5AB1A

Complex of the fimh lectin with a beta-cyclodextrin c-linked alpha-d-mannoside in cocrystallized orthorhombic crystals at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Anti-Adhesive Strategy in Crohn'S Disease: Orally Active Mannosides to Decolonize Pathogenic Escherichia Coli from the Gut.
pubmed doi rcsb
molecule tags Cell adhesion
total genus 38
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5ab1A00
3ME0B 4BUQA 2J2ZB 4AV0A 3JWNG 4XO8A 3SQBB 2XG4B 4X50A 5AB1A 1QUNB 2JMRA 3BFWA 5ABZA 4XODA 3BWUF 4XO9A 4XOCA 2XG5B 3ZL1A 4LOVA 4AVIA 3RFZA 4AVHA 1UWFA 5CGBA 4AVKA 4AUYA 4CA4A 4XOEA 5F2FA 4AV4A 4X5RA 2JTYA 4XOBA 4X5QA 4AUUA 4CSTA 1N0LB 4AV5A 5FS5A 5AALA 5AAPA 2UY6B 1KLFB 4J3OH 3JWNE 1PDKB 1N12A 1ZE3H 1KIUB 4CSSA 4XOAA 3ZL2A 4ATTA 1TR7A 4AUJA 5LNEA 5FLUA 2W07B 5JQIB 4J3OF 4J3OG 3JWNH 3BFQG 5FWRA 5IQMA 2VCOA 5F3FA 5IQNA 2UY7B 5LNGA 3MCYA 2WMPB 4AVJA 3ZPDA 5IQOA 4X5PA 5FX3A
chains in the Genus database with same CATH superfamily
5BUPA 1Y6KR 3ARBB 3DVNA 2NR6D 3D8MA 2FZ3A 4JM4L 4HS6B 1IV8A 2HP4A 3P0YH 2YD5A 5BJTB 4N3TA 1JZ5A 2NW2A 4ZFZB 4ODXA 4N5ED 2ZAHA 5C7XH 1HSAB 3C5ZD 1MVUA 4L1SA 5ABZA 1XH3A 1JZJA 3NVQA 4LP4A 1WIOA 1R3IH 3T4AA 1XTLA 1TNNA 1ZLWH 1O5DT 1WHPA 3ILPB 3KPNB 4MMXA 2J56A 3ZO0A 1FF5A 3ARRA 4DP0X 4BGDA 1E9QA 2EICA 1MJUL 3I2CL 5J06A 2VDOH 4H0IA 1FO0B 4WWKB 2BNUB 4AYFB 3IDNB 4AIXA 5E7FA 4ZAKB 1E42A 1O7VA 1I8KA 1SMOA 2DYPA 2EKSA 1MRFL 2VDPL 1X9UA 5C0DA 1OANA 3ZDYB 4E9SA 4PJXE 5GGVH 4FULA 3S4SB 3DGGA 2X4RA 1A25A 4TMPA 3FH7A 4XNYH 4Z0BH 2WVVA 5KSBB 4YHZH 2W38A 4G82A 2NZ9C 5E8PB 3T0VA 5DC9B 2IXQA 1U8HB 2CGRH 2ICWA 2YXWA 3FT4A 5K9JL 4U1IA 3FFDA 4XR8C 4MQ7A 3VGFA 1MDAA 1X5HA 3L7FB 2AJ3B 3LMJL 1E6OH 3SPHA 3HZMB 2O6EA 1NL0L 4B53A 1FZKA 1T0OA 3H56A 4KQ0A 1TDQA 5TF1L 3LKNA 1XCQB 4K8RC 2C4FU 1MHCB 5L2KA 3CQPA 1KJ2B 4ECNA 1N18A 4FQXD 4Q14A 3TBBA 5EIIA 1EUTA 4AEHH 2D3VA 3DRQB 4OZGA 2ZAGA 1JZ6A 1YMMB 3QQ3B 4HS8H 1OV8A 4NS0A 2FO4A 2KQMA 1YDPA 3FTXA 3TVMB 2NOYA 1XSJA 2WNKA 1NKRA 1LWJA 1J9TA 4XMKH 3QIWC 5IVXB 4KKCD 2AQNA 3SIKA 2C1OA 3DUUA 3GWJA 3I6KA 3KBFA 1S7WA 5JIQA 5H37H 5G2NA 2J5LB 1ZIAA 2EYRB 3FQXA 4OIBA 4DVBA 1XIWB 4Y5VB 5CMAB 4GY4A 5DJ2A 5T1DL 3WJMB 1NIEA 5I8KL 2AEPL 2WLJA 4HAGA 3BE1L 2FT6A 5DVLA 3TX4A 4OVUA 4HUVB 3QQ4A 5EEZA 1TFHA 1OD7A 4AXWA 2QGCA 3QPQD 4NIKB 2CIIB 2VDRH 4P07A 4LLDB 4D0BB 2QQLL 3QIUC 4W4OC 5DGQA 1O6VA 4EOWH 2HN7A 2YPLE 5ANME 3V6OC 3TIEA 3VFGH 2I9TA 1KGUA 1PZ2A 1KPUA 5BRZD 1KLGB 2G4GA 3T65B 4C4BA 2DQ6A 4BFRA 1F58H 2FD6H 4N2EA 4GP4B 4LKXB 4XZUA 4EBQH 1B0IA 1J1OL 3D39E 1PGRB 2OK0L 5SWZB 1B4RA 1AGBA 3FN3A 2VLRE 4WUKL 5ICYB 4GMTH 3OR6A 3QZWA 5ACMA 3ATEA 5AOKA 4GI9A 4KOBA 4Y5YC 1UHVA 2P44B 1BREA 1GYCA 1KCRH 2AMGA 2WINA 1AQKL 1DSWA 1EFXD 3GMOA 4G8IA 4F57H 3W81A 2WBJB 3B9KB 3FU7B 3U48A 2ARJA 4U7KA 2FJGB 4U49A 5DWPA 5CEXB 2UXVA 2F8IA 2FEDD 2C3VB 4ODWB 3WMSA 5AW7B 5JPMC 4IOIA 5TTRA 2WXOA 1YZZA 5HXMA 3NSJA 5FYLE 3CLEH 3UPAA 4X7SH 3FW6A 1LNUB 2QDWA 3U36B 4ZFGL 2R1WB 2ZUYA 2CKNA 5A3ID 4UU9A 2IGFH 3MRDA 4HH9A 2K6YA 5BRPA 1FFNA 3BUIA 4QXUH 5LGJB 2P43B 5C0ND 3IU4H 4TKWA 1KB9J 2J21A 3K8LA 5E94A 2AZAA 3E3QC 5KVFH 1OGAB 2XQ0A 2EDHA 1FYHB 1IAOA 4JN2A 4IMLA 3O2VH 1D9KA 4HEPG 3GD1C 3FFCE 3VFOA 4K9EH 3IXAB 2AQTA 4FCHA 3EGSB 4X8XA 4WW2C 5E24E 4JQIL 3CDFA 1GZPA 5HI4D 1DL7H 4MAUH 3ERXA 1BFSA 4HK3J 1OTTC 4HKXB 4OCSH 3LS4L 3FFOA 4DZ8A 5HI3D 5L4FA 5CSBA 5FYKL 2J6WA 1IL1B 4JCLA 1FNGA 1TQWA 3MJ9H 4ZTOH 1RUAH 4JFXB 4FDWA 2XTJC 2CPUA 5C0BA 1ZSDA 1QBAA 5C0FB 1BDYA 2K4AA 1U8PB 3ASOB 5F3FA 1SOQA 3VRJB 4O9HH 3ZKND 3S8FB 2ZP8A 4YH6A 2DQJH 2DQTL 4IIQA 3V55A 1IKFL 4S0SD 3N40P 3CZFA 3K1KC 2VDMH 4WUUE 3S3JA 3POHA 3UTZB 5HYSA 3HJ0A 3WLWD 5ESQB 3PREA 3D18A 2V7HB 3IJSB 5EF1A 4PRDB 2QVFB 3HZYB 4ISVB 4WW1B 3DPBA 1MCCA 2I25N 3MJ8B 4JPWL 1XSKA 3OGOE 1L0YA 3P02A 3JV4A 5I74B 3RJQB 4FLOA 3D12B 4MJ5A 1T7XA 5AVWB 3LRSB 3OXRA 4OF3A 4P48A 3TBYB 4M02A 2I85A 4HUWB 3SE4A 3ZZQA 2X7LB 2HRHA 1CLZH 1OARL 1DTUA 1U95B 3RFZA 3GBNL 4MD4A 2CU9A 2OL3A 1KIUA 2YQGA 2Z91A 5I1DB 1YN6A 5C0RL 1YUHB 3T3MB 1N6VA 1Y1DA 1IM9B 4PJHA 2Q7YA 1OD9A 3WS6C 4B97A 1LO4L 2XQYG 3EHBC 3FN0H 4H2CA 5GJTL 5GS2D 5LAXB 3ZTJG 4WTQA 1GHFL 1HSBA 2P5WA 5H94A 3HN3A 2PXYA 3P3UA 3C2AH 4N4YB 2K0RA 4AQ1C 5E5LA 4KJPC 3GHBH 2FLBT 5FO7A 3ZU8A 3GJFB 3R7RA 1A7NH 4L23A 4OAWA 3T1WA 3H7BB 3S3DB 4C8XA 4NRYB 3EYOB 4M6OH 1DSFH 4XN5A 4LGSB 1MZZA 3VB8A 4FOMA 2YD9A 3RUGF 3NZ8A 3BJLA 4Y1AA 4PUBL 1QLEB 4WV1A 5IT2L 3JWNE 1SEQH 2XTLA 5HVWA 4D9RE 3WFDL 2X4SB 4JG0H 3VG9B 1QFOA 1XCTB 1FHGA 4G8EB 4GFXA 3MJ6A 2YFOA 3WLBB 1IMHC 4KMTH 3EYSH 2VISA 1HNGA 1TTGA 2AJVH 1JNLL 3PUUA 5AUMA 1JV2B 1NFDB 4BH8A 1NANH 5JHDE 1AYOA 3DV6A 5LKNA 2DH2A 2Q7NA 3WIFB 4BKSC 4XPFH 4PWEA 5LDUA 3BX7C 4NO2A 5F9OH 2OXGB 4GP5B 1T21A 4XMUA 3MCKA 2OAAA 5EC2B 4JPKL 4YPGA 4YX2L 3NOIA 3ZK0A 2ED7A 4M7JL 1UZ8A 4RZCB 3VTMA 4DGUA 5CEZL 3L4ZA 3JT2A 1FVCB 3H3PL 3W39B 4MNHB 4MXVF 3M46A 3T8XB 3ILQC 3VD9A 3BDYL 5A43C 5FYKD 3Q8CA 3F12B 1KTBA 4IRZH 2X40A 1FFQA 4KMQA 5H37G 4YMPA 2J1YA 1ETJA 5JO5B 4YVNA 3MFFA 3PGDB 1DQLL 4N2BA 3S5LG 1MIEH 3VVVA 1ZMYA 3KPLA 3OAWA 3WKML 3GIZL 3P3SA 4UQ9A 5HSFA 4XHQA 4L9LC 4R5TA 1FJ1B 3GIVA 4XNUH 4LIQL 2VW7A 5INDA 4Y9BA 4Z7IA 3GSUA 3HCVA 3SDDA 1G84A 1P7BA 4L4VA 1WCBB 2ZXQA 4JNXA 4ELDA 4ZRGA 3RU8H 3VWKD 1B3JA 2HFGH 3O8XA 2XACC 5JHAA 4QTHA 5TQ2L 1IAKA 5EZJA 5LWYH 1VEMA 5L4JA 5FOBA 3FH8A 5T33L 1I1AC 1XDTT 1N68A 2ZUUA 3L5WB 5ID1B 1XSOA 3BZ5A 4DQAA 5C0AD 4ZNCD 4U05A 5I1GH 4P2QE 4PLKD 2ICCA 3RWIA 5MEQB 4FFZL 1BQHG 4GBXA 3ZO9A 5BVJB 1I8IA 3SE8L 4E0RB 4K3HA 3FUJA 1WYJA 3K72B 1RZ8A 2GSIA 1H6TA 1S9WB 2OMZB 4A7GA 2VUOA 1BM7A 1JJUA 1OQXA 3IJYB 2FIRT 4YE4L 1FYTB 5ELIA 3U6XS 2W95A 3GKWH 1Q0XH 3D39D 4G8FB 5K93A 2A6IA 4PJAB 3KL5A 1AO7A 1UA6H 5KYYA 1QTYT 4GS7C 5AOLA 4C56E 1NANI 5DK3A 3ZVVA 3MROA 12E8H 1RPQA 2XV3A 1NMBH 4WI3A 3TCTA 1JPGB 4BWUA 4YSDA 1CXHA 4L2LA 4U1LB 1ORQA 1DQKA 4PRPE 3QZBA 3SKJH 5IZ7A 2VAAA 4IRSB 1A6VH 2VL5A 4AW7A 4ZYKA 5IMLA 1DBKL 3MVSA 4LCWA 4PIBA 2A77L 4FFWD 2YKLL 5BS0D 1ZJBA 2LLGA 4EKXA 2EUVA 1PY4A 5FYLD 1SJEA 5D7LD 2HFEB 1GRWA 2IF7A 1PZCA 3RPBA 3SDCA 5KVDH 1GOFA 4NWTH 5KSUA 4MZRA 2WZ6A 2KLTA 5CD3A 4N9GB 3BVNB 3ZQWA 3U0PA 4GJTB 1JIBA 4U6HB 4NENB 3MOBL 4JFDB 4R6UA 1A14L 3STBA 3EFFA 1CTMA 3FQ2A 4HJJL 1MJJA 2CCWA 2WZ0A 3ESOA 3Q8FA 4U1NB 3BQUB 1S9KC 1AXTL 2JV6A 2DTML 5I8OH 4Z77A 3SO3C 2DWSA 3T4AC 2ZT9C 3B83A 3VMOA 5IG7A 4PB0H 1A6PA 3U9PL 3O0LA 4DVRH 4MMXC 4NOFA 2AZUA 5FPIA 4PJBE 2A9CA 4M8RA 4ETQA 4YSSA 1YLBB 1U8LB 1HE8A 4ELKB 3QI9C 4IEFA 4XO3A 3RI5K 3Q13A 3UCQA 4OGYL 4S1DD 3WUWA 5C2UB 1LYQA 2OMUA 3LRLA 3QIWB 1TVBA 4X6CB 2RJMA 1E9OB 3RDTA 5FKAB 1QBMH 3NYKA 4M5YL 5EIIG 3LNGA 2Z93B 4NCDA 4NRXA 1F4XH 1WAAA 1OSZB 2BIHA 1XF4B 4K94C 3K2KA 1E40A 4Z7UB 4I4WA 2G30A 3ELAT 4ODHH 1QPKA 1Q9OB 3ET9F 2GSGB 1A02N 3DBSA 1M7IA 1EHLL 2VR5A 3B4NA 3RVWD 4DP6X 4U1KB 1G6VK 2IWFA 3ARFA 2C3GA 4Z7VB 1ORSA 3U1PA 4YXHL 5F7HA 2C9VA 5JDSA 5DD6B 2H32B 1MNUH 3D87B 3WG7B 1PD0A 3I75A 4UTAH 4FG0A 4H25B 3M07A 2FBJL 1T4KA 4HIXL 4NZ8A 3RL1A 1C5CL 4Y5YB 5DDHA 4PJ5D 1G7MB 2ED9A 4JFFA 3ZDYE 2RCSH 1BAGA 2R23A 2FNWA 3VNZA 3VI3A 4IU2A 1MG2C 4LLUA 3PQYA 1J05B 1JMZA 2DWDB 4M1GL 5KSBE 3EBAA 1DBJH 4UILL 3ULVE 1YPZB 1MY7A 2WD0A 5JPMB 5DI8B 4NZJA 3VSTA 3H54A 4AUJA 3DURB 3TCXA 5GGQH 2X1OA 4XPTL 4LHUB 3KLHD 3LCYA 4PSPA 2AQRA 1L3NA 3DROA 4I48B 4LHJB 4YSQA 4JE4B 1PFOA 3MC0A 3X13B 1PS3A 3LZFH 4MJ4A 4H0LC 1KGXA 3GM8A 5GGVY 1G7QB 5FUZL 1JWSB 1WBYB 3PAVA 4OF0A 4JPIA 1YJDH 5HY9A 4QT5A 3WDIA 3QR0A 4HJUA 5TPWL 2H9GA 5IW6A 4A6YB 4CVZA 4KV5F 2XETA 2Z0BA 2JWYA 2HT2C 3KCWA 3OHXB 2DQUH 1YMME 3U7WL 1VCBC 1T1ZA 3O3DA 3ABMB 3PGFH 2HRPL 3D25A 1Z0NA 5FM4A 4YDZA 4FQCH 4A39A 3G6JB 4HG4J 4XC1L 1J5HA 3DBXB 4XWOC 5I1LA 4WW2B 2D9CA 1JPTL 5IVXE 2NX5B 3LS5L 4S0HA 1IGYB 5GRYA 3L3HA 5EUOA 3VI4F 5DMKB 1OT4A 1XSIA 2VIRA 1HXKA 5D5MB 2C3XA 3NP4A 1D5ZA 5AKSA 3DIFB 3VJ6A 3KGUA 5F7UA 1A7OH 1TJHH 3F7YA 4U1JA 5GSRA 4BXVA 1MAKA 4Z7NF 2DQEH 2E7CA 2QL1A 2VN7A 1IVTA 5IK3A 2XZAL 4HWBH 4QRRD 4D0DA 5JHDD 2VN5A 4PRAA 1HHKB 4ODSL 3EJSA 5JPNA 2UUDH 3DK2A 2Q5BA 2XBTA 3KPTA 3O2WL 4RZKA 1AXSA 4OT1L 3U7YL 3FJTA 2VO5A 4Y7MA 3JVFC 2AW2A 2H6PB 2JJUA 4CA4A 2NTFB 5SWZE 2IPKA 2NW3B 2W0FA 2NLJB 4WI0A 4FFVD 1PZ5B 4Y16D 5D8JL 1CD9B 3RHWK 4JDTL 1R5IB 4FE9A 3FCTA 1D9KC 1BYPA 1UYWL 4MRBA 1R3LA 2C9QA 4KK9D 1MHEB 4HHWA 1WFMA 2G75A 2VR9A 2J71A 2W0LA 1ZAGA 2ZSWB 4K73A 2HT4C 1J0YA 1DDTA 4QHKI 5IM7B 4PWGA 3LXCA 2IH1A 5DURB 1WUNT 2CMRL 5CCHE 3SGEH 1SJHA 3N3EA 4WTXA 1B4TA 3EYUL 3W9DA 1G6RA 3WY3A 4NNPH 3CDCA 1NLBL 2EC9T 3SHSA 4WO4D 2YRZA 5MI0C 3EHBB 4N0RA 4MA3B 4MA1B 1BJMA 5AZEL 3VXRA 1V5JA 2OW7A 1KFAH 3QIBA 5H2BA 3MNZB 1PLAA 4AQ1B 2JXMA 4IIQC 5SWQA 3GHPA 1A6ZB 1A6UL 1NGQL 2JJVA 4HS3A 4IS6A 1C12A 4R0LA 3ML8A 5FOJA 1OGAE 2JCCA 2XG5A 1EIBA 1TZIA 5JIKA 1UD2A 2Q8BH 5D7IB 2ZG3A 5C6PB 4DP7X 1JK9B 1EEZA 4JVPA 1KYAA 3K0YA 3N0PB 4LPUA 4XAWH 5D7JB 1A7RH 1CDCA 1CD1B 2A3TA 2L04A 4RRPG 5CEYA 2G3NA 3SODB 4QY8A 2B1AL 3NSFA 1JUFA 5GSVB 1DANT 2CAKA 2UXGA 1HS6A 4GSDL 4QTIH 3TT1L 4F1ZA 1A4AA 5LBSH 3SE4C 3U6RA 3R8BB 5JHLH 5HGHA 2X3AA 5HGBA 5CN3A 4CVXB 1IQDB 2QFRA 3HI1A 4U6TA 5IHZA 3FHQA 1MQKL 5AW5B 3O41B 4JRYD 5I1CH 1QR1B 2G4EA 2X05A 2ATPB 3DO7B 1A6AB 3QWOA 4A66A 4PRPD 2DIAA 3IAQA 5I8CA 4TUJA 2OP4H 4YHPB 5F7BA 4APQA 3L9EA 5EUKA 3QZPA 4GSUA 3HMXL 4M7LL 1NMCC 3L9BA 4XBPB 2PXYC 3N44B 1W72B 4LKCB 5DYOB 4NWUL 3LHPL 2F58H 4GKLA 4P9MH 3Q48A 1MIML 3IB4A 3SE3C 1YEFH 2VN6A 2MCPL 2OTWB 4UM8A 5LQBH 1VJSA 2BJML 1QNZL 3BW9A 4BQ6A 3BXNA 5AEAA 3O6FA 3SPJA 5KOVC 3TO4A 3GJEA 5DRXB 4O4YL 3E2HC 1NBYB 2X2IA 1YO4A 1UJ3B 3R8QA 2KH2B 5GJSH 4N8CL 1ZHBA 4HUXA 2YS4A 1SXCA 2JK5A 2CKBA 3SGEI 4PYHA 2FTAA 2NXYD 1T3FA 1I8LA 2R56H 5CJQL 2CUMA 5HHXH 1CFBA 3T3ME 1P84K 3VFWB 3ZE1B 2VLKA 1M7DB 1FIGL 5KBLA 4L9LB 4GRLD 4M1CD 4F8PA 1D5IH 3N41B 5DUML 3HG1A 2V37A 43CAA 2PWHA 2UY6B 3AACA 3B43A 3DUSA 3QW9A 3PHQA 3V5HB 1XX9C 5AWNL 3ARDC 3CBRA 2J3SA 2YHGA 3CZGA 4JM2F 3MRIB 3K4AA 1F86A 5BRQA 3WNLA 3FOLA 2I60H 3QFJB 4UT7H 4OQTL 2GIYA 4E36A 1OAXL 1I1AB 3BKYL 3ILDA 2AJUL 1F2XK 2K7QA 2AXFB 4ZO7A 2BVPA 5L6YH 1EO7A 2WLHA 2YIHA 3RVVD 3UTTA 1JHKH 4Z78B 2B8OT 1JWMA 4Z7WA 2UZPA 2BNQD 3FAWA 1M2VA 1WZKA 2XZCL 1ET8A 2NY5L 3S5LB 1M42A 3M8OL 2KPNA 2R51A 1L3WA 4PRBB 3S8WA 2DICA 3G6DH 4XXDA 3L3GA 4Y4HB 5F0JB 3KPSB 1A2YB 5IB4B 2VDRB 1AY1L 1IT9H 3WNOA 4IOSD 1N5AA 5ICXB 4YSEA 3ATBA 2G0LA 4GS7B 2XXMB 3D07A 4U6XB 3SSGA 1P5VA 2B16A 1ASQA 2EDFA 3BT2L 1UT2A 3H0TA 5EO9A 3EZJB 5GGSB 1NFDE 4PW3A 4X98A 5DK0B 1FDLL 5FHBL 3TNMB 1R33A 2AK4A 4TUKH 4HIEB 3B5GA 4F3FA 4YXLL 1IEAB 2CA3A 3SDDC 1DR9A 1LXMA 2GEQA 4ADJA 3IDYC 1GKOA 1B9KA 2GITB 2PO6A 3LRKA 5HHMD 3O8XC 3T6XA 4QNPE 1GC1H 2KPWA 4I77L 4FQHB 4N3UA 2JKIS 2WO2B 1I9RL 5KYWA 1DVFB 4PJ8A 1MW0A 3MV7B 1NCNA 3GHEH 4KK5C 2Y36H 1DBMH 3N5AA 4Z8FH 1OB0A 1PFCA 4YBLC 3KNBA 2RFXB 5B4MD 5IFHL 2Y1AA 3GXMA 2EZ0D 4GBXC 5EH1A 4ODXB 5C0JA 3OWRA 5C0CA 2EC8A 3BQVA 5L0QC 1MVUB 1F4WL 5BOZG 3IGAB 1XH3B 4HWEL 4KJQC 1C5BH 5CNHA 5FKPB 1S7TA 1YMMD 3SO3B 3T4AB 4P8QA 2VB5A 5IROD 1F00I 3TVMD 4MMXB 4EVNA 3EYVA 4XOEA 3VM5A 1Z9SA 3MI6A 2DD8H 5F2FA 1CDIA 5FA3B 1INEL 1UXSB 1HXYB 2G9HA 3QI9B 4I89A 3F7PC 3TU6A 5DUPH 4NEHB 3UZVB 1KJMA 3F7QA 1XIWD 3OGCB 2DYPB 1I8KB 3EJTA 2WVTA 4D7BA 1E4HA 4JFHE 5C0DB 4L29A 3QDHA 4IQHA 3N50A 4KHXH 2EADA 5FS5A 1N70A 1QSFD 2ZYIA 3LNIA 6TAAA 3EGXB 4NO5A 3B7UX 4W4NA 1LL1A 2WVVB 5I1AB 1UUSA 3BKMH 1CDUA 2Y07L 3PDDA 1CXEA 3FNKA 4GQPH 1UD8A 1ZE3H 2QPDB 4P46D 5F8RC 3SDCC 3WIAA 2ICWB 3FT4B 3FFDB 1OM3L 2LFGA 1FYTE 4WU7B 2APFA 4MMYA 5IB1B 4P9HC 2O5NA 3B1UA 3K3QA 3MODL 4PJXF 3HPJB 4FQPA 3GK8L 4PJAE 2FJSA 2W88A 1KYOK 5DTFB 1KG0A 4WGKA 1DVYA 3ARQA 3BAEH 1QOKA 1XGRA 5EIIB 1KENH 4EI5A 2WGNB 4I85A 4KMLB 2IG2H 4R96A 2WHVA 1OHZA 1UFUA 4H8WC 2A7BA 3FT0A 5E6IA 5MERB 3J7HA 9PCYA 4AL8L 4WEMB 3RP1A 3E7JA 3QCTL 4NQCA 4OM0H 4FXGA 2GPZA 3UYOD 1KN4H 1DBBH 2VGLM 3K91A 1U33A 3ETBJ 3JTSA 3TA4D 3RDTC 3DUUB 4Y9FA 3VFVA 4F8TA 5A2LH 1A3RL 5SWSA 3VX0A 1QFHA 2ICES 3SDXA 5DJ2B 1OAKL 2PPEA 1CDBA 4AMKL 2FJHB 4R97C 3FDWA 3QQ4B 4JFDE 3RURA 4N2OA 5F9JA 5IJCC 2WC7A 3QNXB 2ZE0A 25C8L 4AXWB 5CGTA 3ZZLA 5FUOH 2ADGA 5BO0D 5DRNB 4FLHA 2MIZA 2D31A 4E41B 2DM7A 1FFOB 1UVQB 2A6JA 3ABZA 5DS1A 1JZ4A 1BBDL 1NAMA 2JKJA 3HI6L 2NT0A 4KUZH 3FOMA 4U6YB 1V7MH 2H1PL 3HBGA 5IBTH 3O3BB 5IHWA 4K55A 5L9DL 1AGBB 2F53B 2VZ1A 2DQIH 1QLRA 2YSSB 1T7VA 2IAMB 2NCEA 3OR6B 3QZWB 4NBYB 5AYQA 2ZOTA 1QVOB 1F4AA 1NH6A 4G8IB 5KANG 5D7HA 3GMOB 5CP3H 3UG3A 2ARJB 4BSVA 5I23A 3LKQA 3FF8A 1NINA 4Z7UE 2AEQL 3BJ91 1WFUA 6CGTA 3HRZB 3FB7A 4QKTA 3F00A 4LOEA 5DMGC 5I5JA 5J0BA 4JG1H 3IFOA 2OFQA 1CLVA 2NY3C 3NK4A 3IDXL 3MBED 4TUOA 3V6OE 1AI1H 4Z7VE 1OK0A 1JZIA 3L9RB 1LLAA 2LR4A 3TJPA 2Y1ZA 4LDOB 4UU9B 4F7MA 1FCCA 3MRDB 3DX9A 3MMEB 1E27B 2YGOA 1KYDA 3DI3B 3MLRH 3RVUC 4GSXA 4FQ1H 5CJXA 5DFWH 1HINH 3QUXB 4W9FC 2LLNA 3L2NA 4WHYG 5E94B 3F3HA 5CR8A 1A6WL 3IVKB 1RK0A 1IAOB 4JN2B 4IMLB 1D9KB 1S7QA 4BWWA 4XPBL 5EN2A 1SDYA 4XE5B 5J3HC 3REVB 4UOW0 5C09A 4FNLH 5JYMA 3QAQA 2MRYA 1MHHA 2OCFD 3LZPA 4KY1H 2HWZL 2OJZL 4HQQH 2UZIL 1YPZE 4G5ZL 1IM9D 5FECA 4G8AC 3QHFH 4J6IA 5AG9A 4EUPA 4O2CA 4EIGB 4QKXB 4HXAL 3FUKA 1FNGB 3T8MA 1BD2B 4RMSA 4B9FA 5GS0H 4MJIE 1HKFA 2XVKA 4G3YL 1WHOA 1J12A 2IH9A 4M6NL 5DRZA 5B1BB 1CGUA 3NUKA 2F1BA 3VXTB 1R9FA 3RWEA 2CJSA 3FSZA 5JPNC 3VW3H 2QQNH 1AS8A 1EWHA 1P7QA 4Z7OB 2A9DA 1LTXA 3PWUB 4IIQB 4PLJC 5CLTA 3KBPA 3EBIA 3ZDZB 5L2JA 3CZFB 3RJDA 3E3QE 2ZWLT 4JO4H 2F19H 4ESKA 4LVOB 4RMWA 1T1XA 2VJ8A 4RDQF 4S2SA 1YYMH 7PAZA 3BWUF 3D18B 3G6JE 5EF2A 3VSQA 1E5BA 3BSZA 3DPBB 4OD2B 2XYBA 2NX5E 3QE5A 1JYXA 2X3BA 3CE1A 5A7EA 3CDYA 3EO9L 3VXMB 4JFPA 2JB5L 4MJ5B 4RRPM 3K8KA 4MJ6B 1IAMA 5CGBA 3RTQD 3OXRB 3ZYIA 1N5YH 5D5ME 3QFGA 4YHLH 1BVZA 5AW3B 3VACA 3FTWA 4TTGA 3AS1A 4AQAA 2W80C 4J28A 1OIOA 2VLJB 3QHZL 4XVJL 4QHPA 1QEWB 4MD4B 1R3JA 2OL3B 3MV8A 5DEZA 1WQVT 2H4EA 1KWGA 1YCSA 4NZRH 3U6XA 1U8MB 2OMBA 3OQRA 3W82A 2IFFL 5DR5L 3P11H 4PJHB 4OVVA 3PWLA 4ZPVB 3UBFA 3GSNH 4W9DC 1IGJA 1HAUA 1S78D 1SY6H 4RSVA 5KSAC 2BSDA 1OF2B 1EAJA 1HSBB 1YC7A 4LSPH 2DIBA 3L17A 4MCZA 5FYJE 2C8NA 1NMCB 5B1JA 5BUAA 1SN5A 3NFPB 4TF4A 3QIBC 2JQZA 2F2HA 2F1AA 1F6AA 3CFTA 4UDTA 3OAUL 4Y4KA 4LSRL 3MRMA 5FO7B 3GDBA 4AZ8B 4R0LC 1EGJH 1BFVL 4NNXA 2X0VA 2F7OA 3LOWA 4JO8A 2EDRA 1CCZA 2PKDA 5FGCB 4ORZC 3LYRA 3DLQR 3P9LB 5I8EB 2P47B 2G5RA 3EADA 4WJKB 2VZSA 3PP4H 5D7KD 3VNYA 3COOA 3E2HB 4GKNB 2HKHH 3SKNB 3HG2A 5DZ9A 2B0SL 3BSHA 1V7NL 3NZ8B 1TCRA 3L13A 3NJVA 4Y1AB 3HAEH 2IGLA 3WE1A 3NDYE 1NGYA 4N90E 3SY0A 5MEPA 5DQ9A 3APDA 2DQHH 3PJSA 4AC4A 2ZNWA 4WEBH 3OB8A 2VISB 3NAAH 3ZT6A 1G5GA 4JO2L 4NHCL 4P3CH 3T0EA 3H85A 3ARDB 5AUMB 1NFIB 2AXHA 5EU6E 3BC9A 4TQPA 4BH8B 3RGVD 3QORA 3DV6B 4FA8A 4HXBL 4APQC 1RURH 1KCUH 1F4HA 4NO2B 3K4DA 2YMXL 1LE5A 4LSVH 4U4IA 3MCKB 5D7IE 1I1YB 1B2WH 1N64L 4YSTA 1GCFA 2CHZA 3FMGH 4P4RA 1XGTA 2EYSA 4GEJA 2DQFA 5T3XH 1FYTD 2DOCA 3PL6A 2JMRA 3O6FC 1VEPA 5M94B 3TO4C 4PWHA 5DUBA 5I9QC 4WJ5A 3UTPD 3MXVL 1T5KA 1T2JA 1GGIH 4W6YB 2BXZA 1S9VA 3ARED 3MRKA 3ARGA 3C5SB 3N42B 1IM3B 1WGOA 4XXWA 5CZXD 4IRJA 2DW5A 3W2DH 5IIEA 3LEYL 3JWDL 3ZYJA 3C5JA 4LVEA 3CFBB 2F08A 3C08H 3MFFB 2A73A 4JAMA 1AR1D 1MHPH 3LH9A 4L4TB 3MRGA 1I9JL 2IH3B 5HD8C 4HHGA 1GZQB 1TQSA 2IBGA 4IRSD 4KK8C 4XI5D 4Y1TA 2UXFA 2H26A 4NERA 3VWJA 2WW8A 3W9EA 1J8HA 1QSVA 3HCVB 2CBTA 3EO1A 3RWFA 4GP8B 1JMXA 1A66A 3L3OA 2UZXA 4UT9L 4I88A 4DN3L 3O8XB 4L5FE 1BLIA 3TTSA 2XV2A 4M61A 5EZJB 1UKTA 5FOBB 2XDHA 2GAZA 2HUEA 1DCLA 1H19A 2WMPA 4QO1A 3WHXB 2GI0A 2CE6A 2NXZB 3WIHL 4O02A 1O6SA 3BQUD 4YBLB 4C59B 1I8MB 3RWIB 3KJ6H 4GKSA 4BE5A 1FL3A 2UYLB 4PY7B 3Q6FA 2GSIB 4TVPE 1AYRA 4NKIH 4FFYA 2KLRA 3JWOC 2P8PA 1YNLH 4Y4FD 4Q2ZA 2MFNA 1R5WB 1TQUA 2BP0A 4FCAA 2VABA 4QHLB 3X3FH 3EJRA 3ZXAC 2XPGB 4OCRH 4HBQA 4F7TB 3HNSH 2F54A 3CBKB 3ZE1E 2BSBA 2H2SD 1AD9B 2A6IB 3MO1A 5IGXL 1NM9A 4CKVX 1Z9NA 2YC1B 5IMOB 4UQCA 4J6RH 1GYUA 2XVGA 2EDWA 4R7DA 3MROB 3GSVA 2WGXA 3FQNA 2X88A 2XPYA 4QLRA 1TUPA 2FR4A 1MCFA 3ZTNL 2JIXD 3WNIA 4LGRB 1ORQB 3E9TA 3QFJE 1R5VB 1XT5A 2AI0H 3NPSC 5ALCH 5BZWB 4X4YB 1S6NA 1FUNA 1KB5A 2VAAB 1U8OA 4NP9A 2DWTA 2VL5B 2EIBA 2PLTA 5GGTH 2F1EA 3HS0B 4HHAA 4ZYKB 3VFNA 3PDGA 5IMLB 2PO6C 5KVGE 3QDJD 5F7YC 5I2IA 1SJEB 4ZX5A 2GVYA 2NQ3A 1MFBL 2YD0A 5E9DA 4M9PA 5E2TH 5E1IA 4PJ8C 3TT3H 4HKBA 3CVHA 3QQXA 2B20A 4KROC 1B0GA 3K5RA 2CM5A 4S10A 3RIFF 5JIIA 3UZQB 1CFTB 1L9OA 1JZFA 3UJJL 1RUKL 4HKZB 4EF3A 3EFFB 1JGIA 2VRKA 2GTWB 5KYXA 1QYGL 1ZLSH 4YR6B 4TOYL 5I75C 2JE8A 5HDRA 3IJ8A 4GMSH 4F7KA 4G7YL 1T5XA 1ZS2A 3H9ZA 5TFSL 4OGXH 3QC6X 1VZGA 4ALAC 1IGCH 3LH2H 5EC1A 1FNFA 3BHBA 3QDGD 3A6OA 2YMTA 4IEFB 2Q9OA 1KN2H 3C60D 1RERA 2M26A 1M6UA 2EO7A 1NC2A 3P0YL 4U1SA 4RGMC 3R19A 2Y5EA 2HJFA 2ZOKA 1INDL 3LZNA 4ZPTB 2BRRL 4PRIB 1OAYH 2ZG1A 3SDYL 3H9SB 3MV7E 5HYEA 4PRHA 5I76B 5CGMA 3RVXD 1F1AA 4RMBA 1PQZB 4KTEH 1B90A 2MHAB 4PIRF 1J9CT 5CFAA 4PJBF 4R97B 5IP4A 3NQKA 4I4WB 1HFUA 2VDOL 5I6LA 5I6PA 1M7IB 4EZLA 3E6FA 1QW8A 2IDUA 3M17A 1ZV9A 2X1XR 4W6XB 1GOGA 3MRHA 1IC7H 4LBEB 2GQHA 3TA3D 2WLIA 5GGVL 1L9QA 4G8GA 2VMCA 5HGDB 1ZVSB 2YAOA 1TTUA 3B5HA 2NX5D 4P49A 3I75B 1U8IA 2NQCA 4ZNEE 4KKBD 4J3VA 4PRNB 1U9KA 2EH8L 3SCMB 5DDHB 5B3JE 2CGRL 4JFFB 5E6IC 4BFNA 1BXVA 2B9BA 2AXGB 1MUJB 4FXGC 4WI4A 5B8CA 4IU2B 2J6EH 1E6OL 4UI2A 4JG5A 3UX9B 5F9DC 3IN0A 5E0FA 3DDGA 5KBKA 3TZVD 1ZT1A 1ZHNA 1BOYA 1HHIB 1MRDL 4TSBH 4AGMA 2XVLA 3P40A 2CRMA 4J3OC 1JP5A 4LAQL 3FTYA 4TNWF 4TSAH 4FX5A 2VZOA 3WFBH 2ZKHH 3WN6A 2FH6A 2JKSA 3DROB 1AZUA 1F3JA 4Y2OB 1AIZA 2EDOA 2XWDA 3LKRB 3ZYOA 4XCNA 4N8VG 2AAVA 5D71H 4QYOB 3TBVB 4RESB 1E8WA 2P9RA 4XMKL 4Z3IA 4MA7L 5KSBF 1JTPA 3DX6A 5MP6H 2L8AA 3ULVF 4V2BA 2Y22A 3KWUA 3OKEA 1I3GH 4B5ZA 1FI8C 3AU1B 1T1ZB 3PY9A 3D25B 4LLWA 3FB5A 4CAGA 5ESAA 1BV8A 4URTB 4FKEA 1TMCB 1JGLH 3P30H 2NTSP 2XWTB 5DURD 4Z6AT 4GAJL 1YN7A 1B3IA 3FAXA 2J8UF 1D5MB 3L3HB 1Q0YL 1TPXC 1OCWH 4N90D 2B5IB 4IGBA 4K94H 2VIRB 1IC4L 4OCNC 1D5ZB 1BMZA 3F7YB 4U1JB 5GSRB 2XWBB 1YEHH 5FM8A 4J3SA 3L3DA 3ZQ9A 2OI9C 3HLKA 3PXHA 5HDBB 4A2EA 2Q86A 5JPNB 3AT0A 3CUPB 1JCVA 2DQGH 4Q4EA 2WZPD 4URKA 3K6SA 1AXSB 1XBRA 3P73A 2NRDA 4K9JA 3G5VB 3T1FA 4XRCB 2LGNA 5CIPH 4UM9D 2DZEA 5D7JD 2B3IA 1D7BA 5EB9A 5CJXC 2IPKB 3QRGH 2F53E 2W0FB 1FL5B 2XIDA 1DUYB 5GZOD 1TZ8A 4N0YH 1GCYA 3GNMH 4APXA 1R3LB 2GK2A 3CLEL 1KV7A 3QXWA 4OCLC 2G75B 5EOTB 1SM3H 4R8WL 4YSUA 1VF5C 4LSSH 1NCJA 4JZNA 1S3KL 3NCWA 5FAAA 2AJSL 4PVLA 1EMTL 4ICXA 5K9KA 4KGJA 3V0DA 3LKSB 4QXUL 1KEGL 1IEBA 3MGOB 4RCAA 2YGVA 4R4BA 3V4UL 4NPJA 1SJHB 4C58B 1JVOA 2W81C 4UV7H 3GSXB 2XN9B 4QLWA 5BV7L 2RALA 4V33A 3ZMRA 5D6CA 1LO0L 5KSAB 3O2VL 3QHTC 3FYEB 3O9WA 3QJZA 3JV0A 3V0GA 3QA3B 4NFDA 1TG8A 3E8VA 4B50A 5D1XD 1NCCH 5H2BB 1N26A 1EERB 2JXMB 4KK6C 3RZCA 4MAUL 4AGQA 5SWQB 4K2UH 4IS6B 4R0LB 2BXYA 1TZIB 2XOTA 4J1UA 4OZHA 1ACXA 5G4MA 3DOHA 43C9A 4BUHA 3V52L 4PBDA 1YEJH 5LCVL 4TVPD 3MKGA 4A2HA 1CR9H 1OTUD 4H88L 4RGOL 1EEZB 4HU8A 2NR6A 3ZHFA 3T0WA 5CEYB 3NSXA 3WSQL 3Q0HA 3TBWA 2I7OA 4DO6A 4NKDA 4O9HL 2FUTA 4DW2L 1NCTA 1BX2A 1LDPL 4GO8A 1P6FA 2DQJL 3V4PL 2W1NA 4XNDA 3CSBA 4L3ED 3C5ZA 3ECVA 5F8QC 1BD2E 5F0PB 5HGHB 2EXYC 3S9DB 1IEHA 3NJGA 5CHNB 2XRAL 3LXAA 2BMKB 1BXAA 5BO1H 3M7OA 4PWFA 1BAWA 3WIIL 1EEUA 3QFJD 5AYUH 2AABH 4LBAA 3GUTA 3DJSA 2R39A 4HH8A 3V4LA 4FZ8H 1A64A 2L0DA 1C1EL 5I8CB 1IIIA 3ZDZE 1RJLB 4APQB 3AMKA 3CZLA 4QXWA 4R2GB 3FUIA 4WTZA 1QX1A 5JA9A 1P7HL 3FU5A 4YNYA 4PGDA 3FZUC 4OI9A 4L9DA 1O9ZA 4CN6A 4XMZA 4XX5A 4F80A 4Y4KC 5FB8A 4LNVA 2CJ3A 3R06A 2VDKH 3GMMA 4J8RA 3ZBMA 3FQ4A 4AG4H 1QFUH 4PGZA 2CHWA 4U3SA 4Y4HD 3QUGA 3KPSD 4AQEA 5I9QB 2IOIA 1NCDH 4NM4H 5F88B 3EOAA 4RFEA 1RUMH 2EXWC 4I18A 1FNEA 1M71A 4LL1A 1IGIL 1XEUA 2FWLB 3H55A 1SQMA 2WUCH 1P7KA 2JK5B 4YAQA 2CKBB 2VLJE 4FYTA 1FGNH 3RKDC 3O4LD 3FO9B 1LEIA 3NP3A 4X5XB 1T3FB 2VE6B 3VD2A 5LBGA 4Q9QL 4NKMB 1AJ7H 1UWGH 4BA0A 2WQ8A 4OF5A 3SE9L 4NN5C 4PJHE 5SV3A 3D06A 5D9SA 4Q0XH 2IBBA 4XMPH 2VLKB 4FQXA 1OWWA 2ATAA 3HG1B 5KW9L 1HTYA 4M6OL 1DSFL 3T0EC 4AKOA 3BAYA 1J5OL 3V10A 4W9GC 4WRLA 1DVFD 1TVHA 2K70A 1KBVA 2JB6A 3QORC 2BW4A 4NUGH 1OSPL 1T5WA 3FOLB 3QEQB 1ICTA 3S98A 5ES4B 2WO4A 2QQQA 1SEQL 3BN9C 3D85B 3IRCA 3K7UA 4Y7OC 2BY3A 5JOFA 5FGCE 5KTEH 1T03L 1KLUB 4JG0L 4LOUC 1PW3A 4PREA 4WVRA 1CFSA 2B15A 3N1MC 3T3MF 1JWMB 4FNRA 4RMQA 5GGRY 1HOEA 1AKJD 5KVDE 1N4XL 2D4DA 4KMTL 2ICEA 2VDQB 3CMGA 3PL6C 4Y1AE 1VADB 1NOAA 1U8NA 1HHHA 2XIBA 4PJCF 4NQSB 2IQ9L 3BKCL 4FKKA 3AADB 4XXDB 4NQXB 1UM5L 3MLVL 3ARGC 3QI9D 3L3GB 3IF1A 4XXWC 3C6SA 4IRJC 1N5AB 1S9XA 2BCMA 2ZZUT 3A6BL 5I0DA 2OR9L 1CC3A 3CVIL 5BRZA 3DWTA 1ZK9A 4LLQB 1KIPA 3H0TB 5EO9B 1VFAA 4U1MB 4F92B 1JZ3A 4X0NA 3B7RL 3TP4A 3VD4A 3K2UL 3HHMA 1CLOH 3VWJC 4F3FB 5BMFL 1MLCB 3V8CA 3CMOL 4JZJA 4OGZA 5E95B 2EVHA 1LK3H 5JORB 3FO2A 3L3OC 4JY5H 1JNHA 1EFXA 2PO6B 3B2DC 1WIPA 3NA9H 4XHJC 5I5IA 1TTAA 2Z7ZA 3D3VB 3B8YA 3SDAD 3LN9A 2Y6SC 4XAKD 5EZIH 4PJ8B 2VRQA 2NNFA 5IBLC 1GPOH 4MTMA 1E50A 2GEEA 5JR1H 1NFDF 1U6AL 3KYOA 2X89D 2YBRA 3Q06A 5F6HJ 3GSWA 5C0JB 4PJGB 4MAZA 4PJIA 1ZTXH 3HUJB 4JGJA 2H6OA 5KOMC 5I75B 4XBEL 8PAZA 3RU8L 1XF3A 2HFGL 4WSGA 1P5UB 2ZCZA 3MACH 2KUTA 1AZBA 2CPCA 4KI5D 3V7MA 4TNFA 1Z9SB 1G9EA 1OE1A 1QWUA 5I1GL 3IMBA 4M5ZL 2CLZB 2X12A 4K5OA 5EZLA 2P7TA 4HPYH 4NPKA 2UV3A 4PN6A 4OUUA 1E8ZA 4P06A 4X6EB 3E1F1 2BP5M 3SOTA 1PSKL 4BFIA 5B7MA 4TNWK 2HTKD 2K1MA 4NO5B 5AQ0A 1KT2B 3G5ZB 3GKWL 1JXDA 1Q0XL 1D5XA 2IC2A 4IMKA 1A0QH 2V7NA 1IB5A 3TO2A 1ROCA 2YUVA 3BIKA 1GAFH 4E41D 1J5CA 1XMWA 3S2CA 3U4AA 1KXTB 12E8L 4H5SB 2X4OB 1N3NA 4E5XA 4CNIA 1N8ZA 2YD1A 3G04A 2JKXA 4EEEA 4JRXD 3H2WA 4J27A 3FYIB 3B9AA 2IAMD 3QH3A 4FZEL 4JR9H 1A6VL 4KJYB 4RISL 3VE0A 5J1TC 3SQOH 1E28A 2UUDK 1ET7A 1CDJA 1FFTB 3EO0B 3FTUA 4FTVD 4OB5H 3S6CA 1JPFB 5E6IB 4NWTL 1WBXB 4AV0A 3M86A 4IOFC 1JE6A 2F5BH 3O3UN 1X6NA 4FXGB 5ICZA 1HKLH 1RZKH 1DVQA 4ELMB 3II3A 3L5XH 1YQ2A 4YSCA 5FGSA 4X5WB 5GRJH 1LD9A 5SWSB 5I8OL 3Q2VA 5JNYA 2VUYA 2ZX6A 2DV6A 2IPTH 2Z4TA 1VACA 2PPDA 4DVRL 4ABVA 4I2XA 1JXFA 1M1XA 4FXKA 2WKGA 2ZPKH 1FBIL 2DKMA 3QUXD 1NCAH 2ADGB 1U2HA 4YQXH 2GY7B 1QFWH 4B9JA 4AIZA 2A6DA 2EEXA 4X7DC 1VGKA 1XBDA 2YA2A 3EFOA 2ERJC 2OZNA 2OSWA 1VFOA 3A21A 2VDNL 3VGGA 4I0PB 5A2KH 1NAMB 5T1MB 2BP3A 3NIGE 2Z1PA 1OXYA 3IWUA 2PYED 2X53A 3MRLB 3PNWB 4XN9A 1ETZB 3QUML 1DBAL 1VEOA 5F1NA 3KS0J 3PABA 4FG6D 3ECBB 1IGTA 4Z3TA 1QLRB 2BWIA 2HB0A 3O6KL 4G7VH 1QFPA 2WLMA 1CJYA 2TRYA 3NEXA 2DN7A 4GSRA 1JN6A 3KYNA 4V11A 1EO5A 1BD2D 4KQ4L 3W5NA 4PRIE 3FTGA 1NBCA 5JZ7C 1UD3A 1QRKA 3H9SE 4F7EB 3MV01 4B3EA 5B8CC 4BSVB 1K4CA 3LKQB 4ZS6C 3V4VA 1PZSA 4JM4H 1JPSH 4N8VB 3Q3GA 2ZUXA 4R7NA 1NGWB 3UTOA 2QMJA 3BP5B 1ROWA 2RGSA 1MNUL 4XOAA 4Q4IA 4NO0D 2OI9B 3IFOB 5EU4A 4AYBA 4UTAL 4I1RA 4GYBA 3TYGH 4TUOB 4JGNA 4TQEL 3JYCA 4P9HH 4R5VA 3GMLB 3X3GL 3ASWA 3P4NA 4YHKL 1Q94B 4MB4A 5E4EB 4F7MB 2IADB 1WBZA 2NZIA 3BUDA 2K4WA 4MSWB 4ZMOA 4RDBA 1MJUH 3IFLH 5A2AA 1I7RA 4F33A 4Z7UF 2FATL 3PS6A 4PY8J 3TN0B 3L16A 3VXMD 5CKAA 5AVTB 4LP5A 4HZAA 2YAEA 1ZA3A 1RK0B 4JFFE 3G3LA 3HS8A 1NIAA 2VDPH 5GGQL 4YBQC 3BWSA 4CGTA 2V5YA 2M2DA 4DN4L 2HH0L 1KV3A 5C09B 4Z7VF 2VLJD 5FGBA 3P3RA 4GOSA 3RE0A 3TJEH 3LKOB 4MAYC 4HLEA 1KXHA 1MHHB 2K78A 3QPKA 4HBCL 4XCFH 4ZO9A 4EIZC 1FVEB 3NTCL 5FECB 1XF1A 5LGKA 3EG9A 3EOBB 4IGBC 4I3RL 4EUPB 2A6KB 5K9JH 4L8SA 1HNYA 1P1ZB 3L48A 4R84A 3RPIA 3QJSB 4M3HA 5JXED 3LMJH 1FO0L 2DF3A 1NL0H 3PGFL 1SEBA 1QFWI 5G4OA 1DN0A 5TF1H 3LB6C 3RWEB 2F74A 5FDWA 1PKQB 4DF9A 3O3AB 1MAML 1MLBB 2DYSB 1P7QB 2BFVH 1PDKA 3R7QA 1FRGL 1WITA 5L2JB 1XVSA 2XWJA 1YPZF 4QOKB 2ARWA 3WXWL 1IQWL 4N6QA 3VWKA 5DA0B 2R2EA 3RLSA 3S88H 1DVTA 1BAFH 1MOEA 3ULVL 2X1QA 1RH8A 4WCYH 1YYLH 2C1PB 2P5EB 4ZT1A 3FTSA 2FQGA 3TEZA 2WLLB 5GRVK 4CKQA 4GUPA 4Z1PA 3L54A 3OX8A 4W9JC 3RVTC 1RL1A 4NDMA 5K9OB 1Z5LA 4ANVA 3CFQA 2CR6A 1PG7W 3UMNA 5SX5H 1AQ8A 4CADA 5AB2A 3WTTA 1RJZB 2WB1A 2AEPH 2J7LA 3BE1H 4PVBA 2BHYA 3GRWL 2OPCA 2J43A 3GGWA 1MCQA 4A68A 5J9PB 1X5LA 4ZMTA 1WE5A 5IKCB 1BQLH 3D39A 5DZLA 1MRCL 1T1WB 5HDBE 2QQLH 4QXTA 5D4QA 4XNXH 2QGBA 4WW2F 3PWLB 1BG1A 1IGJB 4M1DL 3HI5H 4UF7C 5A2BA 5D93B 1UB6A 1TEFA 3O9WC 4YHML 1PD6A 5D5MF 3P3TA 4KX9A 4N0UA 3PAYA 1S5IL 1J1OH 5DZOA 4UDTB 4NPYB 4Y4KB 4EPSA 2QTEA 4WUKH 1BZOA 2WIIB 1WFIA 1EEYA 4YHYB 2UY7A 2MJWA 3OKLA 3QUKA 2BCKB 3QYNA 1HZKA 2YN3A 3BH8B 5CZRA 3TJHD 5BS0A 1AQKH 1WA0X 3LZOA 2EP6A 2DI7A 5CBAA 3IE9A 4NNPL 5D7LA 1WWAX 2NR6C 1R34A 5AOIA 4UTBA 3JV6B 4CMMA 1TCRB 3V0EA 2BSTA 4L4TD 1J7VR 2JTDA 3BCFA 4HIJA 5MEND 2K8QA 3ARWA 4N5EC 5EIQA 1IJ9A 3VFSB 4HJTA 3C5ZC 3SY0B 1MH5A 2PN5A 2XN9E 5T5FA 3DVGB 4G6MH 3JTBA 4ZW6A 1T04A 4ZFGH 2ITEA 3VXRE 4LPTA 5E1AB 2JFCA 3FFCA 2DPKA 3T0EB 4YJZL 5IEHB 3AG2B 1QZNA 3IMSA 4HUUB 1J9SA 3DYOA 3MNMA 1U3NA 3ULSB 3APMA 5C70A 2E6PA 4QUOA 2XWEA 2NXZD 4QTIL 1XGPA 3WCYA 2DBJA 2XXCB 3L1FA 4XODA 4WQOA 3KDMA 3PAUA 1S5HA 5LBSL 1MREH 2IAND 1H0DA 5E1QA 2CUHA 4JQIH 2DQFB 4WWNA 1KULA 4QRUA 3PL6B 5I1CL 3QO0B 5CJ5A 4A7TA 1Y18A 1EVTC 5DUBB 4FMKA 5E23A 4RQQB 3ZDXB 5ACLA 4PEEA 2F5AL 2OP4L 3ARGB 3QUZD 4N2CA 3STZB 3REWB 4NQED 1NDTA 3AGWA 3J8F7 2YJQA 5IIEB 1YSOA 3CDZA 4H4NA 2WK2A 4LF3A 5D7IF 5IFJB 2KZ1B 1CLYL 4JAMB 2AXWA 2B4CL 1PG7X 4KTYA 4NQUA 4P9ML 3TH3T 1ZXQA 3DX0A 4B6ZA 3MRGB 5KUMA 1YEFL 3QDAA 3DETD 4HDIA 4FQXC 3TV3H 5LQBL 3W0WD 1IKFH 4BDVA 4F8NA 1BZ8A 1AC6A 4QJ5B 3KG5A 4LP8A 4LK4A 4PJ5A 1F13A 3L3OB 3OLIA 5EIVA 5J1AA 5I18L 4TL5A 1ND0A 1HEHC 2PWDA 4YHNA 5GJSL 5E00B 4JGUA 4X42A 5DFTA 2OXHA 4JPWH 4XC3L 3VXPA 4MQTB 1BVNP 1CFQA 4QO1B 4KKCC 5INDB 3O2DA 9CGTA 3FUEA 4ZMWA 4O02B 5M95B 4GRMB 1N67A 2D4FA 1YQVH 2LU3A 1S7XB 5EFIA 2ED6A 3KLAA 4NT6A 3QG6A 1FL3B 2ICEC 1OARH 5AW0B 4QHUA 2FK9A 4D7PA 1U91B 3GBNH 1OEZW 2EDKA 3OKKA 3V0JA 5LXGH 4Q2ZB 4Q6IA 5CCKH 3CXFA 2VABB 3LNDA 1EQWA 3NIFB 4S11A 5D1ZB 3QPQC 5F9WC 3TF4A 2I60L 5I0WA 2EH7L 3ULUC 2VLKE 5D2LA 1LO4H 5C92A 5GJTH 3G5XA 1TOXA 2CUAA 4QJ3B 3HG1E 1GHFH 3MYJA 5L6YL 1JHKL 2ITCA 3QFDA 2OJEB 1W6LA 3GSVB 1QLFA 4PRID 5DVMA 1XF2B 2SEBA 5C2BH 1NOFA 3FTVA 3IMUA 2R7EA 3QEQE 1RLWA 5KS9F 2KDGA 4OR1A 4JZJC 3SD5A 1H8OA 1CXIA 3QS3A 1T7YA 3ASNB 4CMHC 1AGCA 3ZRFC 4HHAB 3VFNB 4RAVA 5F1KC 5EU5A 3ZE1F 3G9AB 3AUWB 1BOGA 2Y2YA 1DQJA 1U8CB 3N41F 2FEDC 5E9DB 1CF1A 4P23A 4KPHL 4AMWA 3BLKA 2DYRB 4QHMA 4PUBH 4A7QA 1BWMA 1R75A 1DUZA 1LK2B 5IT2H 3D4GA 4ACPA 3WFDH 5JHDA 5HHQB 1GYWA 3DSFL 3NSDA 4TL4A 3HG5A 1I75A 3QULA 1KB3A 1CDGA 1SVBA 4TUKL 1F90L 2HLEB 1T7WA 2QHRH 1OO2A 3KPOB 1H8NA 1F97A 4P5SA 1WC7A 4JHVA 4NCC2 3SCMD 5A3IC 2OMTA 3OKDA 1RULH 1JNLH 1MFDL 1O75A 4AUYA 2G2RA 5CIPB 5I19L 4N0CD 5EC1B 3WY1A 1ITCA 5I6NA 2DMHA 3GHEL 2E9BA 1R3HA 1DBML 3AFLA 4Y16A 5C0NC 4Z8FL 3GPEA 3V8OA 1CBVH 1EO8H 4RLDA 1NC2B 4WU5A 1UXMA 2Y9RT 2O30A 3JTTA 4U1SB 3QJQB 2CHDA 4ZZFA 4F2EA 5K39B 4YX2H 3M88A 1FN4A 2CIKA 2I24N 3TPKA 3TPUA 5CEZH 1M1SA 5HI4C 4PRHB 2Q1EA 4HD9A 4LT7A 5T1KB 1KTLA 2PETA 4OZFH 4W9HC 4IMKC 2DD8L 1F11A 1IAIM 1HH6A 5HI3C 3UROR 4PJGE 2V2XA 8FABB 3M45A 3HUJE 3DV4B 1OPOA 2VJXA 1DQQA 3E6FB 4WO4A 5DUPL 3IDJA 3M17B 4MS6A 3D2UD 3MRHB 2W59A 5L4IA 2ERJB 2QVIA 4LCUA 3WKMH 3GIZH 4X0KA 3ZKNC 2DWYA 3AQZA 1JD7A 1U8JA 4KHXL 4YLQT 3V5DA 4XP9H 2D7QA 4LIQH 4A7VA 1ZS8A 5CBEB 1U8IB 4P2QA 2WVSA 4XH2B 4KRMB 1MWAA 4ZUWA 3VQ1C 1PLCA 2HVKA 4N2KA 3WLWC 1TEYA 2VMDA 3N06B 3CC1A 2BY1A 1Z3GL 3BUPA 5TQ2H 2Z1KA 5T33H 1JYNA 5ECGA 2EUXA 4U2ZA 1BJ8A 4UOJA 4XVUD 3ELQA 3KEDA 4JQVA 1ZT1B 4FFZH 1YG9A 3NABH 3MRCA 3SE8H 3R1GH 1VFBA 3ISRA 3CH8A 2R29A 3O6MH 5F7DA 5BQDA 4M6MH 4YE4H 2YWYA 2CK2A 3GXDA 3C09C 4JRYA 4R5XA 5B3JF 1ERNA 4FXKC 2K45A 4DKEH 2AEWA 4MB3A 2Y7NA 4OM0L 1DQVA 4PRPA 4WFGE 4XTRD 1PAZA 1DBBL 1X6LA 3IJHA 1W16A 5EDXA 4AE1A 1TKWB 4PP2B 3KYMA 3VFRB 2BP8B 3CFJA 4O5LL 3F7RA 1KBWA 1FV1A 2EINB 2H1LM 2ZKWA 3IU3A 1KELL 2VXQL 4LLWB 5ESAB 2O6PA 3VXNA 4ELME 4Y9GA 1T4WA 4MAYB 1EAOA 1ODUA 4MDIA 5F3HA 1UEMA 2V9QA 2A77H 3L2LA 2YKLH 3GUFA 4N2LA 5FK9A 3T0BA 3EXJA 1HQ4A 4MZIA 5FUOL 1FORL 3E6HA 3OAYH 5CLXA 5CUSH 4G7QB 4GRWH 3FRUA 5CLZA 2XN9D 1DJSA 5SWSE 5IV2A 4L18A 1O5PA 1AHWA 2HG0A 3QEUB 2CDFB 3MJ7A 3QRFM 4OZGF 2H6UA 3SKMA 3BAWA 4W9EC 1CGYA 5IQLA 2WTRA 4DPRA 2HAZA 5I6XC 1A14H 3L3DB 3UJTH 4ZFQA 1G87A 2G60H 4HJJH 4EQ3A 1SHXA 5AW4B 4R90L 4HUCA 1AXTH 3QUYA 1KY7A 2DTMH 3EDDA 3KW8A 2Q86B 1Z0MA 3F01A 2DQDL 4GRLA 5ETUA 3IFPA 3WO4C 4K23L 1XCWA 3K6SB 3LV3B 1HESA 3U9PH 3BPCA 3UP1A 2DEWX 2O6FA 3T1FB 5JIHA 4TRPH 1PZDA 1BHGA 4UV4L 3ZUNC 2BX5A 5ENWA 4OGYH 5CWSA 1L6XA 1RZJH 4FG4A 3X2QB 1XR9B 3EBHA 4ZFZA 1H3XA 1TQTA 3OZLA 4JANB 1HSAA 1T6WA 2H3XC 3CZKA 4M5YH 4APXB 5IJKA 2EIJB 2BNQA 1AI1L 1N0XL 4MCNA 3P3YA 4UWQB 4KX8A 3VD5A 4FABL 3ILPA 3KPNA 4QXVA 3HNTH 4K8RL 2ZTBA 2EDNA 4CVWA 1KXQE 4IYKA 1VIWA 4NBZB 5DK2A 4UNTA 1KGCE 1XFPA 5K9KB 2KS0A 5DVPA 5KN5A 2CRIA 4BSWA 3IMRA 4QWWD 2AJYL 3BIBX 4BQ8A 3D34A 4L8SC 4R4BB 2BNUA 3KLQA 4R2GD 3M1CA 4IOSA 4AYFA 5EU3A 3IDNA 1Q0EA 2B1OA 3UACA 3EGDB 4ZAKA 1DJXA 2X2JA 3ESNA 1CTOA 4YXHH 4UINL 3O9WB 3V0VA 1AVAA 4JFWA 1TTCA 1TO4A 3GB7A 4FNLL 5JOPD 3S4SA 2GTQA 2QDVA 3I74A 5EU7C 4N68A 3PLYA 4G9DB 3UGEA 3WAKA 1H6FA 1T6BX 2FBJH 1UTDA 3PIQA 1K3IA 3AZUA 4MB1A 4HIXH 4Z9KB 3UTQA 3D2TA 1EHNA 1KCWA 2B3RA 2MMXA 3QHFL 4NGHH 3VWKC 2GABA 3ZRCC 43C9B 3MJWA 4HGKC 5C09E 3S7GA 3L7FA 4R83A 2AJ3A 1CFNB 1ZLVH 5G4NA 4G6KH 5GS0L 3OB0H 1FPTL 3WXVH 4PLKC 3BYYA 1KB9K 1XCQA 1KPRB 3DX2A 4N6RA 3ZN6A 1MHCA 1KJ2A 2QQNL 3VFTB 3DI2B 2ZWYA 4BV1A 5I16B 3FUMA 4XPTH 2QGDA 3D0VA 3DRQA 1URZA 1BW8A 4JO4L 1YMMA 3D09A 5HPOA 3BMVA 5DJAB 2XKSA 1W9XA 5IROA 3TVMA 1DJGA 2YPKB 1PKQE 3QEQD 5TPWH 2YGQA 1KDIA 2FUQA 4Z76B 3D85D 5IVXA 3K2MC 2YFNA 3VFUB 4QOKE 2E76C 3OLGA 2J8HA 5DU7A 4EO5A 2Q3ZA 2PF6A 4YNYB 1XIWA 4PGDB 4Y5VA 5M7QA 2TRHA 1N5YL 2HRPH 4HJGA 4YHLL 2Y72A 3FN9A 2ZSVB 1NGXA 3F05A 3FO0L 5AOMA 2NT1A 4NN6B 4DUWA 1WZAA 2P5EE 5AALA 4HUVA 1H8LA 2ZX8A 2FGZA 3R06B 1VRSA 4B0MM 4J8RB 3LS5H 1YRKA 4X6DB 2YAHA 4FFWC 3NIDB 3ZKXC 4LLDA 4G71B 5F1OB 3EYQD 3GSNL 1T83A 3IGFA 3DPDA 4P46A 2J1XA 4RFEB 5CCJA 1FNEB 2I9LA 1TLKA 1KLGA 4LSPL 2HVJB 3NSCA 4U3CA 4A6YL 1BP3B 4LKXA 4XP5H 4UTCA 3KWTA 4FG2A 5SWZA 4CN1A 4H13C 3VD0A 3V79C 3MRRA 3T4YB 1F3DJ 2BS71 3O2WH 4OZFG 5D9SB 4FQXB 1PCXA 3U7YH 5JW4M 3KJ4C 4NKOB 5IBUG 3B3IB 4PCSA 4B0MB 5CFHA 2WBJA 1AOZA 5DSCB 1T1YB 5IB2B 3D3VD 1UWXH 3NSYA 2OR8A 4HJIA 5CEXA 3NJMA 3QEHA 1J8KA 1OAJA 2C3VA 1QG3A 2JB6B 4ODWA 4X4ZA 4S1DC 4DFHA 4PHXA 3VRIA 3GXFA 1UYWH 4KBPA 4PREB 1M7XA 4OIIL 3LXUX 4PJHF 3MUGA 3WDHA 5I71C 4FQQB 5HYQB 1GGCL 1NQBA 2DQHL 3QZMA 4QRPD 3U36A 4NUPA 2R1WA 3K5SA 2ICEB 3E1ZA 2OZ4A 4B27A 1HX0A 2YA0A 3CZSA 1CGXA 1CTNA 1UOLA 2EVIA 5FYJL 3APCA 3EYUH 4P2RD 3RVWC 3C6SB 4YFLF 1MFCL 1OGAA 3U0WL 3L4VA 4LSVL 5AZEH 5JHBA 1B2WL 1WF5A 5A2JH 5BRZB 1BPVA 3T0EE 4PCYA 1KIPB 4MNQD 5T3ZE 2OSLA 3FMGL 4LO9A 4P5TD 4RGND 4HIPA 5T3XL 1YEIH 3BSGA 3DVIA 3PG2A 2V5RA 4EZMA 3GSOB 4JZJB 1JD9A 4L37B 4CMHB 4KITB 2X4UB 1GGIL 3FO2B 4F57L 1IL1A 1MCLA 1CQKA 4GG6B 3TWCH 2VKWA 4JFXA 5GS0D 4JREC 3UABA 3LPOA 3PJNA 5C0FA 3S3CB 4HLJA 1U8PA 2B1AH 1PJWA 3VRJA 1ADQA 7PCYA 1NIDA 2VKXA 4GSDH 3I6LE 2E4FA 3P4OA 1KEMH 3MJGX 4RIRA 2OX5B 3ZDXE 2FX7H 4YHOH 1FNSH 3GSWB 1OSYA 2R1XB 1IVLA 3KLHC 4PJIB 1A1MA 1ZSHA 4UBDD 3K81A 1FNHA 4KO9A 1WA1X 2C3WA 2D2CC 1KGIA 4DAGH 3TASA 3UTZA 2IV9A 4M9OA 4OTXH 2WQRA 5DD3H 1MQKH 4Q6IC 1SLUA 1KCSL 2GW5A 3IJSA 1J5IA 1B6DA 3HZYA 2R8SL 3DTXA 4UT6H 5AVYB 3SJVD 3W11D 4D3CL 3F85A 1F42A 4KVCL 5I6OA 3ZYZA 3F7LA 4QI3A 4G6JL 4JPVH 3HMXH 4M7LH 3TBYA 4L3FA 4ZUTA 1RSFA 3V0AC 4HUWA 3KJ6L 4Z3FA 1THAA 4NWUH 3LHPH 1TJGL 2GJ6B 2VDPB 3MCLH 3X1NA 3KL0A 4I1NB 4U0RB 4U33A 4BFIB 2MCPH 1YNLL 4P57A 3T6WA 4UYQA 3VAEA 3OMIB 4L1BA 5BZDB 5I1DA 4G83A 1YUHA 2H2PD 4WO0A 3NG5A 1IM9A 3SY6A 5IB5A 5GHWH 3HNSL 3D69B 5DHVA 3MUZ1 3TO2B 3BIKB 3ESUF 2QT6A 4N8CH 4RFNC 3KEHA 2Q0ZX 3KCPA 4I0PD 3FT3A 5IHBA 4BUQA 1N3NB 2CJTA 3DKHA 1S7SA 3NIFE 3U46B 1FH5L 1N8ZB 2X2UA 4JK0D 1F4YL 4OZIB 3G04B 1W72L 3GJFA 5E2WL 1PVHA 5ALCL 1FIGH 1RUQL 3L81A 3VE0B 4HC1L 3H7BA 5DUMH 3AG4B 4L5FL 5EORL 3BGMB 4BFJA 4GQQA 5DQJA 5AWNH 1GS8A 3OTTA 2MEJB 5FGRA 4U2YA 4OLYL 2GIMA 4I13B 2ZXAA 3DYMA 1TZAA 5E2TL 3TT3L 3LNHA 4OQTH 4FFVC 4WI7A 4A7GF 4Y16C 4IHOB 1HOCA 5FFOA 5EMYA 2LAGB 2QR0A 3BKYH 1K72A 2AJUH 1MCRA 4JL2A 1A7PL 2D03H 2MQ3A 1XCTA 1E4KC 4G8EA 3GTVA 4KK9C 3RTQA 2EVJA 5HVFB 2NNAB 4H8PA 3KPRD 2EYTB 2H7WA 2Z35B 1ZLSL 3BAKA 4DO5A 5E9DE 2XZCH 1UOVA 4LB8A 5JNYB 1NCBH 1A5FL 2NCMA 1CXKA 5HI5D 2WWNA 4OGXL 3NJJA 5B7FA 3C09B 3LH2L 1W8NA 4XN7A 3WIFA 3CBJB 2IJ0C 3T2NH 4MYPA 3TN0D 1KN2L 2OXGA 4OLXL 3KYAA 4WNQA 4WO4C 4WNJA 3HHSA 2FEJA 4GAFB 4AIZB 2BIOA 1KIQB 1VGKB 3RKPA 3HG0A 5FHBH 3Q8AA 1NCHA 2QZQA 2DJSA 5T3XD 5KVGL 1FVCA 1U8KB 2X6MA 5E8OB 3W39A 5I6KA 4N2DA 5F1NB 5HHOD 5HJGA 1IGTB 5DWUL 1WGVA 1MN4A 3X1EA 2W9DH 4NP4H 1I53A 1IZJA 3MHZA 3IJEA 3F12A 4PR5A 4UQDA 3WKNA 4BBWA 3C2SA 3LEXA 3FU8A 4AENA 3H6JA 3KYNB 4I77H 5JO5A 4KZEL 3FTGB 4XVTL 3A4DA 4UOW1 5DVNA 2W92A 4JZOB 4PRHE 1BEXA 4FEIA 3GXPA 5A16B 4HJ0D 4EDWL 5AVQB 3WE6A 4JQVC 3OKOA 5IFHH 3EJZD 4MKMA 3NIGF 1TQBC 2OMVB 3H42L 4U31A 4PCKA 3CVHH 4GAYA 5EU4B 2Z92B 1F4WH 4QOKD 3L1GA 4HWEH 1ZEAL 1WCBA 3WO4B 2FYYB 5IB3B 5ALBL 2VXVL 5I5RA 2WAQA 3IDMB 3FCBA 4KWUA 3X12A 1WBZB 2P5ED 2C4XA 4PJDA 3RGVA 3L5WA 1WAAF 2J6EL 4IBTA 3UBXI 1QA9B 2R0LL 1MFVA 4IBYA 3HW7A 4F33B 2ISDA 5MEQA 4X83A 4Z95H 2Z31B 2MOVA 2VC2L 5BVJA 4E0RA 1CIUA 4Z0XB 3DX8A 1S9WA 4XBMA 3OZKA 4TSAL 1KTRL 3SQBB 3IJYA 2JKWA 1I7UB 1CD8A 1FYTA 4H1LH 5CO1A 2WKOA 3RWHA 4Q6KA 1L6ZA 2X09A 3PFUA 1MI5B 4DPCX 2FECI 3BFWA 3MV9D 1NKGA 1T66C 5F3BA 5I30L 3MREA 4I8DA 4KXZH 4PJAA 5D71L 3EG9B 3CN2A 5HGAA 2BSSB 1AHWC 3AS2A 2ZWSA 1OM3H 4JRFA 2GBAA 1SXNA 1MNNA 1N6QL 2NXYC 1JPGA 3LZLA 3LQAC 4NO3B 2YRBA 4U7SA 1XH0A 1P4UA 3DMMC 1SEBB 1SDDB 2WSKA 1DN0B 3IM1A 2YWZA 1IC5L 4K4KA 1A4JB 5CN1A 3VX1A 2ZUSA 4GW1A 3H9YA 2F74B 3VI3F 4IRSA 1ECZA 3KPQB 1XAKA 4GRLC 4M1CC 4HUKB 3MX0B 1OP5H 3LPGA 3OM3B 4WI5A 1JXJA 3U30B 3LY6A 4GXVL 4FYQA 1OCWL 1FG9C 3FC8A 4K94L 4YLBA 2BS9A 2VZUA 4AL8H 3BVNA 3HFML 4B5EA 4TXVB 5EO1A 4LPYA 4U6HA 5DD1H 4AYMC 1GSMA 5E03A 5C0AB 5D2NB 3OX8B 3RVVC 3HE7B 5IJKC 1A3RH 3BQUA 4LLMA 1P4BL 2W0PA 1PG7L 4LNRB 4TNGA 2YAFA 2EILB 1ACCA 4KUCD 5LVEA 4CADB 5LLIC 1P6WA 1ZHLB 4Q9BA 4AMKH 1DVUA 1WG3A 1R24B 4Y4FA 3FSWA 4HG4K 3VXQA 3GGWB 1AS6A 1U8LA 1HL5A 2XIIA 4ELKA 5C0GB 3KLSA 25C8H 1OF0A 5AB0A 3SBPA 3U1SL 1JV5B 4ORGA 4QXTB 4MQXD 5J5EA 5TD4A 4X6CA 4DEUA 2E8ZA 4UUJA 5FKAA 5EUOF 5DJYA 1S4IA 1MAJA 3FU3A 2Z93A 4ZUVA 3HI6H 3KLLA 3FPXA 4PAZA 4HW6A 4M43L 2H1PH 4N0UB 1XF4A 4WFFE 4LSSL 4YDMA 5L9DH 1C9SA 2UY7B 1Q9OA 4WDIB 5EULV 3QDJA 1A1OB 2HRLA 2XN1A 4QMEA 5HDBF 3ZKXB 3AG3B 4U1KA 4W4OA 5CBAB 3MOQA 4UV7L 5D7LB 3CFKB 1KFGA 2OMYB 5DZPA 4KXZI 3P9WB 1U3HD 1IGFL 4ATWA 2X2YA 1MCDA 4AYEC 5FIEA 5B4MC 5DD6A 2WNGA 3HBQA 2EZ0C 3ZKSD 1SBBA 3IDXH 3EBGA 1UXLA 2Q10A 1MH5B 5JW4Q 2PTUA 2OMXA 1KACB 2CALA 2F15A 4Y5YA 5F6HI 1G7MA 3NRFA 5IROC 1J0KA 4QHNA 3X11B 3TVMC 2H0JA 2Y1YA 1YEJL 4JKLA 1NCGA 1J05A 2PW1B 3FT1A 3QDGA 4ZXBD 4MMZC 3QQ9D 2BSED 3C60A 4V1DD 2J5LC 4OY9A 3VXSB 2BNRB 1A6WH 1XGPB 4ZQKA 4F58L 1JGVL 1XIWC 2V9RA 3DURA 3EF7A 4Y5VC 1NEPA 3B37A 4ZX4A 3FCGA 3N2JA 4PV8B 5I71B 3UBXG 3X14B 2RAMA 3X13A 3B8SA 5BO1L 1G7QA 2HWZH 5FXCH 3NCCB 3ZZ1A 1TZGL 1JWSA 2NNRA 5D1ZD 5A2FA 4G5ZH 4ZX6A 5AYUL 2AABL 5EEUA 2WQVA 1KIRB 1FC2D 4P46C 1ZGLM 1T83C 3FH5A 4FZ8L 3SZKC 3BZ4A 5IBUB 3VSUA 1W15A 1X5MA 3OHXA 1WEJL 2JCCF 5KWYC 1THCA 5DFVD 4LF3B 3UH8A 3GEWB 1DQDH 2Z34A 2NNCA 2UZYA 3TA3A 2WJ7A 3UJIH 3G6JA 4HVBA 1WS7A 5C9KA 3DBXA 5IR1A 3EF4A 1W0VB 1EBPA 1WD8A 2NX5A 4Y19B 4HDIB 1LP9A 2VWEE 4IHBA 5F44A 1AZRA 5HVHB 4J2XA 3OKNB 3K6NA 5DMKA 1JF5A 1QFUL 4ONFH 1BZ7A 6PCYA 1NCDL 1ONQA 3JZ7A 3VDAA 1RUML 2HCZX 2Y25A 2XFXA 2WUCL 1ZGLB 2O5ZL 2QGEA 3NZSA 4KTGA 2OXHB 4X6DE 1G0XA 3PFQA 3UG5A 5DHDA 1UWGL 3NIDE 2D3NA 2VMFA 1VGEL 5B3SB 1HHKA 2RB8A 3TZVA 2KQNA 1DJZA 5FWRA 4AKPA 4HEPA 4YFEA 4TNVK 3NFNA 5DC2A 3G08A 1HJCA 3MCYA 4QHUB 2WXHA 1PZ3A 3QHZH 2HVBA 2V9TA 3KWVA 4UIMA 1NIFA 5HDQL 4Q6IB 5F9AC 2NTFA 1OGTA 2NW3A 2NLJA 3IS0X 1KYFA 1SF3A 4NUGL 3F6IA 5CZKA 2XBDA 2EIDA 1HQRB 1X5XA 1U58A 5D2LB 1QWNA 3HN8A 4XE0A 3QXAB 2RBLA 1MHEA 1B4LA 5E4OA 2ITCB 2ZSWA 1D2PA 4LSRH 1AC0A 4R4ND 5T1KD 5I17B 5IM7A 4GLRH 1BFVH 5ABDE 4WWPA 2RR3A 1ZD6A 5AL8A 4LCIL 4QPEA 4PS7A 4RAVB 3NA4A 4M48H 2BDNH 1RK1B 4GRWB 2OL3L 2N7BA 3RX5A 1DQJB 1BQ5A 1ZV5A 2B0SH 1V7NH 4RFNB 2YLHA 5D72H 4F7PB 4IKIA 2APVA 3LIZA 4XNMB 3V0HA 4GXUM 4H1LG 5DT1H 3UAEA 1O7DC 4HCRA 3N40F 4CJ0A 1MCEA 4NC2B 4QRRB 1H9DA 4N8PA 4KKRA 2MSPA 3MBEC 1OP3H 3ULUE 4J3BA 2GC4C 4P2OD 1LK3L 2WP3O 2VMEA 4OLVH 2WZPA 2G2NA 1I82A 3GF8A 4JY5L 5BRZE 1RVFL 2OMTB 4OD3L 5DZJA 3DX7A 3NA9L 2CXGA 1UENA 4HV8A 4NHCH 4XP6H 1F02I 4Z7WF 2ZAIA 4LCCA 5IW3A 4UM9A 2KMWA 5D7JA 1E3XA 1CD1A 3FCUB 1N0LB 4ZS6D 1PL3A 4HXBH 5GSVA 4PQXA 3P69A 1LEKA 3WI9A 4FF9A 5GZOA 4WU5B 3D51A 3DDFA 4PY8I 4GG6E 2H3NA 2NSQA 1N64H 1ZTXL 4CVXA 1IQDA 4YO0A 2VJ0A 1OAQH 3QK0A 3K1DA 2EUWA 2ENPA 4FYRA 4LMQE 1OCZB 3GO1L 1QR1A 1CB4A 4NFBA 3DO7A 2ATPA 1A6AA 2XCMC 3MACL 1M05B 3D30A 1KTLB 4JRLA 3TBSB 1OAUL 2W07B 1F11B 3TFKD 4YHPA 1F3RB 1SZNA 1MCHA 2V2XB 4PJIE 4WGVB 4XBPA 3LEYH 3JWDH 4YC2C 1DQQB 4LKCA 2O1AA 4KFMA 1G9NH 2XXGA 3DHPA 3BCDA 5DC4B 1PCSA 2EDEA 3MKKA 1ZRUA 2X1WL 1WO2A 2GYSA 3EH1A 2P52A 4LCUB 4PGBA 1GW6A 4X0KB 2OTWA 1U8JB 1I8AA 5DO2D 3VD1A 4MAYD 4PI0A 1A7BA 3V5DB 1KTCA 1KY6A 2G3MA 3QWRD 5DRXA 3H4HA 3HFFA 1A0QL 1NBYA 1UJ3A 4FNSA 4GLRI 4QRAA 4TQ8A 2GJ6E 4WY7L 2AP2A 2D8KA 2FB4H 1CT8A 4N26A 4PS3A 2YD7A 4BKLB 4WHCA 1G1KA 2D2OA 3VG9C 3VQMA 2CBPA 5KBPA 1PF3A 4WFHE 3RTQC 5C0BD 3UG4A 2P42B 1TQBB 1KGYE 2VW6A 4JR9L 3S34L 5IF0B 1EJOH 1DFBL 1DYZA 4QR7A 2UY6A 2WXJA 3F84A 3V5HA 1A47A 2A74B 5SX5K 3LQZA 4JFUA 4EE2A 3WL9A 4HA1A 4OB5L 1AG6A 3JBG7 4HIIA 4WFFD 2AJXH 2WQSA 3QFJA 2VR6A 5CN2A 3B9DA 3WJLA 4PGJA 2F5BL 4RMRA 3ROLB 2MQGA 2R69A 1F1DA 1I1AA 3NEEA 5EPMA 1MCWM 1S78C 4JKNA 4DP8X 2AXFA 1HN1A 5CJBA 5H37A 5T1LD 1WLHA 3U0TA 4CC0A 2W94A 4JFYB 1NCOA 1KBKA 5GRJL 4L0YA 5ITBH 3CFJB 3FQWA 1L7IH 1EEQA 3IU3B 3S5LA 4PRBA 2FNBA 2CK0L 3OF6D 3VXNB 1XXDC 3PHOA 4GB9A 3MLTA 3ALXA 5D1QB 5JTWA 1JDCA 2LW3A 5JXAH 1NA8A 4JDEB 4Y4HA 2UXTA 3KPSA 5IB4A 1RZ7H 1UH2A 2WBWB 5L7XL 3E6HB 3OKYA 2BHUA 3FRUB 4YQXL 1MFBH 4KXAA 1QFWL 5AD0A 1V05A 4U6XA 1QSZA 2VM3A 2WCPA 3ALPA 4UQ2B 3O4LA 5GGSA 2FX9L 1ECYA 1WFJA 4X6BA 3V0FA 3TNMA 3Q2CA 3UJJH 1RUKH 3DMMB 1BA9A 2QKIC 4HIEA 1IEAA 5K69A 1QYGH 1BQHA 4ATTA 4TOYH 2PR4H 3IFPB 2GITA 4G7YH 4KVPA 3ARYA 3PWNB 4PWJA 4B9YA 5TFSH 1FAIH 4IBLT 5D96C 3STLB 1BXUA 4FQHA 2B1HH 5IUCA 3SDXF 3RGVC 1DVFA 4MQSB 4J3OF 3MV7A 4YGVB 3RY6A 1JPSL 1R4XA 5ENWB 2GBTA 2RFXA 1D5BB 2EDTA 5CWSB 5DC0A 5AVSB 2ZOOA 3A4AA 3MQIA 4DUVA 3L5HA 1CE1L 5ICUA 3CHRA 3IGAA 1LWHA 1INDH 3TYGL 3IK2A 1AKJA 2BNQB 2BRRH 5FKPA 4HLZH 4P9HL 1BFOA 3SDYH 4FGMA 1JFHA 1LO2L 4B60A 5DK2B 3UYPA 2DJUA 5FA3A 1VCAA 5DJ0A 1UXSA 1HXYA 5FX3A 5MEOB 5KN5B 3AREC 3PXJA 3PDOB 3IFLL 3QI9A 4BSWB 4WI8A 2BRQA 3BRGC 5CZXC 4M93B 3RL2A 2PW2A 4ZNEA 3AS0A 4H8WL 3UZVA 1EJ6A 5EU3B 4MCMA 5DJZB 3GLEA 3OGCA 3CHSA 1HIML 1NCWH 3EH2A 1AR1C 3L8QA 5AB1A 6FABL 3V0VB 1EHAA 4ZK8A 3GB7B 1BJ1J 2GC7C 4ZD3L 3TJEL 4BM7A 3EGXA 4IRSC 4XI5C 2D0HA 1CYXA 4NM8H 4XCFL 5AVZB 2J55A 4FHKA 3VU2A 4F2FA 5I1AA 3DGCR 4OI8A 1H3UA 3PIQB 3N1FC 2WXIA 3UTQB 2EH8H 1EZVY 1XZ0A 4NZDA 5HHMB 1UURA 4ZMXA 1K9TA 4PTUA 1KTJA 1WZ1H 3MJ9A 1UWYA 3CHXA 1SUJA 3SDAA 4WU7A 3O4OC 1INQA 1MI5E 1XHHA 5IB1A 5LHDA 1NLDL 4KU1A 4QF1A 1NBVH 3HPJA 2NSXA 3BQUC 2A38A 3QDMD 1MRDH 2X89A 4N6RB 5DTFA 3DSNA 2KZWA 4DP5X 5FYKE 2EO9A 3Q5OA 2BFVL 4LAQH 1MCKA 4HK0A 2ZX7A 3D0VB 3MSPA 4Y4FC 1LE9A 2OULB 5MERA 4XGZB 5HYJD 4AUUA 4EN3B 2E9JA 3S88L 1BAFL 4NUQA 3BDXA 4YN3A 3UAAA 4WCYL 5KBDA 1YYLL 2H2SC 5EU7E 4K3DH 3H7LA 4IBSA 4MA7H 1HHGB 4MMZB 5AZ2L 4XBGB 2ZWZA 3I6GB 2LTQB 5AAMA 4PG9B 2EEBA 1F56A 2ROXA 3KLKA 3U7AA 2RIKA 3S0PA 4OKVB 2NY0D 1CYWA 1Q9KA 4OCYH 3LZRA 4HJGB 2DI9A 1AMXA 1CS6A 1NGXB 2NPLX 2FJHA 1IBZA 4PP1D 4Z3GA 4KVNL 3EOTH 1QSFB 5IMMB 2AQ2A 4RVBA 5C0AE 4GAJH 3SGJA 3VFMA 3QNXA 5D2NE 1BQLL 1AZCA 1Q0YH 1TQCB 5EBMB 4OJEH 3SYAA 5DRNA 4XNXL 2VN3A 1IC4H 4P46B 3ZIMA 4E41A 3HI5L 1KCLA 1W80A 2V6HA 2VQUA 2I9LB 1FFOA 1I1CA 1UVQA 1MCOH 3BN3B 2GBUA 4QRSB 1C5DA 4BD4A 3BPNB 4U6YA 2E46A 1U4FA 4TLUA 3O3BA 2EEDA 3GMRA 1ID2A 4QCIB 4JRXA 2F53A 3O45B 4BQ9A 1OE2A 2YSSA 3MRRB 4Y5XA 2IAMA 3L4YA 1ESOA 1JF6A 3ZPDA 1QVOA 5DQDL 5IQOA 4PV9B 3D4YA 1W2KT 3VXUB 4AJVA 4LARL 3UBXB 4FTVA 1S7UA 4N0UE 1LO5A 3QEHB 4LCWD 3SN6N 4A2LA 2IALB 3C60C 5KVEL 3HRZA 1SQ2N 1ADWA 1XV8A 2DQCL 1Q9LB 4NXKA 3VRIB 4LEXL 1PAMA 5BS0E 5ABAA 1WCQA 2TSAA 5I66A 5D7LE 3MUGB 4KJWD 3L9RA 4G6ML 15C8L 2YXFA 4R8WH 2P48B 1S3KH 2PP8A 3W1ZA 3RVXC 2AJSH 2EACA 3A0OA 1PY0A 1EMTH 4M29A 4KXCA 2QEJA 3MMEA 2V0AA 1E27A 3EJPA 3IEAA 2X87A 3V5KB 1KEGH 1KC5H 3RUGB 3C6LB 3V4UH 3N1QC 3CGTA 1LWRA 3QUXA 1TZOA 4DKFL 3OHXC 4BINA 5BV7H 2R4SL 3T2OA 3IVKA 1KBBA 4PI2A 1LO0H 1UFGA 2J12B 3OKMA 3O81A 1AANA 2GJ6D 3KMDA 1MREL 3REVA 3TA3C 1LEGA 1D6VH 3QO1B 5TDNB 5BQ7B 5IVOA 2OSLB 2PYEA 2H3KA 3ZL4L 1AGEB 5C1MB 1NWPA 3THMH 3BAIA 3HC3H 1IGML 2QTVA 1VPOL 2O26U 4KKBC 2BNRE 4WFHD 3GBML 5AVVB 1UOWA