1ZVNA

Crystal structure of chick mn-cadherin ec1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
SGWVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQRLDREERSQYTLRAQALDRRTGRPMEPESEFIIKIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin 1
publication title Type II cadherin ectodomain structures: implications for classical cadherin specificity.
pubmed doi rcsb
source organism Gallus gallus
total genus 24
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 1zvnA01
4NQQA 2WD0A 2A4CA 2OMTB 2OMUB 3K6FA 4OY9A 3MVSA 4QD2E 4AQEA 2OMVB 4AK1A 4AQAA 3Q2NA 1SUHA 4NUMA 4ZT1A 1ZXKA 3LNEA 5JYLA 1Q1PA 4ZMPA 3K5RA 3UBHA 4ZMOA 4ZMQA 4AXWA 5CO1A 1NCHA 4ZMXA 2OMXB 1WYJA 2V37A 4ZMLA 3LNFA 2OMYB 3LNHA 4ZMYA 4AQEB 4ZMVA 2OMWB 2WBXA 4AQAB 5JYMA 1FF5A 4ZI8A 4XXWA 2QVIA 4NUQA 4ZMWA 3LNDA 3K5SA 3Q2LA 2EE0A 2X2UA 3PPEA 3QRBA 4AXWB 5KJ4A 5CZRA 2WCPA 5DZVA 4NUPA 3Q2VA 4AQ8C 2A4EA 1EDHA 2QVFB 3UBFA 2YQGA 1OP4A 4ZMZA 3FF8A 4APXA 3K6DA 1L3WA 2WHVA 3UBGA 4ZTEA 1O6SB 3LNGA 4AQ8A 3FF7A 1NCJA 3Q2WA 1WUZA 2YSTA 2O72A 3LNIA 4XXWC 4APXB 1ZVNA 4ZMNA 3K6IA 4ZMTA 1NCIA 1NCGA 2OMZB
chains in the Genus database with same CATH superfamily
1AHMA 1E4KA 3V9CA 4Z5RB 4U6YA 2I9TB 2WLIB 3MRMA 1BMGA 2PWEA 1VDGA 3D2UD 3L5XL 4H88L 4IGBC 4HS3B 1IKNA 1CDGA 1ETJA 1FQ9C 3O4LA 2DZEA 5DI8A 4DKAA 1PX8A 4FI8A 2KERA 3BLBA 4P46C 4GG6A 5GRXG 4U4IA 1TQCC 5KYYB 3M88A 3QORC 2IVFC 5CJQH 2XYBA 1D5ZB 2P5WA 1QZNA 4FYTA 3EHBD 5C08B 3QNZB 3DVFA 4WO0A 3MNVB 3BAYA 1KLUB 2F1EA 5CGBA 4F57H 1JHKH 4N68A 3GSNL 3T08A 5CJXA 4RFNC 5KS9B 4OQ1A 1LDSA 2X1XR 1I8KB 3V6FB 1CFSB 4J6RL 4R4FL 5ADPL 5E0QA 1PX3A 5I0YA 1NDMB 2E4FA 4ISVA 2A99A 1YEDB 3Q8BA 3R0NA 3FQTB 1DANT 2H0FA 5TQ2L 4ZMWA 3MRIB 5T5FA 4YHNA 1A8ZA 1JVLA 2F54A 4XGZB 5SWZB 1PY9A 4U1JB 3SBPA 4R90H 4LP4A 4D7PA 1SY6A 2H3NA 4BELD 4G1EB 5DD6B 5SV4A 1NGYA 1MDAA 1NCTA 5E1AB 4M5TA 3WE6B 5J6GB 3SDXA 3J7HA 2ICWJ 1RPKA 3EYFB 4NQUA 2CG9X 4NO2B 3C5XA 5EBGA 4L18A 4HGWA 4OFYA 1E9OB 5FYKH 1T3FB 5IF0A 3QA3B 3N04A 5EU6A 3CIQA 4HP5A 3H42L 5KZCD 4PB0L 3F01A 1CF8L 3B7YA 3SODB 3W0WB 4XN8A 1L9TA 1YG9A 1VEOA 1K8DB 3I85A 4QRAA 4APQC 3DO7A 3HZYB 1JUFB 1IAKA 2AXHA 1CLCA 2E9BA 5F9WB 5IM7A 1F86A 2VXQH 2X10A 4WSGA 3M8OH 1SJEA 4FTVA 4H13C 3MRQA 2ERJC 5EOCL 3VXQA 4YHZH 3HNSH 4JQIL 2YFNA 3VRIB 3MX0B 1AR1C 1KJ3L 2AZAA 3FT0A 5GJTL 1ZCRA 5IB1A 4O58H 1A22B 5JIIA 4WI0B 3RLSA 1WUZA 2G5BB 5E6ID 2DM2A 3ATAA 3R4DA 4BM7A 2L7QA 1H5BA 1P7HL 3LIUA 3GUFA 3R06B 3E7JA 4MB1A 3ARGC 1ZEAH 1PLGL 4EDXA 4FABH 3AY4C 3BD5A 4JKKA 1CS6A 2CKBL 5TE6H 3VFWA 1Z7JA 3GLDA 4G7SB 2RR3A 1R33A 2K6WA 3BT2H 5ICXB 1IV8A 2VXUH 1ZSDB 4PY7B 4ILDA 4IDJH 3JV6A 3LEYL 4XNDA 3AWFA 5AYTA 1NOFA 1I75A 4YZFF 2PCFA 3GMRB 3RP1A 4IHOA 3F5WA 1I3VA 3H3PL 4TYUA 1HC1A 5AB1A 1LK2A 4QRSB 2BSRB 4BE5A 5B3JF 3HBPA 3MJ6A 1BREA 4G6KH 1WAAA 2XXCB 3PDDA 1LVEA 2E9IA 4PYGA 4FRWA 2UZYA 4Y89A 5E6YA 1U3HB 2QDVA 4RZCB 5M94B 3BVUA 4JO5A 3TN0A 4KQ0A 5EWIL 1AXTH 3AMKA 3BZFA 4HPOL 1MJUH 4R3SA 2Y06L 1DBJL 1YNLL 2RA1A 4NC1E 1CL7H 4OR1A 2A9NL 1DL7L 2MNUA 3PWJA 3HUJE 2GBAA 3L5JA 1C5BL 1LK3L 5J6SA 2Q2EB 3ZL4L 4W9KC 2GK0B 4MNQE 4X4ME 2FHCA 4CA4A 2PR4H 1QLFB 5D7JB 4M29A 3PP4H 4OCNC 1DLHA 4OZGE 2NY7H 1Q1JL 1I8IA 3PS6A 5KVFH 4P3DB 4PPTA 4HJ1A 4XN5A 3N2JA 5J13B 3OGOE 5JXED 5AW1B 5T1JA 1WD9A 3T4YA 1E9PB 3U36A 1ES0B 3HBQA 3EGSA 4LPWA 1R5IA 2LLGA 2X4SB 1V3KA 2HFGH 1Q4NX 1V05A 1JZIA 3MYJB 1N19A 5E4IA 3JTSA 4F8NA 2NYYC 4KKAD 3UDWA 5IVNA 2X89D 4DP1X 2CXGA 2QSTA 3E1ZA 5AAMC 4XPFH 3SIKA 4WHYH 2WOBA 3LN4B 5HJBA 3QIBD 2EH7H 4ZUTA 4NFBA 2R29H 4FQQA 4NNYB 5K9JL 2OZ4L 4LEEA 1MCPL 3LOWA 1I7RA 4AJWA 3ZQ9A 5I2IA 1KIUB 1JZGA 1JZFA 5IFHH 1F6AB 1AIFA 2C7FA 3BRFA 2ZJSH 3DPBA 4QCIB 3L3HB 5F7DB 2W0LA 1RULL 1OWWA 5IB5A 5C0CA 1VCAA 3VG0H 5K59F 4GUCA 4OCSL 4PG9A 3K81A 3DX2A 4Q89A 1DEEA 1RD6A 1MW1A 1L9OA 2FGWH 3BFWA 3DX7A 4YR6A 4FXGC 4CSSA 3EJCA 5D6DA 4AQOA 1FZJB 4AG4H 1YQVH 1JRHI 2C3XA 4X7DC 2QQNH 4DKEH 3HKZA 4OW6A 3LXUX 2NY2D 4JANA 4XTRD 5F96H 5CJ8A 4CU6A 3Q3GB 5CEZD 4M93B 3RYMA 2WY3B 2XVLA 1A25A 2YQ3A 1X6LA 2AK1L 1LJMA 1IQDA 3D25B 3D50A 3DHJA 2OMXA 4KDWA 4ZFZA 5AVYB 3S37L 4FYSA 3VI3A 1NMCC 4XVJL 4N2FA 5L2KA 2XWZA 5TDNA 4NPJA 1RZPA 4KPHH 2PYFA 4Y5XC 1DQLL 5DT1L 2PWDA 2VAAA 1HQRB 2CM6A 2YUZA 4UAHA 2ROXA 5LGHL 4MZ3A 3O9WB 1KBBA 2WZPA 3ALWA 3HRZB 3MUHL 5J3HC 1CQKA 1WEJH 4I88A 4LSQH 2R69L 1EHNA 4ONFH 3SZ6A 1PSKL 2EH8H 3UABA 2ZUVA 4NN7B 4DAGH 5BVPL 1PQZA 3OZ9H 4NJ9L 5HGHB 1F58H 2UX7A 4LCWD 1R5VB 3NSJA 4UOQA 4QT5B 3BUIA 1IGML 4K94L 3CVCA 3AREB 4NZTL 3B5TA 4JRYB 1ID5I 4JFEB 3PIQB 4F8TA 3MODL 4FYQA 3CDYA 3AQXA 3IAQA 1G0YR 3VD3A 2EXTA 4BUQA 1ZY9A 3FTWA 1WZKA 5TF1L 1RJYB 3L54A 4G7VL 5C3TA 4ONHA 2XTJB 2F08A 4KHXL 2K9FB 4MJIE 4HSAC 1QRND 3GSOB 4HKBA 1U95B 4L1SA 5J11C 1G6VK 5MENE 1OPGL 2SODB 3PAZA 1SF5A 1UQSB 2DI8A 3VE0A 4DVRL 5ACZA 5A2FA 5IIEB 4WWKA 5LVEA 5F70A 1MAML 4PJGF 1ASQA 2YKKA 3L1OL 1J0KA 3SE4C 3SPIA 3SB3A 2UV3A 1BF5A 4PJXB 1T1YA 5DHVH 2E27H 2XZAL 3LPGA 5H35A 4LLQB 4Z7VE 3K8MA 3Q9PA 3MDJA 2OX5A 4W93A 5FYJU 5EF3A 3ENEA 2VLJA 3TU6A 5BVJA 1J05B 1QSEE 4TULL 3QUKA 5D70L 5B38B 1S78C 3M17A 2YD9A 1N3NB 4NQDE 1NWOA 3RKPA 4ANKA 4B0MB 2JWYA 5HDWA 3WFCL 4GUOA 4HKXA 3SCMA 3RGBA 2AAAA 3EOYG 3DOSA 4JGNA 4Z7UB 5JPMB 3E6FA 1T83C 3EOBB 5F0PB 4PJ7F 4DEUA 4CVZA 1CYGA 1N8OE 4H7VA 4AMKL 1IGFH 3DETD 2LGNA 4IRJB 5I6PA 4ZOCA 4F5CE 4OD1L 2M83A 2X9ZA 1JGEB 3IMBA 3IJYA 3S0PA 4XX1G 4BFIA 5J56B 2I9LA 3BKYL 4AKQA 1GA2A 5DVKA 4WW2B 5EH1A 4L5FH 4RX4A 4JFFA 2X4TB 2D4DA 1H15B 3DVIA 3FO0H 4G42A 2DQCH 3EYQD 3GSQB 1NL0L 1UD8A 1U2YA 1RERA 2YD6A 4L3EA 2OSLB 5D1QB 2F5BL 1Z3RA 4LVOC 2VC2L 2H8PA 3VU1A 4M48L 1HCVA 1DCLA 2GJZA 3H53A 1N10A 4Y2DC 3VVWA 1GOHA 4I0PD 5DK2B 1M57B 4DPBX 1K5WA 2YO3A 5GRVL 3RWDB 4HLZG 2LTQC 3KBPA 3GBMH 4FZ8L 2IOIA 4A6YB 3LZLA 5IR1A 4D7BA 1QLEB 2C4FU 4WU7A 1A9BA 5JQ6H 1XZWA 2OMWA 2ZXEB 5GZNA 1DVFA 4OJYA 4NZFA 1S7WB 2BZCA 1UA7A 2X09A 2ZUYA 3CVHA 3FTZA 3TESA 1BFVL 2NXZC 2CO7A 2LOEA 3NACH 4JFWA 1OAJA 4GI9A 4NQCB 1SUJA 4FP8L 2QQKL 4JG1L 4PW9A 5KANI 3BLPX 4GIAA 3BX7C 5D7LD 1ZIAA 3HNTH 2FJFA 5T1KB 9PCYA 1BF2A 5DO2C 3GTTA 1MVUB 1P4UA 1M6OA 3DGDA 4QOKA 4N2DA 5A3IC 3CFQA 5HHPB 3TBWA 2BNRE 1YLBB 2VN5A 2ICCA 4ANUA 2Q8BL 1PKQA 1MHEB 4IGBD 5IHZA 3HG1E 2WWKT 1CFNA 4PFEA 4R0LC 3D30A 5JHAA 3NCJH 1MY5A 4N2OA 3W9DB 4DERA 4F1SA 1FUNA 3TH2T 2GSGA 1QA9B 4JQVC 1MCKA 3QPQC 5HI4C 3BH4A 5K39B 4FXKB 3SE6A 3QORD 5KYWA 1KJ2H 1FGNH 3SPGA 2APFA 4ZO6A 1UYWL 3IVKB 5EBLB 1O6VA 5DJCA 2BNQA 2J8UF 4YSUA 4JBSA 1AYOA 1Q72L 2DQGH 2H0PA 2O26U 4LEOA 3VFNB 4E41E 1MVYA 4Z3FA 5L4FA 3RJOA 2ZAGA 5HVHB 1BQUA 2G3NA 5IV2A 4H5SA 5JHLH 4X7TB 3DROB 3PL6D 4LDCA 5I1HL 1PF3A 1FH5H 5EBWA 4AYBA 1P0SE 2E4TA 3GS4A 3OKEB 4HHWA 1DEDA 1QVOA 3GNMH 2JLLA 1XGTB 1SLWA 3BSHA 1KYDA 3FQ1A 2DWSA 5I24A 3S88L 1UWGL 2VJ8A 3KVQA 2VN6A 4FA7B 1T1ZA 3G9AB 1ESOA 3WEOA 4ADIA 5IJKC 4D8PA 4I2XE 2XFGB 4H1LH 3QEQB 4HJEA 2FL5B 1VGEL 2OA9A 5GRZA 4HKJA 1AFVH 1NLDL 1UKSA 2WGNB 1RP9A 2JELL 3S98A 1DE4B 4QRRA 3UAEA 2JJSC 3MV7B 1IKFL 3FUIA 1D5MB 2W9DL 5I74C 1AP2A 5ICZA 2C1OA 1PW3A 4M7LL 4YSSA 2QR0A 1Q9KA 3K6IA 5F9AC 5D8JL 3ARBA 4M4RA 5IVZA 4WJ5A 3LD8B 4M1DL 3PG2A 3QUZD 4NT6A 4EXKA 2V2WB 1S7UA 2A0LC 3KG5A 1OGTB 1MXDA 3M86A 3PUUA 1G9NC 1XL6A 2D3JA 4HWBL 4JFOA 2WIIB 1F2QA 1Z5LB 3CLFL 1FIGH 1KJVA 2BDNH 2UYLB 2WSKA 4N4YB 2DPKA 4ZT1A 2R0LH 5LWYL 5D1XA 3N9GL 3E9UA 3B43A 3P0VL 1CGUA 4L1LA 2XQ0A 3ILEA 4B7IA 3V4VB 1G7HB 3LRHA 5I8EB 5T1DL 1I53A 3MRRB 1QO3A 5CGMA 1CN4A 4LHQB 1F90L 1R34A 3UGUA 3QQDB 3ZHFA 5C0DB 4DEPC 4L4VB 3O2DH 4M6MH 3ARGD 3NT0A 5IEKB 2CALA 2IXQB 3PU7A 4QRTB 4D9RE 2AJUH 1KEMH 2VXQA 4UTCA 4ZMYA 1MRFL 5J1TC 3FQXA 5LN4A 5CD3A 5ALCL 2WO2B 5E94B 1A1OB 3FBQA 4A7TA 5I1KH 2D03H 1H9VA 4FGMA 1O7DE 1WCBB 2QSQA 4YHKH 3VCLA 1HCZA 2BP8A 1MJ8L 3EYSH 3GQFA 4I0KA 5D7KD 4BDVA 3S6CA 4DQOH 1NBCA 4UB0L 5FGBA 4PBWD 1MFCL 5EIIA 1PAMA 3CCHA 3D12B 2Y3NA 3GMLB 1RP8A 1F3JB 2BIMA 4CMHC 4X6DA 4JFXB 1J8HE 4JFQB 4DN4L 4JHZA 1QW8A 3M6DA 2F5AH 1EV2E 3PFQA 3T4AB 4LMQI 4I3GA 4YSDA 5FM8A 3CZGA 4MSWB 3SGDI 3WJMA 5C9JA 1IAII 4CNIB 2ZICA 1NBQA 4WWOA 4H0IA 1A3ZA 2WUBH 1J05A 1R5WA 1TETH 2LU3A 5H2BB 1INDH 3OL2A 2OSXA 2NUTA 1Z3GH 4NUJA 3OAYK 4HPYH 4OJFH 4Z7AA 3EFOB 4KKPA 5JPMA 3A23A 1AG0A 1I3UA 1CO1A 4R7DA 4L8SB 4LDOB 2EVFA 5EU7C 3UYRL 1QFWL 4NENB 1MI5E 3WTTA 4P5SA 3BGAA 1B3JA 4HCFA 3KLLA 1L0YA 2Y7QB 1X5AA 3K72A 4OKVB 2JTYA 5I1GH 1NBVL 2VL5A 4LSVL 1OAQH 1A4BA 4QXUH 1OSYA 4TMPA 2NYYD 2NTFB 5HHVL 5I75B 4P0DA 2GB2A 5LGJA 3S7GA 3OKDA 3KM1A 3OB8A 3R4RA 3QVAA 5HI3D 3IMWA 1PZCA 1NICA 1OSZB 1KUMA 1IC7H 2Z31C 4K5LA 1M3JA 3HS9A 5JLZB 5DMJB 3T0EB 1IAIL 3QUXC 1N5YL 3SPJA 5KYXA 4FG2A 2CMRL 3H7LA 4KUCF 3QIUC 5E6RB 4M6AA 4JDZB 1NBYA 1DSYA 4TV3A 4MCMA 3LDBB 4HOZA 1MCCA 3GK8L 3C2AL 3WU1A 4FHKA 1LMIA 3RNQB 1KZQA 5AW3B 4G8IB 3QHTC 1E28A 3X1FA 3DJSA 1Q1PA 4JFZH 4ZMPA 3EOAB 2HPTA 2Z7WA 4NQSB 3MUJA 3H85A 2VERA 1ET5A 1O9WA 3DXAA 3VRLE 3EFFA 5DHYB 3U2SB 3MV8E 1ZLWK 2R29A 2NZ9C 2UZPA 5B1BB 4MA3A 1GAFH 1J9SA 3F6LA 2OQJB 4TUKH 4QRUB 1K6QL 1ZTXH 4JHWL 5AENA 4QHMA 2HFFA 3ZY7A 3VX0A 4PGBB 1T22A 1GCFA 2XN9B 3NBNA 3EHBB 3LZFH 3QJSB 1KXQA 1TEYA 1RUMH 4L0YA 4NZUL 4DO5A 5IOPA 5EA0L 12E8H 4J12A 3EBAA 4ATTA 1ZLVH 3JV0A 2N3JA 1C5CH 1IBGH 2X0VA 2W92A 4PLOB 5F0JB 4F7PA 3UTSA 5F7MC 1BWMA 4BCZA 1I1FB 2ZCHL 2WXQA 3QFJA 1GZQA 3I50H 3VGAC 5F9JB 4WNSA 4H4NA 4KXZH 1LLAA 3K6SB 2VZVA 3A6BL 4DW2H 3Q8FA 4TTGA 1GGBH 1IGCL 2MPAL 2A6DB 3OX8A 5CEZH 4MFHA 1PY0A 2Q3ZA 4UNTA 4MHHG 1U42A 4RIRA 4U3SB 3UTPD 3CFDA 1RSYA 1D9KA 2LU7A 2A6IA 4LGRB 2LVCA 2LU5A 2QVFB 2P80D 3BKJL 2PETA 1FBIH 1OTSC 1SOSA 4ZPTB 5IBUG 3ARXA 1J1OL 1QX1A 1WIUA 5F6IC 3V6OC 1RZGB 5KG9A 4XO5A 4KQ3H 1UD3A 4P07A 1XGTA 5I0VA 2WHVA 5I0DA 3I3DA 2FATL 4F9PC 4JLRB 3MBEA 1MAJA 2IV9A 1WIOA 43CAB 4ZO9A 5I1LA 3QIWC 2FT8A 4L8DB 3DMMB 1FGVL 4R4ND 2TRYA 3T8XB 2O4EA 4GS7C 2BRQA 2MH4A 3QXDA 2O5YL 32C2B 1BZ9A 1A7OL 1AZUA 5KSBB 4PJ8C 4TUJB 3N55A 5DVPA 5DC2A 4JO8A 4W9IC 3WAKA 4RFEA 4J4PA 3RIKA 1KSRA 3WEAA 3FSVA 1S78D 3HS0B 2D8KA 4J3OC 4BFKA 2F61A 1FAIH 1OSEA 3GRBA 2BP5M 3QHFH 4FG4A 4EAEA 2V2WA 5CD5C 2AJSH 3D3VB 1EMTL 1O9VA 1XH1A 3R1GL 1QBLH 3IJSB 2OMVB 2SEBB 3G6DL 3ZZ1A 5CR1A 3TONA 1MFUA 5I5JA 3R7RA 4X7FC 3VRLF 5DHVA 5EO0B 1IGTB 2KZWA 1DBBL 5DZPA 2XG4B 4A2LA 3V0JA 1JZ4A 4BV1A 1KYFA 5CBEB 4PW4A 2HUHA 1NSNL 3KPRA 4R8WL 3QJHA 4EOWL 2BRRH 4LP8A 1SXCA 1RIUL 1TITA 3UYPB 3VGEA 2VZSA 4XX5A 1B4RA 3SDAA 1S9YB 4PJEA 4QNPF 1XIWA 1ZHBB 4JY6A 4OCWH 2CRMA 3BHBA 4OIFA 3KNBB 2AJ3A 3TT1L 3TEUA 4YDJA 1TJGL 1IARB 4GRLC 4HSCX 2E9WA 4DPCX 2NSXA 5E94A 4EVNA 1J1PL 2BVOB 1DLFL 4S0SD 5A7EA 3LQMA 2CXKA 4GSRA 1ZLWH 2L7UA 3ZVVA 3EXLA 4PGEB 4KNQA 5DFTA 3GRWH 7PCYA 3PPEA 4KRMB 1U8CA 4JRWA 4MQXC 2V6HA 1NTDA 1TNMA 2NXZD 3IFPA 3AG1B 3MJ8A 1ZV2A 5F7NC 3ZE2B 4JFQA 1MHHA 4GXVH 1NCBL 4GMSH 1T21B 2AZUA 2G75A 2JCCB 3B9KC 3AG2B 4E0RB 3FHAA 4ZJ9A 5KTEL 3ILQC 4Q9RH 4G6FD 4GQPH 3LSOB 3GHBL 2R15A 1TPXC 2ARJQ 5KSVA 3BWSA 3VDAA 4UOW0 5HPMA 4Y16B 1D7FA 3CXDH 4NYLA 5A3ID 1XXDC 4HSQA 4HCRL 2YEQA 1J0YA 1YYLL 2GUYA 2Q7AA 1R75A 3U0TA 4OLUL 3CPLB 4U1MB 1XGPA 2WBJC 5ERWA 3BIKB 1PIGA 3OSKA 3GIZH 5E8NA 3CFBA 3ZE1B 1AXSB 2O5XL 3B2XA 4Y4HC 1TCRB 1V7NL 4NSKB 2MJWA 5GGRA 3O6LL 3MHZA 1PLCA 2BS8A 2APBA 4YDIL 4NP4H 3X13B 1ECZA 3S5ZA 5FHAL 2BS9A 3VFRA 5CLWA 4NCC1 4GXFA 5I76A 1WTGT 2JV6A 3UFIA 2VR8A 4PJFB 3UACA 3SOBH 4ZNEE 1G7PA 3D18B 5DD1H 3VFMA 4IIQC 3NSFA 3GS7A 2VLRD 1AD9A 2VQTA 2DYPA 4OTXH 5DJ0A 2ZONA 1N64L 2H2PC 3HE6C 3RWIB 3FU6A 1ANUA 3SYCA 4KAQH 1MKFA 5IROD 1F11A 1WITA 2D9QB 2Y24A 2PO6C 3FTSA 1ED3A 3O2WL 4GBXA 4KC3B 2DI9A 5DRWB 1JJUA 2ADIA 4IRZL 4YS4A 1KJ2A 4XCYA 5CCKH 4PJAE 1JFQL 3S9DB 4A7QA 4PBVC 2FEDC 3W3BA 1SXNA 1JHTA 4CC1A 1JHKL 2BPBA 2GC7C 3SDDD 1FV1A 4XN9A 3D2UA 5DMKA 4ZX5A 1RXLA 3II1A 4BRVA 5LBSH 5JHLA 5C0FB 1PG7H 2AQSA 2X4OB 4EI6A 2A73B 4YDKL 3UTTE 5A2IH 1IZKA 2A5UA 3AXHA 1ZVYA 1AO7E 1BVKA 1NFDE 2Y7NA 1KLFB 3KW7A 3P54A 5E9DE 5FV1L 1CDUA 1J9QA 4XVTH 4UYPA 3VI4A 4LP5A 4PTUB 1OHQA 2ISDA 1JK9B 4HF5H 4AQAB 1HH6A 4HMDA 1U4FA 4HQQL 1S9VB 5EZOH 1YJDC 3EH2A 4H1LA 3RPBA 2FQEA 1WLHA 3ABLB 2X2IA 2JKSA 1W0WB 4MQSB 2DIAA 3LJ3A 1NCWH 3L95B 3I74A 2D7OA 2X7LA 4P5TC 2ZP0T 4ELME 3S8WA 1U8HA 2X4PB 2Y6SC 2H6PA 3AB0C 4G6AC 5EUOE 4DGWC 1SM3L 2X4QA 1L5GA 5FUZL 3EH4B 1OP3H 1RUAL 1DVSA 2COQA 3T04D 4BRJA 2Q8AH 4XE0A 1BJ1H 5CBAA 1BW8A 4KVNH 3BO8B 2NY1C 4WUUD 2Z7UA 4TLKA 4Y88A 1ZXQA 5ANME 2JB6A 4HKZB 3S36X 3ME0A 1RZKC 2F19L 4WRLA 1ZA6B 2Q0ZX 3QO1A 1T7WA 3LZNA 3Q1SL 5DZAA 3VSTA 1WBYA 3FPYA 2GJ6E 5TDOA 1TQBC 1I1AB 3SDYH 1E30A 4ZS7H 2LVEA 3N42F 4LEBA 5ID1B 5L4MA 3L4UA 4OFDA 5GXBB 4HH8A 5DR5H 2RJMA 1IIIA 2IWFA 2N1KA 1SLXA 1LNUA 1ZEAL 2WYHA 3O2DA 4WV1B 3H0TB 1CI5A 4LEXH 3QWOB 1QEXA 1TFPA 4AX3A 4IDJL 1SBSH 5DJYB 4C4UA 1GSKA 1SHXA 3A67L 5I66B 1MCEA 3US9A 3V0DA 1NCIA 2AGJH 3UTZB 2V2TA 2DQFA 2I32A 4RVBA 3SQBA 2YXVA 3HC2A 4NRZA 2UXGA 4I5BA 2D31B 1JPTL 4LL4A 1X5ZA 4UWQB 5G5DA 3CN2A 5E6IA 4WFEE 2BVQA 1CFVL 4G6KL 4JKPH 2YRZA 1Y6MR 1JGDA 2ZWLT 4NZ8A 3QRGL 1JG9A 2F8XC 3PHQA 4F8LA 3WHE1 3PHAA 1K5NB 2NDFA 3LYRA 1C1EL 4UZUA 4XE5B 3IU3B 1EBAA 3OJVC 4PBXA 4X7SL 1E6OH 4BIKA 4LHUG 2XY1A 5E24E 4N2NA 1KBWA 4D3CL 1KB9J 3ZKQD 4FA6A 1T7VA 2OULB 3UBHA 3DRTA 4KFZC 1T20A 2VLMD 3EJZC 4ZX4A 1X5HA 5FGSA 3LHPL 4U1LB 3QNYB 2AVGA 1JK8A 3P11L 4PUBL 2WXJA 4R26H 3UZVA 3O11A 3II2A 4NN5C 3EF4A 4YXKH 2NMSA 1A2YA 5BUAA 3SE9H 2IBGA 5D7SH 2Z31D 2NY7L 3FOLB 4LCYA 1EHLH 3WSQH 4AIXA 3QUXD 3ZMNA 1I31A 3AWEA 1W16A 4MS6A 4I3SH 3VDBA 5D7LB 5C08E 1PZDA 3QIUD 4F3FB 4ZTOH 1SHMA 4NRYB 1U8PB 3WDJA 4A6YL 2Z35B 5IMMB 1IM3B 1KNOA 1QLEL 2HFGL 3P9LB 2IO5A 4XP1L 3FU5A 1EDYA 3WI9A 2EE2A 1R3LB 5KS9E 1NGQL 1AQDA 1KPRB 3TPUA 5FFOA 1XB3A 4XPFL 1SHWA 3VTMA 2NOYA 4WK4B 1FPTH 1MQKL 4JZJA 2EH7L 2A83A 1EEYA 1OCWH 2NZ9D 4P46B 2DTSA 4X0KB 1S9WA 2JJTA 1TQCB 1XGYH 2ZOKA 4Y4KC 2A9DA 5JXEA 4YHLL 3U4KA 4Z8FL 3BUYA 2ZJSL 4Y9CA 5SWZE 1H8SA 1QW9A 4H8PA 1WICA 2CLZB 3WNLA 3A6CL 4JHUA 3FONB 3RAJH 5JW3L 3T0DA 1XCTB 1UJTA 4C59B 2X89A 4LCUA 1FE8H 3VQ2C 1HILB 5BUGA 1JDCA 1SN0A 3RRQA 2B3RA 4PRBB 3ZE0B 3QIBA 5IVXF 2OSWA 4OLXL 4WHDA 3AY2A 1N2RA 2YARA 4W6WB 3HR6A 2J25A 1J8RA 1QEWB 3V0WH 4PRAB 2XU9A 2DIBA 4DKEL 1L9SA 1HNFA 5TFSL 2VYRE 1ND0B 3ESNA 1ZD6A 1VA9A 3IMRA 1LO5B 1ZS8B 5IBUB 3A4FA 4PJFA 4DP4X 3KLDA 3LH8A 4AZ8B 4QTFA 3QDMD 3ZKNC 1BVLA 4TLSA 1T1XA 1MW0A 3NEXA 3FFCB 1OAYH 5MP6L 5EUKB 5IK3A 3B9EA 5L0QC 1B0RA 2Z8RA 2NXYC 2Y7SA 4HXBH 2VDLH 5ISZB 4IU3A 2ADFH 3ARUA 1DTUA 2R4SH 4AH2B 1I8MA 3B2UD 3QEHB 1DQKA 3BH9B 2MHAA 2K6YA 3VXPA 1L9MA 2EXYC 4NWUH 1U8JA 2EH8L 3DK0A 3FB7B 1CD9B 3QG6A 1COBA 1GGTA 5E2TL 3V5HB 4M8QB 4PV8B 3QIWD 4H8WC 4APQB 3VXUD 2FBRA 2WXMA 5EPMB 4HIJA 4TS6A 3DGCR 5C2UB 3OM3B 1H3UA 2PP9A 2E75C 3T0XA 2FR4B 4PJ8D 2EKJA 3O3AB 3SPVB 3CN0A 2EE9A 3LNFA 5DRZB 4F9LC 1AR1B 2WMPA 1G5GA 4NP9A 4RNRB 1MJ7H 1OCZB 5DMIL 4J3OD 2EXWD 4FQ2H 3WENA 4BHUI 5FA4A 3BPNC 3B1TA 2NW3A 2DJUA 1E7UA 3DVNB 2WC7A 3FU7B 2EC9T 5DJZA 3NPSC 4LCWA 4OLZL 4Z0BL 2Z92B 3MU3A 2VNCA 4ZZFA 2A9BA 2F9BT 3HPJB 1BGXH 3WO3B 3AGWA 1NIDA 5IKCA 2W5PA 1IBDA 2W0FB 4O2CA 1N6QL 1NEZA 2XXFA 1CICD 4Z7OF 5AB0A 2ZX7A 3JWNC 4QRBA 5DEZA 1BA9A 4QO1A 5FUOL 3KLAA 1C16A 1DUZB 2K8MA 5D7IA 3TIEA 4S1SH 2XPGB 5JZ7D 3KS0J 3V4VL 4ZX3A 1OWRM 4PB9L 4B9YA 1QRNA 2YRLA 3CHSA 1UFUA 1AQKL 2IH8A 4FNQA 2PYEB 3EJSA 2CDGA 2I85A 4JY4B 2F68X 4OGYL 3QR2A 2JXMA 4GW5A 1NC4B 4U2ZA 5B39G 1DDHA 2YR3A 1W80A 1M9WA 2WLJA 4JRXB 4M7ZC 4S2SA 2IG2L 4GRLD 4AGPA 4B9JA 4Z76A 3G04A 3D5OF 3DTXB 4G59C 3ESMA 4IIZA 5I6XB 4FC3E 3X17A 4F58H 1M53A 1RZJL 35C8H 2J4WL 3FO0L 5C0GA 2DQCL 1LYQA 1THAA 3DUUB 1E4XL 5L7XL 4MQXD 2L8AA 1D6EB 1NMAL 4RGND 2JIXD 3MXVH 1UTDA 2G30A 1OGAD 3WNJA 1E4WL 2ITDB 4OT1L 4WU5B 5T1LD 3LNIA 3P9MA 4Z7WA 2MCPH 2ITCB 3REVB 5DDHA 4LQ1A 3B9KD 2YLHA 4Z23A 5EORL 1CK0L 5HYSG 3ILQD 3ATDA 2EVIA 4OZFH 1BX2B 3CVIH 4LIQH 3W11D 1BM3L 1IAMA 1WG3A 3OBAA 3BLKA 4F2MA 5I0XA 2C9VA 4F33A 4BFEA 3REWB 3GRWA 2ZG3A 5GS0D 2CU9A 4LKXB 1IAOA 3C8DA 3GB7A 3GBEA 2AEQH 1EZLA 1E2ZA 4J8QA 2KLSA 3SJVD 4L4TB 5MHSD 3U7AA 4DKFH 4IDLA 1DBAL 4Y4HD 4P8QA 3S36L 4JFHE 4R5TA 4ZPVA 1G7JA 4I0PA 1VHPA 1UCTA 2X4RA 2E7MA 4M3JA 2DI7A 3GGWA 1LP9E 4JM0A 5E1HB 3VXSE 5BJTB 4QF1A 4OUOA 3D85D 1LTXA 1SN5A 4V1DA 4WKZB 3BP5B 3FXIC 3N43F 2ZWYA 4MB4A 2MOQA 4ZQKB 1MFAH 4LSRH 1RV6X 2NX5D 4O02B 3CZKA 2ARJB 1V3LA 4P57A 1A6TA 5LXVA 4OZIA 2W80C 3PUCA 2H2PD 3HE6D 3ABGA 3NCCB 1UENA 2HN7B 1Z0MA 5A16B 4B50A 1TZHA 1X44A 5TPWH 3U1SL 1JNNL 4OZHA 1EEZA 3KYMA 1II4E 4HUXA 1A6VH 2B16A 5KYNA 4ANWA 3H4FA 4WCYH 2WNXA 5GS1C 3LEXA 1YECH 1NCOA 3TIDB 5A2JH 3PRZA 4QGTA 1PJ9A 4JRYE 5E8PA 1R6VA 4JFEE 4A7UA 2FEDD 1IL1B 1K2DA 3KPLB 4Y1AD 2BSED 5FOBA 3RNKB 1NMCB 4JO4L 4LF3A 1GGIL 4IGBA 1ZPLA 1ORSA 4AKPA 1T4WA 1LWRA 4Y5XB 3TCTA 4FFZH 2X12A 3DX4A 4C56D 2RFXA 1INQB 1QUPA 2YA0A 4WFFD 3EGDA 1DFXA 1A1NB 3T2NL 3BIAX 5EN2A 1NCDL 2R0WL 3HG3A 3QORA 4RH4A 3DBXB 3KCWA 5GRJH 3FN0L 3G6AA 5E95B 2GTZA 1IVLA 1KXVC 4PJXE 3GXPA 1RZ8A 4IK6A 1BBDL 5JQIB 1SHSA 5I82A 1UWFA 1JPEA 3FZUC 1ACYH 5E7FA 3HMXH 1AFVL 3DJTA 2OW7A 2XKNA 5E8EB 1A7PL 1NQBA 4JPVL 5LBSA 2I69A 1UOVA 3PL6A 2VERN 1ZAGA 2Q86B 2GABA 4P5TD 3UX9B 3LPWA 4G6AD 2JB5L 5HTSA 1TTGA 4PJCA 3HW7A 2DL9A 4YFLI 4PRAA 5CEYA 3GSUB 1ILSA 3MRFB 3PDOA 4RMUA 1LQSR 2BINA 4WI3A 2R56H 5DUMH 3ISYA 2NY1D 1Y7VA 1FZKB 2DH3A 2GY5A 1HDMB 3S97C 1I1YB 4KY1H 3WLBB 3OJ2C 1JNLH 4M62H 1DJWA 2OTUA 1TU2B 4D0BA 1DJZA 1HE8A 1CC3A 3V7AE 1BPVA 3MREB 1ZK9A 3FH7A 1WE5A 4YDVB 3MRJA 4NPKA 4PS8A 5FO9A 1CE6A 4FHJA 2LQRA 5EO1B 3WFHB 5D1QE 5E2WH 2IFFH 2F8VA 1ZT4A 3BZ4B 1G1OA 3QUZA 4AY0A 2PCXA 3CVBA 1IGIL 4FQJL 2PCPB 3L1FA 4J3OG 4KK6D 4M6ML 3JWOL 5FB8A 2WBWB 1MWOA 3PWLA 1CXIA 2APWA 3H9HA 2AS5M 3G6JB 2L3BA 2ZSWA 4TPRL 4BQBA 5DJ6B 5DQ9B 4I18C 2YBRB 5BV7B 1OOAA 1IC4H 4XI5D 2AKRB 2OW6A 3P3TA 3CDGA 3FB6A 3KAAA 4PSRA 3KXFB 3MLUH 2BVTA 2ZTBA 4JN1H 5C09D 1FFPB 4JM2D 4GKLA 1ZLSL 3PXJA 2XBDA 4HUNB 3TH3T 5I8OL 4NQCE 2HB0A 4LVOB 5GIRA 5PAZA 4J3WA 3FU7A 3IDJB 4IHBA 4LHUB 5DUPH 4BSWB 1MUJB 4S0HA 2VRKA 1GYVA 2FX9L 3ARGA 4Y2DB 1NGWB 1UB6B 1J5IA 1SJHA 3VFTA 1JXGA 3M45A 1MREL 1U6AH 3O41A 3Q5OA 3CK0L 3RWFA 4FQHA 4G1MB 5F7YC 3R8QA 4BK5C 1B0WA 4XNMA 4BQCA 4Y4FC 4E9WA 2P24B 3EJZD 3CN4A 4PGJA 4G8EA 3CC5A 3KLSA 3KCPB 4EE2A 1Z3GL 3BYYA 2PPEA 3DRQA 5INCB 4ZDHA 1HJCA 3LRGA 1E3XA 5FLUA 2NXZB 5IREA 3QCUL 2H3XC 2VXVH 2FEEI 3PV6B 3TA3D 1RJCA 5KBLA 1SMDA 4FFWC 1KCRH 4ZO8A 3V6ZB 4RSVA 1TO4A 1FCCA 2AI0L 3TBSB 1F4WL 1M42A 3PNRB 2ALAA 1FNAA 2VDKH 5I1GL 4FE9A 3OR7A 2C34A 1T2QH 1ZV5A 2Q10A 4OCRH 5C6PB 2GEEA 4CSPA 4HA1A 3F12A 4LQFH 1HXMA 3MLXL 3RUGB 3RWGA 4CRPA 3HB3C 2YAEA 4R0LB 5CSGA 1IC7L 2DEXX 4P2RD 3VXRD 4KH2A 4JZOB 5FWRA 5T3XE 2I60L 1AG6A 5HGAB 3V0EA 1EAPA 2MCG1 1ZVNA 1LMKA 4YH6A 1DQJA 1TJMA 1G0DA 3CBJB 4HUKB 3AT0A 5I8KH 1N59B 1V7MH 2GAZB 3QEQE 4POUB 3APFA 4KXZI 4M7KH 1UUSA 2IOOA 5J8OA 5EIQA 3SKMB 2XJLA 4YJZL 2B1HL 3MV7E 2TAAA 4EZLA 3BAWA 5C3LD 5E5MA 3IWVA 2X6CA 1I3GH 1J1XH 3TYGH 4TN9A 4CMMB 2OI9C 4IBSA 1XF2A 2A77H 5B22A 2HJKB 3OKKA 2IGFL 3LV3A 4DNLA 8PAZA 2Z91B 4QHKJ 4DHLA 6PAZA 1CYXA 2BJMH 4PRID 4TNVF 3S4SG 4I48B 4MJ6A 1U21A 2IANB 1Q0YL 3FQRA 1HCFX 1N6VA 4G8FB 1ASOA 2EIBA 3FNKA 5CWSB 4B6ZA 3L6FA 2ZXQA 4YPGB 2ID5A 3MRNB 4UTBL 4JFDA 4R2GC 3ZKND 1IBGL 4MCYA 3WL9B 3ESOA 1LILA 4M5SA 4PP1C 2XWRA 3MOQA 4FXGA 1MFDH 2NXYD 1AXIB 4CAGA 4HLEA 2XI9A 4ZI8A 5JDSB 1EHXA 5I17A 1UM5H 3HC4H 1AGFA 3LNDA 3ZDYB 3UTQB 2NSQA 2EXYD 3FRUB 4DW2L 1GGBL 5IMLA 4L4VE 5AKVA 3PAVA 4HWUA 3DO4A 2Q7YA 2IIJA 4XP5L 2OYPA 2IDUA 4HPHA 4C47A 4AYGA 2P8MB 1LHZA 2FJHB 1A02N 2O61A 1FZOA 2AEIT 1UH3A 1TQUA 3D39D 3IFNL 4M7LT 5DFVC 3MRGA 3R0MA 3ROLA 4F7MA 5C8JB 2AQ3A 5I1JL 5DQDH 2AQNA 3GBDA 3JT0A 3WN5A 3CFCH 1V5JA 3KE0A 3GMPB 1WT5A 1UA6H 5HDBB 3MO1A 1ICTA 3KYKH 4ZAKC 1EEUA 2I25N 5HYQB 4G6JL 4OBRA 3VFPB 4ELKA 1FNEB 2A7BA 3NJLA 5KWYC 1HEJC 4CKVX 1DQIA 3D1MC 2IFGA 3JTTA 3IGAB 4DZ8B 1KYAA 1NCJA 3OMZA 1OLLA 4FJ6A 3TVMB 4YIQA 4CVWA 5FO8B 1QTYT 1GIGH 4ODVH 4J3OH 4LPCA 3L9RB 4XBPB 1GL4B 1OP5K 3W56A 1QP1A 1QACA 2AEPL 2FYYB 2R2EB 3QHFL 5B39B 2K70A 2VSKB 1UB5A 1ZKAA 3UXFA 2P4AB 3C08H 3WLWC 4BKLA 3FH8A 5E0FA 4CMHB 4NZRL 2OMZB 3MCYA 1FAKT 3MMEB 3EO1A 2BNUB 3ZPDA 5JDJA 1NBZB 4HDIA 5B1JC 4D9LH 4GMTL 1Q9LA 4YE0A 3E38A 5C0EB 4HCGA 5LHDA 3ZKMC 4FD0A 2XA8H 3C75A 5D1ZB 3FB8B 1T89C 4JJ5A 3PGCA 1BLIA 3EDKA 3FRPG 3RX9A 5A6LA 1AGBA 2W9LA 4JE4B 4PAZA 3N1MC 4YHMH 3UADA 4AUYA 5E5UB 3ZGHA 1OAUL 3T0EE 5HYSB 4AMWA 3DTUB 2GJPA 4DFIA 3CBRA 4DP5X 2P46B 3VMNA 4OCWL 4GRMB 5KVGE 4N1CA 2FECI 1C08B 1QPKA 2HKHL 4QHUB 4JGJA 4NOFA 4YSAA 3RWHA 2WKGA 4UDTB 3OMNB 5LXGL 1CU4H 2CSPA 1XR8A 4NWTH 3QG7H 4P3CH 4LPUA 1PZ5A 3IMTA 3W5MA 2E6PA 2LFEA 1T0PB 3ZHDA 3A24A 4N3TA 3MACH 2FD6L 4HCIA 3O2VH 5J57B 3P40A 4XNAA 1Z0NA 3F62A 4JDTH 3LZRA 1E5AA 1O7SA 3GLEA 2Z31B 1OY3B 3QRLA 4CILA 3AAZB 1WFJA 3GT6A 1XV8A 2Y2TA 4JUSA 4J7RA 3BH8A 1UJ3A 2E47A 1GYWA 4TL5A 2XN9E 3MBXL 3QIUB 4GAYA 3D48R 4UDUA 4QHLA 4OZFA 5HD8C 1HXYB 4PU2A 3EOTH 3L3OC 1YMMB 5TH2B 1EPFA 2WTRA 1LEGA 1NGXB 2JH2A 5GS0H 4OJDH 2O30A 3HE7B 4OFKA 2FSDA 1T7YA 4K9EC 3F6JA 2XC8A 4GQ9H 3BPOB 4L8CB 1B0GA 1JCVA 2EYRB 2EQDA 1BEYL 5FF6A 2CJUH 2DH2A 5F7LB 3LZOA 1QSFB 2VCOA 3NFSH 3RVUC 1RIVH 4WI7A 3ZO0A 5F8QC 1P7KB 1UVQB 2WBKA 4WI4A 3ZT7A 2EKSA 4GEJA 1J18A 3X2QB 2ZF9A 4I13B 3ZT6A 3OKMA 3CD4A 3NUKA 5F9DC 2EO7A 5CIPH 2VM3A 4G9FB 4ZFOB 2UY7A 4U05A 1HL8A 1QBBA 3BMWA 1NAMH 5CM1A 3TEZA 1D7CA 1KBPA 3UJIL 3ULVL 1JPGB 2X6UA 3HC3L 3KVPA 3UAJC 3P3YA 4UQIM 4OLWH 2XXGA 3CUPA 5DLMH 1YY9C 2ICWA 4AQ1A 3T77A 4FQIL 2ICEB 5JMOC 4O2FB 1KIRA 3HC0A 5F1KC 1CLOL 1IQWH 1CDIA 2ATPA 4QYAA 3MV11 3JZ7A 1JGVL 4N26A 3QQ9D 2LW3A 3C8KB 1OP5H 2PF6A 4N0YL 2CWRA 1X4ZA 3IF1B 3QDMB 2VLRA 4ENED 3M1CA 3VGHA 4OGZA 5C0AB 2NY3B 2OCFD 3INOA 3W39A 4FFZA 3AW5A 4OQTH 3QISA 5IROA 2HJKA 5F6IB 1BD2B 1XAKA 2QJDA 3B9DA 1KCSH 4WK2B 3MC0A 3D3VE 4NFDA 3RGVC 3RVVC 4TQEH 3TZVC 1NKOA 1WZAA 2ADGB 4B9IA 4MMZA 4XX1E 5HYJE 1GS6X 1TXKA 4YPJA 1KLGA 3QIWB 2CLVA 5IJKA 3PF2A 4GS7B 3O6KL 3SDDA 3HMXA 1M7DB 4ICWA 4NO3B 1VACB 3BGMA 3D0VA 3RDTC 2VB5A 5EU5B 2FJGA 2CHDA 2IADA 5A40E 1Z9PA 3RA7H 1JIBA 5KVEL 4HX1A 3IGFA 1K9TA 4KVNL 2VJXA 3QQNA 2H9GA 4XNXL 1E5BA 2KH2B 2D7MA 5JQHC 2X5PA 5E7BA 3RY6C 2E8YA 2I5YH 4FERA 1RZKH 3R7QA 1A6ZB 4MAYC 1WBZB 5DK0A 3S3BB 3ZZQA 2AJYH 4JB9H 4IBQA 3DYMA 4JG0H 4TSBH 4ODXB 4F1ZA 2AANA 2GI7A 5FO2A 3SDYL 2DMBA 3CH1B 5EULV 3BAKA 3C87A 3Q5TA 2DLIA 4XBGB 3X1NA 4M9OA 4GI6A 2VDNB 4N8CL 3ZE2E 4Z3JA 2CPUA 4WUUA 1GGCL 4ZTEA 2JCCE 5DA4A 5B7MA 2FSEB 3K3QA 3FB5B 5DJ2B 2PPDA 2QFRA 1YMHA 9CGTA 1GZHC 3NJHA 3C09C 4GRLB 4I0CC 3OJMB 1OARH 4Y4FD 2VDOH 4LVNC 3NABL 3SKJL 4KTEH 5IJCC 1GJIA 1MPAH 1DJHA 4NBZB 3WHXB 3LX9A 3CSTA 3TWCL 1H6UA 3WO4B 3ZGIA 2R7EA 3ZE1E 3ARDC 4WTWA 3LKNB 3VW3L 1XGRA 4W6XB 3QFDB 3PWPB 4OF7A 5HGGS 4N22A 5T1LB 4XT1C 4CSTA 1CFMA 3O8XC 4K3HA 1AZBA 4XPTH 4X2UA 2COVD 2Z3FA 4M5ZL 3B9KB 5BZZA 3BEVB 1JV2B 4XO4A 1TPXB 2VIRA 3AM8C 3MI6A 4EZJA 2IALB 5AVWB 2B2XL 4HS6B 1L9NA 1MCJA 4K94C 4P59L 3TNNB 3UEQA 4TQHA 1HHIB 1MFNA 1TZAA 4KJWC 3HB3D 2PW2B 1J8KA 3SE9L 2WBJB 1ZJBA 4DPRA 4Z95H 3NFPA 5J4MA 2C8NA 3EFDH 1QFUL 2KZ1B 3P73B 4DP8X 5FLVA 1IE4A 5GGVY 1A3LH 4GW1A 1IU1A 3VH8A 1EZVX 1HL4A 3FN3A 2R1WB 4ZFQA 2VDPB 2WBXA 1S7XB 2OYLA 3F8UB 4P4KB 4S1DC 3D85B 4H25A 1GC1L 1HSAB 3MPCA 5AL0A 2J20A 5DJAB 2W8CA 5JTWA 3ULUE 1AHWB 1D5IH 1ZT7B 4A68A 4PH8A 4XZUA 4YZWA 1ZT1A 4WEUD 4IIQB 1DHKA 3JUZA 4MMYA 3JTBA 3VSQA 5JHDB 3HE6B 2YS4A 3LTVA 5JMRA 5KJ4A 3S4SB 1QLRB 3CZUB 2PO6B 3QUXA 3PPSA 4NPYA 1UADC 1XGYL 5HHOB 3RVWD 5IFAH 3B7UX 3QZPA 1CG9A 2AF2A 3TCXA 1QHOA 4MXVE 2Y36H 3HZKB 4OGQC 2HH0H 3L4VA 5JIKA 3UC0L 5BRZB 3JYBA 4P23D 3OGCB 4O02L 5D5MB 2DQMA 2MNWA 5AAWA 4R2GD 1OAXH 2YAPA 1XWVA 5SWSB 1HH9A 1WZLA 2WINB 3AWGA 4RQQB 4PP1D 2DF3A 3VFSA 3MROB 3VNZA 1R3IL 3ZZSA 2FO4B 4GOSA 4NQVA 3V0WL 5HY9A 2WNKA 1A14L 4Y8AA 1VFBA 3QDAA 1RUPL 4MJID 1QKZH 2K1MA 5D96C 5MEND 3EBGA 1HIML 1G7MA 2F58H 1A0QH 4OB5H 1E9QA 3PGDB 4PJDF 3IDMA 3VNYA 3JV4A 3EJPA 3QEUB 3FQWA 1UT1A 4PRPB 3D0LB 4H0LC 4R96A 4U2YA 1FNSH 3MRPB 1QSED 1SXSA 1OM3L 4DUWA 4NQDD 4YUEH 4RFOL 2VQ1A 3OWRA 5F7HA 3ML9A 2FZ3B 2KI6A 2WN2A 4KY2A 1LGVA 1MWAB 3PQYB 4ZAKD 4E9LA 3VFGH 3DHUA 2XKUA 4HK3N 3T1FB 1WBXB 5FM5O 3PWNA 3CHPA 3WS3A 3CTTA 4BH7A 4DCQB 2Z9TA 4NI3A 5ESAA 1EUUA 1WC7B 4AENA 5B8CC 3GI8H 1T4KB 3DLQR 3LPOA 1MJ7L 4MKTA 3V6OA 1JF1B 1T04B 1SLVA 2OTPA 1TQBB 1MW3A 2VQUA 4X9IA 8FABB 3ULUF 3OJDA 3STZB 2ZXBA 5IMKA 3LPFA 3MLSH 2OMYB 4HU2A 5F3BB 4IOSD 2ZCLH 4N8VA 1RUQL 2QV4A 4YQXL 5JHMA 2NNFA 3VXUA 2W9EH 1QG3A 4GRWF 2UWEB 4UT6L 3FRPB 2DQHH 3QI9C 3ZKMD 2FX7H 2E9JA 3VFVB 5LUMA 2VZ1A 1KIQA 1VF5C 2HFEB 3JWNH 4Y19B 3UGEA 4PJ8A 4XPGL 1MHPL 4G80A 3CFJA 2Q87A 3MLTA 4FXTA 4BQ8A 1JBJA 4XNBA 5TE7H 3D4CA 1FFRA 3QNXB 3VWJC 2CIKA 2WZ0A 3BQUB 4AEHL 2YEVB 5HPOA 5E8OA 2EDKA 1G6RH 4JREC 4AL8C 5CZRA 5EZLA 4AV4A 3JWDC 1G0XA 4WZ9A 4PJIF 3CZJA 3TV8A 1SEBB 1N7MH 5E2UH 2ZXAA 4Z3EA 4X6CA 4I9XA 1QUNB 3MFGB 5C6TH 3ZIYA 4G71B 4G5AA 1MF2H 5FK9B 3L8QA 1CICA 1J11A 1MNUL 2O6DA 5DD5L 4R5XA 2LFGA 5BV7L 1BYOA 2FT7A 2YMXH 3K7UA 1BIHA 3HMWL 4K9JA 3H2PA 1F6FB 2EDEA 35C8L 5DK3A 3QEGL 3HI1B 1YPZE 1VADA 4FF9A 1PFCA 2AMUA 1KV3A 3FO9B 3V9FA 2BNRD 3ULVE 1K4DA 1UXWA 3FW6A 2ITFA 1ZDSA 4IMKA 2ESVB 4XVUC 3HG1D 4K3DH 5AVQB 4JPIB 4JM4L 1QQDA 1JERA 4HJSA 1E2VA 1NCAH 2YEZB 4UINH 2CLRA 1KB9K 3T6QC 4X50A 1XF4A 3TTSA 2P5WE 3APNA 3FH5A 3VXMB 4ZW3A 1MCDA 3BXNB 3GTNA 4FNRA 4JFPA 4LIQL 3FDWA 2UY6B 4EJ1C 1OD7A 4KVPA 1W72B 2VTFA 2ICWI 4FOMA 1SDYA 3VYPA 4PVBA 3KWVA 3MUZ1 3P4NB 2NQ3A 4Y7MA 3ZE0E 5A43C 4E41D 4H8HA 4KO7A 2CGRL 2UZIL 4F7EA 2JIXA 3P2DA 2AEQL 2CKNA 4P2RB 2CUIA 3IS0X 1OGAA 3L16A 5CJOH 3TBVA 2HSIA 3B1UA 2H26B 2DBLL 2FGZA 4PWFA 3O3BA 1TZIB 2VE6A 3NZHH 4Y1TA 1NEPA 4Y4KB 4C83A 3VQ1C 1G7LA 1YUHA 3NIDB 2HMIC 3W37A 1ILUA 3ARQA 4WUKL 1IBHA 3WEMA 2DLTA 2O93L 2HT2C 3AG4B 4YSCA 5F9OH 1H0DB 1R24A 2VDMH 3UJTH 4PJBA 1T1WB 2NUPA 1IBZA 2I7SA 3FFCE 3NQKA 3BP6A 1IFGA 4QXTB 4ZO7A 2E86A 5ISZE 3V5DA 2WVVB 4M6OH 1T03L 1JDAA 3PXHA 3VDCA 3V4PH 3UIZA 3SJVA 1HK6A 3UAJD 5KVEE 4AT6B 4Y4HA 2JCWA 2QQQA 2GSMB 2XOTA 4QEGA 3L5WA 2R23B 3CFMA 2BHUA 3IDIB 5DHXB 4MXWL 2PPAA 5DRNB 3VG9B 2XTSA 1C5DB 5J89A 1B88A 4K7FB 3F05A 4GAAA 2ZOWA 4HIIA 3MA7B 3V2AR 1I9IL 4FNLL 2HJFB 4YDNA 2NX5A 4N87A 4DVBA 4YN3A 4P9MH 4ONGL 3GXNA 4Q14A 4U6TA 5CIPA 4KXAA 4JG9A 4KZEL 5L0QB 1NAMA 2NXYB 4WHTA 1S8DB 3KYOA 2WLLB 4ZUWB 1SVZA 2RHEA 4XO9A 4Y2OB 1RJZB 5FYLL 3RVVD 3TZVD 1MCOL 3QJTB 4IS6A 4NQXA 1HHHA 1IGJA 1EZSA 5I30L 3TO4D 2GTWB 3UBFA 3OWEA 2BOBA 1IX2A 3OPZH 3D0AA 1ACYL 4Y1AA 2BSEA 2OXGA 5KOVC 4HAKA 4GG6F 1G4MA 4D9RD 4NO0D 2BSDA 4N5ED 3ESUF 1DUYA 3RDTD 1VKXB 5IWLA 4C56A 3SPCA 3WJJC 4OQTA 4MD4A 3POCA 5IJVA 4OI8A 2PYEE 1NC2B 1CPUA 3BPNB 1S9XB 4MX7B 4OBSA 3CFIC 3ARSA 3U6XS 1G9NL 1W6WA 4JRXE 4KITB 2LABA 2YUXA 4TF4A 2AXJA 4ZX6A 4L48A 3GUTB 4ETYA 4MAYD 1J8HD 5C07A 4ANXA 1H3XA 4Q6IC 1S5HA 4XC1L 3F85A 5EHFA 3QJQB 5E6ZA 3PDGA 3WFZA 4PJ9C 4P5TA 3IFOB 4FADA 5I0WA 3IXAB 3IXTB 3ECBA 3HAEG 2JK5B 1G6RB 1WAPA 4ZUUB 3NVQA 5K5YA 1DQML 3NCMA 5I6OA 4LCIH 4PGCA 5LQBL 1DQDH 1P5VA 5EF1A 3SDXF 2XWTA 4RMSA 1ORQA 1MIML 1KBVA 1KCUH 1HHJA 3T8VA 4XB8A 3Q7JA 3QQ4A 2JKXA 3A22A 3BZDA 1QYGL 4OV6F 1TKWA 4AVIA 1MI5D 2FE0A 3D51A 3CN3A 4NKMA 5GRUL 4ZMQA 2CAKA 4U1NA 4JDVB 3T3PF 1TQTA 3KWUA 1NDTA 3QGVA 4LT7A 1BLNB 4KXDA 4P2OD 1H6TA 2XPZA 4KDTC 3B2PA 2CR3A 3GM0A 4CW1A 2AJXH 5AWNL 3ARDD 4AZUA 1E27A 4PJHA 2WWMC 3ES6B 2ZSVA 1YEEH 2F74B 1AKJB 5FKPB 4FQPA 5CSZB 3TCLB 5CUSH 5BZWA 3BISA 3FSAA 4WNQB 1IC5L 1KFGA 4ZYKB 5HVGB 1FHGA 3QT2A 2E7LC 1Z5YD 2FJSA 5EN3A 1HAWA 5C09A 3WTSA 3WNIA 2B15A 4FQXC 4JM2A 5C86A 5ETUB 4XMPL 4KJWD 5J9PA 4PQXA 1RHHB 1JD7A 2V8LA 1U8MA 3ULSB 1GW6A 5I5RA 5L9DH 1LDPL 4A2GA 1R0AL 1KCRL 2Q1EA 2QVKA 1FLRH 2WO4A 3MV8D 2OL3H 1CD1A 4ALAL 2YAQA 1XCWA 2F1BA 5GGTH 3IGLA 3S48A 1OF2A 2IH9A 4S1DD 4X6EA 2WSDA 2PNDA 2ZUSA 3I02A 5ENWA 2N01B 4NC0B 1WAAF 5IBTL 4APXA 2CNZA 1N0LA 1PYWA 5FXCH 2XN0A 3TNMB 3WHE0 1CR9H 5C70A 5A6IA 4N24A 2OK0H 2NNAA 2YGNA 1E5CA 1B4JH 3C6LC 4WO4C 4H44C 1TTUA 3V4PB 1CDYA 2E3VA 1YEIL 3TA3A 1D5XB 3I6LE 4JPKH 4NN6C 4ADJA 3K2MC 3P02A 3G5XA 2I07B 5IESL 3CH8A 4PTTB 2B59B 4HFWB 4IKJA 4KI5F 4Y5YC 4TVUA 1Q94B 2UZXA 5JORB 2Y0SA 2J6EL 3QDGB 1W9XA 3VGFA 1DO5A 5LDSA 5F9WC 4UM8A 4K73A 2K78A 3VSVA 2CK0L 4MJJA 4BH8A 1UWYA 1I3GL 1CLYH 3KPMA 3P4MA 4NM4L 4XPAL 2ZUUA 3QJXA 1YEJH 1FNHA 4OCYL 2A77L 3VWKA 1AMYA 1VIWA 4LPVA 5D93B 3VXRA 1ETZA 4EBQH 3HHSB 4EI5B 3B2VL 3I6SA 5EB9A 3ZDXF 1KTLB 4YX2H 3WTXA 3I84A 1I9RH 3WIIL 3HN3A 3DSNA 4QXGL 5DVOA 3DVGA 3ZYIA 3IJEA 1X5FA 3LKSB 2HTLC 1LE9B 4KNSA 5IB2A 1GTFA 3ISWA 3LN5A 5I8CB 2G60H 1LWJA 1NCHA 4N25A 2IF7A 1VGKB 3EGXB 3F7KA 3CX2A 4M6NL 5JPNC 1AZRA 1MFDL 1GGUA 2XV3A 4BFNA 4JL1A 2EZ0C 3NGBC 4U1IA 4BGDA 5DVMA 1HKLL 1U92B 1YEFL 2A9ML 2Z64C 4PY8J 2X4UB 2H2SC 4K71B 4PRIA 3FHEA 3KS0H 3OTTA 4K3EH 4U4BA 4B9GA 1OE3A 2RCSL 3D09A 3G6JE 3SKNB 2VR4A 4AYSA 4PM1A 4M8VA 5ABDE 1D5RA 4O2EB 5HGBA 4LSSH 1JF5A 1FVCA 5CCHE 1U8KB 2AEOA 3V9EA 2IAMC 1ZGLB 4DQAA 4GKNA 3KXFE 1KB5B 3RPIA 1TENA 2WLMA 3BAEL 4JFFE 4HEPG 4U6HB 3L9EA 5HHNA 1WQVT 4Q9CA 3THMH 4X0NA 5AD0A 3MNZA 3MRCB 5DQDL 4L3EE 3E6HB 4MNGB 4X99B 3RWEA 3VI3F 1AC0A 4P5KA 3OQ3B 1EDHA 4LL1A 1CMOA 4LLYB 5D7JC 1KN4L 3OLDA 5DD3L 4S0TD 3HPLA 4AYFA 2LR4A 5I28A 3OB0K 2NY5H 1UFGA 5E99H 1MFBH 5AEAA 3QI9D 4YWGH 2R8SH 1AGEB 5I9QC 3NJFA 4I18B 3D39A 1RVFL 4YBHA 1ZVSB 2L04A 2VT0A 2X53A 3FAXA 4F9LA 3FCTA 1BAFL 3TT3H 3L13A 5TDPB 2K9UA 2BMKA 3L1GA 3P4OB 4ZD3L 3T0VA 5J0BA 3L5XH 4H88H 4I1RA 2VN4A 2VUOA 1Z9SB 4PR5B 3LKPA 43C9B 4MNQB 3HI5L 2XWDA 3EYOB 5EOQL 2YIHA 3K2UL 3X1GA 1CGXA 3WNPA 1HHKB 3QHZH 1G7IA 4YHPB 4DSYA 1FO0B 3FYEB 1RK0A 4TLTA 4Y4FB 2OXHB 1XCQA 4O4YL 2Y5EA 2XX0A 1AAJA 3RUGE 2R9HC 1P5UA 3GSNH 3KDMA 2VDRH 4YHML 1RU9L 2VDNL 2DQDL 3RI5F 3G5ZA 4XVUD 3BVNB 4J6RH 1F3RB 4PJGB 1CUOA 4R4FH 3Q8EA 4HETA 5ADPH 3I6GB 2BIIA 3ZT5A 1NUDA 2A74C 4UM9B 1MW2A 3IJHB 5FYJL 1MHCB 2BNQE 5TQ2H 3FOMA 2ZAHA 2JF1A 3GRGA 3IN2A 3QXAB 4G43B 4NWTL 4OH2A 4P3CL 3BW9B 3WS6A 2EDTA 2WLKA 2DJ4A 3C6EA 4M1CC 5JIDA 5DUBA 2CGZA 2CUAA 4HUWB 1JZ6A 3O2VL 1RPQA 2XJKA 2ED8A 3TWYA 1YCSA 2OZNA 4MD5B 4NKOB 4GUQA 5F1IB 3V5KA 4WF7A 2Q5BA 3MNDA 1FRGL 4PS7A 4PJ7B 5I16A 1KT2B 3VD1A 3O9WC 4XHQA 1I4FA 5GQBA 2AJZB 4L29A 5FYLE 5MERB 1WPCA 2IANE 2ICES 1KULA 1NZRA 1RJLB 1WTLA 5M7QA 3U46A 2EE0A 3L9BA 3H42H 4PB0H 4LNRB 4XXCC 1CF8H 2HT2D 4BA0A 1OT2A 2CCWA 1OHZA 4RDQF 5SX4H 3OKNA 4LSUH 3IDGA 4UV4L 3D07A 4H8VA 1LD9B 1M2VA 2BSTA 2PWGA 4N2MA 1MOEA 4XRCB 2R2CA 4QYOA 2XDHA 4JQIH 1I7UA 4YMPA 3BZEA 2WJ5A 3S96B 3F2LA 1KJ3H 5GJTH 2JKLA 1FFOA 4JPWL 1A1MA 2HLEB 1F1AA 1AD0A 3FQ2A 3WKPA 4L23A 4AV0A 4ZMZA 1AO7D 2VDPL 1RIVL 5CZXC 3U4EA 5E9DD 2ED6A 4W9LC 3DV6A 5F89B 2OTWA 3NCEB 1P6AB 5D6CB 5ID0B 5FECB 1PLGH 4LLVA 5GSRA 4O9HL 1VERA 2CKBH 3DURB 4GAFB 3WUZA 1FVEB 1KPUB 4UT9A 3SE8L 3GSRB 4UTAA 5FCSH 4X4XA 3LEYH 1T5WA 3OXSB 3WGUB 5I15L 3HR5A 3WGVB 1IE5A 2VKWA 1C7TA 2CBQA 4UNVA 2IJ0C 3H3PH 3FSWA 5GS1A 5EV7A 3MXWL 5HDBE 1NIFA 4HFWA 2B4CL 1E43A 3SO5A 3QR1A 2O6FA 3N1GC 5AW6B 5MENB 1PD6A 5IJDC 4GKZA 4ZW8A 5EWIH 1JOIA 1F8TL 2EILB 1QTSA 1RKRA 2B08A 5DJ8A 4HPOH 4N90E 3GEFA 4G83A 2Y06H 1BXXA 1YNLH 5I1DA 4MCZB 4Q4EA 4QGYA 4XCEB 5DLLA 2A9NH 1DL7H 4NDMA 3H4HA 2HCZX 2MMXA 1LK3H 2XY2A 4H8UA 1P1VA 4KMTL 3FT4B 2IPTH 3ZL4H 4JN2B 2UUDK 4Y8DC 5D1QC 3CG8A 2GJ6D 4GQQA 1P4BL 2CBOA 2J8UB 5F93C 4X6DE 4GIOA 3EJYC 1YJDL 4ZAKB 1DDTA 4PMFA 1Q1JH 1GYUA 4LLDB 1EA9C 1GJWA 3NJVA 2Y5QA 4ODBD 4DESA 5ESQB 2P5EB 3BDXA 3HAEB 1F3DH 5FAAA 5BW7C 5CILL 3KLHD 2DMCA 3ZN6A 2BOCB 3UO8B 3HZVB 4PJ9D 3US1A 3IDUA 5DURB 3KWWB 5E70A 3NCFB 4LSTL 3BP7A 4F2EA 3K1KC 3QPXL 3C5SA 2YPVL 1NDGA 5EU7E 1FNLA 1MWAL 3F7VB 2XNAB 4WFED 4XOAA 4I1PA 1A65A 2W07B 1WHPA 4MASA 2OZ4H 5K9JH 1MCPH 3C6SB 3FPXA 3RHWK 2AQTA 3MTRA 1U8KA 3KBHE 3NFNA 1U8NB 4JB9L 4AIOA 4ZZKA 3MRDB 3DX9B 5B4MD 3FC8A 4JKMA 2XA3A 1RULH 2RAMA 4NNXA 1ACXA 1JV5B 1XTLA 2VDRB 4JY5L 4JPQA 4YBLC 2IQAA 2WWMD 5GRVK 1IGYB 1Q9OB 1OP4A 4FCAA 3KW8A 3RFZB 2AQPA 5K9KA 3FO2B 3L2MA 1GVIA 3CJJA 4LBEB 3L7FA 3HCVA 1SF3A 1YMME 5F88B 3L3DB 2Q76B 4M03A 1MH5A 5C08D 4AIZB 5IFJB 1MLCA 1ZLDA 1RUKL 4IMLB 2XWJA 2AK1H 4OUUB 5AVRB 2ZYSA 3AUWB 2WZ6A 1S5IL 1B2WL 5F3HB 3HUJA 4LRNL 4CU8A 3AABA 2VABA 3DXAE 1XR9B 1DQLH 5D71H 2H32H 5KSUB 3UZEC 1QSFE 5J6HA 3MV9A 1TYJA 1O7VA 3OKLB 3C5ZA 3IEAA 2CBMA 2P7TB 4OZGA 2R69H 3O45A 2B1AH 1PSKH 1ONQB 3TPKA 4BK5A 4AGMA 5BVPH 1KXQE 5FDWA 4H0GA 4YNYB 1NPJA 1EJFA 3L3OB 3OR6B 5SWZD 4LLUB 4K94H 1IGMH 4S11A 3ZTJH 3U9PL 5LAPA 4G9FE 4LOVA 5TK4A 2F7OA 3EG9A 3GZQA 2EECA 4UQAA 3UZQA 1QTPA 2X9WA 4MA7H 4Z95L 1K4CA 2V5YA 4XN4A 1FFTB 2EEAA 3LEVH 5KN5B 5TF1H 4G7VH 4HZLB 1A3LL 3DO3A 4FI6A 4KHXH 2HVKA 3Q8CA 5IMOB 4P5MB 2OL3A 4IBLT 1J12A 4GSXA 2YRPA 1I3RB 3MV01 5GGTA 4F8OA 1OPGH 4NRXB 3BDBA 3MNWA 1ERNA 4G3YL 4X5LA 2RALA 3SSGA 2C3VB 4DVRH 1W72L 3KPOB 1G7QA 2BCMA 4AGQA 1MAMH 3L1OH 4L1BA 5C0AE 1G1CA 3MBWA 1FF5A 2XZAH 4EN3B 4XC3L 4NS0A 5H94A 1BD2E 2CUHA 1A6AB 3DGGA 4G5ZL 2GCYA 4YDLB 1F45A 5D70H 4PGDA 5F7BA 2PPCA 3PP3K 4GKSB 2HLFC 5HJ3B 3WFCH 5JOFB 5CKGA 4ELDA 2XBTA 4YLQT 3FCGA 4ODUA 1I9JL 1P9MC 2F7QA 4YSEA 5F72S 1OAXL 4AMKH 3JXAA 5JXAL 3I6KB 3IAGC 2AJVL 4HIXH 3MRLA 1LEKB 2EDRA 4PWGA 4OD1H 2G9HA 4PRDA 5ES4B 1FNFA 1BMZA 3U9UB 3QZNA 1XF3A 3HTLX 2EZ0D 3MOAL 4LVHB 4OD2A 4KKBC 1TFHA 3QZOA 4JJOA 4UQ2A 3OVUB 3NEOA 2E7CA 4H40A 3RGVB 1X5JA 5CCGE 1NL0H 3FTGA 4E68A 2J71A 2F5BH 2OR8A 2VC2H 3BWAB 2QFPA 4M48H 3SY0B 3L17A 3G5YA 4P23A 1QWUA 1YNTA 4HIHB 3SN6N 4U6XA 4K7PX 4KJQC 1FVEA 3T4AC 3EO9L 4KJPD 3VGGA 4FFYL 1P1ZB 1T2JA 2VUYA 2NCEA 3NCXA 4WLCA 2CHWA 3KPRE 1L6ZA 3QQ3A 4PG2C 4NO5B 2J8HA 1G94A 3QZLA 2X70A 4QXWA 1P4LB 1NM9A 1MZZA 3DX8A 2H7WA 4MJIA 5D7JD 1BFVH 4PJEE 4FL4C 1G43A 1U91B 4H8WL 3X14B 1I8AA 5I71C 2M1KA 2NRDA 4NCDA 3I3EA 4FP8H 3VFGL 2HX8A 4JG1H 5CEXA 2A4CA 3W5NA 5FYJE 5G4MA 5I6LA 3L3KA 3VB9A 2CH8A 3G5VB 4ODTH 4JKNA 2XLLA 1G9HA 2O6PA 2X6AA 4P06A 4Z7VA 4KOBA 2OKMA 3P2BA 4JRLA 1HN1A 2ITEA 5I75C 1WWBX 2Q8BH 1QSEA 1UUNA 1KC5L 3PWPE 1MCWM 2CK2A 4NQDA 1GSMA 4XMKH 1A4JA 5I1AA 3IGKA 2W9EL 1E90A 4W9JC 5D72H 4YAQA 3T0EC 3FHQA 2Z93A 1P7QB 1A47A 3CZFB 1JZ8A 1A64A 4WJKB 3SKOB 5EEVA 5AW4B 5IQ9A 3C09B 1BEXA 1FORL 3AG3B 3BAXA 3FU8A 1UYWH 1MI5B 4I4WA 3PWVB 4F5CA 4KRLB 4Z77B 1SDDB 3LDBC 4LVNB 1Q72H 5J1AA 1A6WL 1G6RL 4HK0A 5EBMB 2ZUQC 2XFXB 4KZ0A 3DECA 5DYOB 3ARDB 5ILTL 3Q1EA 1RIHL 4IOSA 3BKCL 5I1HH 1DN0B 3FK3A 3O8XB 3OQRA 4LLWB 4ZQTA 3NEEA 3NSDA 1MJJB 1P4IL 2WXIA 2B9BA 2MOVA 4J23A 4JFHD 2Z65C 3JSSA 1J9TA 1QABA 1KGXA 1T89A 1XGUB 2JVUA 2RMNA 3VXSD 3BAIA 3P0GB 3RY4A 1ZHKB 4MA8L 1GKEA 2WTPA 5JHDE 4DZBA 3ROOB 2P8LB 1VGEH 2BW5A 2ENQA 3FKUS 5DZJA 4CBZA 4YL9A 3PP3H 5BQ7B 2YJQA 3GSNA 3TF4A 4OI7A 1NLDH 1UASA 2JELH 2D7TL 2IH1A 4HGMA 5EU4A 4F20A 4UQBA 3QNFA 1IKFH 3ECQA 4UCFA 1NCAL 4FNTA 3O9WD 4L3CB 5HHOE 2W9DH 1AOHA 3FFDA 5EC2B 3X12B 4M7LH 4HH9B 4DGIL 1TVDA 3PV7A 5KOMC 4U7MA 2DY2A 5D8JH 4MQ7A 1YEKH 2I26N 3X1BA 5AW0B 5BRZE 3ASWA 3N50A 4UIMB 4TUOB 4XH2B 5CMAA 3VXOB 3GZOA 4J27A 1VAHA 4QUOA 1HZHL 2TSBA 3QCTL 4PJEF 1F56A 5SWSE 2YPLB 4UNIA 4JRYD 3BP4B 3LKQB 2EDOA 4JFED 3CLFH 4FDWA 4Z3HA 1C8QA 2ZP9A 4HUVA 2BNRA 2QLVB 3BEWB 4DP0X 4PLJC 5BO1H 5CJOL 4DTGL 4EIZC 4K23L 3A5VA 1PZBA 3HG1A 1WFOA 2YN5A 5DRXA 4QRPB 3H7BB 4BFJA 1BBJB 2EDLA 3LKRB 3DUSA 1PPIA 1YC7A 3OMIB 4B7LA 2YRBA 3F7YB 5T1DH 4JO3L 2BIHA 5CZXD 2C7UB 2C9AA 1VENA 2FH8A 3BGFC 2EIZB 1F90H 2NR6C 5F1OB 5B1CA 5IBLC 3Q6GH 2G3ZA 2Z34A 1UH2A 2FK9A 3UJTL 1EJ6A 3DYOA 3JWOC 2FT6A 4X4KA 1FZMB 2YUWA 2XVKA 3MR9B 4JKLA 2DM7A 4E41A 4Q8BA 3ZL2A 5ALCH 2V7HA 4PRPE 4EKJA 4LSDA 2LU4A 5KJRL 4JQIA 3V4PL 1X9RA 3HS0C 5CO1A 1MJ8H 4DP6X 2EDWA 2L7JA 2PABA 4G8GB 5IG7A 5J7CC 5L2JB 2R2HA 3PQYE 2NTSP 4UB0H 1MFCH 5D96B 4UQDA 1REIA 4AQEB 4XXDB 1YN7B 1BAWA 3CSBA 4DN4H 5IEHA 1TLMA 4BZ1L 2CKBA 3L45A 3CFUA 4I2XA 3U25A 25C8H 1FVDA 3B8YA 5EZIL 4Z78A 4EUPG 3S3JA 3K5SA 3GM8A 4AI7A 1BJ8A 2BH0A 1XGQA 5LG1A 3UAJA 1XZ0A 3AS2A 4HG4K 3A21A 5CU9A 4H26A 2YGOA 5CP7A 3TBTB 2GFBB 1DSFH 3JT2A 3DX6A 5D1QD 2V9QA 3PJSA 3SY6A 4X8JA 4WEMB 4YGAB 2UWEE 3EJYD 4JDEA 1FH2A 1E4HA 2DICA 1XEUA 2YC1B 2B77A 2YD8A 2Z4QA 3MQIA 4K07A 3UYRH 1QFWH 3ZR6A 4KFMA 3RWJA 2OLDA 3G5WA 3LHAA 4J8RA 2W65A 3KYNA 1A21A 1NBVH 4LSVH 3A0OA 1JZDC 3IDXH 4IYKA 1Q9WA 5L8KB 5HHVH 2QKIB 3TZVA 3M46A 4AC4A 1U58B 1U8LA 2KS0A 2OJ1A 3NZ8B 4NQCD 3TO4A 2P8PA 1KF9B 4J3BA 1IAIH 1PFOA 4B9FA 2CMRH 1BZ7A 2VW7A 2BC4B 4NO0A 4XNQA 1HVXA 3RDTA 3VI4F 1KB5L 3K71B 5ELIA 3RJQB 2BSSA 1OO2A 3VWJB 1KG0B 3GK8H 3C2AH 1R3KB 4Y16C 4E5XG 5HHME 3BJLA 1EZVY 1FJ1B 2IPKB 3HZMA 3J8F7 3KHQA 2ESVE 4NFCA 2DEYX 2W81C 4RRPG 2A6JA 2IOMA 4DOHB 2OSYA 2AK4B 3QC5X 4LOEA 5IB3B 3BUQA 2MSPA 1WF5A 2AV1A 3VXME 5BCAA 2OZ4A 5AZ2H 3KZ8A 4MMXC 2OAAA 1K6QH 1B90A 4JHWH 4MAYA 1J8HA 5D9SB 3LRSB 4HC1H 4JCLA 5FV2A 3VFUA 3LQAC 2FIKB 2KPNA 3RKDC 2DLFH 2VKXA 1NGPH 4NZUH 5EA0H 1XMWA 1OTTD 4G7YL 1CD8A 5HP5A 1S7QA 4F7TA 3BSZH 1S7RA 2BERA 3SYPA 1KTDB 4LSPH 4FULA 1LE5A 2ZCHH 2X88A 3NIDE 1AY1L 3IETA 4L37B 5LAXB 1Q0XL 1MG2C 2WQVA 5T3XD 4K7PL 3UAAA 1R3JA 1FG2A 1LEIB 3A6BH 1FO0L 2IH3A 1A7RH 1CQYA 2MPAH 3WXWL 3VD2A 1IEBA 3QO0B 4PWKA 4P2QB 1XEDA 2VZTA 3N41F 2QTVA 3LCYA 3QEQD 4A37A 4P2OA 2OYMA 3ULUC 3WKYA 2Q3XA 3KGSA 1RLWA 3BKJH 4LDEB 1JWSB 3N42B 1EAJA 3MV7D 4ZFFA 1BSIA 3MUGA 4N6QA 4U0RC 1J1OH 2H32A 1AZCA 4OVVA 5KSBF 4YFLF 1GOGA 1JAEA 2BCKA 2R4RL 3H6JA 2X4NA 4ES9A 3E80A 3PHOB 3OHXA 2R69A 1H3WM 1URLA 1XMEB 2FATH 4JAMA 4KRPC 4XPBL 4OIIL 3TFKC 4GP5B 4OFVA 4DK5A 2ATKB 5DQJA 1MRDL 1TVHB 3HLAB 3FQUB 4KOCA 4X5WB 1FGVH 4F7KA 1HINH 2XXMB 2DLHA 4F91B 2OK0L 3HFML 2DB8A 1AGCA 2ETWA 2R1YB 2O5YH 1A7OH 1DJIA 2LAAA 3LS5H 3L3GB 4IOIB 4MD0B 5DEFA 4PV9B 3GIVA 4QY8B 1P6WA 4IQHA 2EYTB 5E1QA 2X1WL 3UBGA 3B83A 3UTTB 1SYVA 5FCUL 2K4WA 4MWFB 1NJ9A 2OMTA 3MV8A 1AO7B 2Y5TA 2P28B 1EK3A 5FDYA 1UOLA 2DWYA 3L4CA 1BOGA 4TUOA 1VRSA 4LAQL 3NIGF 4BGLA 1EMTH 3R1GH 4L4VD 2UXVA 1X5IA 1NKGA 1JN6A 4BKSC 1SOXA 1UG9A 3FMGH 3KWTA 3WEXA 5AYQA 4OJEH 5C0IA 4BK8A 4LL9A 5JW5B 3H2WA 4EBQL 1UM4L 3SDCC 1NSNH 4R8WH 4ORGA 4EOWH 1I1AC 1N5AA 1R3HA 1T0MA 1RIUH 5EUOB 4A2DA 4M00A 4X98A 5BXFB 1ZJAA 5TGBB 2FAUA 3L3JB 2G2PA 3CSPA 3MZGB 4WV1C 1KPVB 1UT9A 5DJDA 4KJQD 1FL3A 4B3VA 2GHZA 5T3ZE 2X0UA 1F5WA 4HV8A 5ANMB 4CADA 1MAKA 3CLWA 3C9NA 3ELQA 1JPFB 5D7IE 1L9RA 1J1PH 1NIBA 1DLFH 1M05B 2EAEA 3JQOB 3IMVA 1WYJA 3GJFB 1IEAA 4PJ5B 3LNHA 4HW6A 4HZ1A 1NH6A 1AI1H 2EDXA 1N67A 1NCNA 1CLZL 2C9RA 2JJWA 4HMCA 4HWEH 5C0BB 1FL5B 4X5XA 3O6FB 1ZE3H 2ADJA 1NCBH 2NW2A 4HJGA 5INDA 4NKIL 5KTEH 4MDJA 1E42A 1BJMA 4HUMB 4W4OC 5ITFB 3GPSA 5IVXB 1KIPB 4PREA 1MXGA 2HT3C 3U4BL 1RFDL 4OV5B 3Q6FA 3GKWL 1EJ8A 5MI0C 1AQMA 5EU3A 3PCYA 1XT5A 1LWHA 4HCRH 3QUYC 4PJFF 5AG8A 1YYLH 3I75A 3RL1A 4A38A 4M4PA 2J43A 4B9ZA 2WZ5A 1BVOA 3UEZA 5F1NA 3T0ED 1EUTA 2O5XH 4WDIA 1RZIB 5E99L 4AK2A 5MEPA 1V7NH 5DZLA 5GGSB 1WWCA 3FFOA 2PW1A 3O6LH 3UL4A 4O51B 1HNYA 2R8SL 4JZNB 3EBHA 3BWUF 4OVUA 4YDIH 5B8CA 1CT8B 1LO4L 3ILPB 6FABL 3GWJA 5FHAH 2R0KL 3BWZA 5IOKA 3TT3L 1K8IB 4JCMA 4CGUB 5IW6B 1W2KT 3SD2A 5EO9B 1SXAA 3B6SB 3GMNA 5H37H 3VFOB 1BPLB 1O6SB 1WS7A 1N64H 2BLFA 1QFOA 2DBJA 1IKNC 2CR6A 3ULVC 4XCCL 2CDFA 1ULVA 5D2NB 3ZMEA 1FWXA 3QHZL 2XG5A 3O2WH 3QI9A 2VXTH 3NJNA 1GPOL 4YZFE 3NN8B 5JUEL 4IRZH 1TZ8A 4V1DE 2R0ZL 2XN9D 4BBWA 3QH3B 4D0DB 1NINA 4ETQA 1JFQH 3MLYL 3EYVB 3MGTB 4D8OA 4A04A 4B27A 5B3JE 5F3FA 4FQXB 2WW8A 2WQAA 3TV3L 3OV6A 5ESVA 1ADQL 2VDRL 1DZ0A 2CO1A 1E2WA 5DSCB 1UXSA 5SX4I 2G2RB 1FL6B 4TSAH 2V2XB 4YDKH 2Q3AA 1JWMA 2EVJA 1U8OB 3L7EA 1Y0LA 2GT9B 5D7IF 4CDGC 2HJLB 1AS8A 4MXQC 2V7NB 3QDGE 4Z7OB 3LRSA 4UQ3A 1ROWA 1WCQA 2IQ9L 2J6WA 5FYKU 2AEWA 2HG5B 1IM9B 1OW0C 3HNVL 3TF7C 3SGKA 4HQQH 5D2LA 4I1NB 2YPKA 2X1QA 5FO7A 3UTOA 3KWXA 2WB7A 5GSVA 2F1AA 2OP4L 1NLBL 4QWWC 2VSMB 3FTXA 3C6LB 3GJEA 3B3IA 2NZIA 4UUJB 4WO4B 4AM0B 2AQ1A 1B4LA 5MEOA 3MRHA 2H6OA 1NPUA 1U93B 3QZWG 4NN6B 4IEFB 3T65A 4ZTPL 3VYOA 4F15C 4WVRA 1I8LA 1SM3H 1X9QA 4QHNA 5FUZH 1RUAH 4Y5YB 2TRHA 1HSBB 2NR6D 4NHUB 5BZDB 3QCVL 3R8BB 2DN7A 2KZKA 3DMMD 4LSUL 1PG7W 4YFDB 4KO6A 4ZFGL 1TTCA 4HWBA 4ZUVA 1I7ZA 2OJEB 4Z7WF 1ZHNA 2F19H 2KQNA 4EXPX 4K9EL 2WCPA 4YO0A 4AV5A 1PKOA 5HYFA 4L8BA 2WTOA 2Q6WB 2CGYA 3Q1SH 2HLAB 3KPQA 1XF1A 4B9CA 1A4KA 1RMFL 1CGSH 1BQHA 2X1PA 2MEJB 1PZUB 3VXNB 4LLAA 3OAUL 2NQCA 5ALBH 3DIFA 3D3VD 4YXHL 1H5BC 4HZAA 2HT4C 5K59E 4EUPB 4N2AA 5HYJD 3CZEA 3QUMB 4PJAA 1CZ8L 1HEZA 4XMLL 1TDQA 4KVCL 4OIBA 1SQMA 2EADA 3SGEH 4K8RL 3H3BC 2HTKC 5E51A 2VLLB 4MJHA 4U1KB 5JPNB 3C60B 2YSSB 3JV5A 3MLRL 3A67H 5IB4B 3QJFB 3UPRB 3NGBB 4MNGE 1CURA 1QBAA 1EFXB 2HVBA 3LNGA 5E4EB 4ZS6C 3U4AA 2XQYG 4FMVA 1JPTH 2DM4A 4OKDA 5FA3A 1NFDA 4EO5A 1N18A 4M3KB 1CFVH 4N0FA 3EDJA 4TQIA 5D7EA 5E9DA 5KYUA 4OZIF 3KPSB 3QRGH 2NYZA 2XV6B 2WN3A 3WNNA 3N43B 2BO0A 5ICYA 2W60B 3MCLL 4RISL 1C1EH 3BZ5A 4X7SH 4OZHF 4R7NA 4MAUL 2IAMB 4XAKE 3GSVB 4D3CH 5J12C 2VAJA 1KBGL 4MA1C 4MJ5B 5I6XC 5AALA 1HI6A 3CZNA 1X7QB 4WFHD 1RK1B 4L9LB 3NH7L 1C8PA 3LHPH 2IPTL 4ELMA 3P11H 5LBGA 4PUBH 3U7WL 1MEXL 2PTTB 4P9HC 3QWQB 3OSVA 2D2CC 1VFAB 1XVSA 4F80A 5K9QI 2LV4A 4F7CB 2VUKA 4N20A 1S7VB 3AFLA 1ZA3A 3KLKA 3GI9L 4N9OB 5SWQA