3E6FB

Mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pa9, from the human immunodeficiency virus (bal) envelope glycoprotein 120
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
MQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title Different vaccine vectors delivering the same antigen elicit CD8+ T cell responses with distinct clonotype and epitope specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e6fB00
5D2LA 4H8WH 5E2TH 1A3RL 3OJ2C 3ARQA 3QCTL 4HW6A 3BZFA 3VE0A 2ZSVA 1NEZA 4MAYB 5T1DH 4MS8C 3BW9A 1MI5B 2VLMD 4Z7OE 4LOUD 4Y19B 4QXUH 4U49A 3REVA 4APQB 4GBXA 3QQ3A 3I9GL 3ZT5A 4X4ME 1TVHA 2QQLH 4EDXA 5F6IB 4NO5B 1JGVL 4AYFA 2GJJA 3RY6C 4G9FD 4W70A 3MV9A 2RAMA 1UM4L 4NGHH 3MNZA 2XTLA 5EIIB 4BZ2H 5E5UB 2BXYA 1AD0A 4GRLA 3KLSA 5IFAL 4YPGB 2F5BL 3MA9L 1NAKH 5C0CB 2ADFL 2Y9RT 4OCYL 1UEMA 1G7MB 3TYFA 4UIKH 3SE3A 5FKPB 3VXSB 1OF2A 2NW3A 4ZYKB 3VMNA 4IEFB 4NQSB 2L0DA 4L8BA 3ES6A 3QDJE 4EI5B 1C5DA 5CSGA 2CD0A 5E08H 2GUOA 3X3FL 1NLBH 3V7MA 1NJ9A 3RRQA 4GAFB 2D7PA 5DT1H 2W65B 3MCLH 1TCRB 5DGRA 1U3HC 4AEIH 2Y06L 4R0LC 1S3KL 3TBSA 1IARB 4HJ0D 5FYKU 3S4SG 2FJHA 5KSBF 3MFFB 3HE7C 1PGRB 3UTQB 1CK0H 1A6ZB 4JM2D 5DLML 3MGOB 4X9HA 2JB6B 4FMFA 3W0WE 1MWAB 2WLZA 2YKLL 2GJZA 1NCDL 4OCNC 2YN3A 5BRZE 4JPVH 4Y2DD 4X7SH 5JDSA 5KOVC 4NWUH 1VKXA 4XVTH 4P5TB 4Y8DC 1FV1A 3QDGE 1TQBC 2QQNH 3GJFH 5LJYH 4DUXA 4QRUA 1CXHA 1FG2B 3L5XH 5EDXA 5ICXA 4RGMB 3MCKA 4ORZC 2VDLL 2PYFB 1XGTB 2V5MA 5SWZE 2AI0L 1I8MB 3PWLA 2VDKH 4QLRA 5E1AB 4ETYA 3I75A 3H9SE 3UC0H 1PX4A 2BHYA 1TZHB 3VFRA 2RQ8A 1NFKA 2X2YA 1NGZA 5CEXA 3Q48A 2ZG3A 4NN6C 3CXHJ 3BGFC 3HZVA 3BIKB 3SDCB 4AQ1B 1T1YA 4ODUA 4KRLB 3DUSA 3E1F1 1YPZA 4JKPL 3L5WB 5I19H 1E28B 5ACLA 2HG5A 5D93B 2EDQA 2ZSWB 3DLQR 5D7IF 3GO1H 4NQCE 3RVUD 2NY4B 2IANE 5GGTH 5DJXA 2H3NB 3P9LB 2F5AL 5EZOH 4HLZH 5D5ME 1MCHA 3KLAB 4DAGH 3QQ4B 2UV3A 5DEGA 3RBSA 3HFMH 1XF4B 4KV5F 3CSBA 1LP9A 5E8NB 4U1MA 1A2YB 5BQ7B 5TDOB 3KPSD 3RHWF 4GMSL 4X6CE 4G8FB 3EFDL 4PJHE 3D87B 3HUJF 1KCSL 4TOYL 4P23A 4RMSA 1G9NH 4RBPH 3QI9B 4POZC 4ENED 4RCAA 5DVMA 4QNPE 4XAKE 3QXAA 1UENA 4JFPA 1CD9B 2EXWC 4TULH 1EJOL 5SV3A 4NNYB 1RV6X 4PRPE 1KUMA 1BBDL 4JVWA 2QHRL 3O6KL 5E8OB 1JYVA 4M8QA 4ZO6A 5F1IB 3IGAA 1BJ1H 2B8OT 2X7LB 3TC9A 1OB1A 3DX7A 5C9JA 3S37X 1QFWL 3OPZL 5KZCB 1NC4A 1LDPH 1EO5A 3E8UL 4NNXB 2Q86A 3A67L 3BP7B 3ETBF 4HJGA 3TZVD 4XWGH 4HS6A 5C8JB 5FGCB 1DFBH 3CU7A 2R1WB 5DD3H 3PP4H 5IB5A 2W9EL 4ELMB 5GJSH 4IIQB 3LMJL 3VXRE 2J6EL 1T04A 2WUCH 1N5AA 4D0BA 5DJ2B 4PJ9A 5C0EA 4CN4A 2J6EA 4ZFOB 5IMLB 4PRHB 5IW1B 4I0PB 5HGAB 4F7PA 1MCWM 4BUHA 3BPNB 4PGZA 5E99L 5FM5M 4L9LC 4X80L 1OGTB 2DN7A 3LPGA 2VXTL 2XI9A 3CX2A 1WZKA 3MRQB 5I2IA 3F7PC 1RZKL 3HKFA 1CD1A 3OZ9L 4R4ND 3BPLC 1I1AC 3RNQA 4JFDD 3BOVA 4IRSD 5IVXB 2FHCA 3HPJA 4WEBH 3AY4A 4O4YH 4U1LB 1T83C 4NHUA 1MHPL 4U1JB 5F21B 3BH9B 3KYKH 5I1LB 1DVFA 1WEJL 2PYEE 3D39B 4N9OB 4YHKH 4AMKH 3QZWG 1K4CB 1KPRB 4LEXL 5CJBA 4ZTPL 3CD4A 3B9DA 4CU7A 4BQ6A 2N7BA 4P3CH 4CGTA 3QEHB 4XCEA 1XGRB 3OHXB 4ZNEA 2X4TB 1IC5L 4N0RA 2H2SD 4NKMB 5F72S 3HRZA 5E6YA 2AJZA 2VIRB 3TPUA 3NZHL 4ZS6D 3UYOD 1XGYH 1IL1B 2HH0H 3PGDB 4NOBA 4XMPL 3EO1B 1RY7B 3U36A 1N5YL 1LO3L 2BVOB 3FO2B 5FUCE 5J9PB 3N50A 3C6LA 3SPVB 2AEQL 2PW2A 2W1NA 5D2LF 3SKNA 5HTSA 2Z93A 4Y4KB 3WLBB 3GNMH 4NRYB 1CF8L 1TQCB 1OTSD 4N8VG 4J4PA 1I9IL 4WU7B 1M05B 3X13B 5FYKL 1HQ4B 2O5XH 2NLJB 1JPTH 2ZKHH 3NCYP 4JG1H 5I8CA 2G75B 3RGVA 3WIHH 2EZ0D 2YPVL 1VERA 4NN5C 2YSSA 2AK1L 3GK8H 3HZYB 5C86A 3HZMB 1UJ3A 1T7ZA 2H6PA 3BQUD 2BNRE 3C09B 4U1HA 5EOTA 4Y5VC 3S35H 3TN0B 4JO3H 5D8JL 4CVWA 1YQVH 3VXOB 5F9JB 5MEQA 2XTJD 4BSVA 4KVNL 1T1ZB 2VH5L 3O2WH 2X9YA 4FQLL 4E42B 4YBLC 5AZEH 3ULVC 3NAAL 4J3UA 3QRGH 1J88A 1UXWA 4K94C 5F3HA 1FG9C 4GH7B 1I9JH 5J7CC 4JG0H 3KG5A 1AQDB 2J88H 3D0LB 43CAB 5IMKA 1XGUB 1DQMH 3DVGA 1H3TA 3O2DH 3KPNB 3SDDD 3TF7C 1A7PH 1Z0NA 3ZYOA 1KLGB 2IFFH 1LNUA 2D31B 4K9EC 4O51A 1ZXQA 3VFGL 1H9VA 4XZUB 3HI5L 1EXUB 4MA7H 2XZAH 5I0DA 4G5ZL 1YNTA 3Q6GH 3VFUB 1Q72H 3SKJL 1IGTA 1EEQA 4Z78B 3A6BH 2YWYA 1G6VK 1HOCA 3RUGA 4NIKB 2BDNH 1OL0A 1NDMB 3BKYL 3CDGB 2C7UB 3GSQA 3FO1A 2IQAB 5DUMH 3S97C 3LN4B 5BVJA 1LEGB 5HGBA 1CQYA 4IMKA 1F3JB 1HHHA 4D0DB 1J1OH 1KXTB 3ULSB 5KSAA 1AXSB 3T0EC 1ZLWK 5E56A 3MRPA 5HI4D 1YN6B 2F53A 3WHXA 4OQTH 3WXWH 2YD9A 1OQOA 3NCJH 3MRKB 1CG9B 2R2BA 5E2UL 3B4NA 5D9SA 4BQBA 3W5MA 4PRNA 5DRZA 3H0TB 2R69H 5ESAB 5TQ0L 3QIBD 3ARGD 1YPZF 5I8EB 1K85A 1KTKE 1JPSH 3FTGA 1U8OB 2VLKD 1YNLH 5FUOH 4FFZL 5EOCH 4EIZC 2W59A 3P9MB 3ILQC 5J11B 1RUQL 1DR9A 4YHYB 2E9BA 2UYLB 1MFBL 4KI1A 5FV2A 2FDBP 3QHFH 4L3AA 4FP8L 2PCPA 3OX8B 1FNEA 1OD7A 3BUYA 4HT1L 1YUHB 4X4MA 4BH8A 1LP9F 2VSCA 4MMZC 5C08B 2X1XR 1IAIM 4JAMA 4WHYH 4Y4HA 1FJ1B 4LMQI 4OTXH 3P4MA 4POUB 2AP2A 5I9QB 3J8F7 3E3QE 4MJ5A 1WC7B 1RQ5A 3IDGB 1FZJA 3CSYA 2DL9A 2PXYB 2DWDB 3R1GL 4AEEA 1KCRH 4LCIH 4WWKC 4PTUA 3NFNB 2VDML 3MJ6A 4LRNL 5EZJB 4Z76A 1VEMA 5FYLD 2X70A 2BCKA 3BPOC 3ZKND 2VDNL 1HXMA 1KENL 2W0FA 3QDJA 1MFNA 1FNSL 1GAFL 3K80A 2NXZB 1BJ1J 1U42A 3ARDC 4XNZC 5DWUH 3QUZB 3VWKB 1JP5A 5CSZB 1UACH 1ZHKB 1BQUA 1BMGA 3MLWH 5EUOB 3SKOB 1B0GB 2V5YA 4JY6B 1OP5H 3TO2A 2BMKB 1OT1A 3QPQC 3BYTA 2AERT 1GXEA 1P7KA 1XCQA 1S5IH 3M1BB 2O61A 5I1IH 2BVEA 4R3SA 3W0WA 1ED3B 2EE9A 5AZ2L 2B0SL 1MEXH 5BRZA 3H3PH 3U82B 3ZE0F 4Z18A 4GXVL 4LAQH 3KAAA 3LS5L 2GK0B 3CLEL 3QDGA 4EVNA 4OZIE 3MLZH 4FQJH 3M07A 2VOTA 4XHJD 5C0GB 1GZQA 3HMXL 3QCUH 1KJMB 2AQ1A 1J0YA 4WV1A 4L8CA 1AY1L 4Y4FC 1A9BA 5SWZA 3BMVA 3HMXA 4QF1A 5DJ0B 1RULH 2A6KA 1H3PL 3L7EB 5HGDB 3T2PA 5E5RB 2GI7A 1DBBL 3NN8A 4NQDB 3TIEB 4HUXA 3VXNA 1U8PB 1LEIA 2YPLB 4KMTH 3WS3B 4K71C 5DSCB 4M6ML 1JZ5A 3F58H 3CLFH 2CK0L 4O9HL 4FFYL 4M02A 2IANA 1F58H 1QBAA 2GSIA 2DMCA 3V52H 5J6GB 4NPYB 1IGJA 4I2XB 4WGVB 3IS1X 4O02L 1MHEA 1HSAA 4XB7A 5CWSA 3C5ZC 3DX8A 3GSUB 1FIGL 7FABL 4JR9H 2NY5C 4UT7L 4PJHA 4WCYH 3N1FC 1KCVH 3KVQA 4UDTA 3QUYB 1RUAH 4R6UA 1BOGB 3OKMA 4ZODA 5GGVL 1TJHH 3D18A 4EOWH 5C0BB 1EJ6A 3BO8A 1NBVL 3UDWC 4YXKH 4NKQB 2MNUA 2GYSA 2C26A 5CAYB 4MCZA 1DLHA 2ICWA 2Y6SD 1GJIA 1Q0YL 4AEHL 4KI5C 1WIPA 1B88A 2J8UF 4U1NA 2EKSA 5B8CC 5E4EC 1R5VB 3IJHB 4Z8FL 3G6JB 4U05A 1T0MB 3O6LH 4Y5YC 4EQ3A 4PG9B 3LQAC 1S7SB 1FZOB 5I71B 3T0AA 3ULVE 3MV7D 3VXRA 4YBQD 4HLZG 5K33A 3WFBH 3QHZH 1FE8H 3ARZA 3IDMB 4AL8L 2CDEB 4RAUB 2V2TA 1R3JB 4K23L 1U8LB 1FBIH 4BH7B 4OCSL 4D8PB 1A6VH 4M43L 5D2NC 5DHYB 5CLWA 2BFVL 4GBXD 1BZ9B 3FB6B 3IFNL 3MXVH 2PO6D 5JW3H 4M48L 3JZ7A 3T1FA 2R9HD 1ADQH 1IT9L 3ULUC 3B9KD 1K9TA 1V3MA 1IJ9A 3BEWA 4HGKC 3HA0A 3CFDA 2BVTA 5C71A 3D1MC 2PYEA 5JA9A 1MUJA 2P8MA 3JWOH 2F19H 2IGFH 3RUGF 4WI7A 1G6RB 1ZTXH 1XIWD 3DX9B 1FFOB 3GBNL 3T0EE 1JYXA 1LO5A 4E5XA 1AHWC 3AUVA 3DROA 4DZ8A 2KPNA 4G9FB 3TBTB 4XBEH 3MLRL 4JVPA 4O2CB 2DLFL 3QDME 1ZLVK 2I60H 4L4TD 1ORSB 2BRRH 2ZOKB 3JWDL 3MOAL 4WW2B 3KNBA 5FO9A 2QR0B 4Z5RA 2HLFC 4HKXB 3CFEA 4LCWA 5IJKA 4X6DB 3VI4F 5AWNL 1S7VB 5JDJA 1FSKB 1QP1A 2ZCHH 3MBEB 2R8SH 4TSCH 3WJLA 1CZ8H 1V7NH 3WMSA 3TP4A 3BPCA 1MH5A 3X12A 1AGFB 4TSBH 2YD2A 3NACH 4NCDA 3SGJC 3H3KA 4HWZA 4DKFL 5ID1B 5F6HJ 1Q9WB 1X5KA 1XR8B 1LD9A 4XI5C 2P7TB 5IFHL 1MFAL 2AV1B 4MB5A 5KAQF 2B1HL 4GW4B 2Z9TA 4WI4A 4Z7OF 3S36X 4MNQA 5LXGH 4JM2B 4YFLF 1IE5A 4GKOA 1P1ZA 3NGBC 1VPOL 3SO3B 4X5WA 1QSZA 1RSFA 3FJTA 4Y2DB 4JO2L 3I3BA 4UT9L 5D96B 2FH8A 5DC0A 1QBLL 4F37F 5HDQL 2BNRA 4LQFL 1UEYA 3RJQB 3S88L 1TJIH 1UM5H 1AFVL 4R2GD 3TT3H 4AIZB 1H5BC 3QA3B 3AGVA 4NKIH 1TIUA 1Z3GL 1WBYA 4FQCL 3Q2CA 1OSZB 4N5EC 2XPGA 2EECA 3I85A 4HWNA 4B50A 4HFUL 4FZ8H 2QKIB 5ITBL 4HDIA 3GM8A 4XP5L 3ARPA 5F7NC 4KK6C 1CDCA 4R0LA 3ZTNL 1BBJA 1CD8A 4NO0D 5KG9A 1QSEE 1UCTA 3HE7A 3F7YB 2V6HA 1DBKH 5EU5B 2JJWA 8FABA 1ROWA 5L88L 5DA4A 5JXAH 3VRIA 1OP9A 15C8L 4XCNB 3NH7L 4P2QE 1WIOA 3M17B 5IROA 3BSZL 5EA0L 2VLJD 1OAXL 4U7KA 3VH8B 2VJXA 4KKCD 4X4YB 3PNWB 3WN5A 3WCYA 3LKQA 1TVDA 1YDPB 4LF3A 5MEOB 4P57A 4H5SA 1FGVH 4JPWH 5JQ6L 3B5GA 3QUXD 2DIBA 4KK5D 5K9QG 3KPSB 1IAMA 1CE6A 8CGTA 4BZ1L 1T6WA 5GGVY 1DQTA 1IGFL 4OF0A 1R3IH 3U7YL 4AH2B 3IDXL 2WWMC 5I17A 1JNHA 2O26U 1FAIH 3IJYA 3MLSH 4MVBD 4RGNC 2XN9E 2X9XA 2A83A 1RZ8A 1HHJB 3OGCB 1H3XA 3LEXA 1EVUA 3TCLA 1U92A 3D85D 3LKNA 3FQXA 2UZXB 4HQQH 1JE6A 1UB6B 4CNIB 4HIXH 4RQQB 5L2KE 4MA3A 4G80A 3WD5H 2GTZB 4RMUA 4JFZH 1S9WA 4NO2A 3PWVB 3TZVB 1WVZA 4XBPB 4YC2B 1DQQA 4HK3J 2VXUL 4OZGB 4WI5A 1EV2E 3TIDB 1NBYA 2Q6WA 4FNLH 5CEZE 3WLWD 1FFRA 1S7QA 1VFOA 1E6JL 2PR4H 3CPLA 1FVDB 3IU4H 3SE9L 4DUVA 4GG6A 2CR3A 2Y4SA 4JB9L 3RZCD 3UTPE 1HEZA 2BC4B 3MRFB 3PHQB 1JGLL 4PJHF 3L3KB 4JEGB 2BY1A 3PXHA 1MJ7L 4HK3N 4HAFA 3GJEB 4JFXB 2FNBA 2BVQA 1MAKA 1ZA3B 3F6IA 3CUPA 4QNPF 1Y0LA 2VL5B 2VE6B 3U0PB 1G7QB 3PWNB 5LBSL 2EXYC 5KVDH 3BYYA 1X5LA 2DM3A 5FOJA 3PABB 4JFDB 5GGUA 1NANI 1ORQA 4IRSB 4HX1A 1FDLL 1P4BH 4YHLL 1EFXD 4APQC 1Z0MA 1B2WH 3ZHLA 1K6QL 3DYPA 5TE4H 4O00A 4U33A 1JI1A 3EGSA 1ES0A 4KVCH 3OKLB 3GMNA 4M8VA 4JLRB 5DD1H 5I18H 1ZE3C 2FX7H 4UTAH 3OKNA 5AYUL 5HPMB 2VDRH 4LSVH 5HBBA 1CR9H 3T3ME 1H8SA 1N0XH 2HT3D 3MJ9L 4L9LA 1S9XA 4NBZB 5D2NE 1JHKH 1A22B 2FBOJ 5FK9A 4I18C 1J8HA 1FYHB 2APXA 4IDJH 1X5IA 1RIVL 2R1XB 3HC4H 3MJ9A 1MCOL 3NOIA 4L4VD 4OZIA 1I1AA 3MLYH 1I3RA 3UTZB 1U91B 3GSRB 3C9NA 5E1HB 3O2VL 4XPBL 2IG2L 4I48B 2OL3B 5I66B 3FQWB 3H2WA 4X7DC 1A4KB 5DD5L 4XBGA 5KSVB 3BXNB 4NM8L 4JQIH 3CZFB 4ZTOH 2NMSA 2EH8L 3WUWB 3UBXI 2GW5A 4JRXE 5IM7B 3KS0H 4WFHE 4TUJA 4I0KA 1JHLH 2X4UB 4HEME 5CIPA 4PIRF 3O3DB 3BMWA 1YECH 3OXRB 1F6FB 3IXAB 4N0UB 4C59B 4KHXL 3KHOA 2HKHL 3BQUB 4RGMC 1MNUH 3GHEL 1ZGLA 3O3AB 4HKBA 4P9HH 4RZCB 1SEBB 2ICEA 5EBWB 2XTJB 3EYVA 3UPRA 3TVMD 1JHTA 3EKCA 5TFSL 4YXHH 1A7NH 2RFXB 1AI1L 2Q8BL 1A7RL 1HQRB 1G9MH 3SDCC 5KVGH 1MHCA 2IADB 2VQUA 5JOPE 1MRCL 1G7LB 1S7XB 5D93C 3ZHKA 1QLEH 3DURA 1PAMA 1BAFL 2CLVA 2WLYA 1QO3A 4KKNA 1AR1D 4TPRL 2I27N 3SDDB 1QKZL 5T33L 4OFKA 1GYAA 3D0VB 3FB8A 3LVEA 3CCHA 4M93B 4TN9A 4WFFE 4JE4B 4QRRE 2NNAB 4QTIH 2AKRB 4OM1H 4RX4A 3MYJA 3ULVL 5IEHB 5HI3D 5LCVL 43C9B 5E95B 5K9OB 4XPGH 2VZTA 3I6KB 4K94L 1OTTC 2MPAH 3WEXB 3OKKB 5HD8C 1VFBA 5L8KB 1M7IA 1RU9L 1CTNA 3BE1H 2MFNA 1CFTB 2VDOL 5KW9L 4LPUA 1WV7T 1IGIH 4HPOL 3LQZB 1X9QA 1E4XI 2OR9L 4G6AD 4I5BA 3FT3A 4M1CD 4KPHH 5KSBB 1J1XH 3L1OH 2N4IA 3NIFE 1R24B 1C7TA 5HHNB 3QIBB 2HKFL 4JFOB 3ARGB 2P8PB 1C5CL 3U4BH 3MRBA 4F7CA 4LBEA 4PJCA 3HTLX 4ETQA 2E3VA 3WO4C 2FIKA 4KK8D 4ZUWA 1XH3A 2F54A 3FONA 4J12A 1JRHH 1NGXB 4F9PC 1JPGB 4JO1L 2YA1A 1KJ2B 2J1KA 5H2BB 1VGKB 4PJDE 3UTTE 4UOW1 1A3QA 4J6RL 5I1AB 3VD9A 1UH2A 2FHFA 5GGQH 1NAML 4U1IA 1ZV5A 1UB5B 2CMRH 1JNJA 3MBXL 1JF6A 3MODH 4I0PC 2D2OA 3T0EA 5AYQA 4OAWB 2OL3H 3BPNC 4FABH 1EH9A 1NAMA 5DJ8A 3QDMA 2KL6A 3TJEL 1ULVA 5T3XD 3PQYE 1U3ZA 3BHBB 4OFYA 2MQCA 1FLRH 2EIZA 1EGJL 1T66D 3ILPB 4ODVH 5GS0D 4GMTH 3O0RH 2PETA 3E0GA 2UY7A 1INQA 4OKVA 1EGJA 3IAQA 2IBZX 4E41B 1B90A 1C08B 2LU4A 4U3CA 5LKNA 5LWYL 1ZA6A 1KJVB 2FIRT 2E6QA 5HYJE 2FWOB 1ZLSL 1XGPA 4KJYB 2BHUA 1RHHA 3LRSA 3U46A 4DKEL 2DQUH 4MCYB 3EO9L 5DJDB 4U1KA 3MROA 4JDTL 2ZCLH 2J7LA 1KB5H 2C3XA 1DUZA 3O6ML 5J06A 4WWKA 4GG6F 3UP1A 5GIRA 3BH8A 2OX5A 3CFKA 3AXLA 5ETUB 5E7BA 1S9YB 1CL7L 4UV7H 1WIUA 2FL5A 2NY2B 3KR3H 1VGEL 4KUZL 4DUWA 3S35X 1MI5E 3LEVL 4NBXB 2AEWA 1MCKA 4HV8A 4Y19E 3LH2L 3G04A 4Y4KC 4A2LA 5I1DA 2NY0D 3ARDA 5JW5B 1TQCC 2B1AH 2RCSL 4X8JB 5F7UA 3CDYA 4PJ7F 3D69B 2YD5A 4P2OC 3UYRL 4U4BA 3ZL4H 1QSEA 5C0CE 2OXGA 5SX5K 3HI6H 1NBZB 1L7IL 1PSKL 1FZMA 1QFUL 1QQDA 4NDMB 3C09C 2F58H 2PTVA 5IIEB 1YEIL 3VXSE 4AENA 1NKRA 5DTFA 1JF5A 3TN0C 3X11B 2EEBA 4P46D 4LPXA 1AJ7L 1RZ7L 1HDMB 5MERB 3GI8L 1GOGA 5EFIA 2BSSA 1D7FA 2KZ1B 6FABH 1LK2A 4WW1A 3HNVH 4Y4FA 3OGOE 4AJ0A 4ZUVA 3C8KB 5CZXD 1WBXA 4OZ4A 5EU6D 1EMTH 2J8OA 4PBXA 4DGVL 2P8LA 4XPHL 4B5EA 4DGYH 4U2YA 1WJ3A 3EYFB 2Y5TB 5IWLC 2AGJL 4RDQG 3UBXB 3PWPD 3L95B 1G7PA 4LVHC 1AD9A 3V6FB 2XN9A 5CBEA 2A6IA 5EN2A 1BJMA 1BQHG 4QXWA 5JW4Q 4LLYA 3V7AE 1Z9LA 3AS0A 5TQ2H 2M2DA 3C08H 5E4IA 4Z77A 5ALCH 3BP5B 3QG6B 4KKAC 5L2KA 5CEZL 2DS4A 1B4JL 4ZPTB 2GTWB 4TTGA 2YPKB 5GXBB 1FN4B 1R0AL 4EEEA 3C5ZA 2HT2C 3RWEA 2VAAB 2Y7QB 3MV7B 2K7QA 3X17A 5JIIA 1JZ4A 1UKSA 2OTUB 5IHZB 3CFIC 2CIKB 1EEUA 4PV9B 2X4NB 4KRPD 3H9HB 1P9MC 1B3JA 1FORH 5CJ8A 2E8YA 1TVBB 5DUPH 2GJ6D 1J7VR 2FLBT 3IU3B 3MRNA 4GBXB 1CICD 5IT2L 1HKLH 4WI2A 25C8H 2PO6B 4EDXB 2HFTA 1FO0H 1PJ9A 4RWYH 2OZ4H 5B8CA 4M00A 4YHYC 3BDBA 4Q9RL 3FHQA 3H7BA 2XA8L 2DD8L 4XAWL 3LB6C 3B9KB 1AD0B 3H42H 4OI8A 3T1WA 4WFEE 5A16B 5BZWB 4LCWD 3TEUA 3CXHK 1ERNA 4KTDH 2GFBB 3TPKA 4HKJB 1NANH 1XIWB 5I9QC 5IGXH 1EPFA 3A6CH 3DRTA 2XKNA 3PWUA 4L8BB 1YYMH 1S7WA 2PXYC 5T5NG 3ULVF 4OGYL 2PF6A 1FH5L 3HB3D 4UILL 2ADJA 4QRQB 3LQMA 2ERJB 3GB7B 3VDBA 3KPOB 5M94B 4PGEB 4PV8A 4M3JA 3P4NA 1U8HB 3SGEI 3P0VL 5I76A 5DEFA 1WT5C 3VMPA 4ERSH 2FJHB 2XWJA 2NXZC 1FGNH 2KH2B 1DQDH 1G7JB 3DRQB 5FGCE 3RNKB 5AD0B 4MNQD 1A14H 4ELME 2HJFB 5F8RC 3I6GA 2MMXA 2YMXL 4NWTL 4H25A 2I5YH 2E7MA 2GJZB 1WLHA 2VDPL 1DN2A 5KN5A 4G8EB 1QA9A 3MGTB 4PJCF 1BQSA 1NL0H 3GSWB 2C3VB 3I2CL 4PRHE 3F6LA 4CVUA 2XY1A 3CU1A 3F7VB 1AHWA 4QRUB 1D5MA 4UQ3B 4J3VA 4JRXA 5FHAH 2FYYA 1D6EA 3ZDZE 2VXVH 4HJJL 3T2NH 1Z2KA 4UAOB 5F9OH 5DJCB 4U0RB 1HZHL 3E6HA 3V0WL 1F13A 1NFIB 4JVUA 5IVXE 3TBWB 2WWKO 3EFFB 3MO1A 4UI2A 1S9VB 3RWJB 5CGTA 3GHBL 4R2GB 1YPZB 1ZVHA 5DJZA 3D39E 2EYTA 3IETA 3OR7A 4NFCA 3SGJA 4DJMA 3B5TA 4R4BA 3KYMA 4OCRH 5F1NB 5GRZA 1F45A 4NO0B 4X4XB 3CMOH 1U8IB 4YDJB 4UMGA 4HHAA 3U1SL 2LU3A 4WEMB 1OD9A 2ZP0T 1KPUA 3HPLB 4RAVB 3N06B 4LHUA 4H26B 4NGHL 2VLJB 5J3HC 5BV7C 3ARSA 5CILH 2DQHH 1NAKL 4QRRA 5C0FA 3ZSSA 2Q7NA 1BWWA 2FJFA 3G5XA 2V7HB 4UIKL 4OCXH 4MDJA 4JQXA 4TUKH 4X6EB 1CGWA 3P11H 3RKDD 3GSOA 3S5LB 1PDKA 1F42A 3D25A 3GUTA 1A7BA 4JZOB 5GRVL 3WDIA 5EPMB 3UJJH 3ARXA 4G3YH 1HI6A 2G5RA 2NZ9C 3G6DH 2X44D 3BX7C 2DQEH 1U2HA 4IRZL 1PQZA 1MRFH 3HMWL 5DT1L 4AEIL 1NMAH 1YY9D 3DGGA 1FZKB 2WUBL 5HJ3A 4ELKB 1RJYA 5HGGS 3G9AB 5E00B 3D85B 1KIUA 1S7TA 4HWEH 4A6YL 1ODAA 2Q76A 2XZQH 4KZEL 1KGCE 4JHZA 3BP4B 1X5JA 1TENA 5C0EB 2ARJB 1E4XH 4JPVL 4X7SL 2FECL 4A6YA 2UVFA 2F74A 5I71C 1N8ZA 2AQ3A 4OGZA 3QJHA 3OJDB 2QQNL 3L5XL 4XCYA 3HLAA 4PJDA 1J11A 3B2UD 3LS4H 1NGQH 1CGXA 1RZJH 1LEKA 3GKWH 1E4WH 3LKSA 3SKMB 1CD1B 2VDKL 5CZKA 5CD5D 4D3CH 3NFPA 3UC0L 3RZCB 1IMHC 3K4DA 3V4VH 3TJHD 1JVKA 3MUJA 3PHSA 5DD0L 2V2XA 3PQYA 4KDTC 1AP2B 5I19L 3QISA 2ZJSL 1WQVT 1CWVA 4KU1A 4M1GL 5DD6B 3PJSB 1KN2L 4X0KA 5EZOL 1RVFH 2CLRA 2HWZH 4XCEB 4DAGL 2DQIH 1EFXB 1AQKH 2HRPH 4I9WD 4OF7A 4HGWA 5GRVK 3T0DA 3IFLH 3HFML 4JM4H 3PDGA 1J8HD 4WO4C 3I50H 4DVBB 5JORB 1RZGB 3QUMA 5K9KA 4O2EA 4MX7A 4WW2C 3UEZA 3K74B 3O8XD 1I7ZB 3CC5B 1DSFH 3KGRA 2HJLB 3C6LB 3DBXA 5DQJA 1FSKC 2DICA 4E0RA 2Z93B 3MBEC 4F8QA 2BVPB 2EDBA 4TULL 4N0CD 1PBYA 5B39B 3H6JA 4L4VB 4MAYA 1T7XA 1PG7W 1MI5A 3EJZD 3TFKD 5I8CB 1P7QA 3GJFK 4Y19A 3KJ4B 2J8UB 3VGHA 4OV5B 2AK4D 3JTTA 3UTOA 2IMMA 1LO4H 4AT6B 5C08E 4NO5A 5HYEA 2BNQD 4XWGL 1UJ3B 4L8SC 1TDQA 2BP3A 4JDVB 1DFBL 4JM2C 5DD3L 4ZOCA 2YD4A 5EIIA 5JXEC 5HVGB 5GJSL 5DZLA 3T2QA 5CJ5A 3SO3C 5CS7A 5TPWL 5GRXG 1I8LC 4XC3H 1G7MA 4ONGH 3U79A 4DZBB 5E6IC 3CK0H 4IBLT 2BY3A 4NQSA 1T2JA 4XPTH 4YUEH 2WBJD 1F4WH 3IF1B 5F3HB 3T3MF 4EI5A 2VKWA 4KY1H 1BWMA 2VO5A 2Z91B 4QKXB 5D1QC 3GMPB 3WSQH 3V9FA 3SQOH 3WFCH 1MF2L 5EUOE 1GOHA 1C5BH 3TVMB 2W65A 1TCRA 3AB0C 1Q38A 1MWAL 4O51B 3EUUA 4WEBL 4O4YL 3MFFA 4KAQH 3UTQA 1WFUA 1A6ZA 4HZLA 3NTCH 2JB6A 4CJ0A 1MWAA 2HVJA 5FA4B 4RBPK 3D3VD 2P5ED 2P45B 5AG8A 4AMKL 4LDOB 3V0AC 3IAGC 3RVUC 4H1LH 4OZFH 5EIQA 1PD6A 4P5TA 3GSQB 1KPVB 3FO1B 5BOZG 5ILTH 4P3CL 4WI6A 2R0LH 5GS1A 2IAMC 2ED7A 1B9ZA 1XGTA 2DM2A 2Y1VA 4P3WA 3CFCH 1SY6L 1I8MA 4NZRH 3WHXB 2AJUH 1L0QA 1OARL 3KWWB 4UNVA 2HH0L 2R2BB 1MVUA 3MOQA 4GW1B 1YEDB 2A9NH 2UZIL 4NQDE 1SY6A 1AXTH 3BIKA 4ENEC 5ENWA 4YHZL 5E8EB 2E7LC 2YPLE 3PL6D 5J13B 5D1XC 3L5WA 2GAZB 5D7KD 1E28A 4YPJA 5IMMB 1NFDB 3U2SA 2ZSWA 3RDTD 3GNML 5ABDE 2F54D 4OFIA 4OT1H 5FGRA 4ZS7L 1T21B 1QUNA 1WZ1H 3P9LA 3VFNB 5JPMA 3KLAA 1JPTL 4JG1L 3T3PF 3TWCH 2WNGA 4F9LC 5GRUL 4JFED 4BH8B 1J0IA 1MIEH 4I2XE 4XXCC 5E94B 3CXDH 3TZVC 5E8NA 3GK8L 1A2YA 3WE6B 5BQ7A 4YC2C 5EBMB 5TDOA 3WXVH 1MJJB 4G8FA 4MJ5B 4EBQH 4JO3L 3VFWB 4MHHI 1K4DB 4HXAL 1O5DT 2NY6D 3QI9A 3VFSA 2C5DC 4Q97A 5JOFB 1BZQK 2IBGA 3O2WL 1TETH 4NNYA 4Y8AA 1HH9B 2XXMB 1LVEA 1RHFA 2ZUVA 3OF6D 4FTVA 5C0BE 5J6HA 2W0FB 3RY5A 3QRGL 5DS8B 5I1CH 5BW7A 5E8OA 1QRND 5F1IA 1SMAA 1GPOH 3UO1H 2J88L 2X7LA 1DQML 2WWKT 3QFDB 4IRSC 3UAJD 3G6JE 4GLRI 1YEHH 4PJGB 3BP7A 5TF0A 4PBVC 2FEEL 3GIVA 5C8JA 1XCQB 1I1CA 4QRPD 5EOQH 1PG7L 3NIFF 2XZAL 4HS8H 4TUOA 1JMZA 1KC5H 3Q6GL 4IIQA 3IB4A 4ZFOL 4EUPB 2R29H 1Q72L 3A6BL 3NIDF 1VEPA 5DJ2A 4HIEB 1OPGH 3BDXA 4ZFOA 4PRHA 2R1YB 4C4KT 5IW1A 2NW2B 4I0PA 3NVQA 5HGAA 5I1KH 5L8JB 1N7MH 4PJDF 4WV1B 5E24E 5F7YC 1FC1A 1J1OL 4UBDD 3MX0A 2H2SC 3K3QA 5EO1A 1FNFA 3NCYS 4M6AA 4M7ZB 3FAXA 3BT2H 5C09D 4ZS6C 4NYLA 3N1MC 4FG6D 2IQ9L 4XPAH 3NN8B 4B53A 3DPBA 4ODXB 1NPUA 4U1JA 1TMCB 3BH9A 5E5MB 2VLME 2HA1A 3NCCB 3D39A 1VDGA 4DK6A 2YZ1A 2NY0B 1GGCH 1Q0XH 1T0PB 1TNMA 5FUOL 1YNLL 1YZZA 1OTSC 5TF1H 2LAAA 3VCLA 3QR2A 5EOCL 1KPRA 4J1UB 1LE9B 4G9FE 2GSIB 1BVZA 3QEUB 1KJ3H 4TSAH 3QEHA 1XGRA 2EZ0C 3QHFL 2UUDH 35C8H 1R5WB 2QTEA 2QEJA 1E27B 2X4TA 4NZJA 5INCB 4X6DE 4NKMA 2QADC 2VIRA 4Z7QF 5HHPA 1G0YR 3QQ9D 3UJTL 1IL1A 2X4SB 5D72L 3GIZH 5ICZB 4P46B 5DVNA 3EO1A 1I7RB 2BVOA 4UDTB 1KCRL 2XTJC 5C3TA 4HEPG 5J9PA 3SPVA 1CIUA 3QXTA 2AJSH 1L9MA 1KEGL 4NT6B 3OKMB 3WLBA 4OB5H 2IPTH 4NRYA 4HIHB 4JGUA 5EU6B 1GC1H 2FZ3B 1M05A 3X13A 4X7CC 4O2FB 3BZEA 2NLJA 3UBXG 4LMQE 1I85A 2W60B 3V5HA 2G75A 1UACL 1XF3B 3PWPB 5FGSA 3SDDC 3MLWL 4Z95H 2EIDA 4UUJA 2CQVA 3HZYA 3MREA 4U0QB 4X99A 4JN1H 3HZMA 4M93C 1S5IL 1KELH 3TN0A 5I1IL 1G7IB 3MRHB 3VXOA 5F9JA 2GITB 2IBZY 4XGZB 1T1ZA 4GRMA 3VGGA 1U8JB 5E2WL 1ONQB 4E42A 3JSSA 3HHRB 3MLZL 1T2XA 3QCUL 3EYOB 3DECA 4YAQA 5GS0H 2JIXD 1RUPH 1X5FA 4HGMA 2HTKD 3U9PH 1IC4H 1AQDA 3O3BB 1OAZL 3D0LA 2AEIT 43CAA 5C0RH 1CGSH 5IMOA 1RULL 3KPNA 3DARA 2NX5D 2OJEB 2D31A 4KRPB 3Q5TA 3BEWB 4XZUA 1EXUA 4B7IA 3QIBC 4UT6H 2DTML 3ARGC 5F9WC 3VFUA 1RJZB 2GJ6B 4KMTL 1CICB 2JB5H 2APTA 4Z78A 3K7UA 4H20H 4GRWB 4DZ8B 3IS0X 3K8MA 3T0XA 3FFCD 3KPSE 4OF5A 3CDGA 1F58L 2C7UA 5EO9B 4MA8L 4R4FH 1W0VB 3LN4A 3KNBB 3V52L 5FO9B 1E4JA 1LEGA 4GT7A 1F11B 4Z5RB 4D0DA 5CEYB 4I3GA 2DB8A 2N1KA 4K3EH 3L7FB 4LCWB 3FL7A 5I1HH 1IQWH 2MKLC 4GUPB 2P42B 2JJSA 1YN6A 1OM3L 4PP2B 2N7AA 1WZMA 3U6RB 1OP5K 4JR9L 3MRKA 1CG9A 4WCYL 4HULB 1QTYT 1CDHA 4C83B 4K8RC 1INDL 5ESAA 4BQCA 1RUAL 2WINB 5I8EA 1R3HB 5TJWK 3AS1A 1U8OA 3ZKNC 1TJHL 4EQ2A 3P9MA 4EOWL 1MVFA 4KRNA 4YXKL 2UYLA 4MNQB 4OZGE 3MR9B 3KYAA 2R0WH 3C5SB 3P9WB 3OX8A 5F89B 1W2KT 1A6PA 1YUHA 1C12B 4MQ7B 5JR1L 2A73B 1HNFA 5C08A 3X14B 3JV6B 3WV0A 3O6LL 2A77H 3NCEB 4P9MH 1AXIB 1WC7A 2Z92B 3MSPA 2A6JB 4YH6A 3IDGA 4OD2A 5DK0B 2DWDA 4JPKL 1AGDA 4W4OA 3P73B 3NFNA 4M7LH 3WFBL 5I73C 2XPGB 3QHZL 4LRIC 5EZJA 2NY2C 3PF2A 1GGBH 2A74B 4XHJC 4JFDE 5DXWA 2Q3ZA 2NY1B 4DGIL 1WT5A 2MSPA 4F2MB 5C0DB 3QUZA 3VWKA 1MCQA 3MXVL 1F8TH 5EUOA 3G9VA 1MCPL 1B0GA 4LSRH 4JY6A 1ADQL 2X1QA 5I16A 2BMKA 4ZXBD 3V4UH 2WBKA 5MHSD 3LN9A 3QIUC 1DBAL 4QHMB 3M1BA 2OQJB 3P0YH 2EYRB 3WN5B 2CRIA 4CL7A 1ADQA 4LF3B 3HAEB 1ED3A 3JWOL 2F19L 4HKZB 2IGFL 4NO3B 4IJ3B 1ZTXL 1CE6B 2C3GA 2GK0A 4Y16C 4XBEL 4GKZB 3K2UH 5HY9B 1KJMA 2BRRL 5JW4R 4C57C 1YJDC 2XOTA 5E8DH 1JNHB 4KROC 2ZCHL 5GGSY 5DJ0A 4NNPH 3DSFL 3L7EA 5HGDA 1CZ8L 4XRCA 2A83B 1X5YA 2NY7H 3LEXB 5C0IB 4NQDA 4U2ZA 5IEKB 3TIEA 1SYSA 2NYYC 1CLOH 3FQXB 2L4OA 4GRWH 5F7FA 1UZ8A 2YPLA 2YD6A 3WS3A 4K3DH 5IBLD 5DSCA 3RTQD 5EU3A 2I9LB 1PLGH 1S9WB 4N0UE 4KQ3H 4PTTB 3KPPA 1N59A 1DQQB 2Y6SC 2MWCA 3S34H 2VL4A 4OZHF 5LXGL 4D9LH 5J6GA 2EDDA 4YHOH 4NPYA 5GSVA 4JHAL 4I2XA 2XTJE 5CJQH 4GG6B 1ZHNB 5GHWL 1BIIB 3I6LD 3O6FC 3GSUA 4JCLA 5IBTH 2Y36H 4H1LG 4OZFG 3CJJA 4XWOD 1TJIL 2DBJA 1UM5L 2HYMA 2VLRD 3QDHA 3CUPB 4YDKH 3QEQA 5INDA 3QUYA 2OXHA 5CHNB 1HWHB 2IH3A 4XPFH 3LRGA 1BOGA 5FO7B 3RWHB 1ORQB 4HX1B 1MCSA 3RX7A 5B38G 4PJ7B 3WO3B 2J4WH 1BQHA 4GBXC 2ZUSA 3HS0B 3EIFA 1O7SA 2B20A 5KANI 3GMMB 1R5VA 4YDIL 2R9HC 4Y7MA 1NMCB 5CZVL 1MHHB 1T0MA 2J8HA 4F58H 2NCMA 4GRLC 4PG9A 1ZVSB 2XQYG 3IRPX 1S7SA 1JI2A 2CUHA 1S9XB 3SE3C 2EE6A 1MCEA 1XIWC 3S37H 4GAGL 4GLRH 1J8HB 2Q87A 1FGVL 4JPWL 3IDMA 3U4EA 1TCMA 2CDEA 1R3JA 1U8LA 4B7LA 4KDVA 4BH7A 4OLZL 1I3RB 4D8PA 5KSBE 4OF6A 1P7QD 1G7HB 1Q9OB 3O8XB 2ERJC 5DHYA 3QBTB 3FN0H 2A1WH 5GJTH 1BZ9A 2Y72A 4WTZG 4KDTA 5I1GH 4RMVA 5GGRY 2M8XA 1K5NA 2B39A 1UH4A 2LAGB 3MLSL 2X05A 1QFWM 4PLKD 3IDNA 4ZPVB 2PNDA 5GS2H 1V05A 3PGFH 2X89A 1R5IA 4YBHA 2AK4B 4F3FB 1AE6L 4PJ8D 1NUNB 4HSQA 5TH2A 4HIXL 3WD5L 2B7DT 5T3ZH 3CZJA 3DX9A 4JFZL 2BVUA 1FNAA 1MREH 1DQLH 2BNQB 3DX6B 5CKAA 1KIQB 3TBTA 4O2CA 4M1DL 3W9EB 4J3OC 1VHPA 4FNLL 1ORSA 2EEDA 2ZOKA 4Z7VA 5KVEL 1MCLA 4UAOC 2QR0A 5ISZD 2BK8A 2PR4L 4U0RC 3EYVB 4HKXA 1EHNA 4X6DA 5IV2B 3IU4L 1S7VA 1JHTB 3MGAA 3S7GA 1LILA 2W9DH 4PJ5A 3RX8A 5FYLE 3S4SB 3C2SA 1AGFA 1SJHB 1WFOA 1KFAH 1W72B 3HZKB 4E41E 4QOKD 3V2AR 1UWGH 1GIGH 3RZWA 2ARJQ 1UM6H 1B6DA 5ID1A 5J56B 5KVDL 1Q9WA 1OAYL 1XR8A 3DNKA 2P7TA 1JZ7A 5IVZB 1CD0A 4JO4H 2AV1A 3VD5A 4OUOA 5DO2D 3BWAB 2V5RA 1B2WL 3ARWA 4JM2A 1J5OH 2G2RB 1IAKB 4RFNB 5TE4L 2HFEB 4WDIB 4KVCL 3D3VB 1V3LA 3FRUB 5DD1L 2P5EB 2FX7L 2ARWA 4UTAL 4FQQA 4Y2DA 3MRRA 2VDRL 4MJ6B 4LSVL 4OBRA 2V2WB 4KKCC 4D9QD 4W6XB 2MQ3A 1CR9L 4I3SH 3QXDB 1L6XA 1N0XL 1Y6MR 2CLZA 4AIZA 2CH8A 1JHKL 3QA3A 5EC1A 1OSZA 3T2OA 4KK5C 4GKSA 4IDJL 2QKIA 3FT3B 1XEDA 4N90E 3GM0A 1H3UA 2P44B 1WAAE 4M5YH 4PRPD 5I75C 2VZOA 3MJGX 1XFPA 3F7YA 4LCYA 3LHPL 5FGBA 4CRPA 3PL6B 3S98A 7CGTA 5EUOF 5EU5A 4NP4H 4MVBC 4PJCB 3RDTB 4LLMB 2FIKB 2SEBB 1D9KD 2F54B 4XCNA 4XX1G 3C2AL 1F90H 4GO6B 4RFEB 4IS6A 1NUGA 3IT8D 3PNWA 4P3DA 1W8OA 3RWIB 1YDPA 4JFEB 4D94A 3BIAX 5IB4B 4MNHA 3LN5B 1S78D 1UQSB 3KPSA 4TQEH 3EOYG 3WKNA 5A2JH 4NQXB 4LIQH 4HH9B 4QYOB 3VWJA 4AH2A 4P9HL 4ODSH 4L5FL 5LGKA 2EIZB 5IBUG 4KHTH 3RZCC 1KXVC 2E7LA 5FYJH 4I13B 3AY4C 1RZKC 4YXHL 1A7NL 1UG9A 4HBCL 1JZ6A 3T65B 3GMOB 5KVGL 5IJVB 3U7WH 3BGMA 5C6PB 3NMEA 1QRNB 1DN0B 4L4JA 1NGWB 1UB6A 4F7TB 4CNIA 1XGPB 1OLLA 1MY5A 4RQQA 2VQTA 4LSPH 2GTZA 3DIFB 3U46B 2DLGA 3PWVA 3TZVA 2BOCB 2YXMA 4QRPB 5GRWA 4RIRB 3MROB 3TIDA 5HXMA 4BFBD 2IJ0C 3MV7E 5DR5H 2VZVA 4WY7L 2FO1A 3FQNB 4OM1L 4EN3D 1FVDA 1J05B 3AXLB 5FUZL 3FHAA 4GSDH 4KXZH 1QEWB 4Q9QH 4XPGL 2BC4A 3MRFA 3PHQA 4BK4A 3UJIH 2MPAL 3L3KA 1ITCA 3C6LC 2HT3C 3RWGB 1WBZA 3GJEA 5F71A 3C5JA 3K4ZA 5I1DB 3BE1L 2A2QT 4FQ1H 4P49A 2VL5A 2VE6A 4RDQF 3U0PA 1G7QA 1CYGA 1IGIL 4Q74A 4RISH 5C09B 1IZJA 1EX0A 3LZFH 3QZWB 2AXGA 3PABA 4JFDA 1R3KB 4IRSA 4KPHL 4XTRD 1KTLB 4ZOAA 4GXUM 1J1XL 1RPQA 2O5ZL 1EEZA 3KJ4C 3L1OL 5CP3H 3P0GB 1TZGH 4JKLA 1JTTA 3U4BL 1OCWH 1FZMB 3OKLA 3IVKA 4JLRA 1UJ3C 3H3BC 3EZJB 1L4IA 1SM3H 5HPMA 5ECJE 4PB0H 3L3DA 4KMQA 4GQ9L 3FT2A 1CDUA 2AV7B 3AROA 2ITCA 2BSSB 4M4PA 2X1WL 4WW1B 2AJVH 2YOCA 5KTEH 1IGCL 3MODL 3ZKSD 1HNGA 1WBXB 3VDAA 2OL3L 2FECI 4N8VB 5I6XB 1U9KA 1OAKH 4U1SA 3UTZA 3GSRA 1LK3L 2OL3A 5I66A 3FQWA 1INEH 3MTRA 5J1AB 2NY3C 4RMWA 1A4KA 2W0PA 1FLRL 5KSVA 1YYLH 3TVMC 3BXNA 4ODVL 4K7PX 3GRWH 1V7ML 3O0RL 1ZAGA 2A6IB 2KQNA 1F4HA 5H94B 3WUWA 5A2LH 1QSVA 5IM7A 4TYUA 4KUCD 4Z77B 3OKDA 3B2VH 3VFTB 4MD4B 5D70H 2X4UA 1ND0B 2VUYA 1JGDB 3O3DA 3OXRA 3IXAA 4JFFD 5IF0A 4N0UA 4YHIB 1J0JA 2DQUL 2FO4A 3BQUA 5KSAC 4Z7VF 5FOBA 4KC3B 2ZCLL 3QFJD 1YPZE 4RZCA 1SEBA 4LL9A 4X6DF 5EBWA 1KB5L 5HI3C 5JMRA 5EZIH 3LPFA 4HUVB 4OV6F 1MQKL 3BKCH 4EJ1C 2RFXA 3MRDB 1EO8H 1D6VH 2FJGB 3KR3L 4MXVE 1KB5A 2IADA 1OTUC 5J13C 1S7XA 2JIXB 4LCCB 1QFPA 3BISA 3DETC 3TH2T 5IQ9B 2B1AL 4G6AC 4R96B 3NABH 3DO3A 3RWDA 1EK3A 2NX5B 5IK3B 3D0VA 4LKCA 2G60H 2ILLA 4JM2F 3ZL4L 1SVZA 1NLDL 2LTQB 2NNAA 2AKRA 2VLLB 4WUUD 5IEHA 5IFAH 1CFSB 2VN4A 3GSVB 2D7TL 2F5BH 3MA9H 43C9A 1F6AB 3GKZA 5KVFL 5K9OA 1ZS8B 5D1ZD 3FFCB 3I6KA 4OCYH 3WEXA 4POZD 4YHML 3OKKA 1CGUA 5D71L 4R7NA 2EXWD 1QFHA 1UKQA 6FABL 5I76B 3LQZA 1T0NB 3X3FH 4M3KB 4FS0A 3RIAK 5KSBA 1J87A 3ELAT 4H25B 4DGYL 2Y06H 1S3KH 1OGAD 4HFWB 3H7LA 4JFOA 1T66C 3ARGA 4DN4L 1WGOA 3ARVA 2VLKA 1MPAH 5DLMH 4M7JH 2WK2A 3ZE0E 4BQ9A 4X9IA 2YKLH 2YC1A 5ANMA 4YDLB 4HCRA 1NGXA 5K9JH 1JK8B 5JMOC 1JPGA 5TQ2L 4JFQB 5F44A 5H2BA 3C08L 5BZDB 1VGKA 4MHHG 1Q9LB 3SCMA 5I1AA 5ALCL 1IEAA 1I3GH 1IKNC 1UB5A 3QQNA 4X6FB 4OAWA 3RPKA 1QYGL 4WV1C 5FYLL 2D9QB 4M7ZC 4MJ2A 2X41A 3BHBA 2FHBA 3K0WA 4JANB 3ILPA 1TTGA 2EDLA 4W4NA 3KYNB 1YEGL 4XB8A 4JKPH 5A1AA 5LGHH 3AAZB 4F57H 1FORL 3ARBD 1RJLB 4L3CB 3L3GB 2NY0C 5DUPL 1C08A 4ZNEE 2GEEA 1T2QH 1KTDB 25C8L 2IBBA 5FDYA 1FO0L 2FWOA 2YA0A 4KJYA 4RWYL 3V5KB 4PY7B 4ZXBB 3OAUH 3R4DA 4MCYA 5ERWB 1GOFA 5IB2B 1FO0A 3H42L 4JZNB 5C0FB 4GMSH 1KF9B 4PYHA 3EFDH 4XVUD 4TOYH 4LCUA 5K9QI 5IGXL 1SYVB 3A6CL 5ETUA 3D25B 1S9YA 1YYML 4P46C 4L4VE 4ZNCD 2ZOLB 5EU4A 3KYOB 1NGPL 4H0GA 2RB8A 2W07A 3WDHA 2J8UE 5JW5A 3O45B 3U48A 1BBDH 3MFGB 5CZXC 3RIFF 3VGDA 4X8JA 5IKCB 2J3SA 4ERSL 1NCTA 4Q6IB 1FGNL 1RJYB 3D69A 1WAAA 2FCBA 3OPZH 4OD3H 1A64A 1T1WA 2FSEA 3V5DB 1S7TB 3E8UH 2BJML 2I5YL 4X4ZA 4YGAB 2VQ1B 5FAAA 1NBZA 1TPXC 1EZVY 2W9EH 4RWHA 3RTQB 2HMID 1NL0L 2APFA 2IALB 2J6EH 4NDMA 5IIEA 1N8ZB 3X11A 3G6AB 5BXFB 1S8DB 5CMAB 4HWBH 5T5FL 3RVWD 1HDMA 5MERA 5FHAL 3EYSH 3SKUD 3WFDH 2R4RL 4XP1H 1I9RH 1X7QB 3GJFB 3ESUF 3PXJA 4X80H 1KLUB 3DV6B 4WI8A 3NFPB 4N8CL 2DQJH 4Z7WA 1KG0B 2H9GB 3P4OB 4BKLB 1GH7A 2IH1B 5C2UB 4KZDH 4G43B 2VLRB 3EYFA 1T4KB 2Y5TA 1CTOA 5HYSG 3EHBD 5FO8B 4M6OH 3UBXA 1BF8A 1TZIB 1KYOJ 3L95A 4KRPC 1BLNA 4IOFD 3TNNA 5TDPB 2C4FT 4X0KB 1MFDH 2EYSB 4HG4J 2R56L 4HGWB 2DQFB 1CICC 4LEXH 2VTFA 4ZTPH 1EVTC 3U0TA 5JZ7D 2CXKA 3BP5A 3QG6A 5SX4I 3EJYC 5E7FA 4Y2OA 1D3CA 5D7SH 4ZPTA 1MCFA 2GTWA 3NFSL 5K9KB 4M5ZH 2JELL 2YPKA 5D6DC 1FN4A 1GGIL 1G1CA 1IKFH 4DEPB 1AC0A 4W6YB 3RIAF 4AY0A 4Z6AT 2DQHL 2Y7QA 3DYMA 5DQJB 5HVHC 4BSJA 3JWDC 4MZ2A 5BS0D 2OTUA 3WJLC 4OCXL 1NFDE 5IHZA 2ADIB 2OLDA 2CIKA 1N5YH 1KIPB 3P11L 4PV9A 2X4NA 1QRKA 1X44A 4NBYB 1F3RB 1T22B 2AEQH 4CUCA 3OB0H 2ATPB 3H9HA 3FB5A 4PRAB 5FUCC 3BRDA 2ZUWA 4PJBB 4RNRB 5HHXH 1P7QB 2D4FA 4HUWA 5DYOB 5I30H 1TVBA 2X89D 2E6PA 4G42B 3IU3A 3JTTB 5T1KD 1I9IH 2Z4QB 1JZ8A 2WSKA 2DQEL 1JGEB 2PO6A 1MRFL 4PS4H 1K3ZA 5SWSD 4L29B 1NMAL 2DMKA 1NCCL 2DBLL 4JPIB 2YPVH 3B9KA 1HHGB 3LAFA 4HWEL 3DYOA 4NN7B 5A16A 5BZWA 1GCFA 2HFFB 4PJ8B 4OSUH 4PJ5D 1E4XL 2GFBA 4HK0B 1QPPA 1SJXA 4HKJA 4HC1H 1XIWA 4X9BA 2EE3A 3ISWA 4PRBB 1EUUA 3QPXH 1BJ8A 4L4TA 1FL6A 5CJOL 4ODBD 5T3XE 4QRQA 1WTLA 3GKWL 5ISZB 3GB7A 4XVSH 5JHDA 4TNVF 3KPOA 3LV3B 3OV6A 1TNNA 2OI9C 4PGEA 4N0FB 3EBAA 5FHBL 1U8HA 2NY1C 3BP6A 4PJGE 2OK0H 2LVCA 1HYSD 3V4VL 2GKIA 1G7JA 3DRQA 4MB3A 3RNKA 5AD0A 4NZTH 4HZLB 3CSPA 2HJFA 5HVFB 4OIIH 4QOKB 1KN4H 2HVJB 3TNMB 1A0QH 3VFGH 1VESA 4G8EA 2YEZB 3MGTA 4YEFA 5IROC 4P5KB 3GSWA 3U9UB 1AIFB 2BY2A 3BJLA 2C3VA 3BAEL 2X4QB 5DRNA 5A2KH 5HHOA 3WN5C 3ZDXE 1RVFL 3F7VA 2HWZL 4UQ3A 5GS1B 5AAWA 2DQIL 1AQKL 3BKYH 2MQ0A 3IFLL 4IJ3C 2VR4A 4JM4L 4LLUB 2IC2A 1UJTA 4ODTH 5DJCA 3B43A 1NFIA 3TCXA 1MVUB 3O81A 4OJFH 4XCFL 5TE7H 3TBWA 4YHPB 3PHOB 1P53A 3RVVD 5ENWB 3EFFA 1DSFL 5GRJH 1S9VA 4MYWB 2GCYB 3RWJA 5I8KL 4I8DA 5C07D 1TJGH 4XMLH 3SBWA 1EIBA 1QACA 3QWRD 3HCVA 3U2SB 5E2UH 3AMLA 3OSKA 1MRDH 4Q0XH 4I4WA 4CMHB 1YMHB 5F1NA 5JPMB 5D6CB 5ICYB 4NO0A 3J7HA 4J23A 4X4XA 3VD7A 2FX8L 1U8IA 4YDJA 3GGWB 1LO4L 1MFBH 2KKQA 1YY9C 2A6DB 4LASH 2F9BT 2EDRA 1D9KB 4QT5B 5F96H 3HPLA 4RAVA 2FGWH 3VFMB 1ZGLM 4PJAB 3RX5A 3D5OF 1IEHA 4H26A 3VWJD 2VLJA 3VFSB 2D03H 4F15B 4HPYL 4XC3L 2V7HA 3DWTA 4ONGL 4X6EA 2PTUA 3E3QC 3R1GH 2JLLA 3S5LA 4UINH 3QUXA 4FTVB 4MA1B 5J6HB 3HC3L 4XPTL 5EU6E 4LRNH 4YUEL 1F4WL 4JZOA 3B2UC 4KY1L 5DFWH 5EPMA 4M9PA 1IM3B 3CMGA 4ORGB 1ZT1B 3P3YA 4LLDB 1VADA 3W9DB 4MD0B 2BX5A 5CD5C 3WSQL 3PWPE 3EJJX 1GAFH 1T3FB 4YGVB 4QRSB 3EOAB 3VGEA 3OMZA 3REWA 1P84J 3TJHC 1YEKH 3GIVB 4KI5D 1FZKA 1WAAF 4ELKA 3CDCA 1ETZB 3C60D 4TUOB 5E00A 3D85A 1NEZG 1CLYH 1J0HA 3NTCL 2JE8A 3WIIH 3BP4A 2ARJA 3IDJB 2EC9T 1DDHA 4U6VL 1P6AB 4H0IA 4P99A 5CGYC 3OJDA 5ILTL 3ZYJA 4JJHA 1RURL 4PP1D 3LS5H 3CLEH 5EO1B 3PE9A 1OAUH 3CDFA 3TBYB 4XMKH 3JTSA 3SDXB 4NYLB 3SKMA 4EN3B 4NZRL 4Z7WF 1I9EA 4IMLB 4ZG1A 2AJUL 5DJYB 3RZCA 3Q6FB 1I1FA 2I9TB 2X4RB 3O8XC 3FMGL 4X6BB 1L0XA 4XNXH 1AXTL 4YFDB 5B38A 4PG2C 1A6TB 2JJVA 1D5ZB 1MELA 4YNYB 2GJ6E 1AP2A 1DBBH 4OD1L 4ZFFA 4MXWH 4PJIB 5KANG 3VCLB 3ME0A 3ULUD 4U6YB 3PDOB 4GRWE 4HLJA 5DD6A 1FAKT 1WZ1L 2P1YA 3PJSA 4P0DA 4NCC2 4QO1A 4YE4L 3TFKC 2WMPA 4M6MH 4YXLH 2CK0H 4OZHB 1RZFH 1EFXA 4FFYH 1I1RA 3TWCL 3CVIL 1IFHH 4LCWE 1MIEL 2NZIA 3CXDL 5HHPB 4DVBA 3UCRA 2XNAB 1I7UB 1QSFD 3OL2A 5JORA 5JQHC 1RZGA 3WXVL 2EO1A 2LU7A 4O02H 4EBQL 3VRJB 2ESVD 1I7ZA 3CC5A 3SDAD 3DVIA 2HJLA 1F97A 2I25N 5DRWB 4PD4K 7FABH 2FGZA 4M62H 4UT7H 4ESKA 2BVPA 4WTZA 1TETL 4JFHD 5B39A 4L4VA 5C70A 4FHBD 5I1CL 5GRYA 4P5MB 3V8OA 4GS7C 3SGDH 3BZEB 4MNQE 3HRPA 3V5HB 3ZDYF 4G6FD 1CFQB 2J8UA 4OV5A 2EDHA 3EAKA 4UUJB 2APBA 3MREB 4AT6A 1YEHL 5C7XH 2VNCA 4X99B 5GGSB 4JDVA 4P2RD 5F9DC 4RFNC 4Z8FH 4FQ2H 4ZSOB 1KC5L 1KXQE 2D7NA 3RGHA 2HP4A 5FECB 5DK3A 4NJ9H 1MFEH 4GRMB 5FXCH 4DZBA 1JFQH 4JFFB 3W39A 3KPRA 4MAUH 2XQYK 3O9WD 3IF1A 5I1KL 4QY8B 2H41A 4YAQB 4K23H 1RK1B 1KT2A 2Z91A 4MSWB 3QFJB 4OCMC 3GMPA 4ZUUA 3BGAA 3BT2L 1RIHH 3FQUB 5IMOB 3MC0A 3FOMA 2BFVH 3TVMA 3TV3L 5I15H 1JYNA 2JTDA 4XPAL 3B8SA 3T8XB 2BRQA 4M48H 1X5XA 5HDOA 2YK1H 3BKML 1JWUB 1I3VA 3RDTC 5FA4A 1GGCL 2A0LC 4W81A 5TF1L 2Z35B 2DJ4A 3PP3H 1EBPA 3B9AA 1KPVA 3BD5A 1JWSB 3GBMH 1EUTA 3TO4D 2B4CC 1DANT 3OKEB 3PWJB 5ESVB 3L3HB 5FCSH 2FR4A 4WUUB 2DLFH 4Q7DA 3MOAH 4LP4A 1H15B 1KNOB 3MPCA 3KWWA 5D1ZB 4GAYB 4FFVD 4GW1A 1A1MB 1YEDA 5AWNH 3GIZL 1B4RA 1NDGB 5E8EA 5DRXB 3WNOA 5SX4H 4RGND 5IB3A 5IMMA 2GAZA 1II4E 3MA7B 1NFDA 3WS6A 1URLA 4OB5L 1CCZA 3ARYA 4MXVF 3RU8H 2Z0BA 5KOMC 3VW3H 1GC1L 1T21A 1JNNH 5KS9B 3VFNA 4I3RH 2EEAA 3SCMD 1O7VA 1OGAB 1MFAH 4RAHA 2B1HH 3UAJC 4DN3L 2DF3A 1LHZA 5E94A 4GG6E 1PW3A 1NMBH 3WE6A 5GGRB 3WJJA 5HYQB 5EBMA 3BI9X 4JN1L 5IUSA 5CKGA 3T09A 1K8IB 1MJJA 1JIBA 4MXQC 5DJ6A 4OD2B 1A9EB 1KELL 3W11C 3IDIB 4GXUN 3CIQA 3VFWA 1AGDB 4JO2H 1K4DA 2KUTA 4G6KH 3STZB 1DLFH 2V7NB 4N1EA 4LQFH 5JOFA 1DZBA 3LKPB 3S88H 4JRYA 1JBJA 1AFVH 5T3XL 1KCUL 3CFJB 1HH9A 4FQCH 1IRAY 4PJ7E 5DS8A 4Z0BL 2B2XH 4BK5A 5GS0L 3BN9D 1RUPL 4LVEA 3U9PL 4QXGL 4XP5H 1LO0H 2UUDK 3INUL 4DFIA 3V4PL 1IEBA 1X4YA 4FG6C 3QFDA 3BZ4A 5DMIH 5I16B 1A7QL 4PJGA 5EO0A 4K3JH 3BDYL 3KPQA 4PLJC 3QP3A 5J1SC 2R2EB 4UT6L 3ARBB 4HS3A 4U6HB 1T1XB 4EXKA 4I9WE 4EUPA 1N6QH 2NTSP 4IOSD 4H20L 4HD9A 2JCCA 2W91A 1ZMYA 1A3LH 1J8HE 4HIEA 3IKCB 4NZUH 4AEFA 1IKNA 2R1YA 2VC2H 5DQDH 2NW2A 2XG5A 4R4FL 2CGRL 4RGOH 5JQ6H 4CVXA 3SOBH 3RI5K 5L7XH 3UTSD 1IQWL 1UFUA 4OF3A 4Z7UA 3U7YH 1CFVH 1HILB 4TNWK 2X5PA 5I6XC 4XRCB 4C56D 4OIBA 1U8QB 2VMFA 4D0CA 1IAII 1SYSB 4ODXA 5FFLA 4CMMB 4XH2A 1FLTX 1UZ8B 4S0TD 5E5MA 5FDWB 4S2SB 2AK4E 3ZSTA 5EU3B 2DQDH 3KPPB 1N59B 1RK0B 2ADGA 1XCTB 4J1UA 4X9GA 2BNQE 3FFDB 1LE9A 3QEUA 4MJ4A 4NM4H 4NN5B 2BXZA 1R5WA 5GSVB 1E27A 1PX3A 2VXUH 5INCA 4M6NH 3B6SB 5IHBA 4WGWB 5EU7E 4Y5VB 4P9ML 2Z31D 2X4SA 4Y88A 5L9DH 4N1CA 3SE9H 5ICZA 4P46A 2QSCL 2E7HA 4JB9H 3QEQB 1I7RA 5INDB 3V8CA 3QEGL 3PV6B 1JGLH 1BPVA 1NKOA 3QXWA 2OS7A 2IH3B 4YBLB 1FL5A 4NT6A 4HIHA 5EU6A 1CXKA 3AC0A 2FZ3A 2ICWJ 1BQHB 4O2FA 2VISA 5LBSH 4LCCC 3DUUB 3TLRA 4ZUTB 2HTKC 4LLAA 2FX9H 2XFXA 2W60A 3HR6A 1FDLH 3MMEB 1XF3A 3PWPA 5LGJB 1F8TL 2HLAB 3D3VE 4YHLH 4K2UH 2P5EE 2WZPD 5MEND 4LSRL 1K6QH 3V4UL 4X5LA 4RMQA 1M6OB 2LTQC 4AG4H 3JXAA 5AYUH 1G7IA 3MRHA 5KAQG 5HHVH 2GITA 3VRLE 2Y23A 2DI9A 2J2ZA 1A6UH 4XGZA 1OTTD 1J86A 5HD8D 3U4EB 3KLDA 1U8JA 3MJ9H 3VGAB 1ONQA 4JKMA 5D4QA 5D7LD 1JRHI 3EYOA 2ORBH 1W0YT 3W5NA 5F3BA 1RUKH 2H8PA 2I07B 4QRTB 3O3BA 5AEAA 4CVZB 4LEOB 5D7KE 2XQBH 5E8DL 5BS0B 1K5NB 4LGSB 4PJCE 3VXUD 4NNPL 4XP4H 4D9RD 3WKML 2F54E 2NXYD 4P4KD 4I77L 5F93C 3SO5A 1UCBH 2NR6C 3IDNB 2OJEA 2OR7A 1CLOL 3VXPB 1R5IB 1LO2L 1RJZA 2GJ6A 1CICA 4K3DL 5TH2B 3OAYH 4JFEE 5CIPH 2EH8H 1IGYB 1CXLA 4YDLC 4O5LL 5SWSB 4KQ3L 2ZUQB 1EHLH 3VXMD 5EO9A 3FQRA 4JQVC 5CUSL 3V0VB 3VA2C 3S34L 4Z7VB 1W0VA 5D6DA 4AIOA 4D9LL 1F11A 2HKHH 5CEYA 3ZZ1A 1J9CT 5JHDD 4YHOL 1L9NA 3L7FA 3ZTJH 4JDZA 5L6YH 1KULA 5E2VH 4GUPA 4PJ5B 4UZGA 1ITBB 3MV8D 3MUY1 4RRPA 1CDJA 4PP2A 4TTDC 3SHSA 3U6RA 1CFBA 2Y36L 4OLYH 1QHPA 1HHKB 5LQBH 4C83A 2P49B 1AI1H 1N3NB 4YDKL 3SN6N 1QRNE 1Y18B 1EERB 3UZVB 1BZ7A 2WINA 4Y5XA 2JK5A 1NFDF 2XRAH 1R3HA 3N85L 3O3EA 2APVA 1MRCH 1I4FB 5EIVA 4H8WC 5HHOD 3KJ6H 4CW1B 3FT4A 4XNZB 2CKNA 4FMKA 2YUXA 4Q2ZB 2J4WL 4R8WL 1BAFH 4QRPE 4S1RH 3X3GL 3MR9A 4TPRH 1DBMH 1CU4L 4FFWD 3C5SA 5T33H 1U8MB 5F89A 2DKSA 4LSQL 2H2PD 1C12A 5H37H 4MQ7A 2A73A 1BGXH 1X4ZA 4FQQB 4UB0H 3MRRB 4Y1AA 4U6XB 1U8KA 4ZXBC 3X14A 3JV6A 4LAJH 4F58L 1M71B 3S96B 2KBGA 4GAJL 5MP6L 4V2BA 2ZUYA 4TNWF 3V6OE 2Z92A 2A6JA 3ULVH 5DK0A 3RKPA 2CLZB 5FM5O 5F88B 4JQXC 1AGCA 3P73A 4K94H 3QUKB 5EC1B 4TVPD 1OSPL 3S37L 1A4JB 5C09E 4GKSB 1RU9H 2A74A 5T1LD 4LARH 4XCCH 5F8QC 1FIEA 5GQBA 5IHUH 3OJMB 2V5TA 2C4FU 4K9EH 3UZQA 4F2MA 3FN0L 2A1WL 2OR9H 5C0DA 1T20B 4LCYB 4LVNB 5C07B 4J8RB 4S1DC 1S7UB 4Q9BA 5I1GL 2V9TA 4Q6IC 4PJGF 4X5XB 4P2OD 1FPTH 2DLHA 1YY8B 5FCUH 2HVKB 1J10A 4IS6B 1JPST 4QHMA 2OQJA 4WFGD 2EYRA 1QPXA 3EOTH 4P3DB 4K71B 3BEVB 5ADOH 1K2DB 4MNGB 5IBLC 3HAEA 3RTQC 3QWOA 2DYPD 2JCCF 4HKZA 4MNHB 4JO1H 4WRLA 4EZMA 4NO3A 5T3ZL 1ACYH 2W0KA 4J6RH 1DQLL 3ZDXF 5EB9A 3CX5J 4GKZA 3VWJB 5HY9A 5HPOA 4M4RA 2D3VA 2JJUA 3RA7L 1A21A 5ESQA 4DW2L 4ODHH 4HXBL 5CINL 3NA9H 4Z7UF 2EH7H 3WFEH 3TJEH 2XWTA 2W9DL 4U31A 3OAZH 4XWOC 3LDBC 5C0IA 1EGJH 3BGMB 1QFOA 5IEKA 4XNUH 1GIGL 3G5VB 1UM6L 1HHIB 4I1NB 2OMNA 4LNRA 2FBJH 2I9LA 4V1DD 4YZFE 3WFHB 3SJVA 4PTTA 5GZND 1N2RB 4XNQA 3C60B 4NRZA 1ZHBB 2HT4C 4XP9H 1REIA 1I75A 4DKEH 3Q3GA 3RWCB 5F7DB 4WHCA 3HNSH 3EO9H 1ZHNA 1BIIA 4JDTH 5EWIH 2CRYA 4DEPC 3LKOB 4MGXA 5ALBL 3DMMD 1DE4B 5IFJB 1WBZB 4K7FB 4I3SL 3C5JB 5DEZA 3B8YA 1CL7H 4CN1A 5T1MB 3ALXA 1G9NC 5CHNA 4MAYC 5FO7A 2AXGB 4CJ1A 3RWHA 2NX5E 4PJ7A 1RIUH 1EEZB 4LSTH 4UNUA 4DKAA 5IB1B 4DQOH 1SQ2N 2GK2A 3HS0A 5F6IC 4GKNB 1BM3H 2WV3A 1NSNL 1AKJD 3W81A 3IVKB 3GMMA 4NP4L 2OMBA 2OR8A 4PLKC 2AAVA 1MHHA 1A6WH 2C4XA 3IAPA 3L3DB 5IR1A 1ZVSA 3FFCE 1L7IH 4PUBH 1TTFA 1PSKH 3FT2B 1MLCB 1QFUH 1RI8A 1ZSDB 2ZG1A 2FEDC 2ITCB 1BD2D 3L3OB 3KPMB 4PJXF 4WJ5B 1FVCB 1IBGH 1RZ7H 3GI8H 1HK6A 2H32B 1QSFB 4EI5C 1CLZH 1QLFB 4U1SB 4KMLB 1G7HA 2ESVB 1Q9OA 3O8XA 4QXTA 3SDAB 3ZT7A 4ODSL 5CCKH 4PG2A 2CDFA 1NC2D 4KHTL 2Q8AH 2NXZD 2ZPKH 5GSRB 2AGJH 1NCBL 5CP7B 1EHAA 4BYHA 2GY5A 4ZPVA 3FZUC 3U7WL 4NHCH 2UWEA 5EBLA 3SGKA 1EEYB 1MCRA 3OKDB 4NC2B 4G6FB 3RWFB 1JF1B 2AK4A 4F3FA 4WHTA 4P5TC 5IF0B 1A5FH 3L6FB 4GRWF 3KPRD 4LSPL 2C9AA 1F2QA 2CRMA 1PY4A 2FB4L 1IAIH 3DX6A 4KJQC 2BNQA 2FO4B 4KH2A 5GS1C 3FN3A 4QCIB 2BSTB 5DO2C 1KIQA 1DEDA 4P2RB 1UYWH 5E9DA 3W9EA 1B4JH 1UVQB 2NY5H 5FOBB 4LPCA 3STLB 5DR5L 2LE9A 3N9GL 1K8DB 5HHQB 1J8KA 1Q94B 2ED8A 3OKOA 2ENSA 5IV2A 3KXFD 3BFOA 3GMRA 4YWGL 1W72L 3MXWL 1YEJH 4QHLB 4MWFB 3DXAD 2BERA 3O9WB 1WWAX 1KB5B 5AAMA 2WBJA 3S4SA 5DMKB 1SJHA 5C2BL 1W72A 3HZKA 4ZAKD 3I02B 32C2A 3T3PE 4FQ1L 3CSGA 3MJ7B 2L7UA 3O4LD 4NZDA 3U83A 4RISL 2NY4C 2RIKA 3RWDB 1WCQA 3ZE1E 1B0RB 4CMHC 1CE1H 3IJSB 2EC9U 5E70A 2VABB 5IVZA 4LKCB 5MHSE 1LMKA 4O58H 3LQAH 2OSLB 5JPNB 3SY0A 4YFEA 3BWAA 1GGYA 2AXFA 2G2RA 1IAKA 3ABZA 4WEUD 2BY0A 1OCWL 2HFEA 2UVEA 4WDIA 3D3VA 3FRUA 1D9KC 2P5EA 1BVLB 5CP3A 5J3HD 4ZDHB 1SM3L 4MJ6A 2V2WA 1RZIB 5DQ9B 3QI9C 3OG6B 3QXDA 4R7NB 3TO4B 3U7AA 3JV0A 3MZTA 1VEOA 3R06A 2PW1B 2AJVL 1S78C 3SE8H 4YX2H 1FL3B 4UILH 1BP3B 4WENB 1A47A 1DQJA 3MLPA 1MSPA 2PTTB 5BW7C 3LPWA 3HR5B 2MHAB 1P4IL 2NZ9D 3RHWK 3ARFA 3ULUH 3P0VH 3MV01 1XZ0B 3PL6A 4RGNB 3NIDE 2VLKB 4FN0A 3GRWL 3RDTA 2YMXH 4NWTH 4LLMA 4FQIH 1MCJA 2SEBA 1ZHLA 5ANMB 2YC1B 3L3IB 4YK4B 5DI8B 1FNHA 5HDBF 2B4CL 4IIQC 4WI9A 4RFEA 3P77B 3GRWA 3WYRA 1FNLA 3MCG1 2H32H 3SCMB 4ZD3H 5K59E 3Q1SH 4HUUB 1IEAB 1K3IA 3B2VL 5GPRA 1WSST 3RWIA 4JFEA 4DFHA 4JRYD 4G8GD 3BKJL 5IB4A 1XAUA 3U4AA 2OP4H 4XNYH 3LN5A 1GVIA 1UQSA 2XYCA 3I6LE 4HJJH 3A6OA 5AUMA 5D7JD 1C16A 4NQXA 4HH9A 4QYOA 2FLRT 4S1SL 2VLRE 4XP6L 5C0JA 1AH1A 3MYZA 5BJTB 4ZOEA 1BEYL 4HIJB 2CKBB 4P59H 5JIKA 5EZLB 3OB8A 1AO7D 3GHBH 3E2HB 1D6VL 3OG4B 1XMWA 3T65A 3OF6A 3GMOA 3V6BR 5IJVA 3V95A 1CXIA 1QRNA 1DN0A 4NQTA 2EDWA 1NGWA 2VRAA 4F7TA 1Q8MA 2X10A 5BVPL 5EORL 3NABL 1H3VA 5DGQA 4EI6B 3DIFA 4Z7QE 4XTRC 4WU5B 4NUGL 1DEEB 3U1SH 1FO0B 2BOCA 4QRPA 2G60L 4RIRA 5E2JA 2VSDA 1UWXK 4WO4D 5JHLH 3Q5YA 4IOIA 3ROLB 1H3WM 5JUEL 2ZG2A 4P2CG 4B41A 3FQNA 3QNZB 2P5WD 4LCUB 4K07A 3WNKA 1J12A 2CJUH 3TA3D 1J05A 1R3LB 3QO0A 3TESA 1X5AA 1QEWA 1KYOK 3V6OA 5FM4A 5EU4B 3MBED 4PJBE 3RWGA 4I18B 4JN2B 4HG4K 1WZLA 3UTSB 5DHXB 5C09A 3N1GC 3ZTJG 3QZWA 4C56B 1KOAA 1R3KA 1I85C 1T1WB 1KTLA 2FSEB 2R0KH 4IRZH 4IM8A 3HMWH 3OWEA 5F7WC 5ADPH 2WUBH 1DANU 3PGCB 4PJEB 1IAOB 1MPAL 4M7JL 5DFVC 4A6YH 5JXED 4WNQA 4KZEH 5JW4M 2DIAA 5K9JL 3IFPB 5H8DA 1PVHA 1NQBA 5IQ7H 1CDGA 2QSVA 2AV7A 5J0BA 2V9RA 5E6ID 3OR6A 4L3ED 2D4DA 5ISZE 4PGBB 2KQMA 3H8NA 4NRXB 1I3GL 3VFPB 4Z7WB 3AS2A 5H37G 1KCKA 3P2TA 2E8ZA 1HSBB 2Z31B 4N8VA 2GT9B 3D9AL 5D1QD 3GBLA 4BFGA 1D5XA 4PGCA 4QOKE 5J1AA 4AZ8A 5DD0H 3AREA 1BLNB 1C1EH 3QXVA 3TNNB 1MJ8H 2R2HB 4CU8A 5KJRL 5DJAB 5LGHL 2UWEF 5H94A 4F57L 2ZJSH 4QTHB 4M1GH 3U0TB 3C6SB 1T2QL 1KN2H 3VFTA 4MD4A 2MCPH 3ARUA 1ND0A 5EUKB 1JGDA 4JKKA 5CD3B 3OJVC 2O93L 5MENB 5SWQB 3QUMH 4UOJA 4YHIA 1KIRA 1QNZH 2IAMD 3OAUL 1T7WA 3K1KC 4D9QE 2CKBH 2YR3A 1PKQB 1WK0A 1I8KB 2JJSC 4R7DB 4IDLA 4L9DA 2KDGA 2AXHA 2K3TA 2R4SH 1FP5A 4HUVA 3HC0B 2R15A 5D1ZC 5F7KC 3MRDA 3MRIA 4U6TA 2FJGA 3FB5B 2D0HA 2AJ3B 5D1XD 4G7YL 5D7LB 4HUWB 3EZ8A 4PY8J 3S36L 2DMBA 2JIXA 3FB7B 4LCCA 4OF8A 4XT1C 5HI5D 4N5UA 4IRJD 4KKLC 5IQ9A 5J11C 1AGEA 3QH3B 2G9HA 4R96A 4MD5B 3VXUB 3F62A 1L7TH 4R90L 2NXYB 4P4KB 2NX5A 4S11A 5IK3A 4PJAE 3V6ZA 2CUIA 3I3DA 4OD3L 3T77B 5ACZA 4NJAH 2F15A 5DUBB 1EDQA 4LPTA 3WO4B 2VLLA 3QIWA 5TE6H 4H88L 1XF2B 2GSGB 1TTUA 1CFSA 1KLFA 3GSVA 1F6AA 3AMKA 5TPWH 3MRMB 4FTVE 1ZS8A 3U0WL 3VXMB 1CFNB 3FFCA 4OLVL 4X9FA 4EKXA 4W4OC 2OBGA 4HWBL 1HH6A 4L4TB 1FL6B 2X4PB 3EYSL 3WFDL 4XP1L 3VU2A 1I9RL 3VRLF 5JHDB 3BVNB 4OFPA 3L3JB 4HWBA 4YR6B 4BSWB 1BFOB 2DQJL 3BP6B 3MV8B 2AJXH 1T0NA 2XG4A 1AGBB 3QUZC 1MF2H 3VWKC 3S3SA 3VFVB 1P7HL 4KZDL 5DVKA 3TYGH 1KB9J 4U3XA 3SE4C 4HFWA 1MWAH 3DSNA 4OGAD 4HMCA 4M6OL 4ZFZB 1KCLA 3STBA 1CDIA 4Y1AD 3UZEA 4OLWH 5F7EL 5DRNB 5HHOB 2X4OB 3ARBC 2XXCB 1MFDL 3ZYZA 1JK8A 4F33B 4YIQB 1CGVA 3L9RB 4JFQA 4JQVA 3IXTB 4Y0GA 1W0WB 3K46A 1F4YL 5BZDA 4PR5B 1Q9LA 3RAJL 3SDXE 3DI2B 5D7SL 3JWOC 1JL8A 1YNKH 4X6FA 5GZOD 3F12A 4NFDA 4FXKB 5JIPA 4M5ZL 1IKFL 4JZJB 1SY6H 2XZZA 4OLXL 1P84K 1QR1B 1QBMH 2ZCKL 4XVUC 1OARH 3HCVB 2WANA 1TFHA 3WHE1 4H8WL 5E2TL 2UZIH 4LLWB 4JANA 4PJIE 3RFZC 4I4WB 4YHZH 1PYWB 3KYNA 5T1DL 4UU9B 5C3LD 5T1LB 1JV5B 4C58B 4KKBC 3AAZA 4R26H 1NCUA 4EIGB 5HHXL 1RJLA 4L3CA 4OZHE 4E9LA 3L3GA 1UT9A 4C4KO 4CKVX 3ZYIA 5I30L 2BSED 4QXUL 5IVNA 4ZS7H 3FCTB 3FKUS 3MRCB 1KTDA 2QQLL 2YD1A 5GS2D 1E4KC 4PS4L 3V5KA 2X1OA 3QCVH 4PY7A 5GRUH 4P2OB 1D5BB 3S9DB 2ZUUA 4ZXBA 5ERWA 1I8IB 4BZ2L 5EBGA 5T3ZD 5IB2A 5L2JB 4JZNA 3F7RA 2QADD 4RMRA 1M7DB 3QXUA 4AM0B 1NEUA 2DYPB 2HMIC 4OSUL 5J57B 4KJWD 4HC1L 3QUXB 1SYVA 4HXAH 5F1KC 3RVWC 3IKKA 4UTBH 1LE5B 3QUYC 1ZT7A 3QPXL 3MRGA 2ZOLA 5E08L 4HC1A 3KYOA 4ZQKB 2AXJA 1FYTD 1VADB 3PIQB 1NLBL 4OLUH 4A2MA 4XVSL 3O45A 1CDBA 3SJVD 3MCLL 4PRID 4NFBA 3REWB 2CDGA 2OK0L 3T4AB 5IKCA 2DRUA 5IW6B 4Q6IA 1CK0L 1YC7A 4NZTL 1F4XH 2LV4A 2W38A 3V5DA 2AJYH 4OIIL 3EHBC 4ZSOE 2IPKA 4LVHB 1KN4L 1A0QL 4L1HA 1F02I 1WTGT 2VQ1A 2HN7B 3WDJA 1C7SA 1PG7H 4FQHB 1DDHB 4IOFC 4NWUL 3RTQA 4XVTL 4BUGA 4V1DB 2IALA 3GSXA 4JFFE 1CI5A 5BXFA 3G6AA 1S8DA 5CMAA 3UYPA 3OB0K 4DWHA 4H1LB 4OZFB 1IGMH 3D2UD 4KTEH 5JZ7C 1P2CA 1I7TA 3JTSB 2WBWB 3QFJE 3ARRA 1X7QA 3GJFA 1MJUH 3VGAC 4ODTL 1KLUA 3DV6A 4S10A 1F5WA 5DC4B 4KJPC 3RJDA 1KG0A 1I1FB 2H9GA 2G5BA 3MUGB 4OJFL 5TE7L 3P4OA 4BKLA 5KVMC 4LSSH 2IH1A 5C6WH 3DMMB 1T6VN 5B38B 3HG1D 5H35B 5GRJL 4G43A 2VLRA 2IQ9H 1T4KA 3QNYA 1TJGL 4XMLL 4ZFFB 4WTXA 5FO8A 3GO1L 1TZIA 1MRDL 4Q0XL 2P24B 5DHVB 4QHUB 5GGTL 1PY9A 4QHKJ 5TDPA 1YQ2A 4LOUC 1L6ZA 2EYSA 2YUWA 2DQFA 3RVTD 2VXSH 2EDEA 5GGTA 2H26A 4X7TB 1CS6A 3DJ9A 4NQED 1AKJB 1ZVYA 4WUUE 2ZUQC 2Q7YB 4YZFF 4LASL 3K1DA 2VXQH 3QJFA 4U7MA 5F96L 1U93B 2FGWL 1X5GA 4F8TA 3GDBA 4TVPH 1HIMH 2GIYA 2DKUA 1G9NL 2D03L 3UJTH 1BD2B 3GSNB 5D72H 2E27H 1BHGA 2ADIA 2YD3A 1GHFH 1KIPA 4I0CC 4NSKB 4UINL 3FO0H 1CT8B 4K8RD 4OUUA 3LY6A 3VA6A 1T22A 5K93A 1FFPA 2ATPA 4PRAA 5FYJD 1KEGH 5KS9E 4PJBA 4RNRA 1UZ6E 2EDKA 5DYOA 2BZDA 3QSKB 4G42A 1OGAE 1VACB 2Z4QA 1NC2B 1JGEA 1LDPL 2APWA 4E41D 4DCQB 4HJ0C 4W6WB 1HYSC 4L29A 4OGXH 1YEKL 3QULB 5E9DD 3PP4L 2AQ2A 4HUNB 4JPIA 3VG0H 1JCKA 5A3ID 1U41A 4JFYB 1CLYL 1HHGA 4KWUA 2WUCL 3RBGA 5I8OH 3WIIL 3NPSB 4Y2DC 2HFFA 2Y07H 3T0VA 4PJ8A 5C0AD 5D96C 3VJ6B 4PB9H 1BQLH 4HK0A 3W39B 3KPRB 5FA3B 5FB8B 1D5IH 1RAMA 5C0ND 2BOBB 4PRBA 1FCGA 4LHUG 1H0DA