1QBLL

Fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords FABE8A
publication title Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution and FabE8 to 2.26 A resolution.
pubmed doi rcsb
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1998-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qblL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qblL01
3UJIL 4FNLL 4FXGA 3OKNB 1Q9KA 1YEHH 2J6EA 1SJVA 5BXFA 4OM0L 4OV6F 2BNQB 1OQXA 5FYLD 2QSCH 4UIKL 3VRLE 5CJOH 3CVIH 1N0XL 4LNRA 3OXRA 3D3VE 4EN3C 2X4RB 3BQUB 1NC2B 2AKRA 4HHAA 1CZ8H 4MJ5A 5BMFH 1XIWB 5EOCJ 2IPUG 4O58L 3FZUD 2CKBA 1H3VA 3T0VA 1ZS8A 4F57H 5B4MC 1B4RA 5I1JH 4F2MA 4G8IB 3ALWA 2VXSL 2QR0A 1D5XA 4YHKL 1WAAA 4PJ7A 4ZOAA 3UPCA 4JM2A 2UWEF 4X6FB 4JFFA 1JZ6A 4U1MA 5L2JA 1WVZA 4XXCC 1MCDA 4PJIE 3PP3K 3SBWA 4EUPB 1CICC 4LDLB 3U7YH 4ELKB 2XN9B 4JRXE 1F97A 2Q6WA 4KKCD 3CDFA 4UZGA 1RHFA 5IT2H 5SX5H 1MUJA 1CE1H 3G04B 4LEXL 3UJJL 1W0YT 4JVPA 1FAIH 4X6DA 1F42A 3GK8L 2MWCA 4XP6H 2QJDA 3SDCB 1IGYB 2JJVA 1TNNA 2R1XA 4WU5A 5E7FA 3RGVB 3I3DA 3BGMA 1FFQA 4MAYB 3MQIA 1X6LA 3V5DA 5K9JL 3MRNB 2O26U 3DOSA 3RY6A 3TNNB 4HLZG 1D6EA 3K4DA 1PFCA 2BY0A 1F90L 4MJIE 3FQWB 4F8TA 1RK1B 4HWNA 1KJ2L 2O5ZL 1RMFH 4P5MA 5EZJB 3MFFA 1G9NC 3T08A 1LO4L 3BZFA 3PG2A 1RUKL 3FQTA 3T09A 4PJFA 3RNKA 2UWEE 1YQVH 3MRHB 1QLRB 1V7MH 4LF3A 1MWAL 3KPRE 2CK0H 4X98A 5KSUA 1ADQL 4LCCB 3FONA 4NO0A 2RJMA 4UAOC 1G84A 3QB7C 5C0BB 1HQRA 1PKOA 2JIXB 3U9PH 5JPMB 2VOTA 4QT5B 5IVXB 1ZE3C 5FECA 5E94B 1T83C 2ICWI 3GHEH 2VDML 4LOUC 1C8PA 2YA1A 2CJUL 4KC3B 2FEEL 3HE7D 4D8PB 5EULV 5FYJU 3LEXA 2BNRB 3L1OH 3QXUA 4GLRH 1QFHA 1G9EA 2YD2A 1MFAH 5CEZL 1U8KB 5BVPH 5DHXB 4R2GC 3PGDB 1ITCA 5HYJB 2A38A 3SDAC 4RMQA 4L8CA 2PYFB 3I3BA 2R4RH 4X0KB 5DO2C 4D0BB 3DRTB 2KQMA 3QEQE 2ATPA 1ZHKA 4OLWL 5FV2A 5IQ9A 5DEZA 1T80A 2HYMA 3FRUB 5D72L 1JNNH 1OF2B 4MSWA 2P49B 2B20A 5F7LB 4Z77A 3HMWL 5LAXA 4M00A 5DQJA 4YDLB 2CO7B 1F4WL 3RTQD 4FMFA 1G9NH 1UB5B 2VITA 1F4XH 5ESVA 4U1LA 4JFXA 3S35X 2K1MA 2OM5A 4Q9BA 3ETBF 4WI9A 4JPVL 3T2QA 4K3JH 3QEHA 5CILL 3O2DH 5ELIA 5F7FA 2J1KA 5EOTA 4PTUA 5HDQH 4QHNA 3L3OB 4YWGL 3TPKA 3QR2A 4PV9A 4JFFD 1B6DA 4HUNB 4NFDA 5C2BL 3THMH 3LEVH 3L3GA 4Z0BL 2FATH 5I9QC 1T21A 1NGQH 1UADC 4Y4FD 3W0WA 3OKDB 2QQQA 3O6MH 4N0FA 4XVSH 3IXAA 2P47B 1Q9LA 3IFNH 4MVBC 3RGHA 4PLKC 2X44D 1RUML 3LB6C 3SKJL 4P2OD 4FABL 5D9SB 1PYWA 1DUZB 2IWGA 5C0CA 3HS0B 1F02I 3H9ZA 4P2YA 3UDWC 3SDDC 4H26A 1SJEB 4AH2A 3NIDF 2H2SC 3UTSA 1D7FA 2XG4A 5C09B 5ID1A 3B9KB 5JHLL 2DQUH 3MLUL 5KSBB 5DFTA 3KLAA 4U0RC 4L3ED 1J0JA 5J12C 2HLFC 4DZ8B 4UDTB 3VFMB 3VFRB 3D6GA 1MOEA 3CXDL 3RVTC 4KKLD 3P9WB 5SWZE 2DN7A 5EBMB 1J0HA 4NZTL 2FX8L 4M48L 4HUMB 4Y19A 4RGOH 3CMOH 1Q94B 5T5FL 4HJGA 4KKBD 1UACL 3KYMB 3VXUA 3L3JB 4QXUH 4NO0D 3FQRB 4F37K 3K1DA 1KCSH 1T0MA 2EH7H 4TVSa 1U91A 3RZCB 3PQYB 4XX1E 4HULB 4ONHB 3TO4D 3D0LB 1IGIH 4ZS6C 3QCTL 3WIFA 1I7RA 4KDTA 4CN4A 2D31B 3JTTB 4D9LL 1M7DB 1NEZA 3NIDE 3PWPB 1ZLUK 3GMPA 1QR4A 1IL1B 3EOBA 3HPJB 5F8QC 4H88L 4FS0A 4D0DB 2A1WH 3U9UB 2A6JB 4JG0H 1J8HA 4GAGL 3HZVB 4EDWL 2E6QA 1KF9B 2R8SL 4KK5D 4MQTB 4PD4J 4PJXF 3CAFA 5D7IA 4TSCH 3IU3A 1MCIA 4KY1L 5GRUH 3BMVA 4UBDC 1JNHB 2H9GA 1B0WA 4I18C 3GMRA 5FGBA 4NGHH 4NQDB 5AWNH 5LGHL 1NSNH 4LBEA 1UC6A 3UBXA 1EERB 4NO3A 4HWEH 4QTIL 5CHNA 4ZPVA 4Y5XC 1I7TB 2HT4D 4JFEB 1FL3A 3PHSA 5I1GH 4R4ND 4H0GA 2F5AL 4ELMA 3VFPA 3SDXE 3VGHA 3EJYC 3EOYG 3NZ8A 4PRHD 5T3XH 1O5DT 1A3LH 3DUUB 3KLHC 1PQZA 5D6CA 1A6WH 3DX7A 3V0WH 2CDGB 2O5XH 5F1IB 4RQQA 1DTUA 5IFHL 2BC4B 2FBOJ 4AEHH 1CLYH 2V2XB 3ME0A 4P2CG 2DKUA 3QEUA 4X9GA 3QNXA 4KV5E 5FGCB 3U82B 5KS9A 2AAVA 5I8KH 1G7LA 5ITFB 1VGKB 2NNAB 1LQSR 5T1DH 1WBZA 1Q72H 4PRDA 2P4AB 4JFPB 4YDKL 3P4MA 3ZYOA 4KZDH 1MHEA 1PJ9A 5I8EB 3NA9L 3M07A 5GS1B 5BVJA 3QUML 1RIVH 1QLEH 3TZVC 4RAHA 5B21A 1D5MA 5IR1A 5C86A 2JCCA 4O5LH 2A83B 5IGXH 4OUOA 4GRLC 1IAOB 2BDNH 1RHHB 3GJEA 3BKJH 1V3MA 1UWXK 3LKPB 1WWCA 3GBLA 4WWKC 2BOCB 1AD9B 4K3GA 1JZ7A 2AJVL 3P4OB 3ZDZF 3UTSD 3HE6A 4XMKH 1VPOH 4HUWA 4MD0B 4PJCA 2KL6A 1LNUB 1S5HA 3JWOL 1OTUC 1A9EA 12E8L 3V4VL 4BH8B 3GJFA 5IK3A 5E2VH 5GJSH 2VUYA 4KRMB 5HHOB 1IVLA 4JKLA 4QHLB 1YNTB 2YPKB 5AAWA 4U1SA 2B1HL 1EFQA 3G6JA 3TPUB 5CUSH 1BBDL 7FABH 2UVEA 5E6YA 5ITBH 4L4TA 4P2QB 3MNWB 1MCJA 2IANB 2N7BA 3QNYA 4WO4A 3F65A 5FKPA 2AK1L 3T4YB 4JJ5A 4R4FL 1YNKL 3CFJA 4OV5B 1BX2B 2MHAB 3CXHJ 3B5TA 1NCNA 1Y6KR 1N4XL 3ZDZE 1BAFH 1KLFA 3O3BB 4X5XA 3Q5OA 2YRLA 2FRGP 2FX7L 4G9FB 3C2AL 2EO1A 1ZA6B 4L4VB 1HNFA 3S4SA 1J8HD 3QI9B 4JQIL 1BGXH 3GSNA 1NCAH 3KGRA 5FYKL 3B83A 1QRNA 1B3JA 4XNZB 4ZNEA 2VAAA 3JV0A 4N8CL 1R3LB 3V4UH 3VRJA 5E9DB 2DLEA 2EXWD 2XTJE 3Q1SL 4F7EA 5GS0L 1K3IA 1I1FB 1RZFL 4KQ3H 5C0JB 2XKSA 1A64A 1WCQA 5GSVA 2ADFH 3ULUD 1X9QA 4U6HB 1P1ZB 1CU4H 3BI9X 1I8IA 5CIPB 4P0DA 3VWJD 3U0TA 1HZHL 2I9LA 1Q9WB 4EQ2A 4OZHA 5DJZA 4QY8B 4G3YH 1P4IH 1YN7B 4Z95L 2GK0A 3U4BH 2MTPA 2IFGA 2NY1C 4JPIB 3FB6A 4XNUL 4H25B 1BFVH 5EU4A 3QP3A 4OZIA 3S36X 3KLDA 2W92A 2XWJB 2LFGA 5KJRL 3P0GB 2F19L 4ZO9A 4IRSC 4G8EB 4P46A 3ZLQC 4NPYB 4ZTPL 4LFHD 4P4RA 4CMHC 1DN2A 4MLSA 5D2NE 1RUAL 7CGTA 1D6VH 5CP7B 2CLRA 2HMIC 2V7HB 4LLDB 1FC1A 4KUZL 2XZQH 4I1NB 2VTFA 4HQQL 5IM7B 3QPQD 1IC7L 2OL3B 2ATKB 1Q9OA 4ZXBA 2GFBB 1P2CB 1KB9J 4FQHB 4YDIL 1CFVH 3WE6A 5KZCD 3KS0J 4CMMA 3BO8B 3BP5A 3O9WB 4JE4B 4ALAL 1J05A 2ADIA 1LGVA 3E0GA 4LQFL 3B9EA 1I8KA 3T2OA 3VU2A 1QBAA 3C5SA 3K8MA 3OZ9L 5EOQL 5IROA 4KHXL 2VABB 4LHUB 1YMHB 5I74C 5HBBA 3C5ZA 4QHUB 4M8VA 1MHCB 2JTDA 4X99B 3OGOE 1AGDB 1I1AB 1C12B 5C0AE 3S37X 1KEGH 2NXZB 3GMOB 5E1HB 1CD0A 4M6MH 3WXVL 4DVBB 1VHPA 1S9YA 1IAII 1NLDL 4PJAA 5HPMA 1WC7A 2BY1A 1H15A 1Y18A 5D1XA 4OZGA 4JN2A 3H3KA 3MSPA 1FFNA 3C08H 3LS4H 4BELD 1WSST 4N9GB 2WBKA 1A6AB 3WNKA 1LE5A 5C08A 1EAPA 4D9RD 2XWTB 3Q6FA 5C07B 1B88A 3DROB 3QXAB 4WO4D 3EYOB 1NQBA 1LO2H 3Q2CA 4LSRH 3QYCA 1BFOB 1WWBX 3U0PA 4Z78B 3UZEA 3CFKB 1T03L 1FRGL 3EDDA 3WDHA 3IDIB 4WIQA 1HIML 3IDMA 2X4NB 3WLWC 1J86A 2BVOB 2IFFH 1IGCH 3RI5K 1R5WB 3KPMB 3C5JA 3HNSH 3UO1L 1LEIB 2P8MB 4AM0A 1NBYB 5HHPA 3QIWB 3MJ8B 1S7VA 4PB9H 2D9QB 3GSWB 1XGPB 1OAYL 4EVNA 2LAAA 2VDLL 2FB4L 4J12A 2HRPL 2QV2A 5FB8B 4G6JL 3ARFD 2E9JA 4FQ2L 2EDEA 4MX7B 4P59H 1ZLVH 5H2BA 3F58L 3AS1A 3FB8B 1XR8B 1WCBA 1BOGA 4HX1B 4Y2DD 5FEBA 2PTTB 3I50L 1G1YA 1YZZA 1KJMA 1I3GH 3VFUB 4FG6C 4KU1A 1AC6A 1A4JA 4UT6L 1G6RH 3SN6N 1LO5B 2ICEA 5DRZA 4NN5C 4PY7B 1CT8A 2C1PB 5KANG 3WFEL 3WXWL 2YA2A 1G0YR 4GKNA 3QUYA 2XT1B 4I0PB 4WNQB 1IEAA 2FYYB 1ES0B 1IT9L 2OL3L 4MNQA 1EPFA 1JK8B 4OZFH 3B9AA 4DKDC 1EAJA 4JPKL 3LV3A 5DJ0A 5AG8A 3MLTA 5D7LA 4K71C 2DQGH 4M9PA 4YH6A 3VXSE 3RPIA 1C5DA 1DANU 2YUZA 4OCXH 5IB1A 4BH7A 4DZBA 2KDGA 2R0LH 1UM4L 1KFAH 1TJIL 4JKMA 2CLVA 2ZJSH 4FA8A 1J87A 3DBXB 3LH2H 1OAUH 5B8CA 3BPLB 4ODTL 1WWWX 1AXSA 4YFDB 2FIKB 1OCWL 2EZ0C 4MHHG 3TN0B 5J13C 5H35A 1U3HA 2ICCA 1EBAA 2LAGB 4AMKL 4Z7VB 4LPVA 1T3FB 5D5MF 1NMAL 2B1AH 5EBLA 3FMGH 2Q7YB 3CFEB 4U7KA 2NQCA 1R3KA 1IJ9A 5KVDH 5DRXB 4AYFA 3MLVL 4LVNC 3BP7A 2EXYD 3ARBC 1E4KC 2YC1A 1EEUA 3C5ZD 3C6SA 4M6AA 5EWIH 4WEBH 3R8QA 1S8DB 1QEWB 3SCMC 1DBBL 3DI3B 2E27H 5E8PA 4P5TA 3D3VB 4GW4A 3LN5A 1S78C 4N0UE 5SWQB 4M1CC 1DLHA 4UT9L 1AJ7H 3GEWB 2P44B 1A7NL 1LO0H 5C0IA 1WTGT 5ADOL 3NAAH 4U1HB 2ZCLL 4PRAB 3IFPB 1F4HA 1CE6A 2LU3A 5C08D 1PDKA 2QSCL 4L8BB 2PNDA 3CVIL 5CJOL 5C6WH 5GRJH 5DVNA 2Y36H 1CZ8L 1CICB 5BMFL 2F54A 5D5ME 4Y5YA 1T04A 4NBYB 3G5YA 5F6IC 1M7IB 4MB3A 1IM3B 2HTLD 1TENA 2NX5D 5EUOA 1TTGA 2BVUA 4JRXB 4YXKH 4F15C 2DL9A 4BSVA 1S9WA 5C9JA 3DXAD 3ZKMD 3LQZB 1MVFA 1I3RB 5KG9B 3DGGA 2WNGA 4RA0C 4TN9A 2DQFB 4ZFZA 5F3HA 1G7IA 4UOW1 4AG4H 5J9PB 1T4KA 2XZCH 1AE6H 4DVRH 3U7YL 3TVMC 3G6AB 5TGBA 3S5LB 3CPLB 1ITBB 2F9BT 1CVSC 1QFUH 4MJIB 5IT2L 3X17A 1T66D 1URLA 2Q1EA 1AD0B 2G60H 4NRYB 4IMKC 3GSUA 5CFHA 4OI7A 1LP9A 2C3HA 3PGCB 4JGMA 4GRWF 2B4CC 3BDYH 4X7CC 5F7MC 2ADGA 4E42B 3FN9A 3QUYD 4FQXC 4UAOB 1N5YL 1B0RB 5IKCA 3BUYA 5IB2B 5IW1B 3KPRB 5D7LD 4PGDB 3STBA 2ZOKB 4UU9A 1RMFL 2A74A 3DVNB 1P9MA 4QRSB 2NXYC 2VYRE 1XCTB 5ERWB 1CG9B 1F3JB 2YPVL 3JV6A 2ADJB 1JP5A 5AYUL 5DMKB 3DPBA 1V7ML 1R3JA 1U93A 2P48B 2DM7A 2Y72A 4R2GB 3VXNA 4JQXA 3T0ED 4XNQB 5IJKC 3SDAB 4G8FA 1U3HD 4YGAB 5BS0E 3FN3A 1CF8H 5DUPH 4TPRH 4X7TA 5GGVY 4TULH 5GRWA 2DQHH 2JJTA 5FGSA 4YUEL 3AREC 2AXJA 2R2EA 1XEDA 3GHEL 4ZUUA 5T1LA 3QFJA 3QEQB 3QJHA 4KJWC 4XP4L 4P4KA 3I9GH 4CRPA 3L1OL 2X1OA 4B7LA 4X6BB 1MFAL 2CDEA 2I07A 5BVPL 2DWDA 5EIIA 3WUWB 3MUGB 1M71B 5BJTB 4I9WE 1FYHB 5DHVH 2OJEA 5IHBA 1FBIL 3IGAB 4KQ4L 2B2XH 1DQJA 1H0DA 5JHDA 1A1NA 1WT5C 1GZQB 2DMKA 3STLA 3CZFA 4J4PC 3OKEB 1CLZH 3QULB 1N6QH 5J7CC 4PUBH 5LGJB 4LVOC 2B4CH 1LILA 4JQVA 1MY7A 3KJ6H 3O6FC 3QIBC 5E6IC 4HWBA 4QEGA 4NQCE 2NTSP 3K2MC 3RA7H 5C3TA 3KPOA 1ORQA 2NY2C 2PN5A 1A0QL 4OGAC 3SY0B 3K81A 2EEDA 5F7EH 4UTBH 3MUZ1 4JANA 1TQCC 3D2UB 3RWGB 1P53A 4WRLA 5DUBA 1HN1A 5GPRA 1B0GA 1JHTA 3QUMA 5EDXA 3SGDI 5FO7B 4M6NL 2FCBA 2EH8H 2KPNA 3AAZB 3O2DL 2DS4A 1NC4D 5CD3A 4NQSA 5DMYA 5JOFA 5DR5H 1DVFC 1OGTA 4P3WA 5HDQL 3SDDB 2A9NL 4XC3L 1OSPL 5DRWB 4IM8A 3THML 3VFSB 3LEVL 5JPNA 1CYGA 5HDBE 1NDGA 4U0RB 1AXTH 2FATL 2UZXB 4QHMA 2X1PA 4NO5A 4UUJA 3V7AE 5J12B 4FMKA 2YPLD 4HZLB 4XVSL 2WAHA 1SJHA 5DEFA 2E7CA 3CVHA 3EGSA 1I75A 1W2KT 2DIBA 1A4KB 3Q3GA 3TIEB 3RIAK 3O3AB 2C3VA 4ODXB 2GSGA 2WIMA 5SWZB 5IMMB 1R5VA 4M3KB 4NHCH 1E27A 5JR1H 4JKWA 1B4JL 3EYFB 1TVHA 4E41B 4HS8H 3SQBA 5J56B 1J1XL 1NGZB 2P5WA 1HHGA 3G5ZA 3V6FA 3WEXA 4NKDB 2DQTL 4KFZC 1JNJA 2YXFA 3BVNB 1OLLA 3D1MC 4KVCH 4P2RA 1S9XB 1EIBA 3H2WA 5DTFA 3ROLB 3CMOL 1K4CA 3FCTA 1CGWA 1KPUB 3QZWG 1QG3A 4P57B 4PV8A 4ENED 1HE7A 4PRPE 3OJDB 5DLMH 2OK0H 5EA0H 2WW8A 3BX7C 4QXUL 4Z7QF 2IAMC 3RHWK 4U6TA 4XVTL 4I18B 1KCSL 2EH7L 4PGCB 2GSIB 5JA9A 1XF4B 4NZUL 5EU7E 2GITA 3BWAA 1IGIL 1N59B 4Y5XB 5T1LD 3QFJD 3DO3A 5HGDB 5DRNA 3ALPA 5EU7C 4P4KD 3C09C 3U2SB 2E9BA 2HFGL 4HJ0C 4R6UA 5DUMH 4XVUC 2EIDA 3BD4A 2A1WL 5IBLD 4FZEL 5I1EL 5HYIA 2VRAA 4NDMB 4HLJA 3P3YA 1ZVYA 4JG0L 4HV8B 1Y6MR 2F8OA 1A1OB 5CS7A 5AD0A 5FDYA 5GRUL 2MQ0A 3SDXB 1A22B 4NGHL 1N5AB 2H2PC 4PIRF 3MROA 4Q0XH 2WWKT 5M7QA 1G7PA 4U1KB 5A16B 1K6QH 1GZPA 5I1GL 4KGLA 4Z7QE 2I27N 1P4BH 3FFDB 1A6ZB 3NABH 3VFGH 3BHBB 4HCRA 4ODHH 2MKLC 4IMLB 2MMXA 4XX1G 4LLAA 5GGQH 3TZVB 3H9HA 3UPAA 3L6FA 3DX6A 5E8NA 3SPVB 3H9SA 2O5XL 4GRLB 4P23C 2XZAH 3MOAH 1OP5H 1I1RA 2YR3A 2HVKA 2NY3D 3JBG7 4WWKB 2X70B 5I8KL 5K93A 3L5XL 3HR5A 5HGAA 1Q72L 1YNLL 4Y16C 1GCFA 3GMLA 4KZDL 2FL5B 2VN7A 2IPTH 3DVFA 2NR6C 3WD5L 4WHTA 4OLVH 3U7AA 5ESAA 1HXYA 5J8OA 5BZWB 1RY7B 4O5LL 3JUYA 2KH2B 4R4BA 2BDNL 3BKJL 3CSYA 2HVJB 2Z31A 1L6ZA 1VFAA 3BEWB 1T5WA 4PG2A 4MJ4A 3ZT6A 1QFPA 4MZ3A 4R96A 4M7LL 3TJHC 2AK4B 3QIUA 3PL6D 1VPOL 4LRIA 3NN8B 5IOPB 2YOCA 3RVVC 4RZCA 2H26A 4G7YL 1MJ7H 3WYRA 4ZUSB 4PJ9C 1QKZL 1EMTH 1NUDA 5KVGH 2VXUH 3DURA 1A6TB 4M62H 2YSSB 5E1AA 4OGXH 3HPLB 3E2HC 1MHPL 2XRAL 4MAUL 4NUJB 5LVEA 5FA3A 1P5UA 3O3EB 4QYOA 4HW6A 2HT3D 4XNMB 2EYSA 2A6IA 1X4ZA 4HC1A 4HD9A 1SY6H 5D4QA 1I1CA 4LLMB 3WLBA 5ITBL 1RJLA 3O6LH 3HC0B 2C3GA 1PEWA 2VQ1B 3BIKA 5JXEC 3KDMB 4GUPA 1KELH 3LCYA 2FZ3B 3IDNB 5I17B 3MA9H 3IDUA 3JTSA 3ZE0E 1X3DA 5L88L 3CUPB 1Z5LA 2AJXL 3MRCB 1FNLA 1SHMA 1HI6A 4NZRL 3FOLA 4O2CB 2HH0H 4PP1D 3MTRA 1RVFL 2FDBP 1CLCA 4X83A 5A2FA 4YPJA 1AHWC 1TJGH 4GAFB 5DJXB 1UKQA 3QDAA 1BGXL 4YPGB 1RZGB 1F58H 4P3CL 3SE9H 3WS3A 4QRRE 2FEDD 4M61A 4JFYB 1MHHB 1YY8B 5FAAA 3NGBB 1I1YA 4FQIL 4HBCH 3WHE0 5I6XC 2E5EA 1EXUA 3KYOB 2DF3A 4OCWH 4TOYL 1EJOL 1FVEB 3OXSB 4IRSB 1INQB 1QQDA 4JHWH 1XMWA 1BM3L 4CMHB 2V5MA 1EO7A 4J3SA 1FZKA 4ZS7H 5EOCH 4R0LA 2G2RA 2BY2A 4NNPL 4RAVA 4UV4H 1MRCH 4PGBB 4L8SC 4YDJA 5F7WC 1KC5H 1CDHA 1UG9A 1EGJL 2C9AA 4HUKB 3U4BL 2PO6A 1GXEA 3B3IB 4OUUA 3X13A 1U92A 4UB0H 3EYSL 4JFDB 5JW3H 3GZKA 4BFIA 4QRPD 3MODL 4M4RA 2R1WB 2EIZB 5HHVH 1U8PA 1HOCA 4OFYD 4JLRA 5I74B 1UWGL 2BSTA 1RJCA 1G6RB 3LKRA 1YPZA 5TDOA 5GRVK 4EI5D 5IB3B 3IAPA 1D6VL 1OT2A 1MQKH 2XZQL 1E4XL 3WMSA 1ND0A 4OZFB 5I1DB 4QOKE 3TFKC 2Z35A 4I5BA 1AFVH 3UX9B 5INCB 1ZAGA 2BMKA 5C0AB 1KJVA 3ABZA 2IBZY 3MBEC 3MLYH 5FK9B 1H8SA 1FSKC 1MJJB 1YEDA 3MRPA 3H42H 2D9CA 4KAQH 4X4YA 3O3DA 3FO9B 1JN6B 1NBVH 2P24A 3IKCB 4GBXC 3VH8B 4V1DD 3F7YA 3MO1B 1NAKH 3MUY1 3D5OF 3QDMA 4PP2B 4MXQD 2UZYB 5HHQB 4PJBA 4LKCA 1KEGL 5TE4H 1BEYH 4FZ8H 3TBWA 5ACZA 4D2NA 4HFUH 3VXOA 3VDCA 1MFCL 1M05A 3L9RA 4LGPB 4PJHA 3SGJC 4IRJC 5DXWA 4AL8H 1EHLL 2VLRB 4HGKC 1VGEH 3NCMA 1HQ4A 2EDKA 3C08L 2I25N 3GMQA 3LS4L 4YHLH 2I60H 4KHTH 3OSKA 4F33B 4XPHH 5J6HB 3PNWB 2V7NB 5KN5B 1KYOK 3ARWA 4AEIL 3PJSB 1I9EA 2G5BB 1KGCD 1LO2L 5DFVD 3S35L 3WFCL 4I3SH 4J3OC 3T77B 2EDJA 4ZD3H 4YBHA 43CAB 1KNOA 2OQJB 3IRPX 1WQVT 1PLGH 2IFFL 2WLZA 5F89A 5FYLE 2Y4SA 4KMTH 1IGCL 4BQBA 3EUUA 5I75C 4NN5B 3AB0C 4Y5VC 5GS3A 3VXMA 2PXYC 2W0LA 35C8H 3ARQA 2Q76A 3PABA 3MRMA 5AUMB 5CZVH 2X4TA 4PB9L 3RI5F 4JAMB 4YHNA 1A6UL 4TUJB 4GW5A 4K71B 1DQML 3I75B 1NFDA 2NW2A 4GKZB 1IM9B 3BRDA 3FZUC 4U1NA 1KPVA 4C56E 4I0CC 2LU4A 4LSUH 1I3GL 3VXSB 2DIJA 2GJJA 2DI9A 3QCVH 3L95A 1G6RL 4LHJB 1SYVA 4PGJA 3BH9B 5IFJB 1MCFA 3ZO0A 1CK0H 5J13B 1DSFH 4PJ8C 5EORH 1FL6B 2GTZA 3IU4L 4TUOA 1RSFA 4XBGB 5GGRA 1VKXA 4K94L 3L3DA 2DQGL 2ITCB 1HDMB 5D93C 4KKCC 4DEPC 4XVJL 4OCXL 2VE6B 2R0LL 4H1LB 1KFAL 2X42A 1RK0A 4XTRD 5F9DC 4NJAH 3LH2L 4LVNB 4HIXH 4K3EH 4PRID 4XHQA 3ARBB 5DJ8A 5IG7B 1BD2B 1KCKA 4CVXB 1QYGL 3LZFH 2EE2A 1G1CA 1UWEH 5HHNA 2QKIA 5T1KD 3F5WB 1KIQA 4TUKL 5FO9A 3SCMB 4J1UB 3BKCH 3ALXA 1CR9H 2HFTA 1CFSB 1J1PL 2PCPB 2ZUUA 2XTLA 3HFMH 1UM5H 3HAEH 1UEYA 4PJIA 4DCQB 2B1AL 4NO2A 3TM6A 3E6FA 5J6GB 2X4OA 1XGTA 5IB4A 4PPTA 4N0UB 5GGSA 1I8MB 5KVDL 1UA6H 3FT4B 2IQ9H 4MQ7A 3EO0A 4ZOCA 1FLRH 2OZ4H 2AGJL 3G5VA 5EWIL 2CXGA 4WEBL 2ESVD 4RGND 4WI8A 5F6IB 3HUJB 2I9TB 3WIHA 1N6VA 1OPGH 3WFBL 3FTGA 1FV1B 2AJ3A 2Y06L 1NBZB 4N1EA 1AJ7L 3OJVC 4U0QB 4ZAKC 4F15B 1LO0L 4U1IB 4J8RB 5SWSD 2CKNA 2XA8H 3CFCL 1D5BA 4OIIH 5E08H 1GGCH 1T2XA 4CVZB 4RMUA 4POUB 4JZOB 1JIBA 4YDVA 2XYCA 1KN4H 3QQ3B 1G7HA 2UY6A 2R56H 5E8OB 1VB9A 5CGYD 2AEWA 2UWEA 4OJFH 3HI1A 2Y36L 2HJKB 4UMGA 1FDLH 1ZANH 4BZ1H 2A9MH 4M8QB 3RDTD 4RAUA 3L5WA 5MERB 4AZ8A 2YEZA 43C9B 2IH3B 3CNKA 3IFOA 2DJ4A 5FYJD 3M1BB 1FL5A 4U4BA 2VSCA 2DRUA 2CR3A 2YMXH 4YXKL 1KB5A 3RUGB 3GNMH 2Z8WC 5D7JD 4YAQB 2ZPKH 3VXMD 4YHIB 2Q86B 4Y89A 4WI3A 5IF0A 3O2WL 5C7XH 3MRKA 3P0VH 5FUZL 4IIQB 3RFZC 5IMOA 2D7NA 4AG4L 3NZHH 1JGLL 1T20A 4S11A 1UJTA 2XZCL 1MH5B 1KIRB 3G08A 4DVRL 4K7PY 3QUZB 3S34L 3V5KA 4JKPH 2V5RA 1K5NB 1UXWB 3CX2A 1WAAE 3MCKB 3EFDH 3WL9A 1IKFH 2D2OA 2ICWA 3NACH 4K23H 4OAWB 1YQ2A 3L5JA 4DOHB 4JFFE 1MRDH 2XV6B 1KEML 1ETZA 4DWHA 3HG1B 3NFPB 4JM2C 2D7TL 3HCVB 2DL2A 5C0EB 1HINH 3P0YH 3KPLA 4M93B 4DGVH 3MV7A 1U8JB 5FOBB 3SBWC 1C08A 1T1ZB 1FGNL 5FKAB 3TJEL 3OR7A 4LLVB 3PV7A 1FHGA 4AY0A 4FP8L 1I7UA 3OJ2C 5ETUA 4EIGB 2EDDA 5E4EC 3LKQA 3CCHA 3AVEA 4HKBB 3ULVC 2AXHA 1GGUA 2HAZA 3BYYA 3L3HA 3QRFM 5DURD 4L3EE 4G6AD 3RY6C 4M5ZH 1NCWL 5DUPL 2MCPH 1EFXD 4TPRL 5C92A 2ZUQC 4PJFE 2DQHL 3O45B 4NM8L 3QZWA 4LLUA 3ARGD 5C70A 4LVOB 4HG4K 2V2TB 3GUTA 4MYWB 3O6FB 3QIBB 4U6XA 5E6IB 3VGDA 3WHXA 5JW5B 1EUTA 4W70A 2QTEA 3I9GL 2VH5L 2NY2B 1JPSL 4K7FB 1E4JA 4KVNH 1Q1JH 5D71L 4NQCB 1TQCB 3BN3B 2CKBH 5C0FB 4CADA 2J8OA 4NZDA 1KOAA 3C60A 4XCFH 1AH1A 3ARPA 4LSSH 1CLZL 2B0SH 2ZG1A 4PUBL 2GK2A 2NW3A 1DVFB 2B4CL 3WIIH 3SKNB 1JF5A 1T22A 3OBAA 1SM3H 2DYPA 3M8OH 1CFQA 4OI9A 4LGSB 2VL5A 1FJ1B 5D2LF 2DQEL 3RIFK 3I85A 3RWJB 3BXNA 3ARDA 5IMKB 2AXGA 4IDJH 1FYTA 4N9OB 5HI4C 4YFEA 1E4WH 3MXWH 3ULVH 5TH2A 3MRLB 2GJ6D 3S36L 2VLJA 5DR5L 4TYUA 3QHZH 4MDJA 5KSAA 2HT4C 2QQNL 3A6BH 4TRPH 1I4FB 4R4NC 3SDYH 1QFOA 1U9KA 3EYUL 3H7BB 3L3IA 3FT3A 1AXTL 1IFHH 1N6UA 4YIQB 1JPGB 2MJWA 3CD4A 4YFLF 5DWUH 3DECA 5E00A 1GGTA 1G9ML 4G43A 2APFA 3QPXH 1UKTA 4ODWA 5GGTA 3F7VA 2ED8A 3TO2A 2XFXA 5LKNA 3SOBL 1G7MA 1QSEA 2CXKA 1MEXH 5D2LE 3PWUB 5AEAA 3MV01 4OQTH 2OMNA 2R9HD 3QISA 3L7FA 5DJYA 1JPFB 1TVBB 4NHCL 5LCVH 2IAMB 4ZSOA 5ILTL 5ICYB 3RIAF 5JR1L 2P43B 4PRPB 4HS8L 4YFLI 4WFFD 5B3JF 1UM6H 4C59B 5C0CE 5E2JA 3T65B 5J3HD 3ISWA 4KDWA 1S7TB 1DANT 3C09B 4MCZB 3KXFA 3UTSE 2EDFA 1JGEA 1HKFA 3PDGA 3TBTB 4GQ9H 4RRPG 4HIIA 5DLML 2AJYL 5EA0L 2QLVB 2GYSA 2QHRL 3V7AG 4HIHB 5HD8C 5IVNA 4QTHB 3KS0H 4PJDB 4PJXA 3MRRB 2ZCKL 3C6LA 4LSPL 4D0CB 3RHWF 1VFBB 3I6GB 2AJZA 4XI5C 2HFFB 4QO1A 5M94B 5GGRY 4XP9H 1J0IA 3PDOB 4C83A 1OB1B 3REVB 3FN0H 5E70A 3ULUF 5BRZD 1KCRH 5DUML 3FQNB 5F97E 4X8XA 2CR6A 2YK1H 3QDJA 3CH1B 4NKIH 4LRNH 3NCJL 3EAKA 2L7JA 2COQA 2HTKD 3IJYA 4XMPH 3C60D 4P23B 4BM7A 5F93C 1U36A 4WHDA 1ZLWH 3ZTJG 4KI5C 1YJDC 4W68A 3UTOA 1ZT4B 4IS6A 4Q0XL 5KS9F 1GAFH 5D7SL 2FSEA 5I0ZA 3DX9A 1K6QL 2PYEA 3R8BB 5CJQL 4Y16B 1J8HE 3BKMH 4NQXB 5IV2A 5D7IE 1CGSH 5FGRA 1DN0B 3BT2H 1AQDA 4Z5RA 4KK6D 1AGCB 4DKEH 3V9FA 1II4E 1CDJA 5GGSY 3BN9D 3R1GH 1N8ZB 2ITDB 3ARDD 3VFWA 3WJJA 1FYTD 2XZAL 1X4XA 3GBNL 2F53B 2ZOLB 5FGBC 3KPPA 3ZDYF 1SMAA 4CNIB 4LCUB 3BZ4B 3IRZA 2VIRB 2F74B 4UI2A 4ELME 3DX8A 3O8XD 3ULUE 3P9MA 1YEIH 1FNEB 2EXWC 2HN7A 4JRYD 5FHAH 1YN6A 3U36A 1KLGB 4L3CB 3TBYB 2QSQA 3TCLB 4PJCF 2G9HA 3NTCH 3NCYP 5C3LD 3D39D 4OLVL 3OAYH 3TH4T 5KW9H 4GXUN 4QRUA 1MELA 2BRRH 4WFHE 4PJ9B 4WTWA 5I2IA 1H8OA 4XCNA 5KS9E 3O0RH 1YY9D 1TJHH 3UYRL 1W0VB 3MRJA 3E2HB 5GRXG 1QSED 1U8IA 2W0FB 4FFWD 5IW3A 3ZZ1A 2JK5B 1BECA 1CI5A 3RAJL 4LCWD 5GIRB 5MENA 5F72S 3B5GA 3OMZA 1NLBL 2JCCE 4WENB 5CINH 1YJDH 3V6OE 5EO0A 4O2FA 3MRFB 4G8GB 4JO1L 4OZ4B 4PGEB 4NRZA 4WHYH 4GKSB 3MJ6A 1XCQB 4U6YA 2DM3A 5DQ9A 2AEIT 2DQJL 1EMTL 1NMBH 4WY7H 1FG9C 4QRQA 4ZUWB 4OGXL 1YDPB 1NGYA 3CFBA 3KXFD 4PJCE 3S7GA 2MPAL 4V2BA 5FXCH 1AHWB 5HVHC 3RWHA 1U8LB 8FABB 2NY4D 1I3VA 4U1GC 5BOZG 1R0AH 1SY6L 2OSLB 3HE6C 5I76A 4G80A 1NAMB 3U4EB 3O6LL 3ZTNL 4YHPB 1OM3H 1BQHG 4JO2H 5CMAB 2ZSVB 3VXTA 5JO5B 1Z3GH 3HR6A 4BSWB 1JHKH 5TF1L 1MI5D 1KELL 4AENA 2ZZUT 1FO0A 3C6LD 3H7LA 5D2NA 5I6XB 1Y0LB 3G6JE 4PR5A 2D7MA 4QRRB 2DJUA 4BQ8A 5B39B 1E6JH 1QOKA 4XGZB 3RVXD 1AGBB 2ICWJ 3H3PL 3NFSL 4UV7H 2AV7A 2IALB 3V7MA 1OGAB 2HH0L 1M6OB 1V8HA 4D9RE 5AZ2H 3DNKA 4HDIA 3R0NA 1V05A 3QDJD 1TJGL 1U8OA 1SEQH 3UTQA 2FO4A 4L8SB 4JM4H 1S7QA 1F58L 4Y8AA 3SE9L 5DVLA 4RMVA 4R7DA 2FJGA 4XCYA 5DK3A 4HKZB 5HVWA 4JPWH 4QXGL 3X3FH 3H3BC 3DARA 4X9BA 4OZIF 2F15A 2O61B 4X6CB 4N8PA 3BAEH 1DBAH 4WWID 3GMMB 4BK4A 4OLXH 1IGFH 4Q9RL 4O4YL 4K8RD 2NY6B 5I30H 3RWIA 4DKAA 4JHWL 2Y5TB 5ALCH 2FJHB 1QRNE 4ZS7L 2AV1A 5EOCL 4NNXB 4XZUA 4PYGA 3VXPB 2VR4A 4UV4L 1MRCL 5CLWA 4HS6A 4LPWA 3V5HA 1HHHB 2W9EH 4NYLB 4N1CA 1K8IA 1DBKH 4OBRA 2FWOA 4NRXB 4NQVB 4POZD 1AQKH 3GGWA 3IJSA 1NC2D 5CEZD 2N1KA 5KVFH 3MBEB 3HZKA 1XIWD 3RX8A 5JW3L 5DJCA 3DV6B 1FSKB 4QOKB 4ODUB 1HEZA 1S7RA 1RZIB 3EKCA 3M45A 4HWZB 5HHVL 1T1XA 4OZHE 4GBXB 3O4LB 4KROB 4XPTL 4Y0GA 4IBLT 1I3UA 3MRDB 3GJFH 5JW4R 2ZSWA 1AP2A 1MQKL 3MV9A 4P48A 4OZIE 4R97C 1W0WA 5EZLB 1WFNA 5KOVC 2ZUXA 4NNYA 1AFVL 2RBLA 4F3FB 1ZLWK 3LOWA 4TVPD 5TDNA 4N8VB 1IEBA 4IRJB 3QO1B 3UTTB 2G75B 4HGWA 1UT9A 3VFTB 3FL7A 3MLYL 3PWLA 4TSBH 2VSDA 2PF6A 4M7KL 1NAML 2E6JA 3EDEA 3BISA 1NBVL 4P46C 2V5SA 3DO7A 4H5SA 3UZQA 1SYSA 3IT8D 3SDCD 5T33H 3K80A 1MRFH 2Y1VA 4XCEB 3WFDH 2F58H 3LS5L 4ZXBC 2R29H 4O02L 2EDBA 2FO1A 4DFIA 1BZ9A 3CFDA 1S7XB 3U6RB 4MNHA 3HAEB 4Y5VB 2PXYB 5I19H 3DUSB 4R3SA 4YHLL 2I60L 3P9LB 4KHTL 1MVUA 2XIDA 1F4AA 5IROC 2EXYC 2ZG3A 4PTTB 5DJAB 3C5ZC 4I2XA 4X4XB 3SGEH 2IQAB 3ZDXE 4APQA 3V0AC 3PHQB 1NGWA 1J18A 5F9AC 3IDGB 4I3SL 5FF6B 3DRQB 4BSJA 2D03H 4ZD3L 2Y6SC 4OZGE 4X4ZA 5I8CB 1MAKA 2R0KH 4ACPA 4ZDHA 4HIJA 1W8NA 5GGVH 5L8LB 3MRBA 3A67H 5C08E 4KMTL 1R3HA 2J8UF 2JIXD 2OR9H 5D1XC 5GZND 2PR4H 4C56B 4HWUA 1VESA 4XBPB 4PJ8B 3U1SH 5CZVL 4LL9A 4N8VG 3BP6B 1MCRA 1IZJA 4G42B 5CKAA 2BNRD 5GS2D 4RGMC 1VSCA 1CXFA 4LDOB 5D93B 4U7SA 4DEPB 1JGDA 1FZJB 1KENH 3DXAE 2HTLC 3QUKA 5HYSG 2NZ9C 5H37G 4LSUL 4MDIA 3NFNB 4MNGE 5CWSB 3UYPA 3RWFB 2ZWLT 4Q58C 1WZ1H 5MEQB 5DC0A 4ISVB 4JZNA 3NCBB 3B2VH 1YYMH 2CUIA 5K33A 3GB7A 5E6ZA 2GAZB 2VXQL 1OTSC 5F9OH 4RBPH 1QO3B 3GSXB 3P4NB 3S9DB 1MPAH 4WW2F 1IC5H 4YGVB 2BNUA 2A6DA 2J8UE 3SKOA 4KJYB 4RISL 5D5MA 3PWJA 4MZ2A 6FABL 4YBLC 3UJIH 1QSZA 4FNLH 1UQSA 2Z4QA 2H32B 4OKVB 5LG1A 1A2YB 1CS6A 4HIXL 1HWHB 5TQ0H 4L29A 5LWYH 2DLHA 4UIKH 5D7LE 1UWEL 1EZVX 3QUYC 3BKCL 1AR1C 1UKSA 3V79C 3MV9D 2D0GA 4OFIA 4AIOA 2YN3A 2CPCA 4O58H 1CXIA 3VXRA 5I1LB 4ZAKB 1UM5L 4KWUA 1N2RB 3CLFH 4KJPC 4LEOB 3GRWA 1VFUA 3LKNB 5I1KL 3T0EE 5FYLL 1ZSDA 4HT1L 2GJZA 1NGPL 3HRZA 4QNPE 1QD0A 4OF5A 1BIIA 4HPYL 2WINB 4QF1B 1CXHA 4XPGH 1FLRL 2OZ4L 1I7ZA 3UJTH 4KKAC 4ZNCD 4G5ZH 1HHIA 4XAWL 4H0IA 4HUUA 3EO9H 3BW9A 1U3HC 1QFWH 3IETB 1KPRB 1BVKB 4UQ2A 1XF2B 5FHBH 4JO3H 1T0NA 5CGTA 3B9KD 5DK0A 1FGVH 2XA8L 4FXGB 4Z7NF 1PGRB 2NCMA 1Q9KB 4OIIL 4Z7UA 5E08L 4M1GH 3BZEA 5BXFB 5EIVA 1INDL 1AGFA 1KN4L 1P84K 4I8DA 1NCCH 4LNRB 3UXFA 3OXRB 2AABL 1YEEH 2AKRB 3BGFC 3S96A 4MJ5B 4MQSB 3GI9H 4APQD 4F7TA 1ZANL 1ZVHA 4LCIL 2A9ML 5CCKL 2FECI 4A2MA 1KJ2H 1H3WM 2CKBB 2O5ZH 4P5TC 5F70A 1ZS8B 3BPNB 1NUFA 1X5AA 3BIAX 4XMLH 5BS0A 4F2MB 3MGTA 2W60A 4JB9L 2YMXL 3GNML 1QSFA 3RJDA 2QR0B 1GGYA 4U31A 1D5XB 2ZPKL 1PEZA 4PJ7B 3TNMA 1MWAH 4JM2B 4JFFB 5C7XL 5EN2A 5HPOA 2PTVA 4MAYC 4U1MB 5L2JB 1JI2A 1X5GA 2F8VA 3PWPD 1LEKA 2P5EA 4S1DC 4Y5YC 2Q6WB 1OWRM 5GSRA 2IG2H 4JKPL 1GRWA 1MUJB 2OTUA 3EFDL 4AIZA 3NACL 4K23L 4IHOA 1DQTA 4X6DB 1EO5A 4C4KO 2CJUH 1JYNA 1MRDL 4OTXL 2R1XB 4WU5B 3OB0K 3BGMB 4NQDD 3V5DB 2FJFA 4R90L 2YD3A 1D6EB 1HINL 2YPLE 3P0YL 3M17A 4JFED 5ICXA 2ZUQB 4WGWB 3HHRB 1FCGA 4P5MB 1NCDH 4ZUVA 5DZLA 3MFFB 1A3QA 4POYA 4JO4H 3BZFB 1OP3K 1ZGLA 2EDRA 2X6MA 3FQTB 4PJFB 3UYOD 3RNKB 5D72H 4PB0H 5I1IH 4LF3B 5J1AA 1J9CT 4X98B 4M7ZC 4OD2A 5KSUB 1T5XA 2O5YH 3HA0A 3FONB 4NO0B 3WNMA 1F4WH 4M5ZL 2QBWA 2A77H 1HQRB 2BVTA 2MCPL 5CJBA 3BD3A 1GL4B 3MV8A 5GS0D 3VXRD 5ISZA 4C55A 1ZWIA 5FECB 1P9MC 2P7TA 4JPVH 4RRPA 2J6EL 3NIGF 2X4QA 3GSOA 2IGFH 3LEXB 3PWVA 3TA3A 1V7NL 1ZHNA 3VW3L 2ZUWA 4KVNL 1Q1JL 4ENEC 5AZEH 4JQXC 3WBDA 4LPYA 3VWKA 4L8CB 2CKBL 3HRPA 4Z0BH 1MFBH 2QQKL 1A14L 3QFJE 3KG5A 4XCFL 2ATPB 2GCYA 2JJTC 2WBWB 1JV5A 2B0SL 3ZKSD 1ZHKB 1OP9A 4RA3A 5IQ9B 1AKJA 4K55A 4WUUA 4MS8D 1DDHB 1RUMH 1JZ8A 4XWOD 3SKJH 3BD5A 4FABH 4Y4KA 4UNVA 3F7QA 1SM3L 4MSWB 3M8OL 4Z77B 5LAXB 5CJXA 2X1QA 5DQJB 5JHDE 3FQXA 3KVQA 1I85A 1FNGA 4N90D 5JHLH 3EYVA 2VITB 5ESVB 1BMGA 1LK3L 2NMSA 4U1LB 4JFXB 4LIQH 3NIGE 3VG0H 1MLCA 4IDJL 3T3MF 1A9BA 4G6KL 1ZHBA 4L5FH 5T3ZE 3RIFF 2ARJA 2IBBA 3QEHB 5DK2A 1CL7H 3MA7A 1AR2A 3MXWL 4CW1A 4MJ2A 2XKNA 4P2QD 3CXDH 1DBML 1MSPA 1QSFD 2ED7A 3Q0HA 2IAND 5EOTB 4PTUB 2YRZA 1JI1A 4QHNB 4JQVC 1DQQA 3QHZL 4CGTA 4GMSH 4PV9B 3JXAA 5T5FH 1A7OL 2VDRH 1XGUA 2J4WH 1GPOL 3L3GB 1P7QA 2HG5A 2P5ED 1IFHL 1T21B 1XT5A 2BFVH 3G9VA 4G9FD 5DWUL 3W0WB 3O6KH 3H0TA 3V52L 4L4VD 4N0FB 3IXAB 2OYPA 3QCTH 1Q9LB 3EYQD 1PYWB 3B2UC 1MEXL 5DC9B 5C0CB 3MLXH 4H26B 3I02A 4AH2B 5E9DD 3ROOA 3UTSB 2R23A 5ID1B 1J0KA 3T3ME 4GAGH 1GGBH 1S7UA 3VGBA 3KLAB 2WWMC 2R8SH 3LKOA 2C3XA 4KY1H 4WI2A 5I1HH 1HK6A 5DVMA 1WZLA 1UM6L 1F2XK 1PSKH 1RAMA 1L9NA 1CFTA 2WQ8A 4R26H 3CK0L 4Y19B 3MLPA 4NWUL 5LXGL 3LRHA 4XH2A 2Z8SA 4HJGB 3WNLA 4QXTA 5TQ2H 1JZ3A 4GQ9L 3VXUB 2P5WE 1RULL 1Z0MA 1IGJA 2E7MA 4UQ3A 1VFOA 1T0MB 4LMQE 2VAJA 5C6PB 1U91B 3MV8D 4P2RE 1C5BL 4RX4D 5HHME 5ISZD 5IFHH 1RU9L 2FLRT 1U6AL 5DHYA 4S1SH 3DSFL 4JN1H 5ESQA 3WIFB 5T3ZH 4CJ1A 5GZOC 3EJZD 3RU8H 1XGQA 4RSVA 4K2UL 3MRGA 1EO8H 1NEZB 3DETD 3GMPB 4XP9L 4ZUTA 3EOBB 1ZHLA 4W6WB 1BQHA 3FN0L 4HBQA 5CBAA 1KCRL 4HF5L 1F11B 3QDHA 2YK1L 3NA9H 3OAUL 1J8HB 3O9WD 4LRNL 3QUMH 3VWKD 5IESH 5D7IB 2DLFH 3IU3B 3OAZH 2H9GB 3GMRB 3D85A 3N9GL 4GRMA 3QJFA 1OARL 4Z7WF 1ZA3A 2I24N 3WDJA 3GM0A 4EN3A 4LBEB 1AKJD 2C1OB 3UBXB 4NO3B 4WUUD 5CHNB 4ZPVB 2DJSA 1CIDA 1X4YA 1FL3B 1I1AD 3BESR 1FZOA 3B6SA 3BKML 4DN3L 2NXZD 1H3TA 1IKNA 1CGSL 4ELMB 4PP1C 2VDOL 3VFPB 4JGUA 3NZ8B 5EC2A 3D0VA 1MCPL 1YECH 4DKEL 3VXQA 4JFZL 1PQZB 5D6CB 2X10A 3DX7B 3JWOH 2B7DT 4RQQB 12E8H 2YKLL 2ERJC 3CVHH 1NANI 4S2SA 3QEUB 3QNXB 5HYFA 3TBVA 5KS9B 4O00A 3UAJD 5C07D 1G7LB 4GKOA 4Y4HA 1YEIL 3MMEA 4UINH 5FHAL 1WBZB 4PRDB 4XAKD 3P4MB 2EDHA 1E28A 4J3TA 2IJ0C 1BBDH 1MHEB 1FFOA 1QZ1A 5JZ7D 4HXBL 3PHOA 4NOBA 5BVJB 4LSVL 1P7QD 4R8WL 5KW9L 1D5MB 2HLAA 5IR1B 2JCCB 1MCCA 5INDA 4F7PA 4X4MA 1L0XA 3UC0H 3QIWD 4ZTOH 3GJEB 4R4FH 4DUWA 4QRPE 3FO1A 5BZDA 5E2UH 2VKXA 1MNUL 5KZCB 4Q9QH 4GO6B 1MCBA 3MV11 2C26A 5L9DL 1U2HA 5HVHB 2FX7H 3MLWL 1RJZA 2XNAA 4U1GB 5E03A 3ILQD 3NCYS 3HE6B 4PJCB 4HUWB 4EXPX 4LLYA 3QAZC 3QSKB 1KIPA 5CINL 1YJDL 4KRPC 2VJXA 4WHCA 5DDHA 1S5HB 5FYKH 1UVQA 1A9EB 3O11A 1L9MA 3GJFB 5IK3B 3O4OB 1PKQA 1NMBL 5IVZA 2ZCHH 2HJLA 3Q1SH 4U1SB 1FIGL 1JGVH 2Z31C 3G6JB 4PG2C 4V1DE 1HYSD 4HS3A 1T0PB 2PKDA 3MFGB 3I6KA 2Y07L 3QIUC 1JL8A 4EEEA 4LRIC 4L4TB 1EEZA 4U7MA 4TSAL 2LU7A 1OM3L 3QNYB 4JO2L 2H3NA 4WO4B 5FKPB 5TDPA 3CU1A 4OF3A 4JJ5B 1RZJL 1JHKL 3LEYH 5BO1L 4Z95H 2GW5A 4KK8C 4MA7H 1RQ5A 3CFJB 4LFHG 5F1OB 4XNUH 5CZXD 4LNVA 2VLMD 1E6JL 1N3NA 4X5XB 4UV7L 4ZFOA 4HCRH 3OGCA 2UUDH 2AEQL 4NCDA 5AZ2L 2ZP0T 3HC4L 3RWDA 1KGCE 1PG7W 4ZTPH 3S4SB 4JM4L 2WIIA 3GSNB 1O0VA 1UYWL 4KUZH 1QRNB 1RI8A 2XICA 1IC7H 2VAAB 1LK2A 4YJZL 5DFVC 3VRJB 1BJMA 4EN3D 1DEEA 4YDIH 3X3FL 3MRIA 1CQKA 1OD9A 4BUHA 3BAEL 4F7EB 4OFKA 3ZE1E 1IGFL 5FIEA 2FR4A 2R2BA 5GSVB 3JUZA 5B4MD 1ZVSA 5A43C 5EOQH 4GFTB 3GO1H 1I8IB 3U0TB 1PG7X 2B5IB 3X12A 2I9LB 3LSOA 5HYSA 4OZHB 5DJZB 5ANMA 3KYNA 2W9EL 5IHUL 4R97B 4OLYH 5I66A 3JWDC 1DBKL 2BOBA 1W72A 2GK0B 3VMOA 1X5IA 1SVZA 3IDJA 4CAGA 3FB6B 3MJ9L 1AQKL 1DUYA 2NY0C 5EU4B 5KVFL 1OAKH 1MIML 4ONFH 1XZ0A 3V95A 1TZGH 5SX4I 4GG6F 4P46B 1EVUA 4H0HB 4P4RB 5C2UB 4R0LC 1A1MA 4HK3N 2CLRB 4YHOH 1OW0A 4PJBF 4PRNA 5HHXH 1Q9OB 4ZXBB 1FRGH 3WE6B 2PO6C 4CMMB 3BP5B 5ADPH 4K7PH 1A5FL 2BSSA 1J05B 1ZT1A 2OTWA 4HC1H 1D9KA 1I8KB 3UO1H 4TSBL 3C5SB 5HYQA 2J88H 5DA0B 1FFPA 4XTRC 5ICZA 4QHKJ 3C5ZB 3F12A 3L5HA 1OAYH 5T33L 2VDLH 2FB4H 2FH6A 4RNRA 3ULSA 4FQ2H 2AEPL 1IZKA 3OKLA 3E6HA 1S9YB 3VJ6A 4PJAB 5HPMB 1WC7B 3I50H 1H15B 5C8JA 4GJTB 3O41A 4GG6E 3N06B 5JQ6H 1Y18B 5D1XB 3EYFA 4OZGB 1EEYA 4JN2B 4PJGF 3VD5A 1FFNB 5I19L 2ESVE 3PIQA 4WTXA 3BUTA 3QDME 4RGNE 4LOUD 4GH7B 2VDQH 1LE5B 1QRKA 3GSNL 3Q5TA 4FQPA 1FE8L 5C08B 3WXWH 1EAPB 4PJBE 3JWDH 3IB4A 1RZ7L 3S3PA 3Q6FB 5MHSD 2DI8A 2YUXA 2BVQA 1IT9H 2OL3H 4RGMB 1KCLA 5F1KC 1F3DJ 4JPKH 4RGNC 1JFQH 3U0PB 4PJHE 4OF7A 4JGJA 1NH6A 5DD5H 2D03L 4R2GD 5CD5D 2OS7A 2R0KL 3IDMB 5DO2D 1UM4H 3A67L 3C5JB 1LD9A 1TJIH 2OR9L 1QA9A 4AM0B 4MMZC 1C16A 1S7VB 1S9VA 3QEQD 2WBJA 4I0PC 5FYJE 4EVNB 3QFDA 4WW1A 5E56A 5H2BB 3SJVA 1WCBB 1BOGB 5ID0A 4NBXB 3VXME 1A6PA 2H45A 3FO2A 4UIMA 1KJMB 1S9KC 4YR6A 4KI5F 3AM8C 1AO7A 3T3PF 1A4JB 3HE7A 2ICEB 4X9IA 1JJUA 5DRZB 1CT8B 3GIZH 1WZ1L 4GKNB 3QUYB 1IEAB 1NFDE 4MNQB 4PG9A 3LV3B 5DJ0B 4LSTH 5T1MA 1DBBH 3MLTB 2AJUH 5D7LB 1FH5L 3RPIB 1FP5A 1IC5L 1C5DB 4DGYL 2FD6H 4BH7B 2CSPA 4DZBB 5IB1B 1A7NH 3FJTA 1U8NA 15C8L 5ADOH 2CLVB 4WFED 3C8HA 4NP4H 5B8CB 3B43A 4W4OA 2ZCLH 1AXSB 5TQ0L 1GYAA 4QWWD 5LWYL 3N1PC 3KNBA 3EOTH 4PLKD 2AQ2A 5LQBL 1JE6A 2KZWA 2GTWA 5C6TL 3DLQR 5H35B 1U3HB 3RTQA 4W6YB 3SDDD 3U46A 2H2SD 3WS6A 1OTTC 1DQDL 1F6LL 1RZKC 1NPUA 3T3PE 5EBLB 3RL2A 3BWUC 2AXFA 3CLFL 3LHPL 4YO0A 5GRZA 1G7QA 1R3KB 2RFXA 5CEXA 2DLGA 1D9KD 5LBSH 3TH2T 3MR9A 1QSVA 5T3XD 1A47A 3BP7B 2YC1B 4XPGL 3RVTD 3BGFB 3C6SB 4L8DA 2AQ1A 5F7HA 2W0PA 1V3JA 4O51A 2QHLA 3UJTL 4G5ZL 4G6AC 5EFIA 1C7TA 4HAGA 5A3IC 5GQBA 5C0DA 1BJ8A 3EO9L 4GAYA 5E8PB 3IYLW 5TPWH 2FHCA 2FGWH 1QFWL 4P5TB 4GW4B 3LN5B 1TDQA 4Y4FA 1DLHB 3UP1A 3AMLA 4DK3A 5FHBL 4JO3L 4FQQA 5C0IB 3BKYL 4Y1AA 1FGVL 5GGUA 5DSCA 4E41D 4P9HC 1OAXH 4M1GL 4P2OA 2Z92A 3JV4A 1CE6B 1CDBA 1NCCL 5D7KD 3MYZA 1YEEL 3NIFF 2EDLA 1N5YH 2F54B 3GI9L 4Y5YB 1T04B 3G5YB 1JHLL 3MJ7A 4L3EA 4JCMA 4MJ6A 3ZHLA 5EUOB 4XMLL 4W81A 4Z76A 1TFHA 4BSVB 1S9WB 2YPVH 5HVGB 5C9JB 1Q38A 1CTOA 5AYUH 4U49A 3DGGB 3FB5A 4CDHA 4ZFZB 4PLJC 5F3HB 1G7IB 5L7XH 3SGKA 1P69B 5A2KH 4NCC1 2W0KA 4B53A 2WBJD 5IEHA 1JRHI 1T4KB 1RZKH 3AS2A 5D8JH 5HDLA 5TGBB 1YC8A 5FM8A 3EJYD 3SJVD 2IG2L 4PLOB 4YUEH 3TO4A 2CIKA 4L4JA 4E9LA 1A8JH 5F7UA 3KLHD 5D70H 4M02A 5ALBL 5AAMA 1AO7D 3GSUB 1LP9B 2J12B 4XP4H 5F7DA 4M7ZB 3HNVL 2ADGB 5IKCB 1VEOA 3BUYB 3X11A 4TQEL 1J1OL 1CDYA 3MNZA 1FBIH 2X4PA 2BVPA 4KQ4H 4UU9B 3R4DA 1LHZA 1NCDL 2A74B 4MCYA 4JO4L 3TZVD 2J5LC 1R24A 1A7RH 4X6EA 3JV6B 5DJ6A 5IFAH 4PB0L 5I1IL 2AS5M 1R3JB 1U93B 5DEGA 4Z7OF 3MV7E 3VXNB 2W38A 1A0QH 2O5YL 3VGAC 4WWKD 3CDYA 3ORJA 1D5ZA 4GW1A 4WFFE 4G8FB 2ILLA 4PRHA 1INEH 4DW2L 1BZQK 2X2YA 2A77L 3F7PC 4X7TB 1PBYA 4XBEL 4M6NH 3HMXA 1GGIL 1KV3A 5BQ7A 2R2EB 4ZUUB 4WGVB 5L0QC 3QG6A 5T1LB 3F62A 3DWTA 3QFJB 1AY1H 1OTUD 2DB8A 1Z9OA 1XH3A 5J3HC 1MF2L 3QJHB 3BIBX 2IGFL 4P4KB 5FM5M 3DVGA 2A9NH 4LASL 2CDEB 2I07B 4XC3H 1OSPH 2DWDB 5EIIB 4TTDD 4KGJA 4YK4B 5AZEL 5D2LA 3TYGH 5E4IA 5EBGA 2OJEB 1MFBL 1DQJB 1H0DB 5JHDB 1KBGH 1A1NB 1DL7H 1HH6A 3STLB 1BQLL 3DIFA 1HSAA 2AK4D 3CZFB 5GISL 1KB5H 1JN6A 2X4UA 1LE9A 4Y1AD 2A73A 4Z7OE 2UY7A 1W8OA 3KPOB 4HKJA 1ORQB 5JDSA 4TNVF 5A40E 4ORGA 1B9ZA 3RKDD 4X8JA 4JANB 1QBML 3K8LA 4YHZH 1B4JH 4FQ1L 1U95A 5DUBB 4NM4H 4MXWH 1B0GB 4LIQL 1Q0YH 1JHTB 1NBQA 3QUMB 4DJMA 2ENYA 3VG0L 1J1XH 3C60C 3DV4A 1LDSA 1F13A 2DQTH 4L5FL 5L8KB 1RJYA 1CL7L 3B9DA 4RFOL 5CD3B 4NQSB 3Q5YA 5JOFB 1OGTB 2ED9A 1N64H 4GMSL 3N50A 1MLBA 2VDRL 1TCRA 4UTAH 3VG9C 1FYTE 2J4WL 5JPNB 2PUQT 4GOSA 2VZVA 5E2WL 2BK8A 1NDGB 3X14A 4XVTH 2BFVL 4QHMB 1IC4L 4NO5B 3O6KL 4UUJB 3GKZA 3ARDC 4NZUH 2VLJE 1QBLH 4FOMA 3D18A 4JRYE 4JZJA 1SJHB 5DEFB 3CVHB 3EGSB 2EKSA 3P77A 3Q3GB 4WI5A 2C3VB 1RIUH 5SX5K 3D39E 2GSGB 3MLXL 3F8UB 3CU7A 2HFGH 2NY1D 5KSAC 5I73C 1R5VB 1E27B 4EZMA 1IQDA 4FZEH 5I1EH 2XQYK 4JFOA 2EE6A 5I0DA 2CDFA 1GGBL 1TVHB 4IRSD 2P5WB 1HHGB 3G5ZB 3V6FB 5I1HL 3WEXB 1QSEE 3VRIA 1YY9C 2RQ8A 1WV7T 1EH9A 1PSKL 2HMID 4P2RB 5HHMB 4QLRA 3WUZA 3FT2A 4R26L 5DTFB 4ZSOE 1K4CB 3FCTB 4PV8B 3MPCA 5AG9A 3AMKA 5TQ2L 3ZT7A 4JFDD 1JZ4A 3VWJA 2BVEA 5DMGC 1JPTH 1NUNB 5CKGA 4WJ5A 2GITB 1U58A 3BWAB 3E1F1 3KXFE 5CLTA 4HWBL 4M1DL 4S1SL 1B90A 4JN1L 3R0MA 5T3ZL 4I0KA 3SCMA 1TVDA 3RU8L 5DRNB 3TBSA 5IB5A 4IEFB 1EO8L 1VDGA 3L5XH 1FFRA 3EDKA 3X3GL 4XPAH 1YNLH 2Z93A 3JZ7A 4PJXE 5JLZA 1KCVL 2NLJA 1S7WA 3GBML 1MI5E 3WD5H 3TGXA 5IESL 5EU6A 5AD0B 2DLFL 3U48A 3C8KA 2ERJB 4M7JH 1S3KL 4RFNB 3V6OA 3MROB 1Q0XH 5H94A 3C6LC 3MGAA 1G7PB 3RL1A 1GZPB 3QDJE 3HUJA 3MJ9A 2WUBL 4NN6C 3RVXC 4OCMC 1IBGH 2Y25A 4HMEA 4M7LH 3DHMA 3WLWD 3QH3A 4KI1A 2OI9B 1YECL 3H9HB 1QLFA 4ZYKA 4KK9C 3L6FB 2VLRD 3DX6B 4G7YH 5E8NB 5ENWA 2VQUA 3H9SB 1TZIA 1S7SA 2DKMA 4LPCA 4RFEA 1QKZH 2FEEI 2PYEE 3CVHL 3GSRA 4KXZH 3VGFA 2HVKB 1NFIA 1KIUA 2EE9A 1T7ZA 4A2LA 4PJ5A 1MHPH 5HJ3A 2XRAH 3HR5B 3TVMA 4MAUH 4UINL 5HGAB 3BH8A 1MCSA 2OTPA 5DHVA 4M03A 3GMLB 5ACMA 1MREL 3QAZB 2X1WL 3IF1A 4KRPB 4P5KA 2AERT 4WHTB 5ESAB 5C0NC 1HXYB 3OQ3B 5A2JH 2VDKH 5IHZA 1VENA 1FQ9C 5EUKA 4FQJL 3UC0L 3WJJC 4R4BB 4GAJH 4FQXA 4ZTOL 5E2UL 3CSYB 4CU7A 4I4WA 4MA1C 4WV1A 2Z31B 1VFAB 4Q9QL 5IWLA 1T5WB 5L88H 2AJXH 1CGUA 4IDLA 4QGTA 4NZRH 4LDEB 4R96B 4M43H 1KLUA 1RVFH 1IM9D 4OFVA 1MFNA 3QIUB 3PP4H 2C7UA 2OJZH 3DTXA 2FLBT 4RZCB 2H26B 3BE1H 4HH9A 4PREA 4P3CH 1YEFL 4TVPE 5TFSL 3ARFA 3DURB 1A7QL 3OKOA 4Y2DA 5E1AB 5MENE 4DK6A 2W91A 2ZCHL 4FQIH 4EDXA 4TOYH 1JGVL 5FA3B 5JW4M 5IVXF 1CIUA 1EJOH 1JCKA 4QYOB 3AREA 2EYSB 2A6IB 1BM3H 3GMNA 1M7XA 2XTJC 3WLBB 4N0CC 2VISA 1RJLB 4NNPH 4P3DA 1YYLL 3BIKB 1OY3B 4GUPB 3ARBD 2ZUSA 3LEYL 1ROWA 1EGJH 1BD2D 4MA7L 3JTSB 3SCMD 3EYSH 5SV3A 3NGBC 1Z5LB 3A6OA 1HI6B 3FOLB 4HCRL 3MODH 2P45B 2W9DH 3ELAT 3OX8A 5F1NA 1KCUL 1UWGH 3ES6A 5IEKA 5HI5D 1J10A 3OF6A 5EU6D 4HEPG 1IGTA 3WS3B 4MD4A 1XR9A 4NQTA 4M61B 2CLZA 3VDBA 3HB3C 1E4XH 4X7EC 2AVGA 2NY0B 3MNVA 5T5NF 1I1YB 5D2NC 3MUJA 3OHXA 5IVXE 1NEUA 3ZHDA 1EXUB 1UXSA 1X5YA 1IQWL 3GI8L 1QQDB 3RQ3A 3P73A 1HXMA 3SE8L 5GZNC 1FZKB 3GO1L 4R0LB 2G2RB 3KPTA 2FHFA 4RAVB 1X5JA 2HP4A 4YDJB 3DUHA 4PS4H 3AU1A 4OLYL 2YBRA 3T04D 1U8HA 3G6DL 1MQ8A 2PO6B 4IOFC 4OUUB 1HCFX 3X13B 1U92B 4PJ5D 1MFCH 1OAKL 4K94C 4M4PA 4OT1H 4BFIB 3TVMD 1EHLH 4ONFL 5I16A 4PFEA 3DYPA 5I8OH 2XWBA 1U8PB 1PY9A 4RMWA 1HOCB 1TZGL 1ED3A 3UTPD 4JLRB 2BSTB 5JTWA 5JORA 3LKRB 1YPZB 5TDOB 4AEIH 3CZJA 3DYOA 4YBQD 3MRQA 5J06A 3VMPA 4YHOL 2H1PH 5I18H 1ND0B 5HHXL 3S35H 3WFCH 2GUOA 4FQXD 4JY6A 4YZFF 1OAZH 2Z35B 4I5BB 3LRSA 2E8YA 2BMKB 2NX5A 1KJVB 5ADPL 4K7PL 3T1FA 2XXMB 3VE0A 5CJ5A 5KSBF 1JPGA 4HC1L 1ZXQA 3OR6A 3BEVA 2Q8BL 3DXAA 1YEDB 2J88L 1R3IH 2NXYD 3MRPB 4X4YB 3O3DB 3MV9E 2P24B 3Q48A 4MNGA 3WNPA 3F7YB 5J4MA 5IMLA 3V6BR 1A6UH 3QDMB 1FO0H 3QDGA 4RGNB 3NCFB 4FXKA 1I9JH 1DQMH 4PJBB 4LKCB 4NSKA 1ZK9A 1J11A 3TBWB 5ACZB 3HG1D 3VXOB 4DQOL 1MCKA 1M05B 4ZO6A 3L9RB 4PJHB 2JE8A 5JQ6L 4JDTH 4QCIA 3ECBA 1HQ4B 2V17H 3GMQB 5HDOA 2J8UA 3ARED 5DT1H 4YNYA 5EU3A 4FRWA 2VDQL 3DI2B 4U1JA 3JWDL 2IPKA 1K8DA 4OB5L 1BJ1H 4KJWD 3IU4H 5HY9A 1JFQL 4K94H 1QVOA 5DD5L 2QQLL 2VXTH 1KNOB 4XVJH 2PW1A 5F89B 4F58L 1SEBA 1BF8A 2IF7A 4J4PD 3VXMB 4I2XE 4ODVH 5IBUG 2Q76B 3PABB 3MRMB 3TCXA 3S3SA 1KG0A 3ZYJA 2X4TB 2WUCH 1QYGH 3OF6D 3QIBD 5E6ID 1VFBA 3T0EA 4YHNB 2KKQA 4JRWA 5FO8A 3KWWA 4TUKH 2CMRL 4Z0XA 2YD5A 4GW5B 4XP5L 4APQC 1J1PH 5J1SC 2H8PA 2NY2D 1NFDB 4MD5A 5F9WC 2NW2B 4OGAD 1WIOA 1U8QA 3INUH 1ERNA 1XF3A 4WW2A 4U1NB 2BXYA 1KPVB 4OD1H 1ZEAH 3BPCA 1N7MH 4Z8FH 3KPQA 3ZE2F 3L95B 1SYVB 1FNSH 3GIZL 2VNCA 4HH8A 2AGJH 2LVCA 3LKSA 4PLNC 5I71C 2A2QT 2VLLA 2GTZB 4TUOB 5GGRB 4LSTL 4YEFA 1VKXB 2AJUL 3L3DB 3WFBH 5FUCE 2Y06H 3HI6H 2FD6L 1DLFH 3WJLC 1BQUA 1T7VA 4NQDE 3BP4A 1IC1A 3CFCH 4I48A 1RK0B 4NUGL 2X4SA 3CC5A 3QWOA 4NP4L 5FUCC 1K4DA 5DJ8B 4JFEE 2YHGA 2R2HA 2D7OA 3EOTL 5KVEL 5HHNB 2QKIB 1KIQB 5FO9B 2VIRA 2X9XA 1FG2A 1ONQA 5K9OA 3LN4A 4LPUA 3ZE2E 4PJIB 3QQ9C 4NO2B 3E6FB 2X4OB 1XGTB 5IB4B 4OCSH 1NC4A 3IKKA 4XWGH 1YEGH 3KYKH 4Z7UF 5GGSB 5LBSL 3AXLA 4XB8A 4MQ7B 5J0BA 3LIZH 5DS8A 3NA4A 3EO0B 3O2WH 3G5VB 4NC0B 5FOJA 5FUZH 3VXRE 3QDGD 2EDOA 1U3JA 5JNYA 4CL7A 1JGLH 3MBXH 1R5IA 5FYJL 5TPWL 1JBJA 2FGWL 3FTGB 2AJ3B 3NPSC 3S34H 9CGTA 1WEJH 4H1LH 2YPLA 3MYJA 1UB6A 5AYQA 4GQPH 3UMTA 4OIAA 1K9TA 2XPGA 5L2KA 1D5BB 2NY7H 1X5LA 5CEYA 1OAXL 3EO1A 2VN4A 4YEEA 1KEMH 2HFEA 1FORH 4YDVB 1U8MA 3PXHA 3B9VA 1G7HB 1WJ3A 2UWEB 2D7TH 5KAQF 3HI1B 3P11L 4GMTH 4NC1E 1IGML 3CSGA 4IIQC 1L6XA 4RAUB 3L5WB 4XVUD 2YEZB 4OGZA 3IFOB 1FGNH 3TJEH 3QUZC 4Z7UE 3BOVA 1FL5B 1H3PL 2APWA 4NOFA 4P9MH 5KBNC 4FP8H 4F9PA 1KB5B 4CN1A 1J8KA 5F96L 4RCAA 4HUXA 4N90E 2H2PD 4XWOC 1ZV5A 3WO4B 5IF0B 4EOWH 1J5OH 2VZSA 3IXTA 3MRKB 5ABDE 5L7XL 4WU7A 1HHKA 5IMOB 4F80A 1T20B 5F6HI 4KJQD 1RZKL 3GKWH 3G08B 3A0OA 1NCWH 5D8JL 1JYXA 4M93C 4P2QE 3VD3A 3V5KB 1QSFE 3L3KA 4NM8H 1JWMA 2J5LB 3RNQA 3P4LA 2MOVA 2IADA 3WL9B 4BFGA 2ICWB 4JR9H 4NCC2 5D70L 1G9MC 1ZLVK 4GRWE 4ZO7A 1ETZB 5K9KA 4JY5L 3QEGL 4ZQKA 2VH5H 2OMBA 2P5EE 1JPSH 3VGAB 4N5ED 4IOIA 3WCYA 1Q8MA 1MCNA 5D71H 3V0VA 3K7UA 3KPLB 4L4VE 3RVUC 3MV7B 3FFCA 1PY4A 4Y16D 1C08B 1U0QA 1WZKA 3WKNA 4WDIA 3OR7B 2NR6D 1YEJL 3QQ4A 3GRWH 5L0QB 4P9HL 4J23A 4G9DA 1I7UB 4M6OL 4OLUL 1A7RL 5E9DE 5ETUB 5KSVA 3LKQB 5IFAL 3CCHB 1TLKA 5CBEA 2F53D 2YUWA 3L3HB 1WK0A 3WIHL 1UZ8A 2DQEH 1INEL 4HIEA 3TJHD 3HLAA 1NFKA 3QZWB 4LLUB 3RVVD 3IJHA 3GUTB 3QUXA 4CVWA 4U6XB 3WHXB 1P5VA 3DMMA 1AY1L 4PJ9D 3S36H 4HFWA 4OGYH 2MSPA 1UFUA 5EH1A 3TP4A 5F3BA 3ZL4L 2QQNH 4NC2B 4PJEA 3ILPA 1REIA 3MV8E 5DYOA 5ISZE 2BSRA 3EYUH 3TYGL 4LLWA 4U6VH 5FYKU 4CADB 3C60B 2PW2A 1KBGL 1DL7L 1G9MH 1KB5L 1HILA 3PP3H 4O2EA 4NZJA 4U2YA 2X89D 2HKFH 1DFBL 5JXED 5L2KD 1VADA 4G8GD 1T22B 3SOBH 3OKYA 1JWSA 1YMMA 2DYPB 4GRWH 4A6YL 1CFQB 3DETC 3TA3C 2VL5B 3VG9B 1JRHL 5TE6H 1X5KA 1MY5A 3OL2A 3PL6A 5ILTH 4DN4H 2Q3ZA 4YHZL 3BXNB 4NM4L 3ARDB 4MXWL 1Q0YL 4WUUE 2AXGB 1DCLA 1FYTB 3S37H 5GRYA 4NKMA 5GXBB 2YRPA 3RWEA 5TH2B 4U3HA 2VLJB 3T1WA 1N64L 4MDJB 4FXLA 4Y4KC 5KSAB 1GOFA 5I73B 3K2UH 1L0QA 4QRRD 5CJXC 2AJYH 4OCLC 4UTAL 2QHRH 1I85C 3L3IB 3QWRA 1CGYA 3FT3B 3FQUA 4LARH 5IQ7L 1OGAD 4H20H 3CX5K 3H8NA 1JWUA 4WI4A 5E00B 4UNUA 5C07E 3T4AA 4G43B 4CKVX 1QBLL 4ODWB 2ZCKH 3VCLA 3F7VB 4LSPH 4XAKE 3TO2B 2XFXB 2ORBH 1KYOJ 4FQCH 2V2WA 1G7MB 1OQOA 1QSEB 1VERA 1WBYA 3HI5H 3UAJC 1LDPL 2X9WA 1RIUL 3J8F7 1BLNA 1VFMA 4N0YH 1QPPA 3L7FB 3TYFA 1T7XA 4JJHA 4X80L 5DJYB 3BSZH 3QO0A 3OPZH 1LEGA 4HJJH 5JZ7C 3NCJH 3SGDH 3FFCD 5JOEA 3GDBA 4XXDA 3I2CH 4BA8A 1JTPA 4O9HH 1OOAA 1GSMA 5D7SH 3VMNA 1XGYH 3KXFB 3RKPA 1JGEB 5CJQH 5DD3H 4Z7VF 3TFKD 1O7SA 4E5XA 4HIIB 4YHYC 3ZHKA 2CRMA 4WFGE 4JHAL 3MBED 3ILQC 3W11C 1ACYL 2GT9A 1JPTL 3D9AL 4HKXA 4PJXB 2BX5A 2CRZA 2WP3T 2RGSA 1DJSA 4GBXD 3C6LB 3O4LD 4J7RA 3GBNH 4CVUA 4Z7WA 3QUXD 4B5EA 4JFQA 2AJZB 3DMMD 2NPLX 5DJDA 1ZTXH 2VWEE 4NN6B 3ZTJH 3VRLF 4C83B 1K85A 3VFNA 2FX9L 4QRPA 4XPAL 1CXEA 2DQDL 3QDJB 2VWEC 1HYSC 4OFYA 4Y8DC 4IRJD 4HPOH 5EB9A 5FFLA 2GIYA 3UTTD 3IJYB 4EI5A 2WWKO 1BFTA 3OKKA 4M7JL 2VLME 4NT6A 3UYRH 3ZKNC 2M1KA 3GIVA 3TEUA 4MMXC 4BQCA 4IS6B 1Q0XL 1DP0A 2P8PA 3IVKA 2FSEB 3DX9B 1TITA 3C9NA 4BKLA 2PYEB 3ZSSA 1YMMD 5CZXC 5FA4A 1LWRA 2M26A 1BBJA 1IBGL 1JTOA 3RAJH 4QRTA 5IV2B 1D3CA 3OWEA 1OL0A 1F3DH 1NLBH 5EIQA 1AQDB 1P4LA 4Z5RB 1UCBL 1JUFA 3BYTA 4V1DA 2PXYD 4JO1H 25C8L 5GGTL 3VFWB 3FKUS 2EYRA 3KPPB 2DQJH 4ZFFA 4GLRI 4MA1B 3DX8B 3P9MB 3DSNA 2VLKA 5MEPA 2HN7B 4KTDL 2LABA 1YN6B 3LRGA 2MPAH 4OCYL 3U36B 3VD7A 5LJYH 2IC2A 1IKNC 2G9HB 4JDVA 3HZYA 3KPSA 2EDTA 3QWRD 4QRUB 5I2IB 3ZTNH 4XCNB 2VDKL 3PV6A 3PE9A 4C56D 3CDGA 3MRJB 5TF1H 4AEEA 4GAJL 1BVLA 4PJ8D 5F9JA 3ARZA 3FB7A 2E7LA 2LQRA 3R06A 5BW7A 1U8IB 1I9IL 1IEHA 3H3PH 3NFSH 4E0RA 3UTZA 4Y4HC 5MENB 2A6KA 4M43L 3L7EA 4PBXA 2XTJB 3WDIA 3PP4L 4X4ME 1ZLUH 2OJZL 3GSQA 5E5MA 3N85H 5EO0B 2CIIA 4GG8A 4O2FB 4LLQA 5BOPA 3MXVH 3BE1L 2X05A 2X7LA 4NRZB 4U6YB 2Z0BA 5DQ9B 1IAMA 1LO3L 3V6ZA 3U7WL 3NPZB 4LSDA 1JF1A 2IBGA 5MEOA 4QXGH 4QRQB 1NGYB 1NCUA 2SEBA 3CFBB 4MWFA 1QFWM 4Q9RH 4O4YH 4JHZA 3RWHB 1IMHC 1H5BA 2LVEA 1ORSA 2XQBL 3HZMA 4G80B 5I76B 1PKQE 1P7HL 1U2CA 3VXTB 1QHOA 4AENB 1FO0B 3QRGL 4LKXA 5D2NB 3O3UN 4C57C 4PR5B 4OQTA 1KT2A 5JIIA 3UPRA 5JA8B 1NJ9A 1I9RH 4K8RL 1RZ8A 1KTLA 5L6YH 2AV7B 2ENSA 4LAJH 3MCG1 1WBXA 3G5XA 1UH3A 5MHSE 1Z9LA 1QTYT 4PRIA 2W9DL 5D1QA 1HHJA 2NY6C 4HDIB 4ZAKD 1CCZA 1AGEA 4GS7C 3WSQH 1U8OB 3QA3A 2DM4A 4XPTH 3UTQB 2FO4B 1RURL 4FFVC 1WFUA 1S7QB 2VQTA 5T1KA 1UJ3A 4ERSL 1T89C 4EUPG 1E0OB 4R7DB 2D4FA 2FJGB 1Z6JT 4XCYB 1I8LA 3SE4C 1CN4A 4F7MA 1MCWW 5CD5C 1X7QA 1BWMA 2Q3AA 3RWIB 1UWXH 4FQLH 5E7BA 4ESKA 4M7KH 3OJMB 1NAMH 2AV1B 4GG6A 1A21A 4DUVA 1MJ8L 4HG4J 4XZUB 4KROC 3QCUH 4HS6B 1DDHA 2ESVA 4HK0A 3V5HB 1OAQL 1K8IB 5E8DH 4PS4L 4CDGC 4S0SD 4LSQH 2FWOB 4TVPL 4EBQH 3LS5H 1FNFA 4ODSL 3GGWB 4O02H 3IJSB 1CD1A 3HZKB 2VLKD 5DJCB 4OT1L 3MACL 1CLOH 5EO9A 1OP5K 5SWSA 1HEZB 5EBWA 2Q7NA 1S7RB 1BVZA 4D9QD 5I8OL 1T1XB 3WNNA 4UDUA 5ANME 2DBLL 1RUQH 3FOMA 3KPSD 1IAKA 4OFDA 2ZSWB 1DQLL 1AP2B 1T7WA 3MV9B 5D1ZA 2H1PL 4J3XA 5I18L 4YHMH 1W0WB 4JM2D 4ZOBA 3RDTA 5I1AA 4NJ9H 3MX0A 4NNYB 4MQXD 1OAZL 4WFEE 5IJVA 2Q20A 3T8XA 5TDNB 1IEBB 4OF6A 4MA8L 1KTDA 4HGWB 1XAUA 3RVWD 1MCOH 4S10A 3PWLB 5D7JA 1EZVY 2JB6A 4PJGA 1R3IL 1XF5A 5DQDH 4WCYL 1OLZA 1TETH 3SKUD 4QWWC 2Z91A 3DO7B 4H5SB 1NCBH 1SYSB 2YZ8A 1FO0L 2BCKA 1HSBA 3ULVD 1I9JL 2EYTA 1H9VA 5F88A 5ACLA 1OW0C 2QL1A 2VZOA 5IHLB 1TNMA 5GHWH 2RAMA 5DGQA 5T3XE 2VERN 2N56A 1BZ9B 3CFDB 1CBVL 4MNHB 4KZEL 3EHBD 4JDTL 2EECA 2V17L 4R3SB 1D9KC 2XOTA 2F8XC 1MVUB 5DT1L 2EC8A 1NDMA 2D7QA 2APVA 5T5NG 3VFVA 1AC0A 2R4SL 3IAGC 4KUCD 4I2XB 4APQB 2VXQH 1NGWB 1BZ7A 5F9WB 2XA3A 1G7JA 3MLSL 2VXTL 4E41E 5JIKA 2R39A 2DTSA 1T1YA 4B50A 4RISH 4ZDHB 4HIJB 4XT1C 6FABH 3MRBB 2V9QA 1R3HB 1X5FA 1K2DA 3SDXF 5D7KE 3TH3T 1RIHL 4M3JA 1OD7A 5D1QD 4NHUA 5DVOA 4ODVL 5I15L 3SHSA 2EDNA 1FZMA 5H37H 2P8LA 5I71B 2WUCL 4LP4A 4KXZI 2H6PA 4UOW0 1W72H 4JG1L 4J3WA 5F1SA 3ARRA 1WITA 4KV5F 5DD6A 1JYVA 5CSGA 1EFXA 1IAIL 1JGDB 2JLLA 1F11A 2BRQA 3INUL 3FHAA 3UZVB 3QUKB 3ARGA 3MJGX 4OD1L 3TIDA 1ZEAL 4MDIB 1N7ML 4Z8FL 2EDWA 4Z6AT 5I1KH 3GSVA 5FYLH 4HT1H 1NGPH 3W5MA 1FNSL 5HI4D 4HPYH 4S1RH 4JZNB 3VI4F 3TF7C 2C1OA 1CGVA 3GB7B 3SJVE 1BPVA 5EO1A 2WBJC 4XAWH 1FN4A 5C0GA 5B38A 3EOAA 3HI6L 1AO7E 2BNUB 3W9DA 2A6DB 4R7NA 3SKOB 1DLFL 5D5MB 2OBGA 3PWJB 1ZOXA 2DQCH 5HI3D 3MREA 4DGIH 1UQSB 2Z4QB 1KN2H 5JIHA 4BFBD 3QNZA 1INDH 1UGNA 2DQIL 3HE7C 4L29B 1FNAA 2V6HA 4NWTH 3S88L 5E8EA 2AABH 3REWA 3V8CA 5D1ZD 4LCIH 3NPSB 5CCKH 3OKMA 4AT6A 5EC1A 1FVDA 3VXRB 1CDIA 1FVCA 1NGXA 1TZHA 4OCSL 3D25A 4JB9H 4G6FB 4XWGL 1YEGL 3KYKL 3VI4E 1ZSDB 2GJ6A 3W0WD 2DTML 2GJZB 3HRZB 2YD8A 1BIIB 4W4OC 3LIZL 1PZ5A 2J8HA 2BJML 2EO9A 4PBVC 1I7ZB 4A6YA 5E5UB 3QXDA 2W65A 2E7BA 1HHIB 4HUUB 3BW9B 5C0CD 3RTQC 3MBXL 4UQ2B 3KPNA 1T1WA 3WS6C 1T0NB 1WEJL 4HSQA 5HD8D 2H32H 4NFCA 3BPNC 5DK0B 4NQEA 2J3SA 2NY7L 4Z7UB 3BZEB 1AIFA 1AGFB 4OTXH 1B2WH 1FORL 1F6AA 4XI5D 3K1KC 5DD1H 4R90H 1E4XI 1UEMA 4GMTL 2AK4E 2R1YA 4TTDC 3S96B 4F7TB 3IDYB 4Y19D 3TT1H 2DOCA 4FN0A 5DI8A 4Y1AE 2UYLA 1CFNA 3VXUD 1CXLA 3E8UL 2K7PA 4Y4FC 4YXLL 1EX0A 1EEQA 5BS0B 3CIQA 3MGTB 4P9ML 2W60B 1JMXA 5FDWA 5FCUH