1ZVNA

Crystal structure of chick mn-cadherin ec1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
b'SGWVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQRLDREERSQYTLRAQALDRRTGRPMEPESEFIIKIQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin 1
publication title Type II cadherin ectodomain structures: implications for classical cadherin specificity.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 24
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1zvnA01
3FF7A 3K6DA 1EDHA 4AQEA 1WUZA 3LNGA 4ZMWA 2OMXB 2X2UA 4ZMOA 4ZMZA 3UBHA 5DZVA 1NCGA 2OMUB 4AQ8C 3LNFA 4APXB 2EE0A 4NUPA 4AK1A 5CO1A 5CZRA 3K5SA 4AQAB 1NCIA 1NCJA 4APXA 4ZMLA 1FF5A 4AQAA 2OMWB 1ZVNA 4NUQA 4ZMVA 4ZT1A 2OMTB 2YSTA 3QRBA 3LNEA 3UBGA 2V37A 2YQGA 4AXWB 3K6IA 1SUHA 3Q2NA 2A4EA 2OMYB 4OY9A 5JYLA 3LNDA 2QVFB 1L3WA 4ZMQA 2WBXA 4AXWA 4XXWA 5KJ4A 4ZI8A 2OMVB 2O72A 1O6SB 1ZXKA 4ZMTA 2QVIA 3Q2LA 1OP4A 5JYMA 3PPEA 4QD2E 2WD0A 2WHVA 4AQEB 2A4CA 2WCPA 3Q2WA 2OMZB 4ZMNA 4XXWC 3K5RA 4ZMYA 1WYJA 4ZMXA 3MVSA 3LNHA 4NUMA 1NCHA 4ZMPA 3FF8A 3UBFA 4AQ8A 3Q2VA 4ZTEA 1Q1PA 3K6FA 3LNIA 4NQQA
chains in the Genus database with same CATH superfamily
1MHPH 4ZXBA 1AANA 1M56B 5FK9B 3V55A 5IFAH 2BSED 3MPCA 1GZQA 1EHNA 2W0LA 4E9WA 2WXPA 4DT2A 1P4LB 4RX4A 3CFKA 2IWEA 5ERWB 5JQ6L 1AFVH 3WHE0 1N6QH 1YNTF 3TT1L 2F61A 4LLUB 3BVVA 3FRUA 4PJFF 4E41B 3WFBH 2LGNA 5ANMB 3VGDA 2G2RA 1FCCA 4ODWA 4XN5A 3SGEI 3IFNL 1QNZH 4WFHD 5D7HA 1B0GB 3FTZA 4N0UA 5DQJB 8FABB 1KPRB 1J1XL 4LVNC 3BDYL 5AYUH 3P2TA 5IF0B 4MLSA 3O4LA 4WWOA 1BW8A 2NCEA 2E0PA 3OPUA 3H3PL 2JKXA 4H26A 5DURD 3LX9A 5I9QC 1U3ZA 3IXTB 3VMPA 1JV5B 4XVOA 4Y4KB 5F9OL 3RUGA 4ELMA 4JO8A 4Y9EA 1ZT4A 3HHSA 1QO3A 4DFIA 5HDWA 3FTSA 4PH8A 5F9WC 3PWUB 2K3TA 1I3GH 4X4MA 1UH3A 1HINL 3BZ5A 5J3HC 5TE6H 3HC4H 1SOQA 2BVYA 3BKYL 2YA2A 3FO1B 4UZGA 3RZCB 3F65A 2H3XC 3S48A 4YZWA 1WTGT 4F9LA 4NIYE 5EU3B 3GXFA 5GGQL 3TJPA 1D5XB 5E1HB 2FJGB 3CDZB 4UDUA 5AZ2L 3TPUB 3TT1H 4WFFD 2NDGA 3RGHA 1G7JB 5CIPB 1T1YA 1H15A 1NGWB 4OLVL 3REVA 3IFNH 3PHAA 4WI8A 2BP3A 3V0WL 1IV8A 3NIDF 1J1XH 3B9VA 3BVNA 3SEPA 3TN0A 3H4FA 3H7BA 4ZAKB 5DEJA 3H3PH 5MEND 1P5UC 4KKLD 3D3VD 5F9OH 1A6UL 5IJVA 1OARL 4KTEL 1GA2A 2EILB 1X4XA 4JN2A 1WFMA 1RUQL 4NBYB 1KEGL 4AMXA 5JW4R 2BY0A 3H55A 2HYMA 2EUZA 1HINH 1C16B 5CHNB 3EO9L 4FQIH 4HGKC 4ZPVA 5GGTA 4CRPA 1MVYA 2KKQA 5H8DA 2NYKA 4LDOB 5KBDA 5C0NC 4JAMB 3W2DH 1BFOB 1X4ZA 3OKYA 3DMMA 4PJCB 4EKXA 4NO5A 1AIFB 4GG6F 4AEHH 5GGQH 3BPNC 3FT4B 3TBTB 3ULVC 2NY2B 1GZPA 4KXZH 5AZ2H 3QAZC 1FL3A 2FBRA 4TS6A 4L9LB 2OSXA 2VN3A 3SPIA 4XCYB 5LHDA 3V0WH 2B1HL 3WS6C 5ACZB 4IMKC 5FKPA 3ERXA 1SVZA 3FYEB 2ZUXA 3P30L 2NQ3A 4PWEA 1FIGH 5E6ID 4FQQA 2CXKA 4WW2F 3F7VA 1A6UH 3V0FA 3KPSB 2YD3A 2C7FA 1AMYA 3NG5A 1BXVA 3VFNA 2ZG2A 4KROD 1RUQH 5FO2A 1T66C 3H9HB 4HQQH 1KEGH 3VNZA 2D9QB 1OHZA 4JFEB 5AG8A 2NW2A 1INDL 3EO9H 5D7JB 1KF9B 5HGBB 1NPUA 4R4BB 3MUZ1 1JAEA 2V7HA 4R2GD 1QTYT 4M3HA 5E8EA 2VR5A 2C9PA 3N55A 4NZUL 5D9SB 3ZYZA 3BIKB 2E8YA 1CFQB 1QR1A 3HAEA 2PR4L 3S36X 4APXA 4OZFH 5IW6B 1ED3B 4X6BB 4JM2F 1S78D 3KCWA 3BO8B 3QUMH 5GGRY 2AQ2A 3HS0B 1BQHG 5HDQH 3WD5L 2K7QA 1SEBB 5DZAA 5BJTA 2BC4A 3K8LA 4A68A 3WFCL 3PV6A 5LG1A 2ZWKA 5I5MA 2D7TH 4HKJB 4OJCA 1TZOA 4PJ9D 5LCVL 4Y5VC 4JRYB 3P30H 4M5SA 4N2MA 3P40A 4AQ1A 5F7WC 3NP4A 4A39A 3S37X 3Q43A 1NCCL 1JMXA 2FT8A 2ZYHA 3QI9C 3US1A 3BP4B 3QG6B 1D5IL 2EDQA 1GGTA 5L2KA 1NGXB 3AXLA 4U49A 3RNKA 3BGMA 1JRHI 3V0IA 3BIBX 2EE2A 3CSGA 4F7MB 3C8HA 5K39B 3OLDA 1IU1A 1BYOA 5LGJB 4NZUH 4BH7B 4TKWA 1DFXA 4BKTC 4N0FB 2PR4H 2QVIA 3V52L 3UGUA 3GEWB 1KGWA 3BH9A 4XNXL 2YXFA 4G6AD 2ZAIA 4G6JL 2BNQB 1O6TA 1IBGL 2APVA 2LR4A 1MHCA 1P1ZB 3WD5H 3NIFE 3QQ3A 4KNQA 4KI5D 2O30A 1ODAA 1F58L 3WFCH 5D7IE 3HMXA 1KXHA 1FZMB 3RY6C 5LCVH 4PWFA 4KZEL 3DVNB 4RWHA 1AGDA 3F7PC 1NCCH 3MN8A 4RESB 3WY2A 4FMVA 1NMCB 2AJUL 3K7UA 1D5IH 3LRSB 5T5FA 4HDIA 1BSIA 5IOPB 1LO5A 1KCKA 3IBOA 3PIQA 5HD8D 2HT2D 4IKJA 4FYQA 4HHWA 3DXAE 5F72S 1ZXQA 2YAHA 3VXSE 3CXHK 4FFZA 2WZ0A 4N68A 1X6LA 3KWXA 1CIUA 4JRLA 3NJHA 1IC1A 5C8JB 1I8MA 4XNXH 1IBGH 3SDCB 2GC4C 4GW1B 3HN5A 1JGDA 2WZPA 1A6AB 4XTRD 2P5PA 4LF3A 4AJ0A 3EBAA 3MREB 4M4RB 5HVFB 1F3RB 2RJMA 2YQBA 2ENJA 3IGLA 4KMQA 2CM5A 4KKAC 4TQHA 3V0VB 3MOAL 4YSUA 3BJLA 4U1HB 4U6XB 4YXKH 1XR8A 4JGJA 4MJ2A 1AIZA 3GMQA 3I02A 5KS9B 4X6CA 4Z3TA 5M94B 1JPEA 1EGJH 2GIXA 1R9FA 3QJFB 1VKXB 2J8HA 3GSNA 2LU3A 2WUCL 3BCFA 4OV5B 2F2HA 3RWEA 4YBQD 1YEGL 3N0AA 4W9DC 3H9YA 5I6XC 1G7MB 1WQVT 4WI0B 2VC2H 1S3KH 1A6ZA 4OM0L 3LD8B 5AVQB 4PP1D 2C1PA 5I8EB 2WQAA 1V5JA 2NX5E 4YSAA 5D6CB 5IB1A 4OCRH 2DQFB 4ONHB 4X9FA 3P11L 5T3ZE 5IEHA 3RFZA 3PQYD 3V0AC 5ISZD 5FM5O 1G1YA 4I85A 3MOAH 1VFMA 4N2HA 1XGTA 3BN3B 1QTPA 5HHQA 3OM3B 2FO4B 1MW2A 5GIRA 2EVFA 3KH3A 4G42A 5SWZA 1KGCE 1BQ5A 4P23C 1S7RB 5AENA 1ROCA 3WNJA 2Y36L 3KLSA 2J71A 1FNLA 2WUCH 4GW4A 5DHXB 3KPNA 3BSHA 4PCYA 1A4JB 1WD8A 1HJCA 1YCSA 3KXFE 4BGDA 2ICEB 4HS8L 4HX1B 3F84A 3HZVB 1YEGH 5D7LD 4CC1A 4UM9B 1MRCL 1YNTA 2V2XB 4L3EA 3O3AB 3IETB 4PJFA 4QLWA 2W9EH 4LCCC 3MUUA 3UYRH 1E3XA 4U3CA 1E8XA 4FQXC 1X5MA 2J88H 3A4EA 3QXTA 3CZSA 2PABA 4PJGE 1LEGA 2RCSH 3BN9D 4UMSA 4Z7OE 4FXGA 2DWYA 5SWSE 2X40A 5KVMC 3ZTJH 4RBPH 2XTJE 2E46A 3O8XA 4M3KB 5IMLB 4HZLA 4YH6A 3P11H 4HJEA 3RIFF 3HJ0A 3RWHB 1OCOB 4HFUL 3LNGA 4YGVA 1A9BA 3FXIC 3MJ7A 2A9BA 2VKWA 5K59F 3QUKA 4MMXC 4TVSa 4CMMA 2C34A 1JN6A 2X44D 3GBNL 3BJ91 4L48A 2P8MB 1Q4NX 4X4KA 2J73A 1QASA 2Y36H 4ZX4A 2JKLA 3K2IA 4OJDH 3H1ZA 1KYOK 2FWLB 1I1FA 2H6PA 2VXUL 4FC3E 4FG6C 3VFSA 4HS8H 3HG2A 4P4KD 4KGLA 5IG7A 1RCYA 1MRCH 1HWHB 4PJEF 4FHBD 4ELKA 1I7TA 2J8UB 4XMLL 2VQ1B 5DMGC 4V11A 4PRPA 2A6IA 3KLAA 4FFVD 2YLKA 2JLPA 4UOJA 3G6JF 3S5LG 4R26L 2ZKYA 5EC1B 3CDGB 3SZKC 4NB7A 3LVTA 1TVHB 4ZSOA 3QUXD 3O6LL 3ULUE 1A25A 2YC1A 3QZLA 5KBLA 5FDWA 4HFUH 3BD4A 3GRWL 1CXHA 2ZCZA 2D3LA 1RJLA 4APQB 3O3UN 1B0GA 3EF4A 3EHBB 3P4NA 5F2FA 1N0XH 4JO3L 3GBNH 5IJCC 4G59C 1FNAA 2WB7A 5AOZA 3OG6B 2ENQA 3BT2L 4X5RA 1CF1A 2XRAH 5DJXB 3TCLA 3ZL2A 3CIQA 4GG6A 1OSZA 1JWMA 3BYTA 5T1LA 4LOUC 2VXUH 3VGBA 4DK3A 1TITA 4XB7A 3NSXA 3NZ8B 4FXLA 2L0DA 1J48A 2P5WD 2P49B 4H8QA 4KAQL 1VJSA 2WBJB 2XN9E 3PHOA 4X98A 3ARDC 2KDGA 4H0HB 2WLKA 3WY1A 3ISWA 4L5FE 4M62L 3NSCA 2YBRB 5EIVA 5C0JA 3RY4A 2VZVA 1G0YR 4IW4C 2R8SH 2ZOWA 4JCLA 4P57A 4R26H 1NFDE 3KL5A 4KK6D 4WW2A 4I8DA 3QJZA 3TESA 2P46B 4XCFL 3O6LH 3GMRA 1KYUA 5J56B 1HCFX 3L95B 1WG3A 3VNYA 3O2DA 5DD1L 2PNDA 3GRWH 1G7JA 3QZOA 3HC3L 5GGSB 4ZFZB 3QFGA 4LCUA 1U8LB 1IIIA 2L7JA 2G5BB 3STLA 3U36A 4JO3H 4UIKL 5GZOC 3DKHA 4OQTL 3UP1A 5GSVB 5DFVC 1TTGA 3BT2H 5AZUA 3DK0A 3GS7A 2V2TB 4ALAL 5AAMA 2F18A 2MPVA 4OFQA 43CAA 6CGTA 2XWBB 1FZKA 4KAQH 3CFCL 4L4VD 2BSCA 3WS3A 5C0DB 4JLRA 1DVFD 4YDLB 5C7ZA 4ZFQA 1C16A 2BIMA 4M62H 3BMVA 3C6LB 2JB5L 5BVJA 3GZOA 3B9EA 1U8QB 1FNEA 4AENA 4IBUA 4GRMA 1IEHA 1D5ZA 4G43B 5HY9B 3QZWB 3B3BA 5DZNA 4XCFH 4H8WL 4UZSA 3H85A 3HC0A 4AUJA 3RVTC 4GKSB 1CFBA 2FQGA 4KKQA 4ZUUA 4YSSA 2QFPA 4IDLA 5D7SH 5EOCJ 4P2RE 3HC3H 3GXDA 3QUYC 1EZVX 1AHWC 4UIKH 3FOLA 1ZANL 2NLJB 4OQTH 2FE0A 2F7PA 2A83A 1CBJA 1NEUA 2D9CA 2DWDB 1FJ1B 3D69A 1KTJA 3EYOA 2BVPB 4ALAH 3FAWA 4Y2DB 5DS8B 4IBZA 3FB5B 3K6SB 4OSUL 1LYQA 1E4WL 4OCYL 2NY0C 2ZONA 3CFCH 3ILPA 2YQ2A 1GGUA 4G9FA 4Z76A 1IC7L 3Q48A 5E4OA 1KXQA 1CICA 3S2CA 5HGBA 2NNAB 2COQA 5EUKA 4RLDA 2VN6A 3QHTC 4JDEA 4R0LA 1JGEA 4FS0A 4LXFA 5L0QB 1MFVA 1YJDL 4ZS6D 5DUJA 4H8WH 4Y4HA 5CKGA 5FYLE 1UUNA 1R3JB 4OFIA 4QT5B 3BO8A 1C7SA 2VDNB 4HLZG 1MFNA 4PJAF 2GT9B 4YHNB 5C6TL 1MJ7H 3B6SB 1ZANH 1Y0LA 3FQ4A 3S5LB 4KTDH 2ZYSA 2Q7YB 1MLBA 1TVBB 2HLFD 3OB0K 5C6PB 3RX9A 3EBIA 2EE9A 3QXVA 4AMWA 3EDKA 4MAYC 3KZ8A 4XO3A 1UC6A 1LMIA 3LKSA 4OSUH 1E4WH 2XWEA 4W9LC 3RVVC 2ICES 5J4MA 1I82A 3U0TA 4NUJB 1D6EB 1S46A 1TIUA 1U3JA 1N0LA 2CU9A 1G94A 2G3XA 2ZUQB 3HHRB 3SJVE 3VFVA 1QSEA 4U3SA 3SSGA 2IDCA 2GBUA 4IDJL 3T0EE 2R0ZL 2AC0A 4LSTH 3MNVA 1KNOB 1FYTA 3BW9A 3JWOL 1JXFA 2FNWA 3NEEA 4YSRA 1YJDH 4BQBA 2JWYA 4JG0L 4M1CC 4RAUA 3QNXB 1F4WL 2WXFA 3BWUF 2V33A 2BFVL 1WLHA 2CBQA 3APNA 5ENWB 1BVOA 4IJ3C 1KXVA 2WZ6A 2BSRB 4J3OH 1S7UB 3MV8E 1WFNA 1JK9A 1CLCA 1PZ5B 4YK4C 1QA9A 5C6TH 5A2IH 3U82B 2TSAA 5K93A 3T1FB 1Q8MA 2OP4L 5D5ME 5J11B 2WTOA 1VPOL 1JXKA 3E38A 1HN1A 3KWUA 4AYMC 4BGLA 4QOKA 3HUJF 5F9JB 4CW1A 2J72A 4NQDD 2BM3A 3O0LA 1M1XB 2OTPA 1AQHA 2EYRA 5CU9A 3O2VL 2YS4A 2AITA 1LJMA 1R5WA 1ZS8B 4LPCA 2I5YL 3O2WL 2Z91A 1YQVL 2VKXA 4A6YB 2SEBB 3HNVL 2R0ZH 2R1WB 4C4KT 4EI5A 4MDJA 3JWOH 2EEAA 3LOWA 1OZTG 1DJHA 4PWJA 1F4WH 1EEQA 1KCUL 1YN6B 3IDMB 3K71A 4Z7QF 2BFVH 2EKJA 4TSAL 1BMWA 2UX7A 3QB7C 4QRFA 1HDMA 4PBXA 3DIFB 1XEDA 2K6ZA 5F3HB 1GGBH 2OJ1A 2YUXA 3NCJL 2R1XA 4RIRB 3SB3A 5JOFB 1SEQL 3WLWC 4GW1A 3JUYA 2P80D 3I6KB 1IB5A 3QK0A 4I3GA 4MAZA 1RUAL 1UB5A 1VPOH 4GG8A 5CLWA 4L8CA 3WFHA 2QVFB 3VXMD 3NIFB 5GS1B 4WTZG 2CALA 3CVHB 4NKMB 4XNZB 1OQXA 1QPPA 2OJEA 5D7IB 5EZJA 2FZ3B 1TJXA 4ORGA 3IJSB 2XV2A 3D05A 4WWKC 4XCNA 4LCWD 3O2VH 5EZOL 5JLZA 1ZHLA 4JFDA 5I73B 5LVEA 3TL5A 2I5YH 3O2WH 5I76A 1ZAGA 4E5XB 3HNVH 4H40A 2Y06L 2BSDA 2Y7QA 1IGML 5DDHA 1Q0XL 4Q89A 4ES8A 5BUGA 5I5RA 2DH2A 4V1DD 4N6RA 4FLOA 5T1KB 2JK5B 1KCUH 4TSAH 3T71A 4IBQA 3DXAB 5F6IB 2R9HC 3TJHC 3VXSB 4O9HL 1EO5A 2OTWB 3NCJH 2X4UB 2W92A 1DJSA 3I6GA 1DJYA 2F08A 2JI3A 1SEQH 2OMZA 3VX0A 1TNMA 3C60C 1JGVL 2DI7A 2QVKA 4PJIE 3L4YA 1MLCA 1RUAH 3KPRE 1QQDA 3T3ME 3TVMB 4NP9A 3BAEH 1X5JA 3AT8A 2PTUA 3TONA 1XD1A 1L9SA 4PJEA 4MD5B 5I0WA 2VLJE 1RZGA 5F0JB 1O75A 2NDFA 2DEXX 4KK8C 4HWBL 5TQ2L 1IEBA 1BQHA 5F1IA 1MXDA 1UB6B 5D70L 4Z78A 5K5YA 3HE7B 3OLIA 2DEWX 3ZO9A 5BRZA 2A9MH 3HPJB 3A21A 4FXKB 4HIHA 3G6JA 3QHZL 2UX6A 1I9IH 3DV6A 4PGZA 1E6OL 2WZ5A 4GB9A 4Z7WF 4OZ4A 1SYVA 4Y1AE 4HJTA 3O3EB 4WLCA 4FEMA 5K1JA 1NKGA 5K9KA 1OWWA 1DBBL 1FH5L 3SPGA 1IGYB 1EUTA 5IHHA 2MNJB 1TU2B 4S1QL 3JV0A 3NCMA 4O9HH 3G6DL 2CA3A 2J5LC 2WPGA 1E27B 1M7IB 1OW0C 3EADA 1VFBB 4DKEL 1JGVH 1T83A 2UXGA 2X4NB 4GRWH 3VAEA 4UQIM 3FTVA 1KBGL 4W4NA 2JLLA 1V3LA 4KKPA 4PJDF 3ZRSA 4KOCA 3VFWB 2VQ4A 5AG9A 4C58B 4KY1L 3ULSB 5BS0E 1K72A 2PUQT 1T0MB 4M7LL 4JFPB 2YFNA 2YRPA 2BW4A 2CJSA 5EIIA 2HKFH 3AB0C 5TQ2H 4XB8A 1PLAA 2NX5B 3Q8AA 3QNZA 2CUMA 2YQGA 3NIGE 5D70H 4LNRA 1UA7A 3S4SA 5CBAA 2Z93A 4LMQI 2BP8A 4YNYA 4B3EA 1KIPB 1KJ2B 4LLVB 1IILE 4IGBA 5F96H 1H3XA 4CKQA 1GS7A 5T1DL 1RZ8B 3K4DA 2IPUG 2NTFA 4A67A 2MQCA 1DBBH 1FH5H 1G7IB 1NGZA 1R3HB 1RPKA 4JDVB 2MTAA 5EUOF 3QIWA 1OSYA 2X3AA 2QQNH 3MJ6A 4JM0A 4S1QH 2DJMA 3T8XA 3VCLB 4YSEA 4E42A 3KXFB 3ULAB 1ZY9A 1YY8B 3G6DH 2A6JB 1CFNB 3PDDA 4GY4A 3T77B 1HIML 4NQSB 2IJ0C 2ZOUA 4JY6A 4DKEH 5EC1A 4MBOA 1KBGH 5IJKA 4R7DB 5HYEA 3CC5B 5AOJA 5I23A 2IBBA 1JMZA 4PJGB 1KG0A 2DYPB 3SE4A 4M7LH 4Z7OB 1JK8B 5SWSB 3HTLX 3KD4A 2VDPB 2XTJB 3EYVB 5EPMB 5AKSA 3IRZA 3BFWA 3MNWA 5HI5D 3MRRB 4LAJH 4LLYB 1UGKA 3D7PA 4BIKA 4FQLL 4A2FA 3F83A 1VZIA 1NBVL 3MYJB 5FUCC 3G9VA 2YEZA 5AW1B 3HBPA 1KELL 4WRLA 4HK0A 1HH6A 5C0BE 2V8MA 3RX8A 4XCEB 4CC4A 1DVSA 2BOBA 5C9JA 4HP5A 1OY3B 5J12C 4JO4L 1T66D 2Z6FA 4PJ8B 1ZJBA 4E9TA 4F2MA 5DRWA 3Q1SH 3E2HC 1B0RB 4LHUD 3C5SB 1A2YA 1FVDA 1JV2B 1MCJA 2CLRA 3VM7A 4M61B 4NQED 1VDGA 4YL4A 3IGAA 1GCYA 3DUHA 3EJRA 1IKOP 2X53A 5IK3A 2Z92A 4FJYA 1ONQA 2GTZB 3UPRA 3T0VA 2HH0L 1T3FB 3CU1A 1M4KA 3L5JA 1IX2A 2VLKE 1WZ1H 4IOFC 1YNLH 5C92A 3IDYC 1H5BA 4GO8A 2AKRA 2X7LB 1NBVH 1PKOA 1N4XL 1U8CA 4P3CH 5FF6A 2PW2B 3QH3B 4NAMA 4GAJL 4GIPD 3T1WA 5C09E 4PVLA 2VO8A 5A7EA 3KPPA 4OF8A 4M5ZH 3BPLC 3EJQA 3ORJA 3DX7A 1VEOA 1H8NA 4JO4H 3QXUA 4PJAA 1ZLDA 3ZZQA 2P3YA 3C09C 5F3BB 3L6FA 1H0DA 3UC0L 2XN9B 1Z6JT 1L4IA 2PCFB 3M8OL 4U0RB 3LEYH 2A5UA 4N8PA 2ALAA 4PRNA 1CD1A 5E0QA 3EO0A 1WUNT 3W9DB 3D12B 3QDGD 4JHZA 1I1AA 2IQAA 1WFUA 4JZJA 3II1A 5KJ4A 4C56A 5I0VA 1NFDB 1NUGA 3EJSA 4PR5B 1ZGLA 2HH0H 4J27A 4W81A 5F0MB 5JYMA 1JFQH 2CUAA 4BCZA 2VZTA 3F01A 4JGMA 1BDYA 2VZOA 4KFMA 4K5MA 4RFEA 4XX5A 4BK4A 1P5VB 2VDRB 3KH4A 3UYPA 4PVBA 1N4XH 2MCG1 5I19L 4FQPA 4TNVF 3TIDB 1RK0B 2NT1A 2QGBA 4QRPE 4OFDA 4Y2DA 3SPCA 3TEXA 3BRGC 5TE7L 3K6SA 1UT1A 1OSPL 2CGZA 4XX1E 2NSXA 3SGKA 1S5HA 3VH8G 4BFRA 1NPJA 1UXMA 4Y1TA 3S3JA 1DCEA 2F53D 4LQFH 4F93B 3CG8A 4JG9A 5CAYB 3LB6C 1M2VB 4LEXL 3AU0A 2VSKB 3UC0H 1AG0A 1EA9C 4OZGF 2LTQB 1D6VL 3SDXF 3GBML 5BV7B 4G6FD 4UOQA 4QRSA 3WNKA 5C0GB 1AKJA 4PTTA 3HUJA 5IB5A 2WWKO 1S9XB 3B4NA 5FYKU 3NACL 2RMNA 1BZ9A 1ZHNA 2WN2A 4P5RA 2AMGA 2P44B 3L3HB 5GRUL 3TEUA 4ZOAA 3WE6B 4Y1SA 2ZP0T 1KSRA 5JA8B 1M05A 1HKFA 1NWOA 2FECL 3CX5J 4WFED 2E7LC 5D1ZD 2XVLA 4PHZA 4XVSL 3IF1A 5IFJB 1DZBA 4P2RB 3CZNA 3VFMA 1TZHA 2ZAGA 3SE3A 4FABL 3QYCA 4DERA 4E9YA 1JZJA 3PL6C 1FORL 4NUPA 5TE7H 5HHNB 3HI1A 3AXIA 4MB1A 3UTSA 4QEGA 4PGBB 3F2LA 1H3PL 5HHOD 5JXEC 1PTZA 2QELA 5EBWA 2E76C 4LEXH 5IHWA 5FCSH 2VZUA 2ZWZA 3L3IB 2YHGA 2JNZA 1BVKB 4UINH 1D6VH 3GBMH 3RY5A 3E8VA 2Q1EA 1ZVNA 2GUOA 3GNML 3KNBA 4M03A 3IMRA 5GRVL 4X7SH 4DHLA 3NACH 2CNZA 1ULVA 3U7YL 3IDNA 2ICWB 1CE6B 3MGTA 3O6FB 4NC1E 1HQRB 5GRUH 3UBXG 4IIQB 2EKSA 4PREB 1NAMA 4WTWA 4WAFA 4E9LA 2E5EA 2G3MA 3PU7A 3V4VB 3V6OA 1E67A 2HLAB 3CLFL 3IAQA 4TQ8A 4R83A 5LNGA 1XAUA 1U95B 4D0CA 2W65A 3V0GA 3VRJB 4FABH 5C0FB 3DO4A 2O4EA 1FORH 4DCQA 4X9YA 5E6SB 2FATL 5HYQB 2MKWA 4NQCD 5EU6D 2ZUTA 3A5VA 1EFXD 2VW6A 2FQFA 1H3PH 3BPCB 4LOEA 5C07E 3T3PE 3CFEA 1TYEB 3Q7JA 4LHJB 1WBZA 2Y72A 3TU6A 1PX4A 1PDKA 1TZ8A 3EOTL 4KWUA 5PCYA 2R1WA 5FV2A 3UTTA 4OZIE 4BA0A 5JIMA 1MFDH 3RIAK 4MSWA 1HEJC 3MRHB 4ALAC 1S9WA 4PLNC 4LVOC 2HFEA 5BCAA 5FO7A 3SJVB 1EHXA 2O6PA 4MQTB 1BVNP 5GRJL 3T0EB 3PG2A 4BSVA 1OANA 3B83A 2HRPL 4JE4B 43C9B 2CCWA 2NY6B 1PPIA 4YGAB 1PEWA 35C8L 5F88B 5IW3A 2X4TA 1U3HC 2ZJSL 1M42A 3E7JA 1UZ8B 4O5LL 4WI3A 3L3DA 3CLFH 1SDYA 4Z3JA 1X5AA 4Z7WA 3MV8B 4L23A 3DSFL 5FYJD 3UBFA 5A3ID 3R06A 1QUNA 4H8WC 3BEVA 3HLKA 3Q2VA 4OCNC 1MJJB 2FATH 4JFFA 2W60A 3GS4A 2WP3T 1N26A 3AG1B 4U1IB 5D5MB 3FQNB 1ASQA 2HKAA 4IHBA 4RQQA 2B77A 2EAEA 4AGQA 4KKBC 3HFFA 2YWYA 1DEEA 5FX3A 1F56A 3EOTH 1CGSL 2ESVD 4BSWB 3QQ9D 2QMJA 2BIQA 2HJLB 4PJDA 1NBYA 1XCTB 3NTCH 4HWEL 3HLAA 1QVOA 5EULV 4CNIA 3CIAA 2VM4A 4PV8A 1IQDB 1OAKH 2W95A 3VVVA 5FB8A 4NOBA 1TTAA 3GHEL 2Q2LA 3EF7A 3VH8B 1E28A 1V3JA 4XPTL 4O2CB 3IMVA 4Z6AT 2HRPH 4TSCL 3KWWA 2AGJL 1SHMA 3A6OA 4CDGC 1ES0A 35C8H 2IWFA 2PO6A 4IBSA 2ZJSH 3MRKB 3BQUC 1ETJA 4O5LH 1A0QL 4PRAA 2OCFD 3CBJB 3FK3A 1I9RL 4MX7B 1ETA1 4AQAA 1YJDC 1HXYB 3NAAL 3DSFH 3GO1H 4Z5RB 1KCBA 2WB1A 4GP8B 3MDJA 1TTFA 3GBEA 4M5YH 5EUOA 5J6SA 4Y5YB 5JW5B 2QDWA 3OV6A 4J3OC 1JNLH 1E8YA 4N9GA 3QRBA 4V2BA 5TH2A 1W16A 2WM0A 4XRCA 1RHFA 4BSJA 5EU7C 4EI6B 5H94B 2NXZD 4LBEA 1CGSH 2WKOA 1RK1A 3QEHB 3CDFA 2XETA 2H26A 4KDVA 2XSKA 3ARGB 5AW9B 3ZR6A 5IIEB 2Q76A 2QGCA 3GB7A 4HWEH 2V5YA 1O9VA 4LLMA 3VWKB 1Z7JA 4GQRA 2A3TA 3GHEH 4GFXA 2Y7LA 2AV1B 4XPTH 2VL5B 3VXUD 2V4LA 3ZDXE 3DGGB 2I25N 2HPOA 1JPSL 4MD4A 1N5AB 4R97C 4AVHA 4TSCH 1UOWA 2AGJH 1U0QA 1TQTA 1JTPA 1M6UA 3HOGA 4YHPB 2JFCA 1AO7E 2QADC 3NSFA 3ARDD 5JHMA 1YUKB 1IBZA 3ARFD 1BJMA 3Q1EA 4OD2B 1AQ8A 1A0QH 5JZ7D 5DHVH 3FH7A 1USZA 3JWOC 4WNJA 1KJMB 2AV7A 2QSQA 3NAAH 2JCCF 1JDCA 2BY2A 2EDNA 4WO4D 1I8IA 4XOAA 3CFTA 4LARH 1SHXA 3ULSA 3CFDB 5TDPB 2YPLE 3IPEA 3QFDB 4JFOB 3STZB 2UWEE 3KPRB 2JJUA 3T3MB 1K6QL 4XBGA 3UBXB 4P5TB 1U92B 3X2QB 2VRKA 4WKZA 1KZQA 3L5HA 3QQ4B 1J05A 3NGBB 3WCYA 4LLVA 2VLJB 2RQ8A 4HCGA 5LQBL 3X12A 3TX4A 4EJ1C 3LXCA 1DE4A 1IC5L 1L0PA 1P84J 1RZ8A 2RHEA 3QIUC 2PXYC 4UF7C 1NL0L 1SHWA 3V4PL 2D3NA 1XIWA 5H2BA 2F74A 3BYYA 2IDSA 4RGND 5GGTL 3RIFK 3GT6A 1JPSH 3HN8A 5DMIL 3ZZ1A 4NKDA 1FL6B 3U83A 4Y1AB 4UBDD 4XMKL 4BFGA 1AQKL 5D1QA 4UWQB 1E90A 4MYPA 1EHLH 1VHPA 2Z31D 4G6ML 5GS0C 4NZTL 3BAXA 4FGMA 1DJXA 1D5MA 3QO1A 4JG1L 3B34A 4TUJB 3ILEA 1UJ3B 1KPVA 1M9SA 1GHFL 3BH4A 1N64H 2EO1A 3BWSA 1OGAD 1K6QH 4QWWC 4CVUA 3OB0H 3B5HA 3QDJD 3QVAA 5BS0B 4AKQA 3T8VA 2BSTB 5DVNA 4FFYA 4XX1G 3EYUL 2A74A 9PCYA 2C26A 1Q72L 5LQBH 3RWJA 1DVQA 4WFHE 2K45A 4N2KA 3NIGB 1MVUB 2XXMB 4WTZA 3WNNA 1NL0H 4XAKD 5TD4A 3T9WA 3V4PH 4OD3H 3B3IA 1H8SA 1LWHA 5GGTH 5IB3B 5FW6A 4JZOA 3CWGA 3C5ZA 5DMIH 1KOAA 3MRJB 3ELAT 4H13C 3QUZB 1FFOA 4XMKH 1AQKH 1BEXA 3DBSA 2ZX6A 3SE8L 1IO4C 2JELH 1JV2A 4YBHA 3WJMB 5L4JA 4NZTH 4EUPG 4AIOA 2NSQA 1OM9A 3CFBA 2H0FA 5ECJE 2AAVA 4JG1H 1VSCA 2VM9A 5CILL 1QNIA 3FFCD 2WTRB 5I16A 4JK0D 1GHFH 3L4ZA 2EC9T 1OTSC 3VFPA 2Z35B 2GTZA 3VWJB 5KJRL 4HJGB 3ZE0E 1F45A 3OJVC 1NUNB 4XXWA 1O9WA 3CSPA 4H44C 3HE6D 4P05A 4U1JA 5I5IA 1ACXA 4L3CB 4MNGA 4OZGA 4WFFE 2E86A 3WNOA 1NMBL 3ARBB 3EYUH 4Y16C 1I31A 5EEWA 3SDXA 4HEPG 1MHEB 4F58H 4XHQA 3T5WA 3UAAA 2B4CL 1YQ2A 2Q10A 1BG1A 5DTFA 4MAYD 2BCKA 5MENE 5B38A 1HKLH 4X9GA 3B9DA 2CG9X 3D3VE 5ICYA 3ATDA 5C0BB 3RVVD 2ZKHL 4HUNB 3N50A 4U7SA 1AI1L 4KKCC 4OBRA 2HUEA 3HAEH 2CGRL 3DX4A 3SE8H 4JW3A 5ITFB 3ULVF 3NFNB 3D25B 3DX8B 1ZPLA 5J1TC 5JNYA 5CILH 1W6WA 1ORQB 3AREB 4YE0A 3A6CL 2MKLC 3QEQA 1A3QA 2M1KA 4NN5B 3VQMA 5KJRH 5DJDA 4PJ5E 4HEMA 1FFTB 5C0CD 2WOYA 4GKNB 2YO3A 3NZHH 1NMBH 4RMQA 1HQ4A 2V2WA 1SJEA 2V5SA 3IGFA 4UT6A 4X7TB 3TO4D 5DUPH 5KYWA 1IARB 1AXTL 2VLKB 3D4YA 5DVOA 2B4CH 5I74B 4N20A 3BESR 1QBLL 4EE2A 2NPLX 4B50A 1QHPA 1RUPL 3SKMA 2Z7YA 4KK5C 4UNTA 4Y5XA 1U8OA 3TBBA 1A3LL 4P59L 2X05A 5C09B 2OXHA 1X5FA 3KWTA 2ZKHH 4D9QD 3VRIA 1Y07A 4HCRL 5B7EA 1AI1H 3CFUA 3BWAA 1CVRA 2CGRH 1DN2A 4WVRA 2XIDA 4P2OB 5JPMB 3PXHA 3BP5A 4N8VG 3HNSL 4P3DB 2WVVB 3HZMB 2P42B 1XCWA 1HHIA 1W0WB 4W1TA 3FQXB 3HCVB 4BDVA 5F7NC 2VITB 4Z1PA 1BD2A 1TJHL 3FO2B 4EBQL 1W0YT 3T0DA 1F42A 1W0VB 3F85A 2G75A 4Y4FD 5JXAL 4MMZB 3A6CH 1LEIB 2B3RA 3WNLA 3DUUB 5MHSD 3U7WL 1J87A 5MP6H 3CN1A 5C0IB 3WFDL 4GXVL 1IM3D 3V6ZB 1XBDA 3RWFB 3OJDB 4PRHD 1U91B 5I24A 5IQ7H 1CDHA 3B9AA 3DURA 4HUMB 4MZ3A 4HISA 3OKEB 3HG3A 1CFTB 3HG1D 1F4HA 4OFVA 1AXTH 4XBPB 1AD9A 3GGWA 5DEZA 2OZNA 1QBLH 3SGJA 3CSYA 3MLRL 2G9HB 1RUPH 1V27A 1OZUA 1FFQA 1ET8A 3VTTA 4KMLB 4QRPB 4EF3A 2EEDA 4P59H 3FHQA 4XC1L 3NFPB 5CS7A 4HCRH 4ZTPL 2C8NA 2ZXBA 4B9YA 4GBXA 2OKMA 4ZS7L 4QRQB 3HNSH 3CCHB 1KIQA 2WLZA 1NC2D 2X9YA 3CVIL 3GLEA 4Y19D 3HKFA 1TJHH 3KM2A 4EBQH 3CH8A 5ID1B 5JXAH 3R8QA 3IU4L 1R3KB 3U7WH 3NCWA 3AGVA 1CPUA 4YHYC 4QI3A 3VDAA 2VLRD 3T6WA 4GXVH 3HVNA 4GLRI 3KLKA 2X9ZA 3UCRA 4DOHE 5T1JA 2HLAA 1DQVA 3G5WA 4MRCA 1T0NA 2P8PA 2XKSA 2E9WA 5G5DB 2AXGB 4EUPB 2EYSB 4UNVA 4UNUA 4KI5E 1SJVA 1UVQB 2XBTA 3KLHD 1JZHA 4R5VA 4Y9FA 4DP1X 4MHHG 4Y9GA 3TV3H 3ROOB 4BWWA 5C3LD 4GKZA 3MLRH 1KDIA 3WDJA 3J27A 1C5DB 2JXMB 4XC1H 1WH0A 2O6DA 4NO3B 1BPLB 4XZUA 4HPOL 1B4TA 1KTBA 1TXKA 1XF4A 4ZS7H 4U1LB 3WDHA 3U1QA 1KLUA 1FO0A 3P0YL 3RPIA 4CBZA 2XTLA 3CVIH 1Q94B 3NQKA 2GEEA 4WDIB 4ZNEA 5IBUB 2QSTA 1Y18B 2CKBB 4UAOB 1TJGH 3OX8A 4OM1H 3LNFA 3IU4H 2R69L 4P46A 1K8DB 3OG4B 2Q8AL 2W80C 3GLZA 5E8PA 4QRRD 3WJLA 4FTVA 4NN6B 3D8MA 4RMTA 1NBZA 3NZSA 3IDGA 2IOIA 2RD0A 3IRPX 1IL1B 2F54E 1LDPH 1WAPA 4HXBL 1U33A 3QDMA 2DIBA 4XNYH 3VXTB 4JDTL 2WSDA 4B41A 5BQ7A 2OLDA 5GGSY 3QR0A 4ZO8A 4PW9A 4G70B 2HZHA 4OUUB 5IW1B 2OMBA 2X10A 5LBVA 1E9OB 2VLMD 2GJJA 4TVPE 3RGBA 5JHDD 3DHJA 3TIEB 5KSVB 4DF9A 4YQXH 3TF7C 5AAWA 5FOJA 3BZ4A 4OCWL 4HPOH 5F7DB 2OL3L 3V0JA 5C07B 3T3PB 2JCCA 2P5EA 1HI6A 5HGAA 3P0YH 5BMFL 1JE6A 3CJJA 1T20A 3T2NL 4OZIB 1EO7A 1PZAA 3D30A 3E3QC 4OFYD 2OJZL 2R69H 5E8NA 2Q8AH 3FU5A 3H3BC 1CFMA 3SDDC 2VIRA 3MBWA 3OR6A 1JZ7A 3OMZA 5L9DL 5GGVL 3FMGL 4N8VB 2BWQA 4I2XE 1HXYA 4YXLH 3HKZA 2F1BA 4MNQA 4HXBH 4O02A 3ZE1F 4JDTH 4GRLB 1T1WA 1PVHA 2PYFA 3IGKA 4HAFA 3DTXB 1SVBA 1SY6A 1IGCL 1ZLVH 5D96B 1ICTA 4EI6A 3VRLF 2BRQA 2AEIT 3BH8A 4LDCA 4YPJA 3FUDA 2FL5B 3ZN6A 3C8DA 4AT6A 1O7DE 4N5EC 2DMCA 4W70A 4OCWH 2OL3H 1OEZW 4MJHA 2NW3B 5ANHA 4QXWA 2EDXA 4Z77A 4L8SB 2UYLA 1SNRA 3MBEB 4JCMA 5BMFH 5CD5C 3FC8A 4UQ2B 5LNDA 4JY4A 4JM4H 4NZFA 4Q0XL 3T2NH 2IGFL 3PWPA 1G87A 5D7LE 5I17A 4Z0XA 1I8LC 1UD5A 2QKSA 3BWZA 4Y4KD 3EXLA 2IC2A 2J8OA 2X9XA 1K4DB 2R51A 3IMTA 4A1RA 4M7ZB 5L9DH 2J20A 5GGVH 4FNLL 4PGEB 1WC7B 4LSQH 5EOQH 4DO6A 4TQIA 4AI7A 2QQLH 3N41B 3TGXA 5I1IH 1DQTA 3TBVA 3RZCD 4GKOA 3RWCB 3GUTB 4GQ9L 3GMPA 2FB4L 2QKIC 2YAFA 1A1OA 1AR1D 5F9DC 4AK1A 4OVUA 5I1LA 2CPUA 5JUEL 3OKOA 3MRIA 1VFAB 5HI3C 5AVWB 3X3GL 1O7VA 1XD0A 1MAJA 3FCGA 4AX3A 1NCIA 5DU7A 1IAKB 3TBCA 4KFZC 3NJNA 4DKDC 1ILSA 4PWHA 5JPNB 5DFWH 2IWKA 1E9PA 1XQ4A 1W2KT 2FEDD 1C08A 3QORB 4Q0XH 1A4KA 2Q5BA 3VGHA 4GUPB 2IGFH 2LHAA 3MJ8A 1TQBC 1DQJB 2A1WH 4BK5C 1BLNB 1UFUA 7CGTA 4XMZA 5SX5H 1U93B 3GMNA 1OSEA 3ZDXB 2NY3B 5FA3B 3RHWF 4FNLH 3GXUB 5INCB 4ODUB 1GMEA 4QRUB 4EN3A 1AO7B 5CIPH 1MCHA 3QIBD 1NGYB 1ZLUK 3BHBB 2BNRD 3MJGX 2R2HB 3RNQB 4GQ9H 4I7ZC 4Z3IA 2WVUA 2QR0A 5AKTA 2FB4H 1NCNA 4NO0B 3HPLA 3MI6A 5AVTB 1G7LA 5BZDB 2D31B 2CLZA 3CHXA 4YAQA 5KTEL 5KVDH 5FO9A 3OKMA 3NJLA 1NEZG 1TZGL 2YPLB 1HHJB 3X3GH 2VR7A 2WLIA 5HVHC 2VNCA 1E7UA 4Q9RL 3MLVL 5EHFA 3U30C 1DVUA 4AIEA 4YHLL 2UWEB 3JT0A 5C3IA 2XXGA 1I4FB 2Y07L 4Z9KB 3ZSSA 5HGGS 3W5MA 3U48A 3SZ6A 3X1EA 1Z2KA 4WIQA 4S1RL 4TNGA 5I1CH 2R2EB 3V6FB 4RWYL 2P5WE 2A9CA 2OFQA 4K9JA 5A1AA 2RGSA 1DL7L 3MNDA 1INQA 1W8NA 2OS7A 1JP5A 1AH1A 3G08B 5AVVB 1HWGB 4XP1L 4G83A 3RVXC 4JFED 3TWYA 4QXVA 4Z7UF 2EEBA 2DQJL 3SPVB 2EVIA 2IFGA 3LN5A 4IRSD 5ADOH 2A38A 3C6SA 4HJGA 4JBSA 5KTEH 5CXPA 4TLKA 4OF7A 2F1AA 5ID0B 3HNTL 2GSMB 4JO5A 1JPTH 3WGUB 1DO5A 3NJGA 3MLVH 4B0MM 1XH3A 2Y07H 4RZCA 4PGDA 3QJTB 2MOQA 3EH1A 3MCLL 4RZKA 2XLLA 1ASPA 1PIGA 3I85A 4UZUA 5ICZB 3GSVB 4S1RH 2YFOA 3UP6A 4RWYH 1NCBL 2OSLA 2A6KA 5E1GA 3RTLA 2ZXDA 3WIFA 4L4VE 4OGAD 4Y5VA 5AKVA 3BXNA 5JXED 4HGWB 3WTTA 5DURB 4N90D 1AACA 1DL7H 4LPXA 3D25A 3GJEA 2EXSA 3QI9A 5KVEH 3WTWA 2YN5A 1DJIA 1QWUA 5GJSL 2QHRL 3O9WC 4MZIA 2BP0B 2YPKB 4NRYB 1X7SA 1ORQA 2MH4A 1MH5A 1D5RA 2WXKA 4K0OA 3UABA 3L08A 4F9LC 1P6AB 3KBFA 1XF2B 3SHSA 1TCMA 1M7XA 5IMOB 1G7HA 5I1GL 3HNTH 3W0WD 3FUJA 2NY4C 1SXAA 3M1OA 4KNTA 3EYFB 2K9FB 3SO3C 3ZE0B 1GC1L 2FWOB 3GIZL 1U3YA 4CSSA 4Q2ZA 3NESA 3S8GB 5KG9B 5KSAA 5E51A 3MCLH 2BNUA 3KPLA 3UZQA 3HRPA 3WFEL 2BVTA 4L0PB 3SE9L 3TBSA 3MRCB 1NCBH 2I9LA 2Q6WA 5C09A 1T5KA 1F97A 3WIHA 1IAMA 3D48R 2D0FA 3HFML 2DQGL 5MENB 1NOLA 3C9NA 5FYKL 5J13C 3D3VB 2WVVA 2NNFA 4TNVK 4RGMB 4S1DD 3N44B 4NHUB 2WHVA 3DIDA 2QHRH 2QJDA 4HIJA 4FULA 4ZOBA 4M1GL 4FQHB 1VGKA 1IZJA 4ONFH 1EXUA 3HR5A 2NUTA 2W07A 3OXRB 3HR6A 3PDGA 4N0CC 5B8CB 1ACZA 5KSBE 5I1GH 2NZ9C 1KTDA 3T4AA 3HBQA 1U3HD 3LN9A 3A22A 1SZNA 1PD1A 1GC1H 4PJ5B 4G9DB 1PL3A 4BUQA 3OHXB 3BUQA 1XTLA 2MCAA 3FF8A 3IBEA 3WFEH 3AGWA 3OWEA 5SX4I 3VO0A 1MCRA 4PJXE 1MW0A 2HT3C 4L2LA 3PWJA 1MHHA 2GJZB 3QAQA 2J6EA 2H1PL 5CD3A 1NEZB 4U1KA 5E6YA 4CVZB 4NM4L 3WKQA 2DQGH 4YHZL 4UQ3B 5E6IB 5FYKH 2GBAA 3IFOB 3ZQXA 1OCCB 2DICA 4YSDA 2YUWA 2PPFA 4C54A 1A6TB 2P4AB 3D87B 1DUYA 1WHPA 2VISB 1HC1A 1VEMA 4KJYB 4KROB 4J5VA 3DX6A 2L7UA 4M1GH 3IU3B 1DN0A 2B7DT 3KCPB 4UUJB 1KB5B 2KC0A 4HJ0C 4J4PD 4MHHI 1V10A 3JTSA 5FDYA 4R2GB 1YPZF 2KLRA 4Z95L 2EYTB 4GI6A 3TA3D 2HFGL 1ZGLP 4ZODA 4K5LA 2XZCL 4EUPA 2BINA 3BQUD 3SBQA 2K8MA 5JW3L 3L9RB 4Z7VE 4FA8A 3KHQA 1AD0A 2PCYA 3BX7C 5EOTA 5HYSG 2KL6A 3QEUB 1KV3A 3PP4H 4QLRA 4ADGA 4CN1A 4OR1A 5B3JE 3U4AA 4AZUA 5I26A 2H1PH 4AQ1C 4PJ9B 4XN2A 3JYCA 1L9QA 4GSUA 4HEPA 4J6RL 4BFIB 4NM4H 4NO3A 4YHZH 4DFHA 3BPOB 3GSWB 4KRPC 3DI3B 1I1YB 1NPNA 4I0PB 3CX5K 3IN2A 4YIQB 4ZX3A 5DRZB 3IM1A 3CBKB 1MWAB 3U9WA 3CZJA 3ROLB 2ZKMX 1MI5A 4QHUA 1USQA 4AVKA 1DBMH 1Z9OA 4U05A 4Z95H 2HFGH 2FIKA 1O0VA 2XZCH 4BJLA 2NY7H 3D85A 4W9FC 1TJIL 1PYWB 2WLLB 2YJQA 5GZNA 2YPVL 2PCPA 3D2UA 1OP3H 1CXKA 1XAKA 4N0RA 3QR1A 2B9BA 1DUZB 2F5AL 3N06B 4JFXA 3VXME 3BZFB 2CBOA 1KJ3L 4FF9A 3BISA 3EG9B 1R3LB 5HJ3A 1WIOA 4JRXD 1X9LA 1L5GA 4IRJC 2BVUA 1KTLB 1TTRA 4FCAA 2IPKA 1RY7B 5HDBE 5LGKA 4LCWE 1HXMA 3ML9A 4O2EA 1KGJA 2X1WL 3FQYA 3WNPA 2I60L 3ARYA 4PY7B 4DSYA 3Q6FB 2J1XA 5J5EA 1ZHKA 1J86A 4Y89A 2FHBA 1N2RB 3OKNA 4V1DE 1X5ZA 4KKRA 4JGUA 4JHVA 3DC0A 2VWEE 4FG4A 5HHXL 4DIXA 1OOWA 4AW7A 3NEOA 2FR4A 1KLGA 1H9DA 3X3FL 5C0EB 1QLEB 1XXFC 3LEXA 1IZKA 1IQWL 3RTQA 3J7HA 1TJIH 3F62A 4QHLA 2IEPA 5GS0D 2X41A 4NYLB 4H25A 3EGXB 1UYWL 4NUGL 2F5AH 4M8UA 2F54B 1KJ3H 4IBWA 4OGXL 3D18A 2XPGA 5AD0A 1U8JA 3QT2A 4DQOL 5E2VL 3GKWL 4YDVB 3P77A 3G6AB 4OW6A 4YVNA 3E1F1 1AC0A 5E5MB 3X11B 4APQD 3D39A 5BXFB 4ANVA 1FZJB 2HB0A 5D2NC 1UHVA 4OF0A 1YAZA 3UEZA 1FF5A 1VB9A 3FH5A 1X5GA 1FQ9C 5DJ0A 1FZOB 5I6OA 1JZ6A 4HMCA 4WU7A 1EX0A 4PWGA 4NKOA 5IP4A 4Y2LA 2QV4A 4FG0A 4JFYB 1IM9A 2C7UA 2CA4A 3ARTA 3NYKA 4UQ9A 4HIPA 1F1AA 4RNRA 5J6HB 3SKOA 4L05A 4NT6B 3B37A 4DPCX 4I1RA 2FBOJ 4KXZI 1XR9B 2YMTA 5A2AA 3AMLA 3KYOB 2OMTA 3BI9X 4FNRA 4NUGH 4I2XB 1ZIAA 1E8WA 5DVPA 1Z66A 2OA9A 2OMYB 4DQOH 5E2VH 3UAJD 5AW0B 2V17L 3GXPA 3L17A 4IHOA 3V2AR 5J6GA 3ATFA 4JJHA 5T33L 1MFCL 3LQZB 4RDQG 3HC2A 1EIBA 4Z7UA 5EO0A 1JXDA 3CN0A 2NR6D 1EBPA 5GSRA 4DNLA 1OM3H 3ECBB 4W6YB 3P9WB 5GZOA 1LE9A 1RP9A 2QPDB 3F5WA 2AXJA 3APCA 1PSKL 1A5FL 1G9ML 4X5WB 5K9OA 3E0GA 1CF8L 3V5KB 4XP4L 3LXBA 2IANA 5E4EB 4IK6A 1AS8A 5D7LB 1AO7A 3WDIA 1F18A 1SLUA 1X5KA 5CEXA 1ROWA 3C6LD 4D0BB 4WWPA 3OSVA 2GJ6A 1CD8A 3RVWC 4JPQA 3LKNA 2IFFL 2OCCB 4XPFH 3FQUB 4F80A 3O8XC 2EXTA 2GPZA 2X6VA 1JPFB 2BVOB 4JJ5B 3MV7D 1EERB 4UT9A 2ZXGA 1MFCH 4XGZB 1AQMA 5IQ9B 3S8FB 4ONGH 4GSDL 4XMVA 1IAOB 4C83B 2QPUA 3FO0L 3DOHA 4ZMWA 1S2EA 1AHWA 1RULL 1G7PA 1AMXA 2J44A 2H2SC 3QYMA 1E2WA 3FUMA 3GIVA 4WK2B 5CUSL 1PSKH 1A5FH 2E9GA 1G9MH 3VI4E 4XP4H 4AYBA 1QW9A 4F5CE 2Y69B 3BAWA 1XB8A 4L29A 5CZRA 4WHCA 5A16A 1FN4B 4P4KB 1TO5A 2VDNL 4LEOA 1T7VA 3HB3D 3M1BB 1JYVA 5T3XH 5DI8A 5F21B 5CCHE 3P2DA 5BUPA 4POZD 4LKCA 1I75A 1N12A 1T4KA 3J07A 1YN7B 5ID0A 4UM8B 2X4PA 1LE5A 2BSEA 3GXMA 4IK7A 3MV9D 4C47A 3LY6A 4N2NA 2VDLB 3PFUA 3FUNA 3IJYA 3IVKB 3JVGA 4GSDH 4LSVL 5DD6B 3REWB 4FDWA 3FO0H 1XGZA 3QNYA 5EBMA 3EFOB 1IBFA 4X8JA 4RRPG 4QNPE 4P3WA 2HRGA 2FX9L 2O5YL 2TAAA 3MRDB 3NP3A 5FO8B 3QWRD 4BKLA 2F6AA 5CUSH 5MEQB 5IQ9A 3MSPA 4Q6IA 1OB1B 4P2QA 4Q4EA 5LAXB 4I88A 4X5XA 3IJHB 3S3DB 1JWUB 1OE3A 1Z9SA 3PABB 3KDPB 4H20L 2P5WB 2QTEA 3FCSB 2VDNH 3O41A 2X4QA 3CTTA 1QFWL 4X6DE 2CDFB 5D2LE 2UUDK 2XNAB 2XWTA 1Z0NA 1NCAL 2DKMA 3L7FB 1B4JL 2R7EB 1EPFA 2Z65C 3QDGE 1G43A 3OQRA 1U6AL 3EFFA 2ZXQA 3OKDB 2DI9A 4NJAL 1X5HA 1XHHA 3MCYA 3MRBB 5GHWL 1Q9WA 3KPMB 1CL7L 2AJSL 4G80B 2DIJA 1AZVA 1XTMA 4FLSA 2A6DB 1OPGL 3P4OA 4QXGH 3ZDYE 4Z7NF 1FVCB 4LSVH 1GCFA 3DO7B 1QI4A 4CADA 3ZLQC 5EDXA 2IH1B 3IAPA 4LNVA 4ZAKC 3RJQB 2FX9H 2O5YH 4A6YL 4MA7L 1BA9A 4X0NA 1KBBA 3WXVH 1YPZA 4P8QA 1CGUA 1ZT7B 3FB6B 5J9PB 2WINA 1KIRB 5AAMC 2GI0A 5DJ6B 3EYSH 5MENA 2F53E 4IBTA 4NQQA 3RDTB 3AJ7A 4H20H 4BXSV 1FRGL 4PP2A 3GM0A 4JKPL 4L4VB 2X70B 1QFWH 5AWNH 1DVFB 2E4TA 4A55A 3VXOB 1KACB 2ATAA 1XL4A 3SCMD 1NCAH 3QPKA 2XOTA 4ZMZA 2Z4QA 4HHAB 1U6AH 3ZL4L 4X9BA 5FFLA 5AUMB 4DUWA 2NY2C 4LP4A 4NJAH 5E1QA 3U4KA 3CVHL 3L2LA 4WHDA 1OK8A 1CL7H 4U6YA 3ATEA 3K2KA 1AHMA 2X89A 4L9LC 2IAMD 4N8CH 2Y6TE 3SQBB 5JQIB 4NENB 2CIKB 3AAZB 1UD8A 3HRZB 1R75A 3FQWA 1LNUA 2EE6A 3MNZB 3U46B 4A6YH 2P9RA 4MA7H 4G1EA 3DYOA 3M1CA 2EDHA 2GSGA 4MVBD 3DVGA 4OFPA 4OZFA 5HHOE 3D07A 2VN4A 4RAVB 3TYGL 1CURA 4LZKA 1FRGH 4F1SA 5CZXC 4JKPH 5DK0B 5D7JC 1QZ1A 4F15B 1RI8A 2QSCH 2J2ZA 2D8KA 3GXTA 1P69B 1PX3A 3TBWA 1YG9A 2R1YB 3QUHA 1BIIB 1DJZA 1JZFA 2JIXB 1JERA 3Q2NA 1YMHB 3SY0B 3ZL4H 4F20A 1Z5LB 1A1NB 4I48A 2R23B 3FU7A 3CVHH 3RWGB 1K85A 3DXAD 1XSJA 3V7MA 2AJZB 3S8WA 3CMOH 1NGPL 2WO3B 3L9RA 3MO1A 3S35H 5KSBB 3HS0C 5DQ9A 1SLWA 3GJFB 2DM7A 1U58B 3B7UX 1UCTA 1XZ0B 4YZFF 1EBAA 4LLQB 2CHXA 3FONB 2V7NA 2DDQL 3C60A 1S6NA 5G2NA 3SPHA 2PTTA 3MRQA 4QTHA 1FPTH 2VTFA 4JFSA 1T1ZA 4F37K 3WEMA 2ED7A 2IO5A 1F4AA 4NQCE 5EU6E 4F7PB 3G04A 5B3SB 3GINA 4PJXB 5E2WH 3EW3B 3LKOA 4PM1A 4YWGL 3SDYL 3TYGH 4DETA 2E59A 1ZGLM 3Q3GA 1S7XB 1J18A 2UY7A 2C9RA 1R5IB 1WYJA 4DKAA 2EC9U 2YOCA 1WSST 3UPAA 3Q6GL 1BVZA 3G5VB 5CP3A 1T22A 1MXGA 1INEH 4I4WB 1MFAL 4KDWA 4HV8B 4KI1A 1NC4B 1EMTH 4DP8X 1G0DA 3KGRA 1FL5B 1KXVC 2WLLA 1NGPH 4FNQA 3DROB 4HLZH 5JDSB 5ESQB 5C08A 1BG9A 5LXVA 2D03L 3E8UL 3VXPB 1CTMA 5T3ZL 1JZ4A 3VQLA 4L3AA 5FYJE 1KJ2L 2XU9A 1LL1A 3LH2L 2DDQH 1OW0A 4M8QB 4XAWL 3EG9A 4Z7VB 4OV6F 5BOJA 3MX0A 5LGYA 4JPVL 3S0PA 4KHXL 3H6JA 2KLTA 4GAYA 5TDOB 1ADWA 1GC1C 4YWGH 2NX5D 5CEYA 3SDYH 4XPAH 3K5SA 32C2B 3CSTA 4NPYB 1XF5B 4DO5A 1XGUB 2ESVE 2YD9A 1K5WA 3AQXA 2MNUA 4ZG1A 1PAMA 2GK0A 3TFKD 4LL1A 3A67L 1X9UA 3W37A 1BZDA 1U8MA 2CDGA 2EEXA 5J1AB 2WNWA 5GJTL 1KGCD 4ISVB 4QGTA 1KDJA 2MHAA 4JFWA 1MFAH 1AP2A 3L3GA 4X99B 1ASOA 3KXFD 2VDPL 2C9QA 4F57L 4J3OF 3E8UH 1A1MA 3SDCC 4DPBX 1QEWB 5T3ZH 3VD7A 5IMMB 3V8CA 2ERJC 4ACPA 4OGYL 3SDAB 1KJ2H 5AOLA 2WQUA 3LH2H 4XAWH 4W9EC 1TT6A 5B1JA 3GSRA 1SGKA 1OF2A 3N40F 4JPVH 2XN2A 5IBTL 1WE5A 2DYPD 1UT9A 3UGEA 5KYUA 3VXMB 2CH8A 5DJAA 1UKSA 4G8GA 4JQXA 1VACA 3NCEB 3RDJA 4N87A 4N1CA 4WZ9A 2AQTA 5HDBB 2M26A 4LCWB 1WBXB 4NO2B 3TZVB 4NRZA 4OBSA 1GJUA 5DVKA 4HKZB 3VXUE 3CH1A 1R24A 3EOAA 4LHUG 3MUY1 2Q7AA 4JPWL 1RZ7L 3P9LB 4V1DB 1CDBA 4QHNB 1WK0A 2JKTM 3IWUA 3ARWA 2Y3NA 4OJEH 4JRFA 2VDPH 1PD0A 4F57H 4LPWA 1UKQA 3KYOA 4MJ6B 4YHKL 3ULUL 3DSNA 3DX2A 3LD8C 4AM0Q 4OGYH 1QSFD 2GJPA 2J25A 3RL2B 1NH6A 1YEHL 3H3KA 3BUBA 3LN4A 1NIDA 3F7KA 4U3HA 3ZOAA 2BWDA 4ZXBD 3OAUL 4ZX6A 2JKJA 2H7WA 5IBTH 2VUYA 5DK2A 5FGSA 5KWYC 5ACMA 1KJVB 1A6WL 4RX4D 4QF1A 3PQYA 5ISZA 1KFAL 2ARJA 4YHML 3ULUD 3DRQA 4B5EA 4AYDC 2NQCA 2X6UA 1X7QA 4AEIL 1KGYE 4F9PC 3BAYA 1XCQA 3WTYA 4QRBA 3P54A 3TWCL 2CNYA 2X9WA 3O6MH 4U31A 3ESMA 1CU4H 4L5FL 1FP5A 1U8KA 2ICEC 3O4LD 4X5WA 3THMH 3V5KA 4NFBA 3UERA 4LVNB 1RZ7H 2V6HA 1JZDC 2WCSA 3WKPA 5CEZD 1DR9A 1CK0L 4J1UB 1NDGB 2R2BA 1ZA6B 4PIBA 2RTTA 3S3CB 4D0BA 5TF0A 4L4TA 1RZJH 2XN9D 4YHKH 1N19A 1Q0EA 3BEWB 5DZ9A 3DECA 1AQDB 2VDRL 1ND0B 1YEHH 3L81A 4LDLB 4B9PA 4HUUB 2W0FB 4DN3L 4FP8L 1KC5L 2IBGA 5BOPA 5B7FA 3OAUH 3LMJH 5AW3B 1AXSB 4QYAA 2ROYA 1G9NL 2YXMA 3Q8FA 2IMMA 3HIZA 4K3JL 3RHWK 1C5BL 1OGAE 2HFTA 1XGYH 1BVLB 1LD9A 1A6WH 3QDJE 4GAGL 3P9MB 4KJPD 4B7LA 2ED8A 4HJSA 5E24E 1KFAH 4QY8B 3VXRE 1MIEL 3UBGA 3UO8B 1ECYA 5CN1A 2X0VA 5L7XH 3MACL 4AEIH 2ZOTA 1PZBA 1TQCC 4ORZC 1ZVSA 3TWCH 2DWXA 4L8BB 4XAKE 3PGCB 1A22B 2QPFA 2H6UA 4AXWB 4PGCA 3TN0D 4Z3EA 1G4RA 1UZGA 2X3CA 4GO6B 2M2DA 1QTSA 4A66A 5F7KC 1CK0H 1QP1A 2Z8SA 5DJYB 1NEPA 1P5UB 1EZVY 1CT8B 4CN6A 4ZI8A 3KR3L 4ICXA 2CO3A 4L1SA 2GEQA 3FQRA 5IB4B 1R17A 2Y5TA 2ZCKL 4NSKA 2BXZA 3PNWB 5CSZB 4DN3H 3FFCE 4FP8H 1KC5H 4KK9D 5IJKC 4PI2A 3DMMD 4XXDB 4EKJA 5DHYA 3B2UD 2W5PA 4TTDD 4G8IA 4UQCA 5F8RC 4ZFFB 4K3JH 3LKRB 2EIEA 4U1MB 3QUXA 4F24A 3V5DA 2X4RA 2Y4SA 1WAAF 3EHBC 4YHIA 1MIEH 3N43F 3OXSB 3MACH 2FQEA 3MNMA 3M7OA 1MQ8A 1K2DB 5HPOA 1EJ6A 2YGNA 4WU5A 5KUKA 3D0LA 1LVEA 4Y9BA 3QYNA 3W81A 1HHKA 1E0OB 4K94L 2PYEA 4LOFA 1MUJA 2WBJC 3PL6A 4D0DB 2R4RL 4OKVA 1QMUA 3BKMH 3M17A 3VI4B 1GAFL 3KR3H 2YD8A 4F8PA 1F4YL 3V4VL 3UTZB 4KX8A 5FYLL 1SYSB 3PDOB 2P7TA 2ZCKH 1T5WA 3C2SA 1EVUA 2YA1A 1YMMA 1MY5A 3I75B 4LHUB 4PJHF 2APWA 1XH2A 3MROB 1AGEB 4KV5E 3KPMA 3LZRA 2F58L 3DIVA 3O6FD 5MERB 3EDJA 5C0CE 3RGVA 3KGUA 4TL5A 4BZ1L 2AK4A 3WN6A 1WFTA 4JL2A 2KI6A 4PCKA 4JB9H 2HTKD 4WUUA 4CVXA 4K8RH 4LPVA 2WWMC 1H5BC 1OAZL 4GQPH 2YK1H 5CF3A 2DPKA 3MLUH 5FGBC 3UIYA 6FABH 4KY2A 1KIRA 1YEJL 2OMWB 1QABA 4K94H 4ZW8A 2HG5A 3MKKA 2HVJA 2ITEA 2R4RH 1LK3H 2ZICA 4D9QE 4YDLC 4TNFA 2IXQB 4IBLT 4KRPD 3KG5A 3TBYB 3WEXB 5TK4A 4N3TA 5SV3A 1F4YH 1BZ7A 3VXOA 1LO3L 4OQTA 3RRQA 5L2KD 3OWRA 5FYLH 3SIKA 5EV7A 1B9KA 1P7QA 2H9GB 2W9LA 1AJ7L 3K2UH 4FFWC 1FHNA 3SJVD 2PCXA 2W88A 4NQXA 4X6DB 5JW4N 5D2LB 5TGBA 3T0ED 3FRPG 1I1AC 1ZHBB 1LWRA 4EQ2A 1MCCA 2F58H 1MCFA 4OZHF 1N18A 3QDGB 3IFPA 3MGOB 4IU2B 4F7TB 3JYBA 3SQBA 4L1LA 1A8JH 2UZYA 3A0OA 1JS4A 5JOPD 5MEPB 1E4KC 1OAZH 3HG1E 3S36L 3BZDA 4FJZA 2YARA 4ZMAT 3WHXB 1ZDQA 3ZDYB 2QPSA 1ET5A 5HVGB 1YEJH 4Y2DC 5E08L 3ZDZE 1FA4A 3BWUC 4NHCL 1WVZA 4K4KA 5LBSL 4X4YB 3SGKC 5GRZA 3CX2A 4LSUL 3ZX1A 1X5YA 4H8VA 1PFCA 3CUPB 3ZJAA 5HPMA 2JQMA 2XWJA 5PAZA 5IB2B 4ILDA 5E5RB 2F53B 4N22A 1LO3H 3IDIA 1I3RB 3DHMA 3GSUA 4NZJA 3E6HA 2CIIB 1SDAB 1TVDA 4PW3A 4Y19E 3VYPA 5L0QC 1D5BA 1PZ3A 2PR9A 3N1QC 4HWZB 1N59B 1E3ZA 4G6FB 3EGDA 2WTPA 5CBEB 2VLRE 2ZOKA 3HS8A 1MFBL 1SY6L 3K2MC 3O3BB 3GJFA 1GMIA 1BQRA 5KN5A 2QGEA 3LZNA 2XV3A 3PWNB 1SXCA 4BH8A 3UZVA 3VMOA 5G4MA 3ZKXC 1KY6A 1SF5A 1VENA 2O6FA 2AZUA 3S36H 5A2KH 2XJLA 3DETC 2WZPD 5D1ZB 4HBQA 3SE3C 2XA3A 3LQMA 5E08H 2WXQA 4NHCH 1GYVA 2HA1A 5LBSH 4PQXA 4Y0GA 2FIRT 5IEKB 5IKCA 4PS8A 1T04B 4JZNB 4G8FA 3MLTA 4YDZA 2DY2A 2OMXA 1XSOA 3H6AA 3WMPA 4FI6A 4LB8A 2F7OA 1JPGB 1B3IA 5HHOB 1JYXA 5F7MC 2CHZA 2PETA 2X4SA 3S37H 2QDVA 4OIIL 3GLAA 4E2OA 1D7DA 4N2CA 3WUWG 4R7NA 2GY7B 1ZTMA 4QRRE 1F41A 3EDFA 1MFBH 1SJHB 1SY6H 3FB7B 2QZQA 5DYOA 2C1OA 1OP5H 2HT4D 1JGUL 2P52A 2X3BA 2QPEB 2H32B 2NYZA 4NPKA 3V6OC 5J11C 2E4FA 4U6HA 1HYSC 1J5HA 2E6PA 3QULA 2J7LA 2DRUA 5DO2D 1HNFA 5MI0C 5LDSA 3ARSA 3H54A 4UIMB 4FKKA 1PQZB 2ZXWB 3WYRA 1F8TL 1BF5A 4ODXB 3U79A 2VLME 3F7QA 4P5MA 1XB6A 2HMIC 4ZYKA 5JHDE 2WUBL 3L3JA 4NQDA 1F6AB 4S0TD 3WNIA 5HHPA 5DJCA 3IMWA 1I8KB 4P49A 2AABL 4NQCB 1JFHA 5D55A 5EU6B 1EFXB 4XP9L 5CMAB 3WEOA 1L7TL 5ALBL 5IR1A 4N85A 2ID5A 2A99A 1FFNA 2I27N 5IVXF 5SWZD 5CJXC 3VSQA 1T0PB 5I6PA 3K8MA 4OIIH 1BLIA 4P23B 3VTMA 4AQEB 3QA3A 5JTWA 3QIUA 2PXYA 2ZUUA 4QRTB 4ODSL 4A63A 2E9JA 4WJKB 3K80A 4UDTB 4LRIC 1FG2B 1TKWA 5ACLA 4TQEL 2OYKA 4AYFB 1JGUH 3VFGL 4ABVA 2FT6A 1LILA 4LCCB 3WV0A 2ZYIA 3QXWA 4HBCL 1HL5A 4FQXB 3DGDA 2AEWA 3FN9A 4PRBA 3G5XA 1EHAA 2X09A 4IJTA 4NNXB 4XWOC 5GS1C 4XNZC 4G7RB 1P1VA 2WNGA 1BHGA 3PF2A 3VQ1C 1F8TH 1YAIA 5FKAA 4G8EA 4GINA 2HTLC 4F7CB 2AABH 5I73C 2ZP9A 4XP9H 1OTUD 2XICA 2EECA 4OLEA 5ALBH 3U4EB 1OCRB 3GD1C 3U6RA 4X6EA 4GO9A 2YSSB 3QARA 5FUCE 4GIOA 4HUXB 2WVSA 4MMXB 2UVFA 4NIKB 2ESVB 4MXVF 1LM8V 4G7VL 4Y2NA 2KUTA 2Z34A 5B22A 4WNQA 5AVSB 2UUDH 4ODSH 1GZHA 1KCWA 5K9JL 3DUSA 1R5VB 2BH0A 5HYJE 2XDHA 4ZZKA 3L7EB 1JXJA 4TQEH 4XNQB 3VFGH 2BMKB 1EZSA 3JTTA 5AKRA 3DVIA 4OH2A 1MJUH 1AY1H 2OQJA 4PRPD 4NM8L 4OLUH 1C8QA 1P2CA 4RMRA 4YHOL 1NZRA 1G0XA 4HOMA 1PKQE 4HIEB 2J6WA 4WEEA 1GKEA 4U7KA 1IGIL 1KJVA 3DARA 3SE6A 3LKPA 4A7QA 3I74A 3L4XA 4UTBL 4NFDA 3ARBD 2IALA 2HKHH 4I1PA 4FXKC 1TDQA 1GOGA 3AS2A 4MS8C 4OVVA 3JQOB 3Q01A 3PJLA 1FFPA 1XH1A 1F3JB 4G7VH 3EKCA 1FYHB 1JUFB 5T1LD 3FNKA 4EIBA 2NYYD 2BS8A 2NT0A 1E7VA 2DLFL 5K9JH 1NM9A 1RFDL 3VXUB 4HWBA 4XB3A 2YIHA 2ZD0A 4DP6X 5T1MB 4HKBA 2GIYA 4C4BA 2CMRH 3FS9A 2DM4A 3ARDB 4X7FC 5ESVA 4F7EB 4NM8H 1SQ2N 4PU2A 4YDIL 2BNRE 3ARFB 3TH2T 1RVFL 2Y23A 1VFOA 5GS2D 3MA7B 3CZFA 4BD4A 3WUWB 2FTAA 3ARED 4QAWA 5EN3A 4NLHA 4WO4B 1PGRB 2FDBP 1IGIH 3W11C 2RIKA 4TUOA 1M6OB 1YEDB 3EIFA 4MXWL 5D93C 5HYSA 4KJWC 4UTBH 4KUCF 1SM3L 4HUWB 4LLWA 2I07B 3WIHL 5IHLB 1WCBB 4PJBF 4KO7A 3WO4C 2UY6B 3EFDH 2VR9A 4DN4H 2FJUB 4FE9A 1S7VA 1FFRA 1FGVL 5I2IA 4UYPA 5D1ZI 3GC3A 2AXFA 4MA3A 5CFHA 5CJOL 4D3CL 2DLFH 1HAWA 1OLZA 1RFDH 3N42B 4GS7C 4JM2D 3TF4A 3QP3A 1Q1PA 2AEQL 1YYLL 4UV7L 3IDJB 1HSAA 3LNIA 3IE4A 4MA1B 1S9VB 4JPKL 4P2OD 3JV5A 1PZUB 2ARWA 5AVYB 3PCYA 4ZFOB 4TN9A 4JO2H 3FL7A 2FECI 1RVFH 2Z31B 4KZ0A 1CFSB 1CTOA 1S7SB 4JQIL 1MNUL 2Q2EB 3G5YA 4BRVA 3ABZA 3HMWL 2XTJC 4QDGA 5C2UB 4M7JL 5I66A 2OX5B 5DEGA 4F7KA 4MD0A 3WUZA 3ECWA 1EAPA 4G7QB 3WIHH 3CFQA 1OGAB 3R19A 2CO2A 3FCTA 3QDJB 1H3TA 2OMUA 3HS9A 4U1SA 2X38A 3X13A 1S7WB 3L48A 4HC1L 4RBPK 5C0AE 3QUYB 3P02A 4JMNA 2C9SA 3VXRB 1U8HB 1UXWA 1FGVH 2Y7MA 2A0LC 2ZOLB 4O4YL 4OZHA 1J8HA 2VLLB 5EC2A 3WL9A 4D3CH 1MG2C 4QRPD 5DA4A 3K6OA 3W39B 3QRGL 2AEQH 1YYLH 3QWOB 4N90E 4PJ8C 4J8QA 4UV7H 3RQ3A 4AQZA 3JV6B 1HEZB 1CICD 4JPKH 5SV4A 4M9OA 2EIZA 3UIZA 4PV9A 5LGHL 4ZDHA 4X5QA 1AGFA 4BEIA 2D73A 4LHUA 4YDJB 4D9RD 3LKQA 1K8IB 4HMEA 4IS6A 3PAZA 1QOKA 1EHKB 1A7QL 1MNUH 2BRRL 3VX1A 4NQEA 5IM7B 1Z3GL 3D51A 4Y4HD 2WYZA 3FFCB 3LRMA 5E94A 3W0WE 1AAJA 4XPBL 1IVTA 1RZJC 2E9IA 2WC7A 1KGUA 2DW5A 2KPWA 5JHLL 4KVNL 2JVUA 2WQXA 3P73A 2C3VA 2I9TB 5B7MA 1ZOXA 4PJ6A 3EOYG 1P4BL 4HC1H 2OMWA 3IYLW 3CAFA 3KYMB 4WW1A 4AKPA 1U8PB 2CKBL 3L1OL 2X6MA 4L37A 4O4YH 4QO1A 4NRXA 2ITDA 4MAYB 1DFBL 1BAWA 2V9TA 3RB7A 3BZEA 2X87A 5LGHH 4EUPH 2Y1AA 5FECA 3K4ZA 4XZ4A 4HD5A 2OI9B 2ODHA 3BSZL 1KV7A 1FYTD 1MCNA 5ETUA 2GAZA 4K3HA 2O61A 5MEOA 1A7QH 2BRRH 5JO5A 1WF5A 3L1GA 3X14A 2P8LB 3CSBA 5DWUL 1Z3GH 5GQBA 5DJZA 4IU2A 1K9TA 3CFIC 4XPBH 1B2WL 3QQNA 5JHLH 4KVNH 1NBQA 3MOBL 5C0CB 3V5HB 4WHYG 1P4BH 3BAKA 1LEKA 4YK4B 3JWNC 1E5BA 1LHZA 3O4OB 2EIJB 4ZW3A 1U2CA 2EVGA 3QO0B 2CKBH 3FTYA 4IBVA 3L1OH 3S96B 4QOKD 3ELQA 4AGNA 3CPLB 1JNHA 1SRDA 4Y5XC 2VR4A 3W1ZA 2ZAHA 4OGZA 4FYSA 4MGXA 1FV1A 5CO1A 2LTQC 3PS6A 4EVNB 5E9DA 4MXQD 4NNYA 5F7EL 1QRNA 4AG4H 1JTTA 3EUDA 1NCJA 3QISA 4EI5D 1JCVA 2V5MA 1N3NB 4W9KC 1JZ5A 1J10A 2FJHA 3K72A 3WE1A 3ZMRA 5DWUH 1D9KD 3VFUB 1E50A 1VADA 1P4UA 5DJ2B 4HOZA 5HTSA 3APMA 4ZQTA 3ECUA 3ZK0A 3JZYA 3SDDA 5IVXA 3MOBH 2J43A 1HSBA 4PFEA 2ADGB 2LT9A 4N26A 4B53A 1GH7A 3PHQA 2AFNA 1Q9OA 3TA4D 1TZIA 2BSBA 3TEZA 3FDWA 2EDDA 3FN3A 3U1SL 1IFHL 5IZ7A 4GUOA 4S2SA 3SGJC 1IGJB 3HG1B 3TYFB 3U25A 5K9QI 4WI4A 3VJ6A 1FNGB 2D7NA 3FPXA 5ESAB 1IGTB 5FHAL 3VI3E 5EU7E 3TM6A 4K8RC 3ZDZB 4GYBA 2ZF8A 1JG9A 3QWNA 4FL4B 2KPNA 3EH4B 3NPSB 4PTUA 3QUMB 4JFDD 2ZIDA 3KDMA 4WWKB 1W91A 5F7EH 2VXQL 4ICWA 1PS3A 2VXSL 3MR9A 4K94C 3G5ZB 4YEFA 1RERA 1JVLA 4XHJD 2IH9A 8PAZA 1NC2B 2ATPA 3GMOB 1BM3H 4Y19B 3ZYOA 2LE9A 2WQ8A 1F11B 1MZYA 4IIQC 4J23A 3ZHKA 5CU5A 2ZE0A 1I8LA 1JWSB 3MRPB 3W9EB 1OGTB 2MCPL 4B9JA 5DA0B 2VLRB 3VXNB 4RFNB 2F1EA 4XPHL 1T7XA 2DEYX 5IROD 1I7UA 1HCYA 4HH8A 1IFHH 1CGVA 2EICA 4JRXE 2VO5A 2IOOA 2K0RA 3D1MC 4NC2B 5CGMA 4M56A 4WJ5A 2EH8L 4G5ZL 2FJFB 4QUOA 1G5GA 3F00A 4H0LC 3H9SA 2VXQH 5B39A 2VDMB 2VXSH 2Z8WC 3F8UB 2F7QA 4P2YA 2QVTA 4AQEA 4E0RB 5SX4H 3PGDB 3QORD 4PYHA 2KYIA 3Q9QA 4EZJA 1GRWA 4UAHA 3B5TA 1GIGL 2Y9RT 4UCFA 2NY6C 3GJFK 2NY3D 3WJLC 4BK5A 4HUVB 1RZIB 4AEFA 2MCPH 4QYOA 4HG4J 1IKFL 1LP9F 2GYSA 4QRRB 1M1SA 1CMOA 1WBYA 3I9IA 4DVBB 2CHDA 2E6JA 2JCWA 5AVUB 5JMOC 5F1NB 4NNXA 4ZUTB 4BCYA 2OMNA 3KLDA 3FRPA 1S8DB 1GY2A 4NO0D 4OCLC 3IPFA 5ICXA 4ODVL 1HHGB 1I7RB 4GT0A 5BOZG 3GTTA 1HL4A 2YPLD 4QAMB 1JF1B 2APFA 4N2DA 1BF2A 4CGUB 2EH8H 1Q9LA 4JANA 1YY9C 5AAWC 5JHDB 4G5ZH 2QSVA 3HW7A 2AQPA 3B2XA 1WS8A 3LPPA 2E47A 3ME0B 4IGBD 3OR7B 3F7LA 4GMTH 4FD0A 2BK8A 1SFDA 2UV3A 4GUQA 1JZ3A 3BVDB 1CLVA 3K6IA 4LLAA 3QIWD 4YR6A 1KUMA 2WLYA 1VIWA 2ITCA 5BO1L 4PJBA 1CDYA 3E6FA 5EFIB 3WLBA 1L0QA 4YFLI 1IEAB 3NVQA 3VD2A 5H35B 1ZRUA 3ZGIA 4J7RA 2R56H 2ZPKL 1ZLSH 1SDDA 1RPUA 1T89C 3WAJA 2N0MA 3RX7A 4BXVA 2I24N 2XZAL 3CQQA 2VMDA 3OAYK 4HIQA 1PNCA 6PAZA 1D2PA 1T1XA 3QXDB 1CQYA 4GRWE 3ZHFA 2WSKA 2IGTA 3T65B 1LK2B 1CGWA 2H8PA 3H0TA 5DHVA 1V7ML 2VC2B 1OD9A 2FK9A 1PLGH 3F6JA 3SKUD 3U9UB 4PD4K 4DP9X 2IDUA 3N3EA 1AS7A 1AGBA 1JDAA 2CR0A 2P26A 1SN0A 1WAAE 2DBLL 5D4HA 4M6ML 5JDJA 4OI7A 2MSPA 1E5ZA 1L9NA 3ES6B 4MJ5B 4ZUSA 4B9ZA 3FFDB 3FF7A 5HYJB 1TG8A 1YEIL 4J3UA 4CSPA 1CN4A 2GITB 3BAIA 3E2HB 3L5IA 3RWIA 3O9WA 4NZRL 2XZAH 3MV7E 4XN8A 4P5TC 1PKQB 3JV4B 4J6IA 3V0HA 2CO1A 3QFJE 4AIXA 3NGBC 1AR1B 2JB6B 2W94A 4FI7A 4PJHE 1L7IL 2LFEA 4GUCA 4PRDB 5JQ6H 1V7MH 2HRHA 2BHZA 2WLMA 3SGDH 4YSTA 2QZ5A 4MNHA 5D1XA 4MWFA 4A2EA 3DYMA 2HJKB 4FLHA 4ZX5A 2LQRA 2N1TE 2DBLH 3N42F 3NK4A 3NJXA 3OL2A 4LSDA 5CJQL 3RYMA 1RZQA 3BDYH 4WGWB 4TVUA 5JORB 4MB5A 1UGNA 5AOKA 3VGFA 3BPLB 5DD0L 4ZT1A 3SD5A 4RSYA 2ZG1A 4EN3C 3C09B 2TSBA 1H8LA 1B6UA 4F3FA 1ZT1B 1YO4A 3MRNB 4KQ3L 2O6EA 1UJ3C 5EZLB 3IMBA 3FB8B 3V4PA 3GZQA 3QIBB 1UH4A 2AJ3A 3BKYH 1UQSB 2VM3A 2BNRB 5HGDB 1I1AD 4NZRH 1M7DB 4C57C 4C56D 1TQVA 2CDEA 4OLXL 2MOGA 3MV9E 3KYKL 5B1CA 1HH9A 4GSRA 4NQUA 4U1NA 5EU5A 4LL9A 5IHZB 3FJTA 4KXBA 3GF8A 1NFIB 3QDJA 4PJ5D 1L7IH 3WGVB 2FWUA 3NCCB 4NZ8A 5INDA 3B8SA 5DGRA 2OMVB 1ETB1 1I9EA 4MCZA 4OF3A 4R3SA 1HK6A 2JSFA 2ZNXA 4OLVH 4YPGA 2ADJB 5DEFA 1KXTB 1HEHC 4PLJD 2CO6A 4MJIE 1CG9B 1KB5L 1VCBC 1CCZA 5CJQH 3K4AA 3IXAB 3BD3A 3JV6A 1TENA 1HEZA 4DZBB 4WHTB 4E36A 5DD0H 5BZWB 4PJ7E 1OARH 4KTEH 1BWMA 5LKNA 1XF1A 3GMLB 3GSOB 4ZPTB 1HOCA 1ZLWK 1V54B 1TYJA 5D4JA 1EO8L 2WANA 5LWYL 1TLMA 4DEWA 2FHFA 1XSIA 1AKJD 1J0YA 1O7SA 1IT9L 4JDZB 4LEEA 1T5XB 5E2TL 4IRSB 3AG4B 2LLGA 3JTBA 2W0PA 4G6KL 4AIZB 1HILA 4OLXH 4LCVA 4UU9A 1EUUA 3KYKH 4X9IA 3BUYA 1ORSB 2I9TA 3HE6A 3DJTA 1CJYA 2ZSWA 4ETYA 5F89A 3OGCB 4PS4L 1XL6A 4PUBL 4CUCA 3QJUB 4FQ1L 5IBLD 4DZ8B 5SWQB 3UAFA 2E9BA 2PW1A 1MWAL 2NSMA 2B1HH 3AITA 1KB5H 5GGUA 4Q6YA 5C0AB 3RWDA 3UTSD 4PJCF 4IOIB 4YEEA 2XKNB 4BFBD 2Y7NA 4I18A 5KANG 3CK0L 3NN8B 4TYUA 4A7GF 1KGIA 4RMSA 4I0PD 3DOSA 2XX1A 1T6WA 2HJFA 1ZK9A 4LVEA 1L9RA 2JJTA 4HS6A 2BZDA 1EO8H 5LWYH 3JWDC 5FXCH 4F33A 5KJ7E 2X2HA 3LSOA 3AY4A 1INDH 1IT9H 3FT0A 4NN5C 1SF3A 1PZDA 1BJ1H 4OF5A 1TZAA 5E2TH 1J88A 3DRTA 3G7TA 4G6KH 3KPQB 1E8ZA 3A23A 1HWWA 3P4MA 5F0LB 4OCMC 3GKZA 2BERA 3DTDA 4PRIA 3W0WB 4MQXC 4PUBH 2DS4A 2N7BA 1UM5L 1GJWA 3IKKA 3TO4A 4ETQB 5KSAC 3S6CA 5DS2A 1M53A 1NGQL 4O51B 3BRDA 1N8ZA 3RIAF 2GFBA 5CP3H 1R3IL 2H47C 1MCQA 2DMGA 4IRJA 3FQTA 4HIIB 1QLEL 4QHMA 1CDGA 3B7SA 3DV4B 4X0KB 4KJQD 3TNMB 2LU7A 2B59B 1GR7A 3UTTD 1YLBB 5I30L 1KTKE 1O6SB 3KVPA 4HT1L 4M29A 1HT6A 2AQQA 4ANKA 1T7YA 4ZQKB 3FBKA 5FOBB 3VFUA 3EOBB 3OAWA 4G1MB 3R0MA 2G4EA 4WWNA 4Y4FA 5L2JB 4R90L 2X4OB 5EN2B 2X1XR 4L8DB 4ANWA 3QZMA 1T21B 3Q5OA 3T4AC 2A4CA 2G2PA 3LQAL 1IAIL 4HCRA 5FA4B 5IFHL 5I71C 1IM3A 3F7YB 3SYQA 3V52H 3MODL 4I5BB