3E6FB

Mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pa9, from the human immunodeficiency virus (bal) envelope glycoprotein 120
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
MQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title Different vaccine vectors delivering the same antigen elicit CD8+ T cell responses with distinct clonotype and epitope specificity
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e6fB00
5IK3A 5SV3A 2NXZC 3HPLB 4K7PY 4U7KA 1GOGA 2LU7A 3GSWA 4NRYB 4YHIA 3GBNL 1A7RL 4F7MA 1KIPB 2AQ3A 3TFKC 4J23A 4P23B 4PJGB 1A3QA 1MFCH 3IJSA 1NPUA 1QBBA 4XP4H 5DK2A 1CLOL 3RA7L 4P9MH 3WFZA 1P7QD 5C0BB 4JDVB 1NCCL 3MRRA 1FSKB 3RU8L 4JY5L 1T1WA 4LRIA 4HLZG 3RVXD 2Y36L 3FO1B 2EEAA 1HILA 4M3JA 2BHZA 3SDCC 4PBWD 5EN2A 4OUUA 8FABB 4OLZH 2BY0A 3N9GH 3B9EA 4J4PC 5DZLA 1I4FA 1XR9A 5TDNB 2JJUA 1N5AB 4XNYL 5IOPB 3KPNA 2RJMA 4F58H 1MHPL 1BJ1J 3DUSA 5LGJB 3UTTA 5IMMB 4PR5B 3TO4C 1RIHL 4MCZB 1HINH 1Q1JL 1YUHA 1G7HB 3FAWA 2NX5E 3DUHA 4JDTL 4HUWA 4U1NA 4HFUL 1KPVB 5ACLA 5D1QB 4Z0BH 1PKQE 4I9WD 4GAGH 2FR4A 1W8OA 4MNQE 3MGTB 1XGTA 3L3GA 1Q9OB 3JWNC 1XF5A 5C0GB 4MB3A 1OSPH 4Q9RH 4ISVB 2EKSB 2UZIH 1RUML 3FQXB 4F57H 1P5VA 2HJLB 4ZS7L 4POZD 4XCYA 4PTUB 1RJLA 2A6JB 1NAMH 1NMAL 1W0WA 2I26N 3VFTB 1E6JH 4WU7A 1IBGH 2H26B 4NQDE 1H3TA 5C0CB 2DLHA 4JHZA 4G8GD 5DRZA 3ARDC 4N8VA 4JFHE 1OAKH 3HCVB 4I3GA 4Q97A 2YD2A 5LVEA 1G7LB 1MPAH 1JE6A 1UXSB 2ZG1A 3OL2A 5EUKB 2F19L 3BQUD 3OB8A 4Z7VE 2FJFA 3DROB 5AD0A 3QXDB 3G04B 5J1AB 3IDJA 4HS3A 4UQ3B 1WVZA 2X5PA 5ANMA 3C5ZC 1V3LA 1SM3L 3S37H 1IC5L 3BW9A 2WP3O 1JZ4A 2VUYA 4MQ7A 3VGGA 3NH7H 2VXSH 3O6FC 5GS0H 1EO5A 4B7LA 1HZHL 3VFVB 3S36L 1FL3B 1T66D 5B3JE 2FX9L 1G9ML 4CN6A 2F53D 4FG6D 4UTBL 3UPAA 1BLNB 5KSAC 1FVCB 4RFOL 1Q94B 5KG9A 1WCQA 2B5IC 3PGFL 1F00I 2WQ8A 1UM4L 3MRBA 3BZFB 2IBGA 4XCCL 3DMMB 2YUXA 4JO3L 1IEAB 5CCKH 3VW3H 3S7GA 4XPHH 4KAQH 4U4BA 1BOGA 5IBLC 4TNWF 1GCFA 3DETC 1IKNC 2QSVA 4IIQB 4J3UA 5D8JL 4YAQA 1JGEB 5HPMA 2Z92A 3RGVA 4OCNC 2C3HA 4BSJA 3KDMA 3N1PC 2DQEL 3MR9B 1K6QL 3LB6C 5F9WB 4HG4K 4OCYH 3A67L 3OV6A 1RIVL 2D7QA 4JFDA 2UUDH 3CX5J 5I66B 3UX9B 3S36X 4KI5F 4PRHA 3GSXB 4XNXL 2A77H 1KIUA 3HC0A 2IPKB 4HAGA 3NCCB 4JRXB 3T4AB 1EO8H 3P2TA 5J12B 4AM0B 3QEGH 1KYOJ 2AXFA 2J8HA 3SE3A 2D31A 5DJYA 3DECA 2GAZB 2NXZD 4LSPH 3D69A 4C56A 3O3EB 2YPKB 4NJAH 4JHWH 3RWHB 1Z5LB 1TQCC 4P48A 2DTMH 2XG5A 2AEPL 3O8XB 3FQTB 2YMXH 5FXCH 3E6FA 1OGAB 4X80L 1SY6A 3C8DA 3UJTL 5JTWA 4HWZA 1OTTC 4JAMA 2VDOL 2YXMA 1NCWH 2QADC 5F1NA 4YDVA 1F6FB 1N2RB 4OBSA 2EKJA 2R0KH 4XHJC 5CUSH 3S4SG 5MERA 2X4OA 1T5XA 5TE7L 1XGRB 4XCNA 2VLJA 5IIEA 4OCSH 5C9KA 1ZA3A 5I9QC 2AK4D 3KYMA 1CLZL 5IQ9B 4ZOAA 3HB3D 1GAFH 3BUYA 5LWYL 2RHEA 4DN3H 4ODVH 4LRNL 1OAXH 1OAYL 2OQJA 4DTGL 1UWGL 3I9GL 3WHE1 4LCCC 1NMCB 1B2WL 4Q0XH 2H9GA 4QHKJ 1IQDB 2P7TA 5DHYB 3VFOA 1JHLL 1S7UA 5F88A 3ZE1F 3FCTA 1RUPL 4Q9QH 1NGZA 3EFDH 4HC1L 3VFRA 1JK8A 3NIDE 2F74A 4CAGA 3L5JA 4M9PA 3B83A 1FL5B 4GMSL 2YRLA 5IMOA 4Q2ZB 2R0ZH 4OF6A 3QIBC 1JFQH 3HE7B 4U49A 3VXTB 5KTEH 5A2IH 5EU3A 1BZ7A 3MYJB 3DV4B 2BVQB 3Q1SH 2JCCF 1CN4A 4X7TB 1B90A 3OAYK 3V0VA 2EH7H 1BJ1H 1LO2L 4HCRL 5A3IC 1CGXA 3ARDD 4G6JH 5L2KA 4JM4H 4TSAL 2QEJA 4AENB 4BSWA 5D1ZA 1A6WH 1F3RB 3H8NA 4PGEA 1J1XL 1EXUB 3Q5TA 5DJDA 3RZCB 3GKWL 2DI9A 3P40A 4PJCB 3O4OC 3QEUA 5DD0H 4YWGL 4ZDHB 3WL9B 5I17A 3GJFH 2KZWA 2DLFL 2ZUQC 1TLKA 3EO0B 1SJVA 4PJAE 1PY4A 5CKGA 4OCMC 4R7NB 1KCUL 3JXAA 2YD7A 1JGVH 3RNKB 1CL7L 1CGTA 3S34H 5SX5K 3STLA 3QUMB 5DSCA 3RKDC 3VXPA 3EYVA 3EO1A 1PLGL 3RIFK 3GI8L 2JJVA 2V6HA 2WMPA 1NMBL 5EU7C 1NEZA 1PBYA 3NFSH 2WK2A 43CAA 4FFYL 4FXKB 1FO0B 4U1GB 5GGSY 2DMKA 4OQTH 2Y72A 1S7RB 5IMKA 5F9OH 3DX9B 3L7EA 4NNYA 4R97B 2NW3A 1DE4B 5JW3H 4FQLH 4Y5YA 3GMQA 4LKCA 1ZLWK 3H9SB 1TCMA 4NOBA 2BMKB 1HKFA 1YMME 4MJ6B 3DETD 4E0RB 3VG0H 1INEH 2P8MA 1G7PA 1KJVB 4ZYKB 1HWGB 4KPHH 3QB7C 3I6KA 4EOWH 1JF1B 5GRVL 5FHBL 2C3XA 3CH8A 4HJGB 4CNIA 2K7QA 3CMOL 3IAQA 1OB1A 3A6CL 4Z0XA 2JB5L 4JJ5B 2OK0L 2E7HA 4KVCL 1YNLH 4RMRA 2W1NA 3RGVD 5D7IA 1SVZA 1N4XH 4JPKH 3VFPA 2F58L 1BD2E 4X8XA 1ULVA 5GGSA 3FOMB 5B39A 3IF1A 5CGTA 3ABZA 1A3LL 1YEJL 5F9AC 4JFDD 4WI8A 1DLHA 1IAIL 2FIRT 2R9HD 3S9DB 5MHSE 4PRHD 5CJOL 1CE1L 3TLRA 3MA9H 1EPFA 2FIKA 1JP5A 5FYJU 2ADIA 3DHJA 4CMMB 4GG6A 4U1HA 1FZJB 1C5BH 2BOCA 3TVMC 1OLZA 2XZQH 3PWUB 1C5DA 4RAUA 5HGDB 3L5WB 3KLHC 3QIUA 1DANT 1DZBA 3FB7A 2HFEA 1E4XI 1GGTA 5JA9A 1SBSL 5C09B 4FHBD 3L3IA 4Q9BA 3GBNH 1NKOA 4FQQB 5JQHC 4XHJD 1F58H 3P77B 4XC1L 4P3CL 1FN4A 3OKMA 4P46A 4C58B 4ENED 4RFEB 1F11B 3UEZA 2K1MA 3JWOC 1CLOH 1SVCP 3RA7H 3QUML 2CKBA 4QTIL 4B7IA 1NCCH 5DI8B 4JFFE 3LKOB 3RU8H 1VB9A 3ULSB 1QRNB 3MSPA 3AAZB 2A9ML 4FQCL 4QHNB 2HTLD 2EDQA 1FO0L 4M4PA 2PO6C 3K0WA 4PJ5E 5JIHA 5GXBB 5MENE 4U0RC 1C8PA 2MQ0A 1L0YA 2VLJD 1MWAB 4H0HB 2IAND 2QR0A 4XNYH 5F1OB 2E7LC 4ZUWB 1XIWC 1KLGA 4UDUB 2RB8A 3K4AA 4JE4B 5EUOB 2B4CL 3SY0A 3RWFA 3IRPX 3V6OA 3ARBC 5D71L 3VXQB 3RNQB 2WANA 2VDPL 1RIHH 3RL1B 3OGOE 1Q1JH 1EAPB 3QH3B 5BQ7B 3OJVC 2BNQB 1NCAL 2JJTC 3QIBD 5GGTL 2Q20A 4HXAL 1JYVA 1NBYA 4JDTH 2NXYB 1MRFL 4WCYL 4HFUH 2VISA 2Z8VC 2D7MA 3HR6A 4CL7A 3PWNB 4X7FC 2A0LD 5E6IB 1T04A 2QV2A 4PLKC 5L2JA 3DX8B 5C0AB 5DJAB 3X17A 3T1FA 4TUOB 3TZVC 4OFYA 1RUMH 4N8VG 5ESQA 3WLBB 4ZS7H 1EVUA 3VGAC 2FJHB 1QP1A 1NMAH 2XZAL 5ICZA 3G08B 2ZOLA 3BKCL 1M7IA 4P2RA 1U8JA 4U1JB 4PJHB 3AY4C 2PYEE 2I25N 2XFXB 5HHMD 5L2KD 1PY9A 4ERSL 1J0HA 4X4ZA 3AM8A 1SBBA 2CKNA 2F19H 4LHUB 5EZLB 4ODTL 1JMXA 2BXYA 2W0KA 3L3DA 4M5ZL 2DQJL 2Y5EA 5D1XA 1SM3H 1NUFA 3I3EA 1IC5H 1WFNA 4LQ1A 3IDUA 4KKLC 1QSEB 1DUYA 4M7JH 3DRTA 3EYFA 4GBXB 5I1EL 2X4SA 1HZHH 4HUXA 5A2LH 3S36H 3H9ZA 4EI6B 3OKNA 1A64A 3U6RA 3BEWB 1ORQB 3ZKXB 4CMHC 5DJCA 3HA0A 3C8KA 1F6AA 1G9MH 4AJ0A 4UTBH 3RY4A 4RFOH 3O4LA 3I75B 4XBEL 3SDDA 2FSEA 3C5JA 4NRXA 3VRJB 4PB9H 3PG2A 1MWAL 3LMJL 1PZ5B 4JO3H 2XKNA 1BQLH 2GJ6A 4JN1L 3KPSA 5E7FA 1YEEL 1VACA 1A3RL 1T1YB 4X6CA 3G9VA 1HHGB 1MCDA 2OXGA 4JO4L 5BOZG 5D8JH 3MRFB 2X2YA 3UP1A 4JFPA 4JRYA 4N9GB 5HYQB 3DVNA 4R3SA 4ODUA 1XF1A 5C0JB 4PRAA 3A67H 4UT9L 4H5SB 4J6RL 2W59A 3PIQA 4P23C 4P4KA 2PKDA 4XNXH 1T0MA 4QXTB 4ZOBA 2ADJA 3KLSA 5SX4I 5EO0B 1OPGH 2X40A 2HLAB 1FSKC 5AG8A 3CXHK 5IESL 1LNUA 1RZJL 3SDXB 3TVMD 4LKXB 3MRGB 5CD3A 1G9MC 1MI5B 2QHLA 4N8PA 3KLHD 3OAZH 5BVPL 3V2AR 5AUMA 1IGJB 4L4TE 3MBEC 5H2BB 3D5OF 4HZAA 4JQVC 1JBJA 2CLZB 5IMLA 4X80H 1DLFL 1DQDL 4U1MB 4EBQL 1Z0MA 1CD1B 4HW6A 5HJ3A 3H9HA 1NFDB 4JPWL 3P4MB 5B8CC 3BOVA 5HGHB 5GGUB 2VDOH 1SYVB 3IVKB 5D7SL 5CEYB 1KT2B 4L4JA 1AD0B 1CD0A 1J1PL 5KS9B 3QQNA 4N90D 1KB9K 1U8IB 4P46D 2H2SD 5D1QC 3ARXA 5TE7H 2P5EB 3GUTA 2GQHA 1F4YL 3WEXB 2BSRB 3MGOB 1JWSA 2IQ9H 3WS6A 5H37H 4Z7NF 5F96H 2ATPA 3DIFB 5F1IA 5T1MA 2YD1A 5LWYH 1OTUC 3ARBD 4MAUL 2HRLA 3U7YL 3QDJE 3O45A 5DFVC 1BBJB 2BSED 4FQHA 1UWGH 3I9GH 3MOAL 2ZSWA 4MJ4A 5IJVB 3W11D 2FGWL 4LCWE 4PJXF 2DM3A 1VERA 2J8UE 4NO5B 1RUPH 5IG7B 1LP9A 2FO1A 4HC1H 4KI5E 1U8LB 3ES6B 3EYUL 3GSUB 4OM1H 2H6PB 4PLJC 4GMSH 4JR9L 1FFOB 3W0WB 4OKVA 1ZS8A 4HKBB 3TZVD 3MLZL 4PRBA 3EDDA 3BIKA 5ADOL 2QQQA 5HYJD 4YHML 2PTTA 3OB0H 1RK0A 1ZWIB 4L8CA 5J89A 3L3KB 4Y19A 1V5JA 2XQYK 3BP6A 1NCDL 2BC4B 2R23A 2ZPKL 5FDYA 5ID1B 4YK4B 1LO2H 4HCRH 4F7PB 5C71A 3TWCL 4PJDE 3STZA 4TSAH 4OFYD 3GMPA 2DN7A 3BYTA 1U8MB 3MRIB 3CFJB 4MX7B 1R5VA 2IBZX 1J1XH 3JV4B 4OT1L 6FABH 3V5DA 2V17L 3GKWH 2PW1A 4P2RD 1EV2E 3OTTA 1ZGLA 1NGYB 4G7VL 4UV4L 4EXKA 2UY7A 3VD4A 5FOBB 3DMMC 2DLFH 5F3BA 1Z0NA 4LDLB 1D5MA 5K59F 4K71C 5DD5H 2CIIB 1BECA 1D3CA 1KCUH 1CFTB 4WI2A 4IIQC 4GXVL 4PP1D 3DXAA 1PLGH 3LRHA 1HH6A 2ENYA 3OKOA 2ZZUT 1UCTA 4XC3L 5I1AA 5HDBF 5F9WC 3PABA 3LKQB 1IC4L 5TDPB 4ELKA 3S96B 5HY9B 3E8UL 4FFYH 4HX1B 3MLSL 5KSVB 3LEYH 5E5RB 2VAJA 3Q0HA 2HFGL 5DTFA 2KPNA 2VDNH 4KH2A 4EI5B 3K2UH 5J12C 3BGFB 5C7XH 2NY1D 5EOTB 3ZE1E 1S8DB 2ED8A 1A5FL 2G5BB 4DGYH 3S5LA 2E9IA 3QEQE 1KXVC 3SDDD 5F89B 2ERJC 1K4DA 4PJGE 5IVZA 1QSFA 1QG3A 2ICEB 1HSBB 2L0DA 3U82B 1Y6MR 3KPSD 3PUCA 3VFGL 5I1DA 1K3ZA 2DYPA 3CMOH 2X4QB 3ARYA 3O8XC 3A6CH 3C6LA 2JB5H 1C12A 5DMKB 5D70L 2OK0H 3UJIL 5D5MB 4WHTB 3RQ3A 3QFDB 5C0BD 4TRPH 4JRYD 2F58H 5F44A 5GGRB 1MCIA 1A3LH 2E6JA 4I3RL 1YEJH 1LO5B 5EU4A 4NO2A 1XF3B 1IAIH 5CJOH 3M8OL 1CE1H 4YQXL 3D2UA 4LPUA 5BO1H 4WNQA 4HIIB 3MBED 5EULV 4XNQB 1CXFA 2DIBA 5TQ2H 1T20A 4LASL 4LEOA 1CR9L 1S9YB 5CP3H 4KK6C 4YHPB 1F90L 1OOAA 3RX8A 1CFNA 2DQFB 2NTFA 3LQZB 4JEGB 4G6KL 1NMCC 3IJHA 4NT6B 1FHGA 3E6HB 4JVUA 1GH7A 1OM3L 4ZFOA 4P3CH 1HHIA 4BQBA 4R4BA 5D1QD 3K4DA 5CZVL 2D2OA 4M62L 4MNHB 3QUMH 2BSTB 1BWWA 1KCKA 1YC8A 3BGAA 1JTTA 5SWZA 1BFTA 4D9QD 4HKXA 4JFOB 1GC1H 1BAFL 5IP4A 5C0CE 4FQCH 2UVFA 3UDWA 1N3NB 1PJ9A 1OTSC 3T0XA 4GKSB 1AGCB 5FA4B 2FX7L 5TQ0H 4YZFF 1AXIB 2VITB 4YDJB 1Q9WB 3G5YB 3VD9A 1LDPH 2NNAA 4H25A 4NRZB 3MOBL 3S98A 2VDPH 3HRZB 2EDTA 3BDYL 3WNOA 3RTQB 3RZCC 1UG9A 4PLJD 1Y18A 5BS0A 3O6KH 5FGCB 1D9KB 5GGTH 3MRMB 4Z77A 5ESAA 3FO0L 4HXAH 4K7FA 3VXMA 4DKFL 2CDEA 4WCYH 1MRFH 2HJKB 4HWNA 5IWLC 1MAJA 1BEYL 2C1OB 4I0CC 1Y0LA 2ZUTA 4PJ9A 2IH3B 3F58H 1FAKT 3BMWA 2V9QA 3X3GL 4HMEA 2AKRA 3FN0L 2VDLL 4L3CB 1AQDA 1GGIL 5IB3A 4U1GC 1BX2A 2XZAH 4ZTOL 2ITDA 4Y19D 3BKCH 5K33A 5CJXC 1UH4A 2BP3A 4NQSB 1I3GH 4RZCB 3WIFA 4ERSH 2AXGB 4X4YB 2B4CC 1PKQA 1YEHH 3IGAA 5C0FA 4OGXL 3RP1A 1JZ5A 3FZUC 3NVQA 4ODTH 2FEDC 1F3JB 4HDIA 4E41B 4UDTA 3PV7A 4KZEL 1LEGB 5SWQA 3UTSA 3RWJB 4CU8A 2DQJH 4KUZL 3SDYL 1K2DB 1KTDB 2NY0D 1MVFA 2YPLA 4LBEA 3L6FA 4NKMA 3VXSA 1P1ZA 4JRXE 4UT7L 1HXYB 4NQDA 4HKZB 4M48L 4NO3B 5I1EH 1TXKA 3RY6C 3LD8B 4WTZG 4GUPA 3DXAD 1OARL 1JN6A 4WY7L 3NZHH 2FZ3A 3MACL 4RBPH 2BNRA 5FYLH 3RHWF 4Z7VA 4KMQA 2XN9B 1NGWB 2JK5A 3ZDZF 3AS0A 3FN3A 4XBEH 5FGBA 2Y7QA 1BQSA 1OGAE 4DN4H 3IDYB 3LMJH 3VGFA 5E7BA 2GW5A 4JN1H 2VABA 2DIAA 1YEEH 3WFCL 4HT1L 1A3RH 1PZUB 2DICA 2QSCL 4TVPH 5D2LA 1EVTC 4AEHL 4D0DB 4P3WA 3F12B 2X1PA 4JO4H 3RIAF 3VRIB 4HJJL 3D1MC 4YUEL 4PJFA 2IPTL 1QSFD 1FZMB 1MQ8A 2X9WA 4UT9H 2DYPD 1A2YA 2NPLX 3MRLA 3EBAA 3C6LD 1UH2A 5IFJA 3D0VB 1HQ4A 1UCBL 3REWA 2O61B 3KPQA 3FTGB 3DVIA 2C7UB 4HHAB 4EQ2A 5IESH 5J9PA 4X9BA 2NY4D 3R4DA 4PV8A 4O00A 4P2QB 2WBKA 1QLEH 4KK6D 1I7TB 3FT4B 3N1FC 5FYKL 2I5YH 1LE9B 4S2SB 4ZTPL 5JOPD 4JY6A 3D2UD 2X4UA 4NQEE 3RUGB 1N64L 4YGAB 4QWWD 1U8KB 3MV9B 1OW0A 4MWFA 5DEFA 2CK2A 5KSUA 4XVTL 3HAEG 4FZEL 1FL6A 4EBQH 4JPWH 4TUJB 3EHBD 4IOIB 5HDQL 3T4YB 5D7SH 2ID5A 3F6IA 2DQGL 2AV1A 1T3FA 4ZS6D 1J1PH 5J3HC 3MRQA 4D9RD 2NXYC 3AS2A 4MDIB 1J10A 1BVKA 2XTJD 3KWWB 4TULL 1OTSD 2V2TA 5E6IC 1F4YH 1R3LB 1EGJA 3L3OA 5E4EB 2MFNA 5HVWA 5E1AA 2DJUA 4JN2B 2X4RA 1PFCA 4PJCE 1I3RB 2AJZA 4WFED 4NDMB 1RZJC 4P5MA 5I8CA 4PRDA 1R3HB 1AC0A 3GMRB 3U7YH 1J8KA 3HMWL 4H1LB 4RAVA 1TVDA 4X6DB 3UO1L 4ODXB 4OGYL 1WAAA 4M8QA 5IROC 5C08B 1K8DB 4WFGE 3QXVA 1JWUB 4L8SB 3DI2B 1E4XL 3MXWL 5FYJH 5BZDA 4I18A 4ETQB 5I1LA 5A16A 1AFVL 3EDFA 3V8CA 1C08A 4U1KA 1U3HB 2NLJB 4QHMA 4X7EC 1WITA 5BS0D 1X5LA 2XWJA 1JUFA 3VXMD 1IZJA 3S3SA 2AI0L 4DUXA 2A83B 5KW9H 5JW5B 4S1RH 3H0TA 4PJ9D 3H9SE 4Z7WB 1NCDH 2ZPKH 4GBXC 5EBMA 2DMBA 5DC0A 2ATKB 3QNYA 3TWCH 3UPRB 3OJDA 3G9AB 5T33H 4OT1H 2Z31B 4GRLB 3FZUD 5FK9B 4G7VH 2YXFA 4UV4H 2YR3A 5C70A 3SKOA 2P24A 1TZIB 1Y6NR 3PDDA 4PRIB 3UTOA 2VJXA 3H3BC 3CDFA 4GW5A 1A9EB 4N0RA 3KXFA 1JPSL 4GXVH 4NPYB 1FDLL 2X42A 3FQRB 5ETUB 1TVHB 4DK6A 1TNMA 1I3UA 1QLRA 3DYPA 4B41A 3CSYB 5GQBA 3UTSD 1PW3A 4Z7NE 3U48A 4XC3H 3U83A 1R3JB 1AXSA 2YPLD 2BK8A 4Y88A 3VXSD 1YEIL 3MNWA 4LLQB 4OLEA 3MLSH 4IHOA 1FORH 3NMEA 4XPBL 2Y23A 4X4XA 2HFGH 5K9JL 2I07A 4PJXE 5MEQA 3B6SA 4PJBA 3O6ML 2Q8AL 5DA4A 1U95A 1A5FH 5C09E 1ZGLM 2BNRD 4XMLL 5JMRA 4LPWA 1CFBA 5JZ7D 4G8EB 3AUVA 1QSVA 1NAMA 3G5VB 2EDYA 2MQCA 3SO3C 4X7SL 4NZJA 4J3SA 3GK8L 4KJWD 3HUJF 3TBSA 3VD5A 4WUKL 3DO7A 2Z91A 3M07A 4OLWH 2E3VA 3GJEB 3K1DA 5D70H 1QRNE 5CBAA 3UJIH 4X99B 4U6XA 2XQYG 1H8NA 4LGSB 5D6CB 5IEKA 3KPPB 1I8KB 5C0RL 5FYLE 4I48A 3DX6B 2YS4A 2X6MA 4I3RH 3SKMB 1S5HA 1RZIB 5DEGA 3GSRA 1A6AB 4PFEA 3WN5A 1TZGH 2Q8BL 2OTPA 3M8OH 1A6UL 5EUOE 3UTPE 4TVPE 3T2OA 3C60B 2Z35A 4YQXH 4EKXA 2WNGA 1IGYB 3VWJB 4O2CB 2IAMA 4HLZH 2NYYD 4L8DA 3IB4A 5C07A 1JGUL 1IM3A 4LASH 1CR9H 5K59E 2BCKB 1QO3A 3CDGA 3QRGL 3WBDA 5JOFA 1F90H 1G7MA 3P4OA 4G6MH 3WXVH 2BNQD 1ZEAL 4G6KH 3JWDL 5F7LB 5J56B 1MJ8L 5C0AE 4ODHL 5HDBE 1OM3H 3DX7A 4EIGB 1KELL 4NP4H 3T3PF 4M7LL 5D7JB 4AH2A 1TDQA 2YA1A 5CZVH 5ISZD 2V5YA 4U1LB 4G42B 2AABH 4OIAA 4DUVA 1WF5A 3WCYA 4PYGA 4OSUL 5KSBA 1BAFH 4PJHE 3ARGB 1YPZB 4NQVB 4WUUB 4YHOH 3JTTB 5GS1C 1HHHA 5ESVB 3ZKMD 1R24B 4YK4C 1QA9A 5FGSA 4O2EA 2XIDA 5JW4Q 1E0OB 3MOBH 5IB2B 1XCTB 2VXTL 3BDYH 1J9CT 1JZ8A 1NJ9B 3LKSB 3HR5B 2PF6A 2QKIB 1QSEE 5IHZB 2XWTA 3W39A 4ZFGH 2C3VB 3FO0H 4DKFH 2ZNXA 3ZYZA 2QQNL 4X5XA 4HULB 4J8RA 5ID0A 1J05B 3AREB 1WZ1L 4QHLA 5I8OL 3JTSA 1HCFX 4GBXD 3X3GH 1R6VA 4OD3L 1K5NB 4KDVA 3P30L 2B8OT 1AO7B 3FONB 3WD5L 2OTUB 3FN0H 2VDLH 4OCWH 5IFHL 1GGIH 3WLWD 4ZTOH 5T1LA 4RAHA 2R2BB 3X3FL 2AP2A 1JTOA 1MCWM 2PUQT 3OGCA 2YEZB 5FYJE 4KXZI 2PR4H 4C59B 5EWIL 3R8BB 3LN4B 4OLUL 4EI5C 3BGFC 4X6DF 1J0JA 2ITCA 5C0IB 3S3JA 3CFDA 4NZRL 4PLNC 3V95A 5HYSG 4PJIA 1VFAA 4FA8A 4OGXH 4WO4A 5IFAL 2OP4L 2FECI 3PWPA 5SWSA 3D3VD 1KENL 2AW2A 3RPKA 2OZ4H 3T0AA 4M61A 4WW2F 4KKAD 3SDYH 4H20L 5JPNA 4X9GA 1DDHA 1A22B 2W07A 3ESUF 4CRPA 5INCB 2XA3A 2FHBA 2J4WL 4I0PA 4UT7H 3HZYA 5I1IL 3KXFD 4R2GB 5FO8A 2PXYB 4HV8A 3LHPL 3CCHA 4M48H 5CEXB 2PYEA 3GMNB 2AJUL 3CUPB 1MI5E 2YC1A 4V1DB 4YZFE 2B7DT 1D5ZB 3JBG7 4KHXL 3MC0A 1OARH 1NUNB 3BKML 4OI8A 4PP2B 5F1KC 1DL7L 3MACH 4IOFC 3MRJB 3P9MA 3U0TA 4E42A 4PG9A 5IB5B 4HUKB 5C6TL 5JW4M 2LV4A 1OP5H 5ERWB 3ZKNC 1KJ3L 3M1BA 2X10A 1NFDE 5CHNA 3WFCH 4HT1H 1JYXA 3SE8L 3LPWA 4UOW0 3OQ3B 2QSCH 4AEHH 1N7MH 4PG2C 5CBEB 2APFA 3PWVB 4JG0H 4OCXH 4U3CA 3MLPA 3HZMA 2GTWA 4HJJH 4YUEH 5DD6A 4JANA 2IPTH 3L5HA 2P5EE 3RVUD 5KZCD 5GGQL 2PCPB 4H26A 3GJFA 4MD0A 2OI9C 2XQBL 2R29L 1FZOB 3BWUC 3PP4L 1MJ7L 5INDB 3W9EA 2D7TH 3I6LD 1XF4A 4P4RB 1WUNT 3ZT5A 2VXUL 4F2MB 1UCBH 3TPUB 1L0QA 4NHUA 1K3IA 4QLRA 2R2EA 4BSVB 1PVHA 4JKKA 4LCYA 3QQ3A 2AJSL 2ZG3A 1KYOK 1JF5A 1OWWA 1A4JB 1A4KA 2NY2C 4M43H 2X4NA 1J8HB 3ESVF 3KYAA 3SJVA 3RVVD 4ZTPH 3NFNB 4XI5C 2KDGA 5DRNB 4JM2A 4Y4KA 2IAMD 3BH9A 4QHUA 5C07D 4XVTH 4FZEH 3W0WE 4IMKA 5KOMC 5E24E 4O58L 1ZT4B 4C55A 3CDCA 5TPWH 5HDQH 4HIJA 3U2SB 4H88H 2DQGH 1D9KC 3P4NB 1BGXL 2CLVB 5HI4D 1JPTL 3O2WL 4L29B 5F71A 5MHSD 1KLUB 4TULH 4P5KA 4S1QH 3CFBA 2BXZA 3QUYB 4L4TA 2A6KB 3Q6FA 8CGTA 3HMXL 4S0SD 1NFIB 2LAGB 2V5SA 4PV9A 3P0YL 1RJYB 3WJLA 3I84A 1DN0A 3WIIH 4IRJA 3PV6B 3PDGA 3NCYS 1X7QA 4YFEA 1HI6A 4B0MM 1CZ8L 2WSKA 4WGVB 4ZFZB 5D7KE 3SQOL 3KYNB 4LVOC 5EU6A 4OGYH 2J5LB 2LTQB 4N8CL 3BISA 1UKTA 3HNSL 3K8LA 5DFWH 1E4XH 2GITA 3FB8A 3MXWH 5IF0A 2VQTA 4AL8L 4XH2A 3O81A 1AY1L 3T8XA 2Y25A 3U30B 1UEMA 1QFPA 4AMKL 1WFTA 4XNUH 4XVSL 2MSPA 1D6EA 3QBTB 1MHEA 4C57C 2AI0H 3QDJA 4BZ1L 5EO1A 1S9WA 4U2YA 4UNUA 3I2CL 3ZT6A 3QULB 3QIWB 3MJ8B 1YPZF 3FFDA 2IF7A 4L9DA 3LD8C 4GLRH 3FRUA 5CAYB 1KPRA 3ARWA 1H3VA 1I8LC 1KIRB 3HFML 1IGTB 4O2FB 4L4VE 1L6ZA 3B9DA 2G9HA 3IDYC 3C08L 2GY7B 5DUBA 5D5ME 4IMLB 1G0DA 4JY4A 1IGML 4BA8A 1FC1A 5C0NC 1IGCH 4WO4D 1TVBB 2VR9A 1FDLH 3OWEA 2EDBA 3PWPD 5SWSD 3QFJB 2OTWB 3HI6L 3KLAA 5DJ2A 3MO1A 1BJMA 5L0QB 3ARSA 3QEHB 3DOSA 1A8JH 3QDAA 1M1SA 1S7XB 4IOFD 4NSKA 1YEIH 3TN0B 4WWID 3PNWB 2X89A 1OAUH 4JREB 3LPFA 3G6JB 1J0ZA 4HK3J 4RISL 3UAJC 1NUGA 3TCXA 4X8JB 1T0NB 1QBML 3JVGC 3KS0J 5F7DA 2R2CA 2V2XB 5BRZA 5E8PB 4JO1L 4NO0B 1LO4L 2Q8AH 2XY1A 4Y16C 2MCG1 1T83C 1F45A 1YMHA 2R1YB 4KQ3L 4UB0H 4H1LH 3QHTC 2B39A 1FH5L 3GMMB 5I2IB 3EYOB 4YIQB 1PX4A 3GK8H 4X9IA 5BJTA 3VCLA 2NY7L 3QZWG 4L3ED 3OXSB 4JZOA 2G2RA 2EYTA 3NCMA 4HK0A 4UIMB 2M8XA 4OI9A 3FQUB 1P7KB 3V6ZB 5DQ9A 4DKEL 4KFZC 4GT7A 4PGBB 3V4PL 3GMLB 5ALBL 3LRGA 3KAAA 4G6FB 2B2XL 2IADA 1VEOA 2NY2D 1J5OL 3C2SA 3IXTA 3QEQA 1A0QL 1KIPA 4HG4J 1XCQB 2Q8BH 1A6UH 4MAYB 1I85A 5E4EC 3IFPA 2SEBB 3SGDH 1FFPA 5F7UA 4JDVA 4NKDB 4MSWA 4TOYL 4NBXB 1JGUH 4XB7A 4DEPB 3HN3A 4NFBA 5FGCE 4EDXB 1PQZB 3BGMA 3QRGH 4NCDA 5DJ8A 2JCCA 3SJVD 2DI7A 3MXVL 1FNGA 4JCMA 2FJGB 2I9LB 1BFOA 5JIIA 1T1XB 1ZEAH 4JM2D 3JWDH 4Y4KD 5IJKA 4OZ4A 1MJ8H 1ZLVH 2EEBA 1LEKB 1KELH 4L8SC 3L9RB 1ZLSL 3U36B 2EIZA 5IOPA 1TTFA 5HYFA 1SEQL 4PR5A 4FABL 2OS7A 3VH8G 1FCGA 1REIA 5DYOB 1U3HC 4DCQB 4XZUA 4L8BB 5DK3A 3F7VB 1BWMA 3GBMH 1GZQB 3PQYA 3SE9H 4RWYL 3MV11 1GRWA 1YEGL 5FAAA 1FVDA 5DK0B 2ESVE 5FYKD 4HGKC 4LSSH 5GRYA 3DUUB 4BK4A 2VLRB 1ADQH 3OB0K 4YXKH 3O3DA 1EMTH 2JB6B 4TTDC 1MFBH 3PGDA 4GRMA 1MEXL 3C6SA 3MNZA 4E41E 4PS4L 3MFFB 2VXTH 1FNLA 4PTTB 2Z31C 4GRLC 3H7BA 3U7AA 1VADB 5TE4L 5AYUL 5B38A 5AAMA 5C3LD 3EOTL 5EU6D 2XT1B 2WINA 2RFXB 3JWDC 3EOAA 3X13B 1EO7A 2PW2A 2ICWI 2R1WB 3D6GA 1WLHA 3DSFH 3MPCA 1ACZA 2IG2H 2QQNH 4H8WL 5I8OH 4Y4FB 4OD3H 2DS4A 3P30H 2XN9E 3WD5H 4UQ3A 1M4KA 1OWRM 2YHGA 5FKPA 5TF1L 5MEPB 5DHXB 5FB8B 3HZKB 1MCJA 1KG0B 4JDZA 4OFPA 1Q0XL 4QY8A 1KBGH 5ACZB 2LABA 1Z9LA 4MJ2A 1ZLUK 1IEBA 3JUYA 5EBWB 1DSFL 1FL3A 4IRZL 4DK3A 3UTZB 1VESA 5C0ND 1LEIA 4HGWA 3EDJA 3T3PE 5TGBB 1JNHB 1QOKA 5E8EB 1FVCA 1KENH 3ULUC 4CN4A 3NPZB 4JG1L 1PKOA 5DRXB 2OMBA 3ROLA 4H20H 4AIOA 2Z93B 1GXEA 5GRVK 5T3ZL 4KDTA 2HFFB 1C1EL 2P5WB 1F4XL 2J4WH 3RIFF 4HWBH 5I1IH 1YYML 1TTGA 3FO9A 4NN7B 4ZODA 4MCYA 4X6BB 3ETBF 2AJUH 4HC1A 2ORBL 4P2QE 2D4FA 3TYFB 3UAJD 4UILL 4KHXH 3TV3L 2FATL 1Q9KA 1QHOA 2J88L 1KN4L 4W4NA 4Y16D 3IDMA 3RUGE 4GW4A 3ARRA 3MLWH 3D48R 1QLFA 4Z9KB 1XFPA 2F54A 3MV9E 2X89D 4IBLT 4NHCL 4XGZB 3C60C 1BZ9B 1KJ3H 1MVUB 4F8TA 3VWJC 4DVBB 1FJ1A 2H2PD 3V6FB 1ZT7A 5BRZD 2Q7YB 4HCRA 4JRXA 4XAKD 3SKJH 1U8QA 1JWMA 1GL4B 2QSQA 4JPIB 1FLRL 4N0UB 1MLCA 5EC2B 1URLA 3DSNA 4R96A 4XXCC 2XRAH 4DJMA 2NCMA 5TF0A 4D0BA 2XQBH 1RZ8B 2R29H 4HK3N 3PP4H 1MJ7H 1KEGL 2V7NB 3O9WA 2X05A 4N0YH 5D93B 2VXUH 4NQCB 3N1GC 3KS0H 1A7NL 3M17B 1ZE3C 4MJIA 3T0BA 2Y5TB 3O3BA 2AJSH 3OXRA 4X6DE 1UXWA 3ARGC 3QEQD 3WDHA 4LLMB 2CK0L 2V5TA 5C08E 3EOBA 2QQKL 3BKYL 1ZHLA 1WCBA 1FE8L 1YY8A 4BH7B 4HUUB 4YPGB 4WHDA 2J6EL 4XRCB 3WIHA 2DQCL 1T7YA 1IMHC 4IS6B 2B1HL 1UKQA 1UJ3B 1QQDA 4RGOL 1XT5A 4O58H 2FHCA 3X12A 4X98A 5F1SA 3TM6A 1VEMA 4F9PC 1U41A 3ZE2E 1GZPB 1T7WA 1U3HD 4X6EB 3V8OA 3QDGA 1O0VA 4Z7WE 1IVLA 3LRSB 4YH6A 1CT8B 1JPTH 1I9JL 3O2WH 1JZ6A 4U3HA 3OZ9L 3T3MF 1SEBA 3E2HB 4Z7QF 5F7NC 4OFIA 1HXMA 4NQEA 5HHOB 5DJZA 5IM7B 4Y5XB 3U9UA 1GIGH 4CW1B 3HMXH 2X1OA 5T1DL 1RMFH 4Q2ZA 3T0DA 2ZKHH 3P0YH 3PQYD 3HE7A 3FB6B 2UWEB 4I0KA 1KTKE 4PRIE 4KJYB 4QRTA 1A6TB 2GK0B 1NBQA 3DV4A 2HG5A 1FFNB 4W6YB 3QPQC 1DQQB 4PRPB 3T0EB 1G7IA 1CICB 2G60L 5IVXA 4X6FA 4R4FL 4J1UB 3HNSH 2EYRA 1UWXH 2GSGA 4AL8H 1Q72L 2DQIL 1DQJB 4M6ML 1E27B 4CU7A 1AY1H 3CVHB 5JPMB 1LO0H 4ZDHA 2NW2B 2YRPA 5IBUG 4CUCA 2IH1B 5JXEA 4LCIL 5HHNB 4KQ4L 3WFEL 4BZ1H 5JHDD 3I2CH 4R2GC 2PXYC 3Q3GA 2FGZA 3ARFC 4LCUB 5TDOA 43C9B 4WV1A 1X5YA 4UV7L 3ZSSA 4M1DL 3QUMA 3THMH 3GSOB 1Z9MA 1P7QB 5I0ZA 2ILLA 5GRUL 1T2JA 1JPFB 3ROOA 3GRWL 4NKIL 4QRRA 1KIQB 4EJ1C 5I8KH 1AE6L 1GGCH 2EDDA 3HFMH 1CU4L 1IJ9A 4RBPK 1NDGA 3T09A 3ULUD 3MODL 5JLZB 2DQDL 3RWCB 3C08H 3HI1A 4WW1B 4HGMA 3OKEA 3Q6GL 3VDBA 3FT3B 2AEWA 1OLLA 2RCSL 4ZPVA 4KRPC 3GZKA 1CK0L 3ALXA 1CG9B 1MQKL 1ZHNB 3IYLW 4JZNB 3HI6H 2UVEA 2VAAA 1DUZB 5E6ZA 1P2CB 4LLUB 1CLCA 3DBXA 1UYWL 2VZUA 5TFSH 1QNZH 1I7UB 3PWLA 4MJ5B 5GGTA 5KN5B 2I60L 5J0BA 3LV3A 4JHAL 3FMGL 3F7YB 3BESR 5IV2B 5FDWB 3IU3A 4RISH 2JTDA 3GO1H 5D6DC 5BW7A 3CLEH 1NDMA 5E9DD 2CR3A 3W2DL 3OAUL 4JFEA 4JO1H 3SBWC 1LO4H 1RHFA 2VLME 3D39D 4NKOB 1EFQA 5JNYA 4FTVB 5BZWA 1M05B 3SGKA 5E94B 2F54D 1DBAL 1ZVHA 4MNGA 1ERNA 1FH5H 3LOWA 5GSRB 3INUH 3T65B 1FZJA 4G9FA 4YHKL 3BMVA 2NY7H 5T3XL 4G8GB 1A14H 3S97C 4OFKA 4Y1AB 3WKML 5KVDL 3A6OA 3QUKB 4YGVB 3CVHL 1A7BA 1YPZE 2Y6SC 3L5WA 5HHVH 2MQ3A 3BQUB 4PJXA 4DKEH 1FC2D 1U91B 3V4PH 4TUKH 4C54A 2EEDA 2B2XH 4EEEA 3RKPA 2DQTL 2V7HA 4DZBB 1J5OH 5EOQH 1A0QH 4WUUD 3IS0X 1YY9C 3DTXB 3O9WD 2X9YA 3QUYC 1U8PB 2HT3C 2DWDA 1N6VA 1JPGB 4MJID 4BFEA 2Q7NA 5DRWA 2HN7A 4TOYH 1CE6A 2ZUWA 3V9FA 5LJYH 3MJ7B 3LQMA 1ETZA 1QKZL 1ZLWH 4EVNA 1JYNA 1P4BH 4HKJB 4HZLA 4QHNA 3QDHA 1OD9A 3MXVH 2F53B 4GXUN 2CRYA 4CGTA 4C83B 4MQTB 2JJSA 2CR6A 2J5LC 2LTQC 4U6HA 4XXDA 3G5ZA 1F5WA 1ZLSH 1GPOL 5KVFL 1AO7E 1J1OL 1SEQH 4FABH 4ZAKA 3QO0A 1Q8MA 3NIFF 5D2NB 4R9HA 3U30C 1IARB 1EAPA 2KZ1B 4YDKL 3QDGD 3QWQB 3KPMA 4RWYH 4L9LA 2AJYL 3N1QC 3HPJB 1E4KC 4BKLB 3CC5B 4BQ8A 2CPCA 5C0EB 3MRDB 3FHQA 1KB9J 4G3YL 4CN1A 3QIWC 4NQED 4K07A 5KJRH 2W91A 3QPQD 4WFFE 3V4VL 4U05A 5LKNA 3KG5A 4M9OA 1PGRB 3RI5K 1QD0A 4OZFA 1RZFL 4EUPA 4PS4H 3WFBL 5JORA 1T89A 3ZKSD 1MCQA 1U8OB 3QUZA 4ESKA 3BH8B 3OPZL 3SEPA 1PG7H 1RK1B 4QHKI 5TE4H 3RWGB 4YHLL 4ODWA 4X5WB 3V7AE 4ZUVA 5HVHB 1CFVL 5CSBA 3EOTH 1KTLA 1AGEB 1UVQA 4LSQL 3PGCA 1WISA 1AKJB 3TBWB 2YZ8A 3MUGA 1K9TA 3ARFD 4H8WH 2IBZY 1T5WB 3W82A 4G9DA 3LKPA 4P2OB 4V1DD 3QWOA 3QDME 3W9DB 1KJ2B 4Z7UB 5JXED 5IK3B 4XCEA 2ARJA 3MLYL 1YDPA 3LKRA 3BDXA 5H37G 3SKNB 1EEYA 2AV7A 3GSWB 1H0DA 4YHIB 2WBWB 5IVOA 3TN0C 3VXNA 1Q0XH 4GAYA 4L5FL 1MNUH 1QSEA 4JREC 1UA6L 1V3JA 4EN3A 1F6LL 1DP0A 3IJSB 5DK2B 3ARTA 3WJJA 1MFEL 3MRRB 1FYTE 4IRZH 4R7DA 1F8TH 5I19H 4QRRD 3K8MA 1T1WB 3BP4A 4KRPD 4YX2L 4GG8A 2VR4A 4JG1H 2OBGA 2FHFA 1FRGL 5EN2B 4OUUB 4KROB 1CBVH 1I4FB 1D6VH 1XR9B 1RU9H 2HKHL 4RGNC 4JLRA 1NGPL 5T3ZH 3S88L 1F4XH 4F7EA 1YYMH 3KPNB 3ILQD 3GSQA 4YHNA 3DUSB 3CXDL 1RSFA 4H8WC 3MRFA 1ZTXL 1J8HE 1NCBL 1SJEA 3KPRE 3C87A 5B3NA 3TV3H 3U46A 2P43B 4FQXC 2DWEA 2FATH 4M6AA 4CVXA 2J88H 1KN4H 1JRHL 4HUWB 5DMJB 4U1NB 3K2MC 4MAYC 4NHCH 5E8NA 3VFUB 2HVKA 4OZIB 5C0DA 2FR4B 4RMUA 2NY5H 1XGTB 3L3GB 2P49B 4JFED 1NC4D 3WDIA 4LLWA 4DEPC 1DEDA 1XF5B 2W9EL 4ELMB 3RHWK 3ARDB 4YPJA 1MI5A 4NNXB 1D5XA 5HI5D 4XCYB 1YYLH 3QCVL 3T1WA 1RJLB 4U6YA 5EU5A 1W0WB 4GRWB 3QI9A 4R0LC 3OKYA 3MA7A 4LEXH 4ZQKA 2ADGA 2C4FT 4HMCA 4APQC 4KJPC 3ULVD 4G9FD 5DRZB 3NBNA 2HT2C 3WO3B 1H8SA 4DVRL 4N8VB 1YY9D 3MTRA 2VLKD 1MHCA 1KN2L 2HT3D 2DKMA 2O5XL 1AGDA 1KJ2L 3QCUL 2HWZL 5AD0B 5I1CH 3NTCL 1IAMA 4HS3B 4NC1C 5E5MA 5F7FA 3T77A 1OCWL 1WTLA 2CK0H 2VERN 1HHKA 2M26A 2QQKH 3BKYH 3BW9B 1FE8H 4PREA 2V5RA 3CK0H 4PRNA 2BSRA 4F33B 2J6EH 2WM0A 2Z8SA 2DQCH 4MA8L 3SHSA 2Y4SA 1WIUA 4RGOH 3VJ6A 1EBAA 4WEBH 4ZOEA 4PY7A 2YWZA 4KZDL 3LH2L 2AEIT 1MFAL 5JDSA 3TPKA 3EYQC 2IPUK 4XT1C 1BBDH 2R0LL 4ZMAT 1QYGL 1J86A 4RMQA 5DJXA 1HWHB 1PX3A 2VO5A 1TTUA 5FV2A 3GM8A 3MGAA 1BOGB 4K7PL 4ZAKD 4Y4FC 1W72A 2H6PA 5HPMB 5T1DH 2YUVA 3RGVB 3O2VL 1TCRA 5K9KA 4S1DC 2XG4A 3KDMB 2KUTA 4LLDA 4U6VL 3WXWL 5BMFH 1HH9A 3SE4C 4JFDB 5LGKA 1ZWIA 3VD7A 4IM8A 4PRHB 2BC4A 2G60H 5L7XL 2AQ1A 1QEWB 2GUOA 3QFJE 1RZGA 4GQ9L 3HC0B 1I3VA 2Y07H 1Q72H 1TQCB 3QUZD 4M6MH 3VXRA 2AXFB 2D31B 5FHAL 5DJYB 1EHLH 3LQAL 1CDGA 1JCKA 3CH1A 3R1GL 4LCIH 5FOBA 3OX8A 4C56B 4KQ4H 3G6JE 4K7PX 3WFEH 4D2NA 4OI7A 1Z2KA 1CL7I 4K3JL 2P8LA 3ORJA 3FN9A 4NN7C 1NBVL 4P2YA 2CIIA 2ZCKL 3E6FB 3QQ4A 4WEUD 4M1DH 3ELAT 4Z5RA 4HWZB 1PEZA 2RBLA 4JAMB 3I6GA 2ADFH 5GRUH 1S7VA 1VDGA 5F1NB 1P6AB 4YDVB 4QNPE 3GRWH 4NKIH 4AG4H 4JB9H 3DGCR 3V0WL 1AE6H 4HPYL 5FO7A 2VTFA 3I02A 3CAFA 5F70A 5MERB 2HVJA 5GGRY 2DQDH 3LAFA 4EN3D 1T5XB 2YA0A 1OP5K 4LFHG 2Q76A 4XCNB 2XA8H 2VLJB 5IIEB 4RGND 3KYMB 5EOTA 4UU9B 1W0VA 4RFNB 3T3ME 1CK0H 1S8DA 4P0DA 4Z7QE 3BUYB 2DF3A 4H0GA 1AD9B 4MMZC 2OQJB 4WTXA 2VSCA 1UYWH 2EZ0D 4QXGL 5F89A 4FQXD 2ICEA 4KTEL 2G75A 3QIBB 2H9GB 5KVEL 4Z7UF 5EORH 2P7TB 4L4VA 35C8L 1S7UB 5D93C 5F88B 3HI5L 3VFOB 3FCTB 3HE6A 3MRCB 1EH9A 1NGZB 3GMOB 4WFHD 5KVGL 3VFRB 1JK8B 2MNUA 4IJ3B 1G6RB 3U4AA 1A1OA 5EA0L 3W2DH 3OAUH 1HHJA 4K9EL 3RWEB 5IMOB 5GGRA 2XV6B 4O9HL 1IAII 4KXZH 2O5ZH 4MS8C 2OR8A 1LO5A 4RRPA 5EU3B 1O7SA 4Q58C 4OLXL 5F7EL 5LGHL 5T3ZE 1DBAH 1BZ7B 1KB5H 1J7VR 2C3WA 3QUXA 4APQD 4KJPD 1S7TB 1G7QA 1UJ3C 3MJ9A 2ZUQB 5HHMB 1H3XA 5L2KB 1FIGL 4KWUA 4DAGL 5DFTA 5KVDH 4BSWB 4JFQB 4NC1E 4LF3A 3HZVA 4YHPA 3OG4B 5D1ZB 4PGEB 5ILTH 3QI9D 2D3VA 5DJDB 2YD3A 2RQ8A 2VLRE 3LQZA 2OZ4A 1RVFL 5I17B 1F42A 1D5IL 3DURA 3GSNH 4CKVX 3QCTL 3MX0A 3MLVL 2X4PA 3OHXA 1BFVL 1SY6L 4Y5XC 3NIDF 2Q3AA 2VKXA 3ZTNL 3STLB 3N50A 3VXPB 2P48B 5I6XB 4JFOA 1QKZH 3EO1B 4OZIF 2MKWA 4QKXB 2VIRA 5DUPL 1MCFA 4M1CC 2BHYA 1EBPA 1NEZB 4V2BA 1WT5A 1Z3GH 4ELMF 1VFUA 4XBPA 3DV6A 43CAB 4M3KB 2PTVA 3GSVA 5IMKB 3T0EC 1CICC 3EYQD 1AGBA 2ICCA 4XPGL 3L7EB 2PTUA 4NNYB 1VSCA 1YA5A 3G5YA 1GPOH 5KVFH 3P9WB 1J1OH 1BREA 4Y5YB 3GMQB 4LKCB 5KOVC 5GISL 3MCLL 1T22A 4ZFFA 1YC7A 5ELIA 3HRZA 3KYOA 1IILE 3RTQA 3LZFL 1G7PB 2VDQL 4YDKH 4QRSA 5J6HA 4M00A 1YNKL 2AJYH 3I6KB 5D7LD 4LLVB 1CDIA 2ARJQ 5JO5A 2HJKA 4CNIB 4PJAF 1S3KL 3BD5A 1OB1B 2EDFA 4Z0XB 4QEGA 4KUCD 3U0PA 1MCLA 1G6RL 4BFGA 5A43C 5D7IB 2H3NA 4OUOA 3BT2L 3PP3K 3VFPB 4D9LL 5IGXL 5GGSB 3WS3A 4WI5A 5B39B 3IF1B 1OHQA 4OD1L 5LG1A 3S4SA 3OJMB 1DLHB 4YHLH 2P5WE 3IAGC 4LHUG 25C8L 4PJ8A 2FIKB 4HPOL 4LSQH 4GG6B 2ESVA 4RZCA 2BOCB 3CD4A 5M95B 3VXRD 1C5DB 2W0FA 2VQ1A 5DDHB 1F3JA 1UB5A 4LAQH 4RAUB 3HUJA 1CDUA 4E41A 3LN9A 2ICWJ 1QFWM 3FB7B 4XX1E 2HFEB 3MLYH 1ZSDA 4KJQD 4P3DA 1RUAL 4U6TA 3L3IB 4L5FH 1AHWA 3OKMB 1UA6H 4P46B 4GKNB 4N0UE 2RAMA 3IETA 3U4EA 2CKBB 2GK2A 2MHAA 3UZEA 3BEVA 1HYSD 2O5YL 4OD2A 4AEIL 4TPRH 4YX2H 1TJGL 2IBBA 1I1AC 1I1RA 1M6OA 3ARBB 2DLEA 3NIFE 2QQLH 4D3CL 1IKFL 1FRGH 4JGJA 4NQCE 2MMXA 1LWRA 1RUKL 4KTYA 2HKHH 4N68A 3S88H 5CLWA 4R90L 1MH5A 4NQXA 4D0DA 4Y5VA 3CXDH 3MV8A 3IDNB 4AZ8A 3SY0B 3RWFB 3BP5A 1JNNH 1ZTXH 2OJEA 3CLFL 3BQUC 3DI3B 4HAFA 3TH4T 3VXUA 3SCMD 2DD8L 1WBYA 4K3HA 3EDKA 4L3AA 1E4WL 2EE3A 5KVMC 4MS8D 3TZVB 1NBYB 2AJ3A 1IRAY 2VISB 5HYJB 3HE6D 3VGAB 1DQLH 1WZKA 4FXLA 4CVZA 2R2HA 1T04B 5L2JB 1MELA 2OX5A 3EKCA 1H3WM 1QBLL 5FKAA 3T1FB 5E2UL 3X14A 1X5IA 1UC6A 3DRQA 1H3UA 5ESQB 1BJ8A 3GDBA 1OY3B 4HWEL 4EIZC 4FG6C 3QCVH 4OV6F 2YD4A 5I16A 5ICZB 2ZOLB 4P2RB 1M7IB 1DBML 1U8JB 5HHOE 4K3EH 3FOLB 1X4ZA 1KN2H 4G8IA 5IBTH 4MB5A 2UWEE 5D2NC 3JWOL 4IOIA 4GOSA 3NCJL 1KJ2H 3PJSA 1MCRA 3QCUH 1KNOA 4QGYA 2W92A 2HWZH 3NTCH 3L3DB 4MXWL 4PRPE 3T0EE 1OCWH 4CMHB 5D1XB 2OJZL 3RWDB 3R8QA 1YJDC 1J11A 4P5TA 2CXKA 1D7FA 1CF8L 1R3LA 4PUBL 1F13A 1RJZA 1DUYB 1ZHKA 2CKBL 3DRTB 2X4SB 1P6FA 4W4OC 5T3XD 4HUXB 4G7YL 3OKNB 3VMNA 3U6RB 3CFEA 3NA9L 4XP1L 5DJCB 2NY1B 3C8KB 1F6AB 4KZDH 3QJHB 1MFAH 4XBGA 4X6DA 3FKUS 3SDDB 2FSEB 3C5JB 4NRXB 3GNML 1IGIL 1RAMA 1OGTA 1Z9SA 1QYGH 5DHVH 1KC5L 1U8HA 1JV5A 3QQ9C 2GJ6B 3KPSB 2OM5A 5H8DA 2J3SA 3KR3L 3FHAA 4TQEL 4X6CB 4J3XA 3GGWA 4K7PH 3QPXL 1U42A 1N26A 4WW2A 4P2OC 2E6QA 3O2VH 4JFPB 4JRYB 3ZYJA 1KPUB 1A1NA 2EXWD 3DVNB 2FYYA 4R3SB 4ODUB 4U6VH 1VGEL 2GFBA 5FO9B 5GJTL 1UKSA 4NZDA 1MLBB 1Q38A 3PIQB 4P4KB 2N7BA 1T0MB 5L7XH 5J6GA 3FT2A 4GQ9H 3MBEB 1R0AL 4LRIC 1LNUB 3HB3C 5A1AA 5CD3B 3P9LA 1JL8A 1U6AL 2FL5A 5FHAH 2C3GA 3LQAH 5B8CB 3R1GH 3MCKA 4JFXA 5AUMB 4KROC 5HTSA 3A0OA 4I9WE 2JF1A 4NOFA 2EDKA 3CGTA 1I7ZB 3O11B 3VRLF 3V7MA 1NBVH 3TYGL 2DB8A 1T6WA 2ZCKH 2EE2A 3HNTL 3EO9L 1JZ7A 4HH9A 4NQTA 4KTDL 5HJ3B 3H9HB 2H1PL 1TVHA 4W70A 3CSYA 1R3IL 5CILL 4LSRH 2KQMA 4FTVD 2GHWB 1KFAL 2YK1L 4HPYH 5D7IF 1T7ZA 5JXAH 1EJ6A 1I1AD 4G8GE 1CDJA 3ILPA 2BOBA 3GUTB 1ADQA 1X6LA 4NYLA 1HDMB 1JWSB 2IPUG 1BQHB 3BD3A 4NFCA 4FS0A 1DVFA 5F1IB 2WWMC 5E8OA 5T1MB 5HHPA 4Y1AD 4JHBA 4MGXA 2CRMA 4IRSA 3O45B 1R5IA 1ES0A 4G8EA 3G5VA 2YZ1A 2WBJA 4NNPL 3LQAC 4FQHB 4YXLL 2ZSWB 4KTEH 2ENSA 5E4IA 4LDEB 35C8H 3DO3A 4RRPG 1A7OL 3HI5H 3MV8D 3VWKA 5EBLA 1LP9B 4LQFH 4X99A 1CDBA 1S7SA 5D6CA 1S78C 2F53E 3OMZA 4K9EH 5IB1A 4FNLL 3VXUD 4YFDB 2IALB 4I1NB 4F7CA 2DM7A 4OKVB 1ZS8B 3SPVA 3VE0A 1RZIA 3TNNA 4Z6AT 1A6AA 4PRBB 5F7EH 4OLXH 5LGHH 5C92A 3BIKB 5CEZL 2PTTB 4L8CB 3DWTA 2KBGA 4Y19B 1TETL 1IM9A 3MRNA 3BP6B 5J57B 3J8F7 4DGIL 5D2NE 4O2CA 3ZTJH 4QO1A 3QHZL 1FIGH 3NIGF 5DVOA 3STZB 3GMPB 4KMTL 2BCKA 2VDML 3I85A 4K71B 1SQ2N 1R5VB 4JO2L 5FA3B 3ZDYF 1FNAA 2PW1B 1ZGLB 2CIKA 5E56A 4LSUL 3B5TA 3LN5A 2RGSA 1RVFH 4UTAH 4OF7A 1YECL 1D5IH 5F3BB 4QXWA 3FQWB 2NY0B 3MMEA 3QCTH 4OZGB 3MLVH 1D5MB 2J8UF 3B2VL 5D7JA 4HWBA 1G9NL 3NGBB 1BIIA 1SY6H 2GCYA 1I8IB 3ZTNH 3BP7A 3RGVC 2MPAL 4K9EC 3DXAB 1HH6B 3OKOB 5DUPH 1JGDA 3PABB 1YPZA 2A1WL 2GJJA 4P5TD 4ELKB 2XZZA 2R9HC 4XPGH 4RQQA 3TJEH 2ERJB 1OP3K 4QOKA 1FP5A 1AKJD 2DIJA 3QQ9D 5DTFB 3PL6A 4PJDF 4Z7UE 2JIXA 1LD9A 5GISH 3DVGB 1CXIA 1UWXK 4TN9A 3S5LB 3SE3C 4TVSa 4P2OD 1QPPA 2W9DL 3LZFH 3MUY1 4PBVC 3LKSA 5IHZA 1YNKH 5JW4R 5IVZB 5DJ6A 1QSFB 4ZUSA 2ICES 2BFVL 4S11A 5I1DB 2DYPB 3TIEB 1S3KH 2FO4A 1U3YA 1Y6KR 4ENEC 3C6LB 2AK4E 3L3JB 1C12B 4AQOA 3AREA 5GS2D 4WI7A 5AZ2L 1WJ3A 1G6RH 5I18H 4MA3B 1K5NA 3BT2H 4ZNEA 2XICA 2XYCA 4D9LH 32C2A 4HS8L 2GEEA 2NY4B 5EU4B 4NO2B 2HTLC 2R2BA 4ZNCD 5HVGB 3O3AA 4CVWA 25C8H 3LCYA 2YEZA 4HPOH 3FQNA 4Y0GA 3D2UB 4NGHL 4KROD 4KY1L 4WNQB 4ORGA 3GHBL 4RFNC 4ONFL 3AXLB 1T20B 3UTTD 1JPST 3TC9A 4I77H 2E8ZA 1ZOXA 4PJGF 3MLXL 5T5FL 3TNMA 1RUAH 2NTFB 4OZIE 3C5SA 2RIKA 3IJHB 5INCA 1V05A 3GB7B 1U36A 4ZFOB 2XTJB 3TCLA 4ELME 1HHIB 1BHGA 4R4BB 3T0VA 2A0LC 2ZNWA 3PDOA 2VL5A 4C4KT 4IJ3C 1YN6A 1X5AA 5C9JA 2HA1A 5SWZB 2XPGA 4HKXB 2O5YH 4I3SL 3ECBA 2WWMD 4AEIH 4GQPH 1VCAA 1AP2A 2IFGA 3UBXI 1TJGH 3QDMA 4MB4A 5F7HA 4D3CH 4XPFH 1XAUA 1IKFH 4K2UH 4IDJL 3SDAA 3RJQB 1RUKH 4JVPA 5CFHA 4I2XA 4R90H 2JJWA 2R15A 3VXOA 2NNAB 4H25B 5H94A 2HJFA 1FFRA 1S7WA 5D1ZC 3CLFH 1S9XA 4IRSD 1S9KC 1S78D 4DOHB 1FYTA 2WBJD 4N9OB 4Q6IA 3B3IA 3BE1L 4TYUA 1Y18B 5BS0B 2DD8H 4Z77B 1LK3L 2BJML 4KKNA 4ZO9A 5ESAB 3VXMB 4K7FB 1FZOA 2CDEB 4DZ8B 1B6UA 2CMRL 4LPVA 3VWKD 1EAJA 3TESA 1Y0LB 4KK5D 3TPUA 4M02A 1E6OL 1XGQB 4PJ9B 5CGMA 1IAKA 1FV1A 4LSVL 5I6XC 4Y2OA 1XGYL 1T03L 1QBLH 2C4XA 1P9MA 1PYWA 4QRPA 2P45B 3ZL4L 2AKRB 1A4JA 5MP6L 5GZOD 4JZJA 1J8HA 1AQDB 3KPRA 4Y2DA 1FNSL 5IB3B 1VFBA 4OTXL 2R1XA 1BX2B 1I8MA 5FUZL 2QSTA 2ITDB 1DBMH 4ZOCA 1IM9D 4ZD3L 1PSKL 3QNXB 4JQXA 4W81A 4GAJL 3U9PH 5BV7B 4Y5YC 4M7LT 1J12A 1NGQH 4Y4HA 1WSST 4MD4A 3IGAB 5CWSA 3EOYG 5C0FB 3JWOH 3NCJH 4GKZA 4JFDE 2OL3H 4HDIB 3U2SA 3HG1A 4UDTB 3ZYIA 3I3BA 2CGRL 2DBLH 3MRKB 5KBNC 3P4NA 4MXWH 3UTSB 4PRHE 2VN4A 3CMGA 4B53A 5A2JH 3HLAA 2OJZH 4L29A 2YPLB 4ZFOL 4LBEB 3L6FB 4NKMB 3VXSB 1CF8H 1P1ZB 3H2WA 4H1LG 5HGAA 1MREL 4G5ZL 4PJEA 3T2PA 1VKXA 4GUPB 5DS8B 4G7YH 3KJ6H 1MCCA 3GHEL 1JN6B 5C8JA 2FZ3B 3UCRA 1HNFA 1RY7B 1NANH 2BNRB 3DGGA 5DUMH 4Z7VB 5LBSL 4UZGA 2JK5B 4X4MA 2Y7QB 4F80A 4YO0B 1IGIH 4C56D 1UQSA 4QOKD 2B1AL 1KC5H 3IFOB 4WJ5A 3BAEL 3PL6D 1YN7A 2JIXD 1A7RH 4TQEH 5D2LB 1TNNA 3NPSB 1AJ7L 1HEZB 1JGLL 1RIUL 3CDYA 1HOCA 4OZGF 3BSZL 5E0QA 3QIUC 4PJFB 1WBZA 3RAJL 3QP3A 4GAFB 3EZJB 4JY5H 1S7QA 3OR7A 1VGEH 2EH8L 4YBQD 1ZVSA 2Y36H 1MAKA 2VLJE 1A2YB 3MRLB 1CFSA 1B88A 2IANE 4P46C 2H2SC 3X11A 1CTNA 4GLRI 5IFJB 1P84J 3MJ8A 1HQ4B 3REWB 4XNZB 2CUHA 4KK9C 2DBJA 3P3YA 4J3VA 4OCLC 1R0AH 4CDGC 3WNPA 2XXMB 5EIIA 5J9PB 4JFZL 4WI3A 1MHPH 4PV8B 2KKQA 4MXQD 1U6AH 4A6YA 2XNAA 2LQRA 4JY6B 3VGDA 2EO9A 2X4UB 3W11C 5BV7L 3C9NA 3KGRA 4MWFB 5DEFB 3TYGH 3REVA 4J3WA 3RRQA 5KSUB 1TMCB 1FL6B 3V6OC 1EJOL 3QFJA 2VZTA 4L1HA 5ISZB 4OZHA 1R3IH 5CILH 1U93A 1CDCA 3OKKA 2AV1B 1JHTB 3IFNL 1T3FB 1KFAH 2WIIA 3I50L 2YK1H 4F9LA 2N56A 3MRQB 4I13B 3RZWA 3BVNA 4OBRA 3TBTA 2BVOA 3TF7C 5IKCA 1G6VK 4ODSL 5HHME 3T04D 2V2TB 5L2KE 3RJDA 2GIYA 3L3OB 5F21B 1A1MA 5E1AB 2R56L 2V2XA 5E8PA 2AJZB 3G5XA 2EC9U 4FQPA 5I8CB 4PRDB 2E5EA 5D1ZD 4RAVB 5EU7E 3GMMA 1XGPB 4YXLH 4ZXBA 4LPXA 5DR5L 1HIML 3VFMA 4M8QB 5E2TL 4QGTA 4MQSB 3QNZA 1V7NL 3ALPA 3OXSA 5C3TA 1A7OH 1A6ZA 2FB4L 3AM8C 3O6LL 4I18B 2EO1A 3I3DA 4PP1C 5A16B 2Z0BA 1MCNA 1P7KA 1C08B 4U1KB 4QHMB 4QCIA 3AS1A 2EYSB 2XWJB 3VFSB 3VG9C 2EDRA 1CLYL 5D1XC 2FX9H 3CZFB 3RWIA 1T1ZA 3SGDI 2NZ9D 1TETH 3BXNA 3H0TB 4AY0A 2A74A 3PGFH 4DGIH 3NZ8A 1UM4H 4WTZA 4MLSA 3SN6N 4NKDA 1U8NA 4XCCH 1CGVA 3QHZH 4QRPD 3QNYB 4PJCF 5DQJB 4AYFA 4CU6A 3OJDB 4KMTH 3VRLE 2NY1C 5CJQL 1PQZA 2VDMH 5T1KA 4Y2DD 3ZHDA 4QRUA 4M4RA 4JO2H 4ZSOA 1VA9A 1A47A 3TEUA 4V2CB 3D3VB 4PGDB 3SDDC 1MHHA 2P24B 1IQWL 1CIDA 1YECH 2DQEH 4CDHA 3CVIL 1K6QH 5D7IE 5CS7A 1RIVH 4QRQA 4Y4HD 3QXWA 3MV7A 4GW5B 3QR2A 3KXFB 3D0LA 1UENA 1MIML 2AK1L 3KNBA 3H6JA 5DYOA 4DCQA 3TA3A 3HG1D 1DCLA 4OLYL 4F37K 3U79A 4YBLB 4FZ8L 2EDLA 3S3PA 3BFOA 5DK0A 5D9SA 4GG6E 3B9KA 4IOSD 3MNWB 4P4KC 3WSQL 3AC0A 4IHOB 3F7QA 1EGJL 3K80A 3UXFA 2JB6A 4WI4A 3ZO0A 3SO3B 4X4XB 3MZTA 5ITBL 1T7XA 2I07B 3IKCA 4NZTL 5MEQB 5D96B 3B6SB 4PJBB 2AEPH 5I1KL 1U95B 3LSOA 2GKIA 4F7TB 1UT9A 2W9DH 3UJTH 4LNRB 5D72L 4C4KO 4HUVA 4N90E 3QIUD 3WUWA 1NAMB 4N1EA 5JMOC 4NUGL 1NFKA 2DTSA 3ZKQD 5F9DC 2BFVH 3AU1A 5KZCB 4OIIL 3PHQA 4X9HA 3HAEA 3TBSB 3MJGX 3AMKA 3DO7B 2Z91B 1G9NC 5IB4A 3UZVB 5CBAB 5JDJA 5JQ6L 5DMGD 1NLBL 4U6XB 2DI8A 3V5HA 4KK9D 1P4LA 1QTYT 3PXJA 4XMKL 4I48B 2DLGA 3QSKB 2DOCA 4WWKA 1CLZH 3NIGE 2FRGP 5IUSA 5DEGB 3GSRB 3HZKA 5F6IB 2NY3D 5IR1A 4UAOB 4LRNH 5ACZA 1OAYH 3WN5B 3ZDYE 2ZJSL 1HQRB 3OF6A 4DTGH 2Z35B 3Q2CA 4NGHH 4KY1H 3V6OE 3J7HA 4N0CD 3WS6C 4P9ML 2J6EA 1DBJL 3IS1X 1B2WH 2IAMB 1VHPA 4L8DB 4MLIA 5GJSL 1MRDL 2W60B 5C07B 4ONFH 2YSSA 4QT5A 4HIEA 1JHLH 1K8IA 1IM3B 3V7AG 1QO3B 3CDGB 5JOFB 1G7MB 5D2LF 2IQAA 3P4OB 1GOHA 4MA1B 5HYJE 2B20A 5GS3A 3MLXH 4OLZL 2W0PA 2ZUSA 3TH2T 2HYMA 3BO8A 2X4TA 4YR6A 4UBDC 1WWCA 1T21A 3MV01 1N8ZA 3DX7B 1RZKL 4F58L 4AH2B 1N5YL 4X6BA 5HHQA 5E70A 5GS1B 3R0NA 1ND0A 3HC4L 1T2XA 3BPCA 4K94L 4I3SH 1AGFA 5EG6C 4P2RE 5KSBB 4FFWD 1YZZA 3NCBB 4MYWB 4FFVD 1FQ9C 2EDWA 5EUOF 4YWGH 1KCSL 5L88L 5CIPA 1FNEB 4D0CA 4RA0C 3V6FA 1RI8A 4NC0B 1QA9B 2FCBA 4O2EB 1OT1A 2V9TA 4Q9RL 2YRZA 4F57L 3N85L 1CL7H 1NCTA 1JYWA 3BE1H 2EIEA 3EYSL 1NAML 5I73C 1XR8B 1IBGL 3NFPA 5FYKU 4ZXBD 2HTKD 3F6LA 3W39B 1LK3H 3GI8H 1RZ8A 1R3KB 1NMBH 5D1XD 1BVLA 2NY0C 2CMRH 2R4RL 3BD4A 5HVFB 1N0XL 4UUJA 5GGVL 1AIFA 1FNHA 3NGBC 3JV5A 3WNMA 1E6OH 4X5XB 4J7RA 1ZLUH 5ID0B 4QHLB 3DYMA 4KI1A 3JTSB 4RMSA 4LSVH 5K9OB 2J7LA 1UM6L 1BIHA 1XGYH 1T03H 2GY5A 4OGZA 5J11B 4GW1A 3ZL4H 5DVLA 5MP6H 3GIVA 3GRWA 4PJHF 3ZZ1A 1TITA 1FNSH 3NACL 1G9EA 2P1YA 3IRZA 5FUZH 3KPSE 5T1LB 3O4LD 1WWBX 4ZD3H 1PSKH 3OGCB 4MXVF 3TBVA 4N1CA 5FHBH 5GS0L 2GJ6D 3IAPA 5EFIA 5C0BE 4JRYE 1ZV5A 5T1KD 3CFDB 4G43A 4PJIB 1VFAB 4JKMA 4WO4B 2A6IA 5F7YC 4KVCH 3PWPB 4KRMB 5SWSB 1KOAA 1GZPA 1N6QL 3L95A 4QTHA 5CZXD 4M61B 3P73A 4PJ7A 5JPNB 5TJWK 4PGCA 5F93C 1DDHB 5CCKL 3MV7D 4I0PB 3VW3L 3C6LC 4P4KD 2HRPL 5CEZD 4KAQL 5FO8B 4HV8B 5DGQA 2PYEB 2P8PA 1MREH 3TA3D 2YC1B 4QYOA 3JUZA 1FG2A 4POUB 3RVTD 5I0DA 1JI2A 2NY6D 2JE8A 3GHEH 4GFTB 3TIDA 2NY4C 5HYEA 3KPOA 3U0TB 1RD6A 4Q7DA 1B3JA 2NMSA 4MA7L 1L9NA 1KB5A 1SBSH 2CRIA 3M1BB 4G6AC 4DWHA 3RBGA 5CHNB 3BAEH 3RL2A 3FFCA 4QWWC 2OI9B 5DWUL 4XC1H 3BHBB 4D9QE 4L3EB 4MQXD 1EO8L 4CVUA 1EUUA 3TGXA 1DQJA 3HZMB 2GTWB 3O41A 3IJYA 5AWNL 3EHBC 5DD6B 3RAJH 4QTIH 4JANB 4XVUD 2X1QA 2XTLA 9CGTA 1C16B 2JKXA 1DFBL 4ZS6C 2EDXA 4LSPL 2EH8H 2ZSVA 5LCVL 4H26B 3GJFB 4MD0B 1V7ML 5GZNC 3RI5F 3W9EB 2NY2B 5J7CC 2A9MH 2XTJC 2UYLA 3GSNA 1FO0H 1XF4B 3SDXF 2YMXL 4OGAC 3UBXB 3HTLX 4FQJL 3RDTA 2X70A 1T4KA 1JPFA 1K85A 2DJ4A 1M7DA 3QQ3B 1KIQA 2HLFC 2B4CH 3UYRL 1A4KB 4B5EA 3DYOA 2X4NB 3UDWC 1CVSC 1H3PL 5D71H 5CP7B 3SJVB 3LS5L 5JW4N 4PJBF 1B0RA 5JLZA 3OF6D 3TO2A 4ONHA 1LP9E 2VB5A 1NCAH 4JM2B 4Y4KB 1NFDF 3TH3T 5BV7H 4UBDD 4QHUB 3GIZL 5FCSH 1CG9A 1GAFL 4JZNA 5KS9F 1KF9B 3FO2A 1DUZA 2BVPB 4HIJB 1MFDL 5DJ0A 4Y19E 3IFNH 3MRPA 3WE6A 5HXMA 3I50H 1I7UA 1S5IL 4OF8A 3VI3F 1FZKA 1RHHA 3CFBB 3QJFA 5IV2A 4PJ9C 4L4TB 4Q9QL 1ORSA 3EFDL 1II4E 4HS6A 5FF6A 3Q6FB 3NN8A 4LVOB 3MCG1 2NX5A 2R56H 1A02N 5I8EA 1KGCD 1DN0B 5DVKA 4MNQA 4UQ2A 1UFUA 1X7QB 1ED3A 1HI6B 4OZGE 1J0YA 1N59A 3SGJA 5DR5H 1HIMH 5IW1A 5EU6B 2HFTA 4M5ZH 5E2TH 5E2WL 2EH7L 5BV7C 1V7NH 1D5BA 2Q86A 4HIHA 4NN5B 2GITB 3DXAE 3FB8B 4M03A 5HYSA 2FB4H 4JM4L 3O6LH 4XH2B 1U3ZA 4I8DA 3QUKA 4OQ1A 5DMIL 2V2WB 5DT1L 4HF5L 1KEML 4HEME 1A6WL 3T8XB 2ZG2A 5DD0L 5F7WC 1CLYH 1D6EB 2L7UA 3FAXA 3QDJB 3DTXA 1S9WB 2Y06L 3HRPA 3FFDB 1MWAH 5DO2C 1A9BA 1WWWX 5IBUB 3FRUB 1KPRB 5CJQH 3FL7A 1QSFE 4W6XB 4FQIL 5DQDL 3CJJA 5JZ7C 1Q9LA 5FGBC 1OAZL 4MD5A 1GOFA 4LSDA 4MVBD 3RVWC 4K55A 2G9HB 3QXAA 5DUBB 3CVIH 4KJWC 3MBXL 5JW3L 4FQLL 1DQML 3NPSC 1G7JB 4J6RH 5EBGA 1MIMH 2AK1H 2Z4QA 2H41A 1MCHA 4OJFL 4OF5A 1H5BA 3VG0L 5DJ2B 3B9VA 4UNVA 3MO1B 3K81A 3GM0A 4OLYH 4Z8FL 4KPHL 4FZ8H 5JOPE 1RZJH 4Y16B 4NSKB 3RPIA 1DANU 3BIAX 4BUGA 3MRDA 2E8YA 5C0EA 1NGXA 3WSQH 1EGJH 5BVPH 2ZOKA 4XNZC 3WUWG 2DKUA 1YNLL 4ZUUA 1KCLA 4G6AD 5ITBH 2NYYC 5BRZB 5I1KH 3TBYA 1DLFH 2VZSA 1DQDH 1YMHB 4OAWA 4WEMB 3JV6A 1DEEB 5D72H 4D9RE 3B43A 1MJJA 4RSVA 2XTJE 4NUGH 1CGUA 5D5MF 1X5JA 3FFCD 5BJTB 1QFOA 4OIIH 1OW0C 1U3JA 1VFMA 5GZND 1C5BL 1M71A 4JZOB 2G2RB 2WUCL 2EYTB 2X7LA 4K8RD 2XZQL 5JQ6H 1NLBH 5ICXB 4OGAD 5F3HA 4HK0B 3T2QA 3BN9D 2DLIA 3BPNC 1VGKA 5DEZA 4AIZA 5SWZD 5J8OA 1WTGT 1OF2A 2D4DA 4Z7UA 5DQ9B 1IAOA 1TZHA 3SKNA 2W65A 5HI3C 5DZNA 2HLFD 1J0IA 2IADB 4XPTL 4M6OL 4G80B 3IXTB 3QEQB 4MAUH 1F58L 1OVZA 3U4BL 3C2AL 2ZJSH 3BRGC 5GIRA 3SDCA 3ZKMC 2N7AA 2QL1A 2IGFL 3IFPB 3MOAH 1FFPB 2I9TA 1DBJH 4N0FA 3RDTD 4J4PA 4DOHE 2FGWH 2APBA 4MSWB 5GJSH 1MRDH 4UNTA 2AK4A 3T2NL 5BS0E 2DQUL 1CTOA 4YNYA 3BGMB 1ZMYA 2BNUA 2ZCHL 5DJ8B 3VXME 2JCCB 3B4NA 3EYUH 1FNGB 4X7CC 1TJHL 3TO4A 5FECB 1UZ8A 1BFOB 4JR9H 4NQUA 4OZ4B 3MLZH 5DHVA 2EXYC 5ADOH 1RZKH 2EIZB 2PN5A 4YHMH 5JUEL 1N5YH 1A6VL 2CLRA 4I18C 5GRWA 1J18A 1ZA6A 4XX1G 2CDFA 3HC4H 3EFFA 1ZXQA 4XZUB 4QF1A 4K94H 1OSZB 1IC1A 2EDEA 3PQYB 1T2QL 2UV3A 1FVDB 5DA0B 3WLWC 5JOEA 3BJ91 1KJMB 2GT9B 2V17H 1WIOA 1KCSH 3VFUA 5L88H 4OZIA 3R06B 3O3DB 2NX5D 1QR1A 3PGDB 4GRMB 3MNZB 3C6SB 4ELMA 5J1TC 3ARDA 3QG7L 4JM2F 3UTSE 4YEFA 3N85H 4MNQD 2QTEA 2DLTA 4NNXA 4LPTA 3MLTA 3H7BB 2YPLE 3EYSH 3VXSE 1LE5A 5B38B 2KL6A 2WINB 4KKAC 2H8PA 3EOAB 5H35A 2PW2B 2R4RH 2FNBA 1IC4H 1N0XH 4I4WA 5GGVH 3E8UH 5JHDB 1RZKC 3C5ZA 3QYCA 1FVEA 2YUZA 2A6DA 4NQDD 2VLLB 4CJ1A 3WFHA 2BNRE 1UM6H 4WI9A 5DO2D 1WQVT 4JFHD 2F8VA 3O6FA 4K94C 3ISWA 4PJAA 4HLJA 4PD4K 4YBLC 2GJZA 4U1SA 4B50A 3WHXA 5FKPB 3NACH 4JDZB 5E5UB 4QY8B 1FNFA 5D2LE 1K4CB 1U58A 2BRQA 2EE9A 5KSAA 4F33A 3RVWD 4M7JL 1IEBB 1YNTA 1EX0A 3GI9L 4PJFE 3MLRL 3VFGH 5D96C 2Y9RT 4ORZC 1LEIB 4HGWB 1ONQA 4POYA 2O93L 5DURD 2HH0L 3V79C 2YPVL 2ICWA 4G8FA 1N6QH 1IKNA 1YEDA 2Z8RA 4BUHA 2GTZA 4RNRB 3EJYC 5E6YA 1PG7W 3ROLB 3RVUC 3A6BL 4PB9L 4CADA 1BQLL 1YMMA 3QZWA 1A21A 4ZUTA 2HRPH 3FO9B 5L9DL 4MCYB 5E9DB 5IEHA 1Q9KB 3D39B 3KJ4B 2UY6A 3IDMB 2BNQE 4GW4B 2BRRL 5F6IC 4UAOC 1QLFB 3RGHA 5EPMA 3WN5C 2F54B 3EGSA 3RVVC 4EQ3A 3CSBA 4MA7H 1BD2A 3VGEA 1F4WL 1QEWA 1FJ1B 1OPGL 1ZT7B 5ISZE 2IAMC 5GS0C 3L3HA 5DWUH 2YBRA 4W68A 1U8QB 1JWMB 4MDJA 4X5LA 4NN6B 5AWNH 3MJ6A 4M62H 1MLCB 1JNLL 2AQ2A 4MA1C 1U92B 2EECA 4R96B 1DFBH 3F5WA 5LCVH 5HI3D 4D0BB 1V7MH 5HI4C 3LPGA 1DTUA 3MUZ1 3LKNA 3TFKD 3O9WB 3VH8A 5BVJA 4KV5F 2FX7H 4MXVE 2ZUYA 4FQJH 4MJIB 3O3BB 3OXRB 4BYHA 2F9BT 3UYRH 5F6HI 1UXWB 5HGBA 3RUGF 1WAAE 1H3PH 3HC3L 3LS5H 3K3QA 4BFIA 4JFFA 3EOBB 3K1KC 4JKWA 3SDCD 3FB5A 1ZHLB 3ULUL 1WCBB 1YY8B 3BZ4A 3TP4A 2HAZA 3CNKA 4BQCA 4J4PD 2IQ9L 4M1GL 4Z76B 4LCCA 2IANA 2EXYD 4UI2A 5F96L 1BEYH 3GIZH 4UU9A 4PJ5A 1QQDB 5FFLA 3BPLB 5MENA 2C26A 5GSVB 3H42L 3X12B 5ITFA 1AD9A 4X98B 4NZUL 3TO4D 1MFDH 4GMTL 3QDGB 1S5IH 3QIBA 3CFCL 4WI6A 1NBZA 2A73A 4HEPG 1SEBB 3MRCA 1HXMB 3GMOA 3HNVL 4NQEB 1CFQA 5DJZB 5LAXA 1CD8A 1G6RA 3U9UB 2IFFL 4OM1L 2P42B 5J11C 3MNVA 3RWEA 3D3VE 5EC1A 5HSFA 1S9VB 1U2CA 3P0VL 1R5WA 4EDWL 4QRTB 3CPLA 4KZEH 2HG5B 3KXFE 5FM5M 3MREA 5BXFB 1G7IB 5E2WH 3CFIC 3D25B 1S7TA 3VFWA 4KUZH 5IVXB 4X6FB 1BM3L 4KMLB 2EYRB 3QO1B 1ROWA 1YQ2A 2GSGB 3DJ9A 4ZPTA 1WC7A 4JFQA 4WO4C 5DMIH 3ARFB 3SDXE 5DT1H 4HF5H 1KEMH 2E6PA 1MFNA 2VXQL 4JGMA 5ICYA 6FABL 4TTGA 3ZE2F 1MCOL 3OKLA 3UPCA 4Z7WF 4WY7H 4ZG1A 4I0PC 3C5ZD 3AB0C 3L7FA 2Y06H 3Q3GB 3VA6A 4PJBE 5DD5L 5GRZA 5EO9A 5TDOB 4WV1B 2LAAA 2O26U 4LARL 3O6FD 2VE6A 4Z78B 3ROOB 2DM2A 4FRWA 4QRRB 3QA3B 2R0WL 3ARUA 4KRPB 4FQIH 5DQDH 1JIBA 5KS9E 3VFNA 2IEPA 1X5KA 5KSAD 1OAZH 1NDGB 4GH7B 3EJYD 3I6LE 3LEYL 2K9UA 3HI1B 3WIHL 3OKEB 3W81A 3MBXH 4OV5A 3VI3E 1WK0A 3TJHC 1DQMH 2VDNL 4ZPVB 3K2UL 5C7XL 2BERA 4Z18A 4DGYL 5IBLD 4OJFH 5IW6A 2AGJL 5ECJE 1XZ0A 2VAAB 4PGJA 3KPLA 3DBXB 2WLYA 2C1PA 1IC7L 5DD1L 2FWOA 4Z8FH 3CFKA 3QAZB 1E4JA 3PWLB 1YMMD 4LLVA 2JLLA 1AR1C 3LB6D 3AMLA 3LV3B 4PPTA 3VDCA 3OBAA 5FYKH 3NABL 5C07E 4UOJA 2CH8A 3QG6A 3IU3B 4OQTA 1N64H 4TRPL 1NDMB 5MEOA 5GS0D 3ULUF 4JFEB 1NC4B 4LGRB 5JNYB 3TVMA 3BWAA 4BZ2L 5BZWB 5EZJA 2R4SL 2FLRT 1LK2A 1MY5A 4U33A 3BN3B 4WU5B 3IXAB 1BD2D 4MNGB 2OLDA 2QLVB 3H3PL 1GHFL 3IDGA 2N4IA 4JM2C 4Y4KC 2KQNA 5BO1L 4G9FB 1JJUA 5TQ2L 2WUCH 4IMKC 2VLKB 1AXTL 5KSBE 5ENWB 3O0RL 5DDHA 1ITCA 2PYFA 3N0PB 2C5DC 3PWJA 1WBXA 3VDAA 1OTTD 1G0YR 3G6AA 4PJXB 3UZQA 2OL3A 2QADD 1EEZB 5CSZA 1SJHB 2WLZA 4XPTH 4M6OH 1J0KA 2V7HB 2F8XC 3U4BH 3C2AH 4P57B 3HMWH 4LDOB 3D85A 2DWDB 2PO6A 4GKNA 2IGFH 3UO1H 5F9JB 2WIMA 1G1CA 5HDOA 5DRWB 1CCZA 2HN7B 1CE6B 1I7RA 2E7LA 3T2NH 2XZCL 1ETZB 4HD9A 3WJLC 4EVNB 4HFWA 1XIWA 2DQUH 4HMDA 4IRJC 1GC1L 4ONOA 2ZCHH 4HZLB 4JFFD 3ARBA 4J3TA 4ZO8A 1TJHH 1AFVH 1EFXA 2XOTA 5TQ0L 1I1YA 1HSAA 2JJTA 4U6HB 3G5ZB 4XXDB 4YE4L 4E5XA 3UTQA 2CUIA 4NN5C 4PJ5D 5JUEH 1A6VH 1LDPL 12E8L 1NC2A 3C09B 3IDNA 5MEND 5TE6L 1AQKL