3E6FB

Mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and a variant peptide, pa9, from the human immunodeficiency virus (bal) envelope glycoprotein 120
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
MQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-D alpha chain
publication title Different vaccine vectors delivering the same antigen elicit CD8+ T cell responses with distinct clonotype and epitope specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e6fB00
1HYRC 5IW6A 1SY6H 1F13A 3I85A 1MCIA 3WS3A 5H94B 1VGEH 2AEWA 4ALAH 4OB5L 5EBGA 5T1DL 4L3ED 4KKBC 3MRHB 4BZ1L 1UH4A 1G7QB 5DD0H 2WP3O 4NDMB 5KSVB 2HTLD 3LMJH 4LU5H 3DI3B 4DGYH 5TE7H 2D2OA 1F45A 4FTVB 2FX9H 5D7LB 5EWIL 3CFKA 3T0EB 3UYRH 3W0WB 2DLIA 2DMKA 3WUWB 5A2FA 4KDWA 5JPMA 4UINL 3DNKA 3TYGH 3UBXG 4G6JH 3NFNB 2VIRB 4HWBL 1YEDA 2X89D 1AGDA 1VFAA 2NR6D 2DICA 4JFEA 5DURB 1FH5H 2JIXD 2X4SA 1NDGA 3FO9A 5LJYH 5TDOA 3A6BH 3UEZA 1J1OH 2HH0H 3BD4A 3T1FA 1CGUA 2BVQB 3CFEA 4L3CB 1A8JH 2UY7A 4WU5A 2ZWLT 1HI6A 5IROC 5DTFB 2HFEB 2E7CA 3WNLA 2OL3B 4KHXL 4MB3A 1MCKA 4P23D 3UJTL 2H3NA 4XP4H 3P4NA 5I73B 1IEBB 4JN2A 2PF6A 2FHBA 4XPTL 3GSQB 4FQCH 4GKSA 5FO9B 3V4UL 4LEXH 1A7NL 2UZIH 4LHUB 1SQ2N 5LKNA 1NEZG 4JM2C 4N5UA 5D7SH 2D31B 4JLRA 1T22B 1UKQA 3IETA 5IVZA 3EYOB 1QFHA 5EU4A 2GW5A 3LN4A 4K55A 3ARWA 3PG2A 2YPVH 1I4FA 1DZBA 4JREC 2VL4A 5SWZB 5CEZE 3NACL 5AUMB 2MCPL 1FVDA 2ADJA 1RK1A 4YK4C 5BW7C 5DSCA 3I6LE 2YUVA 4L9LC 3K80A 2B20A 4W6XB 5J9PB 1ZEAL 2VLKE 3GZKA 3QAZB 1VENA 4LDOB 2XWBB 4MNGE 5DS8B 5I74B 2WBJA 3VRJB 1CG9B 4F57H 2MNUA 3TLRA 1KJVA 5D96C 3GJEB 1FFOB 4MA1B 2NZ9C 4J3UA 3WNPA 5HI4D 4OLWH 1UZ6F 5DQDL 1BM3L 2R69H 5IESH 4C4KO 4G42B 2DBLL 2PKDA 3WDHA 1NCDL 5FHBL 1YY9C 5GISL 3ZTNH 1JF5A 3BHBA 3N50A 1JVKA 3PXJA 4KQ4H 2X4NB 4G7VH 3IJSB 3VXNB 1JNNL 5E5UB 3VFOA 4RFOH 3D9AH 1CFQB 2RFXB 3WO4C 4U1IA 3QB7C 2AJUL 3VFVB 1MHEA 1MH5A 5CJBA 1T2QH 4PY7A 1OSZB 1QFWH 5EC1B 3LKQB 5B8CC 1F58H 3X13B 3TH4T 1N4XL 2C3VA 3BP5A 3MRNB 3KYOA 4KKBD 5KAQG 4WI7A 3D2UA 3EOYG 2ILLA 2A73B 5C0DB 2NTFA 4OCSH 4ZFOB 1OAUH 4ZO8A 5D7JD 2IH1A 4E41E 1FDLH 3IFOA 4R0LA 1M7DB 3ZO0A 3N1FC 3QIWB 3O2WH 1MPAL 4M5YL 4HC1A 4F58H 3GI9L 1J0HA 2NY4C 3MZGB 4U2ZA 5JHDA 2D7PA 5IHUH 3OKKB 5A2JH 2DWDB 4KMTL 1CXKA 1UZ6E 1CDBA 5E8NB 2PO6A 3LKPB 1V7MH 4IOIB 3A67H 4BH7B 2OMBA 4ODWA 3GBMH 1XR9B 4HIHA 4H5SB 1T1XA 5LCVL 4XHJC 1W0YT 4DGIH 4ODHL 1YEGH 2P43B 4QRPD 1AP2B 4ZPVA 4Q2ZB 3V0AC 1FL6B 1KCUL 3CMOH 5FK9B 2CDEA 3OJDA 4HUMB 2ESVD 1MFCH 5EU7E 2UWEE 2QR0A 3LRGA 4TTDD 1T1YA 3T4AA 2FCBA 3FB5B 3SQOL 1VKXA 1KLGB 4Y19E 4NRXB 4YPGA 2YD4A 4PLOB 4X8JA 5KSAB 1ZHBB 3FOMA 4BKLA 2X4OB 4RNRB 3RAJL 4D9QD 2DTMH 3P73B 2X6MA 1A64A 5C0BD 3KGRA 1KB9J 1CQYA 4MA3B 3U6RB 2BSRA 5IVXA 3MRDA 1VADA 2WANA 1P2CA 4QTHA 1LGVA 2JTDA 2WM0A 4IOFC 4P57B 1KCVL 2CKBH 3O2DH 1MIML 4NN5B 3ZZ1A 4N0UE 1SVCP 4UQ2B 1MFBL 5EDXA 1QPXA 2P8MB 5LQBH 5I30H 1RQ5A 1JGVH 1Q94A 3QI9B 4DKDC 3WJJC 3WFDH 4M00A 5I1LB 1SJEA 2VXQL 3MGOB 4M6OL 5J6GA 3FOLB 3FN0H 1FL3A 1XF2B 1JI2A 1KC5H 3TT3L 5IR1A 5SWQB 3CVHL 4JM2A 1YYLH 3G08B 4M6NH 2XZAH 4PTTB 3RI5F 1IBGL 1S78D 1NBYB 4YQXL 3T0DA 3QULA 1QBMH 1DBAH 1O7SA 1MQKH 1YMMD 3VD3A 5JXEA 3AS1A 1RUPL 2Q8BH 4HWZB 1AO7E 4KRMB 2GHWB 2VLKA 4L9LA 4YUEH 1A3RL 4HWUA 2UUDH 3EOAB 3PGDB 2J4WH 3MLTA 5ICXB 1A1NB 1TVBB 4CMMB 3AB0B 4KKLC 4WGVB 4L8BB 4NC0B 5IBLD 4U4BA 2P49B 1A3QA 5INDA 3VD9A 1HILB 3V4VL 5CSZB 4G9FB 1KB5B 3FO1B 5FYKL 3PWPA 5E94A 3SN6N 5DYOB 4DN3H 3ARFC 5DQJB 5MEOA 3JVGA 1YJDC 3KJ4C 4GFTB 5IGXL 3MROA 5L0QB 3ZLQC 5FYJE 4K3DH 4YGVA 4DAGL 1FNEA 5KJRL 5E9DE 4PRPD 3TBVB 4M43H 4OZIE 2ICEA 1RU9H 3TBSB 3RTQB 1UB5A 5ACMA 1BIHA 1P7QA 5ELIA 4OUOA 5I1KL 1PGRB 3NCMA 3VI3E 3GUTB 3TBYB 3EBAA 4BFIB 2BXYA 3RIFF 4X6DE 3TJEH 2Q76B 1OWWA 3BOVA 3GSVB 3I6KB 1LO5B 4ODVH 4H25B 1NLBL 4GQPH 1S7QB 4M7KL 4HX1A 4P2RA 5DJDA 5H37G 2F15A 3H9YA 5DI8B 5L2KD 2XG5A 4E41A 4XP9L 2HRLA 4S2SA 1JWSA 4LRIA 3LS5L 5HHQA 2OM5A 4QCIB 4Y4HB 4QRRA 1YMHA 1P53A 4OAWA 5D1XB 3H8NA 3TO2A 1Y6NR 1QKZL 5IJKA 5EA0L 4GBXC 4R26L 1EO8L 1UCBH 3L7FB 4DVRL 4LNRB 3CFBB 5DEZA 3D69A 1DQML 1G7MA 4AZ8A 4UIKH 4APQA 3SKMB 4IMLA 2AJYH 3PP3H 1T6VN 3DX6B 1DQDH 3S37H 2APFA 4HCRH 3VE0B 4P9HL 3QCUH 2QHRL 4JY6B 3NPSB 4DEPC 3UPCA 3IF1A 2BCKA 4EDWH 4XPGL 4NBYB 5J3HC 2CQVA 3VFRA 1NUGA 4ORGB 2EE9A 1GAFL 4OD3H 1K4CA 1OL0A 2D0FA 4JPVL 5F9JA 3NVQA 1FLRH 4D3CL 1LEKB 3TO4C 5HYSB 4OI8A 2YBRB 1NMCB 3QFJB 3KPRE 4F33B 4PJCE 2DQIH 3GK8L 3DROA 2R2CA 2Z35B 2WINB 1VPOH 4L8SA 1ND0B 3MJ8B 3VWJA 1A47A 1HYSD 3QQ3A 4U6XB 5AZEL 3DSNA 4Q6YA 1WEJH 5AZ2H 5CCKL 2WK2A 3KXFA 4NQDB 2BHUA 4DUWA 1KEGH 4ZOEA 5I8KH 5AYQA 2BVOB 2AJSL 5IIEA 3BVNB 4GW5A 4Y4FA 3SDAD 5J89A 1BZ7A 2B4CL 1FORL 1HXMA 3MREB 3OKLA 3VGAB 3MRPA 4XNZC 3QWOA 5T5FL 2W0KA 1BBJB 4KKLD 2COQA 15C8H 4YDLC 12E8L 5DMJB 2X44D 3EO1B 1JTPA 3HNVL 4JO2H 2F8XC 5CZXD 1CR9L 1DANT 1NDMB 4R4BA 4BFEA 4EEEA 5JQ6L 3BGFC 4NCC2 1LDPL 1P1ZA 1AXTH 1JP5A 3OZ9H 5EPMB 4IRZH 1ZT7B 5F7FA 5MI0B 4HIIB 4KJPC 2XA8H 4NQSA 1QR1A 2ARJQ 1AO7A 7FABL 1F00I 1K8IA 2F5BH 4Z7WB 4P4RB 1LD9A 2CDGB 25C8H 1S7WA 5JMRA 4ONOA 2HN7A 5BJTB 4BUGA 2YPLA 3SKNA 1HKLL 3HI1B 3VFUB 4JY5H 1IL1A 5F96L 1HSBA 3QFDA 1QR4A 3W9EA 1NCAH 4M4RA 5ERWA 4P2OC 5ACZA 3EFDH 4POZC 4PJEE 3RNQB 3ARFA 3H7BA 1OAZL 3F58H 1MHCB 2XZQL 1MRFH 4UTBH 5E9DA 4NPYA 5L7XH 4OZIA 1BZ9A 1FRGH 4XWGH 2VDQH 4JVPA 3OAYK 4GBXD 4KU1A 1G1CA 3ZKND 1QVOB 5ID1B 1ZS8B 4UILL 5DT1L 5E4EB 3L95A 5F7WC 3L5WB 3LD8C 4ZTPH 1EAPA 3NFPA 5GS0C 2VZ1A 4NZUH 4R2GC 3WMSA 5H35A 3WFCH 4P3CH 3P4LA 5I1GH 4YDIL 1E27A 1OLLA 3DXAD 3DYPA 5GGRA 3AFLA 4PJXB 3NCYP 4NYLA 1XGYH 3DVFA 4PGCA 4XP6L 4EI5D 2EICA 4DTGH 1EXUB 1BZQK 2XN9E 1PBYA 3AUVA 3UTPE 1AXSB 4HMDA 2Q7YB 5IJVA 5JMOC 3KPRD 5HBBA 3UTTE 5E95B 3UJIH 1B6DA 3TO4D 3RGHA 3X12A 2W38A 4WFGE 3WLBB 5DJAB 2FECL 2LTQC 3I3EA 1UM6H 3NCJH 2UY6A 1EVUA 3ABZA 4FOMA 5CSBA 2XICA 1FGNL 3C6SA 5FM8A 2WUBL 4B53A 4KZEL 1CCZA 3MJ6A 3UZEA 5FM5M 1AKJA 3INUL 1T1WB 2FIKB 2HKHH 2OTPA 5F7DA 1TQCB 4Z9KB 5F3HB 3QQ4A 5DMIL 3ROOA 2W60B 3FN9A 1NGZB 3KLAB 5DJZB 3TESA 3RUGB 3UTSB 1CGSL 3LZFH 2JB5L 4AMKH 1XR8A 3AROA 3GSXA 4OQTL 5I66A 1KCRH 1LE9A 5KOMC 5IUSA 5HJ3A 3PGFL 4IRSC 4UT7H 3RL2B 2F5AH 4PJ5E 2VLMD 5BOZG 32C2A 3O6ML 1NAMH 3R1GL 2VB5A 4H1LH 4Y5VB 4XPBL 4ESKA 4TNWK 4XI5D 2VLLA 4QXTA 2NYYC 2WMPA 1IGMH 4P2QB 1FAIH 1MCPL 4YDJB 3TZVB 3FRUB 4YHOH 2AK4D 3F12B 3KHQA 1NSNH 4EIZC 2NY5C 3MXWH 2E9BA 4KJPD 1GGBH 3K4DA 4CRPA 5KW9H 4N0RA 3W5MA 1A7RL 4UT6L 1IGIL 4JCMA 2FJFA 3QXDB 5E00B 3EDKA 5TQ0H 2NY2B 3CIQA 2B0SH 4GRMA 3IVKB 3M1BA 4PUBL 4YO0B 1F8TH 1DVFC 3OR6B 4H26A 5GS1C 1K2DA 4P59H 4DVBB 1OM3L 4G6AC 1R3KA 2SEBB 1LEIA 2C4FT 4P2OD 3RA7H 1ZOXA 3NFSH 4NHCH 4POZD 1WBZB 4NQEE 5EU3A 1OF2B 3P11L 5D1ZA 4QXWA 3B9KB 1QSEB 1C1EH 2ZOKB 2XRAH 3QO1B 1JN6A 1BD2E 3ARGA 1S3KH 1D5XA 5C0JB 1MCCA 4F9PC 4D2NA 1HIMH 4BQBA 1GGCL 2JCCE 4JFDB 1ZWIA 4K3EL 1JNLL 1HQRB 2LVCA 1B0WA 3NPZB 2VXUH 5HHOD 2EZ0D 3D6GA 1GGIL 3GMPA 3BZFB 3RPIA 1TZGH 4PGBB 1BFOA 5D9SB 2VDKH 4CW1B 3O41B 2X4QA 4B0MM 1JI1A 5H2BA 4JQIL 4R2GD 5I71C 1SJXA 3PL6C 4PJEA 4G8FB 1BIIB 2FL5A 1A6WH 3S5LB 4GRLC 1YEFL 3K2MC 4Z0BH 2D0HA 3BUTA 5B39B 4S1RL 2R0LL 2R0ZL 4OLUL 1AD0B 1JHTB 3UTTD 3FZUC 3EGSB 3QDMD 1ZLSH 3HZVA 4JO3H 1U8OA 4K23L 1MHPL 1WAAF 3KLHD 4PLJD 4ODXA 4UDTB 1KJ2A 5IB2B 3MACL 1SEBA 3EYSL 3T0EC 5E2TH 4FTVE 1QLEL 4ZPTB 3OGCA 3T0EE 3W0WE 1DJSA 4KI1A 5K9JH 3BUYB 4PPTA 4LOUD 5DUPL 1I9IH 3B9VA 5A40E 1CXFA 1LEGB 4FQHA 3O0RH 1IFHH 1DEEA 1N6QH 2BRRL 1WC7B 4HEPG 2XN9A 5EIIB 4OZHB 4UB0H 4HWNA 2WLZA 4JG0H 3LAFA 3ZDXF 4UV4H 3CSPA 1C5DA 1IQWH 1A6VL 4NJAH 4XCFH 4NKMB 1FYTB 4JFHD 1YPZB 2MPAH 3RKDC 3ZKMC 1CGVA 5JUEH 1TVHB 3WFEL 1UB6A 1D6VH 5I73C 1U8MA 1G6RH 1PSKH 3ZE1F 4CGTA 2JK5A 2E6QA 1FZMA 1KFAH 5I15H 4MS8C 3HKFA 1FC1A 1RZ7H 5ESAA 3GKWH 3OX8A 3VXMD 2VDLH 1JE6A 5JW3L 2ED7A 2MTPA 4XAWH 4D9RE 3S9DB 1WAAE 1A7PH 1X5KA 2W0LA 3N06B 4CN6A 4FP8H 1I8IA 5CKGA 2LE9A 4PJ5A 1SBSL 2FATL 1I7ZB 2NX5A 4KVCL 2Y1VA 4CADB 3K1KC 1S9YB 2E8YA 3D0LA 4I3GA 3QUYB 4KDVA 1DQJB 2OJEA 2Z93B 3EYVB 4NQED 2G9HA 2ITDA 1KTDA 1YY8A 2R39A 5DK2A 5T1MB 3VFNB 3LCYA 5FV2A 3BFOA 5IFHH 5I74C 4JFYA 2VLRD 3P4OB 3MV9E 5BOPA 4G6KL 1I3GL 1N59A 5DHVA 1GRWA 4MA1C 2OBGA 3ZDXE 1JPGA 2G75A 4PP1D 2Q3AA 3C5ZB 4I48A 1T1ZA 2V5YA 4G8EB 1ZHKA 5DFVC 5TQ2L 1BFVH 4R8WL 1FNFA 1P5VA 1XF5B 4QOKB 4JKKA 3MRCB 3OHXB 2GJJA 3S36H 1CLOH 2CSPA 3ROLA 1YQ2A 4G6MH 1BX2A 1I85A 4QRSA 1J0KA 1WCQA 2DS4A 3AVEA 4X6FA 1CXLA 5GGRY 4TULL 2ZG2A 1UWEL 3RBGA 4A6YH 4TSAH 2AJVH 1TCRB 1KTRL 5HHME 2IJ0C 2OJZL 5JW4Q 5I75B 4HQQH 4PV9A 1N5YL 1BQLH 3QBTB 2LU4A 2Y23A 2FJGA 5J8OA 1CL7H 1SY6L 1BD2A 3DMMD 1VGEL 4PTUB 4ALAL 4XH2B 4XTRC 4GRWB 4I3SL 43CAA 1HH9B 1IEAA 3FZUD 1ED3B 2BY2A 1T04B 3FRPG 2MJWA 5DD0L 2BVPB 2DQDL 3NCFB 5DWUH 3IDXH 3JUYA 3SE8H 3UYPA 2HT4D 3MBEB 4LU5L 4DGYL 3N1MC 4MXQD 1BQHB 2NY1B 2F53B 2DQUL 3CFJA 2FX9L 1WTGT 4FTVD 2C5DC 3QIWC 4X6BB 5D7LD 1R3JB 3W0WD 2XKUA 3CX5K 4MD4B 3H9SB 4PY8I 4QTIH 1UENA 5IB5A 3DBXB 2XZCH 2V5MA 1JGLH 1QBAA 3I75A 1LP9B 1TENA 3PL6A 5GRVK 3FRPA 5DURD 1B3JA 4PRDB 1FH5L 3HAEH 1WFOA 5GSRA 3HS0A 3EDJA 3A6BL 2HH0L 1DP0A 1IARB 2FR4B 8FABA 3FQWB 1YEJH 1XGRA 4FQJH 1JZ8A 4JFFD 3BQUD 4U1GB 3LQZB 4PR5B 2ZSVA 4NDMA 5KSVA 2GYSA 2I27N 4XP4L 5TPWH 1W72L 3V95A 2GK2A 4RBPH 4TUJA 4ELKB 4FQCL 5KSAC 4F7CA 3SCMB 1OD9A 2BHZA 4LEXL 1J9CT 3BT2L 2DQJH 2NQCA 4MS8D 2UZIL 4UIMB 1RUKH 3B9EA 4YXKH 4ZUTB 5D7SL 3L5JA 1INQA 3MUJA 1QRNA 4K94C 4J6RL 1ERNA 1IT9L 2YPVL 1J05A 5DRWA 4TUKH 2HVKA 2BVQA 5SWZD 5LGJA 4RMVA 2ZUVA 4Y5XB 4NN5C 1CDCA 2HFEA 2OL3A 2Z8SA 1EHNA 1R5IB 3QI9C 5BS0B 2W0FB 2BRQA 3K7UA 4O9HL 2AKRB 2YZ1A 1RZ8A 4L1HA 1EEQA 3ILPB 5I19L 3V8OA 2ITCB 3R8BB 3V7AE 2DDQH 5J4MA 2HLAB 4IDJH 3V2AR 3QUZB 4OGAD 5DR5H 5DJXB 4GXUN 4MJ6B 4HUVB 4OLWL 2DLTA 1WAAA 2BVTA 4UU9A 2D31A 5T3XL 1HHGA 5BVPL 4Z77A 1KACB 3PQYB 5C0FB 4NO5B 5JW4M 2WW8A 3VXSB 3ZTNL 4KQ4L 3VFWA 1KCSH 2J6EH 4FQXA 5AUMA 1OGAB 2ZCHH 3D9AL 4RFOL 1S9WA 3GGWB 2PR4L 4MWFB 4P46A 3CVHA 1JPTL 4GKOA 1DLHB 2L4OA 1X4ZA 3MV9A 3AB0C 3JV0A 1F58L 3VRJA 2H8PA 3ARRA 1B0GB 4M1GH 4XTRD 1OT1A 4I4WA 2FSEB 4MNQA 3QDGE 3DUHA 1I3RA 2IADA 4LCYB 2YD2A 4ZAKA 4OCSL 1DBBH 3QEUA 1ONQB 3KAAA 3MRGA 5L0QC 1FDLL 4G42A 4K7FB 5JOFB 3EZ8A 1QLRA 4NRYB 3UYOD 3O2VH 2FDBP 4W68A 1UYWH 3EJZD 4F58L 1MEXL 1YA5A 1TJHH 3T0BA 3O3UN 3RTQC 3VXPA 4MDIB 1CFNB 4I2XA 5A3IC 1PQZB 3RWGB 1V7ML 4Y4KB 3A67L 3BEWA 3GBML 2MOVA 1MJ8H 4C54A 1QZ1A 1U58B 2QBWA 3BKMH 3MRNA 4ZUUA 4KXZH 4F7PA 3CMOL 5EUOB 1H8NA 1MFCL 4J3TA 2BSTB 2HG5B 3S37X 2A73A 2NZIA 3I9GH 1M05A 3C8KA 3CZJA 1CXIA 4RMQA 3VFTA 4ZG1A 4R7DA 4U1LA 4Y4HC 5ICZB 1M7DA 5D1XC 3QIWA 4UQ3B 1T4KB 4XNUH 3AU1B 1KLUB 4ZFFA 4N8PA 3FAWA 4O5LH 2V2XB 5CD3B 4J3SA 4GAJH 3MCKA 4OZFG 3OKKA 3SGJC 1EBPA 5ADPH 2H9GA 3CGTA 5GSVA 2ATKA 3LKPA 1KYOK 3I6GB 1F4AA 2FBOJ 4MA7H 1Q9WA 4ZS7H 4NIKB 5HY9A 3CSYA 4LGPB 5EUKA 3C60B 4FQLH 4HFWA 1IVLA 2CKBL 2OZ4H 3O2DL 1JYVA 3TVMA 2VITA 4JN1H 5KS9F 1T2XA 5EO1A 5IM7B 4YWGH 1UGNA 3NPSC 5LQBL 4OZFA 5I30L 3UMTA 1JGVL 3FB5A 1EO7A 4URTB 3RWHA 2Q6WB 3IJHB 4V1DB 2V2WA 2XYCA 4NRXA 1ZT4B 4U6HA 1ZHBA 1CK0H 2A74B 1NGWA 3FN0L 2X4OA 3VXRB 1NMCC 3IDGA 4RNRA 3UJJL 2PYED 3QXWA 1K5NA 1U8JA 1KC5L 3IDNB 5JQHC 3UROR 1BECA 3QFJE 3K74B 1YYLL 2AI0H 4M6NL 2EH7H 3V7AG 3LQAH 3F7PC 3OAUH 3EOBB 4DKFH 3SDCA 4BK4A 1QBML 3UDWA 1DBAL 2KUTA 4RA0C 1MQKL 2PTTB 4HKJB 2HLFD 2WBJD 4H8WL 5EBMB 4LLWB 2Q86A 2Q8BL 1OPGH 1T2JA 4NQDE 5KTEH 4Y0GA 4YUEL 1S8DA 4N8CH 4HGWB 2P8MA 1K4DA 2J4WL 2VN7A 4X7TA 3VGAC 2OS7A 1YYMH 1FNGA 2BC4A 4XNQA 2EO1A 5C0CB 5JNYA 2BNUA 2EDJA 3LEXB 1DQQA 1J5OH 1PG7X 3MGOA 3O8XB 4HW6A 4G9FD 5L8KB 4DN3L 2OTUA 1D9KB 5F7EH 2CXGA 5DUBA 3BMVA 1DUYB 3GMRB 5SWQA 4B7IA 4RWYH 1WGOA 3AXLA 2AABH 3HMWL 4K3DL 1BLNB 1JWUA 3NIFF 2E8ZA 5MI0C 3VWKA 2YA1A 2QSCL 3BRFA 4X6EA 4M43L 4MDJB 1OAXL 5F7MC 3SKOA 5D7KD 4M6MH 1RU9L 3AY4C 5MERB 1ZHLA 2WWMC 1W0WA 2V7HA 3O6FB 4NKOB 1XGQB 5DO2D 4Z7WE 5E6IA 4R4ND 4EN3A 3LS4H 4NZDA 3BW9B 4KK5C 3QDGA 5GRXG 5EZLA 2GFBB 4RQQB 5IMOB 3DVGB 5FCUH 1G7HA 5CJXC 4O2EB 4L8CA 1H15A 4JKMA 2PO6D 3C9NB 1U93B 2BY1A 3GSNB 2C1PB 3TA3B 5D1XD 1IGTB 1IGYB 2APXA 5E2VH 5IFAH 1UCBL 1TZHA 4QYOA 2D03H 4QHNB 4O51B 4HKXA 1R5VA 4BUHA 2ZUXA 3RDTB 1XGUB 5E4EC 2JLLA 3BPCA 3RUGF 4UIKL 4WTWA 5AEAA 2X4TA 4BFIA 4Q74A 2AJYL 2VL5A 4XX1E 4O4YH 1ORSB 3GSVA 3NIFE 1DQDL 1JYXA 2PXYA 5BQ7B 5EO0A 4EDXA 3V5KA 1SJHA 3MRQA 1VFBA 1YUHB 2L7JA 1TIUA 2WIIA 3AM8C 3QCUL 3ZL4H 5DC9B 1Q38A 3VFPB 3Q5YA 4YHYB 2EIEA 5E56A 4EDWL 3WFZA 3QISA 3IAQA 4HJGB 4Y4HA 1RULL 2VERN 1EEUA 4OD3L 4YIQA 1WIOA 4DUVA 3S88H 3HPLB 1FLRL 4XXCC 4LLUA 2IQAA 3MYZA 3QFJD 1J7VR 3CJJA 3T3PE 1UT9A 2DQIL 2CPCA 1ZVHA 5D70H 1HSAA 4G9DA 1VPOL 1FL5B 1ZHNA 3SKMA 4ONFH 4GMTL 4PJDB 1WEJL 5AZ2L 1TQCC 1QD0A 2CRYA 4UUJA 4NQDD 3KPLB 5E8PB 1OP5K 4HHAB 3QIUD 4RMSA 2I24N 2YD6A 1GVIA 3WFBH 4N90D 4XP5H 1GGUA 2GITB 3RUGE 4I0PB 1ITCA 4Z7VB 3TCXA 5C2BH 2HVJB 1E4KC 1DN0B 4CVUA 3KYKH 4N0FA 3BKYH 1HWHB 1MREH 2ATPA 1U8NA 4Y5VC 1SVZA 4JO2L 4HFUL 1LEKA 4E42B 5HYSA 1LDSA 4OZ4A 4WO4A 1R3LB 4TPRH 2XG4A 3RBSA 3WHXB 3BZDA 3MXVL 5TF1L 4OQTA 4I18A 4F15B 5C0GB 1RURH 4JFOB 2GI7A 3TZVC 1AXTL 4M03A 4NQCE 4IRZL 3V9FA 2VISB 4U6XA 2RJMA 3LB6C 3B8SA 3LY6A 1PX3A 2DQEH 5IF0A 1AQKH 2F5BL 3TN0A 3WSQL 3BH8B 3BVNA 1A1MA 3HA0A 3LPWA 3U30B 3F62A 2R1YA 2NY2C 2HJFB 3PWPD 2VC2H 5K59F 5I18H 2DOCA 4IEFB 5DF0A 4AY0A 3T77A 4RMTA 4OT1L 2GSGB 3OKEA 5ISZB 1F4YH 3C09B 3PDOB 3ETBF 1PD6A 1NCAL 4AEHH 5KS9A 3T0VA 2F9BT 5HHVH 2XY1A 5CHNA 5HGBA 5FDYA 5CEYA 3EFDL 1JTOA 1ZVSB 1JZ2A 1CIUA 1WZLA 3CH1B 3HUJF 3F58L 3B9KC 1C12B 4DQOH 1MRFL 4UTBL 4KTEH 5B21A 5L7XL 4XWGL 3FQXB 2XQYG 1ZT7A 3U46B 3ULUH 3GMMA 2VDQL 1U8LA 1NLDH 3VXUA 2MCG1 3MJ7B 2YD5A 3QJHA 2AXJA 3O3BA 5K9OB 4MMZC 4P2RD 3D18B 4JRXA 2Y7QA 3EYQC 4OLEA 4ZTPL 4D0CB 4M61B 3O11A 4G8GD 4LCUA 4NZUL 43C9A 3WFCL 4P3CL 2VDOH 4QRRD 5I1GL 1QYGH 4LDEB 4LAQH 1QSFB 2O93L 1DN2A 1XGYL 2ZUTA 3M07A 5DHYB 1CQKA 1MF2H 5B22A 2BNQE 5K59E 4K9EC 4DTGL 4IMKA 4YBHA 4X6CB 1KULA 5FECB 3O3EA 3MNZA 4N9GA 2X05A 5IQ9A 3W11C 4RMUA 3UJIL 1QVOA 2WQRA 1P9MC 2BNRE 3IAPA 1UM6L 2CGRL 3NCJL 3E8UH 3ARBA 4OSUL 4QHMA 1XH3A 1QFOA 1DE4B 2GEEA 4Y8DC 3HUJE 3CSGA 3W9DB 3RZCA 1J11A 1HXYA 1N8ZB 4LF3A 3VH8B 2HKHL 2E6PA 3O6LH 1I9JH 5IHZB 4CU8A 1XGPB 5FGBC 5E24E 1A14L 5IMMA 2GJ6A 4CU6A 3LZFL 3UTSD 4AMKL 1R24A 1CLYH 1QQDB 5HVWA 5I1CL 1KCRL 4WEMB 5C7XH 4HBQA 5DEFB 4UT7L 4POYA 4KY1L 2F5AL 4LBEA 4NWTH 5C07A 3N85H 5F1IB 4F37K 4F7MA 1IAOB 5F9AC 1NAML 1QFWM 1AR1D 4L4TE 4XXCA 3KXFD 1FO0A 3WLBA 1RZJH 3WL9B 2D9QB 4Y4FD 1IGML 3KPMA 3MLWH 1DDHB 4P2QD 4FA8A 1FAIL 2R0WL 5FB8A 2H26B 4MQSB 3WJLA 2JB6B 3TZVD 1U3ZA 4YHOL 3GFUA 5EOTA 1NSNL 4ODUB 3LB6D 3MXWL 4MA8H 4OGYH 1IC7H 1GGBL 5BZDB 5I0ZA 3S34H 3OJMB 1F6AB 3ZKQD 2CJUH 3EJYD 5DJZA 5SX5H 3RUGA 2FH6A 5TQ0L 5BZWA 2NY2D 1RJZA 5J56B 2B0SL 5EG6C 3ILQC 4W4OC 1WWWX 1TJGH 4P5KA 1E4KA 1F8TL 1KGCE 3T65B 1MRDL 3S36X 4P59L 1PY9A 3QUYC 3WIHH 4LGSB 3QZWG 4LEOA 4HULB 2H32A 5D6CB 1RZKH 3IDMA 1QTYT 2GJZB 3G5XB 2H2PC 3SY0B 5IEHA 4KMQA 4PREB 4NQCA 1C1EL 1QSED 1PYWA 4MB5A 4HS6B 4ETQB 3ULVL 3TP4A 1S3KL 3JXAA 4P5TB 1RJLA 4JFZH 2F58H 3DV6B 3F12A 4QT5B 3C5ZC 1SYSB 2H41A 5F7YC 1N0XH 1HIML 1ZV5A 4YBQD 4WHDA 4JFDD 5H37H 4Z0XB 1QSVA 4OF0A 2V6HA 1R0AH 2ADGA 2VXUL 1WBXB 3QXDA 4PJIB 5CIPH 2R4RH 5BV7L 3BP6A 1SMOA 2DQFB 5TE6H 3EYQD 3FFDA 4LASH 1TZGL 2IALA 4FFWC 3V0WL 4OM1H 2VDKL 1AC6A 1YN6B 4YO0A 5K9QG 9CGTA 2O61B 3VFMA 4LDLB 1F6FB 2GAZA 3PWVA 3PE9A 2VLJA 5I75C 4JGJA 1MRCL 5HDBE 3WBDA 3SDXF 1YEHH 4Z0BL 3GMNA 4CDHA 3FT4B 5JIKA 1F4HA 2BMKB 2KKQA 1P4LA 3AGVA 1KIRA 1I1YA 1K8DB 1V3KA 3BKJH 3RY5A 1FPTH 5C0JA 5IFJA 4GRWE 2VDPH 1P4IH 1Q9OA 4QRUB 2VDNH 3DVNB 5ESVB 1ZLSL 4JO3L 4U7SA 3MV8B 1EFQA 3MBEC 4YAQA 5HYIA 5TH2B 2NY1C 4S1SH 5C6PB 1P7KB 4XVSH 1NC2B 2QQNH 3WXVH 4OLZH 5E2TL 3BZFA 2F53E 4PRIA 2AXHA 1BGXH 2B1AL 3G5ZA 1CYGA 3FFCB 1UM5L 3M17B 2R29H 1I9IL 5T1KD 5E2WH 1A4KA 1C5BH 1X5GA 3WN5B 2ENSA 2FO4B 1GC1C 4WUUB 2BNQA 3GJFK 1LP9E 3O0RL 1WWCA 3REWA 5FA4A 1TNNA 1CFSA 3K46A 4HZLB 3B2UC 4JG0L 4TVPL 4UV4L 3W82A 2Y07H 1IQWL 3QEHA 4NJAL 5HYJE 1FYTD 4U1GC 1S9XA 3MRJB 1AKJD 2BNRA 2MPAL 5JUEL 4PJHB 5BRZE 4NO2B 4KQ3H 3X11B 1QSZA 3PHQA 1D6VL 4LARH 1X5YA 3HUJA 3SDXE 3JV5A 1G6RL 1RFDH 2ZUSA 4MQ7B 5F7KC 4MD0B 3SCMC 2D7QA 1JV5B 1FVEB 1HHIA 5I15L 1CU4H 1MHHA 1RZ7L 5BVJB 5F93C 1CF8H 1G7LB 2EC9T 3CDFA 4GKNA 4K71B 3BUYA 1VEOA 4XAWL 4L4VA 1A7PL 2YEZA 3IFPA 2VABB 4FP8L 1FP5A 1WC7A 1MFNA 1OY3B 5EIQA 4GG6B 3ILQD 5IKCA 2Y36H 3BD5A 5TDPB 4Y5XC 4PG9A 3QDJB 2Q87A 1MWAH 3QEQB 4L4TA 4GAYA 1S7TB 3DIFA 2EXWC 4NKMA 4AT6B 2E6JA 1WIUA 3T4YA 5DMKA 5K9KA 4KI5C 5IFHL 2DJSA 3HZMB 2H2PD 3E3QC 5BS0E 1AGCB 1ROWA 3LQMA 1JZ7A 1M1SA 3QUZC 1N7MH 1E4XH 5A2KH 5ICYB 1R3IH 3ARZA 1G7PA 1BOGB 1MUJB 3NN8B 1OP5H 4QOKD 1WV7T 4KUCF 1CLOL 2XNAA 4KUZH 5CZVH 5L8JB 1GHFH 2YUZA 3PQYE 4G6ML 4Z6AT 4K8RL 3DLQR 2P8LB 4UV7H 3G6AA 3VXSE 5HVHB 4J3XA 1T89C 2EDWA 4A6YL 2EE6A 2FX7H 4TSAL 5GRYA 2AJVL 1T66C 3QUYA 1OGAE 1LQSR 4HQQL 4NNYA 3V6OC 3VXOB 1BQLL 1TETH 1CL7L 3VFNA 1T7ZA 1A3LH 4OCLC 2DQHH 4M6AA 1ZSDB 2YD1A 1NBZA 4HEME 4W4NA 4EZMA 2I5YH 5CP3A 2K1MA 4NC1E 4NNPL 4W6YB 4MHHI 2XWJB 4R90H 3D3VE 4KKCC 5EFIA 5ENWA 3SE8L 3IDXL 1I1AA 2C9AA 2J8UF 3ZYJA 3PWNA 5DRNB 5F3BB 3CPLB 1AGFB 2EDEA 3DETC 1CLZH 2N56A 4YXHH 5CKAA 1BFTA 1HNGA 4QTIL 3H9SD 1X6NA 2NY6B 3CCHB 4KJYB 4QRQA 5GIRB 5FA3A 1JGLL 3WIFA 3T3ME 4DK6A 4FQIH 1JGDA 4Y4KC 5IW3A 1OTTD 4QHKJ 1F4WL 4PJ8A 1GZQA 5B3JE 3QUML 1KJMB 1HKFA 4PTUA 4K7PY 3B2UD 2CIIA 5IVOA 4FQJL 5JA9A 4U0QB 3IDJA 5I8CB 4WFFD 1TZIB 4C56B 1F02I 3HLAB 2BVPA 3QWQB 5DK3A 5HPOA 2DKUA 5TPWL 3SQBA 2OK0H 3HFMH 1S7UA 4LPCA 2GK0B 1DQLH 3RIAK 3GSUB 2R9HC 1UWXK 4G8IB 1PKOA 4X6BA 4I9WD 3SCMD 2DQJL 2QSQA 1RUKL 1EHLL 4YXKL 3N1GC 4MAYB 1CD1A 3D1MC 2J8UE 5LAXB 4Q6IA 2OLDA 3C87A 3JUZA 4NZTH 1UJTA 1M71A 2D0GA 5KBNC 2R2EB 2E7HA 5D2NB 5T1LB 2X7LB 1FFNA 3C60C 1Z9LA 2A83A 5BXFA 1DFBH 5HYJA 4P9ML 4OCYL 4OFYA 4I13B 1WVZA 5BRZA 4XB8A 2EXWD 3DRTB 3SDXA 2FWOA 4LKCB 4HPYH 4KI5D 4OLYH 4ERSL 4WV1A 2P8PB 2WWKT 3T8XA 2DDQL 3F8UB 4AIZA 5JXAL 4JKWA 4NFBA 3FT3B 1KN2L 4OKVB 1U3JA 3HZKA 1ZAGA 1C16B 5FKPB 5MP6H 1L9NA 2KH2B 4JZNA 3VXSD 5CILL 3MCLH 1F5WA 4JPKL 3D25B 1KCSL 5CMAA 4O00A 2GQHA 4NBXB 3C6LB 2ZCHL 1MAKA 4DZBB 5L9DH 1AJ7H 1T66D 4WI6A 1YZZA 3TH3T 2VXVH 1ZANH 4FABH 4KC3B 1MCDA 3CUPA 2KZ1B 4WW2F 4HUWB 3ET9F 4OUUB 5D5MB 4F2MA 1Y6KR 3MBXH 1H0DB 4PRHE 3O8XC 5C0CE 1KV3A 5HDQH 3UZVB 1ZLUH 2LQRA 3GEWB 5IK3B 3QUZA 1D9KC 4EXPX 4UOW0 4KKCD 5DJXA 1DBBL 5F1OB 4IHOA 1KJ2H 2X4PB 1BOYA 1BWMA 4XBPA 5JO5B 4OV6F 2DIJA 3O2VL 4L3EB 4OB5H 5T1DH 1UYWL 3CLFL 1ETZB 3B5HA 1U8PA 3VXTA 3L6FA 4AM0B 1H5BA 4RX4A 1TJHL 3PIQB 1QOKA 3O6FC 5ITBH 1WFTA 4LLVA 4Y4KD 4KAQH 4PJAB 4PBXA 1BEYL 2FGWH 2BFVH 2HT2C 1MJ8L 3OG6B 1QUNA 3G5YB 4GMSH 5MHSE 2EKSA 3U4EB 1B0GA 5C08B 1BP3B 1HDMA 1T21B 3BKML 3D3VA 4BQCA 3U2SA 3AREB 5CP7A 3WHE0 5A16A 2CIKA 3I9GL 4CUCA 1OP3H 3STLB 5IT2H 3WD5H 4ENEC 3Q1SL 5C8JB 4OBSA 3TA3C 1FN4B 3L3OB 4PJGF 2IH3B 4ACPA 4NFCA 4HUXB 4C83B 4LLDA 1UQSB 1IAIH 3HE7B 4O5LL 4P23B 2CUMA 2FEDC 5INCB 4GAJL 3OKDB 3U7AA 5EU6D 5ADPL 3RDTC 3KPPB 4X5XB 3ZHLA 1J88A 4M5ZH 4ZS7L 2DRUA 1FG9C 3CFDA 1U8QB 1A7NH 5AD0B 2XTJE 3C60D 2OZ4L 3AS0A 1DLFH 2MMXA 2ARJA 5DGRA 2WWKO 1HEZB 5CSGA 4YWGL 3DI2B 4YHYC 4BSWA 4Y16B 1HE7A 2AXGA 1MLBB 2ZOLB 1VDGA 4QHUB 5I17B 5DJCA 3SEPA 1OCWH 1QRND 4XPAL 4V1DD 5DHVH 4ISVA 1W0VA 4TYUA 1G9NL 1CK0L 1BPVA 3T09A 3DUSB 3VXRD 3MJGX 3FHQA 5A1AA 2EEDA 5GZOC 2J8UA 5GGTL 4LVOB 5I0DA 2AI0L 4NQXA 3L3HB 1H3XA 4Q0XH 5FUOH 1R5WA 3LQAL 1IQDB 1KPRB 3QPQC 3GJFH 4GO6B 2QSVA 1NGPH 2IG2H 3LDBB 3ULVF 4EIGB 4BM7A 4WFED 4PJDE 3MJ9A 1OP9A 5F44A 1VFUA 3Q2CA 2CKBB 4PB0L 5KTEL 4N8CL 1XEDA 2DBLH 4X7FC 4LPUA 2YD7A 3KYNA 1NCDH 4I0PC 2DYPB 5GISH 4EOWH 1RK0A 2EEBA 1U91A 2Q6WA 1JNNH 5J6HA 1IC5H 5ECJE 4F9LC 1J5OL 3RWCA 3IDIA 4TQEH 1ZGLP 3FONB 2OR7A 5EO9B 3WKMH 1ZT1B 5F7EL 4LLYB 1S7RA 2QSTA 2W59A 2DMBA 3KPQA 2AEQH 4OD2B 3SBWA 4F15C 1IGFL 4ZXBA 2AABL 2NCMA 1TTFA 3V6FA 4YEEA 1MCOL 3EOBA 3GRWA 4EKXA 3QUKA 2IAMB 3MRKA 3NZ8B 2PTTA 4M6ML 5FYLE 1M4KA 4LLWA 5F88A 4UBDC 5D7JB 5FO7A 2EXYD 4I3RH 3U30C 1S7XA 1FIGH 1U42A 2FIRT 2YOCA 4GW1B 3MA7B 4KK9C 4MJIE 4M5YH 2B4CC 3GI9H 3QIBA 4PRHA 3LS4L 3QA3B 5HGAB 3C09C 4QWWC 1BJ1H 4R96B 2I26N 1G7IB 4XCCH 1PKQB 3O8XA 4KMTH 2WZPD 3CZFB 4IOSD 5FCUL 5FYKD 2GSIA 3KDMB 3GIVA 3S98A 2FJHA 4LLQB 5AG9A 4ENED 4AQOA 5IG7B 3WEXB 5D1QB 3T0AA 4PJBB 5D71H 4Q9RL 5E2VL 5IFAL 1XAUA 2CR6A 5D8JL 5I16B 4XXDB 4MNHA 3MRLB 2D03L 4DFHA 1NC4A 1OT2A 3KWWB 2FEDD 4XP1L 5EBWA 2R2BB 3O6FA 4JFPB 3RDTD 3KHOA 1S7SB 2FX8H 4PRBA 5IBUB 3VFSB 4RISH 4OV5A 4O4YL 1F90H 3OAZK 4CJ0A 1MLCA 3G5VB 5C0BB 1HINL 3I3DA 4QF1A 4AEEA 3ZL4L 4QEGA 3O45A 3DVGA 2DAVA 1IAKA 3SGDH 1QSFE 1RZGA 3LPFA 4QKXB 4RIRA 1TNMA 2LU7A 4MAUL 3P4MA 2PW2A 2ZUWA 4WW2A 1KCVH 4JHWH 5KVGL 3HMXA 4HK0B 3GSNA 4X6CE 3DX9A 1AE6L 3IXTB 1NBVL 1U8KA 2HFFB 5GZOD 3TVMD 5D70L 4M7LH 5MEQA 2R0KL 4G80B 5ESQB 4GG8A 3O3DB 3O4OB 4BFGA 3C08H 5E1HB 4XBGB 4ONFL 3GMOB 4UOW1 3HI6L 3QPQD 5DC4B 5C0AA 4BH8B 4WJ5B 3LV3B 1AHWB 3F7YB 2F74B 1PG7W 1A4JA 3P9LB 5BQ7A 2F8VA 3CVHH 2KL6A 1CT8A 3WFBL 5LVEA 4XP5L 3BI9X 2DWEA 1IBGH 3ES6B 4Z76B 3H3BC 5C2BL 4I0PD 1VHPA 4OZGB 3C5SA 2GTWA 3HNTH 4MZ2A 3KYKL 3BKYL 3NIGF 3CC5A 4U1KA 5DQ9B 1MREL 1UWXH 4BA8A 3QH3B 1KCKA 4OLVL 1TVDA 1A3RH 3ESVF 3PWJA 1X5LA 4NGHH 2EDFA 3QXTA 4PGEB 3G6JB 4TPRL 1IGJA 4NO0D 1HOCA 4Z18A 4WFHE 1RURL 3SDDA 3TC9A 1NL0L 4HC1L 1FYHB 3BO8A 1UVQB 3WHE1 2C7UA 2DQEL 4HIEB 1AQKL 2CDFB 2X10A 1N2RA 1QFWI 4HHAA 3OXSB 3RHWK 5IGXH 4ZQKB 1Q9LA 1Q0YL 4JDZB 1ZK9A 4JY4A 2VC2L 4DAGH 1JNHB 5KJRH 2DM2A 3SGEH 3TF7C 4KK9D 1RIVL 5I1AA 4TUOB 3LKSA 3VU2A 1F4YL 1T5WA 2CLVB 4D94A 5ISZD 3D85A 3LRHA 4UMGA 3U36B 4QWWD 4AEHL 2APBA 4OTXH 2K7QA 3VWKD 4BQ9A 5KSBF 1YEIH 4OFVA 5C0IA 5FUCE 4WVRA 3CDYA 3MGTB 4ZD3H 1EEZA 2A6JB 4HIJA 4DQOL 4UNVA 3JV4A 1KELH 1NLBH 4P5TC 3DTXB 3SPVA 2AV7B 3NIGE 3ULUL 3IU4L 4EN3D 1NLDL 4HKBB 4RZCB 1ZGLM 3O6KH 2BZDA 1D5ZA 2P5EE 3QXAB 1OW0C 3LH2H 4MJIA 4LCCA 2HJFA 4YBLB 3EJJX 3UO1L 2Y06H 4PJIE 1J8HB 2XTLA 3GSOB 2CLZA 1EO8H 3BAEH 4MYWB 5T33L 1B4JH 3FCTB 3PDOA 2EIZB 5D6DC 1QYGL 5CWSA 2YSSA 5MENA 2XFXB 1RZIB 2Y6SC 2VSDA 4OZFH 4ONHB 3BDYL 5EBLA 1KTLB 5TDNB 1MF2L 1BMGA 2VQ1B 4KDTC 2A38A 3Q5OA 3CK0L 3L9RA 3QUXA 4WRLA 2A6IB 4P4KB 4DOHB 4P9HH 3PNWB 3ZSTA 2QHRH 2I9LA 1A1OA 1XCQA 3PXHA 5KSBE 1AGBB 2E7BA 2Z8RA 2GT9B 2H6PB 4FMFA 1T5XB 4KK8C 1UEMA 3MUGB 4TSCL 2MKWA 5CEZL 2OX5A 4XCYB 5K33A 3FQUA 4CVWA 5GJTL 1O0VA 3IFLH 4YR6A 1I9JL 2NPLX 5DUML 4M1CC 4QO1A 3G04A 4X0KB 3WN5C 3GK8H 1CDJA 1P6AB 1U8HA 3FFCE 4GSDL 4CVXB 5HHPA 1H3GA 1CLYL 1CICA 3VGGA 1I1FA 2IANB 1PJ9A 4WUUE 1I7RA 5AZEH 3Q0HA 3PHOB 3PGCB 2YC1B 4PGDB 4YZFE 1IRAY 5CCKH 3I84A 2AK1L 2EYTB 3MLUL 1A6PA 4NJ9L 4NWTL 4X6CA 4M3KB 4XBEL 3VFGL 3N85L 2YMXH 3ARDB 4OCWH 3JWDH 4GKZB 5C09A 1UJ3B 1QEWB 2XQBH 2NW2A 3SDAB 1KIPA 2VR9A 1FORH 2P48B 4YHLH 4PJHE 1WK0A 1AGEB 2AJZB 3DO3A 4OM0H 3MLWL 2FZ3B 3PP4H 4XB7A 4ZS6C 4FXGB 5DD6A 1N8ZA 4G43B 4K71C 3MFFB 4MA8L 4OGYL 1IC7L 1CR9H 5CD5D 4JO1H 1I7TB 3LOWA 5IW1B 4LL9A 5JQ6H 3KR3L 5SWSB 5E8EB 1YNTA 4V2BA 2IMMA 5HYQB 4WO4D 5E0QA 3V8CA 1QLFB 4FFYH 2EE2A 4U0RB 5CEXA 4Z7OF 2M26A 3UTZA 1CFTB 1UKTA 3QEQE 1NAMB 2E9JA 4H1LB 1RZKL 4JKPL 3BPNB 4EI6A 3O9WB 4JPIA 1UH3A 1ES0B 3TBTB 5F96H 3L3DB 4D9LH 4JFXB 1WQVT 1ZA3B 2JB6A 3OXRB 4JFZL 1A6ZA 3NH7L 4NSKB 2F58L 4P5TD 5DXWA 4ODUA 3PV7A 3SE3A 3G6DH 1UFUA 3DJ9A 3HZYB 1I8LA 5EZJA 2P5WA 5DJ0B 1R0AL 3MO1B 4EVNB 5KG9B 3T1WA 4OBRA 2OSLA 1UXSB 1CE6B 1T3FB 3ZE0E 2A6KA 5ALCH 1JF1A 5TE6L 4KMLB 3QHFH 1JZ5A 3VRLF 3REVB 2BSSB 4PRNB 5HVHC 4OI7A 4R3SB 5KZCD 1T03H 3TEUA 4YHML 1MY5A 3L3KB 5DT1H 4ELMF 3P77B 4LLAA 5B38G 5D6CA 3T0WA 1YEHL 1LK2A 1NFIA 1Z9SA 4GLRH 4N1HB 4HPOL 4WW1A 4JRXD 2XPGB 4RFEB 3BKJL 5IB3B 2D7MA 5IOPB 2VWEC 4Z7OE 1KBGH 3CX5J 1FPTL 1FFRA 2VDPL 3DV6A 4YC2B 1SYSA 2VDNL 2VWEE 5FF6B 2P5EA 3M8OH 3QRFM 3MV8D 2ERJB 3V5HA 4XP6H 2YXMA 3BIKA 4EI5B 4LIQH 1GZPA 5B38A 2AVGA 4XVSL 1OW0A 2BJML 1T0MA 4KK8D 2QQNL 4PG2C 4OLZL 1NC2D 3WXVL 3RL1B 1QFPA 5BV7B 2AQ3A 1BGXL 1M7IB 1U95B 2NY6C 1KNOB 3WCYA 1WITA 3FFCD 1CLCA 3K2UH 3WS6A 4TNVF 2R29L 3SHSA 4M1CD 1C5BL 2DL9A 3OL2A 4WUUD 5JW4R 5FDWA 1FGNH 3VGEA 4XGZB 4RGOH 4OD1H 2VAAB 3ZMRA 3VRLE 5LGHH 3IGAB 3BRDA 2Y07L 3Q6FB 1Q72H 5KSBA 3MRRA 2R23B 4WWKB 1A6AB 3HR5B 4DZ8B 4RAUB 4ZOCA 2BXZA 2KZWA 4OQTH 4MX7B 2I9TB 3BGMA 3DURA 3PGFH 1IMHC 4JANA 2GJ6D 1RFDL 2QQQA 1P7KA 4HH9B 4O2FB 3FB6A 1L0YA 3O6MH 2NXYB 1ADQA 1Y6MR 5DDHA 2IFGA 1CF8L 1Z5LB 3DO7B 5DFWH 1G0DA 5C07D 3GMLB 1AD9A 4MAYC 1LO3H 1JF6A 1MCPH 4HDIA 3MODH 2IMNA 4YHIB 3L5XH 4Z7QF 5D2NC 3VXQB 2ENYA 3D39A 4LPWA 1NGYB 1EUUA 3P2TA 4QY8B 3BWAB 3QG6A 3QDJD 1JIBA 3RWDA 3QEQD 1BQSA 2Y5TB 3IJYA 1IGIH 2ZKHH 4UT6H 2D4FA 4L8DB 3RWIA 5FYJL 1ZA6A 4KV5F 2P42B 1FJ1A 4PUBH 1S9VB 3GB7B 4XCNB 3IAGC 4FZEH 1J0IA 4O2CA 3ZDZE 1G6RB 4N8VB 1OM3H 3WE6B 3F7VB 2DD8H 2X2YA 2I07A 5IMLB 4L29B 1N7ML 1E4XL 1CVRA 5HHXH 4PLKC 1R3IL 4Z78A 3P11H 1TXKA 3HCVB 4KUZL 5DJ8B 3MRMB 4I5BA 3QNXB 1T0PB 3TNMA 1B4RA 4WHCA 4PLNC 4UV7L 3MRIA 1FSKC 3C6LC 1UXWA 1N6UA 3EYFA 5HHOB 1HQ4B 4S1DD 5CGYD 1Q9KA 1V8HA 1EK3A 4WGWB 1A3LL 3DX8A 2FNBA 4Z7QE 4JQIH 5ALBL 2MQCA 2QKIA 2I5YL 1T83C 5D5ME 4XMPH 4OFPA 1F3JB 3WNOA 5ICYA 3LSOA 2F54A 4S1RH 4PJ9A 5D7IF 2VLJD 1FNHA 2VR5A 2EDTA 3W39B 3SE9L 5FM4A 1CLZL 1EEYB 4YXHL 4BQ8A 3NCEB 4L3EE 1IKFH 2HTLC 2NY6D 3JTTB 1OAYH 3QQ9C 2WUCL 4FQIL 3QQNA 5DJ6B 4A6YB 5HD8C 4PJ7F 3MACH 4JZOA 5L2JB 1QLEH 4KRPB 3NMEA 3FTGA 2EDOA 3B43A 4U1HB 3QNZA 3TIDB 2WQ8A 4OGXH 3DSFH 3DGCR 3X14B 5DUPH 1U3HA 4MD5B 3NABH 3DRQB 1C08B 4PRID 1XIWD 5CBAB 1FO0H 2AGJH 4XZUB 1NBQA 4C56D 3AREC 3DUUB 1S5IH 3IU3A 5GRJL 2OK0L 3NCYS 5F1NA 1DQLL 4MZ3A 4ZUSB 2MHAA 4M48H 3MMEB 5FKAB 1A6VH 4LNVA 3HE7C 2R8SL 3MV7D 2UUDK 4WNQB 4P23C 3R06B 4LLMA 3BH9B 3EHBD 4QHKI 1YDPB 1VB9A 4MAYD 3HPJB 4XPFH 4JZJA 3HE6A 4NHUA 5ANMB 1EFXB 4NCDA 4Y1AB 3HAEB 4NZTL 3UC0H 4HAGA 5T1LD 3LKNB 1A7QH 2YK1H 1DANU 4ZO9A 4ZODA 1KPVA 1NFDB 3KPSB 3N1QC 4AH2A 5JW3H 5DJ2A 2H32H 4ELMA 5I8CA 3IXAA 4GUPB 2X70B 4Y16C 3FQRB 4HPYL 2DKMA 2EDXA 3C5JA 5D2LB 4OLYL 4GW4B 3MNWB 3PWLB 3RU8H 4L4VD 1M6OB 4D0DA 4YX2L 3RVWD 4HLJA 4FQ1L 2BOCB 4NN6C 1YN7A 1DUZB 3X17A 4LVOC 4Q9QH 4PLKD 5IQ7L 1OTSD 2GUOB 2VDML 1A6TA 5CJOH 3ARUA 2Z9TA 4G6KH 3LIZH 1WLHA 1AIFA 5DD1H 2KQNA 2Z91B 4WUKL 3LDBC 4X4YB 5HI4C 3MCLL 3SGKC 3F5WA 4QHLA 5L9DL 1JUFB 5GGTA 5DRZA 1DQTA 4AENB 4PD4K 3DRTA 4MVBC 5HHNB 2VXVL 3I50H 4L1DA 1B0RA 4FABL 4HGKC 3KNBB 2OMNA 3JTSB 4OIBA 3RWFB 2A0LC 4JRYA 2P8PA 3MBXL 1UWEH 2NXZB 3O4LA 1AC0A 4C4KT 4S0TD 3P9MA 2A6DA 2N1KA 3CXHK 3HRZB 5IEKB 1KJ2L 2BY0A 3PP3K 3U83A 3MR9B 3DMMB 1X7QB 3MZTA 4P5MB 2ADFH 1IZJA 4I3SH 4X7DC 1F11A 3OTTA 5T3XD 6CGTA 1FNSL 2CUHA 1RJCA 4FXKB 5DZNA 1WWAX 4IRJA 2DQDH 5D7JC 5I8EA 3QQ9D 2G60H 4JM2F 5ITBL 5SX4H 2DQUH 4JVWA 2D7TL 3PABB 5HD8D 4KAQL 1I1AD 4RGNB 3V6BR 2FGWL 2BFVL 3U7YH 2VH5H 1LK3L 2PTUA 2DI8A 4GMSL 5HGDB 5JDSA 1RY7B 3JV6A 5C08D 5CBEB 1T83A 5C6WH 1MFDH 3C2SA 3H9ZA 1FLTX 3ARED 3IKCA 2QTEA 1VACB 1TJIL 4WIQA 5IT2L 3BJLA 4XCEB 3WD5L 5KANI 1P84K 3OKYA 1HH6B 1RAMA 2ZJSH 5D1QC 5IWLC 1XF1A 3TT1H 4L3EA 4QRPE 4JFFB 4UDUB 2W65A 1IAIL 3BQUB 3HE7D 4PJBE 4TTDC 3GDBA 4I8DA 5FYJU 3RWJA 1G6VK 2ESVE 1VGKA 1LE5B 1URLA 5K93A 1W72H 4KRLB 3BP4B 5C0EB 4M5ZL 1HHJA 3KPTA 4U6YB 1JYNA 5F9OL 5FGSA 1MI5B 3QCVH 1D5MA 3BT2H 3FQTA 4M62H 2VDRL 5DEGB 3GM8A 1ZLVK 2H2SC 1MVFA 3PWUB 1KPUA 1DLFL 4D9QE 4LGRB 2X89A 1CDYA 1IILE 4XRCA 4R7NB 4J6RH 2JIXA 5C0BE 3SKJH 4BSVB 5HXMA 1IT9H 4Y16D 3FN3A 4PRAA 4F7EB 1OCWL 3B6SA 2V7NA 4WU7B 3VRIA 5KN5A 1BJMA 4P23A 2ZP0T 5EOQH 1A9BB 2R1WB 2X40A 3T2QA 4IIQA 4O9HH 5D7IA 4X5XA 1OGTB 4Q0XL 3O4OC 5FUOL 4UZGA 5I19H 1ORQA 4NM4H 1NGPL 1PX4A 5FV1L 2IG2L 2DLHA 1AHWC 4F3FB 2C4FU 3GSWA 3RY6C 4PJFB 4FQPA 1NJ9B 3FT2B 3QJFB 3WUZA 5T3XH 1W8OA 4PJ7A 5BVPH 4M8QB 1S78C 2Z8WC 4KJQD 4MVBD 4GAGL 1UKSA 2DYPD 4EOWL 1XMWA 1A7BA 5CP3H 2YPKB 3OR7A 2DL2A 1E6JL 1IC5L 4HUUB 4OZGE 3RNKB 2A0LD 1PZ5A 1YMME 1MCFA 4TQEL 3EDFA 2PR4H 2UWEF 3DUSA 3WKML 1JPTH 4IDLA 4MJ2A 1OAQH 5JZ7D 5ID0B 5JORA 3SJVB 3O3AB 5HPMB 2AEQL 5IBLC 3G6JE 2APTA 4FQQB 1WT5C 4NT6B 1AH1A 4P3DB 4Z7UB 4JR9L 2IAMD 3RPKA 1CE1L 2X4RB 5CLWA 1CL7I 4I3RL 3ZT5A 3L5IA 1FIGL 2G5BA 3ULSA 3FB8B 4KHTL 4RSVA 2J12B 3H0TA 5IW6B 4TN9A 1MEXH 4N0CD 5KVMC 3WS3B 5DRXA 4E5XB 3EFFA 4PRPE 3STZA 2V2TA 4OCNC 1U36A 4XCCL 1E4JA 1LO2H 4RX4D 5AG8A 3KPNA 2ZSWA 4CNIA 1U8IA 3GMQA 3ZKXB 4ZFGL 5JW5A 3CFKB 5D1QD 5D71L 1Z9OA 3MOAH 2Q20A 4Z5RA 3ZT6A 4AL8H 5JPMB 5DD3H 4S1QL 1YEDB 5D7JA 5L2KE 1VFAB 4JFEB 4UTAH 2LVEA 2X4SB 2Y72A 1NDGB 2FX8L 4GW1A 4RISL 5TDOB 2B5IB 1F90L 1QACA 1XF4A 3JZ7A 7CGTA 4WU5B 1R3HA 5E7FA 1HI6B 5DD5L 3ECBA 4Y5YC 2H2SD 2OL3L 1PW3A 4HJ0D 3UBXB 4ZUWA 1MJJA 2R2HA 3OPZH 1IM9A 2H3NB 3U9UA 1G9MH 1JWMA 3KDMA 4P4KC 4QRPA 4JN2B 4JHWL 4U3XA 5FOBA 4NKDA 3WEXA 5IWLA 4GKSB 5IROA 2DM4A 4E0RA 3SE4C 2ESVA 3IRZA 4DOHE 5CAYB 1MNUH 1WZMA 4JLRB 5IVZB 3IETB 4M7LL 2EDLA 5EU4B 5J13B 3C08L 3LN4B 1S7SA 3EOTL 1PFCA 1I4FB 4OZIF 3UJJH 3GSRA 2PYEB 3U0TA 2VUOA 1FVDB 3E6FA 1RK1B 3VI3F 5DSCB 1HHHA 4X6DF 1IE5A 4JAMA 1NEZB 2ZCKH 1HYSC 1UZ8A 5F89A 4U05A 4LSSH 1NAKH 2CO7B 3HNTL 1KT2A 2WBJB 3RJDA 4H8WH 4LFHD 3EZJB 4XT1C 1JGEA 1UJ3C 1KJVB 2J8OA 5BW7A 3SDAC 1I1RA 4XNYL 4NGHL 4KGJA 4ZFZA 1HNFA 1N3NA 4MNGA 3H42H 1AQDA 3RZWA 2IEPA 2HT3C 4XBGA 1A6UL 5BMFH 3BHBB 3CH8A 5CZXC 4LP4A 5DVLA 4WJ5A 3LV3A 4LQFL 3ELAT 3VFOB 4U1IB 4HCRA 4MXWL 1MHEB 2YN3A 1MH5B 5IB1A 3HMWH 4PY7B 3ES6A 2AV1A 1JBJA 3GHBH 3BXNA 4U0RC 2QSCH 1OAXH 1YMMA 1FAKT 3T04D 1UACL 5C92A 3MSPA 2C3VB 1Y18A 4CMHB 3BP5B 4OTXL 4U6TA 3KYOB 5DZOA 2NLJA 1YEIL 3PV6A 1CDIA 3D2UB 3NZHL 1E28A 2NTFB 3BPNC 3O9WC 4JQXC 4ZD3L 2IH1B 3P30H 4KKAD 5FEBA 1S5HA 3IFOB 1KELL 4R0LB 5B8CA 1RUMH 4ZDHA 1JPFA 1U2HA 3QCTL 3EO0A 3MYJA 4PJCF 2VQTA 5JHDB 1R6VA 2Y9RT 4J4PD 3O6KL 5EOCL 2CDFA 1SBBA 1TFHA 4NN7B 2PO6B 3ME0A 3LH2L 3LRSA 4ZQKA 1YEKH 4WCYH 3TNNA 1JNHA 2Y06L 4J7RA 4ODWB 4PRPA 3D0VB 4XVJL 4HIHB 1J8HD 3BAEL 4KXZI 3ZKNC 4TUOA 1B4JL 2CLVA 3X3FH 3U36A 1CDUA 4FZ8H 4X9FA 4CJ1A 5T3ZH 3VD5A 2CDEB 3OJDB 3BIBX 3HTLX 1EGJA 4U1SA 4KH2A 4X99A 4KPHH 5DK0A 3T4AB 2QR0B 1T1YB 2EO9A 1VKXB 4EUPG 5E70A 2HJKA 4P4KD 4YPGB 5IMKA 4X8JB 5E99L 3FOMB 4BKLB 4YC2C 2UWEA 1IGCL 1OB1A 2CLRA 2VE6A 2ZZUT 3DXAE 3F7QA 3MLZL 4DUXA 5L2KA 3QNYA 5CZKA 1OWRM 2ERJC 3NAAH 4EI5C 3GIZH 4Y19A 4K94L 2BSRB 1RULH 5IVXB 4ZSOE 3MRDB 1VADB 4A2LA 1P2CB 4QTHB 4EUPA 3MJ9H 4F8QA 3IFLL 4D0BA 3FCTA 2UZYB 4JM4H 5DJYA 4Y5YA 5HI5C 5D93B 1SJVA 2AJ3A 5JOEA 2IAND 1RHFA 4GMTH 3FB7A 4QRTB 1Q94B 4N0UA 4RAHA 2OR9H 4XNMA 2A6IA 2YMXL 5FXCH 1SJEB 4OCWL 2YWYA 3ARDD 3JWDL 3QIUB 5J6GB 5C0AD 2XQBL 4PJEF 1T7YA 4WWKC 1BVLA 1SM3H 2K3TA 2XA3A 2DQTL 5IR1B 2Z4QA 4YHLL 2ZNXA 5GJSH 4OM0L 1VEMA 2Z0BA 3WJJA 3PP4L 3MUGA 5L6YL 2AXFA 3GRWH 5FHAL 1V7NH 1QBLH 2HT3D 2NXYC 3QULB 5M94B 2VLME 4HFUH 4XI5C 2RIKA 3TBWA 2J88H 1E0OB 4JO1L 1I8KA 5GGSA 1ZLVH 4X0KA 1L0QA 2VLKB 3MXVH 5SWSD 1J0JA 1REIA 5TF1H 5J11B 1N5AA 2P7TA 5DVKA 2EECA 3MLTB 3VD7A 2XKNA 2V9TA 1BJ1J 4FFYL 4KJWC 5MEPB 4B7LA 4YPJA 4HG4K 3PGCA 4PGDA 4Q9BA 2AK4E 1FZKA 2X1QA 1KB5L 1XCTA 3WSQH 1V3MA 2RHEA 3BEVA 4GT7A 3SDAA 4X9HA 3PWPB 3E6HA 1Y0LA 5MEOB 3IDYB 2V5TA 1HWGB 2AJXH 4OT1H 4MLSA 3MROB 3O9WD 2NY0B 4O02L 5EC2A 5J7CC 4D9LL 4YGVB 1FNEB 3OMZA 2HKFH 1T0NA 2HJLA 3THMH 3DV4A 2ICEB 3MC0A 3G6DL 5JLZA 1UB5B 1P7QB 4M02A 4EBQL 3WNNA 1IKNC 5E8EA 3V4PH 5ALCL 3QHFL 3UBXI 3IFNL 3L3GA 3QYCA 3EYUL 3ZHDA 3JWOH 1T03L 4CU7A 2EH8H 1K3IA 4HX1B 2EZ0C 4P2RB 1YECH 5DJDB 5FFLA 3QHTC 4RBPK 4X6DA 3KYAA 5HHOE 2Y25A 4IBLT 4S2SB 1JWSB 2WV3A 1V05A 5HHQB 2ICWA 3HMXH 3LPGA 4G8GB 4JQXA 3KJ6H 4QRRB 1SYVA 3DX7A 1YMHB 4OAWB 3TCLA 2JJVA 1KBGL 5E6YA 2R1XB 2JJSC 2ARWA 4ORZC 3ULVD 4X7CC 1WSST 3JSSA 3M8OL 2I60H 4KZDH 4R4FL 3HZYA 1NPUA 2P24B 4LIQL 3N1PC 1S7VA 3D69B 2E27H 3FMGH 1EJOL 2CK0L 4APQB 4IMLB 5CIPB 1MJ7H 2YZ8A 2A77H 3REVA 4GBXA 2EDQA 3DGGA 4EXKA 3UPRA 3K2UL 3QDME 3KLHC 2YRPA 4PLJC 4IS6A 1F6LL 2CGRH 2VZTA 4OSUH 3OJ2C 2X4UA 3MRBA 4FNLH 2YRZA 2XI9A 4LSVH 5HI5D 1GGTA 1K6QH 4XHQA 1KIQB 2C3WA 4RGOL 2BCKB 4KRPC 4OD1L 4AK1A 2Z92A 3VFRB 2DLEA 4LOUC 5LGHL 5C1MB 5DC0A 1EX0A 1K4CB 1X44A 3DXAA 4GOSA 1E4WH 5F9JB 1Q72L 1A14H 4WENB 1JPSH 1MCSA 4WWKD 5C71A 5I1CH 2KBGA 1CXHA 4ZUVA 3RWEA 4JJ5A 4ZSOA 3DROB 5F70A 5ACLA 4KY1H 2XZZA 4L8SB 5DA0B 1CICD 3KPOA 3VWJB 3QQ3B 3BZ4A 3KPRA 2JCCF 2NXYD 4PJCA 4PP2A 3KXFB 3TO4A 4JFHE 3QO0B 1NCCH 5IIEB 1LO3L 1JYWA 4GW5B 4M9PA 1IM3A 4Y4FB 1BZ7B 4Y2DD 3X3GH 2R0WH 3MODL 5E2UH 1HXMB 1H3TA 1G1YA 1RUAH 1D6EB 3S4SG 3L5XL 5ANME 3MRPB 1F97A 5GGUA 2IBGA 3QWOB 4WI4A 4KJWD 2E7LC 4TVSa 4MCYA 3L3JA 1GJIA 3V5DB 2EE3A 4POUB 4S11A 4FRWA 3VXME 4TVPD 2ZKHL 2W9DH 1CTOA 1NFDE 3FO2A 1MVUA 3IS1X 5C9KA 4R4BB 5I1DA 2W9EL 2D3VA 4C55A 4FZEL 4JVUA 1MRDH 2Z31D 2AERT 3S4SA 2OTWA 2DD8L 2OQJA 3WFHA 5TGBB 1HK6A 4NQSB 2FLBT 1QR1B 1JK8A 1XZ0B 1AO7B 4HKZA 5HHXL 3DO7A 1K8IB 3GMLA 1LD9B 4WI8A 4LRNH 3NCCB 2HN7B 3ULVH 2YPLB 1MCJA 2VLRE 4LKXA 4PP1C 2AK4A 2IC2A 1FNAA 1IL1B 1UCTA 4TNWF 3QFDB 1A2YA 3BWAA 3W9EB 5ERWB 1FG2A 3L7EA 1MWAB 4YHPA 5TF0A 3UTQA 5BV7H 5IV2A 1MJUH 2PYFB 3P0YH 1WUNT 3V0WH 3FQNB 4NO3A 1WISA 1J8KA 1HHKA 4CKVX 4NPYB 2NXZC 1BZ9B 1MCEA 3F7VA 4XMPL 2AEPL 4WWID 4P2OA 1MRCH 1OQXA 3J8F7 3UCRA 1MCWM 5C3TA 3DMMC 3OF6D 5I1EH 1I7UB 3L95B 1JMXA 1IKNA 4KWUA 1IAMA 3LN5A 4CVZA 1EAPB 3NFPB 1QO3B 1IKFL 1GXEA 5H35B 1QA9B 2HT4C 4NNXA 4K8RD 1OAYL 1EMTH 5GGRB 4MXQC 5HDOA 3OKOA 5F72S 4NYLB 2B7DT 3GI8L 2CD0A 3AAZA 4RGNC 5C9JA 1JMZA 4TNVK 4KRPD 5D7LE 2B1AH 4DK3A 4OGXL 1KENL 3DSFL 1UM5H 5T1KB 5ITFB 3NABL 5IJVB 1TCMA 4NQVA 2JKXA 1FO0L 1CGTA 2AGJL 2HYMA 3G9AB 1CD0A 5CGMA 1EZVX 1S5IL 3OKMA 3X12B 2VYRE 3C8HA 4M7JH 1A02N 2P45B 4TVPH 4M48L 3UTTA 5FO8A 3C6SB 4LQ1A 2ZPKL 4AYFA 3BQUC 1NCWH 1AKJB 3QDMA 4JGUA 5GGSY 4JFFE 3QQ4B 3ROOB 3RY4A 2A2QT 2FEEI 1SMAA 4XPFL 1GIGL 1XR8B 1EFXD 4Y1AD 3GSXB 3TIEA 5I66B 1P7HL 1LE9B 4PV8A 2A9ML 5CGTA 3UC0L 1E6OH 4NUGL 3CFCH 5AAWA 4Y88A 3SKUD 1A7QL 1C5CL 2YK1L 4OQ1A 5TFSH 5F8QC 3KPSD 3L3IA 5E8DL 3ZTJG 1BVKA 3DUUA 2VLLB 1NGQH 1WZKA 5CS7A 1UC6A 3RU8L 3K8KA 4IRSA 4X4XA 5SWZE 5FKAA 5C86A 1CD9B 5I2IB 3QAZC 4Q9QL 4ZYKA 2G2RA 2CK2A 3B3IA 5JPNA 2FBJH 2FJFB 3HPJA 5CJOL 5GHWH 3LIZL 3LKRA 5DD1L 4GRMB 3M1BB 4OGAC 4HS8L 4BSJA 4OF5A 3LKNA 1ODAA 2HFTA 3VXMA 4H26B 4LCIH 4FFVD 4YDKH 1R3KB 1Z9MA 1ULVA 1QNZL 2GCYA 5I9QB 3BISA 3I50L 3VCLA 1Q0XH 5EU3B 4K8RH 1T20B 1XGTA 5D1ZB 3RVTD 3H2WA 3HG1D 2PNDA 1DVFA 1JN6B 3ARGB 3L5HA 5GS1A 1ZGLA 1D5XB 1D5IH 2NXZD 2HFGH 4DKEH 1U92A 4NQEA 5CINL 4LSTH 4H0IA 1ZWIB 2ICES 2GTZA 3GHEL 1P69B 2ADFL 2VLRA 4L9DA 4JFQA 2X42A 1UM4H 3LQAC 3RPIB 3LKOA 4NNPH 2JCCA 4J1UA 4F9PA 4D8PA 2X4QB 5H2BB 1RJYA 2ZUQB 3PJSA 4HS3A 1F42A 2G60L 3BP7A 3MRFA 4MSWA 3S96A 2FL5B 5CJ5A 1NGXA 3EJZC 2ADIA 4BFBD 5H8DA 3AMLA 3HC4H 4J8RA 4RGND 2F54D 3U7YL 2VH5L 5DVOA 4DKAA 1OAKH 2XACC 3QRGL 1C8PA 5F7HA 1F4WH 1FZOA 1MFDL 3HZVB 1U8OB 4GRLA 4C57C 4QLRA 4TRPL 1INDH 1IC4H 1RHHB 4RA3A 3WUWG 3ZKXC 1KJ2B 3QUMH 5H94A 1SEBB 2ZJSL 3TT1L 5JIPA 1BJ8A 3LD8B 3ISWA 3MRHA 1U2CA 3OGCB 1G7QA 3RGVD 1NUFA 1F4XL 1U3HD 3ARTA 5EORH 4BK5A 4FQHB 3H6JA 1WTLA 4RGMB 4FTVA 1DEEB 1H3WM 4P99A 5D7LA 4HSQA 2XN9B 3T0EA 4LCWD 3W0WA 1JGUL 1MI5D 2B5IC 3QCVL 4FS0A 3WUWA 2XWTB 4M62L 1EHLH 4ZOBA 3ZE2F 1EIBA 2VIRA 3NFNA 3E0GA 3RQ3A 4MB4A 1YNLH 2P46B 3SKJL 4U1MB 1ZXQA 1UB6B 1JHLH 1JZ3A 3HC3H 4HT1H 4L3CA 4LHUG 2JK5B 2QQLH 1FZMB 3S8WA 5DTFA 4P9MH 4OCYH 4I77L 2W91A 3BQUA 4OCXL 2M8XA 5ESAB 3OX8B 5FAAA 5EOQL 4N0YH 1Z3GH 4ERSH 4Q97A 5J13C 1IEBA 2VKWA 2XV6B 5F9WB 4U6YA 4NM4L 2FB4L 1I8IB 3GSQA 5FO9A 2NX5B 1ZKAA 4HMCA 4J3OC 4LHUA 5DEGA 5JXAH 3D0LB 1F2QA 1NCTA 2LFGA 2PYEE 1KN2H 5FGRA 4JDTL 2OJEB 1T22A 1CN4A 2RGSA 2G9HB 2ITDB 3EYOA 4Z95H 4BSVA 1KTDB 4RDQF 1YY8B 5DK2B 2B8OT 4WI2A 5CILH 1CI5A 4JPKH 4JFYB 2HLFC 2WBJC 5SWZA 3TPKA 1E4XI 3SOBH 1T7WA 1N59B 1JRHI 1FC2D 1JFQL 5DHVB 1I9EA 3ZE2E 4MJ5B 1JPGB 4LSQL 2G75B 4KK6D 3BYTA 4I48B 2XY2A 2IQ9L 2IFFL 3VGHA 1AI1H 1OAQL 5J9PA 3SJVD 2XWBA 2WBWB 3D5OF 5DS8A 4HUKB 1CFVH 3UP1A 1CG9A 3ROLB 1OVZA 3GJEA 1BX2B 1FFOA 3GJFB 4QRSB 3BZEB 4X6FB 1EO5A 4G9FE 4JRYD 3RVVD 3O4LD 4AIOA 1A21A 1P6FA 3AS3A 4PV9B 2BSED 2FJGB 3CLFH 5LGKA 1BD2B 2W1NA 2X4NA 3IJSA 3OWEA 3VXNA 43CAB 1CFQA 2RFXA 2ED8A 5D7KE 1LO2L 5DO2C 1F2XK 3VFVA 1MCWW 4HD9A 4R4NC 4IRJD 2IBZX 4NM8H 1OSZA 1BEYH 5EC1A 3LKQA 2DM7A 4R0LC 3X13A 4U31A 4C59B 4NT6A 4AL8L 3MOAL 3BSZL 5DD3L 5IB5B 5C0DA 4ZFOA 3I75B 4XMLL 1GC1L 3PL6B 2VZ3A 2PO6C 4JFED 4UTAL 1BF2A 1LWRA 3J7HA 4NP4H 5GS2H 3Q1SH 3EUUA 5GSRB 2LV4A 3HS0B 5JW4N 1FV1B 2CRZA 3CFIC 8FABB 4E5XA 4AQ1B 1EA9C 3IRPX 5E6ZA 5EU6B 1XGRB 2DWDA 4X5LA 2PCPB 2EYSB 5E8NA 3OPZL 2ZSVB 4IOIA 5B4MC 2CKNA 1G9ML 5T5NF 4BH7A 1XR9A 4H5SA 4CN4A 2EDYA 2EC9U 4XC1H 4TUJB 1AP2A 4F7CB 5SX5K 1N26A 4Q2ZA 1FL6A 1A7OL 1ACYH 5LXGH 3ULUC 5FK9A 4I0KA 2A9NL 4KGLA 1O7VA 5M95B 3QHZL 1MNUL 3ULUE 1LNUB 1INQB 3KS0H 1QRNB 4XPAH 1KLGA 1J0ZA 1TPXB 1RD6A 2FYYB 2DTSA 2VRAA 1G9NH 1RZFH 1J05B 5KSAA 5IVXE 2HMID 5DRWB 3NCBB 2HVKB 5LGJB 3P73A 5GGTH 3W5NA 3DYMA 4Z7WF 1O5DT 5D93C 4G3YH 4OCRH 3UBXA 4MA3A 3U6RA 4YHKL 1AFVH 2ZCKL 4LSSL 1NAKL 1RZ8B 3VA2C 4P57A 4X4ZA 5EB9A 3QIUC 1YQVH 4PFEA 5FCSH 4PB0H 4UQ2A 1VEPA 3TFKC 5E8OB 6FABH 4N90E 4ZNEE 3H42L 5F97E 5GGVY 4MCZB 5DVNA 4UU9B 2OP4H 3QI9A 1HHGB 4Z77B 2E9WA 5I1LA 2G5RA 4QXUL 3IKKA 5BMFL 3FOLA 3VFWB 4KFZC 4FQXB 2PYEA 5JXEC 1XF2A 5EN2B 1S9WB 5J11C 3G08A 4JJHA 4PTTA 1IGFH 4P46B 3CVHB 2RR3A 1NKOA 4NCC1 3M45A 1NEZA 4G5ZH 1EVTC 5F1SA 1RVFH 1MCOH 1NBYA 3MV9B 1L9MA 2APVA 3GHBL 1D5BB 4NUJB 1K85A 2H8PB 1T7XA 4I4WB 4MNQB 4HWZA 4PJXF 1I3RB 2IADB 1AY1H 2F19H 3ZYOA 3JVGC 3IDYC 4ZAKB 3PGDA 3EOAA 3D2UD 5AWNH 3PWPE 2V9QA 3QEUB 5ICXA 1A1NA 1RZJC 2NY0C 1TVBA 3MRGB 3P30L 4CMMA 4L8BA 1NQBA 1QLRB 1RUML 1HILA 3UAJD 5CSZA 4G9FA 1KB5A 3FO1A 4U1JB 3T3PF 4PB9L 5DYOA 3VXPB 5DQJA 5JHDD 4RDQG 5HHMB 1B2WH 2VTFA 3MLRH 4I2XB 4YHZH 5EIVA 3S7GA 5A43C 1YEKL 5J1AB 4WCYL 2H1PH 3BEWB 4Q9RH 3TBVA 5D8JH 3X3FL 3TBSA 3RTQA 4FZ8L 4XP1H 4UAOB 4ZUUB 4F7PB 5T3ZL 3GUTA 1I3UA 4KPHL 3TBYA 4P2RE 4YHNB 1LO0H 4LRIC 5B4MD 1M05B 3C8KB 1RZKC 3VFTB 2Q76A 4JB9H 1RV6X 1IAII 3I6KA 4R7DB 4U1LB 3MUZ1 1LO5A 4YNYB 4H25A 5KOVC 4OFIA 1S7QA 4G8GE 5DMYA 3BE1H 1K3ZA 5C3LD 1HINH 5IJKC 1GPOH 5EH1A 4QRRE 4ZFFB 5DI8A 3ULUD 3KLDA 3NAAL 4PJXE 1ZMYA 3MCKB 4MJ4A 3U1SH 4NKQB 3GIZL 2ID5A 3MCG1 2H9GB 4MAUH 5GSVB 2ATKB 4QCIA 2W9LA 4APQC 5KVGH 1IM9D 1OTUC 1Q9WB 2KPNA 4OF8A 5HY9B 3CSYB 5D1XA 3D0VA 3AS2A 1AE6H 3JBG7 3MJ9L 3U9PH 5EUKB 2BX5A 4HFWB 1NBVH 3L7FA 2MKLC 4JM4L 4V2CB 3TVMB 3CMGA 2VITB 4LNRA 5HI3C 5BCAA 5EU7C 3SGJA 3CFBA 5EO1B 2R0KH 3BKCH 4OZFB 3HI6H 3RWHB 3DX6A 2OR9L 2V2WB 2RCSL 5HYSG 5EULV 5F21B 4U6HB 3RI5K 1RI8A 3VE0A 1NGWB 3IDGB 4F80A 1SM3L 1K5NB 1U8JB 3TFKD 2F8OA 4JY6A 3UTSE 5EU5B 3DECA 4JM2D 5JIHA 5GJSL 3DHMA 2BERA 4L8SC 4ORGA 4BJLA 3GRWL 3VWJC 5CEZD 1V7NL 1AR1C 1QBLL 3SDCB 4OLVH 1B6UA 2J88L 2YBRA 3I6LD 3QFJA 4NO0B 4F33A 5JXED 2Q86B 5J0BA 5I1HH 4Y4FC 4HIXH 5T5NG 3KXFE 3RVUC 3V6ZB 1S8DB 2VLKD 2VMFA 1K4DB 2Z35A 2WINA 3VMPA 3SDYH 1NL0H 4HC1H 1ND0A 2AQ1A 3MJ8A 4X7TB 4RAVB 4P2QE 3FAXA 4KTYA 4QRTA 1FNGB 2BC4B 4XNQB 5JNYB 2BNUB 4NQDA 5SV4A 1DQQB 3EJYC 2BVOA 5FUZL 3ESUF 3QIUA 5JTWA 4ZNEA 2YD3A 1Q0YH 2NZ9D 2OTUB 2IPKB 5DUBB 2AJXL 3MREA 3OBAA 1RIVH 2NY0D 3AXLB 1BBJA 1KN4L 2HKFL 1JWUB 3VWKB 1YY9D 2B2XH 3RIFK 3THML 4S0SD 3EO1A 4X6EB 3SKOB 1J1PH 1EHAA 1NDMA 2YR3A 1EPFA 4LPTA 1ZHLB 1P7QD 1W0WB 4H0HB 2V7HB 3V4PL 4C58B 5E6IB 4WDIB 2RBLA 1RMFH 5EPMA 1QSEE 4X5WB 3LEYH 4EN3B 5MEPA 3IU4H 4HIIA 4YBQC 2D9CA 2YPLE 3JWOL 3VW3H 3QDGB 3VDCA 2NY7L 1MCHA 3AY4A 2EH8L 5EZLB 3T08A 4Z7WA 4P4RA 2A1WH 1WJ3A 3AMKA 4JFDE 1YECL 2CDGA 3TH2T 1FNLA 4GXVL 3BDXA 5KVEL 1G7HB 2RQ8A 4W81A 3UO1H 5BJTA 4E41D 2IPTH 4L8CB 3HI1A 1H15B 3HMXL 2VJXA 5T33H 3VFUA 3GSNL 4OZHF 3KJ6L 5DFTA 1AXIB 3H9HB 3IYLW 2YUXA 3KG5A 2GKIA 3R0MA 3HNSL 2ZUYA 3BDYH 1YPZF 1TZHB 4QYOB 2NY4D 4XX1G 2I60L 4KZDL 3RNQA 4HKXB 1R5VB 4M93B 3CK0H 5CJXA 1FQ9C 1MHCA 1VCAA 2E27L 3BPCB 3FMGL 1TDQA 2EYRB 3V0VB 2X4TB 4APQD 1OTUD 2VL5B 1MJ7L 2A77L 1F3DH 4YH6A 4XHJD 4X9BA 3SGDI 2PXYB 1KXQE 3WDIA 5EO0B 4EDXB 1ZS8A 5ID1A 3V5KB 1SJHB 3MRQB 5HI3D 1VFBB 4FXLA 2WIIB 4FNLL 3ZYZA 4LSVL 4TSCH 5CEZH 3WIHA 1K6QL 3L5WA 2OCFD 3CD4A 4JPWH 5GJTH 1KOAA 4Y19D 2HWZH 4G8GA 5DUMH 4Z8FH 4YIQB 3GNMH 1E4WL 2R1XA 4PJXA 1JPSL 4GSDH 4LLUB 2IQAB 3AM8A 1FZJB 1ZE3C 1MCNA 3VA6A 2P24A 1HSAB 4G9DB 1EXUA 2AK1H 1V3JA 3MLUH 4NJ9H 1ZHNB 3VFGH 4NZJA 4XBEH 1AXSA 2Q7YA 4OZHE 5CIPA 2OYPA 4WI9A 3VWJD 4K07A 1A22B 4UUJB 4IOFD 3OB0K 1FYTE 5FGCB 5DJAA 1NCCL 1YPZE 1HZHH 1U0QA 3EKCA 3RVUD 5F6HJ 3X3GL 4U6VH 1CGWA 5E08H 5E2UL 1RUAL 3CDGB 1KIQA 1ZLUK 4DGVH 1T1WA 2FIKA 3OV6A 4N0FB 4YFLI 3CVIL 5F3HA 2W60A 2ATPB 1NGZA 3KLAA 3KR3H 5HDBF 1U8NB 2W9DL 3BWUC 3UTSA 4OZ4B 4WO4B 5CFHA 1P4BH 3CXDL 3B2VH 4XWOC 4BZYA 4I18B 1DEDA 3RL2A 3WIIH 3OB8A 5FYLL 4GRWF 4OGZA 4OF6A 4HAFA 4Y5VA 4X80H 1AO7D 3QO0A 5IF0B 3WV0A 1H3PL 1RIUL 4I1NB 4JKPH 4M9OA 3SGEI 3TN0B 1DBJH 3V79C 1GOFA 1A1MB 4PD4J 4JG1H 5F6IB 4LRNL 2O5ZL 2R1YB 4P2QA 4F37F 3MX0A