1ZVNA

Crystal structure of chick mn-cadherin ec1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
SGWVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQRLDREERSQYTLRAQALDRRTGRPMEPESEFIIKIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin 1
publication title Type II cadherin ectodomain structures: implications for classical cadherin specificity.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 24
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1zvnA01
4OY9A 1OP4A 4AQ8C 4XXWC 3UBHA 4ZTEA 4ZMLA 3Q2NA 3Q2WA 4AQ8A 1WYJA 1NCJA 1NCIA 4NQQA 4AQAB 2WD0A 3LNIA 1NCHA 1NCGA 2YQGA 3FF7A 4AQAA 2OMTB 3K6IA 4AK1A 4AQEA 2WCPA 2O72A 4ZMXA 2EE0A 3Q2VA 3LNHA 2OMYB 5CO1A 4QD2E 4ZMTA 4XXWA 3Q2LA 5CZRA 3K5SA 3MVSA 1ZXKA 1ZVNA 4NUPA 4ZMYA 3PPEA 4AQEB 2YSTA 2OMUB 3UBGA 3K6FA 4NUMA 3FF8A 3LNDA 4ZMZA 3LNEA 2WBXA 4ZI8A 2A4CA 4ZT1A 4ZMNA 4ZMOA 1SUHA 5KJ4A 2QVFB 4APXB 1WUZA 2A4EA 1L3WA 2OMVB 2WHVA 3UBFA 5JYLA 4APXA 2V37A 4ZMVA 2OMWB 2OMXB 4NUQA 1EDHA 5DZVA 4AXWB 3QRBA 2OMZB 4ZMPA 4AXWA 4ZMQA 3K6DA 2X2UA 1Q1PA 3LNGA 3K5RA 3LNFA 1FF5A 1O6SB 2QVIA 4ZMWA 5JYMA
chains in the Genus database with same CATH superfamily
1O6SA 3PE9A 3P2BA 2FWUA 2VMFA 3HI1A 4O2EA 2ATKB 4YHIA 2A3TA 4AEEA 1XAKA 4OKDA 1DP0A 3CXHK 4QT5B 3VD2A 1HILA 4KOCA 3GMMA 4HHGA 4F15C 2WLIB 4AYEC 1T21A 1ZEAL 3DX1A 2XCMC 3K6SA 2J88L 1RI8A 2ZG3A 1BAWA 5KVEL 5EOTB 2B59A 1QSED 3WUZA 1FFPB 3OLIA 3C8KA 3US1A 3QUXA 3GNMH 2J6EA 3FQ1A 2AXFA 3QDME 4GG6E 1UACL 4NP4H 3L3DA 3CLFL 3FU7A 2VDML 4UT9A 3ENEA 4LAJH 5HHME 2B3RA 2R56L 1M3IA 1DJGA 1BLIA 1GGCL 3C2SA 3QQ3B 4LBEB 4IMLB 3TXAA 3II3A 3FQNA 3OKOA 5LCVA 4UTBL 3C5XA 1BWWA 3RX7A 1B9KA 4YFLI 5DMIL 2X3CA 1YEWA 2DBJA 1WBXA 3E38A 4OLXH 1JWSB 3P9MA 2IALB 4PJGE 4N0CC 5D96B 3S4SA 3UAFA 4X6BA 5CZRA 4P23A 2CO2A 3GK8L 5KVDH 4HIHB 4FERA 1DFXA 1OTSD 3I6KB 3R8QA 4JFFA 4URTB 1TETL 4LARL 4ODTH 5GIRB 2YS4A 3BZFA 3WFHB 2J21A 1MLCB 4FL4C 5EEUA 5FM5O 3I3BA 3RIKA 2J8UE 3MMEB 5DD1H 2HRHA 1DQJA 4KNTA 3LZNA 4FQLL 3ZDWA 1M6UA 1FFOB 4GW4B 4P9MH 4OM1H 4XBPA 3V0AC 2MSPA 1XR9A 1FN4A 2A4CA 1RHHA 4MASA 3ARBD 4HJJL 5F89B 4ZW6A 1A9BA 1PLGH 3NCEB 2J20A 1MHCA 1K3ZA 1WD9A 1S3KH 4JFXA 1MG2C 4OBRA 3BVTA 2Q87A 5BVJB 4TLSA 1J8RA 1IGYB 5DJZA 4ZNCD 2OMVB 5D2NC 2VDNH 1A3RH 2BNRA 5IJKC 4WWKC 1WF5A 3WNNA 2N56A 1DVYA 2LFGA 5LBSH 4OFDA 2K9UA 2NNAA 2B0SL 3ESMA 3TIDA 1RIHL 4KTEL 5DZVA 1K4DA 1J8HB 3OF6A 1KJ3H 4PJFB 1GVIA 3VFSA 1JD7A 1WEJH 4M3JA 2Q7YB 5JZ7C 5KYUB 1FRGL 4CVXB 1BM3H 4PJCF 2BVEA 3T3PE 1HEHC 1SOSA 5G5DA 3EJQA 2O61B 1G9ML 2C9SA 1U93B 4BSWB 4S1QH 3UC0H 1U8NB 2WINB 1JRHL 3L3IB 3MLRL 3HNSL 2BSCA 3MJGX 4G43B 1JV2B 3S0PA 5EA0H 4LSSH 1EVUA 3ES6B 4FG0A 5JDSA 2JELL 5L9DL 1QBAA 3FO1A 4OGQC 1PKOA 4EDWL 3NZ8A 4JANB 1OPGH 1HCZA 3LRGA 2NTSP 3JWNG 1JGEB 4PS4H 5EUOA 2Y7MA 4FTVD 3TO2B 3CFJA 4M7JL 4Z7OB 2X4RB 4TN9A 3QJTB 1LO0H 2IQAB 3WGUB 5KBLA 5KEZA 5GGQH 5D6DC 2F5BH 4OLVH 3TO4D 4F7EB 5I75B 2WPGA 3P40A 4X50A 4ZAKC 1K8DA 4GAJH 1VZIA 1TENA 3NABL 1E90A 3VFPA 4RETB 1BQLH 2UY7A 1JGIA 5H37A 5C0ND 5IHBA 3ZHDA 3ZU8A 4C56D 5C0AD 1MCEA 4LRNL 4YXHH 1VFBB 2GITB 3S5LA 5IHWA 1T5XB 5L88L 3UG3A 2P80A 3L4ZA 2WQAA 2QKIC 4Y16A 5ESAA 3S35H 3AITA 4K3EH 1HHIA 4LCCA 1J5IA 1MFCH 1P7QA 3CTTA 3DOIA 2FAUA 3PHQA 3IMSA 1U91B 4X4XB 2P44B 2ZCKL 2VL5A 1IKNC 3OKEA 4UT6L 3ESUF 3SQBB 3T6VA 1TF4A 2DDQL 2R8SH 4JHVA 2YSSB 2DI9A 2ALWA 3U1QA 2ADYA 1DJXA 1TQSA 4E9VA 4CVWA 1XDTT 3B5TA 1A7RH 3X1FA 3GSXA 1G7HB 1ET7A 5B39G 1Z1WA 2WZ0A 1YUHB 1D5XA 1WCBA 1P5VB 1TZAA 4KMTH 1HTYA 4NIKB 3BEWA 5SWZE 5C0CE 5I82A 1JK9A 5ADPH 3UPRB 4KK9D 5C0BE 3AG4B 1NGPH 4PJ8A 2XUWA 4K7PH 1J5OH 4AIOA 2WM0A 3F05A 5F88A 3KPSE 3DXAA 3T1WA 3HG1B 2VDOH 1P1ZB 2AERT 4EI0A 5KJ7E 3FT0A 1A64A 1EK3A 4NHUB 1FLRH 3D85A 3PL6A 4N90D 1WT5A 2R9HC 3HNTH 1Q9OA 1TMQA 1E8WA 1MRDL 4L8SA 5FWRA 5GRVL 2ZUTA 3FCTA 4EI6A 2ALAA 1KCRL 2VXQL 2WXRA 3WHXB 4ZOAA 2IDSA 3L3OB 2CKBH 2B15A 4HVBA 1NH6A 2FYYA 1TKWA 4EIUA 2PWHA 4JFUA 4IKIA 3G6AB 3L2NA 2YAHA 2VRKA 3QAZC 5AWNL 1H6FA 4P46A 3V0WH 1DQDL 5AG9A 2HFEB 1WZ1H 5D1ZD 5FGBC 4MX7A 5D6CA 2BO0A 3QSKB 4JPVL 3QUMA 2AQ3A 2YOCA 2JJTC 2R39A 3G5VB 3OJMB 3N40F 1VESA 4MAZA 3CFUA 3OAYH 2OR8A 3PHSA 3ZBMA 4E42A 5JMOC 4HKBA 1QFPA 2F18A 3B8SA 3RDTD 5CD5C 2GUYA 4OFQA 1HQRB 2YD7A 3ZTDC 2FX9H 3F01A 4V1DE 3UABA 4N0UE 4LPUA 1X5FA 1XIWD 5SX5K 4LSTL 2MKWA 5CKGA 2WCPA 3VXQB 2OFQA 4XH2A 2ICEC 2GJ6A 2AHIA 3DYOA 1XGTA 4NKOB 2D4FA 2QSCH 2Y2YA 3DX3A 3T8VA 4I3RH 3Q43A 3KLAA 2Y1YA 3ETBJ 5J13B 1W6WA 2NXZD 3QR0A 4W1TA 4AM0A 3GKZA 3SOBH 3GSWB 1MWOA 2FO4B 4BQBA 2QGDA 5F9JB 4JAMA 2HPTA 3RFZC 3P1VA 4GRMB 2NQDA 4UZUA 4PR5A 4YE0A 5IEHA 3DMMB 4IM8A 4M7ZC 4G8EB 2ICWA 3FB8A 4MRCA 4DW2L 1JF1A 4OZIE 2PPDA 2C8NA 4KXZH 4HS8L 1HHHA 5DO2C 4DKTA 4JM2C 2IBBA 3CVHB 1RUKL 2A83A 1I1AB 3V9EA 2DWEB 3Q1SH 4TSBL 4DP4X 5F6IB 5M7QA 1YN6B 3N42B 2GB2A 2WLLB 4TQPA 2M83A 1VGEL 2AV7B 4XPFL 1BMZA 4JRFA 2Y3NA 4QXTA 3VG9C 4P07A 3EO9H 3MRIA 2QPFA 1IGFL 2IPUG 2FQDA 5CEYA 3COOA 1CGYA 3QIWB 5I73B 4RCAA 4NCC1 3QFDA 4FQ2H 3ASWA 4Y19A 4X6DB 1ZD6A 2Z8RA 4UM9A 2D0GA 3KW7A 2VM9A 3RY6A 4ELKA 4GNKB 1C08A 5CIPB 3U30B 3P3TA 5BQDA 1CDJA 4Y4KB 2EABA 1T80A 4UB0L 2HFTA 4TNWK 4NC1E 4N8VA 1AQHA 4Z77B 2PCXA 3EYVA 3WDHA 2DRUA 3CSTA 4P2QD 5TD4A 2E9GA 5F9DC 2B1OA 1PVHA 5E95B 1ICTA 4NNYA 3AT0A 4DVBA 5FM8A 4TLKA 1CN4A 3L17A 4PRBB 1T3FA 1WISA 2J8OA 4W9GC 1GPOL 2WCGA 3N43F 5DMKB 2P5ED 6CGTA 2PXYD 1BGXH 1NGWB 2CO4A 2CBQA 2EINB 3FONB 1MZYA 4ZTEA 4JFQB 4LIQH 5CN2A 4XO5A 3TZVD 4LHUB 3MLYH 1NWPA 5AVSB 2DQJL 1VADA 5D7LE 3RWIB 3HG4A 4OW6A 2YD2A 5I8OL 1QASA 3HC2A 2G9HA 2GSIA 4QF1B 3DVGA 2Y23A 2DEXX 2NY0C 2IDUA 4J3OF 3IGUA 2NX5B 2ADIA 5IG7B 4D9LH 4F9PA 5M95B 3ROLA 3CU1A 4QLRA 4KO7A 3MHZA 4OIAA 2VLJB 4FP8L 2QZQA 5GGSB 3L4VA 1OVZA 2A6JB 4B9YA 1E42A 3WV0A 5IQ9A 5F8RC 2XDHA 5CGYD 3DWTA 1AIFA 4DQAA 3GMLB 4TSAL 4RMUA 5E99H 3WHE0 2ED6A 4HUWB 4DEWA 2OCCB 1QYGL 4MKMA 1NFIA 1RJYA 2DQEH 2N1KA 3KNBB 4BWTA 4EI5D 3T77B 1JMXA 4L3EA 5KYYB 1JYNA 2WUCH 1CGXA 5I1HH 5JXED 2X6VA 4ZW3A 3T0DA 1AZBA 2JVUA 3CHOA 3BVNA 3FU5A 3BAWA 4W9IC 5TJWK 2Y24A 3AMKA 3DUSB 3BHBA 1RHFA 2X42A 1OHZA 2Q0ZX 4GP5B 4PD4J 2NNFA 1U8IA 2BFVH 4DP8X 1BD2B 3WNLA 1AZNA 2X38A 1H9VA 4BFRA 1IC7H 4X5XB 4LEOB 1NL0H 3NCBB 1OCWL 5B1CA 3V6FA 2ZYHA 4IRZL 4GMTH 4B9FA 32C2B 5A3ID 4U7KA 4R7VA 4E9WA 5IF0A 1ADQL 2A73B 4PS8A 4HXAH 1LLAA 3DX6B 3M86A 3F58H 4DPBX 3WXVH 1U92B 1DJIA 1YLBB 3IJ7A 4N1EA 4Z7WB 4FYTA 4ELMA 1QFUH 2CMRL 4NT6B 5I1CL 2I07B 2QHLA 4OGZA 4KWUA 2Q8BL 1JD9A 5F3FA 2WLJA 3VXNB 2Y7OA 1JRHI 4OCNC 2O5ZL 4R4BA 4LVHC 2YD9A 4GT0A 4X9GA 3VWJC 3ML8A 5FYJL 1E5UI 3B43A 3RIAF 3NIGB 3VM5A 2QQLL 5GZOC 2FO1A 4PG9A 4LLYB 3DTDA 4XAKD 3GSNA 3IDNB 3UBXB 3O0LA 4MJ2A 3SQRA 4XX5A 4JR9L 3SGDH 4ZFZA 1ML0A 3D0LA 3PYCA 3QNXA 3SCMC 2WKOF 2O6EA 4LDOB 2J5WA 1HXYB 4PJ7B 5FOBB 2OSLA 3HS9A 2IQ9H 3ZSTA 3DJZA 1IKFL 3BWSA 4CC0A 4E9XA 2VXTL 1A6ZA 1EIBA 4R0LB 1X5AA 2V3DA 1LO5B 3CN2A 4JRYA 2I26N 4NRYB 5D1QE 5EOCL 5F7DB 1CLYL 5FYKH 2YEZB 2OR9L 3WN5C 4ZSOB 4FQ1L 1FNGA 1V8HA 2AABH 4G8AC 3RTQB 1KWGA 1BJ8A 3BX7C 3MBXH 5IB2B 2HTKD 4DGVH 4XODA 3HBZA 2XI9A 3D25B 4GEJA 4LSVL 4MQ7A 4Y4FD 1CFNB 3NSDA 4AZ8B 4Z3IA 5I5MA 4Y8DC 2FHFA 5HYSG 5IVZB 2XTJD 2CLZA 2Z4QB 3ORJA 4K94C 3CVHH 5DDHB 1X5JA 5I1LB 4Z7VE 2QFRA 4NZ8A 3QJVB 1MWAA 2EIKB 4JFOB 2BX5A 1ZTXE 1J8KA 4R4ND 4NQDD 1E6OL 3MXVL 4ZMYA 1TO5A 1F86A 4TQIA 3GMOB 3ZKQD 1M1XB 2JV6A 1S5HB 1EXUA 4L4TE 5MENB 1YEFH 1YYML 3KPOA 2C4XA 3EJYC 3WXWL 4R6UA 5JQHC 3GI9L 4PJFF 4XPGH 5IVXE 1UZ6E 1LO2L 1ZHLA 1X7SA 1PL3A 2Y72A 5CIPH 5AYUH 1JTPA 2NY3C 2X1WL 1S4IA 1A6AA 4W93A 1AP2B 5ITFB 1NCBL 1OAQL 3GMQB 3KDMB 2C3HA 3FTZA 4P5TD 3B1TA 5DURB 3PV6A 7PAZA 1BFSA 5BS0A 4KJYA 3PWPA 3EKCA 3V6OC 2ZOTA 2PW1B 4RFOH 3W2DL 3QIBA 2NLJA 3IJHA 4M8QB 2ZP9A 3O3AA 4FNLL 4TYUA 5K1JA 1PGRB 1YEJL 4ZOEA 1MCHA 3V5KB 3BSGA 4PBDA 3B7TA 1I4FA 1NANH 2EDFA 3RPIB 4TUOA 1Y1UA 7PCYA 1UJTA 2OKMA 1DQMH 3WENA 2HUEA 3JV4B 1QW8A 3MFFB 5JPNC 3J27A 4YXLH 3QQXA 1T20A 4G72B 5T5NF 4BA0A 1FNEB 1FVDA 4AEIL 4Z7OF 1QSEE 3GHBH 3SKOB 5ISZE 1LE9A 5BMFL 1FV1B 4JCMA 4W9EC 1M2VA 4E68A 2BHYA 1UWGH 5BZWA 4FXKC 4JO3L 1YAIA 5CS7A 2EO9A 3ZZ1A 2X9YA 1QFWI 1I7ZB 1G9NL 3NK3A 4IIQB 4XXWC 3GMNB 3JZ7A 3E8VA 1GZPB 5T1MA 5FB8A 4YUEL 4HALA 2JFCA 2DMGA 1J8SA 3B2XA 4HK3J 5I16B 1JGDA 3MRBA 4JJ5A 2H41A 1JV5A 2A77H 1O9ZA 1N4XH 4HZLA 1ZLSL 3TV3L 1TFPA 3S4SG 1IC5L 3HAEB 5CSGA 5IQMA 2H32A 1KGYE 3IPBA 3S3BB 1J5CA 4KXBA 4MMXA 4AJWA 1A7QL 1YDPA 1OE2A 4OQ1A 1K72A 5IB5A 4BKLB 5GGRA 5EF3A 3TIEB 1ACZA 3TA3B 4YO0A 5FR3A 4DOHE 4ZMTA 4BH8B 3E6FA 4R5XA 1YC8A 3AACA 5EOQL 1DQVA 1CDHA 1FC1A 4IKJA 3VXTB 4WUUB 4OUUA 2MRYA 4UZGA 2OZ4L 1J9TA 1JZGA 3MXWL 5B38A 5MHSD 2YSTA 4APQA 2VLMD 1CL7L 5DRZB 1ORQA 1TQTA 4PJAB 2I5YH 3M1CA 3DV6B 2X7LA 1TQUA 3MLWL 4LSDA 3RB7A 4WUKL 3VSVA 5DR5H 4LOUD 3TPKA 1FO0A 3ULVE 4NZRL 2FVNA 4YLCA 3ZGHA 1RZPA 3FN0L 4F7MA 4NZTL 2VN5A 1P2CA 2Z91B 3K71B 1M05A 5D1XD 2VCOA 3P4MA 5CJOH 1NGXA 2ROXA 2PP8A 3HE7B 3QUXD 3L6FB 3WIIL 5CZVL 1G9MC 2ZJSL 4G5AA 1KF9B 3VI3E 4PJHE 1E9PB 1I8MB 2W0FB 3CUPB 1NBCA 4Q74A 3US0A 1HH6A 2Z31B 3WTTA 4CMMA 4FCAA 3W81A 2VQ4A 5MERA 1DQLL 5DMGD 1BG9A 2HKHL 3MOAL 2B9BA 1OGTA 3CDCA 3JV0A 5E03A 4X7EC 5IWLA 1NC2D 4P23D 5DJYA 4NN5B 3RP1A 4DN3L 5T3ZL 2RHEA 3I9GH 1A4CA 4F9LC 4X98A 1QR4A 3GSOB 5J6GA 1LL1A 2ENJA 4L3FA 3MYJA 3EH2A 1PYWA 2CSPA 4BCYA 4GG8B 4FTVE 1ZLUH 3K1KC 8FABB 4YPGB 3DIFB 1G43A 1PKQA 3BVVA 2KC0A 4NUJA 4OSUH 5HDBE 2XN0A 3GINA 3IDXH 1V7MH 4B41A 1MCPH 3I84A 1AZZC 4AV5A 5HHPA 1T7WA 5C0AE 2EDNA 3MRQB 1RUQL 3RAJH 2C9VA 4TTDC 5KN5B 1K3IA 1BOGB 1EHKB 1SDDB 4AGPA 1HFUA 2BNRD 2R2BB 3H3KA 5T1LD 1AKJA 1TCRB 1EEQA 5LAPA 3N42F 1XEUA 1FH5L 4N6RA 4L4VA 5A43C 4LASL 1NGZA 3BW9B 3VFOA 2QLVB 2R7EA 3QI9D 1F4WH 3L08A 4JJHA 2LU4A 3N50A 4W9KC 2EIBA 3MV9B 4X7CC 3R0NA 4PG2C 5GS2H 1G7LA 2BP8B 5F9WC 1DVTA 2XY2A 4X8GA 5CHNB 2MQ3A 3U9PH 4X6DF 3MJ9H 1U8PA 3TF7C 5D4IA 3W82A 1J0ZA 3ZDXE 2BC4A 2E56A 2M2DA 3L9BA 4HWZA 4FG6D 4PS7A 4WHYG 3W39A 4AL8L 5I1JH 3M1BB 9CGTA 1VJSA 3MKKA 4PRID 5I19L 4JGUA 1DSYA 5I30H 3T8MA 1H3PH 1MLBA 4XGZB 4FQXD 3B9VA 5T3XL 2Q3XA 4PJDE 3GKWH 3WNKA 2DWXA 4AYFA 2BVPB 3B5GA 1JIBA 4Z0XA 3NJHA 3D4YA 1O0VA 4G42A 2PCFA 4HIQA 3EDEA 1F2XK 3QZPA 3BWAB 1DDHB 1UUSA 3M8OH 4HIEB 4ISVA 3JWNE 4IU3B 2WHVA 4LCWE 2R0WL 1HYRC 3ZTNL 4PS3A 2AV1B 3EDDA 3J07A 5C6WH 1Q90A 4F7PB 1ZT7B 3G08B 3L1GA 3QDMB 3OHXB 5DVNA 4GG6B 4QRRA 5B7FA 5AEAA 3MLTB 5DGRA 1A7OH 3DVFA 5HHMB 1THCA 2RMNA 5GSRB 4G1MB 2ZAIA 1UM5H 4AXWA 5CEZE 2X4PA 4F37F 4KDWA 1KMGA 1N59A 5GGTL 3VA2C 4I2XE 2P5WD 2P80D 3D18A 3D9AL 2DD8H 3C5JB 2YWZA 3L5XL 4Y16D 5JOPD 3L3JB 3NFNB 3ARRA 4KK5C 4PJGB 1P7QD 1KFAH 3TYGL 4YHKL 3VXOB 2X89D 5ETUB 5KW9L 4GAGL 1EHNA 5LKNA 4QHUB 2BXZA 4K7FB 5BV7H 2IPUK 3WE6B 3MTXA 1R19A 3UBXI 1BVNT 1CU4H 4LCUA 2AGJL 4OF7A 2WVSA 2PCYA 3ZSSA 4CBZA 4CGUB 2FNBA 4FFWD 4YX2H 4G1EA 1FSKC 1WYJA 4K71C 1J7VR 3L9YA 4LMQI 3WSQL 3STZB 4BH7A 4OCYH 4JFED 4U1NA 2J8UB 5I74C 2XBZA 4XZ4A 3U0TB 3FBKA 3IAQA 1QR1A 4PV9A 3CVBA 5AG8A 4JM0A 3HHSA 2BCMA 2FCBA 2ZWLT 3CSBA 5GHWH 1V7NH 4L0ZA 4NX0A 5E6RB 4PJ8D 1DN0A 1W16A 4H5SB 5F7YC 3VXUA 2WXMA 3DXAD 1M57B 4KO6A 1F4YH 4MBRA 1V10A 3D48R 2WGXA 3M7OA 3O9WC 3OMNB 3U4EB 3ULUD 1QLRB 2O4EA 4XWGH 4JHWH 3PL6D 1GTNA 4MCMA 1PQZA 3PGCA 5GRUH 2CRZA 5L8LB 4XVUD 1C5CL 4H8PA 2OM5A 1E9QB 1CGSL 3NJKA 3QISA 3QO0A 3HI5L 4ECNA 2J1KA 4HS6B 3KPPA 4Z7WF 4BBWA 4DGWC 4NCDA 1C1EH 1NBZB 1ODUA 3L81A 4LNRA 2BMKA 4OZ4B 3U6XS 2WBWB 4KZDL 5KBKA 3CFDB 1EERB 1FHNA 1PSKL 5FYLE 2JTDA 2OL3B 4WY7L 3FN9A 1Q0YH 3TPUB 3FQXB 2VRQA 5IK3A 5I1IL 4ZMOA 3NIGF 5DJ0B 5TDNB 1N19A 4DGIH 4RISL 2VLRE 4OCWH 2YFOA 5C0IB 5IQ7H 1BECA 3W5NA 3QBTB 4U1GC 5FV2A 1AHWB 2IGFH 3A3YB 4EDXA 6PCYA 4N8VG 1CMOA 1SMDA 4KQ4L 4AEHH 1O5DT 4MA1B 4PJ7F 1QRKA 4P2QE 3HN3A 3U0PA 3KJ6H 4OFPA 4XVSL 4RWHA 2Z92B 3IJ9A 4HZAA 4ZMVA 3IDIB 5FO9A 3PQYA 2OK0H 2KS0A 5K9KA 2N3JA 2WTRB 3FHEA 4UOJA 3DIDA 2Y2TA 1E4WL 4PIRF 4Y4KC 3NCYS 3F5WA 4JN2A 1GL4B 3EG9B 2IXQA 4ERSL 3ETTA 1PLCA 4X0NA 1T5WA 1ZLDA 1L7TL 4KITB 4S1RL 3Q8FA 3B56A 1CLOL 3VRJB 4UQAA 1M3JA 1KGWA 4JPKL 1P4LA 3O3DA 3O45A 4PJEE 3QRGL 3S2CA 1HVXA 3GO1L 5ID0A 1R1CA 3R1GH 3DSNB 3A4EA 4S2SB 4W70A 4ONGH 3L95B 3BO8A 4FA8A 1PDKA 1U8OA 2V8MA 2OR7A 5DRNA 1VSCA 4Q0XH 3QWRD 2HKFL 3Q5TA 1GCFA 1QLEH 3GUFA 1XGRB 2B1HH 3RLSA 4IBWA 1E8XA 1WFNA 3GJEB 2JIXB 4X6CE 3T0EC 4XMLL 4PRDB 4ZUTA 1R5IA 1T22B 5C08A 3U7YH 1MCBA 3CN3A 2DWDA 3B8YA 4M6MH 1Q94B 3X14A 5F70A 1FWXA 2WCSA 1CICA 1XGYL 4HLZH 3U2IA 3C12A 1EO8L 5LAXA 4R7NA 3QXDB 2XWDA 2FJFA 4QTFA 1FL5A 4Y19D 4M3KB 5IBLC 5FDWA 1IIKA 1SFHA 3M1OA 5JIPA 5SWZB 5C0CB 3MGTB 5F1NA 2GY5A 4ZX3A 5LWYL 5C0BB 3PY9A 4OZHE 1CL7I 4EE2A 3TEWA 3O3BB 3HMXL 4FNRA 1VKXB 4UAHA 4YDZA 3LSOB 1JI2A 5KJRL 1S3RA 1KT2A 4N2MA 4GUOA 1TZGL 4MS8C 3RFRA 5B1BB 3RIFK 3EGXA 2PLTA 4H2CA 1UWXK 2MHAA 2BIHA 3C6EA 3JQOB 1F42A 3I6SA 2D2OA 5EU3A 4QRSA 4DPAX 3BPNC 2FECI 1ET8A 1TJXA 3QS2A 1AACA 2E7CA 3FPYA 3GBNH 2NY2C 2BSBA 4ODSL 4ZS7L 4N8PA 1Q0XL 1MVYA 1FGNL 3FPXA 4Q6YA 4A37A 5EF1A 4PQXA 1HL8A 3WDIA 5I9QC 3SPVA 2XPGB 1YN7B 2D7PA 3TCLB 5A2CA 4Z7UE 5MEOA 3KR3H 3IS1X 4M43H 2Y7QB 3E8UH 1R75A 1PS3A 4AOFA 1VFAA 2CUAA 4GRLC 5BVPH 3LY6A 4JUSA 3VSTA 3EYOA 2C7FA 1MQKL 2OMWB 3WJLC 4YHMH 4XAKE 5LBSA 3T71A 4OKVA 1KB9K 4NO3B 1KJ2L 4POZD 4V1DB 4ZS6C 1NM9A 4N0UB 5HJ3A 3TFKC 2OA9A 3F85A 3VXMB 1QHOA 2BOCA 3D30A 4JKLA 3PPSA 4MXWH 4ZO7A 3DRTA 3VFGH 2OYMA 3QIUC 4AIZB 4F20A 1VLXA 4X9FA 3TT3H 3MA9H 4XNQA 3IJ8A 43C9A 1QSFE 3E7JA 3IJSB 2WVTA 2W1NA 4X5WA 1TJHH 2AF2A 4YWGH 2UXTA 1HESA 1RZQA 5I8KL 2FRGP 4IW4C 3A6BH 3WFDL 2HT4D 2Y5TA 1WA1X 2R2CA 4HKZA 3PWUA 3NJJA 3P3RA 3NJMA 2LTQC 1UM6H 4GXFA 5IB1A 4OZIB 4PW4A 3V9FA 5JHAA 2F61A 2AKRA 4M1GH 4Z7QE 1YMME 3L13A 4F7KA 1XL6A 3CC5B 3LZQA 3NCFB 2D7OA 5EU6A 2CO6A 4NN7B 3E3QE 2OTWA 2B77A 4XCNB 2X4OA 4NPYA 4GSRA 4WW2C 3BKJL 2VWEE 1QUNB 2NY4D 2ZP0T 3NAAH 4AQAA 4PJAF 1NCWH 4Q2ZA 3QCUH 1CLZH 1B0RA 1SBSH 2OMUA 3MRFA 5FFLA 4ZMXA 3Q2VA 3CXDH 2YUWA 1IC0A 1TXKA 5DXWA 3FMGL 4JKKA 1MPAL 5DWUH 3DO3A 1HQ4B 1MCWM 1T7ZA 5KTEH 1TJGL 2OL3H 4EN3A 1JUFA 1FZKA 2BZCA 4HWEL 4LOVA 3Q8BA 1MIML 1WGOA 4XPTL 3DURB 1U8KB 4YXKH 4MA8H 3LZLA 1GKOA 2ESVA 3FZUD 5HY9B 1A1MA 4KKPA 1J1OL 4WV1C 3WTSA 4HWBH 1MJ7H 1WG3A 2P47B 3H9HA 1NBVL 4Q9RH 2DMCA 4JPWL 3U9UA 4A55A 3DX9B 3UFIA 2A2QT 1TSHA 2XN9E 1ETZA 4UOZA 1G6VK 1HU8A 2B16A 4X9IA 3LIZL 3T0XA 3RVXC 4FADA 2R69H 3MLVL 4KAQH 3C60C 4WIQA 2O5NA 4PB9H 4ZYKB 2HH0L 1G7MA 1OK8A 4U6VH 1NCNA 5I8CA 4JRYD 4XNBA 2FIKB 5D7KD 3QZNA 2WTPA 3QUYD 3U7AA 5IFAH 2AXHA 4XWOD 1D5BA 3MJWA 5GSVB 4JY5H 2AJVH 2DM2A 3HRZC 4N2HA 2J5LC 5D7LB 1UM4L 1YEKH 4ZFOB 1AY1L 3SHSA 3UTPE 3S88H 1G9NC 5E6IB 3BPOB 3JTSA 1WA0X 4IHOA 1KACB 2NW3A 4WEBL 3DX8B 4P2RE 2H47C 1HXMB 2QKSA 4LO9A 2HLEB 3O3EA 3HE6B 4MDIA 5DFWH 1WO2A 3QJHB 2CKBA 4J27A 4IRSA 2I9LB 4ZFOL 5B4MD 3DBXB 3IMRA 5EZIL 4Q7DA 4I87A 4NNPL 1B3IA 3QQ3A 3VE0B 1KEMH 4IMLA 1NJ9B 4BQ8A 1NFDA 1UD3A 2WKOA 4DJMA 5C9JA 1GGBH 1T1ZB 3KHOA 3RI5K 2C1PA 2HX8A 3EO1A 1TTGA 2MTAA 3OKDB 1NCGA 2AQ1A 2CD0A 4XBEH 5E1QA 5FUOH 3TT1H 2XKUA 3QHZH 4M62L 5C6TL 2FL5B 1QRND 3ZE0E 5CEXB 4BFNA 1W72L 4FKKA 2AK1L 3Q0HA 4P3DA 4AX3A 5CKAA 3C6SA 4KTDL 4J3BA 1J1XL 4YL9A 2VMJA 4WU7B 4J6RH 5L7XL 1CTMA 4JB9H 5IIEA 4GBXB 5JUEH 3V79C 3O8XC 5HYJA 1D7DA 4U1IB 4W6XB 1K2DA 3RVWC 1DJHA 1XD1A 3K8MA 4JG1H 1C16A 2EVIA 2J1ZA 1YEHL 1LO3L 3LEVL 1CT8A 3AUWB 2EE9A 4HEPA 2CUHA 2NYYD 4K3DL 2RJMA 4ZUVB 5K59E 4L18A 1EDQA 4PJIB 1P4BL 1A4JB 2QGCA 2V3FA 4F8PA 2NCMA 1T7VA 2V4LA 1BLNA 3GEWB 2K78A 5KS9A 1AQDB 5JHLL 1U21A 3TTSA 3UCQA 4N87A 2OMVA 4GG6F 1NEZA 4TVPD 4TL5A 1RU9H 3T3ME 3CQPA 3KGRA 4HPOH 2P5PA 3O3UN 4FI8A 1EBAA 1B90A 4BUQA 4I1NB 3K0YA 2PCPA 3MJ8A 4XNYH 2A7BA 3EJPA 4XE0A 1H8NA 3WNPA 3GFUA 4MMZA 1GR7A 5TF0A 4H25B 2QVFB 1DVFC 2B2XH 4RZKA 4PJGF 1Q9LB 2LW3A 3GJFK 4RGND 4HS3A 3ZL4H 2A4EA 4CVXA 2F7RA 2ZXQA 4HGWB 2H9GA 3BN9C 4XO4A 4LSRL 1DJSA 2OTUA 3KJ4C 5D1QB 1ZHBA 5TK4A 1IAMA 4Z0BH 2A99A 4KU1A 1JVOA 2JF1A 1U8NA 4JFFE 3WY2A 7FABL 1ROWA 4KJQD 1AMXA 3CE1A 3WUWB 3T4AA 5BO1H 2NY7L 1BBDH 2J8UF 4LB8A 1WCQA 1KV7A 3L3GB 3ES6A 2AJSH 4JRXA 2VXVL 4KKLC 4XP1L 4WI4A 4EJ1C 1VCAA 3LKQB 5J1AA 1A5FL 2YGNA 3SGEH 4CRPA 1QBML 5J9PA 2CA3A 2IMNA 5HGAB 4Z7VB 3NCCB 3VU2A 1CVSC 3UAJC 2MCPL 1MHPL 3N06B 2UZXB 1IL1B 4OY9A 5CGTA 5AVYB 3MA7A 1XGQB 2X4RA 2EEAA 5JR1L 1QI3A 1WVZA 3EW3B 3FO2A 5KVFE 2VKXA 2DQDH 3CN0A 2DI8A 1Q9WB 2H2PC 3BPCB 5ID1B 5LVEA 2BNRE 4YLBA 4XTRC 4L4TB 4PREB 1F0LA 2D3VA 5K9QI 3ILQD 1KV3A 2X1OA 2RTTA 4HMCA 3S97C 1FFNB 4XRCB 1R5WA 2ID5A 3LH8A 3TVMB 1WDAA 2H0EA 5IVXB 4UV7L 4GB9A 2YLHA 4HIXL 3G5XB 2LQRA 1JWUA 5HHQB 1MJJA 2YRZA 4J8RA 3NJXA 2WO4A 4NHCL 3RGHA 5K69A 2N7AA 4MA3A 2YOAA 2JK5B 3QUZA 4P9HH 4BFGA 1DQKA 4QTIL 4AL8C 3ZTJG 1JCKA 2E74C 4LLWA 2X1XR 5CCJA 2EZ0D 3MRRA 4JN1L 2FBRA 1IBGL 2BP0B 1A0QH 2LE9A 4LAQL 4M29A 3MN8A 4UIMB 1S7VB 3TH4T 3QR2A 5CGMA 1SBBA 1UOWA 1ET5A 1G0YR 5E23A 5T1KB 4KTGA 1BP3B 1ED3B 3X12B 1R0AH 4N2AA 1YUHA 4FEMA 5GPRA 5J1TC 2PTTB 3ECBB 2ITCA 5B1KA 4Z1PA 1PZDA 4GUPB 1KTLA 1SHWA 1OARH 2AJ3A 3P0VH 5IBTH 1BQSA 4CW1A 5I18H 1UZGA 3DYPA 4M5ZL 5DFVC 1QSEB 3N3EA 1PTZA 5DQDL 5EUOE 2WV3A 5ISZB 5HDRA 1UXWA 3D09A 1OQXA 4GKNB 4ADGA 1BFOA 1RIUL 5GS0L 4PRHA 1S7WA 4LL1A 2GC7C 1FL3B 3S8GB 3H9SB 2KLTA 2WLHA 4K94H 4Q89A 3DGGB 1LEIA 4Q9RL 5ERWB 3IAGC 2PPAA 1XZ0B 3PGFH 4WHTB 4DEPB 3GUTB 3SPHA 3X1BA 1QD0A 4BFIA 1P1VA 1F11B 1RFDH 4MCNA 3H1ZA 3HPJB 2ZWZA 3WHXA 3FQRB 3EYSH 5I1KH 2UYLB 1DLHB 2OMXB 3EOAA 1JFQH 4HFUL 4U3CA 5SX5H 2Q1EA 4N8CH 5GS1C 5EFIB 4XP6L 3SDDA 1AKJD 4HH9A 2HPOA 2Y07H 1JG9A 1MF2H 4FQIL 2A74C 4JG5A 4ZUWB 4HUUA 1YO4A 2Z1PA 3DHPA 4NZUH 4ODXA 2OBGA 4WTZA 3LDBB 4M7KL 3G04A 3ABMB 3PXHA 1G6RL 1GYWA 1TTFA 3T2QA 3VXPB 5EF0A 4DOHB 2GIXA 1YY8B 3BZ4B 3BUIA 1HQRA 1N9PA 5CINL 2EIEA 3SPIA 3N1PC 3CZSA 4JFHD 1ETJA 2V0AA 5BUPA 2FJGB 4QO1B 1MCLA 2YD4A 3S34H 3RZWA 4HCRH 3NZHL 4P57A 4PP2B 3ZQXA 1BZ9A 1AVAA 2A9BA 1MFUA 4UTAL 3IXTA 3DXAE 3US9A 4WKZB 1URLA 1A6TB 1TJIH 2XWTA 3F6IA 3FB6A 3B3IA 4QHMA 2J4WL 3MRCB 5C8JB 3VRLE 2GAZB 4AYMC 2F7PA 4BV1A 5DUML 4AVKA 5TFSH 2FO4A 2TAAA 1ZY9A 2W92A 3MR9A 1JZ3A 1MREH 3UIZA 3RZCA 2WK2A 3ZX1A 4MS6A 4ODBD 1JGVL 4DZBB 1CDCA 1S7XA 4G8EA 5B7EA 5AKVA 5JW5B 1YUKB 1G4MA 4NQVB 3AMLA 1J5HA 4KKAC 2BY2A 4I18C 2R56H 4QRRD 3VI3B 4PJHB 2IH3B 4G8FB 2O93L 2Q20A 4LPTA 4I4WA 2D31B 4UTBH 4ABWA 2WLLA 2GG1A 4L1DA 4NQSA 3VX0A 4XVJH 2R29H 2VAJA 4ZDHB 4O2CB 5IMOA 3STBA 1KYAA 4BHUA 2I60H 3MRMA 3FL7A 2VR8A 1F6FB 3LKRA 3FB7B 2YK1H 4U2YA 3HFFA 4JFZH 4TULH 5HTSA 1IUZA 4KROD 4X6EB 1XR8A 5H4ZA 3BUPA 1WHOA 1TETH 4LARH 3NK4A 3MREB 4XN2A 1SVBA 1WH0A 3DROB 4HF5H 4L48A 3WNMA 1MEXL 2FZ3B 4LKXB 5K9OB 3WJMB 2OLDA 3AXLB 1QNZL 1XH3A 5CIPA 1RUPL 3HJ0A 4FTVB 2Y36H 2GJ6E 1ZA6A 1AR1D 1CE6A 5KG9B 1RJLB 5HDBB 2VDLB 2V17L 1BFTA 1CC3A 2ZUYA 4HJJH 3V4PA 4JY6B 3C2AH 2ZUUA 4XN4A 4GQZA 5F7WC 3SKUD 2IAMA 1SYVB 4P2CG 3LKSA 5C0AB 2IWEA 1ZTXH 5BZDA 4N0FB 4PRBA 1AD9A 2GSGB 4UM8B 5EO9B 4JFPA 2FBJH 1THAA 1I8IB 2VDKB 2Q6WA 3SGKA 4OZIF 5J6HA 4ZXBB 3DECA 3DETD 4RH4A 5EC2A 2VM3A 3VXUD 1NGWA 4UAOB 5HJGA 3GTNA 4MFHA 1V3KA 4PTUA 4KTEH 2VDLL 1Q1PA 2AXWA 3I02A 2VJ0A 1CFTA 3QDJD 2B9AA 2RB8A 1INEH 3B4NA 1UD2A 3AQZA 5AZEL 2BHUA 2X4UB 5I1GL 2FWOA 3PGDB 2VDKL 2XTSA 3Q8CA 3OWEA 2HCZX 1LNUB 2UZPA 4Y19E 2GFBB 2HJLA 3ZDYE 3CHRA 3PXJA 3N2JA 1Z0MA 2CLRB 1WBZB 3C6LA 3TBVA 3DGCR 6FABH 3T77A 2PETA 5C0GB 2JB6B 3VGAC 1FJ1B 1OPOA 2HT3D 1RMFL 4PJDB 4X5QA 4ACPA 2V2TB 1NEPA 3AFLA 4JO1H 1E9OB 4QTHA 3K2UL 4I0PA 3MRGB 3AXHA 4EOWL 5GXBB 5LO7A 5E8PA 1PFOA 4YE4L 1QEWA 2ZWYA 1X7QA 2N01B 3DUSA 3PQYD 4M7JH 1OGAD 3LMJL 5I66B 2ODIA 1JZ2A 2N4IA 1VPOL 3IFOB 3AJ7A 4LCWB 4Y4HA 4PLNC 5IV2B 5KYXB 3OJ2C 1Z0NA 4HH8A 4QI3A 4YHYB 2H5UA 4M5YL 4WSGA 4ZUSB 4YDLC 2D0FA 1NEUA 3NDYE 3ZE2E 4L0PB 1I1CA 1TIUA 4N2FA 1EFXD 1OB1B 5IB3B 4HW6A 3U2SB 2HB0A 1J0KA 2HSIA 4NNXA 4F92B 4LRNH 4KGJA 3NA9L 5L88H 3HW7A 3FUEA 4Y2DB 5FHBL 3MV11 4FG4A 2D0HA 4QJ3B 1RIVH 1HSAA 2AJZA 3LQZB 3B9KB 2MOGA 3KXFB 3FFCE 2XJLA 4Z7WA 3VFNB 3PWNA 1Q4NX 4TMPA 3RDTB 1PG7W 2OSXA 1P5UB 1PEZA 4UT6H 4NT6A 3HI6H 4AYGA 5TGBB 3I50H 3NFPA 4W81A 1HYSD 1XIWB 1X5KA 1NKGA 3L9RB 2CIKA 2ZOWA 1GOFA 2HX7A 4NLAA 1E8YA 2CRMA 4Q9QL 4OGYL 4GSXA 3WS3A 1XB8A 4HJEA 4L3EE 1U8HA 1XSJA 4UIKL 4F7CA 3GIZL 4YZFE 3FC8A 3W1ZA 4X4YA 2XZAH 4C83B 2GUOB 2C3VA 4IS6A 2IPKA 5B39B 1EDHA 1QA9A 3O6LL 2FB4H 4MSWB 3UDWC 2APVA 4PJ7A 1X5MA 4IBLT 5L0QB 4BUHA 4YAQB 3PNWB 1UD5A 5H8DA 3CXHJ 1MCIA 4JL2A 4B6ZA 3QJXA 4PLKD 1OTUD 4WI6A 5H35A 1YEGL 3Q9PA 4PYHA 5BCAA 3B5HA 2MH4A 4OFKA 1T0MB 4UNUA 2ZOKA 1AIZA 1FP5A 5D72H 2XKNB 3ULVH 1LK3L 3WTYA 4V33A 4G71B 4FJ6A 2P48B 1D5ZA 3WD5L 5IB2A 2X0WA 2DQFB 2NUTB 1ZT1B 3CZFA 4QNPE 5A40E 3TURA 2UZYA 4U1HB 5AW7B 3QQ4B 4DUXA 1F97A 2E0PA 1R3HA 2G60L 4XVTL 1MRCH 3FT2B 4U3HA 5C07A 4JE0A 3HLAB 3VFMB 1UYWL 3QJUB 4ICXA 4ELME 1Z9LA 3H4FA 2EDMA 4NQQA 3BKCL 2KPNA 1KXVC 4PJIF 2HRPH 4X0KB 3OKNB 4MAYC 3T65B 3EAKA 2Y3AA 4IKNA 2YA1A 3WKQA 2IH1B 2I7OA 4UILL 1TNNA 4ZTPL 3BD4A 4DGYL 1F5WA 4UQEA 3GZOA 1P6FA 1KB5B 1OM9A 1HWGB 2VLRB 4CC4C 1R3LA 5GGSY 3WLWC 4EXPX 2C9RA 4PWHA 3AWEA 4PAZA 2X2JA 1J1PL 1ZJBA 3H54A 2EVJA 5K5YA 3BP7A 3AGVA 4P2QB 2XXMB 1CF8L 4YS4A 4Y5VC 2KZ1B 1SY6H 1WIUA 3LKPA 1HKLL 5F7KC 1HZKA 1T66D 4CSSA 1I1RA 3K1DA 5I0ZA 2FSEA 3SDAC 1DVXA 3K6NA 4XC1H 2XXFA 1M71A 2PXYB 3L5WB 4D3CL 4JRYE 1IGTB 1H15B 2W65A 2CCVA 2CJSA 4NC1C 1WGVA 2E76C 3GB7A 5DC4B 4ZJ9A 1BYNA 2GK0A 3MJ9A 3PU7A 3X11A 2MQ0A 2NZ9D 5KSAB 1UTDA 1EUUA 2PW1A 3W38A 1F6LL 1Q1JH 1IQDA 2DQHL 3CLEH 2A9NH 1YYLL 4PJEB 3SE9L 1WS8A 2QZ5A 4WJ5B 4DW2H 4EO5A 2DOCA 1F18A 5F7BA 1JZEA 4C4BA 5KBMA 2AZUA 1EV2E 1IGCL 1IQWL 1KELL 4XNXL 2DL9A 4MDJB 2MCAA 4Z7VF 3JV4A 43CAA 4TSBH 3AUVA 2XRAH 3MBED 5EU6D 4XBMA 1U33A 4IOIA 2L7UA 4XPFH 1JXDA 1OCRB 4A7UA 1PIGA 3ARFB 4X6CB 3TJHC 5IMMA 1MFEL 3AW5A 1A9EA 2DWTA 5AAMA 3R4RA 3ZYJA 5KANI 2WVVA 3HIZA 4C4UA 1CTNA 3DYMA 5IFHH 4J3OD 2DLFH 1MW1A 3PAUA 4FJZA 4JZJC 4P5MB 4YHPB 3SD2A 4WF7A 4UQIM 1MFDH 1U3HC 5EBLB 5F8QC 5IVXF 4GRWE 5I1EL 4N2BA 4W9ZA 4HIJA 4OF3A 2XX0A 3SBWA 1SN5A 5ITBH 3ARGB 4M6NH 4OZHB 5C92A 3SE4C 1XGPA 1EAQA 4LF3B 2HMIC 1AJ7H 1Z9MA 3S98A 4B60A 3UOAB 3LXCA 1KYUA 3PAVA 3U6RA 3LJ3A 3EDFA 3RL1B 1G7QB 5JQIB 5JW4M 1W9XA 3AM8C 4G5ZH 4KBPA 5BS0E 3PWPE 3B7SA 3SPGA 1E5YA 3JWNH 2DAVA 1K8IB 3IU4L 5F7EH 4BH8A 3HA0A 3HC0A 1S7TB 3V4UL 1YNTB 8PAZA 2ZCHH 5JW3L 1IARB 3UZQB 1KPVB 2X70B 4JHAH 3MX0B 4RNRB 2YPLA 3KWWB 5CEZH 5AZ2H 2FJHB 4JS7A 3UP1A 1CCZA 4C57C 2WN3A 4Z7UB 4F80A 3TEZA 5DRZA 5KZCB 2ZOLA 4PJ9A 4PJAA 4OF6A 3OHMB 2MJWA 2ROYA 3DV6A 3ARDB 2FR4B 4TVPE 1NEZG 2QL1A 4YVUA 2IFFH 4QD2E 3UTSA 4WHCA 5FCUL 1MH5A 2WYTA 5DTFA 1FBIH 5E56A 1BDYA 1AGDA 4M8RA 1N18A 3BAXA 3W0WA 4H8HA 5ACMA 1M7DB 1KBBA 4IRSD 4RGNE 3L6FA 1INDH 1FFQA 3RKDC 2XNAB 1BREA 2O26U 1ZV9A 2VAAB 3U7WL 1P84J 1E5CA 1L6XA 1QSFB 5IFJA 1I8MA 1C12B 3LKOA 3T6WA 5DCCA 4FDWA 3UTOA 1JGUH 3UYOD 2H7WA 5AFAA 2C9UA 3H2QA 1MUJA 1WC7A 5FO2A 4HK3N 3HOGA 3NCWA 1HEJC 3N85L 1QG3A 4ATTA 1Y18B 1SDAB 5GJTH 4LE8A 4Z7QB 1YMMB 1T6VN 4NRXA 3R19A 4WO4B 3K3QA 4EKJA 5E5MB 1A7NH 1ND0A 3TF4A 2DQGH 2JB5H 3L4YA 4WEMB 4L8BB 1KCVL 4OZFG 3ZZQA 2QQNL 3CHPA 2X44D 3K4DA 4U6XB 4JY4A 1FNSL 2ZAHA 4OQTH 4Q58C 1ZGLM 1KENL 2HT2C 3PIQB 4P4KB 4K73A 3ECWA 5DF0A 2QVTA 5EIVA 3ULVF 4R97C 2CMRH 3BWUC 2RA1A 3JVGC 2YGPA 5I1CH 1FHGA 2FUTA 3N0AA 5FYLH 2KL6A 1HL5A 1KYOJ 5KAQG 1GTFA 1QVOB 1D9KB 3RWFA 4XR8C 5KVGE 3FB5A 4G7RB 4HHAB 1KB5H 4OIIH 1OAYL 3UTTA 2I24N 2YKLL 1SDDA 1ZCRA 3MRHB 5ESQA 1ZLWH 5I71C 4M56A 3VI3F 4WWKA 4PJHF 4ZMLA 3TWCH 5KN5A 2PTVA 3VI4A 1WTLA 2XWRA 4QXWA 5CZXC 1G7JB 3CSYB 3MLUH 1OB0A 2GSMB 1EAPA 2VISB 3HZ3A 1WZAA 5JLZA 2EH7L 1MHEA 4TUJB 2XN9B 2Q10A 4N5UA 2R27A 4ZFQA 5FO7A 1F6AB 1FG9C 1HDMB 4ORZC 3SYQA 2DEYX 1TLKA 2YQGA 3BLBA 4NKQB 5FWQA 3FO0H 4PBVC 4N0YL 1RZ7H 3NCMA 1ACYH 4OCSL 2DBLL 3DVNA 3JWOC 4M6OH 1I1YA 5F6HI 4FQ1H 1RJCA 1BZ7B 4MGXA 1HCYA 4M7LH 2W81C 3D08A 4ZZKA 2IEPA 4NO2B 2ZYIA 3MUHL 3QXVA 5IREA 3F2LA 3PREA 4TOYL 3QARA 1B4LA 4NO0A 4KY1H 4XBGB 4O4YH 5GS0C 3OMIB 4E36A 3Q2LA 1NDTA 4V11A 4XGZA 3AREC 5HDBF 1FORL 5I2IB 4U1LB 1N0XH 1PKQE 1KIUB 4JRXD 4TV3A 2VDQB 3ZIYA 4RRPA 2F19L 4YSUA 4N9GA 3QJZA 4PD4K 3L54A 4KC3B 1HK6A 4K8RH 1YA5A 4A2MA 4LCYA 4CU8A 4P2RB 2YD1A 3CD4A 3VGHA 3ZQ9A 1FPTL 1SLXA 5E8EA 3HCVB 2D9QB 4ZG1A 4ZMZA 4HQQL 4K2UL 2IPTH 1T2XA 2Q7AA 3GSVB 2VSCA 3HZKB 4WWOA 4Y2OA 5E5UB 3FU6A 3OHXA 1OHQA 1UVQA 4AI7A 4ZAKA 4GKSB 4NFBA 4OFIA 3VFVA 2VDQL 1S7UB 1Y1DA 5J0BA 5T33H 2G75B 1R3JB 3CCHA 4LFHG 2P8MA 4L4VE 3TJEL 4KZ0A 3CFCL 1PW3A 2XLLA 3BD3A 4XCYB 4R5TA 1XZWA 4PY7A 5IOPA 3PP4L 2QKIA 3WFBH 3B6SA 4RMQA 1X4ZA 2MQGA 1OAQH 2OQJB 2VN6A 2XXCB 3MO1B 2YC1B 5BQ7B 1WBYA 4ETQA 1XGUA 4I3SH 2BRRL 5AKSA 1ZXQA 3ZE0B 1PPIA 4BZ2H 1FC2D 1LE5B 3WO3B 3W2DH 1IKNA 3A0OA 4JFHE 2XA8H 4CC1A 3QNYA 1NMAL 1OTSC 4RZCB 5JIMA 4LVNB 1YEJH 1MFBH 1ZSHA 5CAYB 5JOFA 3ZRSA 2ZKHH 1CYXA 3T6ZA 5CCGE 4PJDF 3SDYH 5ESVB 1O6SB 1JAEA 2G0KA 3OG6B 2QHRH 1JF5A 3QNFA 3BC9A 3HI1B 1U3NA 4O2EB 4YHIB 5TE6H 4BE5A 4EQ3A 3GMMB 5AYTA 4D0DA 3BVWA 3ARBC 4IK6A 4WNQA 3K6SB 1KIRA 2CNYA 3A67H 3L2LA 3IDMA 2B59B 3KBFA 3CFNA 1TQWA 3ATDA 4UMGA 3GDBA 1U8LA 2H3NA 2YUXA 3C8KB 3NTCH 1P4IH 3HG0A 2AXFB 3T3MB 5AKRA 4QRRE 3FU7B 4FX5A 2YBRA 4YUEH 3BPLB 1ZK9A 1LWRA 1YEIH 3FU8A 4OLEA 1HT6A 2OV0A 4FFTA 1WJ3A 3J2PA 1KIQA 3LHPL 5FLVA 5GRWA 3OKOB 4K9EH 3VG0L 3QEUA 1AGCA 2AEPH 3FQUA 1CG9A 4HWNA 3SYCA 3RVVD 5J8OA 2BW5A 3S4SB 3S6CA 5JXAL 4X6BB 4XI5D 5T5FA 3ZHLA 1KGUA 1SXSA 3H55A 1Z3RA 4P23B 3SDDD 5TPWH 2J6EL 5FGSA 1GGYA 3QZWA 3L4WA 4A63A 5TQ2L 3CDYA 4JFFB 1UWYA 5CP7A 4XP4L 1E8ZA 2AXJA 2JJTA 3BZFB 4NSKB 4XAWL 1JNNH 5HI5D 4WK4B 1R24A 4GXVL 5LCVL 1CPUA 1DQJB 3V6BR 5HGBA 1NC4A 3AB0B 4R2GC 5GRXG 4XBPB 2VOTA 3RX8A 1FN4B 1RK7A 1RHHB 5E0QA 1RZGA 3RX5A 5F44A 1KPRB 1XAUA 1G1OA 1A9BB 4EBQL 1U4EA 3F6JA 1MHCB 3HZMA 3OZ9L 2YD6A 2ICEA 2R69A 4JFXB 4UINH 3AZUA 1IMHC 3VXUE 3IJYA 4J3SA 4F91B 2ATPA 5I5RA 4UV4L 5T1DH 3QG7L 4M5TA 4QHKI 3OAUL 1QI5A 5CSBA 2JKTM 3Q2CA 3GXTA 2R59A 4QHLA 3TO4C 5ABZA 5JPMC 3FN0H 4GSUA 2NNAB 3QXAA 3TIDB 2XVKA 1A3LH 1NPUA 2UWEF 4U33A 4N20A 3U9WA 5C0NC 4APXA 3RZCD 4JDTH 3RFZA 4BZYA 2K3TA 2VT0A 5LB1A 1F90L 4CN1A 2FE0A 4S2SA 5JW4N 4Z8FL 3VFSB 1X9RA 3L95A 3PRZA 3T1FA 4S1SL 3WIIH 3Q6FA 3QCTH 3Q13A 5H2BB 2PMZA 5EPMB 2GTZA 4K3HA 2AJUL 2JKLA 3TEXA 2Y7NA 4Y9FA 3L7FA 2GHWB 4JM2A 5F3BA 5KVFL 2BIPA 4BFEA 5F7NC 4J4PD 1I1AD 5G5DB 3KD4A 1I1FA 4U2ZA 3NSYA 3PXLA 5B22A 2G5RA 1ROCA 1E5ZA 1JPEA 2JIXA 2WKGA 2WOYA 4WI0A 1MNUL 5DT1H 1T22A 3BQUC 3U1SH 2OX5A 4FC3E 4MD0A 3W11D 2E6PA 5ENWA 5JDSB 2WB7A 4XPBH 3QIWD 3UGEA 1UWXH 5LHDA 4M1DL 1B4RA 3FO1B 4I77L 3QXDA 3NZ8B 1G5GA 1L9TA 2K70A 3FCSA 1YPZA 2ZPKL 4K3JH 5EH1A 2DICA 5I6XC 3ESNA 4J6IA 2DLIA 3MGTA 3OMAB 3WJJC 1WS7A 3PQYE 3LQAL 1PU0A 3O3BA 4HEMA 3UGUA 2YBGA 1U8MB 3CFJB 4IKLA 1XSOA 1VKXA 2CXGA 2OJEA 1RZJL 2W9LA 1IILE 2C1OA 4NM4L 3GLAA 3EHBD 3HZVA 3S3DB 2D7TH 5E2TL 1MCOL 3RUGA 3BGFB 1K8DB 3UADA 4AT6A 4PJEF 3VFPB 2UY7B 1N10A 2IAMD 1F1GA 4MA7H 3MNWA 2EDBA 5DJXA 1HWWA 4GAAA 5FUCE 1JPSH 1YQ2A 4RX4D 1Q8MA 1W80A 1CBVL 4Y16B 5ESAB 4LCCB 1C7SA 1EAOA 1LO4L 5LXVA 1I8KA 1SEQL 4Z3HA 2VL5B 3OKEB 5D1ZC 4X6CF 5AW3B 1XT5A 2PPFA 4WGVB 4C47A 3ILPA 2BIQA 3QFJA 5MEPA 2W38A 1Z9OA 2W60A 5EBGA 3V0EA 5D93C 3PAYA 4PPTA 5DHDA 5C08E 4ZQKA 3W5MA 2A4ZA 3D05A 3HMWL 2NX5D 4NRZA 5IEKA 1BZ8A 3RDTC 3GSXB 5MI0B 5AYQA 2VLJD 5GRZA 3M88A 2WN2A 3VXMA 1D5XB 1WCBB 4LLAA 2C3WA 4OZHF 5IGXH 5D70L 1JK9B 3BT2H 3GS0A 3UJJL 2CU9A 3HS0A 4PJ8B 4WCYH 3VFUA 1L0XA 5T3XH 4PBXA 1IJNA 3CDZA 4W9HC 5IMKA 5JHDA 1DJWA 3AT9A 3DXAB 2CBPA 2VXSL 1R5VA 5EMYA 25C8H 3IJSA 1HL4A 1X5XA 4PRNA 2X41A 3GS7A 3D85B 3L16A 3PL6B 5LBVA 3AADB 2NXZC 2VLKA 1I85A 1AYOA 5L0QC 4L8SB 4NDMB 4HJTA 3MLPA 1M6OB 3FCTB 1DR9A 3MRNA 1RL1A 5D55A 4EI6B 2VXUL 4K23H 2O5YH 5B1JA 3A4AA 4JRWA 2NR6D 1YNTF 3TBYA 5LXGL 3GXDA 2FYYB 1TKWB 4NWTL 1ZV2A 4BK4A 2XU9A 3QP3A 3H9YA 5KBPA 1UXMA 3ARVA 3ZYZA 3T4YB 2YWYA 4P46B 1A6UL 3ULUL 4MQSB 4TM9A 1KOAA 2YN3A 4MX7B 4Z7UF 5D6CB 2D73A 5HI4D 3L1FA 1SM3L 1X5GA 3HZYA 3QUMB 5GRJL 3L4CA 4JKNA 1J0IA 3UG4A 2RAMA 4NQTA 3IDUA 2CHDA 4TTGA 4E42B 3ISRA 2EDDA 3F8UB 1MFAH 1BEXA 5IHZA 1DZ0A 5A6MA 4Y1SA 3VNYA 3S96A 4EZMA 3KL0A 1A7PL 1A65A 4NO5B 5I0YA 4LP8A 1QBLL 1DEDA 2QSTA 1EPFA 4PGZA 3VWJA 2Y5EA 3MJ7B 4XCCH 5GZOA 3Q8AA 4XPAL 5TQ0H 2GJ6B 4KMLB 2F54A 3GTVA 1XGTB 4U0RC 1W0VA 4EIZC 3Q7JA 1GMEA 1YQVH 5PAZA 2RCSH 3KLAB 2CBOA 2FLRT 4BFFA 3FTGA 4AM0B 1H3TA 3R8BB 4FN0A 1WP6A 2WWOA 1ZIAA 4JAMB 1CFVL 4W9DC 1AGEA 4PR5B 4JKPH 3IN0A 4QKTA 1OAKL 3MRDA 3GLEA 4Z7QF 4MQXD 4N22A 2PXYC 1HHHB 5I23A 2K9FB 2WWMD 3UJTH 1OP9A 3WN5A 1GYCA 5EU6E 2A83B 2IADA 4HC1H 3TZVC 4EUPH 3VH8A 1T4KA 4BE6A 1FUNA 4G9FA 5F7AA 2NY1B 4FYSA 5F9AC 3WBDA 1EFQA 1J05A 2HP4A 2X1QA 3LB6D 4QXTB 1BF2A 3MRIB 3NOIA 5ICUA 4AWJC 2X1PA 1HHJA 5CEYB 2DLHA 4F5CA 4WSJA 2CDGA 3VQLA 2YR3A 3KPNA 3QYNA 2WQWA 2ATAA 1NAKH 3QFDB 4Y19B 1HXMA 1H3XA 1LWHA 5I1IH 3RPBA 4UM9B 4J12A 3MRLA 4TUKH 3HE6A 5CGYC 4DUVA 3ZDYB 1FG2A 1S9KC 2CBTA 4A7VA 2ZXCA 3ZDZE 3WFCL 3O11A 3LPFA 2A9MH 1C08B 1AXTL 1J5DA 4LSQL 3ALXA 2QTVA 3QPXL 4PJXB 4XPHH 5HXMA 2ESVE 3CK0H 3LKNB 3POCA 4FCHA 4EI5C 1HCFX 5MEND 3DBXA 1QPPA 2JCCA 5JXEC 4N8VB 4XVSH 3CBKB 4HPYL 5EC1B 3PJSB 3EYVB 5L8KB 3AU1A 1NJ9A 1OAUL 1SHSA 2KH2B 3LRHA 2PP9A 2WXHA 3Q44A 4NBZB 1X9QA 4NNYB 2ZF9A 5AVQB 2K4WA 3MV7A 3CAFA 4DVBB 1U6AH 1ECYA 2DTML 1T3FB 4RSYA 1E4XL 3AVEA 2H45A 3OKDA 4WEUD 5GS2D 3RIFF 4S11A 3UXFA 1MCCA 2ENPA 4S1RH 4ZPVB 5CCHE 3ZE2B 1RP8A 5EZOL 5DURD 5FM5M 2V5RA 3D3VE 3K74B 4KI5E 5TK2A 2FX8L 3V6OA 2O5XL 3BAEL 3IKKA 1VADB 4HCRA 4AMKL 1H3GA 2NXYC 3G6DL 5A3IC 2F53B 1N64L 2G9HB 2GSIB 1EXGA 3DVGB 1JZHA 4PGEA 2R1WA 1N6UA 1IAIL 2B5IC 1QW9A 3FFCB 4PI2A 2ADIB 2ITDB 2WQ8A 3C5ZC 5L8JB 5DUPH 3GBLA 5CD3B 1FZJA 3ROLB 1W6LA 1NICA 1S7QA 3VM7A 5KSUB 3D2TA 1PD6A 2ZP8A 3GJFH 5JPNA 2AEIT 4PJIA 4O02L 1A4JA 4AM0Q 4F58L 1LDPL 2I85A 4L23A 3ZGIA 1AIFB 3AS3A 4GINA 4QXGH 4W9FC 3VW3H 4FXKA 1XGYH 1I9IH 1NFIB 1RJYB 2AQSA 2EIDA 2XWEA 3GMPA 4L3EB 2J8HA 4YBQD 1PY0A 4XXWA 3OSVA 4K0OA 1QSVA 4YMPA 3BVNB 4UTBA 1CLVA 4Y8AA 3APNA 5D8JH 5BRZA 5J11B 3BRDA 1NFDE 2M1KA 4WHYH 1KLGA 4ZK8A 2DQIL 2WAQA 4H25A 3GQFA 3V8CA 4NQXB 1CFSA 1DUYB 5EOCJ 4RRPM 4MLIA 4O9HL 1QP1A 4LEBA 3ZE0F 1P6WA 2EC9U 1DTUA 1R17A 1S78D 2PKDA 2JI2A 5CXPA 3V6FB 5DS8A 1OAZH 2BLFA 3QDGA 2CJUH 4J2QA 2NY4B 4NFDA 4ZX6A 4JDVA 3TA3D 3WNIA 4DVRL 4PB0H 1PFCA 2Q2EB 4TKWA 4X8CA 3SBQA 1LQSR 5IF0B 4F24A 4Y4FC 2BJMH 5HYJE 3JSSA 1X9UA 2CUIA 1OM3L 3HS8A 4MNHA 4ELMB 2XTJC 1N26A 1RURL 4MRBA 5FYKU 4Z7VA 3HFML 1NOFA 5K59F 4AUJA 3IFNH 1A25A 1QATA 1XF4A 2F5AH 3ZMEA 1NOAA 5DYOA 3QUMH 2NCEA 2WB1A 3BUQA 4R4NC 5KS9E 2XWZA 1T04A 1FYTA 4CGTA 3T3MF 2NZIA 5GZNC 3BPCA 3KGSA 5B3NA 1FE8H 3UTSD 2HJKA 3FTSA 4LDCA 3GSNB 2VIRA 5EIIA 5C9JB 4ZFZB 3D0LB 3QNXB 2BVUA 2Y22A 3MOBL 4HBCH 1ES0A 3W0WD 3FT9A 2OSLB 5JIDA 2FQEA 5E9NA 3EF4A 1Y0LB 4YOKA 2V9TA 4AYSA 3ARTA 1YECL 3LEXA 4LEXL 1ZVSA 1A6ZB 5JA9A 1LK2B 4GMSH 4QHNB 1CTOA 4NN6C 2V8LA 4JRYB 4HLZG 4FLRA 5DI8B 5DVOA 4MCZA 2VZVA 4KK8D 2B20A 4P5TC 1CXIA 3GSNL 1FNGB 2VE6A 3LZFL 3OJDA 3WTWA 3P0YL 2E7BA 2WOBA 1GZHC 4PN6A 4YDJA 4KPHL 4MQ7B 1S7VA 1TZHA 4J1UB 2OMTB 1ETB1 4JRXE 4QR7A 4YSSA 2VR4A 3A47A 4Y1TA 4Y2LA 5T1KA 4RRPG 4HCFA 2BSRB 2CLZB 3BKJH 4W4NA 3ECBA 4F9LA 1OD7A 3CFQA 2MTPA 4Y5YB 3VDCA 4E9QA 4GUPA 1HN1A 1MWAB 2FX7H 5I5IA 1NLDH 2Q86A 3OD3A 3I2CH 4X5RA 5E1GA 2D03H 1SYSB 3GLDA 2J2ZA 1BYOA 4GKNA 4AG4L 5DZOA 5CJ8A 1FL3A 2IOMA 5DJ6A 4LIQE 3H9SA 5J56B 4JLRA 1EXUB 4FHJA 1VACA 1XTMA 2ZSWA 3SYAA 4NJ9H 1XZ0A 3KPOB 1IZJA 1KCSH 4RFNC 4HWEH 5DMYA 1CD9B 3N9GH 4GRWB 4XPTH 1KC5H 3FRUA 3TNMA 5B3JF 4ZBJA 5FEBA 4NQEA 1ZHLB 1WIOA 4HV8A 4JG0H 4MAUH 3LX9A 1A6AB 4A7GA 1O6TA 5DA0B 3JWDL 4UT6A 3RI5F 3ZL1A 3UH8A 2BVYA 1D5IH 2WAHA 2A1WL 1WWCA 1A2YA 3VAEA 3PV6B 4KVNL 5KJ4A 5BS0B 4BXSV 3ILEA 4KJYB 1SJHA 1WAAA 2P7TB 3IDGA 3PWPB 3QNZA 4IRJB 5DD5H 3QIBB 4P3CH 2NLJB 3IJHB 4PWKA 3KHQA 2F68X 3WEMA 4PG2A 4N9OB 1YY8A 3CHSA 2OAAA 1IC1A 1I4FB 4DT2A 3UZVA 2EH8H 4TUOB 3ZKMC 4NUQA 2FJGA 3BKYL 5CJ5A 1W8OA 1OF0A 4PY8I 3KYKL 1DSWA 5G2NA 4PP2A 4NO0D 5F1IA 1FVDB 1Q72H 3F12A 3HUJA 1LE9B 1KBPA 1VRSA 4M8UA 4NM8H 1F1AA 5BZWB 4NC2B 4PRHE 4GIPD 1FA4A 4ONFL 4BDVB 1GHFL 2UZIH 4HDIA 4LOUC 1BFVL 2P4AB 4DTGL 2WBJC 3VGGA 2EKSB 2OCFD 1QKZL 5T1MB 2YPKA 5FB8B 2X9XA 2Z0UA 4MWFA 4DZBA 1JGDB 5A2KH 3MRBB 4JJ5B 1JV5B 4R26L 5D1XC 4UQ2A 2V9QA 3HKFA 1WA2X 5HHXL 4RGNB 1JP5A 3BIKB 4HZLB 3QDMD 5J12B 4FABL 3QUXC 1H5BC 1NCIA 4ZAKD 2H32B 4TVPL 5HHMD 5L4IA 2ORBL 3ARWA 3P3SA 1NCDH 4MMXB 4QXUH 3U4AA 1FDLL 3QZWG 3KCPA 1EO5A 4M4PA 1YDPB 4JUTA 4XC3L 5ALCH 1XBDA 3IMUA 3ERXA 5IB5B 1IIIA 5GGRB 4O2CA 3A21A 3OGCA 2FH6A 3NFSL 3U48A 1T4WA 1BZOA 3WY3A 3WS6A 2JQZA 3E6FB 2YXVA 4Y9GA 5F71A 1CE1L 2FQGA 4KTDH 3DSFL 1F4HA 4D8PB 1E2WA 1WFOA 1E3XA 3WJMA 4BFKA 4P06A 5B38B 4I1PA 1RK1B 1KBGH 4OLZL 1WUNT 4APQB 3WIFA 3K0WA 3MNVA 2AXGA 1BJMA 1ORQB 5CNHA 2ZICA 4H20H 3X3GL 4FZ8H 1RJLA 4ZOCA 4YZWA 5BOJA 4XMTA 1K5NA 3BUBA 4XO9A 1SVZA 4XVOA 2ICWI 2ZX9A 1JF6A 1NPJA 1OQOA 4RDQF 4U6YA 1FO0B 5FYKE 2KDGA 5E2UL 3UROR 3V6ZB 5EULV 3W56A 3L4TA 3LTVA 3R7RA 1EMTH 1MIEH 2WUBL 4F7MB 4LSPH 2YUZA 3MCLL 3STLA 1M05B 5DJ8A 2XJKA 4ZXBA 2HN7A 1HJCA 4FOMA 1KTDA 5EWIH 3P4MB 4P99A 3FUMA 1NGXB 3O9WA 4L1TA 1K6QL 4FXGC 4AUUA 3ASOB 1JVLA 2CCWA 4JKMA 2B4CL 3O0RL 3NH7L 1EGJH 1NCCL 1II4E 1KN4H 5D7JA 1FO0L 2DKSA 1KY7A 2BS71 1A14L 3BVDB 1HH6B 1AI1L 3EBGA 3QI9C 4ZFFB 2X4UA 4XOBA 2O6PA 2HVJA 1E4XI 3A6CH 3PGDA 3WEXA 4CMMB 5KVGL 5F0MB 1CXEA 1ZS2A 2CLVA 2V7HA 5MERB 2WLNA 1OGTB 3INUH 5SWQA 5DJYB 3ABZA 5J89A 2MPAH 3E2HB 4RGMB 2GFBA 2QQKL 2H0PA 2R2EA 4X98B 2WZPA 1XF1A 3MYJB 2CLRA 1PYWB 4B7IA 1RZJC 4AUYA 2QPDB 5IY5B 3O6KL 1PKQB 2EDWA 1A5FH 2Z34A 4FQXC 4NUJB 1VFOA 5DRXA 5CD5D 2X28A 1E28A 1CDGA 3CFEA 3MAWA 3A6OA 3LEYH 4OM0L 3QULA 4P59H 2H3KA 1MWAH 1NMBH 2IV9A 1KN2L 4Y5XC 3O6MH 5HHPB 4JQIL 4WEEA 4IJ3B 5DU7A 5DQJA 3TA4D 2Y6SD 3IFOA 5HPOA 4CAGA 5E4EB 1WITA 3FH8A 4FTDA 1E4JA 3G7TA 4X9YA 3SBRA 5GGVH 5IB3A 1OB1A 2E59A 1AKJB 1HS6A 2Z7YA 3WL9A 2XWJA 4GRWH 4N6RB 3T6XA 3U4BL 1NMCB 4L4VB 3V7AG 3R06B 4L5FL 1NGZB 1AGFA 1CK0L 3FOMA 3VFOB 4E41A 2R7EB 1CR9L 1ZDSA 5FIEA 2GT9A 1IBBA 1DSFL 1AMYA 3B9KA 4GIOA 2PO6C 3KXFA 1SUJA 4UNTA 1GAFH 2P8LA 4MJIA 5DO2D 3SE6A 1WAEA 5E08H 3BZ5A 4TSCL 1S46A 1P5UA 2ADFL 4QGYA 4G6ML 4AC2A 2OS7A 1RD6A 1TQCC 1U8PB 4DQOH 5HI3D 2HLFD 2BC4B 3ZDYF 4AQEB 4G6KL 2JIXD 4OLYL 4HWZB 3W39B 3T0EA 4LAQH 1NCAH 2B7DT 3GBDA 4G7VL 5IUCA 4WQOA 2KZBA 1XH2A 4FFWC 4PJXF 3NJGA 3RG1C 2HZHA 4PGCA 5DZAA 1MLBB 2WXKA 1GSKA 5AOZA 4ZD3H 3WAJA 1HHGA 1BHGA 4AEFA 2EEBA 3JWOH 3A24A 2WXNA 3OX8A 4Z0XB 1A6WH 2BY3A 2Z9TA 3BAJA 3BKML 3HNVL 1ZE3H 3FQ4A 3TNNA 2PCFB 1A6VL 4RAHA 4LQFL 3EOYG 4YAQA 5SWZD 4M5ZH 5DQDH 4PGBA 2FJUB 5C0BD 2D9CA 4ISVB 4YFDB 2G9KA 3LHAA 4JREB 1KYDA 1I82A 4PJ8C 4MJ4A 4KX9A 3UCRA 2IV8A 4Q9BA 4I89A 3ZE2F 2E8ZA 5JIQA 2ZXGA 3CX5J 4E5XA 5EZLA 2AVFA 2NY6B 4ZOBA 4QYOA 5F96H 4HOMA 4QRRB 3ULUC 2R0KH 4G80A 3LV3A 4DPRA 1BJ1H 4Z6AT 4IBVA 4HYTB 1MJ8H 1U3JA 4GS7B 4AXWB 2UWEA 1DANU 2NUTA 2X4PB 1ADQA 3NEOA 3ZR5A 4PYGA 3N55A 1Z6JT 1N59B 1RUAH 3D51A 4PUBL 1R3KA 4XVUC 5B8CC 5MP6L 3E1ZA 4OQTA 3D18B 1R9FA 3FT2A 3GTTA 4I13B 4NWUL 4XP6H 3WNOA 4Z7WE 4KKBC 3Q01A 4BRJA 5AB0A 2H32H 3V4VL 1BQRA 2XG4A 5C09A 5AZUA 1DJZA 1JXFA 4PCTA 1XO8A 1T1WA 5EEXA 3RWGA 4M7KH 3RNKB 2K4AA 1E6JL 3AS0A 4XX1G 5HVHC 1QZNA 3LN4A 3DJ9A 3LN5A 4G1EB 4GRLA 4BH7B 4U1NB 5E1AA 4AQ1C 1AR1B 3WJLA 1OAJA 5CP3A 1LEKA 1QR1B 4PV9B 2HA1A 1XV8A 4V1DD 1ZV5A 2AANA 3VX1A 1KXQA 3HHSB 4NB7A 4HMDA 3VXMD 3G5WA 5E9DA 3GD1C 4NJAH 2EDRA 1KPUA 1DN0B 1LTXA 3QIUA 5JHDD 1IEAA 2XN1A 3KBEA 3MROA 4H88H 3NZSA 4A67A 5KSAA 2CBMA 1TVBB 3AT8A 3KPQA 2DJSA 2OYKA 2UXVA 2VLKD 1NDGA 3VH8G 1PQZB 2W9EL 3CDGA 3PGCB 4L9LC 2V5YA 4QNPF 4YBLC 5F9OL 3WEOA 5JMRA 6TAAA 4JK0D 3B2UC 3QO0B 2JJWA 4XNMA 2OMNA 1PG7L 3KM1A 3KPPB 3RJOA 5C0FA 5C07E 5CLTA 3T08A 4ELMF 4ENED 3I75A 2ZWNA 4LNRB 2BMKB 1OAXH 4YHOH 4BGDA 1BG1A 1FAIH 1YNKH 2X53A 3Q1EA 3FCBA 2F0CA 3TN0A 5TH2A 4AJ0A 5A2BA 2P45B 4LPVA 2ZXDA 1YZZA 3ARFA 3BVUA 4Q4IA 5DEGB 5C7ZA 2O6FA 3D34A 2YMOA 4YN3A 3H3PL 5JA8B 3LS4H 1X4YA 2FGWL 2R4RH 3L1OH 1SUHA 4EDXB 3IF1B 1BM7A 3P2DA 5CJQL 2IO5A 4GFXA 3U0PB 1JPTL 1QNZH 2HG5A 4R4FL 3QS3A 3BFOA 2F7OA 1RULL 1UEMA 3PQYB 5FO9B 5K9KB 4OCMC 1NUNB 4M93C 1DFBH 3NJLA 3WG7B 3B2PA 4U7MA 3RY6C 3X3FH 4EEEA 3PFQA 5LJYH 2F54D 3F5WB 4JN2B 4R90H 1A21A 4WV1A 4BZ2A 1KNOB 2IXQB 4I5BA 1G7QA 1E4KA 1T5WB 2E7HA 1LM8V 5FM4A 1LILA 3IDYB 5E6YA 2ZAGA 3V10A 2KLRA 1P4LB 3O3DB 3O45B 5GJSL 1KXTA 3BWZA 2AQQA 1FF5A 5ID0B 1VERA 4QKXB 1RUML 4H26A 3BO8B 4MNQA 3LZPA 5AL0A 1GS6X 1PDKB 1U8OB 3KPRA 4L4JA 3CWGA 5DRNB 3DX2A 2WXJA 4HP5A 4J28A 4YDVA 3GSRA 2H1LM 1KPVA 1QHPA 4CU6A 3FUKA 1Z5YD 1OWWA 5D7LD 4NS0A 5IESH 5K9JL 2CRIA 4ZUTB 5C08B 5E6ID 2DWDB 3X14B 3BSHA 5TE4H 4DNLA 4EZJA 1B6DA 3BDYL 1BZQK 1GGIH 2VW7A 3MUZ1 1CICB 3OKMA 5ALBH 1N6QH 4IKKA 4R7NB 1QHQA 5LAXB 4GRWF 3SO3C 4POZC 3ZTJH 5T8IA 2FJFB 1FL5B 1NAMH 5FDWB 3NYKA 1IV8A 4KDVA 4ZMAT 1QTYT 3HE6D 1J48A 2EKJA 5F1NB 4O58H 3EYQD 1J18A 1JDCA 2EE0A 1QX1A 2VDRH 1OV8A 2VAAA 5DD6A 3K2UH 1JHKL 3LRSA 1GKEA 4YE4H 1KT2B 5FPIA 2E9IA 3GNML 3EJYD 2JQMA 4NP4L 5AW0B 4HOXA 3LMJH 3VVVA 4DKEH 1ID5I 4E0RB 2MHAB 2HT4C 2HAZA 5EU3B 1DLFH 4QRSB 4KKNA 2G3MA 3P30H 3V8OA 4MMYB 4KV5E 3VGFA 1AO7A 4OLXL 3UPCA 5C0RH 4G6JL 2JJVA 2OZ4A 3QPKA 5FHBH 2YPLE 3ME0A 5KVDL 3SPVB 4TVSa 3BUYA 4HT1H 1HXKA 2Z7UA 5MEOB 3MLXH 1ZWIA 4PJAE 4ODTL 5L6YH 3O8XA 2AP2A 1BX2A 4GLRH 4AITA 4A6YL 2VDNB 2AMUA 1NIFA 3EYOB 3UTSE 7CGTA 3NSFA 1RQ5A 5DD1L 5IW3A 4X99B 2XIDA 4LGRB 4OKVB 1JDAA 5HJ3B 3LPGA 4YNYA 4P9ML 2VQUA 4OM1L 2ODHA 5E00B 2BOCB 3W0WE 1D9KA 4BQ9A 3SKMA 2AAVA 2CJTA 2NY5H 2ZUXA 4JW3A 4WI2A 3VD5A 3DRTB 5CU9A 1PLGL 1QZ1A 1GCYA 3SPCA 2CRYA 4X42A 5C97A 1S3KL 3SYOA 1KTRL 1E5AA 2FWLB 3FZUC 2HFFA 5A2FA 43C9B 5INDB 3CSYA 3QWOA 1A3RL 5HPMA 4X5WB 4XOEA 1UFGA 2XN9A 3D52A 5LBSL 3V0FA 5KBNC 1F6AA 2Y5TB 4HKZB 3PWUB 1DVFA 1GY2A 1U58A 3MUGA 1GA2A 1KJ3L 3QE5A 1LK3H 4S10A 1WEJL 3AG1B 3IETA 4CILA 2AKRB 5D1QD 1SXNA 5C71A 2X2HA 1AS7A 4WHDA 4LOEA 3QUYC 4CN4A 2C9PA 4FZEL 2VR7A 3U82B 4XWOC 5EU6B 4YEFA 1FFRA 2OTWB 2X4OB 4NPYB 1NCJA 4Q6IC 1IBYA 4AQAB 4LHQB 1N7ML 3BH8A 4Q2ZB 4S1QL 2DMKA 3UC0L 2MNJB 3FQ2A 4U1LA 1B0RB 2EVFA 1CGUA 5HYSA 1CIUA 2JI3A 1MW2A 1PF3A 2CK0H 2OXHA 5EA0L 4LSSL 1MI5A 2IWKA 3S2AA 1SXCA 3SKJH 3UAJA 4MD4A 1QFWM 3C9NB 3TBTB 4RGOH 1OPGL 1CF1A 1JUFB 4EN3B 5C3LD 1FZKB 4TLUA 2R0ZL 2QTEA 3ZDZB 5C7XH 3IFPA 4HCIA 4XMKL 5D7EA 3UTTE 3JWDC 1ZJAA 4PRAA 2H26B 4PS4L 1V3MA 3AAZA 2QVKA 2ESVB 3K5SA 3G6JA 3OMZA 3S3PA 1A1MB 3VFWA 1S7SB 2EICA 4L4TD 5GQBA 4ZNEA 3VI4E 2WLZA 1KGIA 1L0QA 1GJWA 4LSUH 4NI6A 5GGQL 3TEUA 2F5BL 3TVMD 1FCGA 1R3JA 1CJYA 3VMPA 5DO8A 4YGVA 3S5YA 4GAJL 3EGSA 1BQLL 1ETZB 1YRKA 2Y5QA 1ZLVK 3BZEA 4A2FA 5HJBA 2LU5A 2I32A 4YXHL 5BQ7A 2OQJA 3MO1A 3O6FB 3ZRFC 2YC1A 4DP5X 3JYCA 1B9ZA 2VO5A 4HG4K 2ARWA 1G7MB 2EJ1A 4DKFL 3GXIA 5C0EA 1MFCL 2OJ1A 1YYLH 3D3VB 3EH3B 4YHZH 3UGXA 3CSPA 2YGOA 2FJSA 2X0VA 2ZOOA 5HHVH 4DETA 3WI9A 1GJUA 1PZCA 4LLUB 5DYFA 2R8SL 4DEUA 3KLLA 1AS6A 3LH9A 1P7HL 1AFVL 1XBRA 5T1KD 4B27A 2VDOB 3CZUB 3JTSB 1IO4C 4IHOB 3ETBF 1TTBA 2NW3B 3CPLA 4FE9A 5E8DH 2Z93B 2BNUB 1FZMA 3QRBA 2CUMA 4B5EA 2ZCLH 5BZXA 1MRFL 4H8UA 2DL2A 4LGSB 5ISZD 1KCUH 3O3EB 4FNQA 4MDIB 4KGLA 4OT1H 2CKBB 4MD5B 1NGPL 2G4GA 4IRSB 2J43A 1J5OL 4GSDH 4OB5L 1NGQH 1OTTD 3H9SD 5C3IA 3DBSA 5I1EH 5E24E 2C9AA 2XZZA 2Q3ZA 4I8DA 1NFDB 1FLRL 2C5DC 1ZOXA 3HNTL 3EO0A 2WGNB 5SV4A 3QXUA 2VMCA 3T6QC 4NQED 4IBQA 2C1PB 1M1SA 3EBIA 3EO1B 2Y1AA 4RGNC 4DSYA 1F8TH 2CKBL 3GGWA 5GS1A 3VWKA 4W4OC 5D7IA 4YC2C 2PUQT 2A74A 3HC4H 1W91A 1WV7T 1EJ8A 4P3DB 2V5SA 3C6SB 2I9TB 3E80A 4NSKA 1NOLA 1WZ1L 2Y2WA 4OTXH 2VITA 2AQTA 4LL4A 5IIEB 4F8TA 5AVTB 5HYJB 5JW3H 4O5LH 2YZ1A 1K2DB 3FXIC 3GPEA 4MB4A 1TEYA 1C16B 1UUNA 2HRGA 3EGDB 2DIAA 5AOIA 4E9RA 1CT8B 2WWKT 3I9PA 1SF3A 2ZKMX 2WQSA 4UYQA 1WFUA 2FX9L 1KPRA 2EXWD 1BLNB 5KS9B 1TLMA 2LLLA 4B97A 5ELIA 1NEZB 3VJ6A 1RZIA 3MLSH 2B4CC 4XXDB 1VGKA 3ULVD 4OJFH 1BAGA 2Z1KA 2YKKA 3ILQC 4HC1A 2PCPB 3MJ8B 4X7FC 5F0JB 4I3RL 4EUPA 3CVDA 4B9IA 3L8QA 2AEWA 3IRCA 4MMZB 1ORSA 3SOBL 2WYZA 3QW9A 1ZSDA 4I1RA 2OJZH 4R83A 4ZRGA 3U7WH 5A6IA 1JN6A 5H2BA 1IEHA 2C9QA 5EPMA 2PWDA 2XFGB 4HS3B 3UTZA 3P11H 2AJXL 4I18A 4D9QE 3MRPA 2WKLA 4JO2L 2AI0L 1MXDA 2H9GB 1YNLH 2OTUB 2CXKA 1QPKA 1ZHBB 4NQCA 4FFYH 1ZT4A 1BXVA 1CDIA 4JNXA 2QLYA 3BSZL 1P7KA 4TPRH 4QRPE 1DBJH 4WJG3 4X80H 2EZ0C 3QHFH 3N85H 3T4AB 3Q1SL 4H0IA 5DHXB 1C8QA 1FIGL 3BP5A 4KH2A 3D2UA 4GO6B 2A9AA 1EQWA 4JRXB 3TONA 5KYNA 4MZRA 1FNLA 5J1AB 1R47A 1BMGA 4KO9A 4F8QA 5J9PB 1FVEA 4OJDH 4ATWA 3F7VA 2VNCA 1MCNA 4FQ2L 4OZFB 4I9WE 5FO8A 1AQKH 4UDTA 4JCWA 1U8MA 3DIVA 3MA7B 5FS5A 4KJPC 5ESVA 3FO2B 3SJVA 3QZMA 5C2BH 4DPCX 3ZIMA 1BJ1J 1NKOA 4B3VA 2SODB 1XGZA 4UNVA 1N67A 2MCG1 1R5WB 4DF9A 4YLQT 3FTYA 3GHEH 1F58H 4HJSA 4HSQA 4HOZA 2LV4A 4NAMA 3ZTCC 4ZXBD 4LXFA 2E7MA 5IZ7A 6PAZA 1JWUB 2P28B 1MJJB 1CS6A 2WXPA 4HGMA 3GSUA 4J8RB 3M45A 2R51A 2R4SH 4NKIL 4XN7A 4M61A 3VRIB 1BGXL 2EH7H 4MA3B 5F21B 3LRLA 1XMEB 3QUZB 4LZKA 4LHUG 4LIQL 4QEGA 3GJFA 4JZNA 5D7JD 1LVEA 4LLWB