1QBLL

Fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords FABE8A
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qblL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qblL01
5DJCB 1GGIL 2PR4L 1B4JH 1UVQA 3PG2A 1MRFL 5FA3B 1PKQE 3PHOB 3CLEH 4TUOB 3FN0H 3VXUE 5D1ZC 3FB7A 5L6YL 1DVFA 5C9JA 4PJGE 1MPAH 1BOYA 4DEPC 3O6FC 2XRAH 3TJHD 1U8NB 2LV4A 2DTSA 4R3SB 5I15L 3V8CA 1KYOJ 3D25A 3ARGC 5ESQA 3MRRA 1D7FA 5IB2A 2VLKD 2WIMA 2Z35A 4LCCB 1P9MC 2R56L 4X6DE 5B3JE 4LVNC 3EOBB 3SDYH 1PKOA 4ZUUB 1ADQL 2AW2A 3U0PA 5GSVA 2HN7B 2P43B 4XBPB 2AJSH 3C60C 5CJ5A 4M5YH 2VQ1B 1G1CA 5J6HA 3GSNH 4HUVB 3AMKA 2W92A 5DQ9B 1N3NB 3DIFA 1K4CB 2R4SL 5ANMB 4MJ6A 3L7FA 1F11A 1X6LA 5EU5B 1VGEH 5CINL 1FNEB 4O4YL 4EBQH 4NBYB 1X7QB 1S7VA 4ONGL 5IESH 5JXEA 4QWWC 4Y5XB 4ORGA 1VFBA 4LSTH 2QADC 3IDJB 3S4SA 4PJDF 2VDML 3HUJF 1RZGA 2QKIA 4XCNB 3SGEI 2GUOA 4OUOA 1EPFA 5EU4B 3VI4E 2B5IC 3HC3H 2CO7B 5LQBL 3I9GL 2CKBL 1YN7A 3LQZB 2ERJB 1RZFL 2Z9TA 3WIFB 4LPCA 5GJSH 2AGJL 3HPLA 4HBQA 1JPFB 4ZG1A 4HUNB 1ZHNA 3NOIA 4HZLA 5I8CA 1XIWA 4KU1A 1ACYL 3ALWA 4HF5H 3W9DA 3FT4B 4WTXA 5ALBH 5FIEA 4GRWB 4FFYH 4KVNH 3RPKA 4GFTB 1AQDA 3CNKA 1WV7T 1A0QH 4GQ9H 4Z7WB 2CDGA 4EDWH 3ULVH 1YQ2A 1RUPH 5C0ND 4JZJB 2IH1B 4JFDE 1FNGA 1KELL 1MVUB 4F9LC 1MCBA 4FXLA 2VWEE 1OM3H 1RZKH 5BVPL 2IPUG 1ZGLP 5ACLA 5GRJL 1KIPB 1QBML 1P1ZB 5IM7B 1DL7L 5J0BA 1TJHH 5LKNA 1FNFA 1HCFX 3QUMA 4FXKB 5AZ2H 4FA8A 1FL6A 1YEFL 2DQIL 3WUZA 4GG6F 1RZKC 4O9HH 1UM5L 4ZQKA 5BO1L 1P4IH 5DGQA 3B9KB 5EWIL 2R0LL 5C07A 3VFNA 2N4IA 2XTJD 4KQ4L 5KAQF 5EWIH 1QSEB 3ZKND 2ZOLA 1HHKB 1KJVB 3MRGB 4HPYH 4WI7A 5B38B 3LKRA 4GQ9L 3T1FA 4MNQB 4YHOH 1B0GA 3P0YL 4OZGE 4P4KB 3TBWA 1YYLH 1NJ9A 4CN1A 3U0TA 3L5WB 2YRPA 5ESVA 1Q9OB 2WQ8A 1RJZB 3EYUH 2KL6A 5D1QD 2VN7A 3RUGE 1XH3A 4NWUH 3TBYA 4I0PD 3CFJA 2N1KA 4GH7B 2VLKA 5FUCC 2MCG1 1U41A 5D2NC 4UNTA 3V52L 1YEGH 3FQTA 4PRNA 3T3ME 4GRLB 3F8UB 4XVUC 3NN8B 3BZFB 1OSZB 4D9RD 1IGTB 4UILH 1SBBA 2B1HL 1JGLH 1FZJB 3QCTL 5EIVA 1BFOB 4KK5C 3X17A 4NQEE 2A6KB 1E0OB 2F5AH 1ZVSA 4E41D 4JFED 2Z92A 1DVFD 3TBVB 4H26A 4NUGL 1NLBL 5D9SA 4P3DB 4YH6A 1T6VN 4R2GB 5ETUA 1JZ7A 3RWGA 4JFFE 3M17A 1NFDB 3WSQH 4D2NA 1GPOH 4G6JL 5E56A 3BKML 3LEXA 4V1DD 1A3RH 3NCMA 1WEJH 2XN9E 4PJXE 1YEIH 1BLNA 4K2UH 4WEUD 5GQBA 3WO4B 3JXAA 1ORQA 1W72B 3BEWB 1S7SB 1JK8A 5EOQL 1LDSA 5L2JB 4N0UE 4HXBL 4NM4L 1S78C 1YN6B 4NNYA 4AL8L 3FKUS 5DHXB 3VG0L 3KYKL 4OJFH 5HVWA 4U33A 1VADA 2VAJA 1G0DA 3C2AH 4HK0A 3Q0HA 4EVNA 1XIWD 4YDVA 1S7XB 1A21A 1XEDA 4UI2A 3S88L 3WFEL 4JZJC 4TSBH 1LGVA 1EO8H 2YA1A 5D1QC 4NQVB 1MIEH 4R90L 4QRQB 2ADJB 4XC3H 2IG2L 1CFSA 4MNHB 4WWKA 4G42B 4F2MA 4YXLH 1CTOA 1LE5B 1ZVSB 4D0CA 5TPWL 2NXYC 4U0QB 3TH3T 4HJ0C 5DO2C 4JFDA 3GUTB 5CEYA 2VZOA 1UGNA 4X5WB 4CL7A 2UZIH 5EB9A 2APFA 5CKGA 2AKRA 4FQIL 1A6ZB 1MCWM 2VXUH 4O2EB 1LEGA 2XKUA 1TJGH 4D8PB 4OF7A 3UTQB 3WHE0 3N0PB 3GUTA 2DLIA 4EQ3A 7FABL 5HHME 3TO4D 5GGRA 4FFVC 2WWMD 4J3OC 3OB8A 5FGCE 5IB4A 5C0RL 2F53D 3SKMB 2FJGA 2OYPA 3DWTA 2AJYL 1OCWL 1IEHA 5GS3A 4MA8L 3EYVA 5EO9B 4OZHF 4NO0A 1JGDB 1ZS8A 2HN7A 3HZMA 4JJHA 4ODVH 4UT6L 1DBJL 4ESKA 4GW5A 4OZGA 5FCSH 1OCWH 2EDLA 2AJUH 2NY3D 3MLUL 5CJBA 4DW2L 3IXTB 3OKNB 1QRNE 5DR5L 3STLA 5D7JA 1SEQH 3CXDL 3EUUA 4XP5H 2Y36L 1EAJA 5J13B 3BISA 2M1KA 3VWKA 4H8WC 5CSZA 4M62L 2O5XL 3GMQB 4XPGH 1Y6MR 4XHJD 4KVCL 2Q8BL 2YD4A 4WCYL 4Z7NF 5I0ZA 3QCUH 3CUPB 3MRDB 4OI9A 1P1ZA 3K46A 2GCYA 2OXHA 2ZUYA 5T5FH 1QR4A 3WO4C 2CRMA 3M45A 2HJLB 3KYOA 1LNUB 1ND0B 4WO4C 5DFVC 5H8DA 1A7RH 4QHUA 2CDGB 5EFIA 1S3KH 2ZP0T 2BCKB 3VRLF 2JIXD 4L9LA 1EUUA 3FQUA 4OLUH 2I9TA 3BQUC 1H0DA 5HGHA 4EOWH 1IGIL 3MUGB 1FL5B 2BSTA 1EGJH 3AS1A 4HS6B 1RJYA 4O4YH 1NC4A 1Q38A 3LY6A 1BIIA 1MFEH 3VXRD 3WD5H 2NY6C 3L7EB 4UIKH 2IFFH 2NY4B 3ARGA 4MB5A 3CVHH 3DIFB 1N0XL 2FEEL 4IDJH 4KZDH 2DQUH 1PW3A 4JM2A 1FNHA 2IQAA 3VCLB 1BZ7B 2YPKB 2IQ9H 2VLJD 2ERJC 1KLUA 4M6OH 3T0EE 1OY3B 4KDWA 1ZLVH 3EOBA 3AAZB 1WVZA 1IZKA 4KGJA 3C09B 5BRZD 4FFVD 3PHSA 4MNGB 1UZ8A 4R97C 1CE6B 1AY1L 2K1MA 3EOTL 3W82A 4HIEA 3SKJL 3QZWG 4MAYC 1JHLH 1C12B 1U95A 1LO0H 2E7CA 1IGFH 3H0TB 3TPUA 3HMXA 4O2FB 4H25A 1KIUA 2XQBL 3LN4A 2R8SH 1H5BB 1MRFH 3TBTB 1W0WA 3B2UC 3D3VA 4DZBB 3PWJA 4UAOB 3ULUE 4MJIA 1EVUA 1HYSC 3IDMA 5I6XC 1S5HA 3N1PC 4JM2D 3I6GB 3UTTE 4L8CB 5DK2A 5FCUH 3V5DA 3UTPE 1QRKA 3UTSB 3T2OA 1KEGL 2EE9A 5F1IA 2ICWI 1HILB 1U6AL 1ZT4A 4H88L 1LWRA 3MRMA 5L8LB 1I7RA 32C2B 3N1MC 1B4JL 2DI8A 5CILL 5CBEB 3PP3K 1ZAGA 1KEML 3GSVA 4KAQL 4JFHE 1HZHH 1A4JB 4LLQB 3DOSA 4GKZB 1MJ8H 3WUWA 5CUSL 3MV7B 4NQDA 3FFDA 4N0CD 5DJ6B 3U2SA 3EGSB 1ZANL 3WV0A 1Q9KB 5GGSA 4LMQI 3QJHB 4HMCA 2G60H 2APXA 1R0AH 1YPZA 1PQZB 2FSEB 4WWID 3JTSB 1RJLB 4M9PA 4XX1E 2Q6WA 1I7ZB 4TVSa 4PIRF 1JPTH 2D7PA 2OR8A 4IDLA 3ULUD 1AIFA 1Q9LB 4I2XA 4MJ6B 5JLZA 3GI9L 2RB8A 5ADOL 1NAMB 1SMAA 1J1XL 4PJHB 3MZTA 5F1NB 2EC9U 4P5TD 3RBGA 5HHPA 5CJXC 4QYOB 5C0IA 3W2DH 2Q76B 2VYRE 3U30B 4K7FA 5IQ7L 4IRJB 3KR3L 2FB4H 2EDTA 3S37X 1JYWA 4G7YH 4QT5B 1U8LB 4OFIA 2ZSWB 1L7IL 1A6TB 3QCVL 3SGKC 4L8SC 3QCUL 3FRUB 2YRZA 3DUSA 5TDOA 5GJSL 1RZ7H 3BDYH 4BSVA 4JM4H 4QXTB 1MJJB 4Z18A 1XF2A 1IKFL 4OFKA 3U7WH 5IB1B 1XGPA 1TNNA 3ARYA 2EIBA 1BJ1J 4WIQA 5DQDL 4FXGB 1QPXA 5DLMH 5DVKA 3AB0C 4WUUE 3RHWF 3U7WL 5BV7C 5DWUH 4K7FB 3U79A 4ODHH 2JCCA 4LVOC 5TE7L 4R0LC 3RWEA 3CX5J 2EYSB 5EORH 4QHNB 1I1FA 3GSRA 1QLEH 4CU7A 4EDXA 1AP2A 3S5LG 4HKBB 5LWYL 3UJJL 1TPXC 1IQWL 3V95A 1IZJA 2WANA 3I6KB 4LNRA 4JPIB 4LQ1A 3KDMA 1YYLL 2QHLA 3MJGX 4MYWB 1JGDA 5J1AB 4FQJL 5I19L 1FO0L 3BKYH 1I75A 1F3DJ 2OX5A 1F58L 3G6JF 2CUHA 4WWKC 3DRTB 4NRYB 4L4TE 4HH9B 3P30L 4HCRL 4LVOB 3BZEA 1PZUB 5A3IC 1MUJA 3KLAA 1JF1A 5C71A 1KCVH 3ZHLA 3HPJA 1OP5H 3V6FA 2J8UB 3OKEB 5SX5H 2AXJA 4C58B 5IB3A 4PJ7B 5C8JA 3QDGD 5E6ZA 4I3GA 3MV8E 5FYKL 4PJDE 3VFRA 1P84K 3PE9A 4HV8B 4OLZH 5EOCJ 3TT3L 4QHLB 3SCMC 1M1SA 5HHOD 5JOFB 4ZPVB 1ACZA 4OZGF 4DOHE 1R6VA 1UWGL 3ARGB 3S7GA 5I71B 2A1WH 4GRLC 3DVFA 1HHIB 1FNAA 1KELH 4XTRD 5LAXB 5MENB 5A2FA 2H26B 2MNUA 5KVDL 4XCYB 3D5OF 1SYSA 1L0YA 4XBEH 2Y5EA 3MYZA 4Y4FD 5KVDH 4XCEB 3BAEH 3O45B 4JVPA 3VJ6A 1LO3L 3C08H 5HI3D 1I8LC 4WW2F 5F7MC 4P2RB 1LD9B 4WI3A 3TVMA 5BVJA 5C70A 4QLRA 1MAJA 5F7YC 1XCQA 1JL8A 4JR9H 4ZO6A 3SDCB 3MJ9H 4N0UA 1N8ZA 2QTEA 1KENL 3MSPA 5D96C 3DO3A 3LQMA 1ZGLB 5HGBB 1IC5L 3LB6D 5KVEH 4ZUTA 3JV6A 2HTLD 5AYUL 1FFOB 2YD9A 2V9RA 3KHQA 5SWSB 5IR1B 4HFWA 1BOGB 1QSFD 3G6AB 3VG9B 2VDRH 5I1DB 5D7IA 3HZYB 3PDGA 4Y5YB 3KYKH 4EBQL 4BSWA 5JW4R 1NLBH 1RY7B 1VGEL 1CXHA 1HDMA 4C83A 5DZNA 4Q58C 2IFFL 3SGDI 2W9DL 1RU9L 3C5ZA 5KSUA 2OSLA 3IAPA 3GSQA 5HHQB 3WYRA 4K9EH 3O6LL 2ENYA 3H9SE 4MD5B 3WSQL 4NRZB 3MO1B 1S5IL 3WUWG 4HS6A 5I1IL 3GRWL 5DQDH 3H8NA 4G9DA 4XNYL 3QFDB 4IDJL 5FXCH 5BJTB 4RMTA 1XGTA 3CVHL 1Q9WA 5E4EC 4Q2ZA 5LWYH 3QUYD 3VD7A 4JE4B 4MA3A 1YJDC 1FFOA 4M61A 2D2OA 1CFNB 5HBBA 1K8IB 4DVBA 3W0WE 1UEMA 4UAOC 5TGBB 5C0FA 4NQCE 1UXWB 3FO9B 1N5YL 4GBXA 4UBDD 2NXYD 2DI9A 4R26H 3ULSA 2EH8L 1KCUH 3MRBB 4NQSA 5FYKD 3VD5A 3SE8L 1DLHB 2GYSA 4JO2H 1ZTXH 4ZUWB 1I1RA 1QBAA 3S37L 1UXSA 4O9HL 3T09A 1FVCB 2RGSA 5FYLH 1NC2B 1S7RB 4BK4A 5CZVL 4NHCL 4JCLA 2X4QB 1KCRH 5IHZA 5C0DB 1XGUB 4LCWE 4PRPE 5EZLB 3FONB 4GW5B 4P2RA 3DHJA 1JK8B 1J8HB 3K4AA 4EI5C 1ZS8B 1B6DA 5EU6E 3WFCH 3GMMB 1ZSDB 3RVXD 3VJ6B 4X8JA 2EICA 3CAFA 5DJ8B 5GGUB 3T4YB 4KROC 4P49A 4KTYA 3DMMD 2AJUL 5KVEL 2MCPH 3NIGF 4TPRH 4D9LH 2EH7L 4FQXD 4C56D 5DD5L 3H9SD 2XI9A 3RGVB 4PGZA 2VXVH 3S37H 3QDGA 3R0NA 3PF2A 3QEGH 2CJUL 2P8PA 1ZTXL 1PSKH 1OAQH 4OGYL 1C5DB 1ZKAA 1CQYA 3E0GA 4J7RA 1S9YA 2D4FA 2R4RH 4JPWL 5HI3C 5JHDD 3ARBD 4BZYA 1C8PA 4AG4H 2M26A 4UT7H 3FCTA 2XWTA 3BOVA 2VDMH 3QIWD 3DVNA 1IAKB 4R7NB 4XTRC 4HFWB 4NN5C 4H20H 1HHJA 4MCZA 3H3KA 3W81A 4QRSB 2JJWA 4N1EA 4NRZA 5KZCD 1WCQA 1YY9D 3CJJA 2F5BL 4FP8L 4AM0A 3D18A 5HDQH 1WBXB 2FJHA 1R5IA 1N3NA 1E4XH 4HKBA 4ZXBB 1S7QA 4PJCB 4NC0B 4RFOH 3RNQA 5I2IA 4P46A 1NCNA 1T6WA 2ITDA 2VIRB 4ONFL 5FYJH 4ORZC 3IFLL 4NFDA 4Y1AE 5T3ZH 4PJ8A 1U91B 1CT8B 3SCMD 4X6EB 2XZZA 3BI9X 4RFEA 4BH7B 5HJ3A 1G7JB 5MENA 1OGAB 3RPIB 3QH3A 1NFDA 4QKXB 5IK3B 4KQ3L 2FX9H 2FWOB 2R69H 4OIIH 4XCEA 3IF1A 3OL2A 5BS0E 1QRND 3MV8D 4ZQKB 3RBSA 3QULA 1CFBA 1Q9LA 5C0AD 3NIGE 3AB0B 3DSNA 3CGTA 4N0UB 3BKMH 3PDDA 5HVHC 1UB6B 3LN9A 4X6CE 2C1PA 5DEFB 1A02N 3Q1SH 1B2WH 2YPVL 2ARJA 4PJFF 4QNPF 3HR5B 2VDPL 2AEWA 3D39B 3ZHKA 3TESA 3FQXB 1KGCD 2D7TL 4Y19B 5FHBH 1T03H 2ITCA 3RQ3A 1IKNC 1G7IB 2Q8BH 2E7LA 1U8MA 3EKCA 4WFED 3O4OB 1HSAB 3MZGB 1OP9A 5ANMA 4FQQB 1QPPA 4YHOL 4HUVA 2OSLB 1EHNA 1H3WM 4PJHF 1KPVB 1NGWA 2VLJE 3L5WA 1I8MA 1UM4H 4GXVL 1C7SA 1J87A 2V5TA 5GRUL 5C08A 2IPTH 5KTEL 5D71H 2Y36H 2VZ3A 5T1MB 3STZA 1UFUA 2R0LH 4ZAKA 2XN9D 4G8GB 1LE9B 4LLQA 1BFVH 4L8CA 4Y5YA 3RTQA 3IYLW 1KB5H 5EU4A 2NY1D 2WINA 1CBVL 4XAKE 1OPGH 3GSVB 3VXUD 2MOVA 4LP4A 4IOFD 2P5WB 1TZGL 2BNQD 1HQ4A 1TCRB 1HXMA 3TVMD 3P0YH 2DQJH 4P5TC 5D1XD 1JHTB 1JPSL 1L9MA 3C5JA 5SWZB 5CCKH 4AK1A 1AP2B 5HYJE 5EA0L 1P6AB 1DBML 3MLUH 4Z95L 3MCG1 2AK1L 4KI5E 3SKNB 5DGRA 1TZIB 2YC1B 1MHPH 3ZDXE 4LPWA 4QRPA 1KG0A 3CDGB 4OF3A 5IW1B 4EI5D 3T0EC 3N9GL 2VIRA 4FQXA 4F7EB 1XGPB 5E1HB 3MX0A 5IFJA 5FGSA 5CIPB 1HEZB 4P0DA 4MZ2A 4XWGH 2IMNA 2DKSA 1AHWA 3K2UL 3TJHC 1JNLL 5I1GL 4F7MB 2CDEA 3CZJA 3GRWH 2CLZB 3UTTD 4M7LH 5J89A 3C6SB 5BOPA 4Z77B 3KPRA 3RVVC 1Q0XH 4OF8A 5KS9A 2DI7A 1JZ6A 1QSFE 1YMMB 4LFHD 2VITA 3KXFA 4KY1H 3U7YL 4IOFC 1OWWA 1RZ8A 3MRPB 4CNIA 4MAYB 1TPXB 3O4LB 3JWOH 4LAQL 4E41A 1BIHA 1GZPA 2AGJH 4AIZA 5JR1H 4X7TB 4LBEA 1XR9A 4LLUA 2O61B 1J10A 2FJFB 5BZWB 5A40E 3EZJB 3CMOH 2LVEA 1FFNA 4NN7B 4Z78A 1X5JA 4UU9B 3SBWA 4L5FH 5I1JL 3MLXL 2HP4A 4LLDA 1JNNH 5DMGC 2H41A 1U8JA 3OTTA 4K3EL 4PP1D 1TQBC 2C3VA 1T2QH 4JRXB 3NGBB 4EN3D 4ERSL 5IHUL 2OZ4H 4LCUA 1UCBH 2X4NB 2FBJL 3B5GA 1J0ZA 3IU3A 1KIRA 1PJ9A 5GXBB 1DUYB 5BV7L 1N64L 3MMEA 1RIUL 5EBWB 1P9MA 4AMKL 2HA1A 4PREB 4WDIA 4YXHL 1GHFH 1DQDL 1L0QA 4XP9L 1YQVH 1CDBA 3WKML 1JUFB 3MOQA 1T89C 2FZ3B 1ES0B 4ZUVB 3TFKC 5F6IB 1WUNT 1A64A 4AYFA 2XIDA 4NKMB 1TVBB 4OM0L 2C4FU 4I77L 1FFQA 4KV5F 4JHZA 4TUJB 2BNRE 1G7LB 4PRIB 5INCB 3VXPB 3MLTB 3LDBC 3GIVB 4JKPH 2VLRE 5J1SC 3C9NB 4RFNB 3T0BA 5C0IB 2OZ4A 5CLTA 2AXFA 1F2QA 2F8OA 1SJEA 3SDCC 5JORB 3HI6H 1DQLL 5F9OH 1MVFA 1JPGA 4WO4A 3WL9B 5F6IC 1OQXA 5DI8B 3DNKA 3VFTB 1CL7L 2NX5B 3R1GL 1P7HL 4L4TD 4KTDH 4HWNA 1YDPA 3EFFA 4FZEL 2LQRA 5DHYB 3RWIB 4R4ND 2P47B 1NKRA 2EDJA 2NY2D 1U58A 4PRPA 2ORBL 3BGFB 5KJRL 5D70H 3T4YA 2ADIA 3MRCB 2GK0A 1LEGB 4C55A 5IW3A 3GNMH 5ICYB 1MF2L 4X0KA 3F12A 2GEEA 4XNZC 3BGMB 4F57L 1I8IB 5DA0B 4OZFG 2EKJA 5EFIB 3UC0L 3U4EB 1Y6NR 2HRPL 4HUKB 2OTPA 1NANI 4J4PC 3PWUA 3D85B 1N0LA 3C5ZB 1YN6A 2EYTA 5CCKL 1IFHH 4LGRB 2HJKA 1F2XK 3QDJA 3AM8A 5B39A 3BYTA 4YHYB 3GDBA 3T65B 2AK4B 5D7IF 3HZYA 1N0XH 1OLLA 2RFXB 3SO3C 3KPPB 4GKSB 4JM4L 4U1LB 3VW3L 3LRGA 4FQ2H 3TEUA 1JWSB 4KKLC 4NQEA 3LD8C 1I4FA 2NXZB 2H32H 1EHLL 1NCAL 2ZNXA 3HNTL 2R29L 1G1YA 4R97B 2P49B 1CI5A 1RZFH 5DWUL 1D5XB 3QG7L 2UYLA 5I8KH 3EYVB 5EO9A 5I1KH 3B8YA 3MRFB 1VSCA 1BFSA 3ZTJH 5I76A 5D7JD 1HH6A 1NBQA 2GQHA 2VABB 5EU7C 1OWRM 4PGJA 2EE6A 4X7FC 4PUBH 1RUAH 4LDOB 1VGKA 2WUCH 5B4MD 1RUQH 4HKXB 5BZDA 3O45A 2MWCA 1UC6A 2XZCH 2A73A 1FVDB 5ICZA 1DTUA 4LSSL 2OL3L 3FCTB 3TIEB 4RGNE 3MV9E 5T1LD 3FOLA 3MXWL 1OAUH 1MJ7L 5SX4I 3ZSSA 4PP2B 5E8NB 2UWEA 3BIBX 5I1JH 2A0LC 3D48R 3O3UN 1HSBA 3WEXA 3SDAC 1E28A 4Q74A 3IDGA 3HC4L 1H8OA 3NCYP 4XRCA 3O8XD 1BQHB 1I85C 4P57B 3QISA 4QRPD 2IMMA 2VISA 5IB5A 1MWAB 3A6CL 2ICWB 1K2DA 5DVMA 2VLKB 2D0FA 5JOEA 1YDPB 2VSCA 4RDQG 3UTQA 4PY7B 5CZXD 3SKOB 4OSUL 1DN2A 5DRZB 2PXYB 1EVTC 3BGAA 3P73B 3RVTC 3HB3D 3KYOB 5I16B 1RAMA 3K1KC 5J6GB 2GCYB 4P59H 3ORJA 4M8QB 3HI1B 3H3PL 1CL7H 5GS0H 5MEOB 4V2CB 1KT2A 3MRLA 4TULL 2VAAA 2WWKT 4Z5RA 4O58L 4PYHA 3CD4A 4YBLB 3IETA 1ORQB 1OT2A 1KTRL 3C8DA 4YHZH 3QWRD 4P4RA 4FZ8H 4WTWA 3V7AE 3MLWH 3ULVE 1OSPH 3ULSB 1XGYH 4NPYB 3OHXA 2WK2A 3FAWA 4TVPD 2G2RA 1LO3H 3C08L 3TN0A 5CJOH 1U3HD 1CICD 1LVEA 1NFIB 3W9DB 3VDCA 3I50L 4YHKH 3RU8L 1QFWI 4P59L 4ZS6D 3BKCL 3WS6C 4I3SL 2P5WE 1D6EA 4AEIL 1GGTA 4PJ8D 5C0JA 3MRCA 3V6BR 1Q1JL 3WJJC 1X5HA 5D93B 2JJSA 3WFBL 3QQ3B 3GJFB 3QHTC 1RK1A 3BGMA 4QXWA 5D7LB 1M71A 4GG6B 2V5RA 3BDXA 1WTLA 4CN6A 1FLRL 5HHOE 1EAPB 2IH3A 4QGYA 1AY1H 3TFKD 1IGJB 3CFJB 4IEFB 1M7DA 2QQQA 4L3CA 4MHHI 3RX7A 4I3RH 4ZODA 2GJ6B 3AREC 3BWUC 3DXAE 1UZ6E 4PD4K 4TUKL 4AENB 2NTSP 3EYFB 1UKQA 4RNRB 3X3GH 1MCDA 4IIQA 4ODWB 4PJ9D 2PUQT 3G5ZB 2JELH 1FDLH 5L7XL 1OGTB 3TA3A 5JMOC 1C1EH 4M3JA 3F58H 1YPZB 5D5ME 1KXTB 1TQCB 4QHNA 4R9HA 3RRQA 4NKDB 2FEEI 1GAFL 3LKSA 5CZKA 3B9KC 2XG4A 4WW2A 3VWJB 5BW7C 3L3IA 3B9KD 4WY7L 3T1FB 2I60H 1EA9C 1QUNA 5ISZD 2IF7A 4KKBD 2EDFA 3E2HB 3H7BB 1A5FL 3FQTB 4PRNB 5EZIL 3G6JB 2EDOA 4S10A 3NPSC 4HH9A 4Z7WE 4GS7C 2EE2A 4HJJL 4P4KD 2FIKB 4UILL 1FYTE 1QSZA 1U8NA 4R3SA 1XH3B 1T83C 4Z9KB 1KJ2H 3MJ6A 1JGEA 5EZJA 1FPTL 1MQKH 4Y8DC 3CU1A 3OZ9L 1X5LA 4LSQH 1E4WL 3OJDB 2CRYA 3KPOA 1RURL 3LKQB 3TO2B 4PJHE 5F7HA 4NSKA 1MJUH 2V9QA 3QHZH 5CJQH 5ERWA 3EYUL 3K80A 5JUEH 1IM9A 3P77B 4LCYB 1CR9H 3V6OA 3RWGB 2AK1H 3OB0K 3T65A 2BNRD 4MXVE 2BSSA 1RZJL 1UKSA 3MLRL 1WIPA 1MRDL 3NCFB 4PBVC 3KYAA 3UPAA 3E6HA 3SDYL 5F9JB 5C2UB 4J2XA 3GI9H 4NHUA 5ADOH 7FABH 5IM7A 3FRUA 1LD9A 3O81A 3BYYA 4MA1B 2AI0L 1J8HE 2DQJL 1T0NA 5KG9B 4R2GC 5DA4A 3J8F7 1MVUA 2XG5A 4RQQB 3S5LB 3IU3B 1CTNA 4FFZH 4ORGB 4UOJA 43CAA 3WXVL 2R1YA 3O6FD 3I84A 3RGVC 5ADPL 3U36B 1ZANH 2GUOB 4V1DB 4PTTA 3EFFB 1QA9A 2GSGA 3OWEA 3IDJA 2PF6A 4GO6B 3ZDXF 1NCCL 3AS0A 3LEYH 1EV2E 5L2KD 1V7NH 1HEZA 4MA1C 4OCLC 4WENB 1NKOA 1CDJA 4MJIE 4WUKH 3FOMB 1JPFA 4LPXA 1SYVB 1J7VR 3U0TB 2C1OA 1N6QL 1GVIA 3JTSA 1MRCL 1K4CA 3BT2L 2GKIA 3IT8D 2FLBT 4G8FB 2NY5C 4X7SH 4F9PC 4PGDB 5DJ2B 3WNLA 1OW0C 1R5VB 3KPSE 2MPAH 1HHKA 2FATH 3SJVB 1RZGB 2MPAL 3QPXL 1NPUA 1J1OH 2R1YB 5F7FA 3DGGB 2QQLL 2X40A 4R0LA 4GBXD 3VRJA 4GKOA 2ZCHL 4TNVK 1LK2A 5INCA 4G3YH 3SDAD 1OTTC 1UCBL 2NW3B 1H5BA 4OCRH 3TBTA 3G04B 5GRVK 2XYCA 4YDKH 5IHUH 4OQ1A 2F8VA 2HMIC 3VMOA 2G5RA 2AS5M 4MGXA 4PB0H 1NCCH 4F7CA 4NQTA 3WS3A 3C2AL 1X44A 1YYMH 4PS4H 3GK8L 3HE6B 4G7VH 3OAUH 1MI5B 4HEME 5HJ3B 2BDNH 2I26N 2CMRL 1A7PH 4JPVH 4L4JA 3JZ7A 5ISZA 5IVXF 3HB3C 5C1MB 4R8WL 3IAGC 4JKMA 3X14A 3WS6A 4LCUB 1XGQA 4K71B 3DX8B 3EIFA 1FZMB 5D7JC 1WZ1H 4HXAH 4KRMB 4MCYB 4DUXA 4S1QH 5ITBH 1M7IB 3TH4T 4K3EH 2F53B 2Z93B 5TE7H 3VXSD 3MRHA 2EH8H 3HC4H 1FHGA 1T4KB 2XT1B 4JKWA 3O0RL 3VGFA 1BJ1H 2BC4B 4P23D 4Y1AA 1MQKL 2IQ9L 3BPLB 4OCSL 4K23H 3NPZB 2DQEH 4FN0A 4GKNB 2AEQL 5E2TH 4M1CD 3X3FL 4RISL 1KV3A 2LABA 1W0VA 1C7TA 2Q7NA 4CGTA 4P2QB 4Y4KC 3MLYL 4N5UA 5HPMB 1ZE3C 3S4SB 5I1AB 2AJXL 4P9ML 3I02B 3MNVB 2AVGA 4JY4A 1CD9B 3WHXA 1Z6JT 2C4FT 4QXUH 1UACH 2MMXA 4P2QA 4HC1A 3KNBB 5MP6L 3IDIB 4RGND 1VENA 2R23A 3MGOA 2VC2H 4NHUB 1AHWB 2QLVB 5KS9F 4XX1G 1HSAA 2I24N 4V1DA 2FX8L 1IC4L 4JZOA 5A16B 2LU4A 1XF3B 1CFTB 2ADJA 1FJ1A 4X4YA 3OG6B 3QXAA 1KG0B 3CDGA 2QHRH 1EEUA 1KN2H 4HLZH 1DBJH 4YHMH 3VFOA 3AUVA 3GSUA 3HR5A 3GJEA 2B0SL 4NN6C 1HNGA 5I75C 1ZLVK 2QADD 4HSQA 1R3JA 3KAAA 1I9RL 1JV5B 5EPMB 5H94B 2XOTA 4K07A 4Y2DB 1CQKA 3T3PF 3VGEA 5DUBB 2EECA 3MREA 2ZSVA 4ZMAT 1BBJB 3BUTA 2M2DA 4WI2A 2G75A 1W72A 3W39B 3TPUB 2HRPH 1UXSB 1NMCB 2YKLH 2HKFH 5EU3B 3DBXB 3IVKA 2XACC 5SWZE 4OCRL 5FOJA 4QF1A 4RGMB 1YC7A 1FN4B 1TZGH 4UQ2B 3QH3B 3ZE1E 1WBXA 5C0CE 3S6CA 5F9OL 1Q94A 3P4MB 1FGVH 4ZDHA 1YEHH 2FATL 3QDMD 3C09C 3EDKA 4Q9QL 4PJ7F 3ARQA 4LCYA 5DF0A 3DGGA 4K3HA 3BRFA 4LQFL 5TDPA 4NZTH 3NIDE 2R0ZH 2WNGA 4NQXA 2G5BA 4FTVD 1WZKA 3UJTH 4PGDA 1PX3A 1II4E 3C8KA 3ECBB 2FYYA 4CVZB 4JFDB 4YEEA 4ZFFA 1G9NL 1MCLA 4PLKC 4KVNL 1LE5A 5EZJB 5DJYA 5I16A 5HVHB 1GGYA 5F44A 1NC4B 4KK8D 2ITCB 5SWQA 4EN3C 3B9AA 2ZPKL 5DS8A 1NGYB 1V3KA 4POYA 3LKNB 4XNYH 3CK0H 4MQTB 5GGQL 4JM2B 3IJYA 3PWPA 1LDPL 5GPRA 3EW3B 1V3JA 3FONA 1GC1H 4QOKD 4EUPH 2W07A 4P5MA 5C0DA 3BIKA 3RL2A 1Y18B 5I73C 4S1RL 4AENA 2EO1A 1BQLH 5GJTH 3GHEH 4O02L 1REIA 5CEYB 3BKYL 3PJSA 5DRXB 3QXWA 3FOLB 4NZRL 5J57B 1HWHB 2QSCL 1LEKA 2RCSL 4JZNA 3DXAB 3QWOA 2X4SA 3DROB 2VH5H 5F72S 5D8JL 5JPMB 4Y2OA 3EOTH 2XZCL 5C6TH 4QTHB 4NZRH 5FO8B 2Z8SA 1JF5A 4P3DA 4F37K 1FAIL 1T7WA 4LLVA 3GBNL 4PY8J 3FFCE 5JPMA 1XIWC 1MCQA 2UWEF 1NCDH 4YK4C 2R4RL 3OXSB 1C5BL 1HHHA 1YNKH 3VD3A 2ZUSA 4MS8D 1C5CH 2X7LA 4PJCE 3SOBL 4KUCF 1K8IA 3ELAT 4LLVB 1CDCA 4K8RH 1JF6A 5JHLL 2KZWA 1FH5H 3EYOB 3OKLB 3Q5YA 1MHEA 1LK3L 5C0BB 3WHE1 1NGQH 3VXMA 4QRSA 3TN0B 2JB6B 3EHBC 4H20L 3TYGL 3N50A 5HGAB 2GY5A 4TRPH 3HLAA 3OR7B 3WN5A 1IM3B 2MCPL 3TYFA 1RMFH 1TETL 2Z4QB 4ODSL 1D6VH 1S3KL 2IFGA 1F4HA 3T0AA 5FOBA 1QOKA 4Q0XL 2E6JA 2A1WL 4KHXL 4Z5RB 1EEYB 1IVLA 4BUGA 5C8JB 4B53A 1MCIA 4PD4J 5HPOA 1JI2A 5J9PA 3N85H 4LSVL 2NY1C 4HDIA 3QDHA 3F12B 4MJID 4PJIA 2QHRL 3QNXB 4MD0A 1U3HC 3ARUA 2NY7L 3ME0A 3T0ED 2OJZH 4XHQA 1Q1JH 1EAPA 3B2VH 1ZEAL 2GFBA 2H9GA 5HHMB 3WDJA 1T3FB 1WZLA 4DK3A 4MXWH 3HE6C 2P46B 1AKJA 2X7LB 2E7BA 1I9IL 4X5WA 3V4VL 3LMJL 3IS0X 3RNKA 4QRPE 3ECBA 3B2VL 2ICES 4IS6A 3F65A 3TC9A 1P4IL 3QFJB 1EHXA 3UC0H 5KSUB 4ODSH 4Z0XA 4NQXB 4G6FB 4DQOH 4R7DB 4ZSOA 4LMQE 3B43A 2BHUA 1OAYL 1UG9A 4DZ8A 3JV5A 4GMTH 5GGSY 5ALBL 4EI5A 4S0TD 1EFQA 2R39A 4U7SA 4G8GE 12E8L 4L9LC 3D87B 5ALCH 4Q97A 4YR6B 3ARVA 3EO1A 3D25B 2FEDD 4G5ZL 3OAZK 3X3FH 5HHXL 5EOTB 1AQKH 3MUJA 5BQ7B 3WIHH 4LLMA 5DLML 2H2PC 3OBAA 1EZVX 4YHNA 5HYIA 2X44D 5FM8A 3CZFB 5EUOE 2YRLA 3ZKXC 5LAXA 4OFYA 5I18H 1C08A 3PGDB 3QUMB 1BWWA 3RL2B 5T1LA 5DD1H 3SPVB 3UYRL 4HWUA 5MEOA 1J86A 4JPKL 4TN9A 5DSCA 1F3JB 4U1HB 3AU1B 2E8YA 1OP5K 4HXBH 4NM4H 4JDZA 1P7QD 1JF1B 3TCLB 1IM9D 2RFXA 1DBBH 3VE0B 1HINH 3RZWA 1UB5A 5ILTL 1KIRB 4B0MM 1C5CL 2PXYA 2YBRB 3ESUF 3QXAB 2OZ4L 4K3GA 4KJQC 4OLXH 4PJ7A 5M7QA 4Z7OE 1IGML 2IGFL 5C08D 4QTHA 3MRJA 4KUZH 4PJIE 4GAJL 5J12C 2VLLB 4S1RH 1T20B 5H35A 3RTQD 5GS2D 3MV9B 4QHMB 5AZEH 2LAGB 3MXWH 1BFOA 1SBSH 1Q9OA 3CFCL 1JFQL 3MA9H 1RU9H 2VE6B 4J1UA 1QO3A 1U93A 1ZHNB 3LQAC 5D8JH 2D7MA 3RWCA 2D31A 4JR9L 3RWFA 3ZT6A 4ODUB 1QSFB 1YMME 3CFCH 1URLA 4K2UL 4WHYG 2NNAB 3IDYB 4XCFH 4CNIB 4ZTPL 1QQDB 1VPOL 4KTEL 2A73B 1EEZA 4ONFH 1XF5B 4Z7NE 2JE8A 1AO7A 4F3FB 1HXYA 4MDIB 2HFEA 4WU7A 2ZOKA 1JNLH 5I1GH 1IEAA 3UBXA 1TVHB 1FNSL 3OGOE 3VXTB 3W5NA 3PHOA 3RAJH 3P9MB 4N0YL 3I6GA 1PFCA 4NWUL 4UQ3A 3RUGA 3HRZA 1QSEA 1MFDH 3WXVH 1ZHLA 4TNWK 4QRRA 3NA9L 4KROD 5HHPB 4FHBD 3HMWH 1G7MB 1K8DB 4HS3A 4Z7UE 4X7SL 7CGTA 5DD5H 8CGTA 5ID1B 2NY5H 3VFOB 2RJMA 1DQQA 4FQ1H 5D6CB 5J3HC 1CXEA 2DAVA 3RDTC 2J2ZA 3QG6A 4X80H 1RIVH 3LMJH 2EDDA 1PY4A 3IJHB 5T1KB 4RA0C 1EXUA 3TNMB 4KJWD 4NM8L 3DUSB 3IDXH 4XGZA 2OL3A 3PGCB 3CSBA 1GIGL 4FFWD 4JB9L 3SEPA 4DUVA 2C3WA 5B21A 5K9JH 3PQYB 4CMMA 3EJYD 4Z7VF 5TFSH 3WIFA 3RVUD 2W60B 1QFOA 5B3NA 5FEBA 2FSEA 4YFEA 4YGVB 3SE3C 1MH5A 4XP6L 3ZMRA 3C60B 4M7JL 3ILQD 3PHQB 5DJ6A 2ZUXA 3FMGL 4HCRH 3T0EA 4QCIA 4LHQB 3BP6A 1RIVL 3MLZH 3MOAH 1ZLSL 1YA5A 3OJ2C 1JYXA 2X4TB 2Y9RT 4J4PA 2Q6WB 3UCRA 3QO1B 3MUGA 4GOSA 2FYYB 4CVZA 1JYVA 4MS8C 2G9HB 4GJTB 4UTBH 1XZ0B 5HHOA 1JZ8A 4D0BA 1DEEA 4OCYL 3AC0A 3W9EA 3X13A 1QVOA 2D03L 5EORL 3WKNA 3QAZB 1U8HA 1RUQL 3FQNB 3W0WB 4ZFZB 4M43H 5IF0A 4KRPD 5I73B 3NCJL 3MJ9A 4DN4L 1W72L 2H3NA 2OS7A 4YK4B 5JORA 4TTDC 4LF3A 2ILLA 4N68A 5DMYA 2DQEL 4TTDD 4YBQD 4DVRL 4NC2B 5E1AA 3O9WA 4G9FD 5KANI 1J11A 5DQ9A 3D3VB 5I8EB 4K94C 4WFFD 4PP1C 3KPSD 1NCTA 4P9MH 4NP4H 4E42A 1TZHA 3ZE0E 4ZOEA 3S34L 2HVJA 3BQUD 4L8DB 4LKXB 3QPQD 4XCCL 1WZ1L 4HXAL 5FGRA 3LH2L 1AO7B 2OK0H 1GGCH 4UTBL 1C12A 1U95B 1MREL 4ZD3H 4LK4A 2VDPH 4XMKL 5CIPA 4WFHE 4AJ0A 3BD3A 3I3EA 3Q3GB 4S1SH 4NSKB 3WO3B 3VD4A 5E70A 1DFBL 1W0WB 3BSZH 3GHBH 1R3IH 4NNPL 1F90L 3QFJE 3V8OA 4GAYA 2DICA 1BVLA 1HK6A 4MB3A 5HI5D 5A43C 1SYVA 4XHJC 1TZHB 4Z0XB 3D9AL 4WEBL 4QY8B 4NKIL 3RVUC 1EH9A 4G6ML 1RZIA 1O5DT 2YOCA 1TTFA 2ZG2A 1IARB 2B2XL 5LCVH 2FD6H 3L9RB 1HI6A 4JPVL 3EYFA 2DIJA 3F5WA 3GSNL 5C09D 4PRAA 5DTFB 1KFAH 5D1ZB 2GJ6A 5JDJA 4OGAC 4KJPC 4AEIH 5C7XL 1FYTD 3VWKC 5A2KH 1I1CA 2MQCA 4RQQA 1UB5B 1OAKL 5I74C 1FNLA 3R06B 5CJOL 1CD1A 4YPJA 2R2HA 3IU4H 3MV8B 3EAKA 2ZCHH 4X5XA 4NUJB 3ALXA 3GMNA 1LO5B 2YMXH 4NO5A 1CZ8H 4N0FA 4N1CA 5BS0A 1O0VA 5ID0B 2DWEB 3OXRB 3VRIB 3VWKB 5MEPA 4ACPA 3MV9A 5LCVL 3SE4A 1OAZH 2XV6B 1S8DA 1VFOA 5FCUL 2QSQA 3BT2H 3PWLB 5D7LA 5MENE 4Y88A 2XA8H 2B8OT 4WW1A 3SY0A 3C5SB 4BJLA 3O3EB 4X7DC 1JWMB 4K3DH 3S35H 3MCLH 4FQPA 5DMIL 3HUJB 4Y5XC 1BD2E 4U1IB 3F7PC 4U6XA 5DO2D 2ARWA 4POUB 4N8CH 5IVNA 3MOBH 3QIUD 3QULB 4YWGH 1KCSL 4MWFB 4XZUB 2DQFA 5I19H 3DETD 1LO0L 3QFJA 3UJIL 2BRQA 1Z0MA 5CZVH 5D72L 2VDNH 4PR5B 35C8L 2ZOKB 3BD4A 2WBJC 2ICEB 3PL6A 2J88L 4M6AA 5EC1A 2BSSB 1PKQA 4RZCB 2Q86A 5E95B 3BKJL 4G8GD 1FFPB 4HIIA 1OM3L 2QQKH 1IAIM 1NGXB 2E8ZA 3QDJE 2X4RB 5JO5B 4X5LA 4JGJA 4FABH 5MHSE 3EO0A 1MHHB 2YUZA 2Q3AA 3SDDC 4U1SA 2VKWA 3TWCH 3NIFF 4HJJH 5IBTL 5D1XB 2HH0H 3IGAB 5B8CA 4NHCH 4D0CB 1DBBL 1RV6X 3S36L 5DURD 3NBNA 1X5GA 4JG0H 1HHJB 1CDYA 2BSTB 4UDTA 1ZOXA 4OCYH 1SY6L 2NQCA 4OCWH 5IB4B 1SM3H 1Y0LB 1Z3GL 2IBBA 4QRUB 3OB0H 4KVCH 4ZFOA 5E5MA 4M62H 2VC2L 5HGAA 5IEKB 4U1NA 4LRIA 15C8H 1JVKA 3NABL 4LLYA 2P1YA 3ULUC 1YNTB 5IBLD 3FTGB 4RAHA 1JWUB 2QQKL 2N56A 2VABA 2AJXH 2Y06L 1A3LH 4ZS7L 3OX8B 5KSAC 1RFDL 3OKMB 1YPZE 4IIQB 4K9EC 1T1XB 4XH2A 5E2WL 1Z9LA 5EN2A 2WLYA 2HH0L 2CDFB 4N0CC 3BEWA 3T2QA 1FVCA 3BE1H 2Y7QB 1ITBB 1J18A 3DARA 3CVHA 4AQ1B 4I0PC 4OZHE 5ANME 3UYPA 4YDLC 1PX4A 4NQSB 3FFCD 2Z31A 3IFLH 1VADB 3AU1A 3MRFA 4GKSA 2IALB 3I50H 5IIEA 3L3OB 1U3YA 3D2UD 4N8VG 4FQ1L 5TGBA 2V5SA 5IBLC 1JYNA 5F93C 3HUJA 5CZXC 3FB5A 2UV3A 2CMRH 1RIHH 1MOEA 1ZMYA 5BQ7A 1WIOA 1U3ZA 2IADB 1HYSD 5I8OH 2C4XA 4EIZC 1JMZA 5DXWA 4IOIA 2YN5A 3A6BH 3FAXA 4LEXH 4M7KH 3SGDH 1FZJA 3TV3L 3S35L 1KBGL 2R0KL 1UJ3B 3BH8B 1NFDF 1IE5A 4HWBL 1EO7A 1LO5A 2VTFA 4YHIB 4FNLL 1IRAY 1U3JA 3GI8H 2ESVA 8FABA 3UBXG 2RHEA 1AO7E 2ICCA 1JTOA 5E2VL 3BO8B 3TH2T 4NQCD 2Y6SD 3I2CH 2VNCA 5E2VH 2V2WA 1RJZA 1EERB 1EK3A 5JHLH 4XB7A 1N64H 5CEZD 5EUKB 3IXAB 2HVKB 1WISA 4I5BB 5I30H 1H3TA 4X7EC 1BBDL 2LVCA 3IB4A 1FZOB 4HIIB 5B4MC 1U58B 4PRPB 1DBAL 3AS2A 5FK9A 3RL1B 4HKXA 3H3PH 4PFEA 5BZDB 1DDHA 4XVJL 1KCVL 5HHVH 1ZA3B 2BVQA 1IM3A 3MLXH 4TOYH 2DD8L 4XAKD 4JHBA 5EU6B 3BW9A 1AR1D 1Y0LA 4QRUA 4F7PA 1EFXD 1CGWA 1X5IA 2VKXA 1S9XB 3HE7D 3HMXL 3RIAF 1T5XA 2P42B 5J6HB 3RWHB 2D7QA 2AABH 4U2YA 1RIUH 1HINL 1LP9E 5FYLL 2F5AL 5KVGH 3OR6B 3ROOA 2JK5A 1G7PA 1P84J 2BY3A 1TDQA 2H32B 4OLVL 4RMWA 2ESVD 3IFOB 1IC4H 3DI2B 3GIZL 4P4KC 3WN5B 2EIEA 2YUWA 4IM8A 4M6OL 4OZ4B 5GHWL 1A1MA 1YY8B 4XAWL 4GAJH 4PRIE 2WV3A 3P0VL 3UZVB 1T7VA 2MKWA 1B0WA 1ZWIB 4OT1L 5I1DA 3RKDC 3CIQA 3JTTA 3HG1E 4WHCA 2YR3A 4LIQH 4AT6A 3UAJC 1WT5A 2ATKA 1N26A 1T89A 1FN4A 4UQ2A 4ZD3L 2XQYG 4I1NB 3CLFL 3D85D 2BY0A 2A9NH 2EE3A 3LKOB 5LGKA 1A9BB 2Z0BA 3RDTD 1NFDE 2I27N 1E6OH 1NMCC 1QKZH 5AAMA 4QNPE 3QCTH 2NY6D 5DUBA 3MQIA 4OZHA 3INUH 4IRZL 4AIZB 2VUOA 4NQEB 1CFQB 2AAVA 3O3EA 4TVPL 1DBMH 1J88A 4L4VE 1CXLA 1X7QA 1TJIH 2JLLA 2VXQH 1MUJB 4XAWH 3LCYA 4LQFH 3DYMA 4MXWL 2EEDA 3DVGB 1BVZA 5KS9B 3B9EA 5EU7E 4GW1A 4GLRI 5JLZB 2XXCB 4PV8A 2I60L 3S36X 1DJSA 2R0WL 3H9ZA 1CXFA 2NY7H 2AXGA 1MF2H 3IGAA 1IQDA 4JO1H 5B8CB 2EDKA 1H3VA 3TA3D 1PQZA 1F45A 2GTZB 3IJYB 3PWPB 3R06A 3W2DL 1U92A 3UEZA 3U48A 1KJ3L 2B5IB 5DHVB 5CGMA 3KXFB 3LPFA 4PJBE 3X11A 2JELL 4YGVA 5DDHA 5JHDA 4C59B 1NGXA 2IAND 1A6AA 4JY4B 1JZ4A 2ATPB 3HE7C 2VLME 1MCJA 2DLEA 2PYEB 4PLOB 3JWDL 4YHKL 1QBLH 1H3UA 4JFEB 4OD2A 1B6UA 3UO1H 2ESVE 5CHNB 3TZVA 1DVFB 1CLOL 5J11B 1F11B 2NY4C 5KAQG 3ES6B 4ZO8A 5EIIB 3C8KB 5SWSA 1Q0YL 1ED3A 3QJFB 5CEZL 5IR1A 1P4BH 4OUUB 2VR4A 2R0WH 1NBYB 4L4VD 2E7HA 4WHYH 1QBMH 4PRHA 1P4LB 5M94B 2D9QB 1CVSC 3REWB 1P69B 3MREB 2Q3ZA 4PJFE 2DQCL 2EEAA 4R26L 4KKBC 2IH1A 1EMTL 2B4CC 2VDLL 3SDDB 5DJXA 3MBED 2H2SD 3O2WH 5IF0B 3GGWB 3BIAX 4FQCH 4I77H 2JTDA 3C9NA 1QVOB 1TJGL 4HUUB 3KPPA 1ZT1A 4U1LA 2OMNA 2PXYD 4N0RA 4Z0BL 2YHGA 1OSPL 5FYLD 3QO1A 4OCNC 1VFAB 1YQVL 1XIWB 3K4ZA 1PZ5A 4WWKD 5MHSD 3KG5A 3O11B 4Y4FA 3QEHB 5T3XH 3A6CH 4NN7C 5GS2H 5E2TL 3O4LA 5EBLB 3HS0B 1HOCA 5CGYD 5FKPB 4QYOA 1V7MH 2A6DA 1ZVHA 4Q9RH 3S35X 3NCEB 3BEVB 3QIBD 2X1WL 4G6AD 3S5LA 3EOAA 3T4AB 5GS0D 2NY0B 1M6OB 5GRXG 5JIKA 4E0RA 1IGFL 2QV2A 1CXKA 3BZEB 4I9WE 4OLXL 4U3XA 4D9QE 1U3HB 1CICB 2EIZA 4NDMB 5E2WH 5DEFA 3OF6A 5F9JA 4HG4K 3D9AH 1M6OA 1G7HA 1XR9B 3UX9B 4ZUUA 3DO7A 2X70A 4D0DA 3C8HA 4NKOA 2CLVA 1NCWL 5EULV 1GPOL 1SQ2N 2XXMB 1F4YH 4MAYA 1AD9A 4WI4A 3VXNA 3WNKA 1A8JH 2CD0A 4HLZG 2F74A 1CIUA 3QQ4B 4YJZL 2JCCE 5IG7A 4DKEL 5CSGA 1OF2B 2BK8A 3AREB 5EC2A 1A6WL 1EO5A 1KUMA 4NZJA 3QIBC 4Y16B 1U8PA 2C26A 4UV7H 1J1OL 4W6XB 4HFUH 3KVQA 4YZFE 4LDEB 1I1AD 4LCWA 1TCRA 3MC0A 1MRCH 2DIAA 2G2RB 3R8BB 4GAFB 3KPRE 4FNLH 2H45A 2DQTH 4HWBH 2WUBL 4ONHA 2OMBA 3WCYA 4F15C 2R0ZL 3JWDH 2EDEA 4HPOL 2VR9A 1R3LB 2H3NB 4XI5C 4I0KA 1IFHL 5ISZB 1YY8A 1CK0H 3REWA 1B90A 1BECA 4PJBA 2NY2C 3NACL 1KT2B 5FDWA 3V0VB 4JGUA 2G9HA 5MI0C 4B41A 1OGTA 3ISWA 2JJSC 3ARFA 3VXTA 3VW3H 5FB8B 4EUPG 2LFGA 2PO6D 1WCBB 4JO2L 2NX5E 5T5NF 3VGBA 4MCZB 1GIGH 1QBLL 3QA3A 3QO0A 4IHOB 2F9BT 2VL4A 4QTIL 1H3XA 2ARJB 2VXTL 2HT3C 4ELMF 1QYGH 3P40A 2H8PB 1IKNA 2NY4D 1U8QB 3OKDB 5E99L 1MH5B 5C07E 2VISB 4G8FA 1LO2L 2BNRB 5IT2L 3ZHDA 4GG8B 4MXQD 1QFPA 4ELKA 3DX7B 1JP5A 5H37H 5AZ2L 3QUMH 1BIIB 2CDEB 4HG4J 1MJUL 4PV8B 2OQJB 3O2DH 1X6NA 3ZO0A 1BF2A 3U6RA 5IOPA 3U9UB 4TSCH 1OGAA 3RPIA 4XPHL 4G42A 2CXKA 5CWSA 1J1PH 2P45B 5GS0L 3KPLA 2E9IA 1KJ2L 1A0QL 1RMFL 1A7OH 3O6FB 3GBNH 3V9FA 4HHAB 2P5EA 3O0RH 1QFUH 5TDNB 2MTPA 1EBPA 4P3WA 1QKZL 2HJFA 2R8SL 3ULVD 4Y5VC 2A6JA 3GIZH 1A9BA 2F19L 1B0RA 4QHUB 4WI9A 4UQ3B 3RUGB 3IFOA 1DQDH 4XP9H 1NL0L 5IUSA 2NZ9D 4P3CH 5L2KB 3EFDL 5F97E 4M8QA 1R3KA 2CSPA 2V2XA 5C0FB 3C5JB 4XXCA 2FRGP 4Y4HB 1TVHA 2Z31B 4F58L 1JFQH 1X5XA 3ZKSD 1ZWIA 2O26U 5CBAB 1OW0A 1EIBA 4WFGD 3L3OA 1J05B 2VZTA 3MYJB 1IEBA 3GMQA 4K9EL 5GZND 1GGBL 4ZS6C 1VPOH 1PEZA 3QI9D 4S1SL 1A6PA 5FUOH 1PVHA 2Y7QA 3PJSB 2PYEA 2E9BA 1FORL 2PTVA 3HC0A 1CD8A 3L5IA 4N9GA 1FP5A 3TBVA 1OVZA 1I1AA 4UIMA 5T1DH 1MPAL 2UWEE 5IQ9B 4P3CL 3DECA 2HLFD 5E8NA 2F58H 2AXHA 4MA3B 1S9XA 2V17L 1BF8A 4OFPA 3WJLC 3GSWA 4NO0B 5EUOA 5HYSA 2ADGA 4AG4L 4MMXC 4P9HL 5TE4L 1SJVA 1NQBA 1OSZA 1K9TA 4UB0H 1FL5A 4XNUH 1N59B 1IGJA 2I5YH 5HYQB 3QSKB 1WLHA 3DVNB 1CLYH 5GZOD 4PP2A 2RBLA 5F88B 3SE9L 5HHNA 3G5ZA 2EKSB 5HY9A 4YHZL 3UYRH 3IDGB 3VH8G 4LLWA 5CP3A 4YHIA 1OGAE 3ARWA 4JN2A 2A38A 3KPSA 3IU4L 2AJVH 4QRQA 5HDLA 3REVA 4D3CH 4FQCL 2Q20A 4WUUD 5IK3A 2X89D 4YQXH 4KPHH 1NMBL 1IAIH 4HK0B 4EVNB 1MAML 2NZIA 5HTSA 1CGVA 4PV9B 3DROA 3HRPA 5F6HJ 2AK4A 1W8NA 1D6EB 1MHEB 5TF1H 5LXGL 1CGTA 5J1TC 2Z91B 3O3BA 5AUMA 3TO4C 4XPTL 5D6DA 5CS7A 3V4UH 1MFBL 3THMH 3TT1H 3V4PL 2EH7H 3F7VA 4K3JL 4LLWB 4RMSA 3HNSL 4Y2DA 2PYEE 3ARFD 3QR2A 2A6IB 5E00B 5TE6H 4MHHG 1QFWH 3QEQB 4NT6B 4HGWB 1RUML 2D0GA 4KQ4H 3B8SA 2ED9A 2BNUB 3CVHB 4BQCA 4JN1H 4F80A 4EDWL 3ULVL 3ARRA 4M6ML 3MO1A 4YFDB 5FM5O 4RRPG 1X5FA 4X6CF 4HQQL 1DQLH 4OCWL 9CGTA 1TJHL 3OKMA 3RGHA 3RIFK 4UDTB 3TNNB 3F7YB 3VFSB 3CH8A 5ACZB 3TO4A 1KCUL 5JNYA 3QP3A 3VFRB 1YMHB 4LIQL 4ZFGL 3ZDZE 2V6HA 5HDBF 5JW5B 1UACL 3P0VH 4ZO7A 1BD2D 4GW4B 4A6YA 5GS1A 3ROLB 3S9DB 5IKCA 5ICZB 4NC1C 5IBUG 4G9DB 4DGIH 1LEIB 1WFNA 3MROA 3DRQA 1UJ3A 4ONGH 2GJZB 1MELA 4GKNA 1M05A 3QRGL 5C0EA 1FH5L 1U2HA 5EU5A 2RQ8A 2G75B 1NMAH 4PBXA 3RIFF 3BGFC 5I76B 3KR3H 1BP3B 1R3HA 4R4FL 3T2PA 1R0AL 3BJ91 1INEL 3JWNC 4PJXF 1JV5A 5H94A 2ZOLB 1IJ9A 5GJTL 1M7IA 1GGBH 1UYWL 5L88H 5GSVB 1S7SA 5D1QB 3ARBA 4U1IA 5FYJU 2YD7A 1T0PB 4I0PB 4OF6A 2XN9A 4PJXA 4DGYH 2E27H 1CU4H 4NKMA 5D2NA 4F57H 4PR5A 3SY0B 4ENEC 1PLGH 4GRLD 3KJ4C 4JQXC 1CGYA 4W6YB 3CFKB 1N4XL 2WBJB 4LSRL 1H3PL 3MR9B 1TTGA 2QQLH 2ZPKH 5TDOB 5SWSD 1NH6A 4F7CB 3FT4A 4HUXB 4NN5B 1N7MH 4PJAE 5GRVL 4H26B 1KCSH 1A14H 3Q48A 4JN2B 4YHLH 5C9KA 4APQB 4KZEL 4C56A 4PJEF 4TUOA 2EC8A 3CH1B 4XH2B 4Z0BH 2B20A 5GRWA 3O4LE 4JM2F 1NLDH 3MFGB 4EI6A 4PB0L 3R0MA 2EZ0D 3DXAD 4E41B 2AQ1A 4N8VA 3E8UH 4WW1B 1QP1A 4LGPB 1V7NL 1P7QA 3K3QA 2P5EB 5DZOA 1CDHA 3A6BL 4M7KL 5I30L 4PG9B 1BJ8A 5HDQL 5E08L 3MV7A 4N8PA 5K59E 3KPRB 2VLRD 2VUYA 4XCYA 2ED8A 3NFSH 1AIFB 4M00A 5J1AA 2NR6D 4WHTB 3VXQA 4U6VH 3V0AC 3HE7A 4PJ5A 4PTTB 3RJQB 3DX9A 4QY8A 4QHLA 1FFNB 1GGUA 5IHLB 6CGTA 5IROA 2R2BB 3WFEH 5K33A 2O61A 3QUYB 3DMMA 1YMMA 3NCBB 1WAAA 4G9FE 3TN0D 1R5WB 5I1AA 1BVKA 2CGRL 4MNQA 3UTSE 4WGVB 3MUHL 4PB9H 2WP3O 2ZUQC 1FO0H 1RZJH 3UXFA 4QRRD 2ZUUA 3O4OC 4K71C 2JKXA 2PW1A 2JJTA 3BRGC 3GIVA 3VMPA 5I1CL 2ZJSL 2OK0L 2BFVL 1J8KA 4G6MH 4PJ9A 1DN0B 2Y06H 4M5ZH 5CEZE 2BZDA 3FHQA 1JPGB 4WO4B 1EJ6A 5EC2B 4JO3H 1JUFA 1MCRA 4KUZL 3VGAC 1S7WB 1P5VA 1B0RB 5ESQB 4MJIB 5E8PB 1AH1A 1VEOA 2BP3A 1NGZB 1KPUB 4OV6F 4X6EA 5E6ID 1V3LA 4PRDA 3VA6A 3GSUB 3S97C 1FSKB 3QUZC 4POZD 1TZIA 2VDOH 2O5ZL 1KN2L 4POZC 2BSED 4I2XB 1EJOL 2LE9A 4UV4L 3RWJB 1TMCB 3HG1B 4LHUB 3VCLA 3U7YH 3O6KH 1NGWB 4UOW0 4WTZA 2Q1EA 1HKFA 1S8DB 2I25N 3QFJD 2AERT 1T5WA 4RBPK 2CKBH 1QBBA 1E4XI 2V7HB 3U36A 2W65A 2PTTA 4MNGA 3MOAL 4HV8A 1ZLSH 4L3EE 2XZAL 4CBPA 3K2UH 2X5PA 2P5WA 3BD5A 1H0DB 4KMTL 4PRBA 3PWVB 3RVXC 1QO3B 1U93B 5JQHC 1KTDA 1P2CB 3KLAB 1YNLL 1KPVA 4D0BB 4PYGA 1T22B 4UDUA 3P9LA 4JAMB 5E24E 3AXLA 3WDHA 3QA3B 3QO0B 3SDXF 3DTXB 4RNRA 2ENSA 1PZ5B 5ABDE 3ZYJA 4BFIA 3RZCD 3CDCA 3PQYA 2V7HA 5IV2B 3G9VA 1JGVL 1IAIL 4QHKJ 3O6LH 1N2RB 1JJUA 2R56H 3MCLL 4PLJD 1P7QB 1UCTA 1KLGB 2F15A 5A2JH 4UMGA 4YE4L 4OZIA 2XA8L 1UM5H 4L3AA 4JQIL 4NQDB 3TJEL 1BBDH 2P8MB 4MJ4A 2VDKL 3BJLA 4KHTH 5C3TA 2HJLA 2CR3A 4EZMA 1K4DA 2JIXB 3QPXH 4APQA 1J5OL 1P4LA 1RQ5A 1T2XA 5E9DD 4LRNL 3BWAB 3AS3A 3P9MA 4YEFA 5EOTA 1FNSH 4EXPX 3QUYC 1XCTB 3QDJD 1T1YA 4HWEH 4ZOBA 1U8KA 3GRWA 1RVFH 1KB9K 3MGTA 3M07A 1X4YA 2ATPA 4Q7DA 3WNPA 4PJDB 5DJCA 5JDSA 1ZHLB 3T3MF 4HK3N 4U6VL 3EDJA 4KK8C 1G7JA 6FABL 1FGNL 2BVYA 1OAXL 3W5MA 1H3GA 1NAMA 4D8PA 3STZB 5J3HD 3DGCR 3LVEA 3QEUA 3QUXA 1I9JL 3DSFH 5CEXB 2YPVH 1FORH 2R2BA 4J1UB 4U1JA 1YJDL 5FUOL 1IGCL 2ZNWA 1WBZA 1I1AC 4DTGH 1F97A 2FJGB 4WHDA 5F88A 2EDRA 3GMOB 4YNYA 3LPWA 3ES6A 4OQTH 4PJGA 4KTEH 1QQDA 1RK1B 5CMAB 3WKMH 3G5XA 1FG2A 3GSOA 3KPQA 4X98B 1J9CT 43CAB 3GSNB 3GJFH 1IT9H 2E5EA 3G6DL 3L3IB 3NTCL 3U0WH 2VMFA 1OOAA 3V6OE 2QSVA 3TLRA 3IKKA 1YMHA 5DHVH 4JFOA 4HS8H 3Q6FB 3H9SA 1J8HA 3MBXL 1YEDA 4AZ8A 4E5XB 4U7KA 1ZLUK 1CICC 5FO7A 2GTZA 3FL7A 2KZ1B 2IJ0C 3VG9C 3UTZA 1UB6A 3O11A 3PQYD 1OTSD 4CVUA 2AXGB 4K8RC 1A7OL 3MCKB 3VXUB 1NC2A 1S7RA 2P4AB 3FT3A 5ITFA 2P5WD 4Y5VA 3QNZA 4LARL 5C07D 5KVFH 3QDME 5AWNL 1BZQK 4OQTA 5HD8D 2WQRA 1MIML 4YO0B 2W59A 4I48A 5IBUB 4HGWA 3AFLA 2NY3C 3WD5L 2C3HA 4FTVE 4OZFH 5EZLA 2BMKB 3HAEA 3SDDA 4IRSC 4H0HB 3QUML 5C0BA 1D5ZA 2C7UA 2Y4SA 1F3DH 5E7BA 5E2JA 1G9NH 3ARBC 3CMGA 2YK1L 1J0KA 4QEGA 5C3LD 4OUUA 4OLEA 5FYJE 2WAHA 5CGTA 4WUUA 2W0FB 3VXME 1N6VA 1U2CA 3QG7H 1KJ2A 4HMDA 5H2BB 3C5ZC 3WE6B 1T1ZB 3PP3H 4RWYH 1ZA3A 1G6RH 4F37F 5J06A 1INQB 3FZUC 4KRNA 4XVSH 5KSBF 2DKMA 1HIML 4P57A 3TBSB 2OTWB 3D6GA 5DJAB 4J8RA 3S4SG 3UYOD 1FRGL 2XWTB 3SO3B 3LEVL 2BHYA 4NYLA 1X3DA 3P2TA 4OM1L 5LBSH 1S9YB 4CJ1A 4YXKH 5EBMB 2YD1A 1FDLL 1Q9WB 1IC7L 1EEYA 3LZFH 4JFZH 1M05B 1NMBH 1IC7H 2VE6A 2GFBB 2H9GB 4KTDL 1AO7D 1UJTA 4XT1C 1UM4L 3D0LA 1GC1C 1VACA 5DVOA 1MHCB 3VU2A 4JFPB 1X4XA 5E94A 1INQA 5DMGD 2BFVH 5I71C 1MFBH 1XGTB 3THML 3V4PH 1G9NC 5GZOC 1YEFH 2DYPA 3MRJB 1AFVH 1SEBA 2NTFA 4YNYB 3O3DA 1FGNH 4U6YB 3B9KA 2JB5H 4O2CA 4XRCB 3BN3B 5ESVB 5EZOH 1D5IL 1LNUA 4BELD 1ZSDA 1UENA 2GAZA 1VEPA 3SOBH 5FB8A 4NT6A 3QEUB 3QUXB 4JANA 4HWEL 4AEEA 1PEWA 1EO8L 2HLAB 3BP7A 2PYFB 2EYSA 5H37G 3RGVA 3QZWB 1NUDA 4AQOA 5C09B 3H6JA 4GSDH 4L3ED 4YBLC 2ZUTA 4PLKD 4Y89A 3BXNA 4P4RB 3JV4A 3U1SL 2A9NL 3GMMA 5C6TL 3BP5A 1KIQA 2B2XH 1A1NB 1PDKA 1CG9B 3T77B 4DWHA 3MJ8B 1JZ3A 5DMKB 4A2LA 1B2WL 3HTLX 3O2VH 1XGUA 4M5YL 4MNQE 3UTZB 4DKAA 4G43B 1NCDL 5FO7B 4B5EA 4DVBB 1GJIA 4CMHC 4X4XA 5C0EB 1U8PB 5T33L 1W0YT 4BZ2L 4NC1E 2ZCKL 4UOW1 5IESL 1JWMA 1L6XA 2VXSH 2X6MA 3CSGA 2WIIA 2IC2A 1AD0B 2EDQA 5DD0L 2FD6L 4JJ5A 3LB6C 2N7BA 5HVFB 1AE6L 2RAMA 1JGUL 2QQNL 2BXYA 4NFCA 1CU4L 3MV7D 3KJ6H 3P11L 5IV2A 4DGYL 1PYWB 5E8EA 4PJIB 4AEFA 3GMNB 4MVBD 4TOYL 4P5MB 2CXGA 5F7NC 4Z7QF 4IMKC 3SDCD 4GT7A 4WFGE 3UJTL 3UZQA 1MFAH 1U8QA 3QWQB 3FB6A 5I8KL 2ADFL 2XWBA 1U8OB 1G9ML 1NDMB 1X9QA 4MA7L 5DS8B 1CFSB 1NMAL 3BMVA 4J6RH 3MGTB 2D03H 1E4KC 2L7UA 2FL5B 2CPCA 2SEBA 1KNOA 2JJUA 3OKOA 3MRRB 1FYHB 5AAWA 3H9HA 2AJZB 4YX2H 4YIQA 1D3CA 2AK4D 1D9KA 3U4BL 3OF6D 3GKZA 3SCMA 1I1FB 3F6LA 2IPKB 4OGXH 4XWOD 3CVIH 5DURB 3NGBC 3VI3E 5IFHL 5L2JA 2PTUA 4UTAH 4Y4KD 3CSYB 3KDMB 1EMTH 1XFPA 4LEXL 2BC4A 1FE8H 4Y1AB 2IEPA 2VSDA 4PJ9C 4PGEB 4BFEA 1D5IH 5DR5H 4LRNH 4HUUA 3QEGL 4Z7WA 1T1WB 1RK0A 3HE6A 5D72H 3K1DA 3GM0A 5DJZB 3X14B 4QF1B 4DOHB 1A2YB 1NCBL 1PKQB 4RZCA 2OTUA 4HJGB 4N0FB 1AGFA 5CP7B 5EO0A 1BBJA 2BRRH 2HVJB 2DBLL 1VESA 3LZFL 4JFZL 4BH8A 4X9HA 1LP9F 3GMPB 3WFCL 3VGAB 5IOPB 3LQZA 4HAFA 4ZOAA 4BKLB 2V5MA 3CVIL 4GXUM 1TENA 2OJZL 3PQYE 3LPGA 2WM0A 3MRPA 5J13C 5CHNA 3TZVB 3HNSH 1AD9B 2J1KA 4DUWA 2NY5L 1DQJA 3V4UL 2YN3A 2F54D 4JRYD 4UT6H 4LLYB 4HUMB 2MQ0A 4Y19E 1RFDH 1U6AH 1GH7A 1AQDB 3BESR 2DYPD 1U8JB 2PTTB 3IDYC 2CH8A 3CLFH 3LS4H 1WBYB 3GJFK 4NM8H 1DBKH 4B7LA 1C16B 3D2UB 1PD6A 1NCUA 4OLYL 2D3VA 2E7LC 5KSAB 1U8MB 2AV1A 4U1JB 5I17B 4UZGA 3WHXB 2DQTL 3BP6B 4ELKB 4LRIC 5JXAH 4JDVA 1KTLA 1DSFL 5KANG 3PDOB 3AXLB 5AG8A 1H8NA 4HULB 5DFWH 2I07A 2Y25A 2V17H 5CJXA 2H8PA 3ARGD 3P9WB 5HYFA 1K85A 2AXFB 3AVEA 5GSRA 5ECJE 3AMLA 3QB7C 3VI3F 1JGUH 4M1GL 4WY7H 1AXSB 1SJXA 4CMHB 4TVPE 1ND0A 4XMLH 1MLCB 4Y4FB 1PGRB 2ADFH 2HTKD 5AWNH 1HCVA 4FXGA 3DYPA 4C56B 1RZJC 4R4BB 2X1XR 4MD4A 4DCQB 5I1IH 4K7PX 4BZ2H 1Q94B 3ZTNH 4Z7VE 1HXMB 4JG1H 4E42B 4NRXB 1EDQA 4NQCB 4QXTA 4JRYE 4GS7B 4HIHB 4JG1L 1DFBH 2A0LD 2P7TA 4I3RL 3G6JE 2QQNH 3TO2A 2ZG3A 2WWMC 5HVGB 4KZDL 5C2BH 4QOKA 5JR1L 3CU7A 2CIIA 4H1LG 4ONOA 4P23C 3ARBB 1CD0A 4FP8H 1UJ3C 1R3JB 3CCHB 3VXMD 2JCCF 1I8MB 1WEJL 4KY1L 4PJAA 4U6HB 1IAOB 2A83A 4AIOA 1DUZB 3BPCB 4OZGB 2F54E 3Q2CA 1PG7L 5EIIA 4URTB 3UP1A 5C9JB 2AJZA 4N5ED 1UZ8B 4MSWB 4O51A 5A16A 4OI7A 2VLJA 5F3HB 2Y07H 4XPHH 3PV7A 4X7TA 2W0PA 5CILH 5FYJD 4G3YL 1I8KB 1VERA 4U1KB 3NCJH 3VRJB 5FFLA 4E41E 1CE6A 3JUZA 1CDIA 1BZ7A 2YPKA 1WWWX 3NIDF 1SY6A 3UROR 3GEWB 3ULUF 2AEPH 4IMKA 4MQSB 4IBLT 2FHFA 5T1MA 4K94H 2UY7A 3KHOA 3LSOA 3K8KA 4QO1A 3E3QE 3A0OA 2A77H 3B6SB 1DZBA 4GRWF 4BKLA 1T5WB 1AJ7H 5DYOA 3ABZA 3FQRB 5TQ2L 1OTUC 4XXDB 4WFHD 3LS4L 4KKLD 5C0AB 5TE6L 4JQVC 3RIAK 1F42A 2YD6A 1I9EA 2H2SC 3LHPL 3GJFA 2B39A 3J7HA 4UINL 4Y19A 2DTMH 4CVXA 4GRMA 4U3HA 4JY5L 4TSAH 2VXVL 2YA2A 5DUML 3EOYG 1UADC 4WV1B 3MRHB 4L3EA 4TSAL 5DUMH 3WFDL 3GMRA 4XWOC 4UINH 3CFIC 2AI0H 3D39D 2AJYH 1XF4A 5C0RH 3BHBA 4HC1L 1ONQB 2Y1VA 2QJDA 1S9WB 3O9WD 1F90H 5E6YA 3MLSH 1HILA 4EEEA 5GGVH 2A77L 1GOFA 1NC2D 4PRHB 4RX4A 3MLRH 1NEZG 3RWHA 2FDBP 3G5VA 1D9KB 4JFFB 4R4FH 1FCGA 3CFKA 4DN3H 3O41A 1F4XH 4NPYA 5ERWB 4LKCB 3H7BA 1J0IA 3HZVA 2XN9B 1F8TL 4PJXB 1EGJL 4PGEA 2W38A 4J3UA 3LS5L 4UV7L 4DGIL 4EOWL 1YECL 2EIDA 1ZHKA 1EBAA 5C86A 5D1QA 3O8XA 4CW1A 3DMMB 5C09E 5I17A 2HVKA 1XR8B 4I5BA 4QWWD 3FT2B 2MKLC 3FB6B 1CLCA 4LEOB 1C1EL 2BNQB 3V6OC 3G08A 4M7ZB 2AK4E 4KK9C 2FJHB 2L4OA 3G6JA 4Y2DC 4P5TA 4E0RB 4WNQA 5C6PB 5TJWK 3BKJH 3FTGA 2E7MA 1AC6A 5GZNC 3LKPB 3QDGE 3MNWB 4QRTA 2YBRA 1FLRH 2FX9L 4R7NA 2BVOA 3BUYA 2WP3T 3LKSB 5EOQH 4HEPG 4KMQA 5JHDE 1MI5E 2ID5A 1ZHBB 5KW9L 5LQBH 1HHGA 1KPRA 1A22B 1MFAL 1TQCC 4ODUA 3TBYB 1A1OB 4LARH 3MLZL 2C1PB 5C0JB 4FTVA 2V5YA 5FYJL 1GYAA 5DMIH 1KC5H 4BFBD 5DJAA 1FAIH 3BPOC 5AD0A 4DTGL 4MNHA 4WWKB 4RFOL 1A47A 1WFUA 3OMZA 2F54A 2IGFH 4ZUSA 4Z8FL 3CUPA 5A2LH 2YEZB 3OKKB 3E6HB 1M71B 2Z8RA 4GG6A 1OAZL 2YPLA 5FGCB 4HKZA 4RFEB 2GI7A 4D94A 2BOCB 6FABH 2NLJB 2Y5TB 4KI5C 1KEGH 1CYGA 4MX7A 5E6IA 2OLDA 3BPOB 4X6FB 1D5XA 2R1WA 1P53A 1RVFL 4K3DL 4GMSL 2A6IA 1T2JA 5I75B 4JQVA 1QR1A 3L3JA 2X4UA 3MV11 4GMSH 4LAJH 4OGZA 2OJEB 4MXQC 2UUDK 1ORSA 3O2VL 1T0MA 3ZLQC 1QRNB 4C57C 5BS0D 4AT6B 3EDDA 3IFPA 1I9JH 2K9UA 4PG2C 4UUJA 3VXSB 3M17B 2DMBA 2UZYB 1QLRB 5DT1L 5IROC 4JFEA 3L5HA 4KKNA 1BLNB 2J6EH 5KSVA 2FIKA 3KPLB 5F9WB 5T3XD 4Q6IC 1K2DB 5C09A 3IXTA 4TPRL 4D9LL 2GT9A 3BAEL 1EEQA 5I1EL 3EYQC 1F6AB 4XBEL 1UM6L 3CFBA 4YC2C 3RWCB 4EUPA 4HW6A 4U2ZA 4AY0A 3LEYL 2EYRB 1C5DA 5ELIA 4X0KB 3KLSA 3DX6A 5FV1L 1I1AB 4UIMB 1MRDH 3CXHJ 3M8OH 2A6KA 3QQ9C 3TNNA 1JTTA 1KFAL 4XCFL 3GSNA 5CKAA 1A7NH 3AROA 2OR9L 5B38A 1HN1A 3ILPB 3U4AA 2YSSB 4OLWL 1N4XH 2X4RA 5JO5A 4AH2A 1BGXL 2OI9B 2WIIB 1HIMH 3RVTD 5DVNA 4NCDA 5I6XB 2HKFL 1IAMA 1QEWA 4OZFA 5HYSG 5D7IE 1K6QH 3JV6B 1ETZA 4S0SD 4X9GA 5C0CB 4KHXH 4LPYA 4YDVB 3ILPA 4WGWB 3U82B 3T8XA 4G6JH 2EO9A 3G08B 4EQ2A 1I7TA 1RHHA 2X41A 3BMWA 3MRGA 3CFEA 3RWDB 2X4QA 3QQ9D 2FO1A 1INEH 1BPVA 3O8XC 3VXRA 1FVDA 3OAYH 4WJ5B 4B7IA 4XMLL 1YEJL 2NX5D 4CU8A 3EO9H 4FQHA 1NAMH 4KJYA 2R1XA 1AR2A 5HDBE 1KJMB 4L29A 3HAEB 1FYTA 3QIBA 2P48B 2QSTA 4BSJA 2ICEA 4FQ2L 4OZ4A 5HYJD 4MNGE 4KMTH 3OHXB 4KKAC 2VJXA 4MA7H 3P4MA 1KXQE 2NY2B 3VFMB 5EBGA 3OKKA 3VA2C 3BXNB 1P7KA 1AC0A 4F7TA 5IHBA 4JN1L 1KIPA 5I9QB 4W81A 4DFIA 3RHWK 1IKFH 1HH9B 3FMGH 3PABB 3MLVH 4LSTL 2DDQH 1HHHB 1RZ7L 3MRIB 4CUCA 2P24B 4JZJA 4JM2C 2X4NA 1U36A 2XTJB 4KC3B 4JGMA 4WI5A 4Q2ZB 1QSED 4K3JH 3Q6GL 4LSUL 4LLDB 3IDNB 2QSCH 5TF1L 1MCPH 2BVUA 3VXOB 4UU9A 5LXGH 4DQOL 4MJ2A 2NCMA 5ESAA 4W70A 3OAUL 1P5UA 4HKZB 4I2XE 4MD0B 5DJDB 1S5IH 4M03A 1A7BA 4CN4A 4XXDA 5K93A 4LBEB 2QR0B 4HDIB 5TF0A 1S7TB 4MAYD 4JPIA 4L4VA 4ALAH 3FO1B 1A9EB 4M6NL 4HT1H 1GC1L 1BQHA 1I8IA 2PXYC 4OLVH 3V5HB 3RWEB 3HCVB 1XR8A 4NNXA 3VXRE 1A6UL 3DX7A 3ZE2F 5T3XL 3U0PB 3NCCB 2IPUK 2XRAL 4XB8A 4EUPB 4XPAL 3MV7E 5F9WC 2EXYD 5FV2A 1RSFA 5JA8B 4BQ6A 2J6EL 4N90D 1KJVA 1ZLUH 1YY9C 1GOGA 3FO2A 3GK8H 4JFQA 5ICXA 4KI5F 3OV6A 5D6DC 4YXLL 4JRXD 2DD8H 4PRIA 3HAEG 2D0HA 1UM6H 3WIHA 4OM0H 2ZZUT 1NBVH 4HGMA 1QSEE 3RZCA 4GAGH 5IW1A 1B0GB 1UWGH 1HYRC 2BNQA 1T4KA 1PSKL 3HI6L 3X12B 1BEYH 4HUWA 1NGZA 5IFJB 4HFUL 1YEHL 4XNQB 1T03L 4P2YA 3C6LB 2F74B 5I1HH 3O8XB 3DUUA 4CW1B 4BFGA 3QIWC 4PJFB 1G7QB 3BFOA 4QRPB 1UA6H 2PCPA 4P2OD 5FO8A 4NKIH 1JHKH 3LRSB 1MAKA 5D93C 3E6FB 3PWPE 1EFXA 3FB7B 2CIKA 4O2FA 3BH9A 5AZEL 1VFUA 2YPLB 3IAQA 3KYNB 4ETQB 5C0BD 1KB9J 4JFHD 1QSVA 3O6ML 2YD2A 4LCWB 2D7OA 1XGRB 4HIXL 3P11H 3FT3B 3LAFA 3LV3A 3BE1L 3L5XL 3VWJC 3QPQC 5JOPE 5CLWA 3BIKB 4KHTL 4IRJA 3DMMC 4GLRH 5EPMA 4L4TB 3TJEH 1AXSA 3ARZA 3HR6A 5DK3A 1RZ8B 3TF7C 1I8LA 1G6RL 2MFNA 4PRHE 3VFPB 2ZCKH 2LTQC 1IGIH 5FKPA 5TQ0L 5IW6A 4IHOA 1I8KA 3JVGC 3U30C 3DYOA 3B5TA 3MRMB 2NW2A 4LVNB 3FOMA 2X9WA 1FC2D 2B1AH 3QIWA 2VO5A 1KYOK 4F7MA 5JW3L 1AQKL 1MCPL 4PJ5E 3QUZD 3MV8A 3ARFB 3V5DB 1G6RA 2XA3A 3BPCA 3S96B 4NJAH 3QEQD 4Z6AT 4ISVA 3QRFM 2F53A 2Z93A 3MLYH 1IGYA 4YDIL 4F7EA 5TDPB 5GISL 4OTXL 1ROWA 5DD1L 3K81A 5GGTA 2BNQE 4MNQD 3CPLA 5JPNB 2PR4H 3M1BA 3ZE0F 5T3XE 1G7MA 1K8DA 5DRNA 1RD6A 5D7LD 3LRHA 4HPYL 5TH2A 4ZNEE 4K23L 1F4AA 2APWA 1A7QH 2DQGH 4OBSA 1RZIB 2FWOA 4JFYB 4L1HA 4YHPB 2ATKB 3RVVD 1ZT4B 4OIBA 1TVBA 2WZPD 4DCQA 3O2DL 3QUXC 4XP6H 2W9EH 4PJ9B 5KVGL 4EIGB 4YDJA 5LG1A 3TT1L 5KSBB 1DLFL 5B3JF 3EJZC 4JFYA 3KPNA 4XPTH 5IB2B 4KJWC 3G6DH 3U0WL 3TWCL 1A7PL 4JFQB 2ZWLT 1UWEH 5A2IH 1S7WA 3M8OL 3VWJD 2IQAB 5E8OB 1LE9A 4OAWA 1R3HB 2IPTL 1XF1A 3OQ3B 1SEQL 3CXDH 4JREC 4LLAA 4RIRB 1KJ3H 1KLGA 2XY2A 1KEMH 2L7JA 3KLDA 3DLQR 4E9LA 2Q87A 4UT9H 1RJLA 3ILQC 1G0YR 1BZ9A 1WC7A 1U42A 1G9MC 3VFUA 4OLWH 1T22A 4YHML 2DJUA 4LNVA 43C9A 3IDIA 2VZSA 3WMSA 3VXQB 1VFMA 4LF3B 1KN4L 2J8UF 2FX8H 1MQ8A 4I9WD 4QXGH 4FZEH 1CWVA 3EYSH 2GY7B 1L0XA 1OQOA 2VZVA 3W0WA 5HPMA 3QI9C 3SKUD 1DEEB 2YD3A 3RUGF 3PWVA 3L9RA 4YZFF 1KLFA 4QXUL 4X99B 4Z7UB 1ZA6A 2YK1H 4JEGB 4NO3A 4PGBA 4Z76B 1OAKH 5HGGS 1CDUA 1S7TA 1MCSA 3MRIA 4TRPL 2W91A 1XGYL 3L3KB 3MNZB 3V6ZB 4WHTA 3EJJX 2VLJB 4L8BB 4HF5L 3UPRB 2V7NA 4YUEH 5E5RB 3SE9H 1NBZA 3PIQB 3W11D 4HJGA 3B83A 1A4KB 4GRWE 4PG9A 4JLRA 3RAJL 2AEIT 4Q9BA 5FAAA 5DD0H 1G9MH 5AEAA 1S5HB 4JJ5B 3KYNA 4ETQA 1ZT7B 1F6LL 1U8IA 2HWZH 5BXFB 4UB0L 4XNUL 2HT2D 3H7LA 1H15A 5DJ8A 5GGUA 1G7PB 2JK5B 4MB4A 1F4YL 5IVXE 3IRZA 3FB5B 2X1OA 1A3QA 3LV3B 4WW2C 4C56E 5BW7A 1MNUL 5AUMB 4EJ1C 2EDYA 3K8LA 1OAUL 1OD7A 3JSSA 3MTRA 4ZXBA 4BA8A 1WWCA 3E3QC 2W9DH 3OXSA 2WBJA 3PL6C 4YFLI 1IQWH 2DLGA 4LSDA 5EO0B 2X05A 3D18B 3LH2H 2E9WA 5IMMA 3IJSA 5CD3B 3LIZL 4Z8FH 1N5AA 2KDGA 4PUBL 5JPNA 1IC1A 3CLEL 5ID1A 4L1DA 4ODHL 2H2PD 1E4WH 4PJFA 4WW2B 3VWJA 5F1OB 4PJEB 3SJVD 2IAMD 3X13B 2YSSA 2R2EA 4GBXB 5KN5A 1LEKB 1X5KA 1DBAH 1I3GL 1RULL 2HWZL 4LSPH 4Q6IA 5JW5A 4DKFL 4ZAKB 4G8IA 2FX7L 5DD3H 4ODWA 1W72H 4LVEA 3KPMB 4AM0B 1T3FA 3WIIL 4B50A 3JWOL 4LAQH 1RJCA 4M1DL 1T7XA 4R6UA 1M7XA 5I66A 5IVOA 3F7YA 4KK6C 1F6AA 1IMHC 4F7PB 1F4XL 1SEBB 2NTFB 2ADGB 5J12B 1WBYA 2VZ1A 1MCCA 2ZUQB 5GS1B 3C60A 2OP4H 4MAUL 5F7LB 1QSFA 1INDL 2ZCLL 3GSQB 4ZTOH