4XPTL

X-ray structure of drosophila dopamine transporter with subsiteb mutations d121g/s426m and el2 deletion of 162-201 in complex with substrate analogue 3,4 dichlorophen ethylamine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport/inhibitor
molecule keywords Dopamine transporter
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2015-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xptL01
3S98A 2YA2A 4ONFH 6FABL 4MZ3A 5CGMA 2VH5H 2FO4B 5E70A 2BHUA 2AK4B 3E6HB 4UUJA 2A1WL 1U8QB 3HS0A 4U1LA 3HB3D 4U6YA 2NY4D 1IM3A 5KVFH 4DZBB 2VQ1B 1CFQA 4LLMB 1BFOA 3UPRA 4U2YA 1G7MB 3VXQA 1EHNA 1X6NA 3W0WE 4PYGA 3W11D 2DDQL 4Z7OF 1KPVB 3BRFA 3HAEB 5FHBL 3DXAA 5MEOB 3P40A 1AD0B 1MCEA 3TT1L 4L4TD 1KIRA 4YHKL 3ZLQC 1WEJH 3PWVB 2NXZD 2ITDA 2NLJA 1I7TA 3ULUL 2UY6A 1JZ2A 3RY6A 2XQBL 4HX1B 1BD2A 1NMCB 3FN3A 2HFFB 1V3KA 2OZ4A 1BFSA 4M8QB 1RHHA 3UYOD 3LDBB 5BVPL 4G5ZL 3QCVL 4LLQB 3IU3B 4TVPL 3IDNA 1VEOA 4GXVL 3S5LA 3VGEA 3BZEB 5I8EB 4KRPC 2JTDA 2C3WA 4HKXA 1N0XL 4KK8C 4XC3L 3IDIB 3VD4A 3TO4D 3VRIB 3S35L 4NZJA 4I3GA 1T2QH 3AAZB 1F00I 4GMSL 3BPLC 5HYQA 3BJLA 3S8WA 4PV8B 4K8RC 3MUHL 5IV2A 3SQOL 5KS9B 2FD6L 3P0VL 4JRXB 5B22A 3T77B 3NCJL 3QXAA 1HNFA 4KDWA 4P2OB 3QG7H 2PR4H 3EIFA 4JFDE 2DAVA 2ARJA 4FXGA 4LLQA 4Q97A 4Y89A 5FO7B 1LE5B 4PJXA 3DUUB 1WTLA 3SBWA 4HUUB 3O3BB 3OHXA 4MD4B 1MCPL 3LKRA 3AY4A 1WFOA 2XRAL 1HILA 1UYWH 3OV6A 4PGBB 3MV7E 1GGTA 3QUYC 3VGBA 3FB7B 3GSWB 3MRGA 1VFBA 3KWWB 5DD3L 2CXGA 3VD3A 3V7MA 2AXGB 2VXUH 5D2NA 2FCBA 5DZLA 3D5OF 5TE7H 2J8UF 2A6DA 3E2HB 1RHHB 3O45B 4NT6B 2MHAB 3V0AC 4MVBC 2EIDA 5E2WL 1DBBH 1DSFL 3C60A 5EU4A 3TCLA 5C0DB 3H9SA 1CLYL 1YN6A 1G6RA 2ADIA 1RZ8B 4YK4C 1I8IA 1UCBH 2K3TA 5JNYB 3N85L 2NZIA 1XGYH 3P9MB 2BERA 4QRRB 2HVKA 5D1QD 5FK9B 4BQBA 4Q9RL 4G8IB 1KBGL 1VFUA 3VFPB 5C0IB 4Q2ZB 4G8EB 3G6AB 4P2RA 1O0VA 4NBZB 2BRQA 3ARGD 3QCTH 3D3VB 4LQFH 4XMLH 4EVNA 3UJIH 5IVZB 4XCCH 4K3DH 3OXRA 1U3HD 2N1KA 1T66D 1LWRA 4MQTB 5L8KB 2IH3A 1KENL 4M5YL 2Y23A 4LLUB 4U1KB 3S88L 4Y2DD 2R9HD 1FLRH 4PGBA 3DLQR 2FSEA 1QNZH 2FGZA 5AUMA 3FFDA 4CMHC 3MLVL 5IMOA 4Y1AB 3MCLH 1OLLA 4HWBA 1C5DA 3SN6N 1A8JH 4IS6B 1TNMA 1S78D 1UZ6E 1QFHA 4KKBC 5IB3A 3RL1B 1OW0A 1QEWA 3JWOH 5D7SH 3LEYH 5C6WH 4JPIA 1TJHH 1U3YA 2X4NB 3D0VB 5EOCJ 4AQ1B 2HFEB 2W9EL 3UTTA 4Z7NF 5EBGA 5JR1H 1UADC 3IFOA 3T65A 3EYFB 3ZE2F 2VLRA 5E6IB 5IB1B 5C0GB 4P5KB 1L0XA 1MVUB 2Q76A 3U4BH 1CGSL 2ILLA 4UINL 1B2WH 1EIBA 3N9GH 1XH3A 3LKQB 5E8OB 4PJ7B 1OHQA 1MCPH 4PLKD 4X7TB 3VMPA 3S4SB 5E7FA 3WUWB 2YPLA 3D2UA 4KU1A 4X6CE 2DWDA 1S7TB 3QG7L 2Z4QA 2X1WL 4OD3L 3X11B 5JQ6L 4JHAH 4UNTA 4N5EC 2RFXB 3TJHD 4JRXE 1GYAA 1JGVH 4K7PL 2F53B 1YEKL 4M93C 3QCUH 4UV4H 4XPBL 4FQJH 4EXKA 5JHDA 5DVMA 3FN9A 2BVOB 1HXYA 2BFVL 1CICB 5J4MA 1CGSH 1QYGH 5DMKA 1RUPL 3CSBA 4GW5B 3O6FD 1ORSA 4LCIH 5CWSB 4PJCB 5EUOE 5I71C 3CU7A 4YDIH 1U93A 2GI7A 3OKDB 5I73B 2AV1A 4JDZB 5SX5K 4LCUB 1QUNA 1OSZB 4FQ2H 3ULVD 5JIPA 1F5WA 5KOMC 3WIIH 3TBVB 3RVXC 4DJMA 4OTXH 3SGJC 5D7IE 4NWUH 1CFVL 1P69B 3EDJA 5KVMC 1S7UB 3DROB 4RFEB 3EJJX 3WKNA 4EUPH 3LS5L 4U3XA 1A3RH 2V7HB 1A5FH 1VADA 4LU5L 4NGHL 3QH3A 5C2BH 4HFWB 3CLEL 4X7CC 2E6QA 4OFKA 1IAII 3QIUC 3REVB 4D8PA 1O7SA 1IC4H 4K3JH 1UVQB 5T1KD 1YN7A 3LRSB 4U1MA 1UM4H 3BGFB 3KLAB 1XGUA 3NCBB 4UILL 1NUGA 1T6VN 1TVBA 4ZNCD 4NP4L 3K4DA 4HD9A 4Y2DA 5L0QB 4PJ8D 2VLJD 4OD2B 5C0NC 4LSVL 4WY7L 1FZOA 5D2LE 2MOVA 4JY5L 1IAIL 3H8NA 4OLXL 3SOBL 1ZLVH 1YECL 2F54E 3WO4C 1INQA 4QRQA 3OKLA 1XCTA 2AKRB 1D5XA 1JJUA 1NFIB 3ILQC 3WFHB 2CR6A 4LVNB 2DL2A 2E6PA 3D1MC 2ITCA 3V4VL 4CBPA 5HDBE 3W0WD 4L29A 4I0PD 2HH0H 3MLRH 1CXFA 2J6EH 5DUMH 4FABH 4H1LH 1OSPL 2LU7A 2Q7YA 2EIBA 4HS6A 4AENB 4XPTL 1MFBH 4HV8A 1G7PA 4OCXL 4ZPTB 2X89D 1YPZB 5IJVA 3QIUA 4L1HA 3EYOB 1YEDB 3L3JA 3U30C 5I1KH 1TTGA 3PV6A 4KPHL 5D5MB 5F89A 2APWA 4ZD3L 1QSEA 4GQ9L 4UT6H 5IQ7H 5T5FL 3KYKH 3OX8B 2B20A 4XBEH 3GMMA 3GSNB 4XP9L 5CJBA 2A38A 3ZE2E 3NIFE 3W9EA 1AXSB 5AG8A 4HIIB 3U82B 1QFWI 1EMTL 1SY6H 1TFHA 2QSVA 2VTFA 1HH9B 4M1CD 4Y4HA 4DGVH 1AXTL 1H3WM 2C3GA 5BJTA 1JRHL 4JM2B 5IM7B 5C6PB 1BWMA 5F1IA 2FIKB 5CHNB 4P5TD 3CXDL 4GRWF 5F7KC 3AMKA 3NN8A 3FB5A 4PRAB 1Q9LB 4QRSA 2O5YH 4X7SL 2Z4QB 5I6XB 1T03H 3O6FA 3MX0A 2EE6A 2AJ3B 5LAXB 4F3FB 5HGHA 4JFDD 3LKPA 4PR5B 1FJ1B 4TVPD 4R97B 1U3HB 5TDPB 5HDBF 2AV7B 1INQB 5KVGH 2V5MA 2R2HA 3ARDD 1LEIA 5GS0H 4G3YH 4XTRD 1BBJB 4U6TA 5MHSE 1MVUA 3TH4T 2CO6B 5I1AB 1OQOA 2IAMB 4ZD3H 2VITA 1AGEA 1T0MA 3CXHK 1Z0MA 5BZDA 4P5MA 4XZUA 4ZO8A 3IDXH 5GPRA 3LHPL 4MHHG 3GJEB 2EDXA 1NC2D 3G5XA 3L5HA 4MJIA 5ERWB 3S4SA 3WUWA 1XMWA 3PJSA 3T4AA 3KLSA 5ESAB 1JPST 1ZVHA 4PJIB 3OKLB 3P9LA 4XBPB 2B5IC 3BKJH 2EEDA 1MCWW 3SCMB 3WDHA 3DHMA 3TFKD 5M7QA 4U1JA 5C08D 4P46D 2HMID 3W39B 1F2QA 1S7VB 3A6BL 5E00B 1DN0A 3JTSB 4OGZA 4KDTA 3O4LD 2VNCA 2DQDH 1YYLH 2NY2C 4JN1H 5C0EB 1MOEA 4OIAA 4S2SB 5DJZA 3KS0H 3EYVA 4ZUSA 3ARFB 4K3GA 1HHJB 1K4CA 3C5SB 2WW8A 3KGRA 1YMMB 4JFXA 4HHAB 2VOTA 2BVTA 1SY6A 4IRJD 2YPKB 3QJHB 1G7IB 3Q48A 5T5FH 1KF9B 4O02H 4XNQA 3UO1L 1ETZA 4JREC 4TPRL 2NXYD 3KYNA 3TV3L 3VFMB 1FNSL 1INEL 3W0WA 2GCYB 5BOZG 4Y5XA 3MUZ1 1MIEH 3BPOC 5FKAA 1CE6B 2F53D 4IOFD 3MODL 3DXAE 4QTHB 3RTQA 4L5FH 4PREA 1F2XK 4NQCA 5DEFA 3LKNA 3QEQB 1S9WB 5FGSA 5I1EL 4L3EE 2O5ZH 5EUKA 2VABB 4J3TA 4ZFZB 4OI9A 3MJ9L 5C09A 2ADJA 2YWZA 5ETUA 2R39A 4UT6L 5D7KE 3BIKA 1U0QA 5EPMB 4ZO6A 1T0NB 1QSED 3PWLB 4JDZA 4LVOB 3CFCL 1FO0L 2VZTA 5J1TC 2RBLA 1MJ7H 3P4MB 5DSCA 3BP5B 3ILQD 2P4AB 3QEHA 1BJ1H 4UIKL 4N0RA 2PYFA 4JO2H 4WFED 3FO9A 4KRNA 3W2DL 2FEDD 2CKBB 4U1GB 4I0PC 4WFFD 3P4NA 3BP7B 7CGTA 3I3DA 2DLHA 3IXTB 4N8PA 4CADB 4NQED 2VDNL 4L4TE 1ZLSH 4PJHF 1WBXA 1WZKA 2P49B 4TYUA 2GAZA 3SOBH 1A6UH 1T5XB 2CIKA 1EO8L 3ULUF 2AERT 1CT8B 1R3JB 1YNTA 5TJWK 2R1YA 1F6LL 4HS8L 4NO3A 5FDWA 2DB8A 4XXCA 2GY5A 4JKKA 2Z9TA 3EJYC 1S7TA 4LDOB 3OXSA 5IVNA 4JFOB 4ZXBB 5TF1L 1FV1B 2AEWA 1TLKA 1WZ1L 1M7DB 3MLTA 3I50H 1JWMB 5DJ2A 2X1QA 4UDTB 3H9HA 5IB2A 1T7VA 1RJLB 3K2UL 4YHZH 5L8LB 3ARBC 1O7VA 4ZYKB 3NFSL 1EEUA 5DJXA 1T80A 4NWTH 3E3QE 5LGHH 1F45A 1DQQB 3OAYH 2P5WD 3JV5A 2A6KA 1V7ML 4UINH 4HJGA 2DLTA 2JJSC 2ZUXA 3F7RA 4LU5H 4NGHH 5EIVA 2ZKHL 5EU6A 2X4NA 3U2SB 3AGVA 2ZUYA 1UJ3A 5D70H 2GSIB 5HHQA 1CZ8H 2H32H 4GAFB 4P2OA 4CU7A 5IHUH 2EE3A 2D03H 1BF2A 1EGJA 5D96C 2YD3A 4JFZH 3UZEA 5C07B 2Y06L 4WO4C 3VXRD 1RUKL 1N64H 2Z35A 1YECH 1QRNE 4YHYB 4QXUL 4LRIA 1PY9A 2C7UB 1MJJA 4KDTC 2PYFB 2HJFA 3VXMB 2CLZA 3IDIA 4CNIB 4I13B 1IMHC 3MLPA 2WP3T 4PJ7E 3N0PB 3BN9D 4N8CH 4HWNA 1GGCH 2FX7L 3MXVH 4JFYA 3LB6C 2EH8H 2DQHH 4IRJA 2CK0H 3O45A 1HWGB 5FYKU 2EC8A 2Q87A 5IFJA 2LVEA 3VI3E 5GSVB 3RHWF 1UWEH 3MRQB 4ERSL 2R2EB 1JN6B 2BDNH 5CINL 1E28A 1C5BH 3S3JA 5ADPL 1LILA 5CZXC 2AXJA 1MJJB 1A1MB 4ODSL 4FQCH 3BUYB 4OD1L 3RKDD 4GG6E 4WW1B 4XP6L 4HK3J 1IT9H 4NBXB 4QCIB 2FO1A 3IXAA 4RIRA 3RWIA 5BRZE 5FUOL 1A7RL 1NFKA 2N7BA 4J1UB 1BX2B 1WBYA 5J6GB 2NY5L 3VFSA 5A3IC 1VPOH 1N64L 3EO1A 3PGFL 4FZ8L 3QNZA 3SKOA 5GGQH 4LP4A 1CL7I 3MLYH 1Q9WA 3FQXA 4NFBA 3FO2B 1D6EB 3MYJA 2C26A 1CFBA 2P42B 2F19H 4HPOH 1OAXH 4F37F 4HH9A 4PV9A 5EO9A 5CD5D 4HK0A 5D7JC 1ZVYA 4KV5F 2J4WH 3RWCB 4Z0BH 5GGUB 1KCUL 2X4SB 4GFTB 4OIBA 4OJFL 4DCQA 5ITBL 1P9MA 4HUMB 1WWAX 1ZT1A 1A7PL 5K9QG 3E1F1 5ICZB 4NWTL 2R4SH 4L4VA 2H32B 5MI0C 4PGEA 3D85B 1EGJH 5T33L 2GUOA 4H1LG 3QUMB 1X6LA 3MLVH 1UA6H 4Z6AT 4UDUA 4S10A 1QNZL 1BVKB 4AYFA 3DNKA 3O3DA 1L0QA 4U0RC 1G6RH 5H37G 5F1IB 3ZTNH 2GK0A 3BDYL 4HMCA 5GS2H 1JHTA 4K9EC 1W72B 3NPSB 1HYSC 1FFPA 1QPXA 4WWID 5DR5L 2XICA 2Y07L 5CD5C 3L9RB 1U8MA 3FCTB 1JTPA 3U0WL 2WBJB 5BS0A 2I5YH 4LLMA 3W5MA 5SWZA 3TIDA 1NC4A 2VYRE 4BUHA 1TQCC 4Y5VA 3ULVH 1SMOA 2OL3A 5TGBB 4KHXL 5CBAA 4F57L 4OLZH 1I8MB 5DRXA 3QDJB 2P46B 5HXMA 4LOUC 1ZOXA 2WNGA 4LMQE 3WHE0 1N8ZA 2E9IA 5EBWA 3PP3K 5C09B 1G9MC 5GIRB 3LQAC 4TUOB 4FQ1H 4L3CA 1I3RA 3GKZA 5IKCA 1HCVA 3B3IB 1CDUA 3MLUL 2J5LC 2KL6A 3FB8B 4UAOB 3RKPA 4XWGL 5FGRA 3LKQA 2BOBB 5HI5C 5IVXF 5JW3L 4G8FB 5E2UL 3QDAA 1QSEB 4H8WC 3RRQA 3VFGH 2IFFH 4HQQH 5F96L 3NBNA 5E56A 5ECJE 2VZ3A 2JCCF 1FNSH 5I66B 1P6FA 2JKXA 1YPZE 4LOUD 4Y4FA 5E6ZA 4JFPA 5EO1A 1HXMB 2EKSA 5ELIA 4KZDL 5I1JH 2J8UB 1CXIA 4RX4D 1DUZB 3R06A 4H20L 1G9MH 2DLIA 3TESA 3MFFB 4LIQE 1KC5H 2Y5TA 4JDVA 5HDQL 3K1DA 4LPTA 1UVQA 2WUCL 4X0KB 4LSTH 2P5WE 4BUGA 5DRZA 1YMHB 1KXTB 1WT5A 3ZHKA 3CFCH 3SDDB 1ORQA 1T3FA 4UB0L 1OF2A 3GSUA 4UNVA 2I60H 2XPGA 2Z8VC 3DECA 5CEZD 4AG4H 5B38A 4IRZL 4QRPD 2IQ9L 3ISWA 4PB9H 3U7YH 2LU3A 1X5LA 3BD4A 4K55A 5EU5B 3KNBA 5BV7H 3EO9H 2NTFB 5C9KA 3ULUH 2VZUA 5C0IA 3E6FA 1M71A 1C5BL 1M6OA 4OLUL 3OAZK 5GS3A 4D9RD 1I3UA 2AEQL 2K9UA 5HYIA 1VFAA 4WUKL 3DV6B 3HRZB 4L4VD 4HFWA 1OP5H 4KTEH 5CZXD 3NOIA 3L3IA 1WGOA 3O9WA 3VG0H 1QBLH 4J4PC 2O61A 2E8YA 4YR6A 3DO3A 4KRMB 2Z35B 3U30B 3C5ZA 4PTTB 2HVJA 3WBDA 1RMFH 1K3IA 1KB5A 2VIRA 1VB9A 2BVQA 1D5MA 2OM5A 5DF0A 5JMOC 4FQXC 4PGCA 4XB8A 3BE1L 1B3JA 2NW3B 5F88B 5C8JB 5HYEA 4N5UA 3U9UA 5D2NC 3V5DB 1Q8MA 2FLBT 3ZMRA 4ENED 4BFEA 4GRMB 3BAEL 4OSUH 3H7BB 3HNVL 2DBLH 3EGSB 4XCEA 5IB2B 2DQJL 2I27N 3C5ZC 4PRDB 2FWOB 4TRPL 3VH8A 3VMOA 1ZV5A 3QUXC 4P2QD 3GIZH 4QHLA 2XV6B 1MHPL 4CVWA 3NVQA 1TZHB 2XQYK 4RFNC 1Y6MR 5JUEL 3FJTA 4XAKD 4LGRB 1B0RB 1WICA 3GSVA 3ZTNL 1DQLH 1P7HL 1WBXB 2DIJA 1RU9H 5TH2B 5IHBA 4JFHD 4Z7VF 1VGKA 4NO2A 1P4LA 4O2EA 2VDQL 5EO9B 3HI5L 2NCMA 2QV2A 1E4KC 1F4WL 4NZRH 4DOHE 3M1BB 2D7NA 2XWTA 2XA8L 5GHWH 5IHLB 2EDDA 3D3VA 1KPUB 1Y18B 3EOBA 3UZVB 3DGCR 3RGVD 3IXAB 4ZODA 1DBJL 4M1DL 2BHZA 3TZVC 2DLFH 5CZVL 1OGAD 1MCWM 1ACZA 1LO4H 2C5DC 2LVCA 1YN7B 3QQ3B 4LPCA 5DJAB 4OKDA 2NY5H 1NGXB 5C0CE 5DMGC 1Y0LB 5CMAB 1DVFC 1G6RB 4M03A 4PRHE 3GZKA 5IROA 3MRBA 1A02N 4XRCA 3N06B 1JGLL 3F7QA 5DGRA 1FL3A 5FYJU 4WNQB 5EN2B 1PEZA 4JFXB 4MAUL 3TP4A 4BZ1H 4EN3C 1MEXH 2ZUTA 5C71A 1JRHI 3CPLA 2BDNL 2IMNA 3LQAH 4I2XB 3U7WL 3KPPA 3A6OA 5F9OH 2QQLL 1JPFB 3BE1H 3RZCB 3IDUA 3QRGL 5HDLA 5CEXA 5I8OL 5L2KD 5HVGB 4PJEB 4TULH 5I15L 2EH8L 1H3TA 1MWAA 3EHBD 1ZHNB 1HSAB 2X4PB 4JCMA 2PW2B 2WANA 4N0CD 4UZGA 1U36A 3QEGL 1V5JA 2RHEA 1YQ2A 2AK4D 1CD1B 4BQ9A 4H20H 3B43A 4JFEA 4X4MA 3QPQC 3GB7A 1JPGA 3NCFB 3QFDA 1FHGA 1S7SA 1IC5H 5IK3B 4FXKB 5I19H 2VN7A 5I1HH 1J8HA 4C4KT 5ILTH 3EZ8A 3HNTH 5M94B 1LO3H 1GL4B 2HTKC 5DJYB 3WFBL 3L5WA 3RNQA 3PABA 2DOCA 3BZFA 3NCYP 3WIFA 3CMOL 4KTEL 1A1OB 1MHHB 1C08A 4KI5C 3GM8A 2AEPH 4JN2B 5GGTH 1JYNA 2WINA 5C0BE 1BQLH 5F7WC 4WI9A 5HPMA 3H42H 1I7ZB 3QFJE 5DJ8A 4Z7UE 3AB0B 2H1PH 1MFBL 2AI0H 4YFLF 3QXVA 1FGNL 3G9AB 3UTTB 4PJEA 4XVSH 1T0NA 5DUBB 1U8OB 3CFBA 2AJVH 3GBMH 3K4AA 3IVKA 1QZ1A 3R4DA 1HINH 3JSSA 2Q7NA 1GXEA 4EIGB 2PO6C 1JYVA 1MFAL 3ES6B 2NW2B 5B39G 1F90H 3QA3A 5CSZA 1JGUH 1A4KA 1FE8H 1A6UL 2CKBA 1U8HA 4MNQE 5D7KD 1RZFH 3L95B 5DUPH 3QDMB 5F7NC 2CXKA 1I7RB 2XG4A 1KEGL 1NCUA 1Q72H 2XTJE 4X6EA 2GJ6B 2NYYD 5F1KC 4DGVL 5KG9A 3QIUB 1G7IA 1KN4H 3LSOB 3L5XH 5IGXL 5EOQL 2I9LA 2F58H 3JWNC 5JQ6H 3CFEA 1U6AH 3LEVH 1RJYA 4JKLA 1KENH 1FNHA 3B9DA 2R23B 3QRGH 1CLOL 4POYA 3VXUD 4P3CL 2BSSA 3VFTB 3M8OH 3MLSH 1N59B 3ZL4H 5F7YC 1IM3B 3HMWH 3JTSA 5I1GL 3V6FA 5FOBA 5MEQA 3WJLA 3K8LA 1RZ8A 1YEGL 2IQ9H 3U7YL 4ODBD 3TO2B 4G8GD 4LQ1A 4ZUWA 1RIHH 5HGBB 3MODH 5DLMH 3WMSA 4HHAA 1KCRH 2ZCLH 4JFFE 4LGPB 3RIFK 1HHJA 3C5SA 3QIWB 1SBBA 3FQTB 2XWJA 3KLHC 2LV4A 2DMBA 1VPOL 1G0YR 5HGHB 1JZ4A 5I1IL 4KKCC 5GQBA 3ELAT 2UWEE 1CXEA 3H3BC 3SEPA 4NCC1 4R3SB 2H2PC 2EDNA 3MRMB 4PB0H 3KYOB 4MA7H 1FAIL 4NQVB 4OV5B 1N5YH 2P8PB 2XN9D 5K33A 5J06A 4NRZB 2GSGA 3C6SB 4AL8L 2XY1A 3DTXB 3KPNB 1MI5D 3NIDF 3VXSA 5FIEA 4DUVA 1C7TA 1FCCA 5E2VH 5TE6L 3PG2A 5T3XE 3RQ3A 1CGTA 3MRCA 3RU8L 1PZ5A 1ADQL 1B0RA 1FVDB 5IBUB 5DJ6A 1TJIL 3DGGA 4DVBA 1AR2A 3B2VH 5IF0A 3BSZL 4EOWH 2VDOL 2R2HB 5FKPA 2ORBL 4PB0L 3SDCD 4HKXB 4BH7B 4JVWA 4JM2A 5IM7A 2WK2A 4WI8A 5FYKH 4LEXH 4GMSH 4CU6A 4Z95L 5J11C 3MLXH 1JPSH 5DMKB 4WHYH 2NY5C 4PJ5A 2Y06H 3RVUC 2CDGB 3SCMD 4MD5B 4N0CC 3CDGA 5CP7B 5CBEA 1VKXA 2C1OA 4F57H 3PWVA 4PJEF 3F5WA 1U3HC 3ROLA 5EA0L 1T5WB 3WV0A 4O9HH 2AJZB 4PJGF 4JFDA 2YUWA 2ZKHH 5DC9B 3S36L 5DQ9A 2DI8A 2FBJH 4OV5A 3KYMB 1IM9A 3TNNB 5GJSH 5JXED 1NCBH 3O3AB 1P7QA 1U41A 3VFRA 3KNBB 4MDIB 3MLSL 4N90E 4OFIA 5L7XL 1RJZA 3N1GC 3WNNA 2YD2A 2J8UA 4PLJD 2FR4B 1P1ZA 5IWLA 2XTJB 4LSRH 4NO0A 4AMKH 4OAWA 1AXTH 5GZND 3MZGB 4M7JL 1EMTH 2HG5A 1NC2A 3KDMB 4ZSOE 1S7XB 2AAVA 3BH9B 2YZ1A 2ZSWA 3ARQA 4KJQC 4MA3B 1J0IA 4O2EB 3CFDB 4MDJB 3QI9A 5HI4D 3SDXB 2ED7A 5JA8B 1MF2H 3N9GL 2VXTL 4MXVE 5GJSL 1J88A 4PJXF 4LK4A 4XNUH 5HTSA 4XC3H 2JLLA 3BPNB 4HBCH 1AHWA 5F3HA 4K7FB 4GRLB 43CAB 5FDYA 3SDXF 1KN2H 2JE8A 4PIRF 3JWDC 3ZKSD 5HYSG 4Z18A 5J3HC 4IIQC 4AG4L 2WAHA 5INDA 5DJDB 4XVSL 3RX8A 1S9KC 3TA3D 5KG9B 5KAQF 1S7XA 4PP2A 5I9QB 3MOBH 5EIQA 1WVZA 4KUCD 5LGHL 2YD7A 1UM6H 4FP8H 5TE7L 4KMQA 1ZLWK 3DX9B 3V6ZA 3QO1A 4NQSB 3P4OB 5IVZA 1EUTA 2M2DA 4UBDD 3RDTC 4CAGA 1QRNB 1I85A 3HI6H 3PHQA 5DK2A 5F6HI 1CL7H 5FGCB 3WFDH 1WCBB 4UQ3B 1X4YA 1E27B 1F02I 4LAJH 4UV7L 2X44D 5IFHL 3RU8H 4ETQA 5CCKH 3F7PC 4P4KA 4GW4B 2BOBA 3SDAC 4PJ9A 4IDJL 1IC5L 4DK3A 3MJ9A 4QHKI 1NDMA 4Q6IC 4XCNA 3U79A 3NCYS 1L0YA 4ODUA 1E28B 4K07A 3MNVA 1QPPA 1FZKB 1T21A 1S7WB 1N3NA 2UVEA 4M1DH 2WWKO 5K59E 1AGFA 4DEPC 5F8RC 4DQOL 2DQFB 3WNLA 4U6HB 4MQSB 1I8KB 5EUOB 2YKLL 1HZHL 4WU7B 4H0HB 1J86A 3KPSD 3H0TB 4CDHA 3HMXL 5FGBC 2W9DH 2ED8A 1N0XH 3GIZL 4TULL 4G9DA 4PJDA 2NR6D 2X4TA 4OZIA 4JLRB 5DI8A 5FHAL 3FOLA 4YPGB 4JZJC 4Y1AD 3DARA 1CS6A 4I3RL 5J6HA 1KTRL 3S36H 2Z0BA 2XTLA 2ADFH 3GSOA 1JZ6A 4L3ED 1RK0A 3IJSB 1A22B 2IPTL 4JY6A 3F12A 4J7RA 1YYML 5C0CB 3VW3H 3V2AR 5DD5L 3DRTA 5A3ID 5J7CC 2QL1A 1FO0B 1MCKA 4HF5L 2W0KA 4JO3L 2G9HB 2EO9A 3U0TA 4G8GB 1RUQH 1R3LA 2FX8L 3D85A 5CJ5A 4Y4KD 3ULVE 1U8JA 35C8L 3Q5YA 3CPLB 3BD5A 4I0CC 4NDMB 4KFZC 3IU4H 4MB3A 3IDYC 4I2XE 5EU6D 1YEIH 2FYYB 2Y6SD 5D96B 4D3CL 3G5VB 1JTTA 4LL9A 3H9YA 1TJIH 5KSBE 5LVEA 1JWMA 5DJ2B 5C6TH 1Y6NR 3CK0L 4KTYA 3A6CL 5AUMB 1GAFL 2HT2D 3EOTL 4L8CB 5I17B 5I30H 4FQQA 4LSQH 1N26A 3FQWB 1B2WL 4IRJC 1H3UA 4GRLA 1AHWC 3GEWB 43CAA 2VQUA 4HH8A 2I07B 4DGIL 5GGVH 1XIWD 4JB9L 2PF6A 4EUPA 3O3EA 5IQ9A 3JUZA 5CJOL 4F2MA 4HIJA 4RZCA 3L3OB 1QFOA 4KMTH 3FTGB 35C8H 1UEYA 1MUJA 3IDGB 2J88L 2ICWI 4P3WA 2EDFA 3CLFL 1NC2B 5FA3A 3VCLB 1AE6H 1PYWB 1A3QA 2D0GA 5C0FA 3MJ9H 3O4LB 3CX5J 5KSUA 2A6KB 3DVIA 5D2LA 2DQTL 2CSPA 3O3BA 1PG7W 4PJ5B 4V1DD 1EH9A 1UZ8B 5E8DH 3P11L 3FCTA 4YHPB 4WRLA 3L5IA 2IF7A 4NFCA 4IRZH 2MWCA 2DMCA 1FVEA 4RQQB 2EKJA 3FFCE 2J88H 3IDMB 4R7NA 1R3LB 2GEEA 3O2DA 1BGXL 3KYNB 4L8SA 5B3NA 3CJJA 1FBIL 4OCWH 5ICZA 5FO8A 1GCFA 3C09C 4DFIA 4NHCL 5FYLL 5HGGS 1N7MH 1JZ3A 4AIOA 3O2VH 4J2XA 3JV6B 3PQYA 3SKMA 2VL5B 3RY6C 4CKVX 4OZIF 1AGBB 3HE6D 5L6YL 1TITA 3F7YB 1CD9B 1RVFH 5A2KH 5DLML 2IEPA 4XP5H 5ESVA 4J3XA 4Y5YC 5FUCC 4JPVL 5BV7L 4NZTL 5JXAL 2G5RA 1T1ZB 2VIRB 3VXSB 3DBXA 5ITFA 4JO3H 3T0AA 4KI1A 4ZUVB 1JF5A 3BT2L 1EJ6A 4RAHA 4UT7L 2F8OA 4IMKC 1PW3A 3BWAB 1OGAE 4XZUB 5J6HB 1ZXQA 1OP3H 1AGDA 2FJHB 4EN3A 3EJZD 4HDIA 3SO3C 4YZFF 1T5XA 2CIKB 3E2HC 2ICES 4XNYH 3W0WB 4EJ1C 4KZEL 3AS0A 3T1FA 1FORH 2OJZL 1G9NL 5F9JA 1ZEAH 3SQOH 1L7TL 2VE6B 4AQOA 4C59B 1RVFL 3KXFE 1OL0A 3NZ8A 4Y19B 4M7KH 3ALPA 1FCGA 3ARTA 5I1JL 3BWUC 4EDWL 5ITBH 1FNLA 4N8VG 3V6OE 1MF2L 2IPKA 3O8XC 2NX5D 2PO6B 5DMJB 4LNRB 1MNUL 2QHLA 3LKSA 3GMRA 3WE6A 4MJIE 5HHOD 2VDKH 5MEOA 1AQKL 3ARSA 3HZYB 5E1HB 1VGEH 3KJ4B 2O26U 4KXZH 3HUJA 5JZ7D 1IBGH 1YEFL 5T3ZE 2YPKA 4RMWA 1A2YA 3V79C 2F54A 4YEEA 1S3KH 1WF5A 2V6HA 3ES6A 3JTTA 1FDLH 3LN9A 1A7QH 5T1LB 1I1YA 3PJSB 5CCKL 5DD6B 3QUXD 2X09A 3EOAB 3G6DH 4ZAKD 1KEML 1EEYB 3GMOA 4F33B 4I0KA 4WW2A 1ZE3C 3IF1B 4NFDA 3SHSA 1O5DT 5CUSH 1S7VA 2ZSWB 4FFZH 2WQRA 1RPQA 1ZA3A 3UTSD 1TJGL 4O00A 3LKPB 3OL2A 3ZDYF 5BCAA 1KB5L 2NX5B 1SHMA 2EDQA 2PO6D 3QT2A 4PPTA 5MERA 1I3RB 5FUOH 5LCVL 1UH2A 2AABL 4QRPB 4MA8H 4JY4B 5T1DH 1Q9LA 1IFHL 3OR7B 3MCLL 2BY2A 5DD0L 1KIUA 1S7SB 4MMZC 1RULL 4DGIH 4HBCL 1QBLL 4OLVL 4GSDL 1LEGB 5EZLB 2DIBA 2AGJH 5E8NB 2CJUH 1PKQE 3CMGA 1EAPA 4HIHB 5GRWA 4MLSA 5JIHA 3RIAK 1AXSA 4PD4K 2A83A 4K3EL 2BY3A 4HZLB 4LCWD 2BSRA 2ID5A 1ZT7A 4M93B 1XGUB 4PJBE 2IAMA 2Z92B 1BVLB 3RAJH 4UU9B 3ZE1E 3GK8L 4RBPK 4MXVF 8FABA 3BZDA 3VFOB 3UJTL 1C12B 3K81A 4PJ5E 4WV1C 1T2JA 4WU7A 1U3HA 3OAUL 3U7AA 3V4UL 1CD8A 1IAKA 5FF6B 1E0OB 4CGTA 1F4HA 3QO0A 1QP1A 2BSTB 3QNYB 3I2CH 4AENA 1MJUH 1FZKA 1HEZB 1YEJL 4WFFE 1LO0H 2YRLA 1CE1L 4KK9C 4APQB 3I50L 2DQCH 5HHMD 1JZ8A 3P77A 3RVWC 4RGND 3QEUB 3QULB 5E4IA 4M48L 4NKIH 2AJYL 4LKXA 1D5BB 4OD1H 4QRTB 1NGXA 3OZ9L 4JB9H 1ZLUH 5CHNA 3T0EA 5DHVA 1EFXA 4RFOH 2SEBB 3FQNB 3CSYA 4KJWD 5T1MA 4HULB 1I1FA 5FB8B 3OJDA 4HV8B 3RKDC 3QXWA 3DYPA 3BP6B 1DCLA 2APBA 1H5BA 5FYKD 4JQIL 2YXFA 5K9OB 1JUFA 1A6WH 1PX3A 4OCSL 4O4YL 4MJ5B 4PG2C 4N8CL 5IG7B 1NFIA 3BGFC 1UA6L 3I3BA 4HPYH 3TJEL 4M4PA 1X5GA 1F4AA 3D2UD 5DVOA 1NMBL 4J3SA 2PETA 4K94L 3GGWA 1ZS8A 1V3LA 1BFVL 3TCXA 2ZOLB 4D0BA 4DKEH 2YA1A 3T4YA 1IGML 3VXRE 2F74A 3C2SA 1S7QB 5EZJA 1X7QB 3H2WA 1U58A 3GJEA 5FV1L 4HKJB 3U0PB 4BM7A 3DRQB 2A9MH 2AKRA 1G7JA 4IJ3C 4WEBL 3WO4B 2A73A 3B2UD 5BVPH 5CSBA 3TZVB 1T2XA 2AJVL 1R3IL 1Q9OB 2NZ9D 4YNYA 5JO5A 2I9LB 2CDFA 3UO1H 4MMXC 3VH8B 1HN1A 2ZCKH 4OM1H 3HLAB 3WHE1 3HAEH 3WSQL 2YBRB 5SWSD 2CRZA 1MH5A 1DE4A 1SJEA 2PKDA 1QLFB 4XP6H 1S5IL 4R90H 1MWAL 3B9AA 1NL0L 5A2LH 3JXAA 3MLZH 1V7NL 4LSVH 3FB5B 2N4IA 4DAGH 4YXHH 3GSXA 2BVPB 3ROOA 4PY8J 1I3GL 4D94A 3SBWC 5E94B 2VLKB 2ESVB 4QO1A 3UTSB 2CMRH 3L7EB 3X11A 3SDDD 3VG9B 1FNFA 1CI5A 1I8LC 2IAMD 3AMLA 3C8KB 1IZKA 2Y5EA 3QUZD 1KN4L 3QA3B 5CSZB 3PIQA 3S4SG 3WUWG 2G75A 3SJVA 1PSKH 2KZWA 4OBSA 1RI8A 2B2XH 4PLKC 5GRZA 1U3JA 3MV11 5IEKB 3INUH 3LB6D 2V2XA 5FUCE 5C0RH 1ORSB 4OLYL 5E08L 3WSQH 1MQKH 2BSRB 3VFWB 1OAYL 3GMNA 4R2GB 2DBLL 1QFWL 3V0WL 5IB5A 1B4JH 1MCJA 1D5ZA 4YZFE 4OLZL 4L4VB 3EJZC 4GUPA 5FO9A 3ARDB 3QO0B 2IAMC 1ZS8B 3H42L 4Z77A 4ZS7L 3HE7D 3UC0L 5CIPH 3RNQB 3UROR 1RZJH 4GRWB 2ZJSL 4FN0A 5C0BB 1BPVA 5E5UB 3W9DA 4QTIL 5C6TL 1OGTA 3F7YA 3VI4E 3X3FH 1KIPA 3QPXL 1C8PA 1FN4A 3PWLA 1SYSB 2GTZA 4X5LA 3I75A 4S1SH 4RGNB 3RVWD 3IFNH 1Q72L 1Z9MA 5A1AA 3QXAB 3O0RL 2WLZA 4CW1B 4V2CB 2VJXA 4XMKL 3I6KB 4QTHA 1YPZF 1X5FA 4QRTA 1OM3L 1WFTA 3P9MA 1JI2A 3IDJB 3WN5A 2FHBA 2HWZH 4ZFGH 2VDQH 3MGOA 3BZ4A 4IOIB 2VXSL 1L7TH 1T1WB 2RIKA 4HKBA 4P5TA 4JRXD 3RL1A 3QWQB 5GGSB 1ZGLB 1C5CL 3D18A 3B8YA 4I9WE 3HE7B 4XWOD 3BPOB 4XX1G 5C0BD 2X4RB 3QIBD 4XBEL 3UAJD 1PLGH 1JPSL 2AJXH 5TFSH 1NCAL 1DLFH 3VXUA 1QQDB 2IALB 2HT4C 3RHWK 3WLBA 1T0PB 4MAUH 4OBRA 4L3EB 2ZCLL 5DFVC 3TC9A 1TPXC 3ET9F 3OWEA 1KCVH 5E9DD 1RFDL 3B83A 4C56B 2UWEA 4KXZI 3NA9H 3ARBD 2DYPD 4G8GE 1HIML 5DRWA 3PL6A 2P5WA 3GK8H 4LVOC 3KS0J 5DJ0B 5IMLB 5HHPB 4OCLC 2J6EA 2CK2A 5GS1B 2ATKA 4MQ7A 4LPXA 2BNRB 1PBYA 4ELKB 2R0ZL 1GGIL 4YWGH 1A6ZA 2JCCB 5C0AE 5EU3A 3UTOA 5T1LD 5T3XH 1WC7B 3ALWA 4U1SA 1FL6A 1QBBA 1ZVSB 2W9DL 1CBVH 5D7LD 4AMKL 1BBJA 4TSBL 4P2YA 5C92A 1FBIH 3SJVD 1ND0B 1IEHA 5D1QB 4OUUB 1J0KA 2XA8H 5GHWL 4EI5D 3JVGA 5LGJB 5C08A 4GAGH 1SJHA 4L3AA 2BX5A 2X4QA 5D5ME 1JL8A 3QRFM 1D5IH 2GK2A 5DDHA 2Q76B 4WFHD 4NSKB 3I2CL 1CFNB 3FAWA 4JFZL 4C58B 2FJHA 4HKZB 1BVKA 1UZ6F 3IJYB 3F6IA 4H8WH 5E9DB 1NANI 5E8DL 1KCSH 2WWMD 3ARBB 3T2QA 2NXZC 4N0YH 1YEGH 4P4RA 5JOPE 1FH5H 4M00A 1ZT1B 1A4JA 3SDYH 4OFYD 1REIA 4Y5YB 1S9YB 2NY0C 3DTXA 1SJHB 4JM2D 5E6ID 2VAJA 4UTBH 2YD1A 2B39A 1NMBH 4U33A 4EUPG 4Z7WF 4CMMB 4KKNA 3MJ8B 1JGVL 2M26A 3TZVD 3K7UA 1AGBA 2PCPB 4PJ5D 3FONB 3WE6B 3VRIA 1QR1B 4O4YH 4MA1B 4Z7OE 4ODTH 3D39E 3ESVF 4LEOA 4J3VA 5F71A 3TBWA 3IGAB 3GJFA 1AQKH 2G2RA 3O4LE 1JNJA 4YHYC 4I4WB 4QNPF 4LCIL 5HY9B 2GJ6E 5ACMA 1AD9A 1XGPB 5C08B 4GAYA 4P46B 1IM9D 1NCWH 2BNRE 1KPRA 1SMAA 5DEFB 1GAFH 2XXMB 3CVHB 3B9EA 1XZ0B 4M6OH 4JFHE 4I48A 4M9OA 3RJQB 1NLBH 1KLGA 2E6JA 4HDIB 5IVOA 3VI3F 4PJFB 5C2UB 4P4KB 5F7EL 3OGCB 3VDBA 1ETZB 4AM0A 5CUSL 4XNQB 5E99H 4U1HB 1YEJH 3SGDH 2HJLB 1N6QH 3LEYL 3GBNL 1XF4B 1KG0B 3KJ4C 2MCPH 1XFPA 1CGUA 1OAKL 3DX9A 1U8LA 4R8WH 3HS0B 4U1LB 3DETD 1RZJL 3Q6FB 1U8QA 3UTZB 3T0DA 1V3MA 4TRPH 5E9DA 2YS4A 4NNXB 1H0DB 4NJ9L 3LKOB 1S9XB 2HJFB 2BK8A 2DYPA 4PG2A 1QKZH 4DKFL 1GOGA 1KIPB 1DVFB 4X6BA 5DT1L 4B41A 3EDKA 1OGTB 2HRPL 4H0GA 4K71B 4PJGA 4QWWD 3GO1H 5SWZD 4RNRA 5L2JB 1FP5A 1GC1H 3L3OA 2W0LA 4PRHD 4HS8H 3QFJB 1FIGL 3TA3A 2CUIA 2C4XA 4JKMA 1A7BA 4P5TC 2CPCA 4Y4FC 2AQ3A 5D93B 2DM7A 4H26B 3LN5A 2HT2C 5D7JB 3RZCC 5C7XL 3T0EC 4XP4H 1TZHA 4NJAH 4K7PH 1U42A 4ESKA 4NUJB 2G5BB 4AH2A 4Q0XL 1KEGH 2GAZB 1NCDL 1RZKH 1CIDA 3PDOA 5IEKA 1PX4A 2HG5B 2YSSA 4F7EB 4YBQD 2VAAA 4M5YH 5MP6L 3W11C 4R0LA 4WI3A 1D9KB 1GGBH 3PL6B 5E0QA 4U6HA 4PJ9D 1A9BA 2AK1L 3BT2H 5D1ZD 4LLDA 5D70L 3FRUB 3NPSC 2HTLC 2XKSA 1LP9F 1N8ZB 3BMWA 2IALA 3WLBB 5C2BL 3TVMD 4D0CA 4OZHB 1RFDH 3S35X 4ZOEA 4XP5L 5LG1A 2XT1B 2F9BT 4X4ME 5H8DA 3KPSA 2XZQH 2ERJC 1AIFA 4WJ5B 1TIUA 3LMJL 3MV9A 5D6CB 4RWYL 5HHPA 4DTGL 1BJ1J 4ZQKA 1EPFA 4YGVB 4RMSA 1MREL 3NCEB 5IQ9B 5TQ2L 2XNAA 1AFVL 3DJ9A 5FGBA 1LO4L 4KI5F 1D5IL 3QDJE 4ODWA 3V4PH 4YXLH 3FQRA 1TZIA 3HRZA 4RMRA 4YPJA 5FAAA 2JJWA 4FZEH 3SE9H 3Q5OA 4H88L 5C70A 1R5IB 2XN9E 3QP3A 2I24N 3I6KA 3WO3B 1I8KA 3ARED 2CGRL 2R1WB 4YEFA 1HI6B 3BQUA 3LN5B 4TVPH 2N7AA 1VCAA 2B0SL 2PTTA 4M43L 3SDCB 1ZLUK 2JIXD 5D6DA 2CRYA 4J1UA 5DT1H 1Q0XL 2GJJA 1QSZA 4LPYA 3NA9L 3ZT6A 4MDJA 5AYUL 1FO0H 3VXRB 1FG2B 1XR8A 1IVLA 4NQVA 4HEME 3DRTB 5ICXB 3SDXE 4YAQB 5GS0D 3SGKC 3VFVB 3HE6C 2NY4B 1OD9A 1X5AA 1AHWB 2XFXA 2VXVL 2W0PA 1SJEB 2J4WL 5AAWA 3P11H 1HI6A 4HWUA 2AJYH 1ITCA 1BX2A 1RJZB 5BMFH 5BW7C 1XIWA 2HJLA 4L1DA 4UNUA 2XQBH 3RX7A 3FKUS 3BI9X 2H1PL 1ACYH 4Z7VE 3P9LB 4MS8D 4XBPA 3U0WH 2ZUWA 2ZUVA 5ALBL 5FHAH 2F8VA 2PTUA 2Z91B 3IJHA 4JKWA 2Q6WA 4W70A 4TTDD 5TH2A 5FO9B 4X4XA 4BFIA 4E5XA 1AO7A 3K46A 1J0YA 5K9KA 1U58B 1GRWA 3PF2A 1Q0YL 4H1LA 3V0VB 2JJVA 4F9LC 1IAIH 3O6FB 2W92A 5BZDB 5EBWB 3M17B 4YHNB 3IU4L 3DV4B 4HC1A 1CICD 4JVUA 3TO4B 3OB8A 4K3EH 4PJ8C 2BOCB 1JNHA 4QWWC 3HI1A 4B7IA 5D71H 3CDFA 2AV7A 3HPJA 5E2VL 5TE6H 3A6CH 4R4FL 4RAVB 4NCC2 2VH5L 1MCBA 4HGWB 2JELH 1T1YB 2OI9C 4LLDB 3FQRB 2ARJQ 3ZKMD 5LAXA 4F3FA 5IFHH 4PJXB 3E8UH 5DURB 3TBSA 4LBEA 1U8IB 5F1SA 3LHPH 4QXGH 1F3JA 1HDMB 3CNKA 1F13A 4PLJC 3KPSB 1KTLB 1FYTA 5EZLA 5DUBA 4Y2OA 4KJYA 4DW2L 2H9GA 2HLAA 4WU5B 1PJ9A 4R6UA 4MCYB 4JFOA 3QEUA 3QULA 1EFQA 4MD5A 4X7DC 3VRLE 1NGPL 5HPMB 3UYPA 1CLZH 1OGAA 1IGCL 4PGEB 1ZHKA 3T2NL 2HRLA 3C5ZB 1XF1A 5MENE 4KHTH 3PV7A 4KK5C 2EDEA 2AS5M 4MGXA 4NKMA 4OF5A 4XVJH 4XP1H 4ZTPL 5FGCE 1NBVL 1FZMA 3MR9B 5E7BA 4I77H 3L7FB 2FZ3A 5DTFB 3VWKC 1LEGA 5CINH 4PJGB 4OI8A 4IMLB 3PDOB 3QIWD 3VFUB 2EXWC 4ONHA 1I9RH 1Z3GH 4XHJD 5IG7A 1I7TB 4TPRH 1P9MC 1K5NB 3QNZB 3QDGA 4DN4L 1OT2A 1EEZB 1BZ7A 2P24B 4EN3D 1NBQA 4KROB 4YHIA 2ENYA 3QDJD 2W65B 4M7JH 4JPIB 1U8PB 3WFDL 3VI4F 2FX8H 3PDGA 1K9TA 1MNUH 4U1MB 4MX7B 2B1AL 3C87A 3FQNA 1A14H 3S35H 5E2JA 3IRPX 3VGAB 2BCKB 3VWKA 4I77L 4MNGA 2ZCKL 2H2PD 4P2RE 3T3ME 3GSNL 4OZ4A 2OBGA 3G08B 1L9MA 1DEEA 1FSKB 3HCVB 3OKNB 4WWKA 1KLUA 3UTPD 1D7FA 5CJXA 3T1WA 3BDBA 2LAAA 4MB4A 2NW2A 5B4MD 3NFPA 5D1ZB 2HN7B 4ZSOB 5DEGB 3CSYB 4LGSB 4WCYH 3AM8C 4J3UA 3FQUA 4XCYA 3GJFK 3EFFA 5BO1H 2W60B 2MMXA 2F8XC 5M95B 3QH3B 3PWPE 5DMYA 3WJJC 2IQAB 4EN3B 3U46B 5CIPB 2DQEH 4P2QA 1G9ML 2DQJH 4V1DB 4YXKL 1CICA 3P73A 1TPXB 4B0MM 1INEH 4HUVA 1U8OA 2VUOA 1SYSA 3TBWB 1U93B 2EO1A 1HHIA 1IAMA 4QEGA 1HE7A 3K74B 2E7HA 5CBAB 5JORB 4PRPE 4HXBL 2PO6A 4GSDH 3MRIB 4YHOL 3QR2A 4OCWL 4XVJL 5I1LA 4YHLH 3ZE0E 3VE0B 2V2TB 4LKCB 1EUUA 2H45A 3D9AH 3U1SL 4JG1L 1KIQA 2ZWLT 4LIQL 3B2UC 1RV6X 4FQ1L 3OAZH 2QQKH 1LO0L 3LRHA 1UM5L 3P73B 5F9OL 5BVJA 5HGDB 1RUKH 3QJFA 2J8OA 3KPTA 4PJIE 4KQ3L 3J8F7 1KSRA 3FO1B 5HHOE 3ZDXF 1AI1H 2W60A 5E2TL 1IGFL 3ZT7A 4K2UL 5CILH 4A6YL 4EOWL 1IARB 2VSDA 1Q0XH 3HAEG 4BQ8A 1NUDA 2A77L 3ZTJH 2FEDC 1U8IA 5GGUA 5FYKL 4M8VA 3G6DL 4C56A 4DUXA 3OMZA 4KI5D 3H9ZA 1L7IL 2Q1EA 2EYTB 5ANMB 1JK8B 2W38A 4JHAL 4A6YA 3MXVL 3VCLA 2FECL 2UUDK 2HN7A 4ZSOA 4V1DE 4WY7H 1J1XL 3KHOA 1X4XA 3KPOB 2O5YL 4X7SH 3L3GA 3UMTA 1F4XL 3DVGB 5IOPA 5D1XB 3ALXA 4IRSB 4YHPA 2BNUB 2HT3D 1AFVH 1IGYA 3MRNA 3RWEB 5JOPD 1T7WA 3VMNA 3L5JA 1BFOB 5L0QC 1MJ8H 1FE8L 5K9KB 5DQJA 1R3IH 3NGBB 4RAVA 3IDMA 4XNZB 1YEDA 5E8EA 2E9WA 2ZCHH 3QQ3A 3RVVC 3MJ7A 4XGZB 1QHOA 3DX8A 1YQVH 3FN0L 1DQLL 1LO2L 4GBXD 3RWJB 3TO4A 3LRGA 1QKZL 4DKFH 2NYYC 4PUBL 3DX6B 1WCQA 4HS3B 4NNPL 2W65A 5GRVL 1P5VA 1YZZA 1ROWA 4M6NL 3ZDZE 4N9GA 1CGWA 4TNVK 3TWCL 3VFUA 4FMKA 1KUMA 1OSPH 1Y6KR 4GLRH 4OKVA 5J12C 4L8CA 1BOYA 1JGEA 2B1HL 5TF1H 3REVA 2B0SH 4LSPL 4PD4J 2D7OA 3UTTE 1FYTB 4X5WA 1P53A 2R4SL 3UP1A 5IBLD 4U1NB 1CLOH 2GTWA 1S9VA 5J1AB 4EUPB 5D8JH 3O6KH 5MP6H 2C4FU 3EO0A 2I5YL 5CD3B 3UTQA 4W6YB 1B90A 2V5RA 2Y9RT 4EDWH 4GRMA 3TBSB 1BIHA 1RULH 3FT2A 5A2JH 1K4DA 5KZCD 2A74B 4XPBH 4NKIL 4YBQC 1SYVA 4R7DA 3ZSTA 1SY6L 1PG7H 1F42A 1UJ3C 2GITB 2AXHA 3TYGL 3DSFL 3MR9A 3C60D 4J8RB 2EYSB 5ADOH 2G60L 3TWCH 1S7RB 3B9KC 1YNLL 4WTWA 4NO0D 3VDCA 4JZJA 3JWOC 5GJTH 4Q58C 2HFFA 1HINL 1S7WA 4OLUH 1MSPA 3QHZH 4EDXA 3GO1L 1J1OL 1NCNA 1XGRB 1ZVSA 5C07E 3CCHA 4U1SB 1IEAA 1PYWA 3UDWC 3O2WL 2Z91A 3IJHB 2Q6WB 1UB5A 2KBGA 1A6VL 1JNHB 5KVFL 1R5IA 4ETQB 1NGQH 4QY8A 3V4VH 4X5XB 2MQ0A 5L6YH 2QQNH 2GQHA 1NAKL 2PYED 1A7QL 5C3TA 6FABH 5I16A 1MHCB 3GM0A 5ACLA 1WCBA 2IG2H 5AZEL 1YNLH 1U6AL 4Y16C 4FTVB 1N3NB 5EDXA 1MH5B 4U6XA 1NCDH 1OB1A 3I85A 4Q0XH 2ARWA 5IMMB 1ORQB 1SJXA 5ILTL 3SO3B 3ETBF 3DVNB 2CO7B 2GHWB 1NLBL 1JV5A 2R56H 1WQVT 4W4OC 1CDIA 4YHLL 4ODTL 1B0GB 4XVTH 3GMPA 3FRPG 3M17A 4YHNA 2A6JA 4MJ6A 4MAYD 3SY0A 2K7PA 4YUEH 1BZ9B 5EORH 2VLRD 1ZT4B 3L6FA 4GKSA 1Q9KB 2GJ6D 1KLFA 5KJRH 4JHWH 3KXFD 1XAUA 1I8LA 3QIUD 2R15A 4C83B 2CKBH 4L4TB 3MV8B 2GCYA 1U8KA 4PJHA 1XGTA 3IETA 3VD5A 5AZ2H 3KG5A 3N85H 1UCTA 6CGTA 5F9WB 4JAMA 3K4ZA 1IZJA 2DQGL 3FMGL 1DN2A 3PWJB 2DN7A 5B4MC 1I7UB 4WW2B 4OTXL 3LQZA 4JG0L 1EEYA 3QAZC 5JXAH 2FL5A 2C9AA 5ID1A 1QFUL 4FOMA 2D03L 4JZNB 3X12B 2OR7A 5F88A 1HCFX 5JHDD 4JPKL 1TCMA 4JANA 4AZ8A 4ZQKB 3ZTJG 1FQ9C 1AO7E 4CVXB 3UBXG 2FIRT 4U1HA 3MXWH 2HH0L 3MLRL 3ARFD 4FABL 3K80A 3CFDA 4ISVB 1KCKA 4OGYH 1LEKB 1CD0A 1TZIB 1LDPL 5JPMB 4U0QB 4O58H 1FGVH 5SWSB 3F5WB 3DUSB 3DX7B 1AKJA 3V7AG 1WBZB 4JR9L 3CCHB 1XZ0A 3H9SB 1X5YA 1S7UA 2X40A 5HVWA 3C9NB 1CR9L 5BS0B 5FV2A 5JXEA 5T1KB 1XGPA 2OXGA 3EDFA 3O3AA 3VFRB 4S1SL 5JPNA 3DV6A 3UPCA 4PRPD 2BNRD 1A21A 3BKCH 2WMPA 3SKJL 2R0KL 3H7LA 5EUOA 3GI9H 3TYFA 4PR5A 4Q6YA 1CXLA 1YN6B 4ZG1A 3S3SA 3MA7B 2ZUUA 3P4OA 5D1QC 5DS8B 1T21B 2IH1A 4FQXB 4GXVH 5KZCB 4P46A 3JWDL 2Y4SA 1RZJC 1UEMA 4EI5A 3ARZA 2BSTA 1Q94A 1EBPA 2KZ1B 2FNBA 4ZAKB 5GGQL 3ULUC 5CEZE 4LCWE 4MCZA 2HJKA 5DFVD 5I76A 2BVPA 3ROOB 2C1OB 2VLJA 5CP7A 5ANMA 2R69H 3NFNA 3FO2A 3ZZ1A 4WWKC 4XPGH 1A9BB 4U7SA 3HG1E 5TDOA 1G7LA 1HXMA 1MLCA 4PJBB 1D3CA 1FIEA 1WIOA 4Y7MA 1R5VB 4WO4B 4U7KA 3QDGE 4ZFFB 4P23C 4POZD 5CJQH 3RTQD 1F4WH 4NZRL 3QPXH 4P2RD 2UVFA 3F8UB 1ES0B 4WW1A 3CDCA 3BUYA 5BRZB 5DHVH 1CDGA 2R1YB 3GRWH 4GKNB 1CFNA 4X8XA 3LEVL 3LN4A 4C83A 2VLLB 3UTQB 4WI5A 5FYLE 4XPFH 1HKLH 4XXDB 5EULV 3OKMB 5GRUL 2DLGA 3UPAA 1A5FL 4HS3A 3CXHJ 2LE9A 1G7MA 3VXQB 3C6SA 5LGKA 2DQDL 3O3UN 4NUGL 1IM9B 2V2TA 4HH9B 4FP8L 4PV9B 1IGCH 4XPHL 4EBQH 4U6VH 4P3DA 4WCYL 4HC1H 1G84A 3LKOA 5L88L 4HEPG 3CAFA 4LNRA 4A6YB 2F5BL 2OL3B 1KIRB 2PW1B 3QG6B 4KAQL 5B8CB 3CVHA 5GRXG 4FFYL 3VWJD 3S34L 2X70B 1H8NA 3MRKA 5EPMA 5DGQA 4G80A 1MAML 1JMZA 3GHEL 1FGNH 3V0WH 3NZ8B 2CR3A 4Y19A 4F15B 4CU8A 4QCIA 4PS4H 1AJ7L 3JTTB 3GJFB 4AM0B 3F62A 3R1GL 4NQCB 3CFEB 2R1XB 4GAJH 3T1FB 4BA8A 1EFXB 3GI9L 4L3EA 3FQWA 5C09E 2NMSA 2HFGH 3EFDL 2J12B 5BRZA 5D71L 3HRPA 4FQHB 4K71C 2W59A 5HYFA 3VFGL 4FFVC 1OTUC 1LO3L 5C9JB 2VWEE 5DJXB 4QOKB 2L7UA 4X7EC 4PRPA 3MJ6A 2AQ1A 2NY1D 5GGSA 4DCQB 2O93L 1TXKA 2AXGA 3BPLB 4OGAC 1ZLVK 2YEZA 3DO7B 2CMRL 2VE6A 4OB5L 4UDTA 5KANI 1XF3B 3R0MA 1YY9D 2ZNWA 1P4BL 3SKNB 1AJ7H 4E0RA 4PJCA 1YYMH 3VW3L 5LBSH 5EBMB 4DAGL 3MGTB 3IAGC 1V7NH 3C09B 1T20A 1JZ7A 3OJMB 1UQSB 4MB5A 4OT1L 1JF1B 4F9LA 3IRZA 3RBSA 3C08L 1VA9A 1JHLH 4JO1H 4PJIA 4YBLC 4HMEA 1KJ3L 2ICWA 5FO8B 3SE3A 3L1OL 5HHOA 1QFUH 3OKEA 3ZSSA 4CADA 5F7MC 3RIAF 1FFRA 3EJYD 1BF8A 1CTOA 3MA7A 5J13C 4ZFOB 2KQNA 1D6VL 3MV9E 4NM8L 2FH8A 4ODXA 2VWEC 4LSTL 3VXNB 1DQMH 5D5MF 3MRIA 2BNQB 1BWWA 1BLNB 1CK0L 3SJVE 3ULVL 3SE8H 3WYRA 2VISA 1BAFH 1A1OA 1MHHA 2E7CA 3VXPA 5E1AA 3AB0C 3C6LA 2ED9A 5T1KA 4YK4B 3LIZH 5LGJA 3C9NA 4M43H 1MRFL 1FC2D 3M8OL 4JFYB 3MV9D 4V1DA 4EEEA 5CEYA 1CE6A 3RWHA 4U3HA 1G6RL 1PVHA 2AW2A 2EDBA 25C8H 4BFBD 5IVXB 4X6DA 2HT3C 3U9PH 2YMXH 3V5HA 1U8HB 1VFMA 3MCKA 1KT2B 1GGYA 1LK3H 3KVQA 4LARH 1DBBL 1DSFH 1A1NB 3RPKA 4RMUA 4G6KH 2YPVL 3MGOB 3HR6A 2XKNA 4TUJB 1BM3H 2DKSA 4NYLB 4E41E 3BP5A 1PKOA 3BQUD 3ZYIA 2XWTB 3LS4L 4OGXL 3MJGX 5B3JF 5I0ZA 2YBRA 1K5NA 1NGQL 4JPKH 1DANU 2YUXA 1A3LH 1YPZA 5IJVB 3I6LE 4EZMA 1QBAA 2DKUA 3NGBC 2AI0L 3LPFA 5FCSH 3L7FA 3HZMB 3AROA 3BXNA 4DKEL 2HKFL 2EZ0C 1XF2A 3MCKB 4K7FA 5C0EA 5DQDH 1NKRA 3B5GA 1MPAL 4G3YL 3HPLB 3QIWC 4WFGD 2CJUL 2DWEA 3OXSB 2EDYA 3BSZH 4N8VB 2A6JB 4JPWH 4KKAC 1CR9H 4R9HA 5JO5B 1QLEH 4IMLA 1Q0YH 1Q9OA 2WWKT 4JY6B 1DEDA 4IEFB 1CXKA 1KB9K 3ESUF 4J6RL 3MV7B 1TZGL 5IMMA 5J12B 5JHLH 4QXUH 4TSAL 1JPTH 1CF8H 4NQXB 1KXQE 4WIQA 4RFOL 1DN0B 4LMQI 1TVHA 1SJVA 3VXOA 1NAML 1JRHH 3NIGE 2EDKA 3UZQA 4P9HL 3GIVA 1J05A 4LPUA 4PJAF 4JO2L 3UDWA 3TFKC 1NKOA 5F70A 1D5MB 4GMTH 4WFEE 3T08A 5B3JE 1X4ZA 4M6NH 4Z95H 2QJDA 4R4ND 3KYAA 1F3JB 3NCCB 5DQDL 5GGTL 3GSOB 3B9KB 1RIHL 4JM4L 3K2UH 3NPZB 1I1FB 5E4EC 5DVLA 1I4FB 4G9DB 5D5MA 4OGAD 1BVZA 2H26B 2VDRL 4YGAB 1JGDA 3FQUB 4XCYB 1CCZA 3D25A 4BFGA 1YY9C 5IBUG 5IBTH 2BOCA 4Z7NE 1LP9B 4PP1D 2FB4L 4X8JA 1LP9E 1BM3L 2P5EA 3NAAL 2D3VA 1L9NA 3LV3B 4OZGF 1IE5A 5HDOA 5J1AA 3MREB 4U1NA 2ESVA 2R0LL 4G6JH 1C1EH 3LCYA 4M7LL 5I1CL 4NN6B 2YN3A 1Y0LA 4XWOC 3DWTA 4MA1C 4FQXD 3W2DH 4TUKL 1ZTXL 2VB5A 4ZPTA 4D0CB 2D0HA 1W8NA 2NQCA 4OFVA 4HLZH 4JO4H 3ARUA 4HK3N 1FIGH 5EO0A 3GJFH 2Y5TB 2DWDB 2VDNH 2GJZA 2HA1A 3L1OH 1I3VA 3AU1B 4G6AD 4G5ZH 2IFFL 4OD2A 4UT7H 2CLVA 3D69A 3MRHA 5ESQB 4QT5B 4FFZL 1AH1A 1A6VH 3FQTA 5CGYC 3CLEH 1INDH 1OW0C 3SDDA 4OZFB 3WXWL 1KBGH 1X9QA 1WAAF 5DJCB 4K2UH 5CILL 4A6YH 3CD4A 4P4KC 1CFSA 4YE4L 1B9ZA 4QHUB 1NCCH 3WL9A 1MIEL 2FZ3B 5DTFA 4Y5XC 4KQ3H 2VDLH 4MJ4A 1S8DB 4JDVB 2QQQA 5FOBB 3VD9A 1X7QA 4X9GA 1IGIL 5BW7A 2ZZUT 1WZ1H 3IYLW 2EC9U 4HG4J 4NKOB 1G7HB 2Z31D 3QNYA 5GRYA 2GW5A 3KR3H 3MBXL 1F8TL 2UV3A 2X7LA 3S37L 5J57B 4X0KA 2WBWB 4WTZG 4M61A 5I74B 3TPUA 3HNSH 4RBPH 4FA8A 4I18C 5JOEA 3OKDA 1FGVL 1P4BH 1EO7A 2V7HA 4HUNB 3HFMH 4AIXA 2Q3ZA 3BMVA 1FFNA 1OP5K 5GGSY 3ZYJA 3SDAB 1SEBB 2OYPA 2NW3A 1U8MB 2JJUA 1QG3A 3SE3C 4LLVB 1IGTB 3HPJB 3OGOE 3OGCA 4MCZB 1I9JH 1FRGL 3KYKL 5J9PB 3IT8D 2P1YA 4JVPA 4JFDB 1ED3B 3AXLA 4HF5H 3BO8B 1GIGL 1T83A 4DVBB 3OB0K 3KLHD 5J56B 3PL6C 1NAMA 1EHAA 2WINB 3IKCB 2IPTH 4ZUVA 2UUDH 2ZUQC 4GS7B 3DYOA 4FQLH 5K9JL 1JIBA 2V5SA 3L9RA 4PB9L 4WW2F 1UENA 1RZKC 3PWPD 1MFCL 4LEOB 1RIVL 2ZOKA 2EYSA 1K2DB 2JK5A 4PJXE 4RX4A 4RNRB 4UQ3A 1WT5C 2H2SC 4JANB 5JW5B 4ORGB 2Z8WC 2XZAL 1FFOB 4KQ4L 5TPWL 4F33A 3RX5A 4TUKH 3RY4A 5I1DB 2ZPKL 4FQCL 2FEEI 2B5IB 1XR9A 3DUSA 1MRCH 3DMMD 5SWSA 1GC1C 1HKLL 4XNMA 2EC9T 4AEIL 4EXPX 1J5OL 5I8OH 3PGDA 2WP3O 3RWCA 1VSCA 2QQLH 4I18A 3GUTA 1MCIA 2OMBA 4OKVB 4QTIH 3HC4L 1SVZA 1KNOA 3V5KB 2BVUA 1TTUA 3WKMH 1VADB 3R8QA 4POUB 5EC1B 4K8RH 3SDCC 3KPMA 4MNQA 2H2SD 2BNQD 4YJZL 3TF7C 2Q86B 3OR6B 1IKFH 4WEMB 2XWBB 4KVNH 3LQZB 4TUOA 1UCBL 4JREB 5I66A 4HIEB 1NBZA 2DD8L 4L9LA 4ZPVB 3GMPB 3VGGA 5IESH 1B0GA 3CLFH 4XRCB 1N2RA 5K59F 3IF1A 2AXFB 3QUZA 1EO5A 5KSUB 1NEUA 4LAQL 3ARXA 4YBHA 1TCRA 5IHZB 1KFAH 4XNZC 3CH1A 1HQRA 3IS0X 2X2YA 5EIIA 1OB1B 3I3EA 1WWCA 5A2FA 4L8BA 3IDGA 3HTLX 3AU1A 3FTGA 2IADA 3U4EB 1CBVL 3NH7L 3ZKNC 4QXGL 2LTQB 2DF3A 1UH3A 4XC1H 4GBXA 1U8PA 1JHTB 1NFDA 3GMQA 1U91A 4MZ2A 4U1GC 1BFVH 4XX1E 4YHZL 3CH8A 3CFKA 3BKMH 3VXUB 5GRJL 3I02B 4RGNE 5TDNA 2OJEA 4CMMA 2HRPH 2X89A 4NSKA 3DUUA 4BK5A 5E2UH 4XT1C 4P2RB 4XWGH 3VG0L 4PJCE 4Q9QH 4G8EA 1M05B 4KK5D 5CKAA 2VAAB 3O3EB 4OCRH 4OIIH 4PJ8B 1MLBA 2UZIH 4L4JA 2DQGH 5TQ0H 4ZXBC 3T77A 3LEXB 5F9AC 3NIDE 1QBML 3TH3T 2P45B 1I8IB 4ZXBA 1IEAB 3VXNA 3GNMH 1U95A 1YNKL 3RA7L 4Z0BL 5KSBF 1FL6B 4FQ2L 2PYEB 5EC2A 3GB7B 2VUYA 3OZ9H 1DR9A 4NN5B 3MRRB 4IOSD 3BHBB 4MVBD 4OQTA 4HGKC 1QVOA 1NPUA 5F7DB 2GSIA 3ULSB 1MCLA 1OM3H 4X5WB 3K3QA 4TN9A 5E5RB 1X5IA 3FOMA 4HUWB 3OG6B 4M8QA 2CUMA 3D3VD 4HJGB 3WFZA 4G42B 1OAQL 5JLZB 4E0RB 2R56L 4U1KA 4KK8D 1C1EL 3VFNB 1K4DB 3CFKB 1N0LA 5J13B 5C0BA 1T22B 5KN5A 1VENA 3MBEA 2X4QB 5ADPH 4JQXA 4JFEB 1L7IH 3MRRA 5DEZA 4JQIH 1XT5A 4PLNC 3UTSE 1I1AA 5KS9A 4RA0C 1ADQH 1HQ4B 3FZUD 3VFPA 4UTBL 4WHTB 4LVEA 5JIKA 5JIIA 3A0OA 4O51B 3QNXB 1NJ9A 3BO8A 2B4CL 4WENB 3T2PA 5JDSB 5HHVH 1FPTH 1N59A 4KROC 3H0TA 4ZO9A 2BSSB 1M05A 3IDNB 3S5LB 4HSQA 4IRSA 4KY1H 5IW6A 5IFJB 4PRNB 2DQCL 5DK2B 3HZMA 1AD9B 4FRWA 1B6DA 3MRKB 2EH7L 4M6AA 4WUUA 2CKNA 4NPYB 5ISZB 1DDHA 2P48B 3QB7C 4HIXH 3CH1B 3G08A 2CIIA 1GPOL 1H9VA 4H5SB 4FFWC 5EA0H 3FONA 4X6EB 1YY8A 2AJUL 1U9KA 4MD0A 2EE9A 1FNEA 2X4RA 3DXAB 1BOGB 5DD3H 1K6QL 1MUJB 4WGWB 5F9WC 3WS6C 5A40E 5INDB 4GBXB 1FSKC 4WDIB 1U8KB 4PJHB 5MEPB 2D7MA 3BP4B 3QAZB 4W4NA 3TVMA 4JZNA 5DR5H 1QR4A 4NZUL 3MACL 3O6LH 5EIIB 4YFDB 1ZT4A 2IAND 3RDTB 5HJ3A 1I7UA 4HAGA 4OFPA 2L4OA 1BQHG 4JFEE 3VGHA 4O5LH 4JLRA 3C5ZD 2J7LA 5DI8B 3STLA 1A6WL 1BD2E 4HT1H 3ARGB 4LHUG 1SQ2N 2D4DA 5ENWA 3SCMA 3EGSA 4XCEB 2XWBA 1RK0B 1ZSDB 1RIUL 2X5PA 3IKKA 3M07A 2MKLC 5T3XD 5BO1L 4MYWB 1FJ1A 3T3PE 1G7LB 3EYUL 3C60C 1K3ZA 4U0RB 3PABB 3KJ6H 3IKCA 3L6FB 1AKJD 4GKSB 3FO9B 1CDHA 4I8DA 4B53A 2V7NB 5IT2L 1W72H 1OAXL 5HHNB 4G6FB 1MY7A 4LLAA 2A9ML 3PHOB 5F7HA 4ZFOA 4OT1H 1GHFL 2V2XB 2HKHL 4FG6D 4JCLA 4KZEH 5DRXB 1EJOH 4R4BB 2PTVA 3KPRA 2O5XH 2XRAH 1P1ZB 5HGAB 1D5ZB 1F4XH 4NQTA 4P3CH 4NNYA 4LPWA 5AYQA 3L3HA 3ORJA 2B1AH 3RTQB 3MRDA 3WHXB 1P84J 4UUJB 5EBMA 3OPZL 2ERJB 2IMMA 4O5LL 4PJDE 4V2BA 4PP1C 4K8RD 3RWGB 2JIXB 5C0JB 4FTVE 3FFCD 3RWDB 3SJVB 3GRWL 4F7TA 4Y4KB 4Z7WE 3BISA 4PBVC 2XG5A 3OKNA 4WWKB 3QUMA 2BC4B 2FJFB 4W6WB 1FVDA 1NAMB 1NUFA 2PR4L 3LD8C 2IBBA 4KV5E 4ODUB 3E0GA 4N90D 3S96B 2NXYC 4DFHA 1R5WB 4M7LH 4QRPE 4PBWD 2V5TA 5D4QA 3WFHA 3EFFB 3MLYL 1DFBL 4N68A 2OK0H 5DJAA 4X80H 1P2CB 1NGPH 1A7NL 4LAQH 4OCNC 1A7RH 1YJDH 3HMXA 5I8CB 3QXUA 3BEVB 3BKJL 5H37H 4KK6C 1DTUA 3EO0B 1FVCA 1T3FB 1QA9A 4LHUA 1R3HB 1BQHB 2RQ8A 3L3JB 3HZVA 4ODVH 3WS3A 3BN3B 4E41B 2DQTH 2NY4C 1UYWL 4BSWA 3ZL4L 4RGMB 2DRUA 3TT1H 4KTDH 4NC1E 5FHBH 5HBBA 1T7YA 4B7LA 4HKJA 3LVEA 4Z7UB 3G04A 2HTKD 2X1PA 4QF1B 5IMKA 3G5ZB 4OV6F 3SDCA 2GFBA 3O8XD 4AEIH 2BNUA 1KJVB 3LN4B 1DBJH 3BEVA 3RNKA 3VWJA 1IFHH 3GMNB 4HFUH 4GAGL 3HN3A 5TE4H 1ZA3B 2P5EB 1A6PA 3EFDH 4KK6D 1KULA 1MRDL 2BMKA 1WJ3A 4LRIC 1OSZA 3GSQB 2BFVH 4QXWA 4PRDA 4Z5RA 1DUYB 1TZGH 1AY1L 1MFAH 2K7QA 1JFQL 2YR3A 1A6AB 1RZGB 4TUJA 5I74C 5BZWA 5I8CA 3HZKB 4BZ1L 4OLEA 4D3CH 4PTUB 4MSWB 1T1YA 5BMFL 1JNLH 4CL7A 4UIKH 2E27L 4NJ9H 4FQPA 4Y4KA 5I15H 2VLKA 4D8PB 2MQ3A 3TPUB 2D31B 4PY7A 1AE6L 3MUGA 5F3BB 4QYOB 5D1XD 1JTOA 1XGRA 5BJTB 5HHNA 2Z92A 4RFEA 5I2IB 3WHXA 1HOCB 4YE4H 3V0VA 2ICEB 2P8LA 5BZWB 5DDHB 4YBLB 4UQ2A 1DBKH 3QI9D 4G9FB 3MRJB 1XCQA 4ZUUA 2ICWJ 2EZ0D 1I1CA 3BKML 4YQXL 3DOSA 1FFPB 4OFDA 2DI9A 3PGCA 3KHQA 1JYXA 5F9JB 3HI1B 3HFML 2ZUQB 3N50A 4K23H 4U4BA 4U7MA 1BLNA 3S37X 3PHOA 5BS0D 4GKZB 1ZLSL 4YDKH 5EFIA 3P3YA 4N0UE 5FCUL 3JZ7A 3DURA 1KJVA 1WITA 2P44B 4N0FB 5CD3A 4L29B 3PWNA 2ZPKH 4Y16B 5HGAA 3AM8A 4JY5H 3EOAA 2DM2A 1S7QA 5EZJB 2DJ4A 4DQOH 2R23A 3BPCB 1AR1C 2GSGB 4UBDC 3AUVA 3OG4B 1A1MA 5F7UA 4XCCL 3NZHH 1E4XH 2DD8H 3VXOB 1I9RL 2V5YA 4MQXC 1T7ZA 2QLVB 2RJMA 3VJ6A 1MY5A 2IH3B 2EXWD 4ALAL 2WSKA 1KTDB 1GJIA 4K8RL 1N6VA 2XN9B 3EO1B 3IDXL 3BXNB 4FNLH 4PJIF 1INDL 1WK0A 3MV8E 1VESA 4G7YH 3FRPA 5GZOD 1Z5LB 4DUWA 4GG6F 4S1QH 1HNGA 4OM0H 2E7LC 4PREB 5CSGA 1HKFA 4U3CA 1AY1H 1XIWC 5DQJB 5JNYA 3GMOB 2C7UA 3MCG1 2X4UB 4JG1H 3WCYA 2MKWA 4NIKB 4X80L 3UTTD 4CDGC 3MMEA 3L3HB 1JN6A 3U36B 3P30L 4BZYA 2MHAA 5CZKA 2F54B 1UXSA 3VRLF 2AABH 5H35A 1JFQH 2DJSA 4X6DB 2JJTC 1FAKT 3WIFB 1GGIH 4YWGL 3MRBB 5GS2D 4H5SA 1WIUA 3O0RH 1EVTC 2QQNL 4Y8AA 5GS1C 4JKPL 1H3VA 4ZMAT 2P8MA 4FXKA 1HILB 4XHQA 3ZYOA 2W9LA 3RVTC 2ADIB 1WV7T 2X1OA 3W5NA 3JV6A 2DQEL 3SKMB 1K8IA 1FC1A 1I1AC 2DM4A 4OZIE 1D9KA 3OPZH 5JA9A 4TOYL 5FYJH 3T09A 3V5HB 5F7DA 4N5ED 3IS1X 4OCYL 4JM4H 3MLTB 3STBA 1ZKAA 4J4PD 4GOSA 4L4VE 1I9JL 3U2SA 2C1PB 4QHMA 1HSAA 2X4PA 5CLWA 4P59L 1WSST 3T65B 3X17A 4MLIA 1MHEB 1PKQA 2OXHA 2DWEB 1F3DJ 5T3ZD 4H26A 4KJYB 1LEIB 1PY4A 3PQYB 1A3LL 1PG7L 4M7ZC 4TQEH 3OKEB 4PFEA 4JHWL 5EUOF 4KAQH 5HYJA 4DVRL 5I8EA 4MAYC 3CGTA 5EZIL 1T1XA 4I5BB 4GG8B 2D7TH 4U1IA 4BSVB 1MI5E 3VRJB 5FM4A 2MNUA 2C3HA 1U8JB 3G6JA 1LHZA 2PNDA 2VR4A 4H88H 2FJGA 4L8SB 1SYVB 1D6EA 3MYJB 5E4EB 5HDQH 1CLCA 5C0FB 1XF3A 4PY7B 4NHUB 1IC7L 2YRPA 3D0VA 1OTSC 5ICYB 3I6LD 4ZAKA 4P57A 4DGYL 4OZFH 5ETUB 3QUYB 1LNUA 5I18H 2RR3A 4HWEL 4MSWA 2VZOA 4KMLB 4RRPA 2EXYD 5K93A 1UM4L 3GI8L 1JGEB 4XMLL 4O2CB 4D0DA 5FKAB 4BFIB 1RQ5A 4E5XB 4J3WA 2YN5A 2BJMH 4NN6C 1WFUA 5MHSD 3WLWD 1YMME 1QQDA 1URLA 3HI6L 5IW1B 1YJDC 4LF3A 4BQCA 3MLUH 2VMFA 2BVQB 2WUBH 1RUML 4NT6A 3DETC 32C2B 1CFVH 3LS4H 4QOKA 4XNXH 1IL1A 3ZE0F 1E6OL 1NMAL 2H8PA 1MJUL 2CDEA 5D7SL 3EUUA 1CDBA 4S1DC 3IFPB 1EERB 4PJFA 4JFQB 1B4RA 4YO0A 3MOQA 4LVHC 3V5KA 1F4YL 5KVEL 4P23A 1RZ7H 4YIQA 1MCOL 3TN0C 3Q3GB 3WFEL 2WM0A 2EICA 4TNWK 3CVHH 2PN5A 4HXBH 3DVGA 1N6UA 3QXTA 4KVCL 1U8NA 4CN6A 4DN3L 1RIUH 1JCKA 2Z93A 2Q8BH 5B8CA 1MRFH 5I1DA 3GSVB 2X10A 4JFPB 5EO1B 2HYMA 3BQUB 4BH8A 4NN7C 5C86A 4AIZB 2IWGA 5HVHC 4AJ0A 2QSCH 1G9NC 4P3DB 4Y19E 3LKRB 4RISH 1N5YL 4Q7DA 4NO2B 4WHYG 4HIEA 1IAIM 3G5VA 4M1CC 4F37K 3TM6A 1GOHA 5IEHB 1EXUB 1BIIB 4L4TA 3P77B 5L8JB 1UWXK 2MSPA 5I1IH 2XKUA 1VEPA 2ZSVA 1KJMB 3C6LC 1NSNH 3EHBC 4PJAE 4EI6A 4F80A 2NY6D 1F90L 4MAYA 3BX7C 1Q1JH 4PJ7F 3RI5F 3MV01 4DVRH 1BD2D 3I02A 4XPAH 1ES0A 2ITDB 2NLJB 4KGJA 3VFWA 1MAJA 5HYJD 3G9VA 4OGXH 1ZWIB 1KXVC 5HGDA 5FFLA 1Q94B 4X99A 4YHOH 1TJHL 3DSNA 4PGZA 1OTTC 5TDPA 3TEUA 5CEZH 2VLJE 4LCYB 3MRFB 4LEXL 5ANME 4HIIA 1JE6A 1N4XH 2DQUH 3P4NB 4L8BB 5CAYB 2UWEB 2BHYA 3QHFL 5CS7A 1HOCA 1T4KB 4IHOA 1FFNB 3P0YH 4E9LA 2VR5A 3BUTA 1A0QL 2FX9L 2QSCL 2JK5B 2QKIB 5EU6E 3B9VA 3V6OA 2M8XA 1M71B 2YWYA 5F72S 4ZNEE 3VH8G 1BEYH 3O6MH 3Q0HA 1B0WA 2F5AH 5AWNL 3SGEI 1UWEL 3O3DB 5CJ8A 1I85C 1UXSB 1A7PH 3D18B 3K0WA 3MC0A 3X14B 3I9GH 3HUJE 1HH9A 4Y4HB 3AC0A 3O41A 2JJTA 2H32A 3L3IB 3O9WB 3V9FA 5IB4B 3DPBA 2ZSVB 5DD5H 2CQVA 2VLLA 4R0LB 8CGTA 1NDMB 1MCOH 2NPLX 3QCVH 4PRBA 1ZSDA 5T1DL 3BW9A 1JZ5A 1RK1A 5FYKE 4F7PA 2Q3AA 4FHBD 3FT3B 1M6OB 4QOKD 4KJPD 4LLVA 1Q38A 5DURD 5TQ2H 3V7AE 2VLRB 5DJDA 1UXWA 2WBJD 4B5EA 4JJHA 2NY1C 1DVFD 5HSFA 3OR6A 3WN5C 3CZFB 1FNAA 4F7MB 4IIQB 3NMEA 1F6AB 5DZOA 4QF1A 5IMKB 3BZ4B 4IOIA 3TA3B 4L8DB 2GY7B 3BH8A 2DDQH 4RISL 5FM5M 3IAQA 1ZMYA 4JJ5A 4ORGA 5GRUH 2X41A 4L3CB 4W4OA 15C8L 4XMPL 4XI5D 4ZS6D 5I9QC 2BCKA 1FO0A 4GG6A 2C3VA 4X4YA 5E6YA 3TNNA 3WNMA 4RWHA 5C09D 3UBXB 4DN4H 2OSLA 1RK1B 3V6OC 3KYOA 5I19L 4XNMB 3F12B 3PXHA 4HZAA 4NM4H 5C0CA 4XBGB 1MFDL 2A0LC 3CU1A 3JV4A 3RZWA 4HWEH 3QDHA 4MJIB 5ERWA 3BKCL 3HC3H 3ZHLA 4IHOB 4K9EL 4EKXA 5K9OA 4Y5VB 3RVXD 1FVCB 2KPNA 3TYGH 1NC4B 2NY7H 1E4WH 1RUAH 3QDGB 5F44A 3BVNA 4YPGA 4F58H 5H2BA 2YA0A 5I16B 4MA3A 1K8DB 3GDBA 5GSRA 5LWYH 4R90L 3TIEA 1T2QL 5E8PA 2E3VA 1UM6L 5FKPB 5IW1A 3MRLB 1JGDB 1NCTA 1NJ9B 2XZZA 1H3PH 4DEPB 4KI5E 2VDPH 1DL7H 2G75B 3AS1A 4GUPB 3X13A 3B3IA 1VACB 4HUKB 4APQA 3GHEH 1SBSH 2WZPD 4G6ML 1QSFD 1IL1B 3LDBC 2XIDA 2F15A 4M4RA 2EDLA 4MJ6B 5HHXL 3DBXB 5ITFB 3G5YA 1UGNA 1J0ZA 3QUYA 4X99B 4PJ9B 1EXUA 4MCYA 2YOCA 3REWB 4JDTH 5I75B 1MCNA 3ROLB 3I9GL 1IGMH 5D7IB 4P99A 3HC4H 2FRGP 2FH6A 5EWIH 2V2WB 3EYQC 5C08E 1H8OA 2YC1B 1FDLL 4FFWD 3WFCL 2XACC 4RDQF 1LD9A 3SO5A 5KVDH 5SWZE 1GVIA 2F58L 1QSFE 5GGRY 4ZAKC 3L3DB 1IC7H 2VKXA 5I1HL 5ABDE 1Z6JT 2BRRL 5F89B 4JKPH 5GGVL 2Y7QB 2XZAH 2N56A 2CDFB 5DWUL 1TETL 1EDQA 2CGRH 1NDGB 5FCUH 3F7VA 1XGTB 2HFTA 1WC7A 3RGVC 2YD6A 3FB6A 2YK1L 5AD0B 4X9IA 1HHGA 1MRDH 3QIBA 2Z93B 1RY7B 4TQEL 4Z8FL 3RL2A 1EZVX 2ITCB 1RMFL 1G1YA 1T1XB 3CX2A 3KPNA 3ZKMC 2ZOLA 1Q1JL 3OSKA 2IANE 4P46C 3C2AH 2YHGA 3MBED 1HSBB 4LCCA 3PUCA 1E4KA 1KJ2L 1DVFA 4X6BB 4I1NB 3UEZA 1MFEL 3SKUD 2UYLB 2BVYA 4J3OC 4E41A 5EWIL 4YO0B 4LSSH 4MJ5A 5E8EB 4BH8B 1OWWA 2ESVE 5KTEL 5JOFB 1FZJB 2XWJB 2BNRA 1YEHL 3HPLA 3L95A 5GISL 3EO9L 4BKLA 3MRNB 1I1YB 1KYOK 3HNVH 2W0FA 3BP4A 3WKML 2J6EL 5DUML 1DZBA 1T89C 3MGAA 1P2CA 4JQVA 3CSPA 1UB6A 3W82A 4R26H 1OAYH 2CLZB 3C8DA 1N7ML 1U3ZA 1FLTX 4NQUA 2WQ8A 5EB9A 1WWWX 3CDGB 4XTRC 5DJ8B 4ZFOL 3HMXH 4EDXB 2W91A 2QADC 3DSFH 1T04A 5LWYL 3CUPB 4Z7UF 5DEGA 5KAQG 3OXRB 3QIBC 4HUXB 3UAJC 1OARH 3O4OB 5IUSA 3UBXI 2BXZA 4I4WA 2A9NL 3MBEB 4DOHB 5DK0B 5IW6B 1NFDF 1Z9OA 1T6WA 4S1RH 1CN4A 4G7VH 4KJWC 3L5WB 3WFCH 1RURL 1W0VA 3MXWL 4YDVB 2CRMA 1I7RA 3QZWA 4APQD 4R7DB 5ID0A 2FATL 3GMLB 1JMXA 2R29L 4KDVA 3Q1SH 3ARGC 3P2TA 4IM8A 1CT8A 1R3JA 1YNTB 2Z8SA 2XNAB 5D7LE 1JNNL 1JWUA 4XP9H 1CL7L 4H0IA 1YUHB 5GS0C 1WUNT 2A0LD 4BKLB 1I9I