5AB1A

Complex of the fimh lectin with a beta-cyclodextrin c-linked alpha-d-mannoside in cocrystallized orthorhombic crystals at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
molecule tags Cell adhesion
publication title The Anti-Adhesive Strategy in Crohn'S Disease: Orally Active Mannosides to Decolonize Pathogenic Escherichia Coli from the Gut.
pubmed doi rcsb
total genus 38
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5ab1A00
5FX3A 5FLUA 2JMRA 2JTYA 5LNGA 1N12A 4LOVA 4CSSA 5F3FA 2W07B 2WMPB 3MCYA 1QUNB 4XO8A 5ABZA 1KIUB 3JWNG 3ME0B 5FS5A 4X5PA 2J2ZB 5F2FA 5AB1A 3ZPDA 4CSTA 5AAPA 3RFZA 5CGBA 4XOBA 4XO9A 3BFWA 4BUQA 1UWFA 3BWUF 3ZL2A 4AVJA 5IQOA 4AV4A 1PDKB 4X50A 4AUJA 4AVIA 4AV5A 5IQMA 2XG5B 4XOEA 4AVHA 5JQIB 3JWNE 5IQNA 4ATTA 1TR7A 4AV0A 2UY7B 3ZL1A 4J3OF 2XG4B 4X5RA 5LNEA 3BFQG 3JWNH 4AUUA 4CA4A 4XOCA 3SQBB 1KLFB 2VCOA 5FWRA 4XOAA 4AUYA 4AVKA 1N0LB 1ZE3H 4J3OG 4J3OH 4XODA 4X5QA 5AALA 2UY6B
chains in the Genus database with same CATH superfamily
2XZCH 1TU2B 1RJCA 1OGAA 5EIIA 2F7RA 1GXEA 3LOWA 1IC5H 5IGXH 3ARBA 1OK8A 5DURB 1RUKL 1XGRB 2J2ZA 4XMPH 5C8JA 4YXKH 1R34A 1BQUA 3JVGA 2H8PB 4Y1SA 4UWQB 3ZT6A 4GFTB 1LP9F 5I30L 1VKXA 1IEAB 5ANHA 1MI5B 4CC1A 1UZ6F 3FJTA 1M2VA 2DRUA 2ZG3A 3HC4H 4FQ1L 3QDGD 2K6YA 1O7SA 4NB7A 3H0TB 3IJYA 4C58B 5I0XA 3EF7A 4C47A 7FABL 4KDVA 4XPGH 5K39B 3OZLA 3V0GA 3S37X 3NMEA 5E4AA 2NY2D 4NUGL 3KYOB 3QNXB 1KXQE 1CIDA 5HHME 1HILB 1HDMB 2AW2A 3A6BH 4F8QA 3KM1A 5FCUL 1YPZE 2F53A 1GH7A 4FXGA 4OQTH 4P2RB 3ALWA 1FZJA 4UT9L 4UZGA 1EO8H 2X9WA 1P6WA 4H2CA 3KBHE 4JY4B 5DQJB 2FB4L 3WJMB 3MLPA 1KCVH 3WU1A 1RURL 1SHWA 2G75A 1ZY9A 1ML0A 3P73A 3TVMD 3PJNA 1G7HA 3MJ9H 4DNLA 1DUYB 1F4AA 4GKLA 2E7LC 3GS4A 4X9YA 2MHAA 4F7TA 4AM0Q 2BRQA 4ZXBD 1MJUH 1WK0A 1J8KA 1T5KA 4JPKL 2C7UB 1NIDA 1ASQA 4N68A 1TNMA 3GLDA 5H2BA 2QT6A 1HCFX 4TYUA 3CFTA 2FX9H 1P7QB 3D25B 3ILDA 2YAEA 4UM9D 5DGRA 3ZZLA 4UTBA 2JKTM 3GM8A 4FQXD 4ZSOA 3O3AB 3L9YA 4CGUB 4PRIA 2A99A 2IV9A 2W60A 3A6CH 1IM9A 4XVOA 3LKRB 5IUCA 1H15A 4Z7VB 5HYJD 3A4EA 3AAZA 2XVLA 5E0QA 4M8UA 2R1XB 1NANI 2HFEA 3F64A 3G5XB 3QIUD 2V2XB 1N0LA 1DZ0A 4I9WE 3SD2A 3UJTH 4NNYA 3QQ4A 5HTSA 2FWSA 4XOBA 4OTXH 2ERJC 3HR5B 4K71B 1EDQA 2J25A 3VFVB 2CJUL 3N1FC 5CHNB 1JXFA 2NSQA 1P7KB 4HP5A 1T83C 3LKSB 5TF0A 3T3MB 5EF0A 2AQQA 2V5RA 3TFKD 4ONOA 4ODWA 5E8DH 5F0MB 2CHZA 4P5TD 2YMXH 4NZTH 1T6BX 1HXYB 2VDRL 3CLWA 5D1ZD 3DK0A 1I4FB 4J28A 4XMKH 2DQFA 1G9EA 2XWEA 1LO0L 2NLJB 1FFRA 2WYZA 3CE1A 2WD0A 1GJWA 4PGCA 5DQDH 3V79C 3S97C 1SM3L 1XR8A 3ROLB 2WSKA 3LQMA 3IDIB 4HZ1A 2O5NA 3UBXI 4PM1A 1RZJL 5CINH 2QLYA 4DVBA 2ID5A 1C5BL 1ND0B 3GBDA 3QQ9D 1A4CA 2AJ3A 4UOJA 1HN1A 3X11A 3QG7L 2MOQA 4WWKC 4LAQH 4XGZA 2NY3B 1BVLA 1BQ5A 4LZKA 4IOSA 4YX2L 25C8L 3RVTC 1G84A 2DEWX 3KPQB 3VI4E 3WUWA 1I4FA 4CAGA 4HX1A 2R1WA 1S6NA 5CP7A 4LU5L 4JFZH 1P4BH 1PX4A 1X6NA 4DAGH 3RFZB 5LBSA 4L37A 5LNDA 4RX4D 1GOHA 2CU9A 2DLHA 1MAJA 1IKFL 1IT9H 2IWFA 4EDWH 5D2LE 2CRYA 1WH0A 2OR7A 2AJXL 5AVRB 5AOIA 4HMCA 1FDLL 3SYAA 2R1YA 4J3SA 4WV1A 3D3VD 2OM5A 3A67L 3O8XB 2R0KH 4Z95L 4TSCH 5TK4A 3CN4A 3HC4L 4LPWA 2V3FA 3AGWA 3S34H 2MJWA 2XKUA 3TH3T 4LMQI 3UTSA 1CICA 2A73B 5HYFA 3VI3A 4OM0L 1I7TB 4P2AA 1FL6A 3NUKA 3PHSA 5E95B 1YEJH 5F96H 5GS2H 4N2MA 1EJ6A 3ZGIA 3R1GL 2OYLA 3WLWC 3KDMB 3NDZE 2L4OA 2DM2A 2VDPB 4JCWA 1AGFA 1RL1A 1U92B 1Q9OA 3L3OA 2R2EA 1HIML 2B1HH 3PV6A 4KTDL 5IVXA 4IGBD 3S37H 4XB3A 5MERB 5T3ZE 2IFFH 1MY7A 1UWXH 2DTML 5F1NA 4NJ9L 2EDHA 5BRZD 4CN1A 5GRUL 3LXBA 4GI8A 5E9DE 3WGUB 1RPUA 4A55A 5EBWA 5I16A 4XE0A 1S9KC 1NDGA 3F6LA 2PPDA 5IBUG 5LG1A 5IQMA 3DOIA 5CLYA 2HLAB 3QDJB 1O75A 2M2DA 2D7TL 2H3KA 2LU4A 1FORH 4KC3B 4MA8H 3AG1B 3BEWA 1UH3A 4CVXA 2D31B 3FT4A 1U0QA 3VDAA 3SE9H 2ALWA 4PD4K 5AAWC 1X5IA 4ZMVA 4JM0A 2FYYB 1NEUA 3K7UA 3HLAB 5TTRA 5L8LB 3RY6C 2TRYA 3PGCA 4ONFL 2W81C 3ASWA 3T8XA 5FECB 1PLCA 4JO1H 3CBKB 3HMXA 3NPZB 4QI3A 3AT8A 4LRNH 4XO9A 2IPKB 3E3QC 4QT5A 4KH9A 1PDKA 1AE6L 2CUAA 2WXGA 4ZX6A 3ZKMC 5F9WC 2QTEA 2ADYA 4FABH 3E6FA 1IBGH 5GJTL 3NGBB 3W0WE 5ID0A 2YEQA 1YN7A 3OKOB 3FFCB 4MZ3A 2F58H 3NVQA 2J5LB 2OMZA 3EBHA 1G7QB 3ATEA 4OD2A 4PCYA 3RX5A 4LSVH 4WTXA 4E9TA 1TO5A 5IM7B 3B3BA 1MFMA 1F3JA 2OW6A 2APFA 3D4CA 4LL1A 1XZ0B 1EEZB 2PYEE 5T3XE 1IJ9A 3NJLA 1N9PA 3RWIA 1RIVH 2ESVA 1NGQH 1JMXA 5DZLA 4ZAKD 1JJUA 1J10A 3ZKQD 4WNJA 4XOAA 1I7ZB 2P5EB 4G7YL 1INQB 1YN7B 2DL2A 1ZA6B 3CZLA 2EE2A 4JZJA 4TUJB 4CILA 5HHMB 2CNYA 5B38B 2BSRB 3MNVB 3MU3A 5EO1B 4RFOH 2BNRE 1TVHA 4XNBA 3TA3A 5AKTA 1R5IA 3MROA 1DJYA 4FG0A 5HY9B 1PS3A 1MRCH 3ES6A 1XIWA 1E4JA 1U21A 3QARA 4BSVA 2H6UA 3MI6A 1JDCA 1YUHB 2GHZA 4LF3B 4GW1B 2BFVH 3L5WB 3IFPA 4YXLL 2P49B 4BCXA 3FN0H 3CC5B 1L9QA 2J1YA 3QUKA 4L9LB 5L0QC 3ZKSD 4U1KB 3D2UA 2ZKMX 1CK0L 2FGWL 1F5WA 5HHQB 3P3TA 5EF1A 1KIQA 2N1KA 4KRMB 2R4RH 3ULUF 3AZUA 4EDWL 3D30A 3M6DA 3GJFH 4FC3E 4IOIA 2BSDA 1Y0LA 1T21B 4OI9A 2V8MA 3INUL 4KGLA 4NCDA 3RIKA 4PS3A 4DW2L 1SEBB 5KSUB 5ADOL 3KWWA 2E9GA 1SBBA 3B8YA 1NFDA 5DZJA 5IVOA 1Q72L 3DX7A 1LLAA 1H6TA 3L08A 4AXWB 3QYMA 3NIGF 3K2IA 5SWZD 5F8RC 3RWGB 1BIIA 4BKTC 1RUPH 2FJHB 3LZFL 4Q6IA 1KB5H 3HHMA 5JMOC 4RGMB 4KUCD 2ISDA 1KENH 1AS6A 2QVTA 6FABL 1XD0A 4WK4B 2OMVB 3V6FB 1XGUA 4RZKA 3VJ6A 3F12A 1YMMB 3KPOB 5GZOA 3APDA 4WO4C 3TTSA 2XSKA 3Q06A 2DW5A 2H0EA 3MHZA 3US1A 3CK0L 3PNWA 5DVNA 3RB5A 1L5GA 3S2AA 4ZMYA 5I1LA 3QH3B 4FTVA 1OLLA 1BEYH 2DIAA 4XC3L 3ZMEA 1C16B 5E6RB 5AD0B 5J1AB 3LRSA 3TBVB 3C09C 2FWUA 3QULB 5F97E 4X9GA 2LLGA 4X6DE 3K74B 4YBHA 2UX6A 5JA9A 4XMPL 3FQUA 2V6HA 4UV7L 3T6QC 3MRHA 2N3JA 3EFFA 4UDUB 4QRQA 4JFDD 1BVOA 4F7PB 2E9IA 4PG9A 1MCIA 4KHXL 1N8ZB 4GKOA 4MDIA 4Z0XA 1AZBA 2WN2A 4IEFA 3P9LA 5CKAA 5JIPA 3VXUD 3MJ6A 4ZS7L 5F7FA 1X5AA 3RVXC 1BQHG 1IBGL 3H56A 3NRQA 3E1ZA 1P7HL 2VLKE 3PWVB 3UPCA 5DUML 1ZD6A 2IOIA 4WHTB 3HE6C 1BJ1H 4G9FB 4HWZA 5CM1A 2BSSB 3OAUL 4XAWL 3CSBA 3U0PB 3M46A 2FYVA 3QIUA 1MCQA 1G6RB 5D2LF 2KQMA 5HHXL 2EIDA 4YHOL 1M05A 4DGIL 3VRLF 1ZANL 1KCVL 1ZIAA 4UB0L 2PP8A 3W37A 3MRQA 4PRID 1J9QA 2YPVH 3AG3B 3TO4B 1ZVSA 2ZUXA 4Y1AE 2Y1VA 4KKLC 1RERA 4NXSA 3FOLA 3MN8A 5F3FA 2VDRB 3OAUH 1NCOA 3K2MC 1V55B 4PG2A 3SJVD 5L2KB 4ZRGA 2DLTA 4PVMA 1JNHA 3KJ4C 4TUKL 1DDHB 3OKKB 2F7OA 5IQ7H 1K8IA 4X7TB 2IFFL 4C56B 2OZ4L 4BQ6A 4M6AA 1X7TA 4O5LH 3UZEC 3QUYA 4LSSL 5A43C 1V7NL 4PB0H 3ULUD 3K2UH 1Q1JL 3LHAA 2KZWA 3LRMA 4J27A 2AQSA 1OL0A 4X6DF 1F13A 2DQDL 4FULA 5F9JB 1D7CA 1JV5A 3RWFB 3I2CL 1I7UB 2WY3B 1GVIA 1T2XA 3VXTB 1J9TA 1CGXA 4PJ9B 4D0DA 3PDGA 5K9QI 2MTAA 2QSVA 4QRTA 4PI0A 3TA4D 1K8DB 1P6FA 3HS8A 1OD9A 4H7VA 1VKXB 2XVKA 4N0CC 1VSCA 3H3PH 3MJ7B 1SDYA 3HNTH 4L8BA 4NGHL 3VO0A 5DUBA 1T6VN 3HG2A 2V8LA 3BESR 5C09D 3HRPA 3DI2B 4NZRH 1BREA 3P73B 3TEZA 1HU8A 1PJ9A 1H8LA 4TLTA 4BM7A 1N6QL 4CJ1A 4GXVL 1LEGA 5EO0A 4MAYB 2DF3A 4JW3A 2FLRT 2VL5B 3EGDB 5KANG 2BVYA 3FH7A 5EPMB 4DGVH 3C5ZA 2P45B 4U1SB 3ZTNH 3LKPA 1TTAA 2AEQL 5E5RB 4LSVL 2ZWNA 2BOBA 1UT2A 3LN5A 1RLWA 2VDML 4ODSH 2C34A 1X5ZA 1QFOA 1KLFA 1UEYA 2LTQC 2A77L 4P2RD 4RA0C 3QXDA 4MHHG 5SWSD 3TA3C 4TSBL 4FEMA 4R7LA 5JW5B 3MUZ1 5JHLL 4FG6C 1IAIL 3WL9B 3SE9L 1U8CA 3DXAB 2Y2TA 5D4HA 4G9FA 4HWZB 1DDHA 4MVBD 4DPCX 4AQ1C 3DV6B 1FJ1B 1E65A 1G94A 3ULUE 5KTEH 2NW3B 3HC3H 4CMHB 4PR5B 1FAIL 2BIHA 1KCSL 5DEFA 4JDVB 4NKMB 5IHBA 4L8CB 1BLIA 1R75A 1ZVSB 4TQ8A 3BP5A 3OKLB 5KVEH 4PBDA 5AKSA 2DN7A 4C4KT 1CGSL 1HESA 3S88L 4PJ8D 1T0NA 5J12B 1J1OH 2WZPD 2A83B 3O2WH 4GXFA 3B7UX 3OVUB 1MFVA 4BGLA 1EH9A 3CQFA 3MBXH 5DRNA 3ERXA 4KRPC 1XF2A 4R7DB 3TO4D 1OPOA 5FM5M 4K7FB 2CLZA 2FEDC 4YSPA 5F44A 3GBML 4AL8C 1GW0A 5I71B 2Z92B 3I85A 3VFRB 3H4HA 4LRIA 3QQ3A 1HJCA 5TJWK 1JGDB 1QLEB 2AK1H 4JFSA 2BRRL 1WDAA 2FBRA 2DLGA 1EO5A 1MOEA 5LQBH 3L95A 2MKLC 2QPEB 3V52H 1BVLB 3M1BB 1WJ3A 4NN7B 5IW1A 4X42A 4YXHL 4NRYB 5JPNA 5I28A 3BGFC 1ET7A 4B7IA 3HBGA 5CIPH 4PV8B 3NRFA 2Y5EA 4RDQG 3Q6GH 2ZX9A 1J5OH 5HBBA 5J6HB 4HFUL 2CLRA 4AGOA 1LTXA 2EYTA 4Q4IA 5HYJA 1O9VA 1J9SA 1W15A 2B5IB 3VWKA 1NINA 5TQ0H 3RWGA 5DMGD 1KB5L 1E90A 5JW4Q 1KWKA 1D5BA 2E59A 5L9DL 2PR9A 6CGTA 3QZMA 5FGBA 5A7BA 4QJ5B 2H41A 2UXVA 3CU1A 3MLTB 1I7RB 1NOLA 1XB8A 5GJTH 1B4JH 2AV7B 1FLTX 3QCTL 2X28A 2H2SC 2UZIL 4QOKE 4ALAL 5HHPB 1YN6A 1YEIL 1CLZL 2Y1ZA 3C5SA 2J8HA 1FFPA 2WCGA 2HTLC 1LDPH 3NBNA 4JR9H 3FQWA 3CFJA 4G7VL 4Y2LA 4H0IA 4I77H 2WQWA 4J2QA 4POUB 3T77A 5I6XB 5JOFA 2I7OA 3V0VA 1F02I 3MRLB 4RGNC 3OX8A 3MO1B 5I1AA 3QB7C 4OIFA 3NCMA 3MRRA 2WAQA 1AR2A 4WI2A 4XH2A 3HNTL 1IBDA 1XMWA 2B0SL 3G04B 2Q10A 2Z8RA 1I1FA 3BO8A 4MRBA 1T0PB 4MJID 2QKIB 4PG2C 5HSFA 1SN2A 4OGZA 1OM3L 4ACPA 1PVHA 1MW3A 4L4TA 3VGGA 2A83A 3GLAA 4AOFA 4W4NA 1E2WA 4JFDE 4KV5E 5DRXB 3W2DH 4IKKA 1OAKH 3IDGA 4WTZA 3QQXA 2YUZA 3W9DB 3L6FB 5DA0B 2LVCA 4GBXD 5T1DL 2KZBA 1P4UA 4U7SA 3V0JA 3A67H 1MCOL 3MODL 1KGWA 4NM4H 3AM8A 2ARJQ 1WA1X 3A4DA 1BQHB 4PJDF 4O02B 4XPFL 5HHXH 3PFQA 1KG0A 3AVEA 3DUSA 1ANUA 2PTTB 2YPVA 1S7UB 3ARBC 3BLKA 5I6OA 3QA3B 3QJFB 3MZGB 3DETD 1D7FA 2VABA 4MTMA 5C0BD 4QD2E 4NP4H 4OJFH 3IF1B 5F9OH 3VI3E 3O11A 2P8MA 3X3GH 4K4KA 4K9JA 3D25A 5I73B 5KYUB 3AXLA 2P7TB 3UTQB 3NJJA 1QR4A 1QW9A 2X0WA 3FMGL 2ZICA 2WZ6A 4MLSA 5DK0B 2VLJB 1NQBA 4QRPD 4CVXB 3RGVA 2Y24A 4R9HA 1QWNA 5FWQA 2YQ2A 2V2TB 1QSZA 1U8IA 3VSQA 1R3JB 4GP4B 3HG1D 4XWGL 4FYSA 5LG6A 1N7ML 4IBLT 4FKEA 3GS7A 5KVDL 1MHEB 2MHAB 1F58H 4L48A 2EACA 3IS1X 1NUDA 4UOZA 1MHHB 4Q89A 3QUZB 1A7PH 5CUSL 1VGEH 4D0CA 3KCPB 1QRNE 1D6EA 4OLVL 4PREA 4NCC2 5C92A 2PXYB 3BKCL 2MPAH 1JZEA 4W6XB 5KYUA 1BZ9B 5KW9H 4KY1H 2C26A 3JTTB 3RNQB 5I6LA 2YQ3A 4B96A 4HJJH 3GPEA 1LE9A 1TTFA 2EE0A 3E6HB 1A3QA 3KLAA 5ICZA 4ENZA 2VQ1A 3D33A 3ZE2F 3FYIB 1NPNA 2HJKB 1XXFC 1WAAA 2AABL 3FU8A 3O8XA 2W9LA 5GRVL 3RTQC 4AK1A 4WSKA 5SV3A 4BK8A 2EXYC 5B39B 1D6EB 5B1JA 1YEEL 3MR9B 2SEBA 4ZMQA 1Q1JH 1DQML 1U91A 1A8ZA 3SKNB 5SWQB 4XPBL 3GMLB 3O4LA 4QWWD 2NY2B 5CEZE 1RPKA 3EDDA 4MNQD 5JOPD 1GYWA 3CD4A 4F7KA 1KT2B 3FQXB 2FJUB 2FECI 5GHWL 3T04D 3BRGC 5HDRA 3NIFB 1NANH 3R0NA 3GSXA 2GKIA 5DUPH 2RBLA 1UD8A 2KQNA 1IVTA 4Q7DA 3QCUL 5KVFL 3S8GB 4GG6F 5DMJB 5IV2B 1FE8H 3B5HA 3HZMA 4X7FC 2BH0A 2YAPA 4Y5XC 4U1KA 4YBLC 5DYFA 4AUYA 3A4FA 3LAFA 4L8SB 2AMUA 3QSKB 4NQTA 4NZRL 5C09A 4M7ZB 1KYOJ 3OL2A 1DDTA 5GRVK 2XFGB 4RGND 3WHXA 3VWJD 2XZQH 1FIEA 1ZJBA 4PGDB 4IBZA 5JW4R 4JM4H 2XT1B 1CO1A 3V4VA 1L3NA 2ZP9A 5AUMA 4MMXA 3V0WL 1GYCA 3FU3A 4NP9A 5IBLD 1GGBL 1RSYA 3THMH 1I9JH 1M3JA 3SE3A 3QGVA 1XAKA 2Z92A 5H4ZA 1J8RA 4P5TC 4LEOA 2BIPA 1CZ8L 1HKLH 2C4FU 3K2UL 2A0LC 4M5SA 4ODUA 4XMZA 3UTZA 2UUDK 2XKNB 4Z3TA 1M3IA 1NMBL 1Y7VA 1ULVA 4EUPB 5CCKH 5LQBL 2MOVA 2OS7A 2VNCA 4N2BA 4W81A 1WVZA 5FFGA 2YOCA 1ZLWH 1DVZA 2X2YA 3KPRE 4R7VA 4WFHD 5EUKB 1I9JL 4NKDA 4P46D 1M57B 4PGEB 2P5WE 3SJVA 4AW7A 1VFAB 3QUZD 3IPFA 4TNEA 1JK8A 3V6FA 4EIZC 1G7QA 3FONB 3GLZA 5J6HA 2KHAA 4P5MA 2C3XA 1UOLA 2IALA 3V0IA 3MV8A 4M9OA 1KDJA 2LLLA 4TSAH 2WXNA 1BQKA 3WNOA 2FX7H 1L5GB 4JRXE 2ZWSA 4H1LH 2J6EL 2XLLA 2Y0SA 3QI9A 1BG1A 5HDBF 4QWWC 1MDAA 3C6SA 4B9IA 1A7RH 3JTBA 4NC1E 1P0SE 4OUUB 4GMSL 1V7ML 4ZPVA 3QUXA 3MOBL 1YEIH 3WFCH 1ESOA 3HB3D 2HPTA 4FFVD 4QGTA 3SJVB 3WN6A 4U4IA 2C3GA 5FHAH 1W8NA 2VDQB 5AW7B 4X6EA 3CFIC 2VXVH 3VVVA 4OGYH 2D31A 1WZAA 1O6SA 5F8QC 1QRNB 1MCFA 5DTFA 3VFTA 5AOJA 5EO9B 1R5WA 2PWEA 4S1RH 1F90L 1N59A 3ROOA 8PAZA 1X9UA 4JRYE 5ISZB 3NOIA 5BZXA 1YEHH 2XOTA 3LB6C 3QNZB 3FH8A 1CWVA 4WIQA 1GSMA 4FNQA 3WFCL 2CDGB 3IFPB 4UV7H 2XVBA 4NWTH 3SGKC 4LFHD 4IDJL 3UYRL 5SX5H 1EGJL 2A74A 4JFVA 4I18C 3HZYB 1MJ7H 4AV5A 3S8FB 2OSYA 3NACH 3RDTC 1AFVH 2GUOB 2WB1A 4B41A 3ECBA 4PBXA 2BCKB 3H54A 4M6OH 4HC1A 1QNZL 2VXTL 4HJSA 5KBLA 2IPTH 1M7XA 1OAUH 4S11A 4MJIE 43CAA 1R5VA 4I89A 3P69A 3VXOB 1NBYB 1XTLA 4PVLA 4I2XA 3CFDA 4Z76B 5BPPA 3CGTA 5EU6E 3FZUD 4GLRH 2DJUA 1TLMA 4RAUA 5IG7B 3OBAA 5FV2A 5AZUA 5H4YA 4BUGA 1YG9A 2DQIL 2GK0A 2J4WL 4WI5A 4HOXA 5D70L 4QMEA 3GMNA 1R3KB 2FO4B 3U2SB 4X99B 2W9EL 1H3UA 1YO4A 3HB3B 1B4RA 2Z0UA 2Y07L 3S3DB 2X6AA 3U0WL 5DQ9A 4LLVB 1TCRB 3QWOB 4GRLB 1MRFH 1T1WB 4Y4FB 4DKEH 3ARGB 3Q2WA 1QSEE 4M7LL 1F00I 2OZ4H 3A6OA 5C0EB 1E5YA 2MTPA 4XWGH 2XI9A 4FA7B 5BQ7B 3CDGB 3QJOA 5B1CA 1OP4A 4JFFE 4LKXB 2GTZA 3EJZD 4Y89A 4KOCA 3WDJA 2V7NB 4U6HA 1PFCA 3SBWA 3RUGF 3F84A 5F7DB 2FD6H 4NQSA 2ZAGA 4RCAA 3IDIA 5EU6B 5J13C 1UA6L 4U3SB 1UADC 2ED6A 4LPVA 3RNKA 1S7UA 2AP2A 3CNKA 3QUMH 5HHNA 2NNFA 4Z7QE 1KYOK 2MNWA 3MV9A 4BYHA 1SN0A 4JJHA 1N10A 2DQGH 5DURD 1FLRH 1QSEA 1TQUA 5C0EA 1QSFB 4PV9A 3BP4A 1CU4L 2DI7A 3CDFA 5D2LA 3VM7A 1URLA 1OAYH 4U7MA 4Y5XA 5IF0B 1AXSB 3IFOA 4XVSL 3UYPA 4OZGB 2D8KA 2BWQA 3LKNA 5A6LA 2ZUUA 4B27A 5JQHC 1QVOA 2WLLB 3VFUB 5CD3B 2HFFA 4GMTH 5IVZA 3IKKA 5MERA 3T0EE 2ATPA 4XNUL 1C16A 1URIA 5D1QA 4KNUA 3NJIA 5F7NC 5TDOB 4NAQA 2DMHA 4JB9H 2PWFA 4IBTA 3K0WA 3PGDB 4R5XA 2JSFA 1T5XA 3NJVA 3IWVA 4OJEH 3VTMA 3U82B 3MRIB 3QIWD 4M62H 4NPYA 5C07D 4JFPA 5FA3B 1SDDB 1AS8A 3SE3C 1G7IB 1I1RA 2QQLH 4FQPA 5EIIG 5AB2A 3MRFA 1FNGA 2A73A 3QRGH 5E24E 1CFMA 1ZV9A 4JQVC 3OB0K 1XF3B 4JPIA 5LBVA 4Z0XB 2JELL 3E38A 4HFWA 4G8AC 4MD0A 4APXA 3DGGB 1SLXA 3W3BA 1JYXA 1CGVA 1MNUL 3PWPA 4S1SL 2JE8A 3Q6FA 5A16A 4YUEH 2AQTA 2VWEC 1GA2A 2L8AA 1DBJL 2D2CC 2X4PA 4W9CC 4LB8A 2VDMH 4H40A 3OPZH 4PGZA 2R7EA 1CS6A 3WTXA 1KTLA 3CJJA 1ICTA 3CFBB 3WE6B 1O7DC 3AREC 3EAKA 3PJSB 1S2EA 4XP1L 4HF5L 4BWUA 2ZPKL 4GSDL 4YX2H 3Q9QA 5TDPA 3ZKXB 1LHZA 4KQ4H 4KTEL 4BFIA 1IAKA 3RHWF 3SBPA 3MUJA 4QO1A 4X6FB 5E70A 4M4RA 2CQVA 5AYQA 4L3EB 4OGAC 2FVNA 1KF9B 1MVUA 4QRUB 1UA7A 4G80B 4M8RA 5DYOB 5HYJB 3ZBMA 1ZVNA 2NT0A 2HFEB 3B2MA 5D6CB 5DS2A 2W0FA 1CG9B 5IHWA 2R29L 2QVIA 4M6MH 2ARJA 3BZ4B 4Q8BA 5JOFB 3CTTA 3EW3B 2VR3A 4KKCC 4JL2A 4YZFF 5D55A 1CT8B 3OKEA 2BXZA 4H25B 3BX7C 5DVMA 1MAKA 2OMYA 4JFFA 3RWHB 2DWEA 2NY4D 3G6DL 3BD5A 1I3RB 1EHAA 2IAMA 4N2GA 5TDPB 4EI5C 2VXSL 1P5VB 3BKCH 1OEZW 3VFPB 4DP1X 1JK8B 2V33A 1E0OB 5CJ5A 1E2ZA 1TJXA 4LLYA 4JFPB 5FA3A 1N4XL 4ODWB 4JPSA 1UOWA 2D73A 3DV4B 3HFMH 4DP8X 4PJ5B 3NJFA 3QPXL 4KTDH 1MIEH 2ATAA 5TDOA 3QDHA 4PJXE 3IYLW 2V17L 1A1NA 1A6WH 2X88A 4U1MB 5I8CA 3N43B 1L0YA 2XXFA 2YRBA 2PP7A 3BAJA 4UT6H 5C0BB 3D2UB 3NSFA 3RVVD 3T8VA 3NDYE 4FA8A 2DQTH 4GT7A 3EOBB 1XGPB 3ARFD 3GHPA 3HCVB 3ZE1F 3TEWA 2EDKA 4BIKA 4BUHA 5HYQB 3DRTA 4EUPG 9CGTA 1J8SA 1KXQA 4TTGA 2ZQKA 1KBPA 1QBML 2VISB 3HUJA 4WU7B 4QRPA 5E5UB 3EGSA 3NCJH 5D7IF 4J23A 3MFFA 3CXFA 3K1DA 3N43F 4BDVA 4HLZH 1AZUA 1SQMA 1EHLH 3HJ0A 2GJPA 2IALB 4AKPA 2EUWA 2PYEB 2AEIT 4WI8A 5AL0A 2H1PL 2EINB 1KGXA 1CXIA 3IMSA 4UAOC 1WS7A 1JN6B 3ULVF 4FQXA 4PV1C 2Q6WB 1S9VB 4OV5A 4K5MA 3SDAA 1VEMA 5DO8A 3DRQA 4XN9A 5FYJU 3IMUA 3EGDA 1RJLA 2ADFH 2Q5BA 2WQXA 2Y6TE 4PWKA 4X4KA 1EHLL 3BVNA 5GHWH 1G0YR 1D5IL 2VLRB 5EU7E 1MLBA 3F7KA 5FK9B 3NAAL 3QORA 3NH7H 1NDGB 2W38A 5JR1H 5E1QA 4NNPH 4FD0A 2EE3A 2R59A 3VGDA 3LZLA 4PLJD 4M00A 2AI0L 1JDAA 1H9VA 3UO1H 4P23B 2G75B 1MFBL 3C8KA 1UM6L 3VXRD 1E9QA 1OTUC 1ZXQA 2Z91A 4HKJB 1DANT 4XT1C 4LBAA 3JYBA 3PL6A 3QZWA 4IGBB 3MRGA 2F1BA 1KULA 1AGFB 1C5DA 2W9DL 1DJXA 2VQ1B 4Y5YC 4RMSA 3D48R 1NH6A 1OAKL 1OM9A 2X4NB 3ZYOA 5IW3A 1ZHLB 3QQ3B 4AEHH 1UUNA 4ONGH 1MRFL 2V5TA 3C6LC 1ODUA 1NEPA 4EVNA 4G6MH 3FB5B 5DLLA 1QAWA 1G7LA 1KPRB 3OGCB 3TZVC 3ML9A 1JV2A 1NCCH 3NJXA 5I6KA 3UEQA 2WXMA 2ZXDA 2IPTL 3P4OB 3FT4B 1X5MA 2YLKA 4F8LA 1U33A 3COOA 5IQ9A 4YS4A 3D0AA 1E9PB 5BXFB 5MI0B 3L3GA 4ZBJA 3SQBA 1QX1A 3II3A 3LN4B 4ZOAA 4X0KB 4GKSA 4EI6B 3HS9A 4ZXBA 4X6CA 1J0ZA 1FZOB 3ZTDC 1PZSA 1UA6H 1UD6A 5IJVB 4L0YA 1H3GA 3L7EB 1ZS8A 5HI5D 2OI9C 4PUBH 2OXHA 1R3KA 2FO4A 4ES8A 4RGNB 1CF1A 4X9BA 3TO2B 2QJDA 4YJZL 5F1SA 4MNHA 1X6LA 1FO0A 3OM3B 1TJIL 2DQUL 2XFXA 2Y2YA 2EYSB 2OTUB 1SY6H 5I75B 5KZCD 3KYMA 4HJIA 4QXVA 1ZAGA 2PYEA 4LP4A 3PWUB 3N9GH 4ADJA 1DBML 1CI3M 4GKSB 5GRUH 1MFDL 3PUUA 5GS1C 2GAZB 4UT9A 4WTWA 3HC0A 4GO6B 2B1AL 2UY6A 3BKYH 3RURA 1RJLB 1ZEAL 2OMWB 1K5NB 3DTUB 1J5DA 3RL2B 4GKZB 1W8OA 4UQ2A 1PZ5B 2LVEA 1A14H 3ZE2E 1NGWB 4N1EA 4WWID 4F5CE 4EVNB 2LE9A 3NABL 2FH6A 4WI6A 5D2NB 2RMNA 1E8WA 2BSTA 2JB5L 3PS6A 3ZO9A 3KBPA 1FGNH 2FQFA 1K8DA 4Y4KC 5C0IB 1ZLUK 5KEZA 3DJZA 3ELQA 3ILPA 1QTPA 4JFQA 3RGVB 3UYOD 2R23B 1HYRC 3PWLB 5IGXL 4G1EB 1OAJA 5FYJD 4Q14A 1A6AB 4RBPH 4F37F 2OMXB 2IDTA 3IDMB 3LNFA 3UTZB 5L0QB 4AE1A 5JHDE 3BISA 2GG1A 4NHCH 1GZHC 3WXVL 2Q3AA 1OAUL 2E9WA 2X4OA 3QUXB 1T6WA 3P11L 3WENA 4G43B 1I85C 3IVKA 4F2FA 1WZ1H 1EXUA 3RJOA 1JZ5A 1LE5A 1KTJA 2IAMC 4Z7UA 3KWTA 1UKTA 1WAPA 2D7NA 4YHKH 5I8OH 3O6ML 4FKKA 5F3BA 4Y1AD 1VA9A 4MGXA 4RBPK 4X6CF 2JCCA 4YIQB 4E9XA 4NENA 2F08A 4OSUH 3FONA 5EWIH 2QV4A 4Z0BH 1W91A 1V54B 4UMSA 1KGCE 2Y72A 1ZVYA 3HG4A 1K72A 1RURH 4I0PB 4ZFFA 3H9HB 3FCTB 3U6RB 2GSGA 4IMKC 5AW3B 1F4XH 4PJGE 4M4PA 2VDLL 2J1WA 1Z9MA 4O2FA 5D2NC 4LP5A 4FERA 1NBCA 5I1IH 3DO7A 2EEAA 2WIIB 1G6VK 5DGQA 4NHUB 4Q9RH 4E9VA 4Y2DC 1NIFA 2VUKA 1EAPB 2MFNA 4NI6A 4TSAL 4Z7WB 4E2OA 1P5UA 2PKDA 5HGAA 4WGKA 1L6XA 2AGJH 3E1F1 3NEEA 3HI1A 5KS9A 5GGTH 3AB0C 1Z0MA 3D05A 5J57B 1S5IL 4EKXA 4WWKA 1RP8A 2PN5A 1N2RA 3S3JA 4C83B 4EEEA 1ZWIA 2XBZA 3RDTB 3WJJA 3FCTA 3U6RA 1VDGA 2A74B 4Z7WF 1RZGB 1JGDA 2HWZH 3KLAB 1MWAL 2AEPH 1Y6KR 4KHTH 3UEZA 3UJTL 3QUYD 4ZTPH 3ZE0B 1E4HA 3CPLA 4YDJA 4GRLC 3FT3B 3P1VA 4JG0L 4MD5B 3BPOC 3D7PA 3SDAC 1NUFA 1J87A 3IDUA 4NJAH 5LBGA 3GMPB 4BFFA 3I84A 3WTYA 1BF8A 2X0VA 4JG5A 5KSAA 2CIKB 1B0WA 4BH7A 4A67A 3U9PL 1S7TB 4ABUA 1JNLH 5ICYA 1BGXL 1F4HA 1NAMB 3ILPB 4QPEA 3UTSE 2XY1A 5CAYB 2KH2B 5CGMA 3TBYB 3T3PF 4C4KO 3VD1A 1E50A 1IAMA 4F80A 3HRZB 5AAPA 4MLIA 1DYZA 2BC4B 4QHLA 3F7RA 4R96B 3SKMB 1SY6L 4YBQD 3CZKA 1U8JA 3VG0H 5EU4A 2ICWA 3LDBC 1Y1UA 2AF2A 1FIGH 1FYTE 2WZAA 3ZIMA 1F8TL 4ZMTA 4DP5X 1Q9WA 5L2KE 2IPKA 1HC1A 1QKZL 3CVIH 2WCPA 1N12A 4KQ3H 1U3HC 2J73A 3NIGB 4IDJH 3WE1A 3CQPA 1ETA1 4MBRA 4XN8A 2EQDA 4WTZG 2H6PA 1QSED 1V5JA 3OB8A 4GQQA 2JIXA 3MLSL 4DO4A 1NGXB 3K4DA 4ZI8A 2NY1B 4DQOH 3RTQA 3RDTD 5I1JL 1VFOA 1HZHH 1QZ1A 2HT4C 3SDCC 4IU2A 5D1QB 4Z8FH 1NLBL 3QJZA 3C8HA 2X4TA 4G6KL 5SWZB 1THAA 3CH1B 4RNRB 1J0YA 3SE4A 5AOZA 1JF1B 4RFEB 5I6NA 1JZDC 3GTVA 4OZGE 2R27A 8CGTA 3VQ1C 4P5TB 5E2UH 3OJDB 4UDTA 4GLRI 1JBJA 3AXHA 1JTPA 4YDJB 3CC1A 4F92B 5ELIA 3MRKA 5B7EA 1JXGA 3BP4B 2ZAHA 3K0YA 3MRIA 1GGUA 3SQOL 4MMXB 2VXQH 4JG1L 5I0WA 2WNXA 1RUQL 1C12A 1WICA 2J8UE 3GI9H 4WWKB 1A0QL 1NPUA 2Q20A 4DIXA 2OP4H 4FFVC 3MBWB 3C5JB 4P49A 1KLFB 2D2OA 1VERA 2ITDA 4OCRL 2XQYG 5F96L 4Z3JA 4I85A 1ORSA 3NSXA 4MJHA 1MCEA 4PBWD 2CBTA 3HRZC 3T0DA 1UOKA 5D9SB 4UTBL 4ATWA 1J7VR 1GGYA 3FTZA 1FLRL 3UJIH 1ZGLP 3L4CA 3S8WA 3PF2A 4G71B 3ECBB 4CNIB 4LEXL 5DVKA 1GGCL 2AJVH 3DJTA 4JVWA 3BVUA 4URTB 2V9UA 1X4YA 3RDJA 5HHNB 4QHMA 2GJ6A 2IQAA 4L3ED 1USZA 2H3XC 5JXAL 1JV2B 2FD6L 2HA1A 1YQ2A 5K59F 1PBYA 5JZ7D 2NCMA 4XCYB 3VA2C 2EP6A 1IBBA 4FQQB 3JYCA 5AD0A 4P2OC 1S7VB 3T3MF 3VVWA 1I85A 2GK0B 2UZYA 1KPVA 2X4UB 3V9CA 1NBQA 5M94B 4FMFA 1IQDB 2OMYB 3I9AA 4JFFB 4K94H 5CGBA 3WFDH 2NUTB 1KCRH 2DM3A 2XWTA 4JN1H 4P5KA 3L3IB 4JO1L 2UZIH 2DQCL 4ALAH 3DHPA 4MJ5A 3CSFA 4DSYA 1KZYA 1N5YH 4YK4B 5KVFE 4IHOA 4HJUA 3VD0A 5IB3A 2F6AA 5EBLA 4KRLB 4YDMA 3TEXA 1LNUA 1E3XA 2PWDA 3Q5TA 1VIWA 12E8H 2QPUA 4DKTA 1JNNL 2VT0A 1CF8L 2XY2A 1A6AA 1F56A 3VSTA 3H9SD 2Y23A 2FT8A 3S3SA 4ZFOB 1R33A 4GW5B 4PCSA 2NYYC 3OXSA 4Q0XL 3BFWA 3G08A 5FYJE 3AT0A 3ZUCA 1ZPLA 3T2QA 4BCYA 5IJDC 4PCTA 3LRSB 1G7HB 3TBVA 4EAEA 1WWBX 3EYFA 2UY7A 4FX5A 3E2HB 5INCA 2YUVA 1NCNA 2BZDA 2XN2A 1ASOA 2H1LM 3X3FL 3FT2B 1S9WB 2VXQA 1CQYA 3BE1L 2FSDA 3AITA 1WFUA 5D1XA 5HYSB 4GRWB 3ZY7A 2HRPH 4LHUD 4LLYB 3MKGA 4M7KL 1WBXA 5ECJE 3VYNA 2CMRL 3BW9B 2Y7QA 2GITB 5ESQB 1GYVA 5JXED 2C9SA 5IQOA 1TT6A 2EXYD 3DO3A 3GI8H 3VE0A 4Z7OF 3FRUA 1XGQB 2VDLH 3JV4A 2VRAA 3OKDB 4JVPA 3MVSA 4JFOA 4FNPA 4XP6H 2CRMA 1ZE3H 5FYLL 5LGHL 1B3IA 2DLEA 5DD3L 1EZVY 2Q76B 4KROD 1NKRA 3MLVL 3NIFF 3VRIB 4O02L 4Q97A 5EN2B 5EULV 1RMFL 1FPTL 2A6IB 2QSTA 2VW6A 3RZCC 3E9TA 5ICXB 4PYHA 1ZTXL 3VFPA 5EEZA 1KB5B 1NLDH 2E7CA 4GKNA 5E2JA 1HEZB 2I32A 2WO4A 1O6VA 3S35H 1U93B 5H35A 5T5NG 1F45A 3T0EC 3FFDB 1CVSC 3ATBA 4LSUL 1UUSA 2ZUQB 4KK6C 2E27L 2AQ1A 4WWPA 3HPJA 4J3TA 5EWIL 3B3IA 1Q72H 4EN3C 4ZW3A 5IP4A 3NSJA 2AJYH 3V4VH 1IARB 4DKFL 4YXHH 5GZOD 3INOA 4LKCB 3ZDYB 2AXJA 5T3XD 4NKQB 2CGZA 1MIEL 1BFOB 4XMVA 5GIRA 1Z9OA 5CWSB 2D03L 4DZBA 2AXFA 3B9VA 1TVHB 3TA3B 3UJIL 4AG4L 1YNLH 1T3FB 4CA4A 3WAKA 2VMFA 2C1PB 5DMKA 3X14B 1EHKB 2Z31A 2ESVE 5E1GA 3W9DA 2GBVA 1GPOL 4E68A 2ITEA 1SVZA 2VUYA 3DX9A 1ZGLB 1Q94B 1ZVHA 2CM6A 5EC1B 3RPBA 4R0LC 5H94A 3V0EA 4KI5C 4NQDB 4V1DB 3O0RL 3K46A 3ARGC 5C3TA 5I8KH 4L2YA 1CB4A 5DZPA 4DQAA 1YECL 2ZCKL 3RTLA 3AB0B 4N6RA 5AW2B 3UO1L 4BINA 1JDDA 3P4MB 1ONQB 4B50A 2EYSA 4PJCA 4OSUL 5DU7A 3MA7B 3DOSA 1FRGL 5EORL 1KCUL 3JWNH 2IEPA 1AGEA 1XF4B 2VAAA 3QCUH 1MFEH 5KVFH 1WQVT 5DK0A 2P9RA 3WNLA 2F9BT 3KGTA 3QHFL 5AB1A 1PQZA 4HKJA 4IW4C 4P4RB 5FYKH 3ZDZF 4PHZA 1YZZA 3OJDA 3QUZA 4JY5H 4UDTB 1XGPA 3JSSA 3P2DA 4R5VA 5EC2A 4ELME 2IADA 4R8WL 4HIEB 1NGWA 1Q38A 1A64A 2V0AA 2ITCB 3L3HA 4M93C 4JDTL 2AXGA 2PXYA 2FHFA 2K9FB 1M7IA 1QP1A 5CEXA 1WBZB 3R7RA 4BQ8A 1FGVL 3Q01A 3PPSA 4JPVH 4BHUI 2IG2L 5ICZB 2WWOA 4FQXB 3X14A 2V5SA 2LU3A 5CCKL 2WQ8A 2YN5A 4NCC1 3FO9B 1QYGL 4P9ML 3U2SA 1DEEA 2X4QB 1RZIB 4AMKL 3U83A 3FUJA 5C0ND 1I3RA 1P2CA 3AU1B 5FO9B 2J8UA 2YLHA 5GGTL 1CLYH 3HI6H 3PDDA 3O81A 1R3LB 1U58B 2J56A 4P46A 3PABA 4F7PA 5I24A 1AR1C 2BNRA 3WNKA 4CVZB 1BQLH 1NC2D 1FG2A 2CBMA 3MRKB 4M1CD 2E9JA 3QEQA 2VZ3A 4ZFOL 4QTIH 3LTVA 2XKSA 1KTBA 1CICB 5FCSH 4AQ8A 5IFHH 2OCCB 3CIQA 4M61B 1G9NH 3U79A 3KJ6L 5C0JA 1G4MA 2ENYA 5M95B 3GTTA 3SE8H 2CLZB 3J27A 4Z7NE 4X6DB 4JKPH 3T08A 2YKLL 5CEZH 2IBGA 3TN0A 1A1NB 1V27A 3MACL 3SO3C 4BWTA 1UD2A 5FGCB 3EGXA 2CBPA 4LLQA 1MIML 3IE4A 3D3VB 3EYUL 4S1DD 5CZVL 4I0PA 3OR7B 4KOBA 1JRHL 1CDHA 1F6LL 3D2TA 1U2CA 3G04A 2A9NL 4NXKA 4X5QA 5MEPB 1HYSD 2XKNA 2YA0A 2LLNA 3FB5A 3TVMA 3WV0A 3O2DH 2Q2LA 3Q8AA 4KZEH 2WYIA 3HE7C 5C71A 7PCYA 4DK5A 4NQED 4EN3D 4MJ6B 1W72L 2X3CA 4J39A 1EVUA 2K8MA 2ZKHH 5I6XC 4S1RL 1IQWL 5CZVH 2QZ5A 4EIUA 5FUZH 1H0DA 1NJ9A 1AD0B 1SHMA 5KS9B 3TFBA 1VEPA 1A1MB 3CUPB 2FCBA 2FECL 4HWNA 3GRWA 1MF2L 1XCTA 4OCLC 1OQXA 1BPLB 3TESA 1RH8A 5SWSB 3IFLH 2FNBA 3V4PH 4IK7A 4LSQH 4QXGL 4ZPTA 4XO8A 2IH3A 2W59A 4MAUH 3DUHA 3S2CA 3BLBA 2OTWA 1WD8A 3VWKC 3MYJA 1RZFH 3DPDA 1AY1H 4FP8H 3SQOH 2Q7AA 2F19L 4ODXB 3CXHK 1TJHL 2QKIA 3LS5H 4WUUB 3VB9A 3O8XD 4KNQA 4XPGL 4P0DA 3L1OH 4H88H 4AIOA 3G6JF 5CEYB 4CU7A 3DSFL 4RGOH 3GJFA 5D2LB 5EBGA 4YXKL 3WDHA 4JO4H 2EYRA 3CX5K 3ZDXF 3A23A 5JUEL 4XVJH 1N2RB 4C83A 3BVDB 1F3JB 3BGMA 2J88L 2ZOOA 3V5HB 3ILQC 4ODUB 2UWEB 5DMYA 3G6JB 4HJGA 2O6EA 5JNYB 2HX8A 4JREC 2XTJB 2YEZA 1T89C 1KCLA 1AHWC 2J1XA 4GAAA 2KZ1B 4G80A 4JY5L 4W9KC 4XPHL 1KLGB 1MQKH 3RWEA 4PGEA 5TGBA 4F7CB 4PRAB 4XCFL 3WIAA 1W8EA 1QUNA 2OULB 1VEOA 4LNRA 3GBNL 1M2VB 2QELA 2VQUA 1FI8C 3MC0A 4XPTL 4CSPA 3UAJA 3MNMA 1QI3A 2EC8A 4HXBL 3MQIA 1ETZB 4XMLL 1OGTB 2DWDA 4FL4C 4ENED 2AAVA 3WOVA 1QFWI 3KHQA 1M7UA 4AE0A 1LWHA 2VL4A 4U6XA 3MLUH 5CO1A 4X99A 5SX4H 3RL2A 3UBXB 4OCSH 2V2WA 1ET8A 1AQDA 1RZKL 1Q0YL 3UG5A 1HOCA 2DI9A 4JPKH 5C3IA 4KU1A 2NY7H 3VGBA 1RLBA 4MCYA 4MMZB 2OMNA 1CFQB 4JG0H 3PWUA 4U05A 5TE7H 3LH9A 1RHFA 4GS7C 5IBTH 3CFKA 4DJMA 3EYSH 5D93B 1G9ML 2ITDB 1YYMH 3QR1A 1MG2C 2HG0A 2IDFA 1BP3B 1AXTH 1BWMA 4RGMC 2KBGA 2FDBP 2WP3O 3JUYA 2GTZB 1CTMA 2VDRH 3HUJF 1YMHB 4K73A 2WXFA 1MFNA 4MS8C 3DBXA 4XHJC 3ESVF 3BT2L 1FP5A 2YC1B 3P0YL 4D0CB 1LEIA 4UUJB 3HZYA 3NTCL 3FUEA 5D5ME 2QDWA 2VR7A 2Y7MA 4KK8D 3P4MA 5E6IA 3CPUA 4LLVA 2KDGA 2PYED 4K9EL 5I76A 3F7VB 2ZNWA 4Q56A 1KBVA 3I02A 5SWQA 3O9WD 3RKDD 4LQFH 5DVLA 4YE4H 4RRPG 3WY3A 1NC4B 2M26A 2GK2A 4Q4EA 4U1LA 4LVHC 4AQZA 4OCYL 4LCCC 5DWUH 4UIKL 3SDDC 3CVIL 2F5BL 3VWKD 4IRJD 4XN1A 4PLNC 1UG9A 4LLWA 3ZLQC 3R19A 3L4WA 3SDAB 5CN3A 3FTGA 3ETBF 4QYOB 3DX4A 3KD4A 2BWIA 1ORSB 1WC7B 2AAAA 3P3YA 4URKA 4YHIB 4U1NB 4W9DC 3SO5A 5IJKA 3IM1A 2OK0H 4ADGA 4GB9A 4I3RL 5FHBL 2BVPA 2X4RA 4PRHB 5KVEE 3IE9A 2EDTA 1Z7JA 3MREA 4AIEA 3ECWA 1DJHA 2OXGA 4MXWH 4KKCD 1MPAH 3KJ4B 3RI5K 5DVOA 4FQQA 3OD3A 4HIJB 3X3GL 1XGTA 4RGNE 1GCYA 4A1RA 3US9A 3O6KH 5D7IA 5K9OB 3M88A 2R69A 3WN5B 4G83A 4LDLB 5DHDA 4AJ0A 4X8GA 4L8BB 2NRDA 1GGCH 1VFUA 3UTTA 4N9GA 4PJ7F 1YY8A 5IB1B 1RJYB 1P84J 1W0WA 1IZKA 2LR4A 1EEZA 4XP4L 2Q7NA 3T3PB 5DJXB 4DN3L 1RAMA 1KNOA 3WLWD 3UBXA 3OKYA 2RH0A 2Z9TA 3CMGA 4I0PC 3AQZA 1NWOA 3OTTA 4UNTA 1E4XL 1MFAL 3N44B 5KOMC 1B2YA 2X70B 4AGMA 1H6FA 3CZNA 4U3SA 4PW4A 4X6EB 3GMPA 2VDPL 3NN8A 3EBGA 2PNDA 3O9WB 4D3CL 3KR3L 2RFXA 5ESVA 4PS4L 5E1IA 5KBNC 1S7XB 3SZ6A 3ZRCC 1XH0A 1AIFA 3CFKB 3MAWA 4ZW5A 3WS6C 1F97A 3QDMD 1JHLL 2ZT9C 4M5ZL 3QPXH 3VH8A 2D9QB 5IFJB 2APWA 2PXYD 2EECA 3K8KA 4J3WA 3OAWA 3VFSA 1FGVH 1WWCA 3NPSC 3OMAB 3H7BA 3VMNA 3D8MA 1BQHA 2NLJA 1E9QB 4PGCB 3MMEB 4NEHB 5MHSD 4KI5E 4NPKA 2CO3A 3VD3A 1DHKA 4P9HC 1OTTD 1S3RA 5SV4A 3OZ9H 3K6SB 3SGJA 3O9WC 2X9ZA 1DQKA 4HQQL 2R9HC 3RKDC 3N0AA 1K4CA 1MY5A 1QRKA 5JHAA 4KUZL 4F7MB 3WEXB 5BVJB 1E9OB 1DVQA 2D0GA 5FO2A 5LBSL 5DHEA 4N0UE 2JQAA 2YD3A 1DQQA 1TJGH 4B6ZA 2NNAB 4P5RA 1CIUA 4KWUA 4U3HA 2CPUA 5GGRB 4NSKB 2CA4A 2XXGA 3DV4A 2DYPD 4NNXB 5SWSA 3VXUB 4S2SB 2YD4A 5H37G 2XQYA 2A4CA 4XXWA 4M5YH 2XN9A 3JUZA 3MCG1 4ZO8A 4YDLC 4ZPVB 4Z18A 5GS0H 3RGBA 2VMEA 2VMJA 2XDHA 3KEDA 4IOFC 5JORB 2BOLA 4N85A 1DFBL 2PP9A 4R90H 4EO5A 1H19A 2J8OA 4A63A 1RZ7L 1KIQB 1TQSA 5GIRB 3ZTCC 4OZFB 1NCAL 1IM3A 1Z0NA 4PG9B 4QAMB 1S3KL 4N5ED 2K3TA 4LMQE 3NZ8A 2MQ3A 5I66B 3T8MA 1MCCA 2PWHA 4CMHC 1CUOA 3KPMB 3MUY1 4HUKB 4U6VH 3UAJC 4F7EB 4L0PB 3RHWK 3ULUC 4FLOA 4HSAC 5AOKA 4AWJC 4PWGA 1OAZL 3UP6A 5CJXA 4QRUA 4JO3H 4Q52A 4JFHE 1NJ9B 1FV1B 4GXUN 3I6LD 1J1XL 1UT1A 3P3UA 4Y2NA 3DJ9A 2VDNH 1EEQA 4P23C 3MV8E 4Z7UF 1KBKA 2NR6D 3IEAA 4I48B 1OW0A 1S7RB 4K3JH 1IKFH 1WAEA 5CZRA 3L3JB 1OPGH 2DH3A 3Q2VA 3IXAA 1CL7I 3ME0B 3V10A 4G8GA 4FHBD 3FT1A 3QWQB 4NBXB 3S35L 4C55A 2J20A 4JPVL 4DGYL 3WYRA 3DX6B 4K3HA 3QDAA 1HHHB 4UTAA 1B6UA 4TSCL 4K3DL 4HPOL 3KPRA 1TU2A 1NFAA 2COVD 3JV0A 4K23L 2VLRE 3CHQA 4QXTB 5ITFB 3HI5L 5DQJA 1T0NB 3AGVA 5DD3H 2R0LL 4AMKH 2NY3C 3MNWA 3DURB 3A24A 2WO2B 1U8OB 5HGDB 3ZR6A 3HNSL 4KXCA 4F8PA 5ALBL 2B2XH 1A1OA 2K3HA 3E6HA 1QPPA 1QTSA 1NFDE 1W80A 3NCXA 4L8SA 3VXUA 2V7NA 4H8VA 4B9JA 5LB1A 2HTKD 4PRPA 1LO4L 1KJ2H 3QNFA 5BOPA 4NT6B 3QZNA 5D7JA 1C5DB 2AK4D 2IIJA 2W92A 1A7RL 5FM8A 5J5EA 1FF5A 3EYVA 1V7MH 2LAGB 1NBVH 3ESUF 3GB7A 4PJ8B 4QY8A 2I5YL 3IETB 4AUJA 1JERA 1LO0H 2VKWA 5FUOL 3MA7A 4JX0A 3F01A 3U4EB 2W95A 2D7PA 3BAIA 3Q8FA 2B4CL 4FQ2H 1IAIM 5EA0L 5FYLD 2BMKA 3NSYA 4MAZA 2JCCB 3U30C 2VDPH 1F2QA 3VX1A 1IGTB 3FO1B 4IMKA 1SDAB 3U7WH 1TEYA 3EYOA 1FFNB 4HJTA 5DR5H 3Q0HA 4TNVK 1HINL 5L2JA 2DLIA 1QBMH 3P0YH 1DVSA 1AI1H 5T1KA 3SDDD 4ERSL 4ODTL 4PJ5E 2EIEA 4LP8A 3LKOA 2IJ0C 2GT9A 3O4LE 1KPRA 1G7LB 4G5ZL 5EC2B 4HIHB 3CVHL 4GO9A 4DVBB 4XRCB 3PWJB 5BUPA 1KMGA 3GS0A 4N6RB 3DMMB 4B0MM 5FW7A 2B1OA 4HDIB 4NZJA 3LNIA 3ARSA 3WUZA 3BCDA 3O0RH 4FABL 4AQAA 1JNHB 4PRDA 1HX0A 3QQ9C 4MAUL 3GNMH 1T20A 2ICEC 4ORGB 1DBKH 4OFDA 4R96A 5IBTL 3SKMA 5MEQB 1CDUA 1MCWM 1XT5A 4F1SA 1MHCB 2P43B 4CU6A 3TEYA 3PHOB 5C0CD 2ADJB 4ZXBB 2O6DA 4B5EA 2Y36H 3S9DB 2BNQD 3UABA 2B7DT 1X9RA 1MHEA 5DJCA 2J72A 1S7QA 4GW4A 1AZNA 2QKSA 4AL8H 1BBJA 2E56A 3QR0A 1MPAL 3RVUC 4DZBB 2C9XA 2OXGB 3GB7B 4QY8B 5ADOH 2DKSA 4K71C 4W9LC 2E46A 3H9SA 4HIIB 1IFGA 3V0FA 4XAWH 3BQVA 1NGXA 2OA9A 5I76B 2WB7A 5IMMA 3KPNA 1CFNB 4BEIA 2BK8A 3UL4A 1DQDL 5C0CA 2OL3B 4QRSB 1A6VL 3WLBB 5BMFH 2CE6A 3KVPA 3ARUA 1ZT7A 5A40E 4UOW0 3S5ZA 4WHYH 2F8OA 2F5BH 4Y8AA 2FHCA 3O2DA 1U95A 1INEL 5L2JB 4GXUM 2BOCB 3DMMC 1MW1A 3OKEB 4WW2F 1R0AH 3MRBB 4HD5A 2QPDB 3KCPA 3P3RA 2VISA 1O0VA 2L04A 2A1WH 3VI3B 2NY5L 4N2CA 1P1ZB 3VI4A 1EDYA 4M5ZH 1V3LA 2A6JA 2R4RL 5T1LA 4L0ZA 5LDUA 1AVAA 4XXDB 4YSUA 5L4IA 2P24A 3PAZA 3AG4B 5KSUA 1T3FA 5E4EB 1R0AL 1HI6A 1CE6A 1F3RB 3GDCA 1FWXA 1U92A 3EXLA 5EUOE 4HAGA 2XQBL 3GKWL 3ZVVA 3MRCB 5IFHL 3PAYA 3I6LE 1ZLEA 2PCPB 3HZ3A 2WLZA 5JLZB 4FZEL 2G5BA 3BIBX 3EJJX 3RA7H 1C5CL 1VPOL 4M48H 3SQRA 1AKJD 4MDIB 3BP7B 1TFPA 2BCKA 3A3YB 1AGBA 3N85L 3PV7A 4Y1AB 3CZJA 1XH3A 3CDZA 1PYWA 2WUCL 3BLPX 2F5AL 2WINB 1N5AB 3F12B 2NQ3A 2VR9A 4P23A 3GRWL 4PJCB 1QFPA 4KGJA 4EI5A 1MI5A 2O26U 1JK9A 2N7AA 3D9AL 1HXMA 1U8QA 3LPOA 4S2SA 2XV6B 5CEYA 3DMMD 2ZOTA 3WLBA 1MSPA 4IDLA 1DZBA 2AEQH 3WD5H 3PU7A 2DKMA 3HTLX 1PY9A 3UAFA 3IDMA 2MQGA 3RJQB 3JV5A 2CG9X 5G5DA 3MV7B 4O2FB 3TT3L 4N2AA 5F89A 1DBJH 4C4BA 1TPXC 2OMUA 4LEBA 3QI9D 2VLMD 2WMPA 1BBJB 1L7TH 1PU0A 5J12C 2OTWB 4WDIB 2K7QA 4PWFA 4KJWD 5EFIA 5A2CA 4UIKH 1K4CB 3RWEB 1AGCB 4K5NA 4QUOA 4XP1H 2IH1B 4V2CB 2YEZB 4X4MA 1JXKA 1RK1B 5IMKA 2EH7L 2OMZB 5KYNA 3RY4A 5KYWB 3O45A 4JFUA 5L88L 3APFA 4G5ZH 5F7LB 3KVQA 2WWNA 3C60C 4OLUL 1E5ZA 2GFBB 3OKNB 1ZCRA 5CCHE 1H8SA 1WA0X 3IN0A 4JM2F 5L6YH 4Y7OC 3P3SA 3TBSB 1JPEA 2LHAA 2R2HB 5DO2C 5E9DD 3T6ZA 4G7SB 3PG2A 3UTPE 1FCCA 4HLJA 5FO7B 4DP4X 2NXYC 3B9KB 2V2XA 4RISH 1D5XB 5DJ8A 1DQLH 2UY7B 2FATH 4GW1A 2Q8BL 2OYKA 3WKQA 2VLKD 1I7ZA 1YEGH 3UTSD 2A9BA 4D8PA 4OZ4B 1AGCA 4D3CH 4K23H 4RLDA 1RUAH 2VR5A 4JQIH 4NRXB 3E3QE 2J88H 5BRZA 3QPKA 5MEOA 2BSCA 1CN4A 4O9HH 3DTDA 4I5BA 5C0JB 4I0CC 1D6VL 1M9SA 3EJYC 3FAXA 3MLYH 4OZGA 5C7XL 3QXWA 4J3OD 2ED7A 1UGNA 3SQBB 4LASL 3BDXA 1J1XH 4NQQA 4JZJC 4FXLA 3T0AA 4ZD3L 2FNWA 2H0FA 2YD6A 2DWSA 1YLBB 4GYBA 3DTXB 4FI7A 1HSAA 1NMCC 2GUYA 3RE0A 2ZF8A 1KACB 5MENA 4ODSL 4GQZA 1H6UA 2GIXA 2V9QA 4X2UA 4ELKB 2OJEA 1XR9B 3HS0C 2WVUA 5SX4I 3RG1C 43CAB 3QC5X 2P8PA 4J8QA 4HS3B 2OMXA 3QC6X 1AYRA 2R69L 3JV6B 3LN4A 2NW2A 4FDWA 4K7FA 1LK3L 1HWGB 3MNWB 4XXCC 1JHKL 2I69A 2VC2B 1MAMH 4E9WA 1XIWC 2BDNL 3G3LA 1JFQL 4EIBA 4PJ9D 4Z77B 4J8RB 2OXHB 3L17A 1Q0XH 2VB5A 3LXCA 2FJFA 1BF5A 5D9SA 4OLXH 1BM7A 1ADQL 2PPAA 2GSMB 3D0LA 3RUGA 1OE3A 2NX5B 4L8DB 3EJZC 4ESKA 4RVBA 4N87A 1WUNT 3DVFA 3LNDA 3LPPA 4HX1B 3OLGA 4G8EB 3UERA 5JMRA 4YPGA 3BAKA 3C08L 4QLRA 4I1NB 4GH7B 3JWOL 2WNGA 4LEEA 4N6QA 3P40A 4G9DA 3IMWA 1M4KA 3S5YA 1U3JA 4M1DL 1DFBH 4R90L 4XODA 4FADA 2JIXB 3HA0A 4ZUTA 4Y19B 3FSOA 4K9EH 5FECA 4HJEA 4DK3A 3EFDH 3N41F 3CFEB 1DLFL 1SZNA 1GKOA 4NUGH 4QYOA 2DWYA 5IVXB 1MCJA 1C7SA 5F88B 3FSWA 3TV3L 5T1KB 1Q8MA 3CH1A 4HGMA 1CGWA 4A38A 4Q6IB 4DP9X 4HAFA 4IM8A 4XMUA 4L1BA 5CJQH 3K81A 4UYQA 5TD4A 2GUOA 2EILB 2UX7A 2BXYA 3L9BA 2O72A 4AJYV 5KVEL 1T03H 5KJ4A 1T66C 3DOSB 2HKAA 3ARPA 1FL6B 1F2XK 2FQGA 2XZAL 4WUUE 4WJG3 3RU8H 4UNIA 3H42L 3IRPX 1FYTB 5DLML 5IVXF 1I75A 5HJDA 4LSSH 4ZOBA 3LZNA 5I1KH 2I24N 3FN3A 4TUUA 4M7JH 5IIEB 3BEVA 3R7QA 3PP4L 4YSRA 4OGXL 2QFPA 1OSZA 4ZMXA 3BH9B 2CR0A 1MJUL 3L45A 3SCMB 4XOEA 5K1JA 5J6SA 1ZGLA 4OV6F 4P3CL 3ZU8A 3L9EA 1I1FB 3BO8B 1EHNA 3NFSL 5E94B 4HKBB 5ALCL 1D7BA 43C9A 5E6ID 1CLCA 3MA9L 1DQIA 1LWRA 4RETB 3FTXA 4FFYA 3WY4A 5DSCA 1UYWL 3BPNB 1BVNP 1MQ8A 4BWWA 3SGEI 2DMGA 4GXVH 4IRJA 4Y19D 4Z3EA 4ZK8A 4PJAA 4AY0A 3VQ2C 4I18B 4QCIB 4HFUH 3FPYA 2DDQH 3G5VA 3TF4A 1E3ZA 2G0LA 4TUOB 4C56E 3D06A 4LCYA 3L3JA 1ZA3B 1JGLH 3FOMA 3CH8A 4U1GC 3JWOC 3CVHH 1T7ZA 2NY5C 2PXYC 5I5MA 2XV0A 3BN9C 1AJ7H 4YFLI 3T6VA 2N7BA 3KXFB 3T1WA 2V3DA 2DKUA 2H26B 3DSNB 3E80A 3JTSB 1KGUA 4JFEA 4XNAA 4PJFA 5EHFA 5GRWA 4DN4H 1A7QL 1E9OA 2OZNA 1W16A 4NZ8A 5DR5L 2JKNA 5CZXC 1K2DA 4ZYKA 5E8PB 4F7EA 2Z4TA 3DROA 3DJRA 3HC3L 1T04B 2OMBA 1U3HB 3M1OA 3ML8A 5HGHB 1KC5L 1Q9LB 1PD6A 2OPCA 2J44A 3N42B 2O5ZL 2XETA 4QXWA 4BA0A 4Y7MA 1TZIB 3V5KA 2GHWB 1ACCA 1S46A 4GUCA 4U6VL 4MNGA 4CGTA 3LIZH 5B21A 3CSTA 5ENWA 3KW8A 1BLNA 5C08A 3MFGB 5AWNH 3FB8B 5A2BA 4M7LT 2BOBB 1J9CT 3BWAA 1II4E 1KCUH 1AQ8A 1FYTA 2PCFB 3ZW3A 3RNQA 5DYOA 4PJDB 4EZJA 5I5RA 1Y0LB 4S10A 1VF5C 2UWEE 4ISVA 4IOFD 3JT2A 2ZYRA 5DTFB 3VFTB 3N44F 4HWBH 1CXEA 4GAFB 4PBVC 3UZVA 1EEYA 3S98A 1OSZB 4PJ5A 3BKJL 1QPKA 4Y2OA 1KUMA 1E6OH 5D6DA 3D0VB 5DUPL 4HG4J 3RVUD 2EO7A 3MRDB 2QPFA 2X0UA 1XGYH 2P5PA 3FRUB 3O2VH 3QUKB 1JSYA 2F7IA 3GFUA 4BH8A 4RFNC 3WD5L 3RGHA 1FVDB 4Y4HA 4HPYH 3KLHD 1J9RA 1PZ5A 4JDVA 4ILDA 4O51A 1UWFA 3A21A 4P59H 5GJSL 5KVGH 4I13B 4HISA 2HRPL 2ITFA 4G8FA 5IB2B 1SLWA 4LNVA 4DKDC 1HZLA 2JK5A 1WT5A 4I8DA 2LGNA 3GSNL 2G4GA 4UYPA 3ZE2B 2QHRH 1F3DJ 5GS1B 4IJ3C 2APVA 3EUDA 1WBYB 3O11B 1D9KA 4ZFQA 3WIFB 4WY7H 1KN4H 2APBA 3UTOA 5IQLA 5E8PA 3RX8A 4H13C 3AMKA 4U6HB 1O7DE 3KEHA 5AVSB 2IAMD 2QR0B 1SJEB 2ADIA 3IPEA 5KS9E 2ZP0T 1F41A 4YNYB 2VWEE 5KVDH 1ZV2A 2NXZD 4J4PA 2AJXH 1S7QB 2YBGA 5HJBA 3HN8A 2NY0C 5DQ9B 3ZRFC 5D1ZI 1KIPB 4MJ2A 3NFSH 5A3IC 3D4GA 4FS0A 1UACL 1YYCA 4OTXL 5MEQA 1IGMH 1UT9A 1CXFA 5BUAA 4AQAB 1PKQB 3TN0D 1OF0A 1W2KT 1JRHH 3GIVB 4FXKC 2Z91B 2O6PA 3FW6A 4WLCA 1AGDA 3GXDA 3TYGL 4ZNEA 2NUPA 2W91A 3FO9A 4RESB 1OCOB 4F9LA 4LASH 3QG7H 5AG8A 4ZFGH 3DYMA 2P5EA 2Z35B 1DR9A 1TCRA 15C8L 3LKOB 4WW1A 1QSVA 4LCWD 3WAJA 1LILA 4MCYB 3ALPA 4MMZA 5GRZA 4QOKB 1VCAA 4DUVA 3V8CA 4J6RL 2ORBH 3L3DB 2ZCHH 1OP9A 1JG9A 2VR4A 4LVOC 3SHSA 4QRBA 2CIIA 3FSZA 3ULVC 3FOLB 3ARED 3LRKA 1QACA 1DJSA 3IJHB 1U42A 1C5BH 1WAAE 3L6FA 4P3DB 4QXGH 4B9FA 5HHVL 4EI5D 4FXTA 4ZS7H 4DOHE 4N8VB 4Y19E 3QBTB 3CSGA 4A6YA 4UILH 1IV8A 4JRFA 1ZHLA 3MBXL 4KJPD 4MA3A 2WPGA 3F6IA 1YEWA 1M56B 5CJQL 1BZ7A 2F19H 1L7IL 3VQLA 4WEBL 2JB6B 3ABMB 1DTUA 2EDJA 4YNYA 2XXMB 4ODVL 5L6YL 4NI3A 1OGAE 4ZZFA 3KW7A 2WLIB 4FEIA 4GJTB 4UT7H 3VFWA 3CQQA 5I8EA 4EXPX 1RJZA 2EEXA 2WQSA 3SDAD 5KOVC 1ZHBA 4FFZH 3TS8A 1VCBC 2ADGB 5FWRA 2FATL 3C08H 1HIMH 2B1HL 3N0PB 4FTVD 4AIXA 1AD0A 1KXVC 5FF6B 3QI9B 5E2WL 1LO5A 1SFDA 2I60L 4KK8C 5DFTA 5F1OB 4E9YA 3MV7D 2YD2A 3V6OE 4LPCA 1H3VA 3PQYD 5IMLA 5T1LD 2NY5H 2WM0A 5IVNA 4A6YL 5D7KE 2BX5A 4OM1H 3ZK0A 5JYMA 4FCAA 5FO8B 4A7GA 4AEIH 4OLEA 4KRPB 5L7XH 4MAYC 1P7QD 4EXKA 4UM9B 2K4WA 1R5WB 2YZ8A 2XNAB 1JS4A 1CVRA 4TVUA 5AOMA 3VH8G 3T0WA 3CDZB 3HE7D 5E7BA 5E9DB 5HJGA 4K9EC 4KKZA 1IFRA 1KTCA 2NXZC 1WCBB 1XGQA 4YSEA 2P4AB 3IGAB 3WO3B 3RA7L 5CLZA 5AL8A 1TZGL 1C5CH 1VPOH 1CG9A 3PREA 2X2HA 5IJKC 2OR9H 5F7YC 1W72A 2VLKB 4PLJC 1BCIA 3GZPA 3U0TA 5IJBC 1OZTG 3V5HA 3UBFA 4NYLA 3L1EA 3KLKA 1GW6A 1IAKB 1N6QH 4NO3B 1E27A 3AQDA 2G2NA 1DSYA 3VW3H 4BZ1A 4P4KC 5J0BA 1XBRA 4K7PX 5FFLA 4XBPB 1G9MH 4N2EA 4N26A 1IJNA 1CD0A 2XUWA 5ECGA 4I5BB 5SX5K 2YPLB 2JI1A 2BIQA 1JVLA 1S9XB 2BOCA 2LAAA 3VW3L 5FM5O 2DWEB 5D6DC 1W0WB 1DO6A 4WI4A 4PVBA 4Z7NB 4N5UA 3NCWA 4Y4KD 4JM2B 5KBPA 5DD1L 5JPNC 3FH5A 3VI4B 5JW3L 5ILTH 3ECQA 4EUPH 4PJ7E 5KVMC 4YHNB 3Q8EA 1BD2E 4HWBA 6FABH 4YH6A 4KDTC 5AQ0A 3CSPA 4KX8A 4PRDB 4WU5A 2CO6A 3F58H 4PP2A 5AZ2L 5DS8B 1E6OL 1IEBB 5FF6A 3PJLA 4JJ5A 4DGVL 2AQRA 2KL6A 2VLJD 1IILE 3OKNA 4D8OA 4E0RB 3S3BB 2X6BA 4X7EC 1SMAA 2D7QA 1OT4A 1DEEB 2X4QA 5DFWH 1QASA 4XP5H 5F7UA 1CK0H 2FGWH 3T4YA 2DB8A 4YHOH 3H8NA 3LKSA 4K0OA 3L3KB 1JZIA 1K4DA 4OVUA 5EEWA 2ZYHA 3H9SB 4O9HL 3P9MB 1N3NA 5HHOB 4J4PC 5I2IB 3EHBC 2Y5TA 3MDJA 1UWEL 5BVJA 4OGXH 1FPTH 3RUGB 3AROA 3ARGA 5E8OB 4XVJL 1HQ4A 2VSCA 4LIQE 4YZWA 3C09B 1P69B 1NM9A 4F93B 2DTMH 5DUBB 4A7TA 2J57A 3AS0A 1IM9B 4UTAL 5E00B 3UAEA 1V7NH 4J8RA 5C70A 5BW7C 4XP9L 4XTRD 5KW9L 1FNEB 4LHUA 3DBXB 3GSNA 3PQYA 5AB9A 4U2ZA 4K2UH 1E4XH 1MFAH 4PRBA 3GJEB 2ZZUT 1Q9KB 4YSCA 1JZ6A 3VUAA 5EU6A 4G82A 1NIAA 2NX5A 1TENA 1ZA6A 4JZJB 4L8DA 4TUJA 4BXVA 1YHPA 3ASNB 5F9JA 3UADA 2A2QT 3WKNA 3S37L 1J0KA 1TEFA 3FXIC 1ITBB 4I4WB 3NCEB 3UZQB 3DURA 4D7PA 4H1LG 4OGQC 2Z0BA 4XC3H 3S4SG 3ZDYF 1RUPL 4B97A 2CK2A 3S48A 3AM8C 5DJ0B 3NACL 2ZXQA 3NCBB 3QQDB 4NWUL 4HWEH 1CDJA 5DDHA 3DIVA 4XVSH 4N2HA 3P30H 1TETH 1P9MC 3RTQB 5T1JA 2FLMA 1DVFA 1G9NC 3W82A 2EDDA 2ZSVB 2ENJA 4NFBA 4OLZL 2UYLB 4PLKC 1X4XA 2NY7L 2XX1A 5DEFB 5C9JB 1IIIA 1S7RA 2AQ3A 2IFGA 1FSKC 3S5LB 4WK2B 1CE1L 1JPST 2VN4A 3IK2A 3QA3A 5E8NA 1ZLSL 5MEOB 3O0LA 5IFAH 4G6FB 1T4KB 1EZLA 1BPVA 3BSHA 4OZHF 4IBWA 4WCYH 1CD1A 1FNGB 3QIUC 3KPOA 3O4LD 3QEUA 4ODHH 5CJBA 5CMAA 3CZSA 1K85A 5T3XH 4I2XB 5I0YA 2BVOA 2EUVA 1XGYL 2YQBA 3O2VL 4ETQA 2VMCA 2X2JA 4D9LL 1NKGA 3WKYA 3NTCH 25C8H 1E42A 3H53A 4RNRA 5BZZA 4AYEC 5DHMC 1SQ2N 4GRWF 1NDMB 4F33B 4B7LA 3KYKL 5BOZG 1JNJA 3HZVA 4NM4L 5JXEC 5BJTA 1JYWA 4J1UB 1ZHKA 3P9MA 3SDYL 4YDLB 3DXAD 4WFGE 4HHAB 1IC1A 3VXSD 1A7NH 1ZPUA 5E08H 1W0VB 2C3VB 2AERT 4ONGL 2CSPA 4LQ1A 3D69B 3U4EA 3HOGA 1QBLL 1WHOA 3ZDXE 4ZUSB 3SGKA 5MHSE 2Z6FA 3RFZA 3RVVC 1L0XA 3OJMB 4HPYL 4I18A 1SFHA 3IJ7A 3OR6A 5EO9A 1R19A 5IHZA 4BFKA 2YD7A 3V55A 4EJ1C 4KK9C 1UM6H 3GSNB 1G7JB 3DXAE 3QDMA 3IAGC 1A7NL 3GSNH 4X7SL 4M9PA 1F6AB 5HHVH 2DQHH 2VIRA 4P9MH 2B3IA 2R83A 5ACLA 5HYQA 2QVKA 4PCKA 3DI3B 4FG4A 5TPWH 2BY2A 5CN1A 1N64H 3L3IA 4RMRA 1QOKA 2B9BA 2G60H 1MUJB 1KCSH 1N8ZA 4TUKH 2X3AA 5AUMB 5CZKA 5F9DC 3F62A 2NY1D 1MW0A 4R26L 5CGTA 3DSNA 4JFEB 2Q1EA 1YSOA 3BAWA 3OR6B 4M6NH 4IBUA 2EYRB 1JGLL 1ETB1 5GRJH 4JRXA 2G2PA 3G5WA 3FTVA 3DBSA 5EEVA 3MV8D 3MJ8A 3PCYA 1T7WA 2ZXWB 4GUOA 5G2NA 5EIVA 2LU5A 3G5VB 3G08B 1UH4A 3N40P 4GAGL 4ONHB 1NBVL 4N24A 5CNHA 1P7KA 5K1NA 1DE4A 1KBBA 4BZ1H 3APCA 1EUUA 4PJEE 1U2HA 2X6UA 1VJSA 5KSAD 4FQLH 1EZSA 1NCJA 4HKXB 4PIRF 3O2DL 4H20H 4WU7A 3FTWA 5B8CC 1S7WA 1SOXA 3IMRA 3FQ1A 5D7SL 1P5UB 2AXHA 3OKOA 3TYGH 5B3NA 2VDOH 3P9LB 3LZRA 4LSDA 4ZSOB 2C1OA 2JJSC 5B7MA 2I07B 2O1AA 3A0OA 2MPAL 1MLCB 4OKVA 5I74B 3SCMA 4UQ3A 1L9NA 1IEHA 2ED9A 4XO3A 1R6VA 2X05A 2E47A 1PD1A 4OT1L 5E99L 3CVHB 3T5WA 1JXJA 4P2OB 4LBEB 2DD8L 2AS5M 4YO0A 4EUPA 4C59B 1ZHNA 1KTLB 3IXAB 2YHGA 3D85B 3QNYB 3OKMA 4OB5H 5GRYA 3SPVB 4WJ5A 2DMKA 2XPGB 2ZOUA 2EIZB 3NESA 2O61A 1JGVH 3IT8D 1CL7H 1PEZA 3HHSB 4S1DC 4M02A 1TJHH 3LS5L 2M83A 4HZLB 4BFIB 4HGWA 2W0LA 3KXFE 4OZIF 4KK6D 4AQEA 4F20A 3V0HA 4FQJH 3P4OA 5E6ZA 2VN5A 4PJ9C 1JPFB 4FL4B 4JR9L 1SJEA 5J7CC 1P4IH 4CADB 4ZQTA 1A4AA 5DI8B 2ZYIA 3WS6A 2GSIA 2RIKA 2AK4B 3P4NB 4JHBA 1OGSA 1CYGA 5B1BB 4AVHA 2YGQA 3T2PA 3C6SB 3RL1B 4ZSOE 2X4NA 3CFCH 3BKJH 3KGRA 3QS2A 1FO0B 2J8UB 3QZLA 1QEWA 5DFAA 3EBIA 5IHUH 3TO2A 4EZKA 1HL5A 1EZUA 5D93C 1E8YA 3MBEA 1PKOA 1G7IA 4P59L 4Y16B 5GJSH 2PR4L 5HVFB 1T0OA 2CXKA 4AZ8B 2AK1L 4KXBA 3Q3GB 1ZLUH 3MPCA 4TQHA 3D51A 1OPGL 1QFUH 3GD1C 5BZWA 1TTRA 4JO8A 4OZIE 1JUFB 5M7QA 2LW3A 4HT1L 3VGEA 4QRRD 4EQ2A 3GM0A 1RI8A 2BZCA 1U8IB 3ZKMD 1GS8A 3QEHB 3V7AG 4IU2B 5IKCB 4XO4A 3O41A 1MCOH 1P9MA 4N9GB 1T1XA 1Q94A 2P26A 2XX0A 4YVNA 2VSMB 3L5XH 2JJVA 1HKLL 5EOCH 1HTYA 2J5LC 2FUQA 3BWAB 3BWZA 3H3PL 5IT2H 4ZUUB 2X12A 3KYOA 1RZJC 1HHKA 2F54D 3C60A 4PFEA 4ZDHB 3N1GC 2A9MH 4GRMA 2ZXBA 1G5AA 4Y4HD 2HLFC 2WJ7A 1UWEH 1BZ9A 2K4AA 1QSFD 1Z6JT 2XA8L 2X6CA 3I2CH 3D09A 5FKPB 2ADFL 3LDBB 4LIQH 3NZHL 3U7YH 3B8SA 4QHNA 3VFNB 3T8XB 1A7OH 1KEML 2FZ3A 2WLJA 3KAAA 3GMQB 2YAFA 3G9VA 4O51B 5DI8A 3RQ3A 1AGDB 2F54A 3C60D 4AC4A 4KHTL 2X70A 1S5HB 3EADA 5LN4A 4LO9A 1FH5H 3C9NA 4G7VH 3SDXE 1PEWA 2MOGA 3WNMA 3BVNB 1IGFH 4LVHB 3BWUF 4E42A 2X7LB 3F58L 2ITCA 5FV1L 4F7CA 4YSAA 4K8RC 3Q8CA 4TN9A 5L2KA 1DCLA 4I4WA 3HG1B 3CN1A 3E8UL 3BUTA 3LSOB 2R2CA 1BX2B 1JN6A 2FZ3B 4BFJA 3VXSE 2I7SA 4L1SA 3K6DA 4YXLH 2Y7LA 1F18A 1N68A 3DC0A 3IFNH 2VDKH 2GI7A 3O6FC 5KBMA 4ANUA 2G9KA 1HAWA 1RZQA 3AXIA 4H4NA 5LLIC 3U0PA 1YDPA 3B2PA 2LABA 3EZJB 5CFHA 4TPRL 3BPCB 3RWFA 1BFVL 3NJGA 4X5WA 3KZ8A 2OK0L 3P11H 1QABA 2XWDA 3Q44A 4MCMA 5D4IA 1QG3A 2EZ0C 4OCWL 2ZIDA 3DRTB 2BVQB 3PGFL 5IEHA 2VXUL 1CFQA 3AS3A 4L1HA 2QSCL 3O3AA 4NRYA 5JDJA 3ZYZA 5IHHA 1BZ8A 4OB5L 4MZ2A 2YSSA 1FFOA 4PJEA 3IMVA 4PUBL 3UTTB 2RTTA 4CBPA 5DJDA 4PQXA 2CLVB 1N0XL 1KXTA 1RULH 1PLGH 2L3BA 3QJVB 1RUQH 2IQ9L 2JI2A 2YPLA 1R1CA 2HFTA 1TTUA 2NY1C 1PPIA 2JFCA 2C7FA 2VERN 5I15H 2QEJA 4U33A 4D9LH 4EKJA 2R15A 3QEQD 1JZ4A 2H32H 3BOVA 35C8H 3F7LA 3VRIA 1KENL 2O30A 5EN2A 1KPUB 1FNHA 2CR6A 2V37A 5I66A 3AS2A 1TFHA 1CURA 4IOIB 1ZJAA 2CGYA 1HSBB 3N1PC 2RD0A 1OALA 1TQCC 5E4OA 4B9CA 4NO3A 1AGBB 4DGIH 2X41A 4WU5B 3D18B 3R1GH 4BSWA 4FQHB 4HEME 3IF1A 4WNQA 1E8XA 2CH8A 1QQDA 2BC4A 4QHLB 2C9PA 1JK9B 1CDIA 4LRIC 3ZO0A 4NZDA 3C5XA 4RAHA 4GAGH 1XR8B 4XZ4A 3ROLA 3PLYA 4FFWC 4ZUTB 3QCTH 1U3HD 1MREH 3DUSB 4XPAH 4OFVA 2X9XA 5HGBB 1G7JA 3QDMB 1T5XB 3UTTE 3EO9L 4JAMA 1S9YB 4JRWA 1RV6X 2Y9RT 5DUJA 4AIZB 1JGUH 5IFAL 2DJSA 3K4ZA 2HT3C 4V1DD 3VXRE 3JBG7 1SYVB 1X7SA 3MLSH 4GQ9L 4MNGE 4WNSA 4FNTA 3HBPA 1NA8A 1KGJA 4FQCL 1OQOA 1EJOH 4P23D 4HEPG 2IGFL 1U8MB 2LFGA 4OUOA 5E6YA 1TJGL 1EIBA 1OAXL 2GTWB 4JZOA 2MQCA 4PJAB 3ULSA 2GIYA 3OQ3B 1WE5A 2BDNH 3ARQA 1JGUL 5E99H 1B2WL 4WFED 5INDA 4JFOB 1ES0A 3R06A 4UMGA 5T8IA 1ZLSH 2EUXA 1X5LA 1FO0L 5F6HJ 3N85H 2FEJA 2WTRA 4FFYH 3DDFA 1VFBA 3VXSA 2JXMA 1JGVL 1PX3A 3O3BB 3QEGL 1E8ZA 5C0GB 3X12A 3OPZL 5K69A 3AT9A 3BKMH 4LGSB 4YL4A 3ZQ9A 4L8SC 1A8JH 4H8WH 4A04A 4NN6B 1DBAH 3DUUA 1MVUB 3SODB 1GGBH 1MCNA 5FUCC 1OE1A 1L6PA 1AQHA 1FCGA 5B4MC 2NDFA 4KZCA 2R23A 1SUHA 3PWLA 4QXUL 2F74B 3IJ8A 3RAJL 1KTDB 2VERA 3FQYA 5J4MA 1ZT7B 1CF8H 3EYOB 3WO4B 1O6TA 3GMMB 5DT1L 5KG9A 4HIXL 3MNZA 1CGSH 1DUYA 1OSEA 1KBGH 3BZFB 5F7AA 3RYMA 3LQAH 4HUCA 4WO4A 3W2DL 5F7WC 3K91A 4LOVA 1L9OA 4ZO6A 3UTTD 5KUKA 2R29H 5SWZA 3TJPA 4AI7A 4QXUH 4XC1H 4M29A 3GMNB 4DVRL 1RIHL 4HUMB 4JFZL 3MV9B 1A02N 1VESA 2VDKL 5B7FA 4HDIA 3U2IA 1DANU 4MB5A 3UZQA 2ZX8A 1ZHBB 2VQTA 4NUPA 2A3TA 5DJYB 1YQVH 5DMKB 1IT9L 1BG9A 4ZO7A 2FIKB 4RISL 3BGFB 3KPNB 4Y5VC 4KFMA 2OJZL 2BFVL 4G9DB 2JJUA 3ZKNC 3HZMB 1PL3A 4Y9GA 2CHXA 3ARWA 4NO5A 5HDQL 3UP1A 1A3RH 4L1TA 1Z9SA 2XIBA 3QXVA 4R83A 4LHUB 4GW4B 3WSQH 2KMWA 2D0FA 2DQMA 1OB1A 2BJML 5B3JF 1TZHB 5CZXD 1TZAA 3KWXA 2VH5H 2NX5D <