4XPTL

X-ray structure of drosophila dopamine transporter with subsiteb mutations d121g/s426m and el2 deletion of 162-201 in complex with substrate analogue 3,4 dichlorophen ethylamine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/inhibitor
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xptL01
2EDYA 3VD3A 2X41A 3HZKA 2X4NA 1XEDA 2P1YA 5IBUG 4JG0L 1P9MA 4LEOB 5HGDB 1U93B 5FYLD 4U6HA 1XAUA 3B4NA 4FMFA 1P1ZB 3PABA 3JXAA 4JR9H 5M94B 5DVNA 1VFAA 4TRPH 5DA0B 4LSSL 3PL6A 4U1IB 1C5BH 1UWGH 5CKAA 1BHGA 3E6HA 3QRGL 3RNKB 4Z95L 5IQ9A 3ROOA 4MVBC 4OIIH 1A1NA 4JFDD 4MD5A 5LGJB 1IAIL 4HT1L 1INQB 3LN9A 1ZHKA 2FATL 3MLXL 4YR6B 1ZLWK 4XMLL 1R5WB 5E6IA 4MNQD 5IF0A 5I73B 4PLOB 1NAMH 4M1GL 4QHKJ 1OP5H 4YFLF 4G7YL 4V1DE 5L8JB 2DD8H 1A7QL 1SM3H 3CFBB 3T1FB 5ABDE 2AQ3A 5IMOA 3QHZH 3UBXB 5HVGB 5I15H 2J7LA 3OWEA 3RY6C 1RVFH 1RAMA 5CJ5A 2G60H 4M7KL 3S5LB 3WFHA 2AV7B 1MRFL 1Q1JH 2ZCKL 1D5ZA 1YY9D 1FN4A 4L29A 1OTUC 4IEFB 1A0QL 3ZKXB 2PTVA 4JKMA 1QFWL 4MB3A 2VAAB 4GBXC 3IVKB 5D71L 2DRUA 4KJQC 4TUKH 1W0WA 5DSCB 1BEYH 3KJ4C 4WGWB 3I02B 2IGFH 3TFKD 3MYJB 1N7MH 1FDLH 3PWNB 3WV0A 1T0MA 3TT1H 1P9MC 4RAVA 4Z7WA 3MREA 4G80A 4JGJA 1AI1H 4XPGH 1XCQB 1F3DH 1NGZB 4L8BA 2XKNB 4M1DL 4CVWA 1A14H 3GBNH 1LEIB 5MEOA 1CI5A 3QXDA 4O2EB 5FGRA 4L9LB 1T4KA 1UWEH 2AXJA 3OBAA 4OZIF 1DJSA 5TFSH 3PL6C 1CE6A 2OL3L 5C0RH 4XP9L 5F9JA 2DS4A 5L8LB 4NQVB 1FNEA 3KXFE 4KHTL 5E00A 4DQOH 4HFWB 5I1KH 3UTQA 1LO3L 4AM0A 3L3IB 2X6MA 4MWFA 2BVOB 3DIFB 5DC4B 3BSZL 5T1LD 4FXLA 3HI5L 5I30H 1J5OH 1A64A 3STLB 1WUNT 2DF3A 2HLFC 3BP4A 2RBLA 4ONFH 5IP4A 4BQ8A 3RJQB 5J9PB 4OD2A 5J06A 5DMGC 1DR9A 5E6IC 3IU4L 5I76A 2DBLL 4JY6B 4Z7QE 2NY6B 4QF1B 2F53D 1NDGA 4MQSB 2AEPL 5C09B 1HHKB 1OTSC 2PYFB 4B0MM 3BGFC 3GDBA 4BKLA 5I8KL 4F57L 5JXAH 4HUUB 3C6LA 4A6YL 3QEQE 4KZDL 3HNTH 3P0VH 4HK3N 3S4SB 2EXWD 3HA0A 4PBXA 2WIIB 5ID1B 1U8QA 2QHLA 2F5AL 4LOUD 5F88B 3BZEA 3P0GB 2AEWA 2R1YA 4M8QA 4HIHB 2H2SC 4Y5YB 4ACPA 5J4MA 2RGSA 2YHGA 2DQEL 1A4KA 4DVRH 2C9AA 1ZMYA 2Z8WC 5HYSG 4D3CL 3OF6A 4ZODA 2GJ6B 5FDYA 5IHZB 5CBAA 3LQZB 5J6GA 4OCRH 3EYVB 1PVHA 2N7BA 3VWKB 3SEPA 5EO9A 3DHMA 1FVCA 1JWMA 4F7PA 1UXSA 5ISZD 5EZLA 4FP8H 1OWRM 2EKSA 1OOAA 3KPPA 4W4OA 4F9PA 2HFGL 5D1QA 4RSVA 3P11L 4LNRA 4YXLL 3FAWA 5D7SL 2XXCB 3OKKB 1NMCB 1A6VL 1RUMH 2ZCHL 3WBDA 1FIGL 1KCKA 5BRZB 3VJ6B 1BWMA 1T04B 4FTVB 4ZXBB 2ZOKA 3KAAA 1QFHA 1NMAH 3RVUD 3OB0H 4YZFF 2Q76B 1BZQK 4Z7UE 3RBGA 2JTDA 2GCYB 5LWYH 4M4PA 3QCTH 4H20H 2E6JA 5FKPB 4MXVF 2EYSA 3CFDA 2AERT 3FL7A 1YEHL 4P2YA 3FT2A 4ODWB 3WIFA 1WC7A 4PS4L 1R3LA 4DUWA 1JI1A 1UCBH 4M7ZB 1WTGT 1JGEB 3QUZD 1CFVH 4NQTA 4FOMA 4FFWC 1C16B 2BXYA 4P59L 5FA3A 4MXWL 3C6LC 3B5GA 1U8LA 1S9XA 2M26A 4NRYB 2BSSA 4YBHA 1FYTD 5INDB 2DOCA 5C2BL 4MNQA 5CMAA 1CU4H 3GJEB 3MLWH 4C83B 1AXSB 2IPUG 4FQQB 1Y18A 5T3XL 4UT9L 3EZJB 3QNZA 1GYAA 3Q5TA 2Y07H 2GJZB 3KNBA 4XGZB 3LRGA 2CXKA 2J6EL 4X5XB 3I6GA 1UB6B 1VADB 2ITDA 3QWQB 4TSAH 5DJXB 4OV5A 4UTBH 2VISB 3WNPA 3BAEH 4XCNA 3AREB 2YPLD 4W4OC 5DD1H 4F9PC 1I4FB 5D1QC 5DRNA 2DQJH 1F6FB 3KHOA 2BSTA 4K3JH 2X1XR 5JDJA 3CLFH 3NH7H 1AD0B 2NLJA 1SBBA 4NN5C 3BIAX 2BSRA 1NFIB 1HQRB 5HHMB 4CU6A 3IJSA 1FFOA 4JM2F 1P4LB 5FXCH 3CVHL 1VEPA 3GSNA 1FPTL 4ODTL 3VFOB 4Y2DA 4HBQA 4GKOA 3UJTL 2X4SA 3MV7D 4HUWB 1FNFA 1I1CA 3OB0K 4WHDA 4X6DB 1FJ1B 3L1OH 2A0LD 5HVHC 2P24B 5HHPB 4XH2A 4O02L 1JZ7A 3GMMB 5E4EB 2H1PH 1AFVL 3QZWA 3U0WH 3N50A 5KBNC 1EHLH 4Q9QL 2KQMA 1G0DA 5T1LA 4X7DC 3ES6A 4YJZL 4PD4J 3L3DB 5DLML 2X4RA 1UWXH 1UH4A 3CSGA 4UOJA 1BIIB 4JO4H 1WBXA 3RWFA 4LRNL 5DHVB 2F53A 4I5BA 4UDUB 1U3HB 3ULUH 5DI8B 5EFIA 1JHKL 5E5MA 5C0IB 3WS6A 3KPSE 4Y4FD 3BX7C 4JQXA 3MGAA 1IL1A 4P5KA 2O93L 1NCCL 1U8NA 4HC1L 5LGHH 4LDOB 1FFNA 3S37H 4UQ2B 2XA3A 2X9YA 43C9A 2BRQA 1YY9C 1F4YH 3R4DA 2PW1B 3GSQA 5EU4B 1KIRB 5IEHA 4OFYD 3QH3B 2ENYA 3LKRB 4BFIB 4OFPA 2GY7B 4H8WC 1R5VA 3TFKC 2QR0A 4X5WB 1ORQB 1KACB 3NCFB 1MCOL 5GXBB 2EKJA 5D2NE 4Y8DC 4NRZB 2EECA 5F89A 2HVKB 1U8PB 4HS6B 4EUPB 3VFTA 3INUL 4HG4K 1JZ6A 1F4HA 4EDXA 2OMNA 2NY4B 3M17B 1BQHB 1DQJA 4G8EB 4OZHA 3N9GH 1KB5A 3QCVL 5GS1B 2R4RH 4JO1L 1AGFA 1PLGL 4KKLD 5D5MF 5ISZA 4Y2DC 2V17H 1KCUH 1QLRB 3EOAA 3CFEA 3K81A 4WEBH 5LJYH 3GO1L 3H0TB 1AGBB 2Z92A 3UMTA 3T0EE 2XN9B 2YUVA 2APTA 4ZYKB 3DUHA 4PB9H 4HJJL 1IAKA 2CKBL 4RGMC 5GRJH 3O6MH 4RGNB 4GRWE 4LLDB 2WIMA 4NBZB 3FO0H 2W0KA 3NA4A 4E41D 1G9NH 5BO1L 4KKAD 1BPVA 1IRAY 1Q9KB 1RZIB 2MPAL 2XNAB 1PYWB 1OF2B 1T21A 3QUZA 1AXIB 4I2XB 4QRRD 1MREL 3WS6C 5IJVA 1UWXK 2EEDA 4JQXC 4I18B 4XBPB 3KPMA 2ORBH 1SJHB 1AP2B 3BH8A 2RFXB 1HSBA 1RZJL 1XT5A 2OR7A 1FYTA 1AO7E 5CP7B 3V8OA 5I1DA 2D31B 4NGHL 4PGDA 2EXWC 5C0GB 5TH2A 1M05A 3QRFM 2P5EB 4LOUC 2AJYH 3CNKA 5DUMH 1CYGA 1DQMH 3GK8L 4ODXB 1A2YB 1FZKA 1Q72H 2P43B 4ODHH 5F7EH 4DW2L 3P4MA 1JIBA 2YUZA 2XWBB 3FQXB 3E3QE 3IJHB 4R2GB 4QLRA 4WU5B 3FO1B 3IAPA 2RHEA 3OKEA 2VDRH 3PP4H 5D72H 3D69B 1EGJA 4UU9B 2ZOLB 1ACYH 1P7KA 4HF5L 3VH8B 3RI5K 2FYYA 5HVFB 3MRFA 2YPLA 4U1HA 1QKZL 5T5NF 4Z7VB 5FYKL 5L6YL 3T2NH 3DVIA 5HD8D 4Y2OA 5ESAB 2EDTA 1KF9B 3MA7A 3RVUC 4AY0A 1UVQA 3RZCB 1NBZA 1LO4H 1OB1A 4Y7MA 2FJGB 1AH1A 5BV7L 2G75A 3G08B 4K7PH 2KKQA 3MV7A 3O3AA 4YHKL 4EVNB 3CSPA 4OZGF 5I1EH 4MA3B 4JFHE 5JOPD 3UTZB 5HGAA 2Z31D 5HYJD 2OR8A 4CJ0A 1FNGA 5E6ZA 1AGCB 3HNSH 3QUZC 4EQ2A 3W0WB 3GHBH 3DBXA 3WD5H 1S7UA 4XWOD 3OXSB 4S0TD 3QO0A 1KPVA 2HAZA 1W72L 5IROA 3VXPA 2XQBL 3PQYD 4YC2C 5TDPA 5GS0C 1H3GA 3RWIA 4P4RB 1ZA6A 2AJUH 32C2B 1W72B 3K0WA 1R24A 4D0DA 1L0XA 5C0CB 1I3VA 1T3FB 1GIGL 2NY7H 2OLDA 4JRXA 4F7CA 4LEXL 5IGXH 2UY6A 3MUZ1 3JWOH 4XXCC 3HB3C 4LVNC 4OT1L 1H3TA 4Y4FA 5SWQA 4LAQL 4MJ5B 1PQZB 4DGYL 2NX5E 1B2WH 2WANA 5GGVL 5KJRL 1I8MB 5FDWB 3HPLB 4PRNA 3BZFB 3TN0D 3C8KB 1T5WA 1F97A 2A73A 4H0GA 5KZCD 4DKDC 5EZJA 3H9SD 5C0DA 3S96B 5KVDH 1FL6A 4OFYA 3RWEA 2CLVA 4UBDD 2WP3T 3RNQB 4OM1L 5E0QA 5FCUH 1OHQA 4J6RL 2PKDA 1QBMH 1ZEAH 4YDIH 1EMTH 4LLQA 5IVZA 4M4RA 5H8DA 1PG7W 3PGDB 3RX5A 5IFJB 1QSFE 2IWGA 3KVQA 1LILA 5HI5D 1TJHL 1FG9C 3K7UA 1XGRA 2N1KA 4XNZC 3RDTD 4PJEA 1WWAX 4WHTA 1F2XK 2JIXD 1TETL 4ETQA 1UM6L 3RGHA 5K9KA 4CBPA 2VABA 5JHDE 3T77B 1R3JA 2A0LC 3AFLA 2IEPA 4OLXL 2VITB 5I1JH 4YXKH 2CSPA 2R8SL 2YK1L 3LKQA 2ESVB 3MLSH 2GJJA 3MV8A 4DFHA 2ICWB 4GW1A 4JLRA 3DX7A 2NQCA 4X7SL 1EV2E 5IROC 2IH1A 3D0VB 1P4BL 3P30H 4ELME 3T65B 1J0JA 2WINB 3PWUA 3QWOA 1DBML 1WWCA 4OAWA 4X6EA 4D94A 3RWHA 1NEZG 4OI8A 3L3GB 4N0UE 3DGCR 3HCVB 2GFBB 4NRXA 5EPMA 2NY2D 2BNRD 3WLBB 4QRRA 3P2TA 2IG2H 4Y4FC 2UUDH 3IDXL 5GGSA 4NN7B 2AEIT 2W07A 4HGWA 4O2FA 3GMOA 1U91A 4PJXE 3V0AC 4NZUH 5DYOA 3QDJE 1JK8B 1S7QA 1FORH 4KXZI 4M7LT 5L88L 1HKFA 1BAFL 2FRGP 4ZOEA 3ARPA 5IMMA 4LVHB 4ZFGL 3MRDB 2VR9A 5F71A 5I19H 4D9RD 5HVWA 5C0EB 1F2QA 1KJ2H 4DCQA 3B9AA 4YO0A 2D7TH 4Z5RB 3QDGE 4CW1A 4K3EL 3WJLA 5DQDL 3X13B 2AK4D 3N1GC 4JY5H 2UVFA 4ZS7L 1OL0A 4YDLB 3D85D 3G6DL 1MSPA 3O4LB 3MJ8B 3HC0B 5C86A 4O51A 4KKLC 1TNNA 3VFNA 4U31A 2DLHA 3TF7C 3O2DL 3ULVD 2E6QA 1MCSA 5ANME 5LXGL 2XACC 3OTTA 4CVZB 4XMKL 5F70A 5AZEL 3WFEH 2JB5H 1WZ1H 4L4JA 5E2TL 2HJLB 2EDEA 5DD0L 2EH8H 2C7UA 4YDVA 2HLAB 3AS0A 1JYNA 3DXAE 1K2DB 1JGVH 4NN6C 4JRWA 4JZJB 3AXLA 4G5ZH 2XFXB 5I74B 3L3HA 5IKCA 1JPFB 1JBJA 2EDOA 4KKAC 5B39A 2Z31A 2E8YA 5HYJA 25C8H 1RJZA 3GGWB 1N64L 2VLRB 2ZKHH 2CIKA 3I50H 4KUCD 3OHXB 3MRRA 5EU6E 3PQYA 3O3BA 2M2DA 4RFEB 2WLYA 2ZUQC 4PJFA 1D5XB 2F74B 4URTB 3X3GL 4XZUB 4U1LA 5MHSE 1U95B 4PJ5E 1FGNL 5CINL 2BERA 5EU5B 4KV5E 3IU3B 5B3JE 3R06B 1J1PH 4BSVB 4NQDE 3QUKA 5EH1A 1AQDB 2MHAB 1Z3GL 3WMSA 5DD5L 1NGYA 1OAKL 3PHQA 3VD7A 4ODUB 4QOKB 2YMXL 3N85H 5KAQG 2B4CC 1ZLSH 1VGEH 3TA3B 3WJLC 2IANE 3BPOB 4YE4L 2AJVH 5EC2A 1J87A 2CDGB 4MD0A 3TN0A 1ZV5A 2ZUTA 3H9SA 1DLHB 1NGQH 1IQDB 1MIEH 3VG9B 5JLZB 2X42A 3MRLB 3KS0H 5IQ7L 3WS3A 5FA4B 4ZDHA 1UM4H 3BW9A 3BXNB 3MUGB 1EBPA 2FIRT 5D7JB 1F3DJ 3VI3E 1JHTA 2AKRB 2APXA 2VDNL 3NFPB 5HD8C 1BMGA 3WIIL 3TNMB 3D3VD 1S7SA 2YC1A 3BZ4A 1MCEA 3TH3T 5CSZB 3B9EA 4JFXA 3RDTA 4WFGD 1VSCA 4YHZL 1CICD 3HRZB 5E8PA 5HJ3B 1WK0A 2OP4H 3QG7L 5IG7A 1KTDB 5SWSD 1RZFH 3RL2B 7CGTA 1DVFD 4OM0H 1GC1L 4CADA 2Z31C 4X4MA 4LGRB 3GJFA 4PGCB 2JELH 1U36A 2K9UA 3LS5L 2XA8L 5T1DL 3EJYC 3QFJD 5GGRA 1R0AL 3TYFA 3U9PL 4XWOC 4PR5B 3GI9L 5FB8B 2Q6WA 2DIAA 4Z78B 5F96H 3O2WH 2E7MA 3HHRB 3V52L 3LKPA 1U92B 3P4NA 1JNLL 5JPMA 5C0FA 1G6VK 1ZHBA 3PP3K 3M1BA 3EDEA 2VLME 1R3KB 5I66B 1MI5B 2PCPB 4Y1AB 3ZYJA 1K6QH 5GGUA 4X6BA 2BNRA 2Y36H 4F7EB 2DI8A 5HXMA 2KBGA 2A6JB 4NZTL 1ZHLA 2O5YH 1G6RL 4FHBD 3PGFH 4M03A 1LP9B 4FQJL 1NCWL 3SPVB 4YIQA 1FG2A 4KMLB 4MAYA 3TN0C 4LRIA 2A6IB 3QIUD 3LEYH 4MNHA 2VDKH 3BQUD 4HK0B 4F9LA 3VU2A 1RZKL 1A4JB 4NNYA 3L7EA 3NACH 2ZPKH 3DETD 4UBDC 4M93C 4WJ5A 3UDWA 5IFAH 2XPGA 4WWID 1E0OB 2X09A 4R9HA 4DKEH 4BH8B 2JLLA 2XWTA 4F37F 1HHGA 1MFBH 3NIFE 3BP5B 2HFTA 5HI5C 3WKNA 2A77L 3HPJA 2AK4A 5CZKA 4P5TD 3G6AB 1T7WA 1CT8B 5C0AE 5EBMB 3RDTC 3VXSD 4JRXE 4K94C 4L3AA 3C6SB 2FJFB 4TOYH 1BQLL 5IVXE 1RURH 1ZLUH 1WVZA 3UTSD 3QUYD 4L8SA 3FB6B 5MEND 5D2LA 4I3RH 4U2ZA 4FABH 2F8OA 3DX6A 4DVBA 1SYSA 4QRSA 3U7WH 5E94A 5DR5L 5BMFH 1CTOA 4V2CB 3MACH 1CXIA 4CNIB 3U6RB 4KZEL 1Q9LA 1EK3A 5KS9B 4MZ2A 1CZ8L 4YPGA 3U2SB 1TVDA 1KLGA 15C8H 4J1UA 3QNYA 5EUOE 1TJGL 3S6CA 2I9LA 4PJGE 1KIUA 1OAZH 1BJ8A 2EE3A 2P8LA 5ESVB 2X4TB 1QRNB 3OPZL 4R7NA 4JHBA 2ADFL 3H7BB 2ADGB 3EJZD 1OARH 4JO2L 5HYQA 3OR6B 4PJEE 5JORA 2JCCA 1HZHH 1WFOA 4M9OA 1IGJB 3DI3B 2H32B 2R29H 4YHML 6CGTA 4HPYH 4JZOB 3E6FA 1CGSL 4LSPL 4PBVC 3ZDZE 1HK6A 5FYKE 3U9UA 1VEMA 4UT7H 4MAYC 4QY8A 4LRIC 2DLFL 1IEBA 1SBSL 4J12A 4F9LC 4ZPTA 4CKVX 4HD9A 4DUXA 5E2WL 2X9XA 4Y5XA 1HHJA 1NANH 3UDWC 3MV8E 4ORZC 4LKXB 1JJUA 2C4XA 1J1OL 2WSKA 4GBXB 4NNXA 3DPBA 4EDWL 2YBRB 2R1WB 4K2UH 4LVEA 1CGXA 5AZ2L 3BGAA 3U7YL 4PJHA 1YJDL 1X4XA 3HZKB 4DWHA 2X4NB 1I7RA 5CIPA 5K9OA 5ITFA 4U6HB 1R5IA 2CIIA 3PABB 4J3VA 4XX1G 1P4IH 3OGOE 3KPSB 4S2SA 4L8SC 1UC6A 2J88H 1IFHH 4U3CA 4JPKL 3ULVC 1WZLA 1VFAB 4YNYA 5CGTA 2VERN 3PL6B 4S1QH 3O41A 4GOSA 1J1XL 3E6HB 4XPTL 1JZ8A 3IXAA 5HYSA 3D3VA 4QRTA 3ROOB 5IQ9B 3MOBH 1A1NB 1N5YL 4ELKA 4NQSA 4MD5B 1CICA 5GRYA 4K7PX 5CFHA 3T0DA 5SWSA 3L7FA 1JRHH 2FB4L 1CDJA 1ZHKB 2YD6A 1KPUA 1WIPA 4PJIE 5FO7A 3C8DA 5E6IB 5IF0B 4KH2A 4JM4H 3U4BL 3QFJA 5L2KD 1MHHA 4OI7A 3UO1L 3GRWA 1TVBA 5IMOB 2BFVH 1NBYA 4XWGH 3BGFB 3WFHB 4I0KA 1QVOA 1IQWH 4OUUA 1D5ZB 1FN4B 1KIPA 4L29B 4KRPD 4Y5XC 3MGOA 4ERSH 4HZAA 2VN7A 1BOGA 4X9BA 4NFBA 1YMME 3CSBA 4N5ED 2V7HA 1W0WB 1QZ1A 4LSTH 4GRWB 4PB0H 3OZ9L 2AK1H 3LY6A 1ODAA 1TZHA 3PDDA 4U4BA 1T0MB 2AJXL 5JQ6H 4RAVB 4Z7WB 3MREB 4G80B 4ALAH 3BQUA 3CVIL 2YA1A 4L8BB 5IESH 2ADJA 2K3TA 5ID0B 5MEOB 3QXDB 4L4VE 3WNMA 1OAUL 3WNNA 1T4KB 2VDOL 3CK0L 4YFLI 3X3FL 2XQYK 3QI9A 1UZ6E 1CE6B 5F9JB 3TJEL 1F45A 1AO7B 1J7VR 4HWEL 4PJDA 1X7QA 5E24E 4P5TA 1FNEB 5E00B 1QOKA 5GRWA 3VXSA 5HHQA 3UTQB 4AM0B 4LVOC 1CICC 4MWFB 2VSDA 3ECBA 3GSVA 4LU5L 4KI5D 5C08E 3UTSA 2AJSL 3QUYA 2PXYD 2VC2L 3QQ9D 3WJJA 5MENA 3BP4B 5EA0H 2I24N 1D5MA 4OD2B 1DSFL 1UKSA 5I76B 4BFGA 3K8LA 1NDGB 1MWAL 2CGRL 4M48H 1MHEA 1SVCP 1CR9H 3SDAD 4PV9A 4G6KH 1F11A 5E8EA 4XVSH 4JHZA 4BKLB 4JQIH 1B6DA 2YSSA 4JPIA 3C6LB 3NCBB 4O4YH 3O3EA 2W9LA 4JR9L 1E4KA 2EIEA 1CLYH 4PJCA 4TRPL 1U8QB 1DQTA 3UPAA 3RL1A 2OTWA 1UWGL 3BZEB 2R1YB 5ALCH 4M8QB 5C70A 1CD9B 1T5XA 3B2UD 5CP3A 1A4KB 4OIIL 4QO1A 5J8OA 5CBAB 5J6GB 3BQUC 1XR9A 1XF4A 1OTTD 4ONGH 5CEZH 5EO9B 1FVCB 1JWMB 4F7PB 4LLUA 5EZLB 2EKSB 3KPPB 4ELMF 4NT6A 5D1QB 3QI9C 3B8YA 1YQVH 4LNRB 1NAML 2DD8L 1EVUA 3C8HA 4P0DA 5JW5A 4NKDA 5D7IE 2QSTA 4P5TC 1UEYA 3QHZL 3HNVH 2ZOKB 4D9QE 1CIDA 2PR4H 4NN5B 1ED3A 1RVFL 3UYPA 2G60L 3MXVL 3T4AA 4L4TD 5E2UH 3T1WA 4FN0A 3QUYC 3O4OC 3WJJC 4UT6H 4C58B 1MJ8H 2EYSB 3CFDB 4PJXF 3U83A 2BCKA 3FT2B 5DD6A 5DMYA 1JGUH 3WIFB 1I7TA 1WC7B 1R3LB 2JJTA 1TFHA 4TUKL 5HVHB 4NCC2 3GHEH 1MF2H 2F5BH 2IGFL 1RUPH 3JWDC 3EYQD 1FDLL 2O5ZH 3FB7A 2YD1A 3LPWA 2P45B 4NCDA 1G7IA 3UTTD 4XPGL 4HBCL 5FA3B 1FL5A 1YZZA 1U8LB 4UNTA 1S9XB 3WFBH 2BSSB 1A14L 3GBNL 5L9DH 1E4KC 4MNQB 1UWEL 1BVLA 5TFSL 5L2KA 5C0RL 1Y18B 4KK8D 3QNZB 1SEBA 3D2UA 4RNRA 4G43A 5EORH 4DZ8A 2VLJD 4L3EE 2OK0L 4W70A 4E42A 1MUJA 3I6GB 3C5ZD 4KKCD 2ZUXA 2ITDB 5F6HI 4OV5B 1J10A 4PTUA 1P6AB 5I30L 1J5OL 4P2QD 3MRQA 5EOCL 1SEQH 4OD1H 4ONFL 5SX4I 4YHPA 4XCNB 4C55A 3UXFA 1BQSA 2RCSH 1YEFH 1QBLL 1NDMA 3OAUH 5DRNB 2EDRA 4JVPA 2BVQA 2IPKA 5BS0D 2BSTB 2A6DB 4EZMA 1T0NA 3I9GH 2NLJB 3QDMD 5CEYA 4PGBA 1BLNA 4Z0BH 1BF2A 2BSRB 3MNWA 4M61A 5DQ9A 3IJSB 2JCCE 1FFOB 1BJMA 5ILTL 3GSNB 1HWHB 2UZIL 2W92A 3HNTL 2MTPA 3MUHL 4Y2DB 2X4SB 3FKUS 4ONOA 4WHYH 3WSQH 1NMBH 3VXUD 3W39A 2JJTC 4NO2A 2X4PA 3ZHLA 3W5NA 1MJUL 4KV5F 4R6UA 4XH2B 1CFNA 3PWLA 4Z7OF 4DVRL 3QZWB 2CJUH 5AEAA 4RGMB 1HH9A 4BYHA 3FAXA 5JW4R 5CSGA 5T1LB 3U46A 3ES6B 4X0KA 2PXYA 3SCMD 4F80A 5FF6A 2X4RB 5HHOD 1OGAE 3MLPA 1WBXB 4FP8L 3RWFB 4PY7A 2BVYA 2P8MA 5E56A 3ZL4H 1LK2A 1I85A 2F53B 3DECA 4I5BB 4WW1A 4XMPH 4TTGA 1A02N 3L5XH 4XVTH 1V3KA 5EFIB 4DGVL 1MQKH 2XZAH 4FNLH 1I1RA 4NZRH 3AVEA 4HGMA 3RVVD 1IL1B 1NMAL 4P5KB 4WCYH 1FE8H 1U8NB 1P7QD 1FFNB 1JNHA 43C9B 4IRSD 3GSQB 4XP6H 3QCTL 2BVEA 1G1CA 3U0TA 2XOTA 4H20L 5IEHB 3CX2A 2P48B 1A5FL 5D7KD 3G5YA 1EAJA 3VCLA 1C12A 4HWUA 5DK2A 5GISH 5TE7H 4KTYA 1U8HA 4XRCA 1R5VB 3NGBC 4G9DA 2QR0B 4M43H 1JMXA 4LSUH 2B5IB 4MGXA 5C92A 4G7VL 2B1HH 5F89B 5EIQA 2R56L 2ED8A 3VFTB 1CFVL 1B4RA 4EDXB 5FUCE 4NJ9H 1RUQH 1OQOA 2EDLA 2LQRA 1DQJB 4OZHB 5AAWA 1KB5B 2HJFA 1DUYA 2LAGB 1AGFB 35C8H 5ISZB 4YUEH 2OZ4A 1KN4L 3S35H 1CU4L 4LQ1A 2APFA 3V6OE 3EOAB 4WTXA 4JO3H 3CFEB 2B39A 3KR3H 5BJTA 2Z92B 1KXVC 3LZFL 4FQCH 2VZOA 2F54D 1IAKB 4HXAL 3L3OA 4JFFE 4L4TA 4TSAL 2R2EA 4UTBL 2KZ1B 2B0SH 2PXYC 3QQ9C 4QRPD 4PRPE 4WI4A 3L5HA 3P0YH 1H9VA 1C5DA 1FNSH 3MLVH 4ZFZA 5DD1L 1T7VA 1VESA 4NOBA 1I85C 1WGOA 2DQJL 4HS8H 2CLRA 3O6LH 2VAJA 1T21B 3KPLA 3QUZB 2VDLL 1AR2A 3OJMB 3RWJB 3MYZA 3NH7L 4GQ9L 5IJVB 5JXED 2VXQH 1NFDE 4FQ2L 5F93C 3KPMB 3UTTA 2APBA 3D48R 4YC2B 3NIFF 3BH8B 1R3HA 1HSBB 3QA3A 1FYTB 3F7YA 1RU9L 2BHYA 5I1DB 4PGDB 3DGGA 5FGSA 4Q58C 3VRIA 4PYGA 5TH2B 1M05B 4LF3A 4BZ2H 1WT5A 2R0ZH 3RIFK 4OCLC 1YPZA 1IMHC 3L1OL 1FZKB 4LVNB 3B2UC 2VLJA 3P4MB 2CDEA 2H1PL 5JR1H 3C5ZA 2CUHA 4U1JA 1QRKA 3ZMRA 3TP4A 1EHLL 4IRZL 3OKEB 1OTTC 4RA3A 1JMZA 1NEZA 3I85A 4ORGA 4P3WA 1P7KB 3BHBA 3V6FA 2FYYB 5DD3H 3ZSSA 3MRFB 2YPLB 3MQIA 4PJGF 4U1HB 4JO4L 4IOFD 4WEUD 5BS0A 3BKCH 4X99A 3ULUL 3TLRA 2W60A 3QDMA 2BDNH 3MA7B 1A1MB 1UVQB 1OSZA 1NBZB 1OB1B 1WCBA 3DWTA 4XNZB 1WLHA 2OQJA 1F4YL 3FFCE 2G75B 4JRYD 1O0VA 3BPCA 3MV7B 3ZDZF 3O3AB 3VXUA 2EC8A 5HGAB 3VXQA 1V7MH 2D7QA 4UNVA 5GGQH 4MAUL 1FNGB 3SE9H 3ZTJG 3EDKA 4OLUH 1P7HL 1I9JH 2O61A 2BHUA 3DBXB 3EYQC 1S9VA 2FEEL 4NC1E 4PV8A 5JPNA 1S7UB 1JZ3A 1KYOJ 2CRMA 4NQCD 4U33A 5TE4H 3QO0B 1KPVB 1BX2B 4HS3A 3SDXF 4AIZA 5CEXA 1ZT4A 3SCMA 3VXPB 4LHUD 5TDPB 2EO9A 3RWIB 4G6FD 4WNQA 1ZA6B 4HJ0D 5HHOA 4D0DB 3W5MA 1R24B 1JFQH 4XI5D 3TPKA 1WT5C 5E99H 2V17L 4F7CB 4JRXB 2E8ZA 2EDWA 2D03H 3MO1A 4KK8C 1X5YA 5B8CA 5T5NG 5IVXB 4WEBL 4OCWH 3KPRE 4WUUD 1MEXL 4Y4FB 3ZDYE 5SWQB 3C5ZC 1IE5A 1P7QA 4KKCC 1BD2D 4MMXC 4IRSA 4PRNB 5JMOC 3NCYS 5GIRA 1T5WB 1Z9LA 2A73B 3O6ML 5DWUH 5EZJB 1KELH 4KKNA 3PXJA 4KY1L 5C0DB 1FL6B 1TXKA 4M7JH 2CLVB 3RWEB 4UB0H 1G9NL 4LSRH 5CHNA 4EEEA 5IBTL 4U6VH 4DN4H 5IEKA 5TDNA 4NWTH 1QHPA 1DANU 3WO4C 5GHWH 4LLQB 3LDBC 5IVZB 1WAAE 3PE9A 3F6IA 4FA8A 1UADC 4PJIF 4MNGE 3NABH 5MEQA 1TLKA 4LBEA 2BHZA 1XGRB 4DOHE 4WY7H 5ITBH 5JMRA 4GKSA 3S34L 4PJEB 5LVEA 5DVLA 4WHTB 1K5NA 3TYGH 4ETQB 3T2OA 2DL2A 1FRGL 5K9KB 2XZQL 4OZFG 2VABB 2IFFH 1R3JB 1MJ7H 2AJYL 2BY2A 3JUYA 5DUML 1DQML 1PBYA 2OCFD 2JJUA 4ODHL 3G6JA 5KSBA 3LKQB 3QCUH 1TMCB 1VERA 2F54A 3MV8B 4N8CH 5F7YC 4GW1B 4JLRB 2YZ1A 3DX7B 4XP5H 2IH1B 4WV1B 4NC2B 3SCMC 2PTUA 3PP4L 4QRPA 2I07A 1RUAH 3LRSA 3PWUB 3QWOB 4NN6B 2VLLA 4OAWB 2Q8AL 2DLTA 1HSAA 4X6EB 5B22A 3RWHB 3NN8A 5CJQH 4LARH 4BZ1H 3NPSC 4NRXB 5EPMB 5B8CC 3T2NL 4Z76A 5SWZD 4QRRB 5JXEA 4JG0H 2J8UE 5GGSB 4QEGA 4HGWB 3RVVC 4O2FB 3EYOA 3GMOB 4KVCL 1UZ6F 3MV9E 1LO4L 1X5IA 1YECL 4IRSC 1IC5H 2ZUQB 5DYOB 3SKOA 2CKNA 3OGCA 1S7QB 3RA7H 2M1KA 4K7PL 4UOW1 1GGIL 2AS5M 5IMMB 1S9KC 2QBWA 4Z95H 4MMZC 2YWYA 2F9BT 4DCQB 3HNSL 3LRHA 4YO0B 4YFDB 4CW1B 4M5ZH 5ENWB 1JE6A 1D7FA 2BY3A 3OG6B 3U4EA 5D1ZD 4O51B 3ISWA 3L5JA 4XMLH 2AJUL 3VFNB 1BREA 2DTMH 3HRPA 1FCGA 1M4KA 2C3VA 4XNUL 2CR6A 2NY7L 1QYGH 3V6ZA 4N0FA 3JWOL 2QHRL 4FZEL 5E4IA 2FJHB 3TESA 4M7KH 1L9MA 4KRNA 1ZANH 1B2WL 1MRFH 2P5WA 2C7UB 4YDVB 1NCTA 5CGMA 4JRYA 4N68A 1J0HA 3AXLB 2LABA 3L3HB 5IKCB 1KLUA 3TVMA 5D71H 5B39B 2Z31B 5HYJB 5FCUL 1RJZB 2NY6D 1E4WH 1QBML 4WHYG 4YDIL 1EMTL 3ESVF 4NQCA 4YHNA 4NNPL 3FQWA 5JXEC 2CIKB 4H1LH 4YBLB 3RUGA 4W81A 3MRRB 3PQYB 4LHUA 3O3BB 4JJHA 3IB4A 3BEVA 4RRPG 1GGYA 4M1DH 4PJFB 1OD7A 5D7IF 3V4PL 4XVUD 4U1LB 2YD4A 2EEBA 3MJ9A 4ZNEE 1OP9A 3PXHA 1TITA 2CR3A 3QUKB 2V5SA 4TTDD 1NGYB 3NAAL 5CGYD 4WUUA 4Z7NE 3PHQB 4KHTH 5D70H 1ZGLA 1LO3H 4ZFOA 3BUYA 4PRHD 3MLSL 5J0BA 5JNYA 2ZG2A 3BSZH 4MD0B 3TN0B 1CLZH 2GAZA 3P30L 5KZCB 3BD3A 3H9SB 4RISH 1AXTL 3DURA 3QXTA 3IFNL 2HVJA 3IU4H 4M93B 5TQ2L 3RWDB 3WS3B 4ZDHB 4YGVA 4GW4A 4IOFC 3BW9B 4JN1L 5IW1A 1K3IA 1JHTB 4BA8A 1OPGH 5E8NA 1S7SB 2YC1B 3BZ4B 5I8KH 2R4SH 4JFXB 1FZOA 3QR2A 3RDTB 4KZDH 1A9BA 2KUTA 3IDIA 4NZUL 4MS8D 5E8PB 4EI6A 5CLTA 5F44A 1FORL 3OKNA 1T7ZA 5IG7B 3FN9A 4L5FL 3IDYC 4LNVA 4O58H 4HCRH 3UZQA 3TVMC 4CADB 5GRVK 3GJFB 3QT2A 4JFYA 3BPLC 5CUSH 1LMKA 3N1PC 2DQEH 3ARRA 5IBUB 1KJ2L 3RU8H 4S0SD 4GG6F 3TYFB 4D3CH 2Q6WB 4JREC 1ADQA 2EC9U 3LKPB 3P4NB 5JPMB 2VYRE 3QEHA 5C0FB 1VHPA 1ZHBB 3LHPH 4HJ0C 3M1BB 2D7NA 4JKLA 4S10A 4XI5C 2QL1A 3WNOA 3ARWA 4K9EL 4ZMAT 4YXLH 4U7SA 5D7SH 5GGUB 3SKJL 4X6BB 2BNRB 1A6VH 5AWNL 3HTLX 5SWZA 3T1FA 5F7WC 5I1AA 1GGBL 3WFEL 3J7HA 1ZHLB 3FRUB 1WZ1L 5C0BE 1KFAL 3HLAA 4YIQB 1FG2B 2EH8L 4MAYB 1J0ZA 1JGVL 4MNHB 3WLWC 1M71A 4NNYB 3L7EB 1YEHH 4RAHA 3P4LA 3VA6A 3TPUA 3DROB 4WJ5B 4P3CH 1WITA 4AZ8A 3ZE1F 4PFEA 2XPGB 1P6FA 2P8PA 3LN5B 25C8L 3JV5A 5EC1A 4GXUM 4TVPD 2XWTB 5C71A 1HHGB 1I3RA 1FNHA 3UC0H 4LGPB 2ZKHL 1P53A 3IRPX 4FFZH 5C2UB 1AGEA 3HPJB 3BPNC 2AK4B 3I50L 1ZXQA 4P59H 2NYYD 3FQTA 4MXWH 5D1ZA 3ULVL 4L9LA 4L8SB 4U6XA 3DRTA 1FCCA 1X5JA 5D2LB 4ZSOE 2CK0L 5GRUH 4PUBL 5DJ2A 5T3XH 3DX6B 4DVBB 1TDQA 1PKQA 1SYSB 3SQBA 4QRSB 5E94B 4QHLA 2OMBA 1RIVH 2W0LA 3I84A 3WN5A 4OFDA 4ZTPL 1Q9LB 4YPGB 1CE1H 1KLGB 4J1UB 4IBLT 3QNYB 2AJVL 3RJDA 4Y4HD 2I9LB 3ILQD 2P8LB 2VLKD 5KSAB 2E27H 1SMOA 1YC8A 4RWYH 2XZZA 1DQLH 1NGQL 5TDOA 1MIEL 4G8GD 4R7NB 2R69H 3NVQA 1N6UA 5I73C 3VGBA 5HYQB 3WFDH 5JORB 2JCCB 1OW0A 1TQCC 3E6FB 1WV7T 3U9UB 3ZT6A 3GNMH 4QY8B 1FPTH 3UEZA 1IEBB 4K3GA 4XNXL 3ULUE 2W1NA 2OP4L 4OUOA 4ZPTB 3O3UN 1RZFL 3T2QA 4Y5XB 1HHJB 1J0YA 3HC3H 2Y72A 4OM0L 1PZUB 4NNXB 1AKJA 2JELL 1MAKA 1MLBA 1VGKA 5CJOH 3D9AL 1AFVH 3VGAC 4PRHA 5I2IA 4Q9QH 4PJHB 7FABL 3LN4A 1I7RB 3EHBD 5F96L 5CIPB 5K9OB 5ITFB 3O2WL 1Z0MA 2VKXA 5D1ZC 5DHVH 2YR3A 4R7DA 1QR1A 1CDBA 1C08A 1R5IB 2CIIB 4JM2D 3QFDA 5GGTA 4L9LC 4S2SB 4OIBA 2D4DA 4YNYB 1NFKA 1K6QL 3H9HA 2Y36L 3O41B 5HPMA 3WN5C 3IXAB 5HYSB 1UACH 3D3VB 4G9FA 2FEDD 4OJFH 4QRTB 2A2QT 2GK0A 3QWRD 3PGFL 4ELKB 4LVOB 4NQSB 1CICB 4XCYA 2GCYA 1F58H 5SWSB 3IDNA 2VDKL 3QXVA 3L7FB 3JTSA 4NM4H 4BJLA 3NTCH 4WI6A 2B20A 1KPUB 1JWUA 4JFEA 4LCIH 3GRWL 5DT1H 5IFAL 1BBJA 5FO7B 2NY6C 4GT7A 4EUPH 5CCKH 1MCOH 3QFJB 1MHHB 1CL7I 1KGCE 1MFBL 1OW0C 4IOIA 2XXMB 3GSWA 1TVBB 4DK3A 4IOSD 4JFQA 1NBYB 2DIJA 5C0ND 5KVEH 4TOYL 1QVOB 3VA2C 4XVUC 4OUUB 1PLGH 1S7XA 1ES0A 4NIKB 1KIPB 4WI2A 4JB9L 1HINL 2FLBT 3MGOB 3U0PA 5EO0A 2DQTL 4I3RL 1BOGB 1RJLA 2HTLD 4TTDC 4FABL 4GKNA 5CGYC 2P5WE 3OKLA 1G7PA 2V7HB 1Q38A 3NZHH 3H6JA 5IM7A 4XGZA 1JYXA 4K8RD 3LKSA 1UB6A 15C8L 1TZHB 4PIRF 1OAZL 4UI2A 3BQUB 5C1MB 3B9DA 3D39E 4F58H 1QLFA 2ADJB 4LCWA 4N1CA 5E7BA 2OXGA 4OBSA 2EDBA 1H8NA 5DGQA 5F8RC 3ZDXE 3QI9B 1OARL 2VB5A 3GSUA 1HZHL 4XNYH 2R29L 4PJDB 1X7QB 4RMSA 4HPYL 1IAII 4P5TB 3ORJA 3PWJA 3VXSB 5HHQB 3RZCD 5EO1A 1RZJH 2PYEA 1JF6A 2RAMA 4MS8C 3GSVB 3ECBB 3BP6A 3Q1SL 4DAGH 2I25N 1RZGA 3UTSB 3QUYB 1E4JA 3O4OB 5MENB 5LAXA 3QG6A 1T66D 1T2JA 3GK8H 5CAYB 1D5MB 2J5LB 2R0WH 2YRLA 2AP2A 4QTIL 1EBAA 2OI9C 3B3IA 4K2UL 1MHEB 4PV9B 5E8EB 1F11B 1AE6L 4Y4HA 1A7OL 2MFNA 2VLKA 5DVKA 3KLHD 2YSSB 1B4JH 1QFWI 2DMCA 4JANA 1WAAF 4HF5H 4JPIB 1T20A 1G9MC 4G8GA 3FQRA 1QKZH 3GFUA 3O3EB 1IFHL 1KJMA 4ENED 4PJCB 3PDOA 2WUBL 3RL1B 2AAVA 2XV6B 4S1QL 5CJ8A 4MJ6A 2OTWB 3KYNA 3KYAA 2J8OA 2E7BA 3EIFA 4XP1H 3C08H 4M6MH 3MOBL 1BBDH 4H1LG 4X9GA 4LIQH 5MERA 1I8IA 4Z77A 3BESR 3GMQA 1XR9B 1XF4B 2BNQD 3ZE0E 1T1WA 3P9MA 4LLUB 2PUQT 2FX8H 4NT6B 3LS4H 4XX1E 5IB2B 2IAMA 4JJ5A 5CWSA 2VIRA 2X5PA 4GXVH 1QSED 1BZ9B 5JW5B 4WUKL 4PRIA 2BRRL 4NKDB 1W72H 3HG1D 4ZO8A 4CAGA 2BFVL 3H9ZA 5DUPL 2NYYC 5FGCB 1ED3B 1RPQA 4G8EA 5F97E 1KJVA 3T4AB 3V5KA 5JIHA 4JM2A 1NAKH 1IQWL 1GOFA 1YEDA 5J12C 2J8UF 3SGEI 4ZS6D 2JJSA 4NC0B 4XHJD 5C0JA 1BGXH 2BCKB 3IDJA 5DD6B 4OT1H 1I7TB 3NOIA 3T0WA 2VO5A 2X1QA 4LSTL 4U05A 2AK1L 5GGVH 3QWRA 4Y4HC 3FB7B 3ILQC 5DFVD 1X5LA 4PJBE 3RIAK 3X14A 1FL5B 4PJAE 3QHTC 5IESL 4P3DA 4OM1H 4GLRI 4HX1A 2VXUL 3ARVA 1BVLB 2YA0A 5L2KB 5BZWA 2Q86A 2BX5A 3LCYA 3HMXA 1SEBB 3D2UB 4RNRB 4G43B 4DZ8B 1U8MA 4E42B 4NQEE 4KDWA 1MUJB 5I8OH 3JTTA 2DICA 4PTUB 3CX5J 2B8OT 3MRQB 4HKZA 5DRXA 2GITA 3EO1A 2YXFA 1MFCH 4YHPB 3FZUD 5DS8A 5BVJA 1EO5A 1NDMB 4OQTA 2IAMC 4OLXH 3NGBB 2BVQB 2IPKB 4N8VG 2K1MA 2EDXA 3L6FA 4M48L 1T0NB 1CR9L 5CZVH 3EHBC 2GHWB 4G6KL 1A7NH 1M7IA 5CEYB 4XVSL 4PGBB 1BLNB 2VDMH 4JQIL 4V1DD 3MLRH 3MNWB 4M61B 1Z9MA 4JM2C 2HFEA 2HWZL 3OV6A 5DQ9B 3I75B 4OCXH 4C4KO 2NW2A 4O4YL 2JJSC 1OM3H 2DQGH 3RY5A 1A3QA 1XIWD 4HUNB 3H8NA 1N4XL 5CZXD 5KTEL 3WIHA 4WRLA 3W39B 3IDXH 2X4PB 4NO2B 1NBVH 2FEDC 4TNVK 1CFNB 5HYIA 3PWLB 2R2BA 3RZCA 4PYHA 3MZTA 5DJYA 1PY4A 2H3NA 1WIOA 2SEBA 1HH9B 3F12A 4Z7NF 3U46B 2JJVA 1MRDH 1GJIA 4X0KB 2PXYB 4PG2A 1U58A 3VDBA 4ONGL 5FF6B 4RMQA 1QBAA 2VR5A 5CEZL 4QXTA 1DN0A 1N26A 4RMUA 1FL3A 3HE6A 1A8JH 2VKWA 4PY7B 3W2DH 2P8MB 4APQD 1MFAL 1LK2B 1YQVL 4WW1B 3RTQD 4K3EH 3R8QA 5DQDH 3E2HC 3HNVL 4D0CA 1HH6A 4GAJH 5C0NC 4OZIE 5JW4N 3BKJH 1V3MA 3FB8A 2X4UA 1HNGA 1JNHB 2OTUA 1N0XH 2YD7A 3B9KD 5D9SA 5E2UL 1GOGA 3KXFD 4G9FE 3CDGA 5C8JA 5JHLL 5HYEA 4UT6L 1N0LA 2HTLC 5LXGH 3G5YB 1A3LL 3TNNA 5IW6A 3VCLB 1C12B 5DK2B 1ND0A 5AZEH 1JGUL 1U8HB 2HT2D 4MA1C 4XRCB 5D4QA 5HGBA 4G9DB 4K8RC 3SJVE 4R90L 5KOVC 3T3PE 3GHEL 5E2TH 1MF2L 2F5BL 2XY1A 2ZCLL 1RUPL 1MCQA 1NKOA 5DD0H 1SJVA 3ZO0A 2NY5C 3BISA 4BZYA 4P46D 5LCVL 2O5ZL 2VWEE 4FFVD 4U6YA 2BNQA 1YQ2A 2HJFB 1DUYB 2FCBA 3WFBL 5HGGS 1O5DT 2YA2A 1AJ7L 2X4QA 1Y0LA 1LVEA 1QSEA 3QEQD 4HQQH 4YDJA 5BJTB 4ISVA 3HG1A 3EOYG 3OKOA 3CDYA 3RZCC 4KJPD 2DQIH 3GSOA 3WCYA 5JW4M 1I1FA 1JTTA 3L3OB 4L4TB 1FGNH 5CINH 2R2EB 5F6IC 4PG2C 1T66C 2Y25A 1SEQL 5DD5H 4OZGA 3HE6C 1C5DB 1CGUA 4ZFZB 2CLRB 4DFIA 5K59E 1LHZA 3C09C 3O8XD 2YRPA 3KPLB 3HFMH 1G0XA 1U3ZA 4LCWE 3UZVB 3N06B 5E1HB 2VTFA 3UTTB 1IZJA 4LPTA 4AL8H 3QA3B 4OZFA 5IQ7H 2Z91A 3F7YB 3GUTA 3DGGB 4ENEC 3SKMA 1UH3A 3VRIB 2V5YA 4LF3B 4RBPK 5FYJE 2PYEE 1QSVA 2I26N 3WSQL 4EUPG 1NMBL 1YPZB 5E95B 4OF3A 1EZVY 2VLJB 2CDEB 5BW7A 3C5ZB 4U1JB 5DRZA 1YN7A 2YUXA 1WISA 4DK6A 1HXYB 2HKFH 1CDGA 2VL4A 1PEWA 2J4WL 1NEZB 4ORGB 2DAVA 2YXMA 4FQLH 1FIEA 5ACLA 3BHBB 1GC1H 3V6FB 2XA8H 5TF0A 5BS0B 3NBNA 1YNTA 3WO4B 1J05A 1H5BA 3U9PH 3L5XL 4XVTL 4X99B 3WE6A 4AEEA 2W60B 3QDMB 3V52H 2XZAL 1RIUH 1JNLH 4NZRL 5IW3A 3MJ8A 4V1DA 4N0CD 4WCYL 1UJ3A 1WCBB 2OQJB 3V4UH 3BDXA 4ZS6C 3CXHK 4XP6L 1XIWA 4XAKE 4XHJC 3BPCB 4HXBH 1NH6A 4F33A 1D5BA 3SKNA 3VXUB 4L3CA 3ULUF 3AY4A 3VXQB 5GISL 5TE7L 3T4YA 3RKDD 4M43L 4KQ4H 4MVBD 5L7XH 2O61B 5JPNB 1LEGA 4PV8B 1S9VB 2YN3A 2Y5TA 2B1HL 4HS3B 4AIZB 2DDQH 5CEXB 5DFVC 1ZT4B 4NJ9L 1RZKH 1LO0H 2MQ3A 4WNQB 5I71C 4PRIE 5HHOB 4LLWA 3NCJL 1V05A 2FWOA 35C8L 1WZMA 4MX7A 5HHVH 4APQA 3S35L 1U41A 1MJJA 3RTQA 2IMNA 3MO1B 3NPSB 4KVNL 3RI5F 2J3SA 4JO3L 5B8CB 4LDLB 4LASH 5B3NA 3FT3A 3KR3L 1ZT1A 3HE7D 3OG4B 1VCAA 2YS4A 3K2MC 5BW7C 4ZSOB 3VH8G 1P7QB 3HZYA 1CGVA 2WAHA 3B9KA 4IRSB 1WEJL 1I7UA 2HT4C 4RGOL 5GIRB 3KXFA 3SGDH 1OTUD 2MHAA 1BM3H 2QQNH 3FZUC 5FKAA 5DR5H 4GBXD 5IEKB 1FNSL 3MLVL 5TDNB 3FMGH 2FECL 4KZEH 4P9MH 2HH0H 3X11A 1H5BC 3B5TA 3O6LL 3IAGC 4UMGA 4XAWH 1OVZA 4UQ3A 1TJGH 5L2JA 2BC4A 3VG0L 5MEQB 1D6VL 4P46A 3ARDD 4LBEB 4NBYB 4HV8A 3VFVA 1IGYA 3FT4A 1UJ3C 4GKSB 1DZBA 3OPZH 1D9KD 3LKNA 1K5NB 2ADFH 1MY5A 2H32H 5JIKA 3KPSD 1SY6A 4LFHD 1XIWC 4RFOH 4WENB 3MUGA 4UINH 5CZXC 4BZ2L 2GI7A 2R0ZL 3RVTD 3QEQA 2ZG1A 3AY4C 4YHIA 4QCIA 2LVCA 1ZHNA 3EUUA 3G6JB 1CGSH 3QO1A 5KSBB 3MRCA 2F54B 5JR1L 4YH6A 4P23D 3DO7A 4YHOH 5AUMA 4MCZA 4PJ9A 3OB8A 5E9DE 4LSVH 4QRPB 2I07B 3LRSB 1F4WH 1DBKH 1GAFH 3HAEG 5CD5D 2VLLB 1E27A 1FV1A 5TF1L 2H45A 1HSAB 4XPBH 3BYTA 1J1OH 3BKYL 3NN8B 5E6ID 4EDWH 4APQC 4LLVA 3RWCA 3RTQC 1A7PH 2BJML 3K3QA 3O8XA 5AZ2H 2VZ1A 3QHFH 4Z76B 3BKCL 5DURB 4Z78A 5D5ME 3MX0A 2BDNL 4QXUH 3EOTL 3EYOB 4Q97A 3B9KC 4I13B 1NGPH 1BP3B 1EUTA 4P9HC 3SKOB 3OGCB 1ZSDA 4GMSH 4ZUWA 3JUZA 1WF5A 4K55A 3T0ED 5GJTL 3BVNA 3KLDA 3V0VA 4Z7UA 4DKFH 2B2XH 2HT2C 3D5OF 1RULL 3G9VA 3SE9L 2R39A 4ODSH 1N5YH 3H7LA 5FUZL 3FO2A 4P46C 5TE4L 1MFEH 4FFVC 5DJ0A 3U4EB 1J8KA 4U49A 3ZSTA 1CWVA 2FL5A 1KSRA 4AMKH 1YEKH 2DIBA 5DMJB 1JFQL 1DBAH 5FEBA 4X7TA 2C3VB 4Q9RH 2DJSA 3TBVA 1EJ6A 5D8JH 3UO1H 2D03L 4ODVL 1KOAA 3V6ZB 4N0FB 1HDMA 4R4ND 1AO7D 2PO6D 4MQXD 1T80A 1IGIH 1FGVH 5CLWA 2XYCA 4KJPC 3BDYH 1NPUA 3C6SA 1F8TL 1U8IA 2VL5A 3ALWA 4MJIE 4YK4C 2P5WB 4PJ9C 5IWLA 5SV4A 5AG8A 4BQ6A 4FG6D 5DWUL 4MB5A 1KELL 4GRWH 1H3WM 4M7JL 3IDYB 4UB0L 4KGJA 4WHCA 1TTFA 1KLUB 3TVMB 5EU3A 4F15C 4U6VL 4DN4L 3ZKQD 4LPWA 3BPLB 3Q2CA 3LSOA 1MY7A 3O8XC 1T89A 1S7VA 1MCCA 3F5WA 5GHWL 5AD0A 3CXDH 4YHNB 4NQCB 2AJXH 3FQWB 4W6YB 3VI4F 4HWBA 3NABL 5JUEL 3RUGB 2P7TA 2E5EA 4JREB 5ESVA 3WKMH 1HKLH 3BZDA 4LHUB 4OZ4A 3BEVB 4G6FB 5J6HA 5J1TC 5EZIL 2CRYA 1EHAA 3TYGL 3VXRE 3CK0H 4O5LH 1ZVHA 1TVHA 2IFFL 3TJEH 1MJ7L 4QGTA 4HWEH 4DZBA 2JJWA 4WUUB 3HE7A 5FK9A 1NUGA 4GAFB 1ZGLB 1KTRL 4ZFOB 3BUYB 5FAAA 2KH2B 2GK2A 4JFHD 4U0QB 4LU5H 3LIZH 3OF6D 5JNYB 3KWWA 2AJSH 2GAZB 1S9WA 1RUAL 3DURB 3OAZH 4YHLL 3K74B 2HVJB 1DSFH 1ETZA 1DP0A 1EVTC 4R3SA 4ZOCA 4YGVB 4GW4B 5CJQL 4PJBF 3BT2H 2O5XH 4LARL 5IW1B 4BZ1L 4PJAF 4QYOA 4X83A 3ULSA 4U2YA 5CEZE 5E8NB 3ARDA 3BPNB 2R0LH 1S7WA 4N0CC 1E6OH 1FZOB 3CMGA 4UOW0 1A6WL 4BK4A 5IWLC 1D9KA 1A9BB 4FMKA 3IDIB 1IC5L 1VA9A 4EI6B 1J0KA 3OXRB 3KPSA 4S1DD 3OKNB 4TUJA 3RA7L 2NX5D 2L7UA 1X9QA 1B6UA 2ERJC 5FHBH 4JFYB 3RWGA 2FH8A 2VXVH 3RKDC 4OQ1A 1T89C 2EZ0C 1ADQL 3ALXA 1ZKAA 1N6QH 3EYSL 4P23A 1JCKA 4M5ZL 1XGYH 1ROWA 3SKUD 3QEHB 5D2NA 2Q7NA 1QSFD 2IBGA 1DEEB 2DTML 2FHBA 4P48A 2E9IA 2YPVH 3GMNA 5H35A 3GIVA 3DV4A 1XGUA 5FYLH 5I1LA 1WWBX 2XKSA 4J8RA 5MI0C 5SWZB 1QYGL 1IAOA 2V5RA 3HE7C 1WBZA 5I1AB 1TQCB 2OM5A 3A6OA 1PKOA 2A74A 1E4XH 3MXVH 3P9LA 5JHDD 1PJ9A 5GRVL 1ZANL 2R1XA 2BMKA 3HLAB 2AVGA 5A16B 1MCIA 3ARQA 1QNZH 3FJTA 3T0EA 1GZQA 2AXHA 1M71B 2L4OA 2H26A 3EJJX 3TPUB 2OJZH 1G1YA 4HPOL 1I9RH 4TN9A 4I9WE 4M6NH 2P8PB 1TENA 2NR6D 1E4WL 4U1MA 5EC1B 4YAQA 2V2TA 1I3RB 1LDPH 2ZSVA 3VGAB 1J18A 4N9OB 3OAZK 5IR1A 1AGEB 3ARDC 3P77A 2Q8BH 1G7QA 2AXGA 1L4IA 2V5MA 3W9EA 3QJHA 4HBCH 4WTZA 3FQTB 3TZVB 5D1ZB 1D9KC 4AEFA 2D0FA 5ID0A 1A1OA 4Y2DD 3PWPE 4U6XB 2XTJC 3DRTB 4BM7A 1UA6H 3RVTC 5DJ2B 2ZUYA 2D2OA 4JDTL 3QEGH 1PKQB 3V7AE 3QDJD 1AO7A 2PO6A 4QHLB 4P5MA 4KAQL 4QT5A 3WN5B 3IKKA 2OK0H 5D70L 3GSRA 4Z9KB 4P23C 2GSGA 3ULVF 3MUJA 3A67H 5TPWH 1MNUH 2X1PA 2NNAA 1CLZL 4H8WH 5EOCH 3U82B 3T3PF 4RISL 5D2NC 5TDOB 5CD5C 5E1AA 4P2QE 5TQ0H 4OF0A 3STBA 3QDGD 2ZNXA 2P47B 2VZUA 3MJGX 1HEZA 1QBLH 5KW9H 5F3HA 1X5ZA 2WBWB 3KPNA 5FM5O 2DKSA 4FQPA 5A1AA 1PSKH 1OPGL 3GSNH 2FGWL 4PJ7E 5J57B 2R4SL 1OCWL 1VFBA 1WFTA 1GH7A 5ILTH 4HFUH 2F58H 5I1CH 4FRWA 2UZIH 5KVFL 3T0EC 4KMQA 4YEEA 1EO7A 5FIEA 1Q9WA 1FC1A 3D18A 4LPCA 4O58L 2ATPA 4HCRL 1YYML 3DXAD 1MJUH 5CUSL 1AKJB 4ETYA 2MKLC 1G9EA 4Z8FH 1MLBB 1VGKB 3EOBA 4PRHB 4K3HA 3RU8L 4R26H 5I2IB 3VWJD 4ZUTA 4UAOC 4OD3L 1NGWB 3LN4B 4NPYA 2UWEE 1MCWW 5K59F 4R7DB 1QR1B 1PX4A 4FQ1H 2ARWA 1C08B 3LHPL 3QFDB 4JFZH 1S7RA 1NGXA 5EU6D 3JV0A 5EIVA 1QFPA 2QADD 2RB8A 3WHXA 4R4NC 3H9HB 2PO6C 4MQXC 5HPMB 5MHSD 4PJ5D 4DGVH 3NA9H 4G9FB 4JPVL 4RCAA 4NQDD 2GK0B 2ICES 1CXKA 4XCYB 4M62H 2HJKA 4FG6C 4X7FC 4R4FH 2N4IA 3IDNB 3VRJA 1A5FH 3E3QC 2NX5A 4RQQA 4WEMB 1HYSD 4Y19A 2OL3A 3JTSB 3TBSA 4JFEB 1JWUB 4P3CL 4XP4H 2ARJQ 1BBJB 1VACA 4GRLD 1GGTA 4C56E 2OI9B 1U6AL 1S9YA 1KB5H 1HOCA 4G7VH 4IOIB 3HUJE 3GSWB 2R56H 3UC0L 4FFZL 4JFQB 1G9ML 1IILE 4LP4A 2BVTA 2AGJL 1UT9A 2VUOA 5GS0D 1JUFA 4BSWA 1KTLA 1QSFA 1S7XB 4G6MH 4G8FA 1ES0B 1XF1A 3ROLA 1KN4H 5AYUH 5E2VH 3U0PB 2YEZA 5EO0B 5GRUL 1CDYA 1RJLB 3TH2T 1EJOH 1EAPA 4GKNB 3OKLB 2DYPD 4HGKC 1G7PB 3HB3D 4BFEA 2BXZA 5LQBL 3LZFH 1RIVL 5IM7B 4ZFFA 1U3JA 2D9QB 5JHDA 3LKSB 1P84J 1CE1L 4HXAH 4A6YA 1EFQA 4UV4L 3ZKMC 5C3TA 2E27L 5F9OH 5FECA 4RWYL 1DQLL 1QLFB 1H3VA 5BZDA 4WIQA 1GOHA 2R69L 4LCWB 4ELMA 5C07E 4NM8L 2ZWLT 4PREB 5FV2A 3UX9B 3GSXA 2VDLH 3WFDL 2ICEB 2A6DA 1P69B 5GS0H 3GSUB 4GQ9H 2VLMD 3QISA 4FQ2H 4N0UA 4BFBD 2W0FA 3PWJB 1NL0H 1XF5A 5EO1B 2PYEB 5T1MA 3GNML 1RU9H 4S1DC 3BP6B 2GYSA 4HKXA 3B43A 4QXGH 2VN4A 3MRJA 1RZGB 5J12B 4G42A 3IF1A 4IHOA 4UDTA 3U4AA 2Y9RT 43CAA 5LAXB 3QG6B 3OKDA 1X5HA 4PJXA 4N8VA 3HC3L 3QDJA 3VXOA 3B3IB 5IHLB 5CJOL 4DN3L 1KB9J 1EGJH 1ZTXH 1BFVH 3F7PC 4S1SH 2WZPD 4I3GA 4IRZH 4Y4HB 3BYYA 4AH2A 5GSVA 2VLKB 4FQHA 3KJ6H 5HSFA 4JANB 4HLZH 3QDGA 1T20B 4G8GB 5GS3A 1GGUA 3FQRB 3DUSB 3H3PH 4B7LA 5C0AD 1KJMB 3C5JA 2X9WA 4JRXD 3CFJA 4J23A 3LEXA 2V2WA 3PDOB 1QBBA 4X6CE 4MJ6B 1S78D 4P2RE 3KYNB 3QPXH 2BP3A 1UACL 3QBTB 4OJFL 2XTJE 4GAYA 5ANMA 4AG4H 5IB5A 3CDCA 2VDQH 2G9HA 5MERB 1I8IB 4Z77B 1F58L 5E6YA 3GMQB 2C4FT 1A6UL 1MVUA 1FNLA 1T1WB 2EYTA 4NM4L 5BOPA 3P9MB 5KOMC 1EA9C 3NTCL 3DXAA 5EWIL 4LCIL 1T0PB 5DT1L 1UM5H 2NR6C 4MAUH 5CCKL 2IAMB 4JJ5B 5CWSB 2VIRB 2J6EA 3LV3A 4PRIB 3VWJA 2UYLA 3DARA 1HNFA 5D93B 4AT6A 1DBBL 5A43C 3N0PB 1KJVB 2WK2A 1KBGH 5KVEL 4XPFH 5MP6H 2P4AB 4GAGH 3V5KB 3Q0HA 2VXTH 4JM2B 5HGHA 1YEDB 5JZ7D 3WHE0 3T0AA 5FYJU 5EU6A 5HHXH 3U30C 5DVOA 1EHXA 2GQHA 5FYKD 1TCRA 5C0JB 3LKOA 3IDJB 1TTUA 4PJ5A 1MEXH 4JKPH 3NZHL 4N1EA 4OB5L 2EIDA 4UNUA 4AIOA 2IPTH 4NQDA 3MV8D 2DM4A 5H37H 2LTQC 3VFPA 5DZNA 3CVHA 1BD2E 2L7JA 4KY1H 1T1ZA 2MCPH 3X14B 3VXME 4FXKA 1QO3A 4F58L 2IANA 3CGTA 1MPAH 5IBTH 3TT3H 4P3DB 3HMWH 4HX1B 5F72S 3MNVA 3HMXL 4FQXA 4GRLA 1CN4A 4HWZA 3OKYA 2CH8A 4LGSB 5BZWB 3RWJA 2Q86B 2ZNWA 3QSKB 1VKXA 3E2HB 4XNYL 2W9DH 3I6LE 1OY3B 1U8MB 3S34H 5E8DL 1TPXC 3JTTB 3TWCH 1FRGH 3BD4A 2XZQH 3N1MC 1RZ8A 4DAGL 1MFNA 4OQTL 4HKZB 5DRXB 2GITB 3EO1B 4HULB 2VOTA 3UPRA 4N0RA 4XXCA 2DYPA 5DS8B 4Z6AT 5BVJB 1SJXA 2R0WL 2DN7A 4MA1B 4AEHH 3EO9H 4H5SA 2B5IC 3UP1A 3KPOA 4HC1A 4NO5A 3VWJC 1NQBA 3L6FB 4CUCA 4F3FB 1M7IB 4CMMA 3U36A 1B4JL 2Q8AH 2HFEB 1HE7A 3CZFA 3WIHL 2NW2B 2GTWB 1HHIA 3MBXL 2QADC 3TIDA 2HMIC 5IMKA 4LLMA 4UV7H 3EGSA 4CN1A 2YD8A 5INCA 1JWSA 3B2VL 5BQ7A 1F42A 4KVCH 1A1MA 3TGXA 2R2BB 4XP1L 3C08L 4M6ML 5DJYB 1YECH 1Q0XL 1YMMD 2H3NB 1BBDL 2SEBB 3F12B 4LIQL 4JQVA 3ZHDA 1GGIH 4WFFE 1I1AD 5F6IB 3WUWG 1HYSC 1U58B 3GKWH 1DN0B 2B4CH 4QXTB 3TBTB 1FL3B 3HE6B 4FQXC 1YA5A 4GRLC 2FX8L 4KI5F 5A40E 3LS4L 2XZCH 3EJYD 4GXVL 2CPCA 3C09B 1FYHB 2CKBA 1FO0A 4L4VD 1BX2A 3LOWA 1FZJA 4D0CB 4TSBL 1HH6B 4JHWL 3FB8B 1ZS8A 2X4UB 3MLYH 3MRBB 3SO3C 4XXDA 2OTUB 1NAKL 5D9SB 5C0AA 3U79A 4XNUH 3CDGB 5C8JB 5HYFA 4O9HH 1AHWA 1L6ZA 4KGLA 3QQ4A 3TNNB 1IAIM 5IW6B 1IC4H 5HDLA 5E08H 1BGXL 2QHRH 4FZEH 5IVXA 2D4FA 1ND0B 1U8JA 5C08D 4IMKA 5HGBB 5F21B 2BY0A 3IFOA 3DSNA 4N90E 4Y19E 3EFFA 4W6WB 2P44B 1YEJL 1A6AA 4CMHC 5FO8A 3K8MA 3QUXD 3X12A 4U6YB 2BNQB 1M7DA 4JFOA 3AROA 4GH7B 1BFOA 3LMJH 5EUOA 3SY0A 2DB8A 5D7LA 4PJGA 1DUZA 2X4QB 3F7QA 1Y0LB 3O6KH 1S3KL 1QSEB 1M1SA 4NNPH 4YDJB 5C09E 1P5VA 1QFWM 4ISVB 3HG1B 3MRGA 1MCWM 4X7CC 1FZMA 3OKOB 4X8JA 1JPSH 3CD4A 4G6AC 4LSDA 1WBYA 3GSOB 5I8OL 1I1FB 3V4PH 4JQVC 4DGIH 5D1XD 3GB7A 1MCDA 1S7TA 2RQ8A 3JVGA 1MFCL 4OZGB 3NAAH 4I1NB 5DJDA 4RMTA 2VNCA 4IJ3B 1F4XH 4E5XA 4QGYA 3CPLA 3RVWD 5CZVL 4WV1A 1A7NL 4WFHE 4FQIH 2GJ6E 1AXTH 2LE9A 2VDML 3IFNH 3MLRL 4Y8AA 5EBLA 4OZFB 5F7MC 5I71B 2Z91B 4OCXL 5TQ2H 4JCMA 3GUTB 4NHUA 4D9QD 4H26A 1FFQA 4JN1H 3SKMB 1AHWC 1OM3L 2DQGL 3FRPG 3SDCD 1RV6X 2DQDL 4KTDH 1S78C 4K94H 2WV3A 4IMKC 5BRZE 1NBVL 3DX9A 4FTVE 3PUCA 1Z9SA 2EDFA 5DRZB 3JSSA 3HAEA 2HRLA 1YN7B 4MAYD 2VUYA 4OKVA 3GJFH 1EEQA 1MRDL 5DUBA 4L5FH 2XICA 1N59A 3G5ZA 1ZLVK 5DVMA 3M45A 1X4ZA 1REIA 5AYQA 3C60D 5FHAL 4GSDL 1XF2A 3W2DL 3DO3A 1YNTB 1J05B 1H5BB 5ENWA 3WE6B 4PJIA 1DTUA 1Z2KA 4N5UA 3L3JA 4GAJL 3BKJL 1KJ3L 4V1DB 4I3SL 4NSKA 1UJ3B 3DSFH 4IIQA 3S3JA 5CD3A 5I1GH 1N0XL 5JZ7C 3ET9F 4K9EH 4PJ7F 3PIQB 4L3ED 1XIWB 3AC0A 2FLRT 3SKJH 3JVGC 5AWNH 4F33B 2AQ1A 1KIQA 1D5BB 3SKNB 4EI5D 4L3CB 2A1WH 1GGBH 5GSRA 3T4YB 3VMNA 2FJHA 3Q6GL 1YEIH 4JG1H 4UTAL 2IC2A 3RIFF 2R23A 1LEGB 1KFAH 1YMMA 5T3XE 2Y5TB 1HILA 4WV1C 5BV7C 3S3PA 4WWKA 5KSAD 1I1AA 2EIBA 4HMDA 4PRAA 2CLZA 3G5VA 1XMWA 2PNDA 5KG9A 4LLWB 1KNOA 3BRFA 1JPGA 2FWOB 2FHFA 1JGLH 1WICA 4MX7B 2UWEF 3PP3H 1ZAGA 4XNMA 5CBEA 4APQB 1MJJB 3RTQB 3KLAA 5E03A 1RK1A 4HQQL 3FT3B 1EO8H 4L4VA 1ZT1B 1HHHA 3O0RL 1BFSA 3ULVH 2DQIL 4RA0C 3SDDD 3HZYB 3ILPA 3RPIA 3MRPA 1G7MA 3B9KB 5HHME 4LP5A 1I7UB 1T6VN 1WTLA 5HDOA 3KXFB 4KHXL 4Z7OE 3MODL 2CK0H 4PUBH 2ATKA 5FKAB 4TSCL 5C08A 2IALA 4X6DE 4ZTPH 1T1XA 4F2MA 3GJFK 3X11B 2ENSA 3Q5OA 1GVIA 4M9PA 2ED9A 4UQ3B 5L2JB 1XH3A 1OGAD 2BC4B 1D3CA 3HFML 4P46B 5DEFA 4HHAA 4HV8B 3VFVB 3ELAT 1IGYB 4NZJA 3FT4B 2DKUA 3QUXA 4IIQC 5IHBA 2H2PD 4UILH 4AL8L 2DQUH 3LKNB 1CFTA 3HUJF 3MSPA 4HKJA 2G5RA 3BGMA 1JVKA 3RWDA 3UTPE 3IS1X 1QEWA 1I1YA 4N9GA 2VXSH 2WMPA 3KGRA 3QEQB 1RSFA 2A9NH 3WFZA 1DE4A 4YHIB 4QCIB 1ZHNB 3BO8A 3Q3GA 2ILLA 5JIPA 3QO1B 4LQFH 5GZND 3MRCB 1QACA 3DO7B 4XNXH 5AUMB 4YK4B 4MCZB 4PJ9B 4WWKC 4M5YH 3JV4A 5D1XA 1I1AC 2HKFL 2OBGA 3LQAC 1JV5A 3O2DA 4CL7A 4FQLL 1E27B 1FV1B 1U8KA 2VZSA 3V0WH 8CGTA 4F15B 3CUPA 1B0RA 5EOCJ 4LLVB 4JEGB 4ONHA 5CIPH 3RWCB 1H8SA 1A6PA 3D9AH 1FH5H 3O8XB 4W4NA 2F8XC 4NUJA 4YBLC 7FABH 1K8DA 4PD4K 3C9NA 2E9WA 4K7PY 3BKMH 1RIUL 5DFWH 2WBJA 5D7IA 5F1KC 1ZSDB 4ZUWB 3V4UL 2AV1A 1K4CA 4G3YL 4ZD3H 3BVNB 3SDCA 4HXBL 1AGDA 4JFFD 4Z7UB 3V0VB 4GMTL 4PRPD 2I60H 3FRUA 4KQ4L 5L7XL 1DBJL 4HIXL 2XN9E 4Y89A 5L0QC 3FO2B 4UIMA 2EE9A 2DDQL 1Q8MA 1QTYT 3FCTA 3QUXC 5DJ0B 1XGPA 1LO0L 4RGNE 2QJDA 1DDHA 3DROA 1W8OA 4MSWA 2FL5B 3C60A 3GRWH 5EN2A 1ZWIA 3LN5A 4X7TB 3TBVB 5HHVL 3QI9D 3LEVH 3MRIA 1HDMB 3PNWA 5I1IL 3SO5A 4HEME 4LASL 5IUSA 5I6XC 4XC1H 2VL5B 1U8IB 3S8WA 4LL9A 4X6CF 3HI1A 1WFUA 3CFKA 4JHAH 4JCLA 3DV6A 4MJ2A 4DJMA 1V5JA 5D1XC 2Z93A 2JF1A 4JB9H 1HINH 4L3EA 5DDHA 2DQTH 4Q9BA 1BM3L 2P5EE 1TZGH 2QQNL 3L95A 5EU3B 1RZ7H 2ERJB 4EI5A 3PF2A 2GTZA 3ZT5A 4HWBL 3FMGL 4UUJA 1INEL 3LSOB 4Y4KD 4P9ML 2HH0L 1S7VB 3F5WB 5AD0B 3GKZA 4WO4D 4QHNB 4XAWL 5FGBA 3PG2A 3RVWC 5DMIH 4OF5A 5D7LE 3MROA 1IEAA 2P7TB 5KSAA 1HXMA 1J8HA 3T09A 2WBJC 3OJVC 4OZ4B 2Q1EA 5J6HB 2Z9TA 3MC0A 4YQXH 3QUMA 1EZVX 1PG7X 2Y7QA 4RFOL 3SDCC 4UINL 3QP3A 1TVHB 5JOFA 4Z7VE 2B1AH 4WW2F 5MI0B 4DZBB 3FFCD 1MRCH 3HE7B 5DK0A 3GMLA 3ZZ1A 5FK9B 1M6OA 3B5HA 4JE4B 3SDDA 4HJGA 1RHFA 3KWWB 1QA9A 3Q1SH 4PG9A 4YHOL 4XB7A 2YD3A 3RPKA 4LSVL 4NOFA 1S9WB 4X4XA 1F4WL 1DBKL 1GAFL 3C60C 3L5WA 3RX8A 4XPBL 1ETZB 3JWDH 4R3SB 4QTIH 4LIQE 3SDXE 1CDUA 3TC9A 5GS2D 1A7PL 1G6RA 3VGGA 4HG4J 4OCMC 4QYOB 3QHFL 4KK9C 3ULSB 5I8CA 5ELIA 3W0WE 1ERNA 1AE6H 1FNAA 1OGAA 1SHMA 3ARDB 1A7OH 1Q94A 5F1IA 4KK6C 4BH7A 1S7WB 4QXUL 4QNPF 4Q6YA 2H8PA 1D9KB 1C1EH 5B39G 4CJ1A 1NGPL 3KPRD 4GMSL 1G7LA 4TUJB 3QDHA 2HTKD 4WFEE 3CH8A 5C0CE 2FGZA 2WUBH 5CP3H 5D6CA 2XTJB 3BMWA 1OSPH 4EI5C 4DKFL 2B2XL 3RWGB 4OTXL 2X05A 3UYRH 3KYMA 4L8DA 3E0GA 4ODSL 5FGBC 1UQSA 2COQA 4ZUVA 4P23B 4IRJD 5KSAC 3DVGA 4P57A 4OLZL 1MFEL 5D2NB 4AMKL 1YEKL 4K07A 1DBAL 3GMNB 4LLYA 5H35B 4Q9RL 3GIVB 3DV4B 1XGUB 2IPUK 4MJ4A 3TBYB 5I1LB 5D8JL 4WUKH 1PY9A 2BRRH 4J8RB 1IAOB 1MVFA 1YNLH 2R2HA 4X98A 1WBZB 3D2UD 1IGIL 5DUPH 3H3KA 1FGVL 1G7JA 3QXAA 2A74B 3P9LB 3V6OA 2P49B 3BDYL 2FSEA 3SDDC 4CGTA 4HW6A 2R1XB 1RMFH 3MCLL 2BMKB 2I27N 3TCXA 2WUCH 1GHFL 1KC5H 2GKIA 3T0EB 1FQ9C 1GZQB 1K8IA 2H26B 1MLCA 2K7PA 4IDJH 4JFFA 3DYMA 1CL7L 5EOTA 3W9DA 5B4MD 3HI6H 1YYLL 3A6BL 4PRPA 1BF8A 4WI9A 4U1MB 4YAQB 3MBED 4NUGH 2V2TB 2R0KH 2ZSVB 3HS0A 5IR1B 3CXDL 2ESVE 5FUOL 3P77B 4UAOB 1M7XA 1G7QB 2AXGB 1EERB 3W9EB 3QJHB 2H2PC 3WKML 1HKLL 2HG5A 2DM3A 3VFSB 1DL7L 3BJ91 2QQQA 3IXTA 2H41A 5ECJE 2VXUH 1NFDA 1A1OB 2OR9L 1AR1D 4O5LL 3MV9D 1X5GA 1MHCA 4YPJA 2PO6B 4P5MB 4QT5B 3GSRB 5GZNC 5F9AC 5MEPA 2GSGB 5H2BA 3DVNB 3AGVA 3DTXA 3LIZL 2V7NA 1WZKA 4EQ3A 4R97C 3F62A 4NKIL 2NNAB 5E1AB 2LVEA 1FSKC 1HEZB 5FUCC 4AEIH 5F3HB 1IGML 3QIBD 4Y4KA 3BT2L 2E9JA 3MLUL 2O5XL 3IDMA 3KPNB 4KKBC 4WO4A 1S5IL 4XNQA 1I8LA 1UGNA 4MDIA 5FOJA 5IJKA 1EEYA 2WQ8A 1XF3A 4LKCA 3V6OC 3D25A 3F6LA 2R0LL 4RFNC 3VGHA 2HWZH 1E6OL 1VFBB 3VFUA 5DZOA 2NW3A 3O4LE 1MCHA 1EXUA 3EKCA 2Q3ZA 1N4XH 4JZNA 5JO5A 5KTEH 1Q9WB 2AI0L 2FO1A 3D18B 2ATPB 4P2OA 4GG8A 3RGVD 1QQDA 4EXKA 3FFCA 5FHBL 1FBIH 2VXVL 3EOBB 3O9WD 1SQ2N 1N6QL 3ZLQC 4ZUTB 1XGYL 4NPYB 4ZOBA 3PWVA 1NCBH 1EH9A 1YDPA 1QFUH 3UROR 1S7RB 1MFAH 1NGXB 2YPVL 5IB2A 2PW2A 5FYLL 3WHXB 4G6JL 1BZ9A 3O6FD 4YBQD 3QQ3A 1YJDC 3U1SL 2VLRE 3ZT7A 4H1LB 1E4XL 2GUOA 2YUWA 1OAYH 3KPTA 3KPRA 2HJKB 5JHLH 1QNZL 3WNLA 1MHPH 4P49A 3VRJB 2CRIA 2NX5B 4OBRA 4RQQB 1A3LH 2BK8A 4Y19B 2OL3B 4PJ8D 5DQJA 3TBSB 2J5LC 2OJZL 1I9RL 4M6NL 4NJAL 2G2RA 1VACB 3V6BR 4Y4KC 4R90H 4C4KT 2ZCLH 4QOKE 1S9YB 4MLIA 4WO4C 3VGEA 3EW3B 1HOCB 1I8LC 1LDPL 3Q6FA 4IRJA 5LCVH 5IJKC 4MCYA 2Q8BL 2NXYD 4J4PD 2OZ4H 1WAAA 1JUFB 4BSWB 1KTLB 1F6LL 1QSFB 4MNGA 5BCAA 4G8FB 4HKBA 3ROLB 1AJ7H 2VDPL 5I8EA 2QSCH 5KSUA 3FOLA 2YEZB 1UA6L 4P2OC 3QPQC 1IEHA 1MWAA 4ZTOL 1EAPB 3I6KA 3QEGL 3RHWK 1TIUA 1OP5K 4ZFFB 2XRAH 5JHDB 2JB6A 4A6YB 2EH7H 3A67L 1NC2D 3MRHA 5TPWL 1MNUL 3EFDL 1NLDH 5K93A 5FECB 12E8H 4H8WL 5I0DA 4NC1C 5K9JH 4A2MA 4CVXA 5TQ0L 1H15A 4GG6E 5BZDB 1Q0YL 3MXWH 5ALBH 1Q9OA 5KW9L 3AM8A 4ELMB 3QEUA 3ARGD 1J8HE 4L1HA 4BQBA 3MBEA 4OSUH 3GSXB 5DMKA 5F8QC 5DEGA 8FABA 1PSKL 3GSNL 5KANI 4N0UB 1JNNH 4X4YA 2W0FB 2VZVA 1XF5B 3BRGC 3I75A 1MFDH 5T1MB 5IVNA 2WLZA 4HFUL 2F58L 5KANG 5I1CL 2J8UA 4HKXB 3SOBH 1CF8L 3MRJB 2HTKC 4G42B 3IF1B 4IHOB 4UDTB 43CAB 5C0BD 1V7NH 3MV9A 1MI5E 1NAMA 3OKDB 3U30B 4PJXB 5EU7E 4Y1AE 3RKPA 2P46B 4N8VB 5C6TL 3QDJB 5DJCA 5E2JA 3FB5A 3VXOB 4LMQI 4HAFA 4ZPVA 5ESQA 4Z8FL 1L0YA 1LWRA 5F7FA 1CXHA 3MJ6A 1A9EA 4IRJC 1LD9A 4R26L 3I2CL 3ZE1E 1LP9E 2DQHL 4EXPX 2LTQB 4QTHA 2QQKL 4X6DF 4AH2B 5GSVB 3ZKND 2J4WH 4D0BA 5K9QI 1GPOL 4FQHB 4FXGA 3FO9A 1MELA 2V5TA 3QDGB 4FQ1L 2MQ0A 4XC3H 4PY8I 4JFDA 4JFZL 4KQ3L 5K9QG 2Z35A 3F7VA 3C5JB 3DMMD 3CFJB 3QIBA 4LCCA 3LEXB 5FV1L 2V2WB 1B3JA 2IJ0C 5L8KB 5IK3A 1TZIA 1A47A 3NA9L 4KXZH 1CLOH 1FFPA 1UXWB 4GAYB 5ANMB 1RQ5A 4ESKA 4Q7DA 3WUWA 1TPXB 5IB5B 2G9HB 4M62L 3GBLA 4R4FL 4EBQL 5A2IH 2C1PA 3TJHD 1MVUB 2NMSA 2EYTB 5GZOD 4NBXB 3RGVA 3AM8C 3DXAB 4XP4L 5B4MC 3HZVA 4WU7A 4PGEA 4RZCB 3MBEC 2UZYB 1CK0H 1R3IH 5F7DA 3O9WA 2ID5A 3LV3B 1KB5L 2A83A 3VWJB 5KS9E 1ACZA 2UYLB 2VE6A 4D8PA 5I16A 3AAZA 1BVZA 3PHSA 5ETUA 4AT6B 1A6TA 2IQAA 3X17A 1NANI 2DMBA 1QRNE 3HR5A 2ZSWA 3NCJH 5HGHB 4G6ML 4D2NA 5T33L 1XZ0A 2DI7A 3CSYA 1AR1C 5EU6B 5AYUL 4KVNH 2QADB 5E2VL 1TCRB 4LSQH 1EJOL 2ZUUA 3FQNA 3LKOB 3O6FA 4JY4A 3ULUD 4PJ5B 5BVPL 1NSNL 4ZNEA 4NQDB 1NJ9A 4OGYL 1A6ZA 2DWEA 2XWJA 3M07A 4OV6F 3TV3H 3L9RA 1WEJH 2XQYG 4RGOH 3VFPB 3CVHB 4MQTB 1JHLL 1T1ZB 3BWUC 2Q3AA 5F9OL 4ZAKD 1VFUA 4FXKB 1QO3B 4PJ8A 2IANB 4IS6A 3MFFA 3MNVB 4Q74A 3QAZC 1F6AA 4FQXB 4GRLB 3QIBC 4LCCC 4HWZB 3H3BC 5B38G 1XGTA 1ONQA 5DURD 3VG0H 5GS0L 4NKQB 2B7DT 1D6VH 1VKXB 4HH8A 5EOQL 4M8VA 4J4PA 1MH5A 3U48A 1JRHI 1NL0L 3V7MA 1YN6A 3VXTA 3SO3B 1X44A 2KL6A 5GRXG 1NCDH 5TGBB 2HKHL 3DVFA 4KJWD 4QXGL 1RZ8B 1S8DA 5JQHC 3UPRB 3RGVC 3MCG1 2DYPB 3K8KA 1HYRC 4H5SB 5ICYA 4XCCH 3O9WC 3KPOB 4NO5B 1EGJL 4PRDA 1ZTXL 1HI6A 1BFVL 3AB0C 3ZYIA 4S1SL 1JP5A 1NC2A 4CMMB 1HXYA 5GPRA 3U36B 4F7MA 4CMHB 3AS1A 5B21A 3KJ6L 1KGCD 1IBGH 1PEZA 5TF1H 3CZFB 3FRPA 1W0VA 3BKYH 1HHIB 4XPHH 2WW8A 2FHCA 3H3PL 3RIAF 1KCSL 3ARGA 4B7IA 1EDQA 2BJMH 1SYVA 1OLLA 4YXHH 3TIDB 5IMKB 2YN5A 3ARBD 4LLMB 3EGSB 1L9NA 3O6FC 4YBQC 3KS0J 3SE3A 5INCB 4Y5VA 4TYUA 1JWSB 3QPXL 3EOTH 5BQ7B 2VQ1A 3IFLH 4Z7VF 2DL9A 3R1GH 2P5WD 1KCRH 1MCJA 4AG4L 5IOPA 1CTNA 2VDQL 4OFKA 2NY3B 4HIEA 1XR8A 3UTOA 5GJTH 4BQ9A 4PJ8C 5C0BA 4AIXA 3TVMD 6FABH 1RULH 2BVPA 3FTGA 1FO0L 1NCAL 1UM5L 3AS2A 1PZ5A 4GS7C 3D39D 3PHOA 3IDGA 5FUZH 2ZUVA 9CGTA 2CKBB 2DLGA 1FO0B 2QQLH 1HIML 1FVDA 3A0OA 2NXYC 1FZJB 5DTFA 1OAXH 4J4PC 4E9LA 4Z7WE 3AMKA 1ZS8B 3OSKA 1KBGL 4XXDB 1D5IL 4XPFL 5MP6L 4GAGL 5ICZA 2VXTL 3VE0A 3H2WA 5C0AB 1GGCH 1U2HA 3DMMA 1AHWB 2VSCA 5HHXL 4MA8L 3VD5A 4ODVH 3QQ4B 1TJIH