5AB1A

Complex of the fimh lectin with a beta-cyclodextrin c-linked alpha-d-mannoside in cocrystallized orthorhombic crystals at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title The Anti-Adhesive Strategy in Crohn'S Disease: Orally Active Mannosides to Decolonize Pathogenic Escherichia Coli from the Gut.
pubmed doi rcsb
total genus 38
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00419 Fimbrial Fimbrial protein
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5ab1A00
2WMPB 2UY7B 4AVHA 1TR7A 5AB1A 4XODA 2XG5B 4J3OF 3MCYA 5IQMA 2J2ZB 4XOBA 3JWNH 1N0LB 4BUQA 1QUNB 5AALA 5FS5A 5F2FA 5F3FA 4AUUA 4X50A 5IQNA 2UY6B 4XOEA 4ATTA 2W07B 1UWFA 5FX3A 4XO9A 3ZL1A 4AUYA 4CA4A 4AUJA 4J3OH 2JTYA 3BFQG 4XO8A 4CSTA 3BWUF 5IQOA 1ZE3H 5AAPA 5JQIB 3JWNG 3ZPDA 4AVJA 4AV5A 4X5PA 5LNGA 3BFWA 3JWNE 3ME0B 4XOCA 5LNEA 2JMRA 4LOVA 5CGBA 4X5QA 4AV0A 1KIUB 2VCOA 5FLUA 5ABZA 4AV4A 1PDKB 4AVKA 3ZL2A 1KLFB 4X5RA 5FWRA 3SQBB 4J3OG 4XOAA 4AVIA 1N12A 3RFZA 2XG4B 4CSSA
chains in the Genus database with same CATH superfamily
2F1AA 3DYMA 1PSKL 5HJ3A 2XZQL 2VLKD 2W9LA 3TVMD 1PDKA 2BSSB 1LD9A 4FQJL 2R1XA 2BIIA 3REWA 3G5XB 3P4MB 4GRLB 3M8OH 4XMUA 3CVDA 3Q1SL 2YJQA 3QPQD 1YMMA 1XZ0B 3D2TA 3OKOA 4HWEL 4YHKL 3V5HB 4KRPC 3SDDA 5A2AA 2ZXCA 3MJ9L 1F90H 1FNEB 1PZBA 2VIRB 2Z4QB 4ZW6A 1KPUA 1NDMA 3VI3A 4W9HC 3FO1B 5J1SC 3AXHA 3NFSH 2GVYA 4QJ3B 1J8RA 3AMKA 3D0LB 2ATKB 4F5CE 2F74B 4ZQTA 2O4EA 2X4NB 4HU2A 4F27A 1OE2A 2AFNA 4X7EC 8CGTA 3RPBA 1R5VA 3D0AA 2W5PA 3ARFB 2F18A 2Y07L 3PAZA 1E7VA 2EXYD 3UGEA 1ZVNA 3NJGA 4Z7UB 1WH0A 4JPSA 5K9QG 4A6YB 4YSOA 2VLLB 3L1OL 4JY4A 3O2WH 4NP4L 1BCIA 4PP2B 5F7EH 5ELIA 5I0ZA 2X6BA 3US1A 3CX2A 4GLRH 4QGTA 1KCRH 2EDLA 3P9LB 5KYXB 5GHWH 4JFEE 4OB5H 4MJJA 3WXWL 1MEXL 1NGXB 5ISZA 4AYMC 4APQB 4D0CB 2D73A 2XJKA 5DS1A 4B5EA 1FP5A 1T1WA 1V10A 2VDLH 2WQWA 1QKZL 3VRJB 3EBIA 1TZ8A 3ARDD 4LBEA 5JDSA 4ORGB 1HWWA 1WGOA 5IJVA 5TPWH 1SZNA 3VFGH 3UACA 4DSYA 5KZCD 2WKGA 2F54B 1S9WB 3BKYH 3VXSE 2I9TA 5F6HJ 3IE9A 4GUCA 3P02A 2YR3A 5DMYA 3L4XA 2D4FA 1OEZW 2X1XR 4L9LA 4KX8A 5CGMA 1V7MH 3U9UB 4R84A 5KEZA 1NBZB 2AAAA 2CNZA 3K6SB 4GSQA 3VTMA 3WL9B 5CIPB 1LEIA 4GRLD 4M7KL 2OXHA 4GINA 1KIUB 2ZCHL 5JW5B 1XGUA 5DURB 3RBGA 5C09A 2R2EA 2Z64C 5INDA 1BM7A 3V0FA 2WANA 5CSZA 2QADB 4GMSL 1A5FH 1SPDA 2EO1A 5I28A 4QD2E 5EBWB 3RVXC 4HWBL 1PW3A 2XPZA 3DGCR 3V6FB 4DGYH 1BPVA 1JHTB 1J1PL 1LJMA 4X8JB 5DK3A 3AGWA 5KVDL 2BM3A 2WQRA 2YJLA 4M1CC 4XB3A 3SPVB 2JH2A 1S7SA 4HGWB 2CDEA 2NY0C 1M7IA 3E8UH 4JO1L 4NUGL 3ARFD 2CJUL 4QXVA 3D2UA 3F85A 3FT3A 4HAGA 1TJGL 4GSDH 3L7EA 4LNRB 2XG5B 4J3OF 3RGVB 4NX0A 5EU3B 2NW2B 3EKCA 2A77L 2F15A 2NX5B 2P8LB 5JQ6L 5GGRA 4KI5C 4F7PA 4K5MA 4DN3L 5BVJA 3MRQA 5A7BA 4LKXA 5KOMC 1YN6B 3M1OA 2ROYA 5JYMA 3TVMA 3O3DA 1H5BB 4IJTA 3QJRB 2OMUB 3GBML 5DGQA 2XZCL 1BWMA 4J7RA 5DUPL 3ESVF 3IFOA 5AZEH 4K7FA 3UTQA 1LK2B 2WQSA 1IGMH 1AO7A 1J18A 2CBQA 3EGSA 2E6JA 1G9HA 2IQ9L 2HT3C 3P77B 4WV1C 3VXTB 2GSGA 4U05A 2F54D 5C1MB 4HZ1A 1MHHA 2UX7A 2WXQA 4D9RE 1RUQH 1Z9SB 3QXDB 5ERWA 4D7PA 3QO1B 1U8IA 1BVZA 4WO4C 5D70L 4AUYA 1NUFA 3S5LB 4TNGA 2VDQH 4MX7A 2X28A 4Z7NB 3BFQG 4MVBD 3BLKA 3MC0A 2DL9A 3GRBA 5E08H 2XY1A 3DI2B 4BFBD 3MA7A 5T5FL 1DBMH 4GSRA 4GI8A 2FEJA 5DURD 3OAYH 2QSQA 3RP1A 4UINH 2EH8L 2QADD 4OJDH 3GSVA 4LCCA 4NO5A 3MUY1 3U4EB 3CV5A 2MTAA 3HI1B 2NSMA 2VL5B 4FA7B 5E2TH 4WHYG 3PGFH 4BSVA 1W16A 3KPLA 1TF4A 4UT6A 3VSUA 2B3RA 1JFHA 3ARDA 3QCUL 4DTGL 3DGGA 3STZA 1GGTA 3HZMB 3D39B 3BESR 1FAKT 3B37A 3FSAA 5IW1A 2LLGA 2P44B 2VC2H 2FJHA 5T1DH 1HHKA 2YA0A 4U1KA 4WQOA 3OGCB 4XCYB 3V5KB 2HJFA 1H0DA 5T5FA 2FL5A 1MRDH 1A14H 2JLLA 2QJDA 3UTTE 3NCFB 2P45B 3OC8A 4P3DA 2NX5D 4FXKC 1NICA 2CHDA 2ZOKA 5EC2B 1N6UA 3S4SG 1Q9LA 1QSEB 3GI8L 1GR7A 1CIDA 5F6IC 2YRPA 5D6CA 2FH8A 3DUHA 4N68A 5A16A 3G5XA 1U2CA 1BM3L 2YGNA 1Z3GL 4ZAKC 4HOWA 1U41A 4NQDB 1JNHA 4A6YL 2IBZY 3V5HA 3O2DA 3QUXC 3CX5J 4EDXA 3GHBH 1YMHB 3N42B 5DXWA 3ZKNC 1H8LA 3FPYA 1UEMA 1AS8A 1P0SE 3T77B 4BQBA 5EUOE 4C56E 1T7WA 2GITA 1HOCB 2AV1B 2CGRL 3CXDH 3LPFA 4R9HA 4PHXA 3SE8L 4PJDB 1XGZA 1TYEB 2F74A 3P0GB 3VH8B 1ZGLP 1VIWA 2X4NA 2IADA 4KKRA 4ZMWA 4Q9BA 2PYFA 3M46A 3V4VB 4ELME 3ZE2E 2YRLA 3WS3A 2HLEB 3TESA 4BZ2H 1FVDB 1ZWIA 4QHLA 2J1KA 1PZ5A 5IHUH 5DK2B 4R7VA 5KUMA 1XH2A 1MRCL 3VXRB 1PKQE 3NG5A 4Z77B 2J12B 2E9IA 3D33A 3DX8A 1ZTXH 1DSYA 3IDNB 4U3HA 3BAYA 2VQTA 1NGYB 2ZOOA 5T8IA 2W9DL 4EE2A 3FKUS 4Y2OB 3GFUA 1HQ4B 4U4BA 3RVVC 1JPST 3IN2A 3QUZB 4ZOEA 5AUMB 3D39D 4AYSA 4DEPB 4X7CC 2A6KA 3OB0H 1KBVA 4KXZI 4N6RA 1I1FA 1YMME 4IRSB 2E0PA 1S9WA 1OO2A 1MUJB 4M8UA 3R4DA 4TUJA 1CVRA 2A9ML 3IETB 4JPIA 3NCCB 3VI3E 3WY4A 3ATFA 4HG4J 1JZGA 3EJSA 5I76B 5EH1A 5AYQA 3E3QC 1W9XA 4NRXA 4RISL 5I6KA 3Q48A 1NBZA 1BGXL 2HG5A 3LRSB 1YC8A 4N1EA 4EXKA 4HEME 4BKLA 4U3SB 3KPRA 5ESAA 1I8MA 2X88A 5C0FB 4KQ0A 2Q10A 5I30L 2IG2L 4L4VB 3AG1B 2GT9A 3N55A 3QJUB 2FO4A 4HIIB 4QHMA 4RFOH 3U48A 3HZKB 2CK0H 1IKNA 5ANMB 5GRVK 2AJYH 2B9AA 3PJSB 3K6OA 5ISZE 3TEYA 3N44B 1NLDL 4ZO8A 4P3CL 3JWOL 5F9JB 1A1MB 5ICXA 2ZJSH 1OCOB 4AGPA 4BSWA 1HSAB 1JN6B 2CSPA 3C8KA 2FE0A 2G2RB 1MFBH 3MRRB 1JGIA 4A1RA 4GSXA 2OR9L 3VXRD 5AVYB 4YWGL 4ZD3L 4MYPA 1VFBB 5BZZA 1WA2X 3CG8A 3MJ7A 4JMXA 1E28A 2NX5A 5AD0B 3MACH 4WWKC 3D25A 4XHJC 2YD2A 5IESL 2P5WB 4ZO6A 3V0IA 3IDXL 1UWXK 1QG3A 3MLSH 1SRDA 3UAJA 4LB8A 1LEGA 5G4OA 4BEIA 3OLGA 3OQ3B 5HDOA 2GI0A 2LW3A 3QG6A 2V9TA 3SODB 1ROCA 1RZFL 3QUZD 2VITA 4Z3JA 3T0EB 2OJZH 1LQSR 2GFBB 4GKSB 1D7DA 5HHNA 1AC0A 4ZOCA 4IRSD 5C09E 1QFHA 1J05B 5ILTL 2EC9T 1FZKB 1W72A 1XHHA 2YGPA 2GY7B 4J23A 4PBVC 4JDZB 2R9HD 2FEEI 2KLSA 3X11B 4H2CA 4Q6IB 1YEHH 1Z9SA 4Y8AA 4LMQI 5H2BB 4OY9A 2AGJL 5JO5B 5KN5B 5JUEL 5CBEA 1N8OE 2KH2B 5GZND 3LKNB 5E99L 2HRGA 5FUZH 1AGDB 4XMPH 5F72S 4UZGA 2EEDA 3WFBL 4KK8C 4MCYB 4AQ1B 2O1AA 4QRUA 4TLUA 1WBYB 1LQBC 1NZRA 3KH3A 4AL8C 2NT0A 4L4VD 4PS4H 4WJKB 4A7GA 2I7OA 3QNXB 4MA7H 1ETB1 1EHKB 2F19L 4HSCX 5I16A 2J6EA 2Y7QB 5CCHE 3ECQA 4H26B 3V4PL 2VDRB 4FNRA 2EE6A 1BDYA 3HI1A 4GAJL 5C08A 5CJ5A 2SEBB 2X53A 1C7SA 1EAOA 4X80H 4Y1SA 2GUYA 1CLOL 3CH8A 3BP4A 5KAQF 4P5RA 4M9PA 2B14A 2IXQB 1PLAA 4GS7C 5EOTB 4QRSA 1NCDH 3L9RB 3WMQA 1NAKH 5DEFA 3BGAA 1YY8B 3P54A 2FSEB 1AO7E 4YSTA 1VZGA 2XWXA 5GS0H 1ANUA 1RZJL 3NK4A 1ILSA 3A5VA 3KS0J 4CILA 2Y5EA 3RDJA 5DO2D 5CZXD 3CFCH 2WVVB 2P5WD 2ENQA 4DZ8B 2WYIA 3V4VL 1XXDC 3SKJL 4N2CA 1JZ7A 3D09A 4K3EH 3H2PA 2CBTA 1CG9B 1XMWA 4K3HA 2DWDA 4OZFH 4UQIM 4LLDB 5DHMC 1N4XH 3PS6A 4G42B 3BP5A 3T0ED 1KELL 5DC4B 2ZAIA 5HHQB 4P4KC 2EDXA 43C9B 4YHOH 1NSNL 2OX5B 4XWOD 2VRQA 2J4WL 5EU7E 5JYLA 4O2EB 2NY2D 1QFUL 5F9OH 2MWCA 4J6RH 1OOAA 5DZJA 5CJOL 1EVUA 5AL0A 3L3JB 4I3RH 4J3TA 4WHTA 5CS7A 5K39B 4P46B 2WQ8A 3O0RH 2ZXQA 2ENPA 4GXVL 5DK2A 1R0AH 4PJ9C 2JQZA 4JVUA 2GB2A 5I66A 2G75B 3EOAA 3ENEA 5IF0A 1HXYB 5LB1A 3VYNA 3HW7A 4WNJA 3ZN6A 1RZGB 1TSHA 1R1CA 1WFNA 3H9HB 4WI7A 3MGAA 2LAGB 4AW7A 2C1OA 5I1CH 2C9RA 1GS6X 1GA2A 1DVFD 2EE0A 2V2WB 1F1DA 4F91B 4PWFA 5DR5H 2H6OA 1Q72H 1DBBL 1VACA 5AUMA 4Q8BA 4R3SB 3WN5C 4FN0A 3DOHA 3I9AA 4POUB 2H5UA 5DMIL 4PGDB 5IFHL 3UO1L 4HBCL 3VRIB 4I1RA 4PJ6A 4BFJA 3DUSA 2X9ZA 3H6JA 2Q5BA 3CLEH 5BZWB 3MXVH 1UB5A 4QNPF 3ZYJA 2WB1A 4JFFD 1Y07A 2XQBL 4Y5XB 1K8IB 3APMA 3I3DA 2JI1A 3RUGA 4GAFB 3RWIA 4B9IA 2J20A 2YAOA 1F41A 4PJFA 5I17B 1RJZA 4GSUA 3ALPA 1IC4L 3CFBA 3F7YB 5C9KA 1RV6X 4PJEB 4ZX6A 3KPQA 4L4VA 1JGDA 3S37L 5SWSD 5CEZD 4XNUL 5ANMA 2X4TB 1OARH 3BEWA 4X4YA 4G1EA 1EA9C 4WJG3 2OMNA 3X1EA 1BQHB 4GXFA 1BZ7B 1OKEA 4PJGB 5IKCB 1KT2A 3QA3B 1MHEB 5F9JA 1C08A 1A1MA 4DW2L 4FQHB 4Y5YC 4S0SD 5ABZA 1JN6A 1M7DB 3P0VH 4NAJA 1QFWM 5CZVH 4EOWH 5FW6A 4IBUA 3MRRA 3FO0L 1DCEA 3CC5B 5C07B 2GJJA 4LLQB 2WLIB 1G6VK 1EBAA 4G7VH 3N1PC 1KLFB 2K8MA 5HDQH 3JWDC 5D1XC 2R0KH 2VXQL 3GSNH 4ZFFB 5K9OA 3HMXL 1IUZA 2E86A 4FA8A 5J12B 1CICC 4FYSA 5L7XL 4M7LL 4WO4A 1P84J 2UY7B 3OSKA 3WFHB 2BK8A 4HH9B 3HB3C 1M4KA 5GISH 5I26A 2VZOA 3KPRE 4CC0A 4GQZA 3VVVA 1QACA 3HC2A 1UM6H 1XQ4A 2X3CA 4YSDA 2GFBA 4TXVB 3S34L 4XX1E 3CN0A 3CLFH 3LZFH 2GBVA 2P8PB 4XPFL 1FZKA 2WMPA 4IU3B 1IIIA 2VDRL 4JDZA 3V9CA 2BOLA 3EDEA 5AVRB 2IOOA 3RZCB 4MRCA 4WUUE 4L3CA 3I6GA 2R27A 5CJXC 4B0MB 3MV7A 1RMFH 3ZW3A 3MFFB 1AGDA 2FHFA 2ZXGA 5ITBL 1HZHH 5D71H 4AGLA 2PO6B 3EH1A 3HAEG 1QBAA 4NN5C 1UA6L 4ZW3A 2EECA 1M57B 5C3TA 1OD9A 4ATTA 3WUWA 1I3VA 4S1RH 2AS5M 1YEDB 4R8WH 5GGTH 2IC2A 5HHMB 2H26B 5CZRA 2YQ3A 4MRBA 3DURA 2NX5E 3Q6GL 1FFTB 1CDCA 4LRIC 1XGRA 4PY7B 2B0SL 2VR7A 5FYLH 1L9SA 1Y0LB 2FB4H 4QRAA 1R5WB 5FYJL 1JZ6A 3LHAA 1DVFA 2BSED 2K78A 3HKFA 4QTHB 3BPCA 5DSCA 2IXQA 4R5TA 5E1GA 4ZAKA 3OVUB 3MMEB 3CX5K 4C58B 4WVRA 3B2UC 3TU6A 2WXLA 3NTCL 1N2RB 3MRIB 4PJAF 4S1QH 4JFZH 3TJEH 3D0VB 4S0TD 1RZIB 1UOLA 1RIUH 1NCBL 2WXKA 2BP3A 4BINA 1F42A 1NWPA 3SDAB 4PWGA 3KGRA 3WFDH 3IPBA 4JFFA 3DKHA 3D85B 4FXGC 3UYOD 3ZDZF 3ZDXB 1F02I 2VDPB 3N06B 3FUFA 2BS71 1CK0L 1O7SA 2ITFA 4Y4HC 1FUNA 2IDQA 3IYLW 2A3TA 1D5XB 1TXKA 3ABGA 2ZCLH 4JJ5A 4U1IB 5H94B 4ZMPA 4S10A 3DRTB 2X38A 3NMEA 5FFOA 2WZAA 4FP8L 4LQFH 5HJGA 5SWSA 3UJIH 3HNSH 2EINB 5KANI 2EXWD 4P2YA 2AEPL 3RAJL 3DVNB 2C34A 1NIBA 2ZZUT 4TLSA 4EIUA 2N0KA 4FZEL 3TT1H 5C08E 3VFWB 3RFZA 1EUUA 3GXNA 1G0YR 3NZ8A 4AEIH 2XSKA 3NYKA 3L3JA 5HYJA 4NS0A 1CC3A 5K39A 2YAPA 4YS4A 4JY6B 3I2CL 3HFFA 1I3GH 2HT2C 2NDFA 3BVNB 4FL4C 3N85H 4PRDB 1EO7A 3L4YA 5F7NC 4OGXL 1FSKC 1GGIH 2DMBA 3PFQA 5AYUL 2AQNA 3ARRA 3ZKSD 5DDHA 3SOBL 4HG4K 3ISRA 5CFHA 4FEMA 2DEWX 1G7PB 4HJ1A 4BXVA 3PWPE 5GRVL 1R3KB 2E8YA 4PRBB 4U1SA 4OM1H 3RZWA 4O2CA 1UOVA 2PYED 1T6VN 1J0IA 1UXLA 1BLIA 3PU7A 3KLHD 1A8JH 3IU4L 4HJSA 4OM0L 4Y9FA 5AW2B 4HC1A 4YSEA 2TSBA 2PWDA 3BE1H 3UPCA 2VE6B 1RUPL 4XPTL 1GMEA 2HLFC 3C5SB 3UP1A 1MWAA 4DAGH 3ES6A 3NABH 1BFVL 1Q9KB 1KTCA 5C0IA 3TWCH 2UY6B 1CLVA 3HC4L 1URIA 4MSWA 5F3HB 1PX3A 5BZWA 3ROLA 3Q05A 4MXVF 3GC3A 4OZHF 5LBSL 3HPJA 3VB8A 4H4NA 1FNGB 2GJZB 2C1PB 1P4LB 5EZLA 3D85D 3RVWC 3NPZB 4Y5XA 1CFMA 4U6XA 1P4BH 3GHEL 4R7NB 2HCZX 1YN7B 2OMVB 2OMZA 2WTPA 4IOSA 4ZSOB 1MCLA 1JGUH 1A6AB 4PLNC 3FCSA 4I88A 2JXMB 4G7YL 5T1KA 3DX6B 5GRZA 3ML9A 4IGBC 3EOBB 3MNDA 4IRJC 4WI0B 3VWJB 2BNUB 4L05A 5DJ2B 1DVUA 3UCRA 3QUMH 1GOFA 2KDGA 2NY3C 5LQBL 4PVLA 1WISA 3APDA 3FRPB 1EJOH 3I74A 2BSEA 3R0MA 3QA3A 4YAQB 2ICEC 1JJUA 4F7EA 1V27A 1JDDA 1EH9A 2YZ1A 3GLDA 2XPGA 3QYNA 4HQQH 5CMAA 1BJ1H 1T2QL 1UM4L 1UKSA 2Q86A 5F7LB 3VFNA 3ZT7A 4M5ZL 3GXFA 1XR9A 3IRCA 3S97C 3QWNA 4XZUA 1YEKH 2RAMA 3DMMB 2XKNB 3NH7L 2HPOA 4BELD 5DHVH 5LLIC 3TBVB 1HU8A 1U42A 1WWBX 3ASNB 4NOFA 1YNKL 4B60A 5EC1B 2PABA 1WIUA 5J56B 2YPVL 1RUAL 5T1LD 4LCWA 4FABH 1HEJC 1RJYA 1HXMA 1QNZL 3O41A 4QTFA 1WK0A 4YL4A 1HH6B 4NFCA 3RUGE 1YUKB 3KPSA 1G1YA 1PY0A 2VAJA 1AD9B 3DX9B 1X4YA 3HS8A 4NJ9L 5I1GL 4PJFE 3L3GB 5IVXF 1X5AA 4K0OA 3O81A 2Y7MA 3J27A 4KKLD 5AB1A 4QXTB 1QI4A 1U8LB 1NGWA 4L4VE 4KC3B 4TOYL 2HMID 1S78C 4UTAA 3DNKA 3U4KA 5I1IL 4FG0A 4KI5E 1CXKA 4AQOA 4U0QB 1HILB 3NJLA 4AQEA 3TO4C 4YDLB 1CL7I 1TG8A 4L3EB 2HTKD 2I69A 1M71A 5MEOB 1JHKL 4J3OD 1RJCA 5EF0A 2GQHA 1I7RA 3L1GA 5FUCC 3G9AB 1JV5B 1FBIL 1AGFA 2DQCL 3DV6A 4JLRA 3VWJD 3FT9A 3V0HA 5KVFH 1LL1A 1X5ZA 4HHWA 2YIHA 4BKTC 3HBQA 1G7JB 3K2IA 3MRLB 1KJMA 4G82A 3VACA 3HG2A 2Y6SD 1N59B 4ODVH 1GGYA 2VUYA 1JWMB 3NIGF 2VDPL 4IHOB 2PYEA 4JPWH 1TZGH 1YDPB 2ZWKA 1E67A 4XPAH 2LVCA 2XBDA 4M8QA 4XMTA 1IC7H 2B4CC 1ADQL 1R19A 3WKNA 1DL7L 1EAJA 1HHJA 1P1ZA 3BAIA 3GSUA 2CU9A 4BZ1H 3MMEA 1IFHL 1NAMH 3E6HB 1T03L 1NBVH 1EXUB 2XWBB 4P04A 2Y36H 4HPOL 1F11A 4DP1X 1P6FA 2V2TB 1FGVH 3D0VA 1I7TA 3DMMD 1AI1L 3IT8D 2DM4A 5IM7B 1FFPB 3QE5A 3HS0A 4P4KA 1M42A 4R7DB 5DUBA 4JM2C 1KGYE 4KKAD 1A9VA 3FO9A 4MNGA 3MYZA 4R97B 5DFVC 1XB6A 3QDMB 4OZ4A 2O5XL 3W39A 1E4WL 4D3CH 3MV7E 3ZDYF 2KHAA 2QPUA 2CUIA 5EO1A 2VISA 1WG3A 2PP8A 5B1AB 4Y2DD 1PCXA 2DQHH 4YHPB 5AW3B 4PRNB 4LCUA 3PAUA 3MRCA 2MQCA 1UJ3A 4PJ9A 4HKBB 2NTSP 1QYGL 4FFVC 3U9PH 4DO5A 4OR1A 3VFPB 1SDYA 4GJTB 1GVIA 4NOBA 4WI8A 2JKRM 4N1CA 1DUZB 2XN0A 4X0KA 4BH7A 4Y4KC 1LTXA 1OAYL 2QVKA 3VFWA 1S9VB 3T2NL 4L8CA 1V3LA 3RKDC 1EZVY 5JIDA 1DJWA 4OU3A 8PAZA 3WIHH 1MNUL 5I6XC 2DQIL 1E3XA 4TULH 2OA9A 3GZPA 1EGJA 4U6YA 1FGNH 2H2SD 2BW5A 1ZGLA 3WN5A 3BVNA 3NCEB 5IJKA 4JO4H 1AHWB 5D7IF 2UZPA 5IREA 3VXMB 3F6IA 3LRGA 5L9DL 2ITEA 5IIEA 3HBGA 2NY1D 2QSVA 1CFSA 5CGTA 1G7PA 3HR5B 3QEQB 2Z0BA 5T1LA 4DEWA 4UT7L 4YDVB 4JFFE 2WC7A 1MRFH 5TE6H 7CGTA 2OTWA 1ZLDA 3CVBA 3VD9A 3US0A 1TNNA 3GSXB 1GXEA 5E1QA 3HE7B 3SYAA 5BQDA 4R4NC 5SWQB 3M7OA 4U0RB 2BX5A 1E6JL 1JZEA 1OAZL 1RK0B 4JKPL 4Y16C 4X9HA 3ATDA 3HN5A 2HVJA 4I7ZC 5FECA 5D5MB 5SWSE 3EZ8A 5CEZE 1PPIA 3GIVB 3P11H 4DEUA 1CR9H 4BUGA 5CU9A 4OF6A 3HZVA 4KK9C 5EBGA 3SBPA 2A9NL 1T66D 4LF3B 3SGKA 1N3NB 1J9QA 3KVQA 4P07A 2OMVA 4XGZA 1MG2C 4OKVA 4DO4A 2WGNB 3LSOA 3N91A 5C0AB 3QHTC 1A6AA 4PSRA 3QFDA 1ZHNB 1K3ZA 2JXMA 2EDTA 4KVCH 1FE8H 2D03L 5F96L 5HYJE 2DI7A 1IRAY 2ARJQ 5KSAB 2AJVL 3VWKC 3T65A 4K3DL 4EBQL 5D1XA 5HHVH 2YQGA 4JZJB 5IHLB 5ADPH 4KV5F 3DX1A 3D52A 2F53B 3OF6D 5A1AA 4FTVA 4TSAL 5I75B 4KZDH 1KJ2A 1RJLB 3OKLB 5A3ID 1P84K 1N0XL 5E2UH 1JDCA 1F6FB 4CU8A 3IK2A 4IBZA 5EBMA 2BFVL 1E4XL 2W80C 1T21A 2EE2A 4U6VH 4NN6B 1SNRA 3CZGA 3E3QE 1T3FA 1WC7B 4GBXC 3QXVA 3WJMA 5D2NB 2OYKA 5K9JL 3B2VH 2FRGP 4XNYL 4DGUA 4ETQA 2GAZB 1T0PB 2FIRT 2OKMA 3NSYA 4KKZA 3HNTL 3VXMD 4UI2A 5EBLA 3ULVH 1IAOA 3K71B 1XCWA 4I5BA 1H3UA 2BOCB 3DTUB 3QEQD 1S9XA 5CJXA 2EC8A 2JB5H 3ILQD 2WUCL 2VW7A 2VQ4A 1ZDSA 3TV3H 4M5YH 3AS2A 1IAKB 4Y2DA 5AW1B 3HE7D 4GB9A 4DERA 3SDXF 3RWFA 3N41F 3ZR6A 3E9TA 3KYMA 2Y72A 4IGBD 5IB3A 5D1ZB 2DQUH 4NC0B 3K72B 4F9PC 1XF5B 4KTYA 2J3SA 4MJ5A 3S88H 3NPSB 2DWTA 5JORB 4HCRH 5CJQL 4P9HL 1J8HD 3IJ8A 1AYRA 4QHKI 5BV7H 4PJHB 3MLWH 4KAQL 4XO5A 4QO1A 1GCFA 4XP1H 4C57C 4J3XA 4ESKA 4DZBB 5FC9A 4YHYC 3C5ZC 5KVEL 3KYOB 2X0WA 3PV6B 3QIBC 4MS6A 1X9UA 3SGDH 3MRFA 1M05A 5JOEA 2QV2A 3QDGA 4P23B 3HAEH 4LIQE 3SYCA 3R06B 1MCQA 3LRLA 5KSAD 4HV8A 4HZLB 2ZG1A 4JN1H 2QGDA 3IAQA 3OXSB 4UYPA 3QXUA 2O6EA 2AK4B 1T1ZB 3T2QA 4PCKA 4I89A 5CLWA 1J10A 4PS3A 1T0NB 2X4OB 1JWMA 4FXGA 4G3YL 4LCWE 3B83A 2XV6B 1BJMA 2K9FB 3AM8C 3CPLA 4HKZA 5J1AA 1A65A 4JRXA 3BH4A 4ONHB 3S0PA 3STLB 1EZLA 5G4MA 2CA3A 3X3FL 1NCHA 2A2QT 4ZRGA 3O0LA 5KYWB 4PJ5B 1EXUA 5JIIA 2XWBA 2JKWA 3KPSE 4OZGB 3VG0H 5BS0A 4IBWA 1G7MA 4RAVB 1XSJA 2CLRA 1IZKA 3MCLL 4JNXA 5DS8B 3VM7A 4ZS6C 1FAIL 2X4UB 2YC1A 1D5ZB 4FQXC 5MEPA 3CMGA 4G43B 4AUJA 1S78D 2YWZA 4MAYC 5JLZA 3DETC 3A21A 1MJ8L 4JPKH 2MCAA 2BC4B 2CO1A 3Q2VA 3NT0A 2P7TB 3WNPA 5LJYH 5E70A 3D9AL 3NQKA 2APBA 2V5TA 3GGWA 3OKNB 5HGAA 4RBPK 4E5XG 2PTUA 2XTJD 4ZW7A 2EYSB 1ZANL 4I87A 1KB5H 4TPRH 5IBLD 3HC0A 4YHPA 4JFSA 1A6VH 5B3JE 1F8TH 4X5PA 4GW1B 5D1ZD 1QFWL 4AYFA 1L4IA 3MOBH 1TDQA 4L37A 3VFPA 1L9NA 2BZDA 3SBWA 3PWNB 3KR3L 3VGBA 2UZIH 4XI5D 1N70A 2PYEE 1EMTH 3REVA 1N7ML 2YEZA 4NP9A 3MLZH 5EULV 3UC2A 4Z23A 1ONQB 4HOXA 32C2A 5I1DB 3VVWA 4P23D 3TBTA 3GS7A 3G5VA 4KJWC 3HPLA 1K5NB 1NGPH 3FW6A 4IKJA 3FU0A 3G5ZB 4XNBA 3TEWA 3MXWH 1WQVT 1WFTA 3L4VA 5FF6B 1XV8A 1D5IH 2OI9B 1MFDH 3HR5A 4KO6A 2AK4D 5CCKH 2CWRA 1XGTB 1MSPA 4MNGE 5DFVD 5C0BA 3S96B 3T4YB 3LZLA 4OLXL 1FPTH 2KI6A 5I0XA 4DHLA 2XX0A 3AW5A 1GS8A 3LXAA 3SO3C 4DESA 3DO3A 3NN8A 4NFBA 1A2YB 2ENYA 35C8H 4HP5A 1NEZG 4G1MA 1QZ1A 4Z8FL 2XOTA 4IGBA 4PJ5D 3UJJL 2D7TH 2DDQH 3SJVD 4IRJA 1DQTA 3IJEA 2FX9L 4HPYL 4XVSH 5D9SA 3CSBA 2XETA 4NUMA 1J8HA 3WSQL 3X14A 1MCWW 3AY4A 3Q8CA 2BIMA 1CXHA 3T1FA 1H3PH 4YK4C 1U2YA 5C0DA 1EFXA 5IK3A 3MODH 5IOPA 3FCUB 1XCXA 3B5TA 1T89A 2W88A 3BT2H 2OQJA 3N9GH 3RKDD 3F7LA 3DHPA 4OCXH 1VCBC 2FT7A 2QQLL 2N59A 2YARA 3QHZL 1NM4A 5JXEC 3Q2NA 5B38B 3I6KB 3BAKA 4WF7A 4WFGD 5ES4B 5D4QA 4OF7A 1BYOA 5CKAA 3ZJAA 4JANA 5I8EB 4ANKA 1MCFA 2LU5A 5GGVL 5FKAB 3QZBA 3QR0A 2W9EH 2WOBA 4DGIL 1J1OL 1X7QA 3RGBA 1G9NC 3AQDA 2MCG1 5GGSB 3JYCA 4HS6A 4DKFH 2HT4C 2E27L 4M9OA 3LIZL 4LASL 3EF4A 1E0OB 4R4ND 3OSVA 1QSFA 1X9RA 2DTSA 2PW2B 4JFYB 4MCZA 1MDTA 5DLML 4D9LH 5E5LA 2G9KA 4TUKH 2F8IA 4ODBD 4QT5B 4Q74A 3MLTA 4YE4L 3GINA 4DPCX 4WY7H 2LLLA 2BPBA 4KK9D 1ZLUH 4MNQA 3WHE0 3HI6H 3NFNA 3GMLA 4ALAH 5F3BB 1Q9WB 4KO9A 2X87A 3DUUB 3FQUB 5I19L 5DD5H 5GJSH 3S6CA 3TCXA 1HL5A 1FI8C 4ZUWB 4HJGA 2V33A 5CGBA 5DZLA 1OWWA 2EDBA 3AWFA 2YD1A 2CR6A 3BVDB 4BFKA 3MYJB 3OAYK 1U6AH 5E8OB 2N7SA 4NQCD 2MQ0A 3K72A 1XF5A 2VSDA 3FB5B 2X4RA 1T20A 5JORA 3PQYB 1SQ2N 5D1XE 4GH7B 3VD1A 2UX6A 3FQXB 4G6FB 1RZJC 2D7MA 4FTVE 4FULA 3QNYA 1M6UA 1AQKL 4PJAB 4DZBA 1DQQB 2IV8A 3HRPA 3DIDA 4OUOA 3FTXA 3H3PL 1L9OA 3KYOA 1PG7X 5FM5M 1NCJA 3QCVH 4OJEH 1HL4A 3SY0B 4LGPB 3KEDA 2NUTA 4CVXA 5A40E 3CFMA 5BRZB 3QB7C 4HZLA 1LDPL 3QYMA 1MJJB 1YEJH 5E6ZA 1BOGB 5D4JA 1D6VL 4P49A 4F8TA 2AK4A 3UADA 3MUHL 3M88A 5J89A 4BK4A 2FGWH 4BBWA 5I1HL 5F1NB 2X4OA 4BHUA 2BDNH 4I1NB 1KJVA 4P57B 4L29B 3RU8L 3T2PA 5FS5A 4KDTC 1AP2B 1JYXA 3FU9A 3WE6B 1FFNB 4KJYB 4CBZA 3NJNA 5E94B 4JRYD 2HH0H 1YYCA 4PJ5A 1PEWA 1U8JB 1FJ1B 4XH2B 3SJVA 3SDYH 4CVWA 1P7QB 2NR6D 3DHMA 3U82B 1KCVL 2MOQA 4XOEA 3LPPA 4G43A 2A6JA 4PV1C 4RWYL 3T3PF 2DLFH 2EIDA 3QJHA 5DCCA 1AXIB 5HYSA 5HPMB 5BZDB 1S7UA 4Y4KA 1S7QB 2BNRD 3CQFA 4PJ7A 2W0LA 1DANT 1L0PA 2C7UA 4MA1B 2VDLB 3BKML 3LMJL 3EHBB 5GZOC 3FO2A 3BKJL 3ZOAA 2Q8BL 4ZPTB 5KW9L 2WLNA 2CO2A 1B4JL 2EYSA 1P4IH 2XZZA 3HCVB 3WV0A 3QDGE 1MREL 1WWAX 1TZOA 2OMBA 2ZNWA 4XPBL 5ETUB 4UILH 3DJSA 3KGSA 1UKQA 4KY2A 2FX8H 4FG6C 5KTEH 3AT8A 1OF0A 4G6FD 4PG9B 4LPTA 4GAGH 3HE6B 4UOQA 4BXSV 5DTFB 4B95C 1I1YB 3B7RL 2VMCA 2FYYB 2VMFA 4EI5B 5I1AB 5G5DB 3JUYA 5E95B 1Z5YD 5KVGE 4V11A 3VGHA 4JRXE 1SOSA 1KCWA 4B6ZA 4WFEE 1G9MC 1CDIA 4G71B 4XMWA 4G72B 1HNFA 3UZEA 1PMYA 4OI9A 5BS0E 4Y16A 4JZNA 3L5XL 2C4XA 3UBXA 5DA0B 3G5ZA 2VERA 1KC5L 2OZ4H 4FNPA 4L0YA 3JVGC 4ZFGL 3GO1H 3NJHA 4J3WA 1XGTA 3BUYB 5FWRA 4BFNA 3GRWH 2KS0A 4Y8DC 5ENWB 4E0RA 3S96A 5D93B 4LSVH 3JV6A 1XD1A 3DV4B 5MI0B 1BFOB 1A2YA 3FU3A 2F5BL 3U7WH 4U7SA 3TNMA 3DX4A 3ZHDA 4PTTB 1E8ZA 3BP6A 4NQCA 3CHPA 3H42L 1P7QD 4S2SA 2XN9A 3VWKA 4ERSL 3OWRA 4ZMAT 1X5FA 1P9MC 4HK0A 4N0UB 3FB8A 3V6BR 4MXWH 4FC3E 4NNPL 4ONFH 1UWYA 3EH2A 4LEEA 3X3GH 1IBBA 5LCVH 3BVXA 3BJ91 2Q2LA 1FYTB 3S8WA 3VW3L 4BE5A 3BXNB 3O3BA 3BGFB 4NYLA 4GBXA 3EHBD 5BZXA 5F8QC 3L5IA 3MLUH 1I8IA 4CN1A 3LPWA 1MELA 4D0DA 4NO3B 1P7KA 4OD1H 5GRJL 2NZ1A 2B9BA 5IMOB 2FJFB 2W91A 5L8LB 4KJWD 5FM5O 1EAPB 3FU8A 1QEXA 2KQMA 2ZXDA 4CC4C 1SHSA 2Z91A 4FZ8H 5F7DB 2YD8A 3OPUA 2WQVA 5DZPA 4FQLH 1I1AB 4PBDA 2W92A 2DIEA 2KERA 3FZUC 4R2GC 1JXFA 2VUOA 1TCMA 4KTEH 3HE6D 4QOKA 4UIKH 3S5ZA 5E9DB 4BFOA 5DFAA 1A7OL 5C0BE 2WGXA 2V2XB 3SKUD 4EI5D 2WUBH 1LK3H 2VDQB 2X2IA 4JRYA 3U30B 4B9CA 1LNUB 2VW6A 1NPNA 3CVIH 4LVEA 1AIZA 1EEUA 2X2HA 4NPKA 4XRCA 5IG7A 1NC4A 5C6TH 2NR6A 4LAQH 3TS8A 2AC0A 1YEEH 2R29A 2YMXH 4JHBA 3B2DC 4H88L 4WO0A 4M6MH 5DJDB 2IBGA 5SWZD 3QZPA 3VD5A 2CDFB 2AEWA 4DKTA 1G4MA 1L9PA 1J8HE 1KSRA 2BNRA 1JIBA 3D3VB 1W8EA 2LHAA 5HTSA 3MRHA 3DUUA 3FT1A 4HK3N 1XL6A 3QIBA 5AG8A 1MAJA 3M8OL 2KMWA 3LEVH 3NJVA 1XH3A 3MYJA 2VC2B 4XC1H 2PN5A 4M7JH 3UIYA 4MZRA 4XNMA 1UD3A 1INQB 1F90L 2P26A 2Y7NA 3T0VA 1T04A 4Y9CA 3D30A 4DPRA 4LPVA 3DX2A 3ABMB 4AIZB 3NFSL 4JFPA 2IANB 2R0WH 1C8QA 2VTFA 4G80A 3L5JA 5B8CB 5I0WA 3I3BA 1DE4A 2Z1PA 3L3HB 3NIDB 1NLBH 2VLJA 3EO1B 2AKRB 1AGBB 5CEXB 3BWAA 3LKQA 3MRJA 4WW2C 1EX0A 2MOVA 2WLHA 2OMTA 4NB7A 1M6OB 3BZFB 1S8DA 2A1WH 3PXLA 2ADGB 3RL2B 3ZQ9A 3O2WL 5F7EL 2JK5B 2R7EB 4XCEB 1QSFE 3O8XD 4N2GA 1KCRL 5K69A 4RFEA 2YBGA 4FQXA 1ZA6A 4OB5L 4MAYA 2EDKA 4LVOC 1CVSC 5DWUL 2EEAA 4X7SH 1KXQA 4FFWD 1SYSA 1I1AD 4MD4B 3W11D 1FVEA 2QSCL 4NQEA 2DOCA 4MNQE 1NIFA 2VDLL 5GGRY 2H2PC 3K0YA 3LN4A 1TFPA 2E9WA 1FFNA 5C7XH 2J55A 4D0BA 2X1OA 5TPWL 5HGBB 5IBUG 4A2FA 2VRKA 3QUKA 2XTJE 4M48H 3VFGL 2WAQA 3H9SA 1PCSA 5FUCE 4YDZA 2HFEA 4HIJB 4YUEH 1JPGA 5FYJU 2LTQB 3BKYL 4MCNA 3DTXB 1GC1C 3QORB 4RRPG 5K1JA 4ENZA 2Q7NA 3JT0A 5A2LH 2DWEA 2Z31B 3N50A 1FC2D 2QTEA 1V7ML 3CN3A 2OCJA 1S7QA 3T0BA 5BZDA 1DZ0A 3D3VD 1DJSA 1AMYA 1XVSA 2P5EA 2YXVA 3UTPD 4G5AA 4GIPD 5D7IB 5K59F 4GOSA 4B9ZA 1T83C 4ZPTA 2ZKXA 4MDIB 3V8OA 5E5RB 1JNJA 2X5PA 1Q1PA 4H7VA 2X41A 3UROR 3PPEA 3Q43A 4DCQA 2EXSA 4F7CB 4GW5A 1CB4A 2VLMD 1YYMH 4RQQA 3MNVA 3I84A 1A5FL 3RWCB 3F62A 3VFVA 3NJMA 3VGAB 2IDSA 1RURL 3BX7C 2VNCA 4G8AC 2WZ5A 1TQCC 1N5YL 4ISVA 4DGYL 2VJ0A 2IAND 4Y1TA 1EWHA 4X98B 5DTFA 1S5IL 4PN6A 4HFUL 2OW6A 4EI5A 5I1AA 1BP3B 1UOKA 3E8UL 4K5PA 3L5WB 4FTDA 1SXZA 3CFEB 2Y4SA 2LFEA 4HS3A 2WKLA 4OZHA 3U0TA 4GSDL 5HDWA 3SJVE 2R1YB 4N6QA 5SWZA 2QKIC 3TYGH 3PNWB 4O2FA 3LEXA 1IBFA 4WEMB 3O3EA 4RA3A 3K1DA 2MNJB 1Y6KR 5DJYA 3OX8B 1KBPA 3BUYA 1IGJB 2DZEA 4UQEA 1NEUA 1OAKH 5A6IA 2CCVA 2JLPA 4XBEH 3B3IA 4PJ7E 5AZEL 5HVHB 2GJ6A 3OKEA 5JTWA 3ETSA 4JREB 5A7EA 1UD2A 4P06A 4QXUH 4NWUH 4H20H 3VXOB 5JXEA 1W8OA 5C97A 3V8CA 3Q6FA 4HWNA 2HFTA 3QORD 3QQ4B 5EU6D 4XBMA 1W80A 1Y6NR 2J88H 3RFRA 2AJZB 2GSIA 4PRHB 2R2HB 4WTZA 2Z31D 3ZZLA 3ZO0A 3RZCC 4EN3B 5ID1A 3D4CA 2VDQL 4P4RA 3EYQD 4DQAA 1ETZA 2QPFA 3QR2A 4KKCD 1DBJH 1N0LB 5E08L 2V5SA 5F7BA 4FFYA 4I48B 3TC9A 2VRAA 4NO3A 1KEML 5IMOA 1GZQB 4BUQA 1DJXA 3DVIA 4JFWA 2PO6C 5F7KC 2OCFD 3O8XA 4HWEH 3UYPB 4UINL 1KCUH 3FHAA 4JG9A 4Y7OC 4GQPH 4IIQB 2VXTH 3MJ9H 4QRRB 1U3ZA 5C0RH 2WWNA 2LAAA 5PAZA 3PGFL 3EUDA 5IVXA 4URTB 4WDIB 5J11B 1G7LA 1MCIA 3MJ8B 4XN7A 3WNNA 3T0XA 3GD1C 3D34A 4UM9A 4R26H 4RRPM 5J3HC 1QRNB 3CDZB 3ULVF 5JZ7C 4LLYB 2CXKA 2VC2L 3QO0B 2F5AH 2X3BA 3B7YA 3JV4B 4X6DA 1K85A 5T1DL 4UUJB 2XBTA 1INEL 2H0PA 1MRDL 1A14L 4NQCE 1IL1B 1A7QH 2XN9E 4IOIB 4Q9CA 4QYOA 3L1OH 4PWIA 5AG9A 2CDFA 4KK5D 5DK0B 4AK2A 1U8OB 2GK0A 1E4KA 4PGEB 2VZUA 3MUGB 4R4FH 5IROD 2FATL 4GRMB 2FBJL 1MN4A 4KGLA 5HGDB 1DVZA 2XDHA 4JG5A 4KVNL 1W0WA 4WUKH 1QKZH 3ZO9A 3ZMRA 3TN0B 3EYSL 3EG9A 3GHBL 1BAFH 2ZKWA 2BIQA 3U6XS 5LGJB 1GZHC 3HI5H 4DQOL 1I7UB 3LKPA 4DT2A 2VN3A 4XOCA 1Z3RA 1P5VB 4MZ3A 2GEQA 1AS7A 1QLFA 3CXDL 2AAVA 4KRLB 5KBMA 4E9RA 3FMGL 3W5NA 4GKZB 2WZPD 4ETYA 1PFCA 4UBDC 5EZOH 5GRWA 1IGTB 3EO0B 2VR4A 4PRHD 4R2GD 3SDCC 1CLZH 6FABL 3V10A 4EN3D 4KDTA 4QOKE 4L48A 2ADJA 1E9OA 1MF2H 2SODB 3ECWA 3CUPB 4PJIB 4BZ2L 3KLSA 1UXSB 4JRYE 3ARBC 3ZRCC 1C12A 5IHUL 4H5SA 4ZZFA 3BZFA 4OZFB 1IGIL 3T8XB 2FQGA 4OF8A 5HDBF 1ZTXL 1VPOH 2BHUA 1AR1B 5EUKA 2YLKA 3COOA 5JIPA 3RWEB 4H1LG 4QRRD 3ZYZA 3U0PA 5HJBA 2E7DA 2IH9A 2H9GB 2BNRE 5DLLA 4EIBA 1J1PH 3CD4A 1OK0A 4ZTOL 4PY8I 4XNZB 1O9ZA 5DQ9B 3NCJH 4U1LB 3WIIH 4O9HH 1DEDA 4IS6B 1QRND 4MA3A 4U1NA 4PJ8B 3IRPX 2WBWB 2YAMA 3P3SA 2IWEA 3QDJB 2J72A 1W0YT 1G9EA 1ZMYA 1MWOA 3DTXA 5EU6A 1LMKA 1TJGH 1EDYA 1TJIH 3QAZC 4UQ9A 5B1CA 4ZX4A 4CJ0A 2XWEA 3WLWC 1L6ZA 3SZ6A 3DJZA 4EIGB 3FB7B 1HTYA 5FK9A 4UF7C 5FKPB 5FO8A 2RB8A 3GM8A 4JHAL 4DN3H 5GRUL 1WBXA 1IGYA 1O5DT 2E7MA 2ZYRA 3MRPA 1F3DJ 1EEZB 5D7IA 1UUNA 5DUJA 3DPDA 3WY1A 4E41E 2VLJE 1OTUC 3DECA 1AGEA 4HCFA 5J6HA 4TUUA 3I02B 3K2KA 5E51A 1D5MA 4RFOL 4YXKL 3TN0D 3VE0B 1ACXA 4GAYA 1CBVH 3KYKL 1ET8A 3MLYH 2CK0L 2WXFA 4ENEC 3SGEH 3ZDZE 3MRDB 4YIQA 2AJYL 3JV5A 4NUQA 5GS0D 1RAMA 4DP4X 1NGZA 1DEEB 3JVGA 1S3RA 4FFTA 3P1VA 3R4RA 1KXQE 1UVQB 1O6SA 1OTSC 4X98A 4UT6H 4MMXB 4NQEE 2ZJSL 4I3SH 5AVWB 3ULUF 1P6AB 5HHPA 3L5WA 5AB0A 1NBYB 4Z0XB 3U2IA 2DQFB 1MFBL 3KM1A 4E42B 5DEGB 4HULB 2I9LB 3C6LB 2O61B 3QJZA 5GS1C 1NFIA 3H9SE 4FNQA 3WO4C 1AD0B 1P9MA 2PF6A 5T5FH 5LGYA 2GSMB 4UU9B 4JL1A 1SMOA 1DVSA 3VNZA 3CN2A 4W81A 5IROA 1CLCA 1BZ8A 4AZUA 4P5MB 2VXSH 1U9KA 1GS7A 3MLSL 1EEYB 2P4AB 1GL4B 3H8NA 3O45B 4KK6D 5I73B 3LNFA 4B9GA 2P5EE 4P5SA 3A6OA 4NZTH 4NENB 3N3EA 4DTGH 2X9YA 3QHFL 1ZT1A 2P3YA 2PXYD 3O2DH 5J9PB 1TFHA 4NIYE 3FF8A 2VSMB 3RDTC 3DXAA 3EBAA 4PV9B 4AQ8C 4ANVA 4CC4A 4UM8B 1YEHL 4Z7VF 4XP5H 2V7HA 2WZPA 2BZCA 3OR6A 4PRHA 5SV3A 2XG4B 5FUZL 2W60B 4XMPL 5AB2A 4NI3A 2WBJD 1IEBB 1JE6A 1CGSH 4ZFZB 1LO5A 3BSZA 1QFWI 4OTXL 4WGWB 1GZQA 5DI8A 4YXHL 3TV8A 3K4DA 4PS4L 4OZHE 4MA7L 1MCHA 2ZWYA 1IM9D 2Q3XA 4LE8A 2XQYG 5SWZE 5E2WH 1GOHA 2X4QB 4FQQA 3EJPA 4B3EA 3NGBC 5FGSA 1BD2B 2GTQA 3SDXA 5E8EB 4X80L 2DH2A 3MJ8A 3G6JA 4K94H 2CO3A 2OP4H 1VRSA 4RESB 4XE5B 2IQAA 1NCDL 4LLYA 3VA6A 1R47A 3QO0A 2GJ6E 1CGYA 1XF4A 3E8VA 4PGBB 1TEYA 2W65B 3H9ZA 4LLAA 3C6LD 5GS0L 2Y1AA 3KYNA 3EFFA 4N8CH 4PI0A 1VKXA 1NCGA 1TYJA 2XV2A 5DRWB 5E1HB 4JM4H 1C1EH 2A74B 5JA8B 1MW0A 3CFCL 4GRMA 3WEBA 1F18A 4ELKB 3PWUB 2HKFH 4FLOA 4K3EL 3UEQA 3SD5A 2VN6A 5IQOA 2E4FA 4LLUA 1JS4A 3ULSB 1N4XL 5GPRA 2H7WA 4GIAA 5DHDA 5TE7H 2P24A 1SUJA 3CFTA 1N6QH 3AAZB 4HX1A 2R69A 4G8GD 3T3MB 4O51A 4RIRA 5E1AB 4X5XA 1LLAA 5F0LB 2PNDA 3WLBB 2V9RA 1N9PA 3BUPA 4JFHD 2H0EA 1RK1A 2R0LH 3LS5H 3QYCA 5GRYA 1PD1A 3BOVA 5F9OL 4PCSA 5ESVB 3S4SB 4J6RL 5IVXE 2ZCKL 4XNQB 2OW7A 1BGXH 3O0RL 1TTUA 3GEWB 4YJZL 4RMTA 3KPOA 1R0AL 4X6DE 1E9QB 3KJ4C 4OIBA 2OMYA 4L8SC 4AV4A 2IG2H 1KZQA 1XAUA 3M17B 2XACC 1P7HL 4QHUB 3KBEA 2P8MB 2UZXB 4DP5X 3VX0A 2DQGL 5I1CL 1N64H 3FUIA 5D1ZI 2UYLB 3RIFK 1NLDH 2NLJA 1T83A 4C83B 3QS3A 3FH5A 3HG0A 3NRPA 1WIOA 4U6HA 2PXYA 3B8YA 4G8EA 3RNKB 3GJEB 3B9AA 2ICWJ 25C8H 4Q58C 3ARTA 1VGKB 4GG8A 2GJPA 1UATA 4HSQA 3NIGE 3GJFK 2XWJA 2VM9A 2A4EA 2N1KA 3CLEL 1W72H 4X8CA 3MXVL 5DJZA 1ET7A 3BPLB 4LPYA 1KFGA 3L4UA 4LHUB 2G3ZA 3H3KA 4G7RB 2AEQH 5EZJB 5KVMC 1S5HA 3BQUC 4X6EB 4Z7IA 5IESH 2OZNA 3IDXH 2WBJA 3IDGB 3B9KB 3FTGA 3TBWA 3MRKA 4I9WD 5C70A 3SPJA 5IQ7H 5HP5A 5TE4H 3RNQB 4FF9A 3I02A 4MB1A 4G8IB 1FH2A 3UABA 3GQFA 1IM9A 5E5UB 2EIZA 4AJVA 2QKIA 4CDHA 2F8XC 1EEQA 3IKCB 1OF2B 4KOBA 4NAMA 4L8BB 2Q6WB 5HD8C 5IQ9B 1OARL 4K23H 2J6EH 3UDWA 3ZDYE 2WO4A 4JZJC 7TAAA 3AT9A 4M7ZB 4OD3H 2X4PA 4YVNA 4LKCA 4QHNB 5I8OL 1DBAH 3QNZB 4OLUH 1V54B 1PBYA 3K3QA 3IAPA 4B9YA 4DKEH 3DOIA 2HFFA 3R18A 5E0FA 2PWFA 3FQWA 4MJIB 3BZ4A 3ERXA 3P0VL 3Q2CA 4EOWL 1MVUB 1R5IB 4Z0XA 5CZVL 1BYNA 4Y5VB 1G7HA 5TH2A 1IEAB 3GMQA 4B9FA 4E42A 2P9RA 4F9LC 4G7VL 2O61A 1M1XA 5HDQL 1BWWA 2QL1A 5FFLA 4Z5RA 4C47A 1LO0H 3QUMB 1S7TA 1AR2A 2BY0A 1T7VA 2EADA 5EU6E 1TOXA 1UWEH 5BXFB 1FDLH 3PL6B 1IVLA 2JELH 5ICZB 3DBSA 5ECJE 5KBKA 2JB6B 1JD9A 1JWUA 3J07A 4N8VG 3GZOA 3Q5TA 4P5MA 3US9A 4AEHH 1LE5A 3KLKA 4GAJH 4HUWB 2QLVB 3ELAT 5GISL 5HYIA 4E9WA 1NL0H 5CR1A 3VXPB 3LV3A 3ME0B 2CR3A 2DYPB 2LU4A 1UM6L 2KT6A 3L9BA 4FQ2H 5IEHB 1ULVA 5E0QA 4QPEA 5E6UB 5ADOH 4OGAC 3IDUA 4P2OB 1V05A 4G8GA 1KNOB 3CLFL 4RZCB 3LZFL 3QJTB 5E24E 1XF2B 4ODUB 4PV9A 4JY5H 2APFA 3O4LA 1ZKAA 4U31A 1H3XA 2NY5L 3EADA 4BKSC 4K4KA 1RMFL 3AUWB 2XG4A 2AXGB 2PTTA 1IM3A 3LQAC 1IKOP 1OTSD 1GYAA 2YPLE 2IMMA 1HZHL 3B9KD 2QVIA 2TRYA 2YD5A 2YHGA 3D4GA 1J8SA 2WIIB 3UZQA 2QPEB 3BDBA 3FOMB 3MROB 4LSPH 4S1RL 3PIQA 1WZAA 2XNAB 5SX4I 5GGTL 4UQ2B 43CAA 4LLVA 1XEUA 2X4QA 1KELH 1QPXA 2GUOB 2IPTH 2FB4L 4KFMA 3WTTA 3RPKA 4G9FA 4AMKH 1HEHC 1W2KT 2XIIA 1GJIA 1LEKB 1QFUH 2Y24A 5EF2A 5EN3A 1YC7A 1QW8A 2FEDC 4AX3A 5AOIA 1NC2B 4MJID 5J7CC 1UFGA 1QBLH 5CGYD 1UZGA 2R1WB 1WFMA 2B2XH 2W65A 4S1QL 4JFZL 3TJEL 2AW2A 1XX9C 5M95B 4LCYB 1RIUL 3IDYC 5J6SA 2J5LC 1TPXC 2AF2A 4RGNC 1HCVA 2BVPA 3ARGC 1SEBB 4Y2LA 3UO8B 1CFTA 3WFDL 3BHBA 3BN9D 5I6PA 2PW1B 3DXAE 3F64A 3TPKA 3ATBA 4HEPG 4NQSA 1SXNA 3ARWA 1JGLH 1YA5A 3PL6D 2DICA 3SDCA 4MLIA 1U3HC 4NNXB 1JTPA 3QJQB 1HAWA 2BCKB 2XT1B 3Q5YA 4NPYA 3CBRA 2ZCLL 4K7PX 2LVEA 4ZX5A 2DYPD 4NT6B 4ZTEA 2CDGA 4NKOB 5BOZG 2AXHA 3UJIL 3IS0X 4WW1B 3AAZA 4P2OD 1IB5A 1SFHA 3IDIA 5FYKD 3L9YA 1PG7L 5DZAA 4PREA 5GSRA 3M86A 3C5JA 3S4SA 3FCTA 3SDXE 3MOQA 4N2LA 2XQBH 5IFJB 3BYYA 4FERA 3G6JE 4GFXA 1ICTA 3SE4A 2A7BA 3ARXA 5FXCH 5JHDA 3E7JA 1I3GL 2APXA 3GKWH 3N85L 3HTLX 1P6WA 3OJDB 4OAWB 1GGIL 2Z7WA 4PJBA 3W0WB 4F93B 2VO8A 4BH8B 4MQXC 5KG9A 1KBGL 5FHAH 3VFOA 3VDCA 3MRBB 3BAJA 2WO3B 1QPKA 3S37H 1CDGA 2A0LD 3IMUA 2UZXA 4AJWA 2AMGA 3CCHA 1K8DA 1ND0B 3BT0A 4ZDHB 2BRRH 4Q97A 3V79C 4PI2A 1VEMA 3PP3K 5H37G 2UYLA 3HHSA 3TURA 3K8KA 2APWA 1BZ9A 1EHLH 3H4HA 2KKQA 4G83A 1J5OH 1NC2D 3IXAB 1F6AA 4DAGL 2JCCF 5E5MA 3ECBA 3ZQWA 3NABL 4BSJA 3KWVA 4KNSA 1JPFA 3U1QA 3FO0H 3UTZB 4I2XB 4N2AA 1Y18A 4KJQD 3TWCL 3FUHA 2GK2A 4UCFA 3KCPB 4PR5A 3BDYH 3MLRL 2NYKA 2JJVA 1SHWA 5I74C 4OV5A 1G1CA 3KLAA 2ZSVB 5EZJA 3NJJA 1P4BL 5G55A 2WWKT 2ZUTA 2NY4C 4YBQD 4LSSH 2WWKO 3B9KA 3C75A 4TSBH 1JGUL 2F58H 5EUOF 2FNBA 4G8FB 1BIIA 1FZOB 4MS8C 5KBDA 3VYPA 3RTQB 3H2WA 2B3IA 1HDMB 4RAHA 4G8IA 2Z7YA 4Z76A 5GS1A 2BP5M 3HOGA 3S5YA 4FADA 1TETH 3QUML 1KACB 1M56B 2YO3A 5F89B 3VD4A 3GHPA 1MCCA 2Q6WA 1HZLA 4XVUC 2DY2A 4DIXA 1RZ8A 3SPGA 1A6TB 4XPFH 1DJHA 5GQBA 4R0LB 5DMJB 4ATWA 3N0AA 1H3WM 1ZLWH 2EDEA 5F1IA 3PP4L 2FIKB 2ZKMX 3EGXB 4X6BA 3UXFA 4N2FA 4HIEA 4AXWA 1QSZA 4Z1PA 1L6PA 1BF8A 4HQQL 2FYVA 3WXVL 1XB3A 1R5IA 3QIWC 1Y1DA 7PAZA 4YE0A 2OL3A 1YEKL 2WTRB 3QPXH 5C8JB 1CF8L 4EKXA 5CD5D 3QQDA 5FYKL 3QDAA 1UA6H 4AQ8A 4EN2A 4JZOB 3QXAA 4G6JH 3CSGA 2MQ3A 2VDKB 2D0GA 2CQVA 4HIQA 1FFRA 3PL6A 4FABL 4N24A 3TCLB 2VSCA 1SN5A 4JG0H 2VM4A 3L1FA 3JWNG 1OGTB 5DQDH 5FW8A 3QEUA 2BSBA 4DGWC 4JEGB 3VXPA 5DRNB 2P80D 3L54A 5AKTA 2R23A 2I25N 5JOPD 5IEHA 4NM4H 3G5YA 3II2A 3LAFA 3KYAA 1OQXA 1OW0C 4P2OA 4MDJB 4P3WA 1KIQA 4RZCA 1ACYH 4Y1AB 2ADIA 3NTCH 5EFIB 2FD6H 4ZXBC 2NZ9D 3EYOB 1S7RB 4LSUH 1HWGB 4BJLA 1HL8A 1XF2A 3I75A 2AABH 4NSKB 2XV0A 3WBDA 3A23A 4BYHA 3KXFB 3TWYA 2O93L 1RZKC 1BQRA 3K6NA 3RRQA 2WY3B 1A9BB 1KOAA 1UKTA 4FG4A 1WUZA 2KZWA 4G2AA 5A6LA 4F2MB 3GSOA 4JQXC 1RXLA 5LXVA 4P0DA 2WO2B 1UQSB 5BNXD 2OSLB 3QUYB 3P3UA 1CK0H 3FAWA 4E9YA 4J4PC 1YEWA 2YMOA 3RTQD 5BRPA 3A6BH 1ZA3B 1GYUA 3VFTA 2XNAA 5KVFL 5KYYA 5BJTA 3UBGA 3ZKXB 1ZLUK 2ITDB 3JSSA 4ODVL 3CFKA 4NDMB 2V7NA 1WEJH 1IJNA 5BV7B 1NFAA 4X6FB 2QHRH 4JPWL 1TZGL 4PRIB 4XPAL 1UXMA 5HHOB 1IC7L 4F7MB 4JRLA 1LEKA 4FZEH 3VFRA 1MI5A 3CZEA 1NKGA 2VN7A 4PRAA 1MNNA 4BZ1L 2ZF8A 5I24A 5KS9F 1NC2A 4BDVB 3D69B 5FA4B 4HC1H 1KN4H 4B7IA 1IARB 2Y36L 1N8ZA 2V9UA 4BFFA 1FGVL 3FT4A 2J43A 3HAEB 1JG9A 1MWAH 4LCYA 3GTVA 5E2VH 1JZ4A 5JIHA 2IOIA 3MVSA 4G8GE 4N22A 5AYUH 3V0JA 1KENH 3O4LE 3PWJB 1KXHA 3SOBH 3QJVB 5J1TC 4YPGB 3F5WB 2B39A 4AKPA 3ZLQC 3PE9A 4D3CL 3BZ5A 3CTTA 5DYOB 2UWEA 5CBAB 2IGFL 5KANG 2DQHL 4ZMTA 2WYTA 3BMVA 2FWOA 4ZMXA 1QVOA 4DVBA 3KCWA 3WKYA 2E47A 4L8SA 4ZUSB 4Y1AD 3N0PB 4HGKC 1A4KB 3JTTB 4YHIA 4IBVA 1NUGA 3FN9A 4NGHL 2CHNA 2YUVA 3KXFD 1AHMA 4H0GA 4NRZB 3ULVD 3IU3B 1TEFA 3HC4H 4ZYKB 4QCIB 4KTDL 2IFGA 1U8CA 1U36A 3LXUX 2ZX8A 1MW2A 1KPVA 3RY5A 3FNKA 3WIHL 4G9FE 3IF1B 5F88A 4ZUVB 3GHEH 4YLQT 2FZ3A 4GO8A 1FGNL 2FEDD 4U1MB 3H55A 3CZUB 5E9AA 1UWXH 3QUYD 4LIQH 5C0CA 4HK3J 4L2YA 5GS2D 3TF7C 2WYHA 4NQVA 2EYTB 2CIKA 3NP4A 5IMMB 2QVMA 3I6SA 2DRUA 5IW6B 4HUVA 4JFOB 4DOHB 1P69B 3GJFA 1FV1B 3BQUA 1WHOA 1MRFL 2JMRA 4PRID 4QWWC 1SJVA 5TE6L 3SPHA 4KXZH 5HHOD 4I77L 1E5AA 4KUCF 1PG7W 2NXZD 3QH3A 3CSPA 4AV0A 3PREA 3KPPB 2I26N 3BPNC 1P1VA 3ILPA 4F3FA 1MCEA 4EUPG 1CD1B 1OE3A 4Y9EA 2FO8A 5EIIB 1OCZB 3QARA 3P11L 4XWGH 4IMKA 1DJZA 3B6SB 2JTDA 3KCPA 1UWGH 2CO7B 4UTAH 1Y6MR 2WTOA 3VG9C 2CH8A 5ITFA 1CD0A 4IK6A 3Q7JA 4MFHA 2YUWA 2YPVH 1GIGH 4NUJB 4N90E 1NQBA 3LDBC 2Y2WA 3T71A 2X6CA 5CF3A 2M2DA 3BGFC 3ESOA 3BJLA 4N85A 4H8WL 4Z7OF 3FT2A 1ORQB 5JHDE 5EO0A 3T3PE 4F9LA 2R4SH 5HHVL 2H1LM 4PJBE 2D0FA 5EU4A 5F89A 2VDKL 5ADPL 1XDTT 4DKDC 2O5NA 4KROB 3UFIA 4B5ZA 2CA4A 3FS9A 4KZDL 1A6TA 3QRLA 4PU2A 1ZPLA 3AU1B 3ZGHA 1SXAA 2X0VA 1J48A 3E6FB 3LHPH 1KB3A 2BXYA 2Z65C 5L2KB 4LVNB 4U6VL 2FIKA 4MJ2A 3TA3D 1QR1A 3GRGA 1BJ8A 1HHGB 1U8NB 3P40A 4LSRH 4E2OA 4JX0A 3KJ6H 3GMPA 4Z7VB 3PXHA 4JVWA 4FLHA 3U30C 4IBTA 3D51A 3KGUA 2WTRA 3B2VL 1RQ5A 2ZXEB 3OZLA 5C0JA 1JUFB 5FCUH 1FBIH 4BQ8A 2E9GA 3AFLA 4Z7WF 2DQCH 4JZOA 1HI6B 1QOKA 2GTWA 3IDJB 2XWTA 5DHXB 3ULVL 3TCTA 4FKKA 1C16B 1AG6A 1THCA 1Q94B 3GSRA 5HYSG 4GT0A 5C0EA 3TCLA 5KJRH 2JB5L 4Z95H 2VZSA 1OGTA 2KZBA 2VDPH 3TV3L 4AI7A 3WIAA 1X5JA 5JHAA 5DRNA 2YSSB 2EVJA 3SKOA 4UB0H 3UPRB 3QIUB 1C5DA 1QMUA 4QYAA 4AYID 2EEFA 4WZ9A 4WI3A 4JFVA 1MQ8A 2DQUL 1IKFH 3H7BB 1WV7T 4UQDA 3Q1EA 1DQDH 5IHZA 3Q8FA 5D1QB 3TP4A 4NERA 1XFPA 3S88L 4HCRL 3VFMA 4IRZA 1PLCA 3OMZA 3K81A 5BV7L 1WVZA 3MLWL 3ULUD 5GRXG 2EDWA 1DO5A 4XP1L 1A9BA 2FR4A 4QXGL 2NNCA 1KIPA 3BO8A 3MV9D 4F2MA 1SJHB 3K1KC 3MCKB 3CFJA 1U4EA 1UQSA 3IGUA 4XCNB 4CU7A 2RACA 1I4FA 5B1BB 3QUYA 3AS0A 1EGJH 2MKLC 4TVPE 1ZA3A 3OKDB 1BX2A 2C3VB 1U91A 2P48B 3RWJB 4JN1L 4DP9X 1TU2A 3KH4A 3ARGA 1HJCA 2NW3A 3O6MH 1ITBB 4E36A 1R24B 1PEZA 2BSCA 5C0ND 5IV2B 1HSBB 1U33A 3VD0A 4GUPA 3ATEA 1FCGA 1MY7A 2VJ8A 2NY7H 4X6FA 4X7TA 4NC1E 3CGTA 1U3HA 2WQAA 3TJPA 4HUNB 1QTYT 4HLZH 2G2NA 1OAYH 4F7MA 5I1LB 4FCHA 3L16A 1YPZB 4IJ3B 1A7PH 3ZL4H 5F9WC 1C5BH 5JHLA 3VG0L 4OFDA 2VR6A 1F3JA 4I18B 4PM1A 3S7GA 3LKSA 2XV3A 3OC5A 3Q9QA 4QRPD 1HXKA 1MHPL 1USQA 2LTQC 1B0RA 2ZNXA 5F21B 5L9DH 4JPKL 1M2VB 2WPGA 2WAHA 1T22B 3O6FB 5CSGA 4PJXB 5I8CB 3SCMB 2YSTA 4M43H 2DMHA 2AJSH 3RB7A 4NCDA 4WAFA 5DD6B 4S11A 4TPRL 3L3OB 4KZEH 4Z3EA 1CCZA 4XMLH 1CDYA 1A6VL 1F8TL 3QIUD 1D6EB 3D4ZA 4RNRB 4U1HB 1FZJB 3TBSB 4ZUSA 4PIRF 3MOBL 3V6ZA 1OAZH 5D1QD 5D2LA 3SY6A 3WNOA 4UZSA 3F58H 4NZDA 2JKTM 2VDMH 1MIMH 4HF5H 2FX7L 1KJ2H 3H6AA 3IU3A 2UZIL 4QCIA 2DQTH 3EJZD 3J2PA 4XPHL 1U8KA 2WSKA 3TA3A 4XP9H 3DARA 1EMTL 3MA9L 1IBZA 3MLZL 5EWIH 3MBEB 2DB8A 1MI5E 4U1MA 1NOFA 2OMXB 5EV7A 3IKKA 3MV8A 4L1DA 1TMQA 1IBHA 1DQJA 1ASPA 4HISA 1FN4A 2L4OA 3ULUL 2BP0A 3L9EA 3MXWL 1PIGA 2EYTA 1D5IL 4ACPA 4EBQH 4CGTA 2CJTA 1ES0B 1MFDL 3KW8A 5CCKL 2VABA 4I1PA 2VXUH 1G7QB 3EDJA 4PLKD 5IB2B 3PGCB 3RBSA 2KYIA 4A37A 1B0WA 1HFUA 2PWHA 4MQSB 1FPTL 2Y7LA 4HHAA 5DJ6A 1E4XH 1YZZA 1X5LA 1M9SA 1FNSL 2WN2A 2UWEE 1DSFH 1I8KB 2D7TL 3BFOA 3MAWA 3TH2T 3QT2A 4OFIA 4XVSL 1B2YA 1NUNB 1OY3B 4MKTA 4F57H 5JW4Q 1AOHA 3VX1A 4JFEB 3HC3H 3ECUA 4N9GB 4M1DH 2IH1B 4JE0A 5DS2A 3MR9B 3GLAA 1I7ZB 1IQDB 1I9JH 3MV9A 5D7LA 4AVKA 4YHZH 3MODL 4IBYA 3D08A 3BT2L 3N9GL 3SQBB 4A7GF 5I9QC 2OXGB 1BVKA 1QBMH 2BHZA 3QQ9D 4IDLA 4OCXL 2WUCH 1AKPA 3RA7L 1IEHA 1RPKA 2ILLA 3B34A 2BMKA 4IKLA 4UDUB 1I8LC 1H8NA 4U1JB 5I8KH 2BRQA 3BGMA 4M4RB 4ANWA 4NZFA 5HI3D 2E59A 3VXSB 5IR1B 5MHSE 2C8NA 3SYQA 3UG4A 2WXOA 4YEFA 1RZQA 3E6FA 2W9EL 2HWZL 2B59A 4QWWD 1ODUA 4FI6A 5J11C 2Z35B 1B0GA 1JL8A 5JPNC 4DKFL 1SLWA 3KZ8A 1F1GA 2MFNA 3MBED 4YMPA 1HYSD 4HD5A 1X5IA 5JOPE 2BVQB 3A22A 3EH5B 3P4NB 1AXSB 2JKSA 3HUJF 4TUKL 4GG6F 4ZXBA 4QRPA 3V0VB 3TEZA 4JKLA 2DQDH 1TZIA 2ZX9A 1KMGA 4WY7L 5JHBA 1ZK5A 3OZKA 4LDLB 1UA3A 2IALA 3HI6L 3GUTA 3AB0B 1H15B 4ALAL 5DD5L 4MAUH 5GJSL 4EI6B 1MLCB 2J6WA 4JQXA 3QWOA 4XN1A 3WCYA 5CUSH 5T3ZD 4M61B 1GYVA 1YEFH 4G6AC 1U8MA 5D7SL 1U6AL 3X3FH 5DO8A 1ZY9A 1J87A 4XXDA 5D1QA 2XIDA 2Y9RT 3OZ9L 3QUHA 4HKJB 4JN2A 2C3WA 4OLZH 5F70A 4JFED 1FF5A 1JPEA 3IRZA 1MFCH 1DSWA 5DHEA 5KSBF 2Z9TA 1YNTB 1RCYA 4GRWF 1QD0A 1Z6JT 4HUXB 4KWUA 4N3UA 4X4XA 3QCVL 4CMMB 3S36X 2QGEA 2XFXA 1O75A 4WJ5B 2ADFH 2QVTA 2EQDA 2G4EA 5IB4B 4F8LA 3VYOA 5EZIL 3FRUA 1ZANH 4J27A 4JDTH 4N0YH 1JF6A 5EN2A 2B5IC 3IN0A 1WA1X 2ZUQC 3AT0A 5ACZB 2FGWL 2WLLB 4UIMB 1VZIA 1ZJBA 4R4BA 4NLAA 1AR1C 1JFQH 2BDNL 3NJKA 4FHBD 2HSIA 4WSJA 3AROA 3SKMB 3SE6A 4QRTB 1ODAA 1CS6A 2F2HA 1KBKA 2DKUA 2NXYC 3BKCH 1U8PA 1ZLVK 1TO5A 3X17A 3UGUA 3ZL2A 2JI3A 3S5LG 2HH0L 2NNAB 4G6KH 4L5FE 3FONB 4P5KA 4GXUM 3SDYL 2MQGA 4XVJH 4LT7A 2OFQA 1D5RA 2XICA 3LPGA 3RUGF 1S9KC 4TVSa 2ENSA 4TNVF 1XGPB 4POZC 2DLFL 4X4MA 4JUTA 1M2VA 3KW7A 4N0CC 1S7XA 3ZIMA 2G3NA 3V0EA 4BK5C 2WWMD 5DJCA 5MERA 2Z7UA 2C3GA 4F8QA 2BO0A 1N5AA 3Q0HA 1ORSB 5F7AA 3G6DH 1P4IL 3TZVC 3THMH 4KI5F 4KXCA 5HPOA 5AVSB 1L5GA 2F9BT 3BD5A 4J1UB 1Q38A 4KDWA 3V5DB 4Z8FH 2FCBA 2ICWA 4UILL 2X10A 3UTTB 5IT2H 3BH8B 1ASQA 4RGNE 1GRWA 3MX0A 2DQJH 2IDFA 3T4AB 1JK8A 5JPMA 1XTMA 1E8XA 5KTEL 5LKNA 5D96C 4GAGL 1KLGA 1UUSA 2PPCA 4WTWA 3V0WH 2NYYC 3U1SH 1M3JA 5JOFB 3WS6C 1JAEA 1IT9H 1B0IA 4Z7QF 4IEFB 3HHMA 3KWWB 5GSVB 2HJKB 4YZFF 1TVHB 4RGMB 4OFYD 3W9EA 2W81C 2G9HA 4XC3H 2ARJB 3LZQA 1DP0A 5LXGH 1ZT7A 4CNIA 4F7TB 4RFNC 2H8PB 3EYUH 4ZMNA 5IGXH 2H6UA 5EUOB 3U83A 4C56B 2OZ4L 4HUUB 2K4WA 1B9ZA 1XR8A 2VLRD 4R96B 3GO1L 3VFUB 4D9RD 4QRQA 1NBCA 3U0WH 4LAJH 2FUQA 3FF7A 3GRWL 4GY4A 4F5CA 5HYQA 3B2PA 3H1ZA 3LZPA 3A4EA 3OHXC 4LSVL 3TH4T 3GPEA 1I9IH 1A1OA 3DGDA 3ORJA 4TV3A 3VH8G 3DHUA 2BY2A 1FO0A 5FOBA 4HIHA 1J1OH 4ELMB 5HDBE 5I6NA 3L2MA 2QLYA 2VXVH 2P28B 4N2BA 4P48A 4W9ZA 4XTRD 3U7WL 3PGDA 4J2QA 4DK3A 3SE3C 5A2CA 5I2IB 5CP7B 3M1BA 1UH3A 1PKQB 4JFUA 4MZIA 1XL4A 1ID2A 3RVUC 2NUPB 2QDVA 1QRKA 2A6DB 1A1NA 4MXWL 4P2RD 3OXRB 5E1IA 1JTTA 4ONFL 5D2LE 4Y9BA 4YR6A 3U25A 2CMRH 2QGBA 4Z9KB 1FL6A 3LQMA 5LCVL 3MR9A 3KS0H 4JQIL 3P4OB 4Z3FA 2DKMA 5IB5A 2KLRA 4UV7L 4W9JC 5I0YA 2B4CH 3N1MC 2FWLB 1PDKB 2EO9A 1LD9B 2R1XB 3MLUL 1VESA 2DYSB 4OLVH 3REWB 4AKOA 4ZOBA 3GS0A 4OD1L 1HL9A 4KX9A 3MV8E 4JGUA 1YMMB 3OKOB 1B9KA 4W70A 4FEIA 3SDDB 1N12A 4OD2A 3TGXA 3UTTD 4X8XA 5DR5L 5F1KC 3TNNA 1KG0A 1SGKA 1KPUB 1NDMB 4FQLL 3VNYA 5CP3A 3VI3B 4KTEL 2Q87A 4UIKL 1JVOA 4DO6A 3BEVA 4JMNA 2BSDA 2ZUVA 3VTTA 1LK3L 2XWCA 3O4OC 2EZ0D 3CVIL 1R5VB 3UTOA 5C6TL 4LAQL 1ZD6A 1A6WH 2YMXL 4OIAA 4WU5A 2VZ1A 2Z8RA 1HHIA 1T1YA 4D2NA 2EDMA 2CGZA 2VR5A 4JY4B 4A2GA 1CBJA 2BVYA 5CCJA 4NM8H 2N4IA 1J12A 2HRPH 4LOUD 4YEEA 3V52H 3U79A 1K9TA 4OUUA 3C2SA 5ISZB 3EJJX 4F37F 4W6YB 5I1HH 3MV9E 5D7LE 3VCLA 4ZPVA 1T1WB 1VCAA 3ZKMD 4EJ1C 4M61A 1PKOA 1FIGH 1II4E 3H3BC 3QAQA 1W15A 2VM3A 4LBEB 1PZAA 4XC1L 5IEKA 4M7JL 4X0NA 5JDSB 3ABKB 3LH8A 5D4HA 1IU1A 1CJYA 1KDJA 1CL7H 3LXCA 3I3EA 4PLOB 4K2UH 2R0WL 2L04A 3T6XA 2I9TB 2WVTA 4X5WA 2ZOTA 3U7YH 1XH0A 1NLBL 4L9LB 3FXIC 1GAFL 4OIFA 2EKSA 4CMMA 4PJCF 3LMJH 2RFXA 4FG2A 4Z6AT 1LEIB 4RH4A 1VFUA 2A1WL 4LBAA 1B4JH 1XGUB 2CG9X 5C09B 2APVA 5D7JC 4W6XB 1WWCA 5INDB 1ZS2A 4M1GL 1TNMA 3SDDD 1BZDA 4QRPE 2VLRA 5CSZB 1TQUA 9CGTA 1TJMA 2I5YH 4X7SL 3ZK0A 3RHWF 4DETA 3WMSA 2K0RA 1YVLA 2OTPA 1D3CA 1I75A 5GS3A 5C7XL 2FNWA 4X9BA 3UL4A 4NRYA 1S7SB 2OPCA 2NNAA 1LO3L 2CDEB 1M7IB 4M48L 4NBXB 2VR8A 2BERA 4YUEL 1OD7A 3D2UB 4OF3A 3FT3B 4P2RA 2G60H 4YSAA 1ETJA 4K8RD 4MTMA 5GGRB 2GYSA 5BVJB 5ISZD 4NHCH 3MRQB 4X83A 4LKXB 1WAAE 2JKXA 4KJPC 4YBLB 3BYTA 4BA8A 3TVMB 3O3DB 2EEXA 1UZ8A 4AH2A 3IFOB 3LNHA 1TVBB 4K7FB 1EO5A 4X6CA 5EOCJ 1U92A 3RWHA 4J1UA 3UTQB 5FGRA 3GSQA 1YYML 1AO7B 3EGSB 5M94B 1CI3M 3SBQA 2ZWNA 3T4AA 2GSGB 3IPFA 4UT9A 1G87A 1MHHB 1DJIA 1QWHA 3CFDA 2F61A 2JCCA 4GEJA 4M7ZC 5ERWB 2BNQA 4MMZC 1PNCA 2XHNA 5I15H 1U8IB 4DP2X 3P9MA 5FGBC 3UJTH 1KGXA 2QMKA 4IEFA 4WU7A 5E00A 2HJKA 1LP9A 3L81A 1TVHA 1WZKA 4MX7B 4E5XA 1JRHH 1CTMA 4LFHD 3NIFE 1KTDB 1SOQA 1X6NA 3TYGL 2R29H 3MA7B 4F7TA 5GRJH 1SJXA 5C09D 3VMPA 4FNUA 2VT0A 4UDTA 4WI2A 3GK8L 3VFUA 3GSVB 4LCCB 4NO5B 3F01A 3LQZA 4S1DD 4XBEL 1QLRB 1W6WA 4BSVB 3KPLB 1DQVA 3KLQA 5IVNA 4RSYA 3ZZ1A 3ARDB 1A7OH 3DGGB 3SE9H 1EDQA 3T2OA 4NWUL 1FHNA 1TQSA 3A3YB 3ASWA 1H6FA 2C9UA 3TZVD 5E4EB 3UZVA 1QQDB 3FOLA 2MCMA 3FFDA 4NN7C 1R17A 3TM6A 3KMDA 1K4CA 2CCWA 1HHKB 1TZAA 1PZCA 2HJFB 1H0DB 3MREA 2H3NB 1X3DA 2FL5B 1R3JA 2LABA 3AQXA 1BA9A 2FH6A 3ILEA 2WV3A 4IOFC 4P3DB 1CFQA 1NCNA 5B3JF 5F8RC 2ZOKB 4MNHA 1NGQH 1NCUA 3POCA 4FYRA 5J13B 4J3UA 3IVKA 5AWNH 1DBJL 4LXFA 4LZKA 1JNNH 1E7UA 4NQQA 5D6CB 1YQVH 1JSYA 5A16B 3VM5A 3PWLA 3TA4D 1NEZA 4DP7X 1JNHB 3KPMA 1EPFA 4Q14A 1KCUL 1AO7D 2OLDA 3VXNA 4EDXB 3NAAL 5FO2A 2VXTL 3K2UH 4KUCD 4ZNEE 1A21A 2IAMC 2ZWLT 5C0RL 1UGKA 1PY9A 2GITB 3NSCA 1OHZA 2VMJA 1Z66A 3EJUA 3FTYA 4KBPA 2IADB 4R26L 4ZQKA 5TDPA 4HEMA 3TX4A 5T3ZE 3RIKA 2PYFB 3VI4F 3KDMB 4IKNA 1CD8A 2F5AL 3ATAA 1TJXA 1ZV2A 3WS3B 4EPSA 4P5TC 3RWDA 2E8ZA 1HEZA 1N10A 1ZWIB 2FLMA 2FT8A 2HX7A 2R15A 1PZ5B 4QHLB 3ZT6A 2DV6A 2GHZA 1A7QL 2B1HH 4RBPH 1IBYA 2E5EA 2QBWA 4YQXH 5I5MA 1SY6A 2J56A 3DX8B 4R4FL 4XXWC 2W8CA 5DWUH 3C2AH 4GW4A 5CAYB 1BQHG 2A5UA 3VJ6A 1NFDF 2QSCH 4PV8B 2X6MA 3GTNA 5CLXA 2E7BA 1N19A 4DFIA 4WUKL 3GMMA 3JBG7 1BAFL 3LTVA 4OLEA 3N43F 3RX9A 3VSVA 5IUSA 2A6KB 2XN2A 3HI5L 4N6RB 1HESA 1I1FB 1A64A 3NOIA 2E46A 1AYOA 5KS9A 1KIRA 2C9PA 2K1MA 3OKYA 2ZP9A 5EZOL 4TUJB 2MHAA 1CLZL 4JPIB 3T5WA 3BI9X 2MPVA 1JMZA 4JVPA 2GW5A 3BIBX 3EUUA 4NRXB 1BV8A 1MF2L 2HG5B 1VFMA 4XP6L 5LBGA 2BINA 5IWLA 1UH4A 4X7DC 4BKLB 4PAZA 3KPRB 2ESVA 5ESAB 3BRFA 1I8MB 4PYHA 3S3DB 2C9QA 3EO9H 1M53A 4HCGA 2W07A 3CZFA 1XTLA 4W6WB 3ZU8A 1A7NH 4MBRA 2GT9B 1EK3A 1VPOL 2FO4B 4N2KA 4QHMB 4L1LA 3CVHB 3ZTEA 1OPGH 1RURH 3EYVA 4WUUB 1U8HA 2XU9A 2I85A 1N5YH 4TNVK 4A7TA 4AV5A 4BK5A 3TT3H 4NO0D 3FFCA 3NCJL 4N2OA 4YDJA 1S5IH 4O9HL 3WIIL 3OKMA 4HFUH 5ICXB 5CHNA 3TZVA 2JE8A 4BSWB 3EFOA 2CD0A 3C8KB 4C59B 4TQEL 2BCMA 3HMWH 5E7FA 3L95A 2AQTA 2YPKA 3HZYA 1TJIL 4F15C 1J9CT 4J8RA 3MJ7B 1E28B 2DD8H 3UTSA 2QEJA 3QRBA 3D25B 3WTVA 1WZ1H 1DUYB 4POYA 3WS6A 4PS8A 1G9NH 2PR4H 2XWZA 2XXCB 1LEGB 5T3XE 1E4JA 3QG6B 1TVBA 2ZUYA 4FFYH 2J44A 2XUWA 4J3VA 2VITB 1CBVL 3MLYL 4LLMB 3QSKB 3LZNA 5HHNB 5D7JD 4Y4FC 1OCWH 4OGYH 1XF1A 2CRMA 3SGDI 1W72B 2VLRE 5DZOA 1CF1A 1SXCA 5JR1H 3OHXA 5IMKA 4M7LT 4UT6L 4I3SL 4CU6A 1JVKA 5CBEB 1UD4A 2QTVA 4G7SB 2XPYA 3DOSA 4K71B 1KYAA 2ED7A 2FT6A 1HINH 3KPRD 2XYBA 5DJ0A 1KTDA 4QRUB 2NY6B 1U93A 3IJSA 3L4CA 4ODWA 3VQLA 4S0HA 1KEMH 2WNKA 4L23A 5ESQA 1BQ5A 4N4YB 4P2RE 1G1KA 5DRZA 3Q01A 5AVUB 5AW8B 4AQAB 5I16B 3APFA 3EJYC 5CLYA 3L3KA 3T04D 2VXSL 3GSNA 3ZE0E 4WUUD 4FGMA 2PMZA 5C08B 5HHXH 1VEOA 1ACCA 4YNYA 3VGFA 1QLRA 1D5BA 2ZIDA 3AREC 4NZTL 1A3LL 1WDAA 3BP4B 1G6RA 1K5WA 3CWGA 5AVZB 3O2DL 4QRSB 1QQDA 4M56A 2YMTA 4UV4H 1CQYA 1XO8A 4XMZA 1TTFA 2Y25A 4X6CE 5DEFB 4KRPB 4XP4H 1AQ8A 3CMOH 1T5XA 2ERJB 1INEH 2H3NA 2Q3ZA 4PQXA 4WNSA 1OP5K