4M61B 3HN8A 4L37A 5KS9A 4F9LC 3OHXC 1A6AA 4FZEL 2NUPA 4HS6B 4IBTA 5D93C 3B7YA 1EXUA 3CQQA 1HT6A 3EFDH 2F1AA 3NZHL 5FUZH 4G6KL 4QXTB 2KLSA 1S7SB 4FFYA 4ZMZA 1DQQA 2N1KA 2G5BA 1F4WH 5DLMH 4WFED 4N0UE 4B95C 4AEHH 1OF2A 3MFFB 4FQXC 1U8HA 3L16A 4OSUL 2EVGA 3P73A 5AB0A 1VSCA 1MLBB 3O6KL 4G80A 4R90L 4YDJA 2AV1B 2Y69B 1U3HB 3K0WA 1J0KA 2AEIT 3EOTL 3MV8E 3PE9A 1OQOA 4LOVA 4Z7WE 4LSQH 2G0LA 5CZVL 1CU4L 1SDAB 4U1JB 2YMXL 5K5YA 1T1YB 2BERA 4QT5B 4WY7L 2VMEA 3WE6B 1F56A 3NIDB 4UCFA 2FUQA 3C6LA 4W9HC 1IM9B 1KWKA 3EFFB 2CU9A 3SCMA 3BKJL 3RU8H 2FYVA 2GAZB 1UB6B 2OR8A 2AK4B 1P9MC 5T5FL 4YLQT 4F7EA 2C3GA 3AQZA 1C7TA 3BZDA 3HG1B 1PDKB 1QTSA 4HF5L 1I3RA 4U1GB 3G5YA 5DJ0A 5HHNA 3UMTA 1DVQA 3PIQA 5SWZE 5KVMC 5IM7B 1NWPA 1UZ6E 4B7IA 5FFGA 4H0IA 4WI2A 3ZZLA 5IOPB 3MUY1 1XVSA 1M7DB 3T4YA 4PV9B 5IY5B 2VXSL 1KB5H 1O7VA 1T0PB 4L3AA 3VRJA 4TYUA 2EDTA 1W72B 4LGRB 3V7AE 1QFPA 2CIKA 4NRXA 4A2MA 1MHPL 5DHVA 1N0XL 2PYED 25C8H 4HUCA 4UIKH 3AACA 5D4JA 4RMVA 3E8UL 5SX5K 3NMEA 4DP7X 4E41D 5HJDA 3BZEA 4LVNC 3B2UD 4XB7A 5CSGA 3N6YA 3F7QA 3QO1B 5FV2A 3WE1A 4A68A 3RWJA 1CGWA 1NL0L 1G9NC 2IWKA 1S5HA 3HG4A 4OFYD 3QEGH 2QL1A 2Y25A 3MLTA 4NENB 4Y4KD 1CZ8L 3BN9D 1O9WA 1K72A 2FT7A 3QDGB 4MB3A 2PTUA 4IOFC 3NIDF 4TN9A 2QTEA 1A6VL 4ZX3A 2WWKO 4ZG1A 1H8NA 2ESVB 3BP6B 2X3AA 1MFVA 4JRYD 1ZS8A 2AJUL 2XQBH 3GINA 5I66B 2BO0A 2R4SL 3FTVA 2F54A 2VGLM 1OP3H 1B4LA 5I73B 3MLYH 3RIAF 3LTVA 4G9DB 4TSBH 5KS9F 1FN4A 3JV4B 2J73A 5TTRA 2IH1A 3DROA 3HRZA 4IBUA 1YG9A 2EVHA 1ZHNA 4HX1A 3QDME 3GXIA 3TCTA 3DGCR 1NBYB 3DDFA 1DLHB 3GRGA 3ISYA 3S5LG 3CZEA 3S3CB 1R9FA 3DX6B 3IJHA 4JQVA 2X2JA 3PJSB 4KRPB 2XPGB 1NCIA 4MCNA 5FOBA 1P4IL 2DW5A 1X9UA 3SDXA 3DIVA 1UADC 3GO1L 3RUGB 4I48B 1WUZA 3QCTL 4NQDE 2FJHB 4WW2C 4PJ8B 1UD8A 3HI5L 2EZ0D 3EJZC 4IRZH 4UM8B 2XUWA 1G1YA 1QA9A 2GFBA 3I6LD 1YO4A 4HOZA 3SQBB 4OZHF 1IB5A 3FB5A 3O2VL 3KPSB 1OM3L 4JFVA 3WJLC 2ICEC 5EFIB 5C97A 4Y4FB 3U36A 5KSAA 4HIXL 5CINL 3FT3B 1YYLH 4AL8C 3WFZA 2MJWA 3OQ3B 3F01A 1Z5LB 1MI5E 2FD6H 3CIAA 4A1RA 4NSKA 3NABH 2P5WE 4WUUE 3WFDH 1DO5A 4BJLA 1LYQA 3HUJF 2XTSA 2H1XA 4U1MB 1U4FA 2X5PA 4NM8H 5JHDB 4UQ2A 5INCB 4OVUA 3P9LB 5CS7A 4Z3GA 4B5EA 3BIAX 3RPBA 1U42A 1G9MH 3WXVL 4JO8A 1FN4B 1GTFA 1MAJA 4BUHA 2OMUB 4AEIL 4JKPL 5F72S 5I1EH 4P5KB 3ZHFA 4HWEH 1RK0A 1R34A 1ZTMA 4JUSA 4IBZA 2AGJH 3EXJA 3SY0A 1KYFA 2ZUYA 3MV7E 4FD0A 3NSXA 1T5KA 3EBHA 4HS3A 5EEVA 1NBQA 2FT8A 4HIEA 3Q43A 2IG2L 4DVRL 1I1AD 3ABMB 4UBDC 4JQXC 1O5DT 1FRGH 1OTUD 1CLOH 5IB5A 3BP4A 1LJMA 1QUNA 1O6SA 1WA0X 5FYKU 2EDQA 2HYMA 1HX0A 1J1PL 4JDEB 3X11B 2HJLA 4X83A 2NY2C 2HT3D 3FQWA 1XD0A 4YDKH 2OYPA 3B37A 4AIXA 5DS1A 4UM9B 4UWQB 5EU3B 5AVUB 5AW2B 5B3JE 1EFXA 2J20A 2UXFA 1RKRA 3HG5A 3JT2A 2YZ8A 3PWNB 5PAZA 3TJEH 3WHE1 4Y4HD 2BSSA 2X1PA 2XFXB 3GS7A 4JFOA 5DZLA 3ZIYA 1A25A 2Z35B 5IVXF 2EDMA 3W3BA 4BH8B 4PJBE 3M6DA 1M6OB 1Q9KA 1CPUA 3K72A 3M1BA 4M8QA 2Y3NA 4X4ME 5I1LB 2UUDH 2KERA 1YAZA 3VA2C 4XE5B 5IMKA 4AV4A 5H4YA 5GQBA 2TSAA 4ORZC 3ULUH 2NX5A 3L4XA 1JZ3A 5BS0D 5KVEL 5GGSA 4YXHL 1B9KA 4GKNB 3LHPH 3QDGA 4FXKA 1HI6B 2FLMA 3UPAA 32C2A 3VD5A 3OAZH 4B9GA 3IFNL 4PJ9D 1NUNB 5I6XC 2P49B 3AREB 3DX7B 5TF1L 1P1ZB 4C4KO 2XX1A 2MQ3A 5E94A 4H2CA 3VFGL 2KL6A 4JJ5A 3WN6A 5LAPA 3HW7A 3TBTB 2VM4A 3ZE1F 2J56A 3GC3A 8PAZA 4HHGA 3VXMB 1QVOB 3C09B 1S7RA 1PZBA 3MRPA 3SPJA 2B4CC 2I7SA 1E9PA 2X4TB 4H8VA 2FT6A 4ZPVA 3QDGE 4JM2B 4GRWH 5D7LA 4AEEA 1MCSA 4HEPA 4AGLA 2PYEE 3B34A 2ICWB 5F6IC 5HHOB 2J5LC 3PIQB 3RVTD 3UXFA 3LMJH 1TIUA 3TEZA 4A6YH 3IPBA 3BT2L 4BZ2H 3KGTA 4HIXH 4LPVA 5CINH 2CHZA 2Y7QB 5GGQH 3D39B 4B60A 3ARBB 1VFBA 4FERA 3ARVA 1PGRB 4KDTC 2E4TA 4OJCA 5F88A 4ZMYA 5CEZH 2EEAA 2ZPKL 3MJ6A 3MI6A 3DVGA 2K4AA 1TTRA 3NJKA 4Y19E 2VLJB 3WKPA 4R7VA 3H53A 3FCTA 3ULVC 2VZUA 3WO3B 3BSZA 3HPLA 3T0EC 5FHAL 1DCLA 4UYPA 1URZA 3KWWA 3VXOA 4LXFA 2ZYHA 5LHDA 4N2AA 2O6FA 1IC4H 2OMXA 3VVWA 4G7YL 1TTUA 3KGUA 5LVEA 5T33L 1LD9A 1NGQL 5TGBA 4DFHA 5BVJA 3WN5A 1A7RH 3HS0B 3ET9F 3PFQA 1TZ8A 4X9FA 1KIRA 4UTBL 3JWOH 4HISA 2X9ZA 1MRDH 1SJVA 3I6KB 4U3CA 3RL2B 1VPOL 4W9ZA 3HC0A 4JY4B 3LZFH 3KDMB 1AG6A 1VKXA 1YZZA 3QUXA 4YDVB 1KBWA 1OT1A 3Q8AA 4HS6A 5E99H 4Z76A 3HG1A 1S9KC 4OJFL 5DC0A 3KAAA 3UTOA 1XBRA 3M17B 4GAJH 4ESKA 3H3BC 1SM3H 2DI8A 4KRLB 3T8XB 3SDAC 3HAEH 3HZMA 1WTLA 1UOLA 5L8LB 2HAZA 1XF1A 3AB0B 3EYUH 1P53A 5IQ7L 1WP6A 3TBYA 2OS7A 1A4KB 5EIIG 3UGXA 3HC0B 3D5OF 5GGRA 4LKCB 4U1JA 1PNDA 2V17H 1RHHB 1A6ZB 4F8PA 3OMZA 3VACA 4WWID 2RFXB 2WUCH 1HOCA 3OGCA 5FO9B 3R8QA 1N5AA 2Z1KA 3TJHD 2DS4A 4XO5A 2N0MA 1TFHA 2NDGA 3S3BB 4TQ8A 4RAUA 4RGOL 1XH2A 3RY5A 3CHSA 2XWTB 1JNHA 3H6JA 4X6DE 3HC2A 2NR6A 3FUDA 2H6PA 2R1XB 1LEKB 3EGDB 4GRMB 2XT1B 2JB5H 3EUDA 2VDML 4U1KA 2AAVA 4EBQH 1RZGB 1YQVL 4HVBA 3FQNA 1HL5A 4KKAC 3VD3A 2ZYIA 1ZIBA 4WI0B 1CT8A 1I1AA 4WGKA 3GIZH 4V2BA 5FM8A 4EI0A 3LIZH 4XGZB 1KGUA 1HYRC 3WMPA 1TMQA 4PCSA 4U3HA 2IAND 3H6AA 4NPJA 4IGBA 4UQAA 2NQ3A 4KHXL 5AYUL 4JRYE 1KIPA 4Y5YA 1WS8A 3H1ZA 1W8NA 4PJ8D 4PREA 2DLFL 2VMJA 3RHWF 3ZKMC 2B4CL 1KTLA 2CIIA 1UYWH 1RULL 2XN0A 2AV7A 4HBQA 3VYOA 1JIBA 4HIQA 2KQNA 4R7DA 5CU9A 3WIAA 4MCYA 4OU3A 5BMFL 2APWA 1Z5YD 2KQMA 5LDUA 2AEPH 3BKCH 4JFPB 3FCGA 1QOKA 4FA7B 4LCYB 2Y1YA 4I0CC 3NIGE 1KCLA 4GIAA 1NIEA 4XHJD 4PRDA 3U9UB 3GK8L 4YPJA 2JCCF 3H55A 4PJ5A 3GXPA 4PMFA 3FUNA 3QIBA 4M62L 3FQTA 5HI3C 3SD5A 2AJ3B 4ZW5A 4MQTB 3LNEA 3EYFB 4NQEA 1ACXA 5CILL 4Z7NF 2Y5EA 4HXAH 3CAFA 2VE6B 3FT2B 1KXQE 4Q56A 4PJEA 5IK3A 3ARGC 1J9QA 3GSVA 3S36L 2PW1B 1SXZA 1BZDA 2WXGA 4MXWH 4UUJB 1U8IB 3AXIA 4IKNA 5B38B 1CMOA 1DZ0A 4FL4C 2UZPA 1M7XA 3C2SA 1HNYA 4PGJA 4BH7A 2Z0BA 2DEWX 3KJ6L 3RFZB 2DIAA 4XMPH 1XEUA 1OB0A 3K2UL 1MRFH 3PJSA 3U6XA 4R4BA 4U6VL 3RNQA 2YO3A 3CN3A 1HHKA 2A9DA 1Q9WA 1R24B 3TCLA 2ZUQB 4FKHA 2HB0A 2WANA 4OCSL 4BKSC 3E2HB 1OE1A 4NOBA 1N5YL 2AJYH 1I3GL 1XXDC 4O58L 4KHTH 1ZTXL 2F8VA 4A39A 3FQYA 4TV3A 2WYZA 3G5VB 5AFAA 4FNTA 4QWWC 3FU0A 5GS2D 1OZUA 4Y5VB 3AS0A 1FG2A 1RMFL 3IDIB 4XH2A 2E46A 1P6WA 1Q72H 3UTTA 2RIKA 2ADYA 1WO2A 1JCKA 1GGBH 3TYGH 4N5UA 3WN5C 3KD4A 1NLDL 3QJFA 1AHWC 4N0RA 4YL4A 5FYKE 4P07A 4JFHE 3RDTB 3FH5A 4OLVH 5JDJA 3QZNA 1GIGL 1NANH 3JWDH 1G7PB 2VW6A 4XTRC 3DX8A 3LVTA 3ZT6A 1JV5B 4I18B 2A38A 1HHGB 4TNGA 4Z78B 3FHAA 4N8UA 4XMKL 4P5KA 5E5RB 5ILTL 1DDTA 4G6FD 3M17A 5GS0L 2FB4L 3DARA 5JA8B 3RWEB 5E5MB 1DQDH 4R2GD 1SMDA 2TRHA 4R7DB 4PRHA 3S35H 1VKXB 4X8JA 1EJOL 4DETA 2M8XA 1NLBH 1CXFA 4NZRH 1CBJA 2CJUL 3T2NH 1NH6A 4EMZA 3JUYA 2BRQA 2Q1EA 2ZOLB 1N0LA 4B0MM 5HYSG 5K1JA 5CZXD 3PWPA 4JRXE 4UM9D 5C7XH 5ALCH 5HI5C 1CQKA 3S8GB 4PJGA 5JMRA 1C5CL 4WTXA 1SDYA 1CN4A 3CFMA 4I85A 4OLZL 1S78D 3WIHA 3QIWA 4AQ1B 4XGZA 4LU5H 2VDNH 5TK2A 4H13C 2CGRH 4GRLD 1ADQL 3C6LD 2BSSB 2OSXA 3KPLB 4NCDA 4W93A 4F7PB 1J8HA 4YR6A 1LE9B 5F2FA 2OK0L 2P80D 1GY2A 4NIKB 5HDRA 3AUVA 5HHPB 5E4EB 4LLMB 4PP1D 4DN3H 1A6WH 3B7RL 4ODXA 2HCZX 1Z9OA 5EV7A 3OG4B 3HUJB 5IZ7A 5FGCB 4F7MB 1J1PH 3GKZA 2Y6SD 4BFRA 4OZHE 2CPCA 3BSHA 4M4RB 4AX3A 1IJ9A 3HNTH 2Y7SA 4R4FL 2R2HB 3G04B 4Y8AA 1YEJH 1HWHB 3TM6A 2PTTB 3MCG1 3RGVC 1BZ7B 1LLAA 1XR8A 2V7HB 4ODBD 1HCYA 4PV8B 1N10A 5CZXC 3T6QC 5JW3H 3DJZA 5ALBH 5KBLA 3HE7C 4RSYA 3SYCA 4AQEA 1S78C 5I8CB 2QT6A 1WWBX 5INDA 1JMZA 3IJSB 4Y4KB 3STBA 5KUMA 1P5UB 2ZXWB 4FAAB 1A6AB 3MXVL 3FK3A 1UXLA 3IU3A 3HC4L 2EIJB 3QDMA 1EEYB 4KBPA 4MB1A 3QUML 4HHAA 1VGKB 4XAKD 4UTAL 2P4AB 3QE5A 3A6BH 1KCUH 5JIQA 3VI4A 3FFCB 3U0PA 1LDSA 2A74C 3S5YA 1O7DC 1GW0A 4H8UA 3EO0B 5L2KE 2VQ4A 4FQCL 2W07B 3MBEA 3I75B 3SE4C 4F7CA 5DGQA 3UYPA 4HOXA 4FCAA 1UXWB 3QARA 2VLRB 3QHZL 4GG6B 4OCLC 1UVQA 4PJDA 4PI2A 1GCYA 2IGFL 2F19L 4MNHA 3L3IA 3SDAA 2ICES 1QPKA 3D06A 4TNFA 2L8AA 3BGFC 5KVDL 2F53E 1SLXA 3DX1A 1TZHA 3VW3L 1MLCB 4X99A 3GZKA 5EC1A 2BNRB 1OP9A 5AWNL 4OZ4B 5I9QB 3RZCB 4LP8A 1HEHC 5TFSL 2N56A 1MFAH 4HDIB 5EZIL 3CDYA 3FB5B 3V0GA 3FOMA 5SX4I 2PMZA 4RGNC 2B9AA 4Y4KC 4DN3L 1UVQB 5I5MA 1YC7A 4FXKC 4Q0XH 3C75A 2P1YA 2ZX7A 3QRGH 2Z1PA 5D1ZA 2DBLH 4OZGF 2EQDA 2A9ML 1FIGH 3CFJA 3EOYG 1QFWI 5K69A 1P1VA 2QHRL 5IVXE 3LS4H 2KZKA 5F6HJ 2YPLD 2AJUH 2WOBA 2XQBL 1KV7A 3ALPA 4QRUB 4GG6E 1DVXA 2D7MA 4P9HH 5A3IC 3MOAL 2R23B 3OPZL 4FNQA 5KBDA 5JA9A 3DI2B 3K2MC 1YNLL 1NM9A 1I1AC 3HMWH 4JG5A 4WJ5A 2VRAA 5D7IF 5E4EC 3TZVD 5INDB 3W37A 4WDIA 2AQ1A 4I2XE 1Z3GH 2EYRA 4PJIB 4Z7VB 5EWIL 4LLVA 2NOYA 4FEMA 1KTKE 5C0IB 2EDLA 2FBJH 3GBEA 4OCNC 3G04A 2YPLB 3NPSB 2ADIA 4AXWA 1E4HA 4PBXA 4QYOB 1OAZL 5BOZG 1LEGB 4WLCA 4MA7L 2WLZA 5I82A 4X9YA 1LMIA 1OCWH 3U7YH 4PR5B 1XF2B 3TO2B 4CL7A 1X5IA 3QRGL 1CE6B 3NA4A 1UQSA 4NQTA 1KLGA 3MLUL 5J1TC 1E8YA 2ORBL 4HF5H 1MFAL 5IBUB 3BPNC 1NFAA 1SYSB 1KY6A 2FD6L 4NJ9H 1BYOA 1UZ6F 4KAQH 3E1F1 2CGRL 4MJHA 4MXVF 4BWWA 5T3XD 4ZFOA 4K3JL 5IR1B 5K9JH 1D6EA 4JVWA 2QQKL 2GC4C 2VR9A 3T0WA 3NJJA 1U33A 1HHJA 4MD0A 4QMEA 3WN5B 4PV8A 2XG4A 1C9SA 2FO8A 4Y1AD 1ZHBB 1P4BH 4LCCB 3FUEA 1I9IH 2WB7A 5D9SA 5BZDA 1D5IH 1LO5B 1PZ5B 1ZHLB 3OWRA 3QQDA 2CMRH 4YWGH 3QUYB 3NDYE 1BZEA 2E9JA 3KWWB 3MBXH 2XZCH 5E8DH 4F5CA 5EBLB 5BO0D 3ULUF 3VQLA 1WRFA 4RMUA 3SCMD 1L7TH 1HHHB 4KY2A 1ILSA 2H6UA 1K3IA 2UY7B 2YLKA 3V7MA 3QJSB 1IQWL 1EDQA 4GW1B 3N9GL 5CZVH 1KFAH 1NEUA 5MENE 1O0VA 5GGUB 1YCSA 4NZRL 5CLTA 3T2NL 3AY4C 4WU5A 2ADJA 3D69A 2YEZA 4GI6A 5C08E 3NPSC 3LEVH 4ZMVA 1E7UA 4NUJB 3VJ6B 5IFAL 1BHGA 3RVTC 4WZ9A 1Z66A 5DURD 2RALA 3G6JA 1AR1B 4YX2H 2Y24A 4F2MA 4Z7OF 5I66A 4A2EA 3F6JA 4AG4L 1JK9B 4RAVB 2JI2A 2WZPA 3FU3A 4KV5E 4KI5E 4QRRB 5D7LB 3B7TA 4MKTA 2NSQA 2DRUA 2GSGB 5GZOA 5T5NG 3L45A 3BGMB 5ENWA 4LMQI 4NNPL 4ZOBA 3SDDA 1IGCL 5DO2D 3VO0A 3F83A 4HD5A 1FAKT 4R4BB 1DQJA 4V1DA 4Q6IA 5F89B 2JKTM 3BD5A 5HTSA 2HG5A 2IV9A 4NN7B 5L2KA 3QW9A 4APQD 2OR9L 1BV8A 5DI8A 1NBVL 3F7YB 1SJEB 1U8OA 4RMSA 2ODIA 4JHUA 2EABA 3PWVB 5KANI 3ESMA 1SXAA 3LKRB 3U2JA 3MUUA 2DV6A 1GZHA 3BHBA 4PJ9A 5CJ5A 1ZTXH 4G43A 4QHNB 2D0GA 3N50A 3TZVB 3V0EA 4LSVH 3WEBA 2ZG2A 3HZVA 4FHKA 4LE8A 4PRIA 1KOAA 3MRQB 1EO5A 1PG7W 1ULVA 2H6OA 3BWSA 3MV9A 4I9WD 5FC9A 1EGJL 1NCCH 4PN6A 3O0RL 2ZOOA 2G75B 2MCAA 4Z6AT 1X7QA 2J6EL 4UTAA 1U95B 3BD3A 1IC1A 2HTLD 5E4OA 1D6VL 2E56A 4FNLH 4GT7A 4LF3B 2R4RH 3SOBH 1UURA 1M2VA 4JFPA 4KROD 5DD1L 4GO6B 3L6FB 4GO9A 3PRZA 4N28A 3RWDB 2O72A 2OMYB 4NWUL 4Q4EA 3RPIA 3SN6N 3ZL4H 4ZQKA 1OD9A 2Y5TA 4LOEA 5KS9E 1CLCA 4YBHA 5FK9B 1JZ8A 4ZRGA 3BYYA 3D9AL 2GSGA 3WE6A 2MMXA 2VQ1A 1UASA 4JGNA 2K6ZA 3V5HB 1WIUA 1ZVSB 3GKWL 4WWKC 3PDOA 4Y2DC 4JFEA 4BM7A 4G6ML 4XXWA 4PJEF 3ESUF 1OSZA 1FHGA 3BP6A 3UYRL 1AKJA 3NJLA 4JFQA 2VZ1A 1OHZA 1ORSB 4M1GH 4OCYH 3RI5F 4QR7A 1CYGA 3SPVB 1FF5A 1KGCD 3QQXA 1R19A 3CN1A 3K4ZA 4N0YL 4BZYA 1X9RA 2QSTA 1CU4H 5EBMA 3UTZA 3O9WC 1NANI 3BPCA 5AVYB 3SBWA 2HTLC 3D50A 3ZO9A 5ID1B 1I85A 3BX7C 2JTYA 3B9AA 1SQMA 1CLZL 4ZS6D 5T1MA 1CFSB 1DHKA 4BSVA 3I9PA 3UGEA 4Z95H 1HESA 3IXTB 5JUEL 2BSCA 4R6UA 1E5CA 3GKWH 4PVMA 1I9IL 4PLNC 3Q2WA 3VXSB 1F4XH 3BEWA 2Y1AA 1VFMA 4JFYB 4WHCA 5IHZB 3A0OA 4TSAH 3SE9L 5E95B 2W0KA 1FNLA 3GTTA 4AMKL 4IRSC 4FABH 2LOEA 3S3DB 4EI5C 4MBOA 1DQLL 4JDVA 2R4RL 2UWEB 2JKJA 3QUZB 4D7PA 1D5XB 2IPKA 4X6DB 2WJ7A 4JLRA 1ZJAA 1NAKL 2OI9B 2UX7A 3NP3A 4N2EA 2WJ5A 3CXDH 3BUQA 4TTGA 2CDFB 4I5BA 4KZEH 3CFBB 5FB8A 1G7IA 1E8ZA 3CCHA 3IFPB 4J3SA 3HS0C 1HJBC 1FL6B 3PWJB 5DK0B 1MEXH 4R4ND 5DJYA 2XWBA 4G8GB 3VXQB 3L81A 2CJSA 2OMZA 4H8PA 3GSRB 3L3IB 1YMMD 4QTIL 3F58H 2G2RA 3E6FB 1KPVA 1TQBC 5I1KH 1A1MA 4ABVA 5ADPL 1OGPA 2W9DH 5D2LF 5GSRA 3BQUA 4PJ7F 3ZKNC 5IVNA 4GQ9H 4OAWA 1CDJA 4FMVA 1T0OA 3KWXA 1GL4B 5AB2A 1KLUB 1GGCH 3EO0A 3OV6A 4CGTA 3D33A 1UWFA 2B8OT 1Z3GL 5E99L 4F2EA 2IANB 4JRLA 1YEGL 1VGKA 4NI6A 3L8QA 4ODTL 1UUSA 4F15B 1URLA 2EDXA 4HUVA 2NNAA 4LSTL 4JFZL 3LKOB 3VMNA 5FYJU 3X14A 4AMWA 5IV2A 3K6SB 5ISZD 4PBDA 4MMZB 3NZUA 2J6WA 2N59A 1H5BA 5IUSA 1E0OB 2NY1B 2DYPB 4BSWB 3ATBA 4R83A 1T7XA 4X98A 5DZVA 1D5BB 1JNNH 1QSFA 3HRPA 4GXUM 1KGXA 1RURL 4JFDA 1AFVL 2K3HA 4ZTOH 3C09C 3KL0A 2R2BB 4QGTA 5FCUL 1HYSC 4KFMA 3BESR 5FO7B 4JFXB 2H2PC 5TE7H 3V6FB 2O6EA 3A4AA 2UZIL 1K9TA 4JFDD 1JZ6A 4J2XA 4G7YH 1B4JH 1EV2E 3X2QB 1HVXA 3DHMA 2LAGB 1RZ8A 4JPKH 1BLNB 4R5TA 4JO3H 3L7EB 4ZS7H 1BQKA 3PPSA 3AREC 3DVIA 3VSTA 5D4QA 3CX2A 2ZD0A 5CZKA 2CLRA 3LQAC 3QYCA 4MNQD 5EBLA 4Y4FD 5HHOD 1T5XA 4JZNA 1HOEA 1QBAA 2PYEA 3CU1A 3GIVA 3IGAA 3DX2A 4QOKE 4QY8A 1Q94A 5KSBA 5J3HD 2OCJA 2Q7AA 4MHHG 4PWKA 3RWGB 3LZRA 4LPTA 1LQBC 1MWAA 2GYSA 3GZQA 5AZEL 4W9KC 1MVFA 5DJ6A 1BP3B 1UA3A 4M6AA 1J0YA 1DJIA 1N3NB 2A83A 3R0MA 4HULB 5A2CA 1F42A 2QPEB 4DAGH 5AOKA 4E9QA 2X4OB 5I17A 1N6UA 3FSVA 1RZ8B 4WI5A 2J21A 1I8MB 5JYLA 1L3NA 2ERJC 4LBAA 4GXVH 3W2DL 4EIGB 4BGDA 5JXEA 4GAFB 1T21A 3M1OA 5HYIA 2W9EL 2K0RA 1JGLL 2ADFH 4HWBL 3QFGA 1SHWA 4PSPA 4X6CB 2YFOA 3QPQD 2W81C 2Z8WC 1E5AA 2VAJA 2JJSA 4PB0H 5E8EB 3SOTA 3V52L 5JR1H 1ZIAA 2F53D 4WHTA 2JK5B 2ZICA 3VXNB 1TTBA 4CMMA 3L3KB 1AJ7L 2JELH 4WSGA 5A2FA 5EZJA 5LWYL 4NZUH 4B27A 1LWRA 5ALBL 2QMKA 5IROA 4H26B 5E1HB 1BFSA 4I8DA 2GSMB 4Z7QF 5JPNC 4YHYB 2X0WA 4QYOA 1M6UA 3G08A 3OKEA 4JN1H 4RSVA 2YD6A 3VUAA 5M95B 3IRCA 1JPSL 4GUQA 1AXIB 5LGKA 1QR4A 1RK1A 3BVUA 3FTSA 4PMEA 3UTQA 5E8PA 2DICA 2GB2A 5DRNB 2MCG1 3PGDA 1RUMH 3KYKL 3P3SA 2E6PA 3SYQA 3I9AA 6CGTA 4WFGD 1OL0A 3SKMB 1USQA 4P59H 1I4FB 1ADQH 2ALAA 1LO0L 2HLFC 3GMOB 1CFTB 1I8LA 1M1SA 3CZSA 5DC4B 4J27A 4Y88A 5JLZA 5CGYD 3SE4A 2ITCB 5I1JH 3KWVA 1YY8A 5FO2A 4IEFA 1YDPA 3RA7H 2H1LM 5CEXA 5IIEB 1BBDL 4AJYV 5CCJA 2EUVA 4L48A 3BWUC 4MJ5B 1F1AA 4MTMA 4P5RA 3QXTA 4LAQH 5SWSB 1FG9C 1U92A 4JHBA 5CWSA 4BFIA 5EZIH 2DQUL 3F65A 5EG6C 5EEWA 3TWYA 1T0NA 4X6DA 4NZ8A 2CCLA 3NPZB 2AK1H 4NZUL 2XKUA 3FHQA 3WCYA 5DJ8B 5ANHA 3ZE1B 3AGVA 4DEWA 2FRGP 4JHAL 4LFHG 4PB0L 8FABA 5JR1L 1HS6A 3QYNA 2P5PA 3JTBA 4YDLB 3O6FB 5GIRB 4OLVL 3SYOA 2R4SH 5D7IE 1A1NB 1X5MA 3QUGA 3KR3H 1RZIA 5AB1A 4JB9L 3U30C 2J5WA 5FDWB 2VDQB 2BHUA 1KYDA 4M7KL 1MHHB 3L3DB 1NMAL 3RZCD 5HDBF 4L3CA 1P84K 2XN9D 3N41F 4MAYD 3FRPB 1F58L 3EJSA 5IB5B 3L9EA 5B3NA 1S6NA 3PL6D 3OLIA 5A2JH 1N8ZB 3RTQC 3U4EB 2Z3FA 3FXIC 5LNGA 1IL1A 2HFFB 4XXCC 3QIBD 3U4AA 3X1NA 3TT1L 5IW6A 3V5DB 4F1ZA 1JF5A 1CTNA 4APQA 4EIBA 3QQ4B 1QTYT 2NYYD 1S8DB 4G70B 4M8QB 2BP8B 4N68A 1UM6H 2XPGA 1XIWC 3TIDA 2YEZB 4ILDA 4DSYA 3MLZL 1JGDB 3B2PA 4X0KB 3AMLA 2WAQA 3GB7B 1NGWB 1FVEA 1OSEA 4K5PA 5KAQG 4WAFA 2X40A 3KLLA 4P23C 3SJVD 4LF3A 5G2NA 3KLAA 4MMXA 3HEIB 5KEZA 3VI4E 2I26N 3TT3H 1S8DA 3O2WL 1NGXB 3C2AH 2J5LB 5JO5B 4ZQTA 4MNQE 3AT0A 4LDCA 2ZYRA 3MRQA 5BZDB 5EOCH 4PRPA 5C0BA 1WAAA 4BCZA 2XWCA 1CXEA 5JHBA 1EMTH 3MLYL 3OKMA 1ZV9A 2WXFA 3CQFA 1JI2A 3J7HA 2RFXA 3SE3C 1ZLEA 3R1GH 2GIMA 4GRLC 4WI7A 5IMLB 2GFBB 5CJXA 3AM8C 4HC1A 1RHHA 2KKQA 5AOJA 4H0HB 4TVUA 5FYLH 3VQMA 5FA4A 2LVEA 1R0AL 1R1CA 2HLAB 3ETSA 2BMKA 4MDRA 2FIKA 2YPVL 3NP4A 3PUCA 1N64H 4RFNC 1N67A 4TULL 1KUMA 1AKJD 3NQIA 4FKEA 2R7EA 4O02B 4Q9QL 3LN9A 3NTCH 4P2OA 5AKTA 2B20A 3FUMA 2C34A 1MHEA 3SGDI 4EN3B 4Z3HA 2Y1VA 4YVUA 2JKLA 4KX7A 3BIKA 2EH7H 4RLDA 1DN0A 3MRNA 2X6MA 3QEGL 3SDYH 5IVXA 5LNDA 2VLMD 4RZCB 2COQA 5GRXG 2EYTA 5IWLA 3Q2CA 5IFJA 2WWMC 1W8EA 2IDQA 3A4FA 3TESA 1KIPB 3IDYB 4N1CA 3V5DA 3BGAA 3KCPA 4PTTB 4E0RB 1E65A 1GZPA 1MXGA 3OAZK 1CQYA 2NY5L 3FMGH 2J1YA 3GXTA 3MV7A 4JE0A 1QWNA 2AK4A 3U36B 5KSAB 5DHXB 1UJ3B 3R18A 2GTZA 4YDNA 2BSRB 2Q5BA 5FGCE 2Q7NA 4MA1B 2VISB 3ELAT 1AGBA 3QNZB 4J6IA 2X0VA 3IRPX 5EZLA 3HPLB 2ZP9A 2GEQA 1JXJA 2EE3A 3PHSA 4IIZA 4LVHC 4UIMA 5T3ZE 5HY9B 1L5GA 5E2VH 1U8LA 4GW4B 4I77L 3OKLA 3QPKA 4GXUN 2R1YA 5I0WA 4Q2ZB 3HE6C 5GHWL 3ESOA 1DUYB 4LSSL 2DBJA 3KL5A 1OAJA 2ZUVA 4Y9BA 1GRWA 4ZMPA 5E6ID 2X1QA 2EDYA 2DI9A 1DLHA 3QZLA 1IBFA 1T89A 3WUZA 5JPNA 5T1LA 4NDMA 2OA9A 5GGVY 1D5BA 3GLEA 3O3AA 4X5QA 3QWQB 3FRUB 3I3DA 1EZSA 3CVHL 2CRIA 3G5XA 3LEXA 1MHCB 4WFHD 1DJWA 4H8WL 3UOAB 2F8IA 1OTUC 5C86A 3QUMH 3DBSA 3WNLA 2FR4A 3JUZA 1EIBA 2VDKB 4KK9D 5ESQA 5FWQA 4X5XA 3WXWH 3D2UD 2XZAH 1CG9B 3K8MA 5FGSA 1GC1H 4UNVA 5KAQF 1T22B 2CHNA 2Z0UA 1XGRA 3LIZA 5AVVB 5C09A 5KYUB 2UY6A 4IHOB 1F1GA 3FU6A 3MJGX 2O1AA 1TQCB 5TE6H 3VU2A 3ZKMD 4PJ5E 1WAAF 4XI5D 3HOGA 4TL5A 4WSJA 2VLRA 3HPJA 3S0PA 5D7JB 3D9AH 2VXSH 4QNPF 5F3BA 3OC5A 4QTHB 3DMMA 3Q2VA 5DUBA 1IC4L 4HUWA 4H0LC 1E5ZA 1PZAA 2VXUH 4U4IA 3O6FA 5GIRA 3VA6A 5KG9A 2BSED 3PU7A 5FGBC 4MJ4A 3RVWD 4UAOB 4FQLH 3P73B 2A77L 1A66A 2C4FT 2WQWA 3U7WH 5DJZB 1SY6H 5I75C 3REWB 2N1TE 1CD0A 3QUKA 4QO1B 2N4IA 5I75B 1GXEA 4L9LB 2DLTA 4AH2A 5FB8B 1VENA 2WLYA 1AY1H 1CVSC 4HEMA 5HVGB 5K1VA 3WNMA 8CGTA 4PGBB 1PZ2A 4FHJA 5IVZB 4Y5YB 1U4EA 1AVAA 4ONFH 5SWSA 5F1NB 4AYID 1NFDA 4G7VH 4H20H 4Y19D 1YQVH 2MPAL 4HKXB 1ZA3A 4KTEH 1WBXA 4F3FA 5AD0B 4FADA 3H2WA 4PJ7A 1BVNP 3WNNA 1UB6A 4PQXA 4KXCA 1CDCA 3AWFA 3IKCA 5TDOA 5ICZA 4J6RL 1CD9B 4JPIA 2DQTH 4RGOH 1RZGA 2DMBA 1EO8L 5F7FA 4C4UA 1SXNA 4TXVB 5I73C 2G3NA 1AIFA 1I4FA 5D5ME 3H9HA 4PRNA 4OLYL 1IM3A 2X89D 1QFHA 2ADGB 2J1WA 1BFTA 1DBAH 2V17L 1DBMH 3FBQA 4HUVB 5DEGB 3NJIA 4FNSA 5J4MA 1LO3L 2IAMB 3BJLA 1OP5K 4HQQH 3V79C 3NJNA 2DQJH 4IIQA 1XIWA 1D7CA 3LEVL 3ZDXB 3ARRA 5BQ7B 3OGCB 2IH8A 1RFDL 1ZLVK 3BSZH 2OTPA 5DMIL 2BNUB 5IFJB 2COVD 2JQMA 4NUMA 4ZO7A 3LDBC 3GSNA 4EI5D 3KXFE 4G42A 4HUXA 4LLWB 4DW2L 2ZIDA 4RX4A 4ODVL 1P2CA 1F86A 4ZDHA 1IIKA 5FKAB 1SM3L 5GRUH 1W6LA 3TU6A 1YNKH 2ZCKL 2ZNXA 4DQOL 2GJPA 2EYSA 4N9GB 1OLLA 1S9VA 4OJFH 3LRKA 4QHLA 5LXGH 2QLVB 1T22A 3BSGA 1X6NA 1DR9A 2FWUA 1WICA 4JRXA 1PEWA 3IMWA 4FN0A 4P46C 3ROLB 1EHAA 1NOAA 4XZUA 4YWGL 2WO4A 1KACB 4XPFH 4OLXH 2F68X 3JSSA 4ZNEA 1IGIL 1NOLA 2ZXQA 3MRLA 1CBVL 1JZHA 3BFWA 4A63A 3QJFB 1AHMA 3MRCB 4KUZH 5IJBC 2XFXA 4V11A 5E2VL 1KNOB 4L2LA 4DP5X 3SQBA 1BD2B 2WK2A 3K8KA 2NY7H 4XMZA 2WINA 4YDIL 4YQXH 4E9YA 2XBTA 5DJXA 4HPYH 3FQWB 4IMKC 5F7NC 1V7NH 4N2BA 5FOBB 5HDLA 2NSXA 3WJMA 5D2LB 2WKLA 1D3CA 2G9HA 3BAWA 1U93A 2NY3C 2WNXA 3NVQA 3QRBA 4HJ0C 5CM1A 1CFSA 4K3GA 2V37A 3KWTA 4D2NA 4J3VA 1A3LL 3W38A 1KNOA 1ZGLA 4GP8B 4K0OA 5D2NB 2HJKA 1U3HC 2Y07H 4K71C 4QXUH 2D7QA 5AW0B 1JERA 1JPGA 2CQVA 4G8AC 4DZ8B 4P4RA 2BOBB 4IBVA 1H3PL 1MJUL 4ANWA 4JDZA 5PCYA 2BIIA 3L95A 1MZZA 1PSKL 2ZZUT 3PWUA 1BX2A 1KJ3L 5ETUA 1Q9OA 2ICWA 2OSWA 5EU6E 1QR1A 2EYTB 4M7JH 2C9RA 4JLRB 4GMSL 4Z7UB 1YMMB 4AGQA 2P26A 3QJXA 4MJIE 2H1PL 3QUZA 4X8JB 2ADJB 3OHXB 4NO2A 2W80C 3WTYA 4TNVK 5IEHA 3VFWB 3H42L 3IU4L 2DJ4A 1OWWA 4MNQB 3ROOB 1NGYA 2VZVA 2HFGH 3SJVB 4B9ZA 4WI8A 4TPRH 5ICYB 4EQ2A 1OB1A 5IFAH 4HUMB 1QP1A 2D7TL 1MY5A 1I75A 2VO5A 4I87A 1SVCP 4KOBA 5D2NE 3IFNH 1CF1A 3BQUB 3AABA 4ZTPH 4TUJB 3IT8D 3ARSA 3E6FA 3DKHA 4YXKL 3VH8A 1M7DA 4HEPG 1L7TL 3ATFA 1VFUA 2JQZA 2XRAL 4WQOA 3RURA 2O5XH 4RA0C 5E1QA 2XA3A 4S1QH 4M6MH 43C9A 1MCOL 4Y16B 3SDXE 3RTQB 4PRPB 5C0BB 1IBHA 1VA9A 1DVFC 3IFOA 4TPRL 3K4DA 5BW7A 5IHHA 5LQBL 1MOEA 2DLHA 4PSRA 4NZTH 3AITA 4WJG3 3QVAA 4WO4C 5IW3A 4RIRB 1NUFA 1IM3D 2X89A 3KVQA 2E47A 2WKOA 3TTYA 3UMNA 5EEUA 2UZXB 1MFMA 4HKZB 4OW6A 2CBPA 4YDLC 2R1WB 1ZHNB 3QT2A 4AH2B 4LPCA 3C6LB 3CVCA 2NNCA 1PAZA 1Z9SB 4U1KB 2EIBA 2VLKE 1MJJB 2PETA 3ZYZA 3LH8A 5FHBH 1MFCL 1DSFH 5AW1B 1DZBA 3O4LE 5I8OL 4DPBX 5HHMD 2NNRA 3LN4A 5J6GA 5DGRA 1WHOA 3FUHA 3B1TA 4IGBD 5K9OB 3MXVH 4G11A 3QK0A 3BVXA 3UJIH 4BRVA 1U8IA 1UD5A 1N5AB 5F7KC 5SWSD 2X6AA 1B3JA 1F3DH 1OF2B 4XCYB 3EJYD 3D4GA 3K91A 5BZWB 5I1EL 1BEXA 1NINA 4Z8FL 2DM7A 1HZHH 1RJLA 4DP0X 5GGRB 1N2RB 4HWEL 5IQOA 1FZKA 3FJTA 4I3RH 1UFGA 3ZKND 3WLWC 4JFQB 3CHPA 1ML0A 1FL3B 3VM5A 2BIOA 2MQGA 5EORH 4AITA 1A14L 4MCZA 2ICCA 2AERT 2OULB 1NAMB 3OKDA 2Z8RA 3QRLA 5CP7A 5DJDA 4FFTA 1XCTB 4NXSA 2FWOA 3WFDL 1AHKA 3VU1A 3CFJB 5EA0H 4Y8DC 3H9ZA 2BVPB 3K71B 5EF2A 1G4RA 5H8DA 4GP4B 2HKAA 2K78A 2NT0A 2X4QB 3FUFA 4GRWE 2X4OA 3NK3A 4Y5XA 3ECVA 5JPMC 1HEZA 1J0IA 2N3JA 2X53A 4GAYA 2OMVA 1NCBL 3KYAA 5JPNB 1HIMH 3BKYL 4K5OA 2YD9A 2PO6A 1I9EA 1ZK9A 2A9MH 1JMXA 1XCQB 1JNJA 5CCKH 1BOGB 5GISH 2R29H 2BDNL 1FH5L 4N2KA 4UB0L 1YEIH 5CXPA 3MRFB 1SN0A 5DHEA 4U3SA 4MAYC 2E0PA 4UTCA 4YBLB 2VLKD 1EWHA 3GMNB 3N43B 4WEEA 1IAIL 3MLVL 4D9LL 2FWLB 4POYA 1YY9D 4DKDC 2VW7A 2OKMA 4F7CB 1HZHL 1BVZA 3FKUS 2GTZB 3MDJA 4X6CE 3IETB 7FABH 5F7LB 3QIBC 3TEXA 1QLRA 2HRPH 3ZGIA 4LAQL 1JAEA 2XKNA 1F90H 2A0LC 3GXFA 5CIPA 3EJTA 1Y0LB 5ESQB 1YUHB 5E9DA 4ZFGH 2WKOF 1ZT7B 3DMMD 3Q1SL 4P5TA 3EDEA 2C9SA 5AB9A 1YECL 3FAXA 3LSOB 3FSAA 2APBA 1A4KA 4X9GA 1EEZB 3L3KA 5DEJA 4TF4A 1TJGH 1MHEB 2NLJA 5I5RA 1INQA 2DJUA 1IBYA 4ZUWB 2YGOA 4PP1C 2AJZB 1I8AA 1YY9C 3WKYA 4M8VA 3SQOH 1KGIA 4OZHA 4QYAA 4Z77A 1GCFA 3K5RA 3F3HA 4CC4C 3T2QA 4Q2ZA 4YAQB 4K94L 1J8HD 3ARYA 1QABA 1AD9B 1YEKH 1WFNA 4GBXA 1CICB 4PRPE 5C0BE 3GSNB 3HI1A 1O9VA 5L4JA 2GK2A 1BXVA 4OD1L 3OX8B 2I9LB 3IBEA 4JG1L 3VWKC 2WBWB 4R3SA 2BC4A 4PWEA 2FE0A 2VISA 4L4TE 4OM1L 2R2EB 3WJJA 2V33A 3WI9A 5TGBB 5IT2H 4WV1B 2CCVA 1Y6MR 5DRXA 5EORL 5IJDC 4FNPA 4LSUH 4MMZC 4WVRA 3OB8A 1JPTL 1BOYA 2PR4L 4HK0B 4DVBB 3NN8A 3JQOB 3KVDD 4GH7B 4GYBA 4RCAA 3SE9H 3EGSB 1QLEL 4GKSB 5E6ZA 5I1LA 5JHLA 1TITA 1PF3A 1KB9K 4P5SA 2IIJA 4HXAL 1GSMA 4HIPA 2XG5B 5F7DB 4HV8A 4M1DL 4QLRA 3BMVA 2NY3B 1XAUA 3VRIA 4E9TA 4WK4B 1PDKA 4EJ1C 3GB7A 3FT1A 3V4VA 1IC5L 1E9OA 4R7XA 3ULUD 2AQ2A 1JZGA 1OAUH 1HINL 1TMCB 4MJIB 4N2IA 4OB5L 3DXAD 4RAHA 4RNRA 3RVVD 5HXMA 3L4YA 3GHBL 3DYMA 1WFJA 4U1NA 4RWYL 4HG4K 1C5BH 3KXFA 1MPAL 1JV5A 1A1OB 4I18A 3VGEA 5KYYB 1N6QH 3WLBA 4R0LB 1SJMA 3BYTA 3P4OB 1GTNA 5FYLD 3GYRA 2P5WA 4UQBA 5GRUL 1R75A 4O4YL 2AKRA 4OZ4A 5E8OB 5IF0A 3OJDA 4LOFA 3REWA 2DEXX 3JZ7A 3LD8C 3UTTD 1AXTL 3RDJA 2W5PA 1DBAL 3SE8H 3HE7D 2XY2A 4HSAC 1G9MC 2VDRB 2IPTL 5F44A 1E4WH 2QEJA 3WFBH 1GMIA 1I8UA 2L3BA 5FUCC 3CHXA 4PG9A 1DN2A 2BVOB 2XTJB 1QRKA 2DDQH 2DQTL 3MROA 3NG5A 3MBEB 2NW2A 3PHOB 4ZQKB 4M5YH 5DJ8A 3RRQA 2YD1A 3GD1C 4F9LA 2H3XC 3U4KA 1K5WA 4H0GA 3G6AA 2WVTA 1J86A 3DGGB 5IGXL 3JYCA 1M1XA 4G8FA 2VUOA 3N0AA 3H3KA 3IEAA 2AI0L 3NJFA 3S34L 4A04A 1FNAA 4LZKA 4GB9A 2ZONA 4WFFD 5BRZA 2XVBA 4FABL 3LEYH 3C87A 5KVFE 4Y2OA 2ITDA 1F5WA 3UH8A 1WYJA 2IDTA 3K72B 3H3PL 5DT1H 4DGWC 3HG0A 3LCYA 3IF1B 2CG9X 2RTTA 1NC4D 3B9DA 4L3FA 4AYFB 3FOMB 4U6VH 4L4TB 2QSQA 3IDMB 4Z95L 4ZPTA 2VDNB 1XHHA 2CZNA 4NWTL 5FYJL 2BNRA 4P5TD 4BE5A 3UBXI 3PHQA 1HC1A 2PCFB 3MXWH 1T20A 4WI3A 3RY4A 4CMHC 4EUPG 1AD0A 4OBRA 2A6KB 4ZX6A 1F11A 1UENA 2FZ3B 2HX9A 2JLLA 4HLZG 3RBGA 4F1SA 5LUMA 1BVKA 5FM4A 4WGVB 5LJYH 4XVSH 2F74A 4G7QB 3CVHA 2R1YB 3O2DL 3OLGA 1CGVA 1FYTE 1DQJB 4V1DB 1QLFB 3K1DA 1ETZA 3HC3H 5M94B 3OHMB 5EZLB 2PXYD 2DD8H 4L4TD 2GBAA 3G08B 4HCRL 4U1SA 3LZFL 3MUZ1 1AI1L 4C4BA 5JYMA 5DHMC 3GSXA 4PTUA 4AJ0A 4HJJH 3SY0B 2X6BA 1NCGA 3B7SA 4PJGB 1I7TB 5I8KH 3X3FH 4X6BB 3RKDC 4Q4IA 5AAMA 5C0AE 4QDGA 2KLRA 2X9YA 2XPZA 3TNNB 4O9HL 1LMKA 3AXLA 4LSPL 4JHVA 4M5YL 4J4PA 4YH6A 4L4VA 4PJAE 1T21B 4AV5A 1UWXK 2H3NA 4OTXL 1QFUH 2JXMA 1YC8A