3RPIA

Crystal structure of fab from 3bnc60, highly potent anti-hiv antibody
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
b'VHLSQSGAAVTKPGASVRVSCEASGYKISDHFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRQASWDFDTYSFYMDLKAVRSDDTAIYFCARQRSDFWDFDVWGSGTQVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain from highly potent anti-HIV neutralizing antibod
publication title Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rpiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rpiA01
3TN0A 1NAMB 3IFNH 3L3JA 1NBZB 1S7QA 1YDPB 2GIYA 2VE6B 1I4FA 4Z7UB 5E24E 4ZOCA 1T3FA 4TQEL 2ATPB 5LQBL 4MNQB 2VDKL 1NGZA 2FZ3B 4UILL 3TLRA 2AGJH 2UZIL 5IVXB 3D3VB 1P9MA 4MA7H 2X1WL 3OG4B 2PYEA 4I0CC 4LSRL 2EE6A 3H42H 5F1IB 3TT3L 1VEPA 3P4OA 4JY6B 3FOLA 4XNXL 3X12A 4P9HH 5CBEB 2Z31C 4KI5F 1MPAL 5IW3A 4I0PC 1BD2A 3BZDA 5CKGA 2CXGA 1F4WH 3LN9A 1TETL 2P1YA 1CZ8H 3MR9A 4WU7A 1YN7B 5E8EB 5IIEB 2QR0B 3OB0H 3UO1L 1SBSL 1JL8A 3NACH 2VLJD 3QHZL 1D5XA 2HT2C 3ROLA 5EO0B 2QQLL 2AQ1A 3G04A 4O5LL 4LVHC 4UOW0 4O4YH 1EGJL 5C0AA 3LIZL 5I71B 3CFKA 1K9TA 5KSBF 3ARED 4ZD3L 4JGMA 1JPSL 3VFPA 3S88H 1NKRA 2GUOA 2VAAA 4OFIA 3QRGH 2CO6B 2VN7A 4ZUUA 3W0WE 4LSDA 5FM8A 1M1SA 4Y4FC 3BUYA 1GJIA 4M3JA 4P2QB 4LDEB 5BRZB 1IBGL 1H8NA 4HUXB 1NGXB 3EDKA 2IPKB 4Z7WA 3FFCE 3FB7A 1CVSC 3VXMD 2BNQA 3QWRA 4LPXA 5FA3A 1GHFL 1Z2KA 1UH4A 5D7JB 3UYRH 2B4CH 4J8RB 4APQB 1DUYA 3WHE0 1JRHI 3DUHA 4MHHI 1BFVL 3ZKQD 4OUOA 5IW6A 4YC2C 3MOAL 4CVXA 3ZKSD 3THML 1EHNA 3WFHB 3S37H 4F9LC 1G84A 3MRIA 4RFNC 1NL0H 5D7IE 3RFZC 5B3JF 3OJMB 1KXVC 1I8LA 1LO4H 2BVUA 2R15A 5F7DB 1B6DA 1U0QA 5IW1B 1J8KA 4KRLB 3DGGA 4G9DB 3H9HA 3TYGL 1S7WB 1S9KC 2W92A 3V4UH 1AD0B 3T3PE 5F3BB 4U1HA 1ND0B 1T1XA 4UNUA 2NY1D 2BVYA 3EJYC 2JJTC 4OCRL 3FT2A 3TWCL 1EEYA 4JO3L 4F57H 3ILPB 3GSVB 3UDWA 5FDWA 2FEDC 3NFPB 3IRZA 2ESVD 1BVKB 4QWWC 4Y5VC 2Q76B 4WFHE 2HG5A 4D3CH 5BQ7A 4KRPC 4U1NB 3EO9H 1Z5LB 5LGJB 4XCEB 2ZCKL 4MD0B 1OP3K 1SMAA 2GFBA 2A0LC 4L1DA 4LSUH 2KKQA 4FQ1H 1TJGL 5CSZA 1N2RB 1CGWA 2Z8SA 5CP3A 2FX9H 1PSKL 3I6KB 5IT2H 2X9XA 3LN4B 3O4OB 1E4JA 3I75B 4X4ZA 1B88A 5GGRY 3DTXB 4I5BB 1QBML 4YFEA 1FO0L 5C0GA 3W0WA 1FG2A 5F6HI 4FZ8H 2D0GA 1HHHA 3EJJX 2CMRH 1BWMA 4KQ3H 3AXLA 4FNLH 2QADB 4JREB 3FFCA 4FQIL 1T83A 1ZS8A 2FDBP 4WENB 5ICYB 5D7LD 2Q6WA 4L29B 1RZ8A 4TUJB 4IOIB 1INDL 2GK2A 2NXYD 1N26A 2JLLA 1VADB 2J8UF 3GMMB 4CGTA 4Q9RL 4QRQA 3CDYA 4JVWA 4WI3A 4P2OC 2PF6A 2OCFD 4G6AC 1L0YA 3HE6D 4LU5H 2DQCH 1TPXB 5FYJH 5SWSB 4M8QB 5D7IA 4DN3H 2GSIB 1XF2B 35C8H 1SYVA 4X99B 2XA8L 3U9PL 1LO5A 5GGTA 5T1KB 2V17L 1EFXD 5CBAA 3I3DA 3MRFB 4NOFA 1GCFA 4N0RA 1A7PL 1LGVA 1CTNA 4P2OA 5KSAB 3UPRA 3GSWB 3N85H 1D9KB 1WCBA 2E7LC 5AWNH 1MAJA 4NUJA 1CI5A 5F97E 1P1ZA 5L88L 1EVUA 4AIXA 1LP9E 1K4DA 5F3HA 1WAAE 4AMKL 5F1OB 2EYRB 4P4RB 4PLJD 4P23A 4XVTL 2FB4L 1QBLL 3RL2B 2IFFH 1CDJA 1AKJD 1IAIL 1NGWB 5DJDA 5JW4Q 1S9XA 3IJYA 3Q5TA 4E9LA 4JZOB 4GG6E 4NZTH 5SWQB 4MVBC 2E7LA 1AD9A 1VENA 3K74B 2MSPA 4LKCB 4ONGH 5IB4B 1MRCH 5DD1H 4Q9QL 2VO5A 2DYPA 4UQ2B 1BM3L 4IRSA 4Y0GA 2K1MA 4M6NH 4XCYB 4AENB 1KN4H 5DUBA 1OP9A 5FGCB 2V5YA 2JB5L 4NNPL 5EC2A 3IJHA 4GMTH 2A73B 1QVOA 3VFUB 2I9LA 2ARWA 3HI5H 4UOJA 3BPLB 1H3PL 1XIWD 4HAGA 4NPYB 4P4KB 2F15A 3FQTA 3HN3A 3TF7C 1NCUA 2YXFA 4RISL 1G6RB 4X7EC 3MBEC 4ZO9A 4X6DE 3MCLH 3QIUB 5I1IH 5I74B 1V8HA 5ALBL 4GKNB 3OR7A 1KJVB 1B3JA 3SDCB 2A9NH 2DMBA 2IEPA 4PD4K 1IAOB 4ZNCD 3QIBA 4YHYC 1QBBA 1MLBA 1EJOL 2B1HH 1HSBB 4X6BB 1JWSB 1N0LA 2X4RA 3LQAH 4N68A 1BEYH 4GKZA 2X44D 1BZ9B 2BHZA 5I18H 2MHAA 1TZGL 5ESVA 5IHLB 1BIHA 3BQUB 3JV5A 3S7GA 1UZ8B 3FN9A 3VWKA 1SHMA 1QR1A 4DKEH 3MBEA 3ZHDA 2YR3A 1T1WA 2WBJD 1ZLVH 3CXHJ 5IKCA 3CZFB 2QQKH 4R0LC 3TIDB 3M45A 2H32B 4B41A 3T4YA 5DMJB 3CK0L 3FRUB 1LP9A 5DSCA 2Q7YA 1JV5A 1WAAA 4KMTL 4HXAH 4U1LA 5SX4I 1CICD 5I8CA 1TENA 3P0VH 3D18B 2EECA 4I13B 4YHPA 1MHHB 3O8XA 4RQQA 4S2SA 3NIFF 4G3YH 1OTUC 4Z78A 4U0RB 2YRLA 3G5YB 2XZQH 3GIVB 3QUMB 4JFOA 4U7SA 5F93C 2WIIB 3UCRA 5DLML 4YGAB 5BMFH 4O2FA 4PREB 1JBJA 2Y7QA 5EUOB 4GG6A 5JIKA 2VZ3A 1L9MA 1QZ1A 1GVIA 2HFGH 5CKAA 3P9MB 4R0LA 1UXSB 3TFKC 4M6OH 2B2XL 3KXFB 5J13B 1ZHBA 4JM2F 5EO1A 4KFZC 5HHQB 3NABL 1JJUA 5MEOA 1FLRH 5L2KB 2YSSB 5CLWA 5KG9A 3BYTA 3AB0C 1JGUL 4IIQC 4WO4C 1FL3B 4XX1E 2VWEC 4Z0BL 5DVLA 3RA7H 3E8UL 3U4BL 1LNUB 2Q1EA 3BFOA 4L8CB 3GBNL 4X6DA 2W9EL 2DQGH 3D0LB 5CD3A 3C6SA 1YEGH 1DBAH 4JFZH 1Y0LB 5TFSL 1NGPL 3T2NL 1I8KB 3U6RB 4I3SL 2ZSVA 3H7BB 4QXTB 3IDMA 4WJ5A 1I3RB 3SE8L 4F2MA 3LSOA 1L7IH 1QUNA 4PJAF 3MLSL 5D1ZC 5E5MB 1RZIB 4IIQA 2X4TA 4K07A 2XXCB 5GS3A 2YC1A 2DMCA 3VXRD 5FYLD 4YEFA 4P2YA 4OFYA 3AAZB 3IS1X 3T1FA 3IDIA 3FB6A 3HRZB 4LSTL 4Y2DA 2R56L 3T77B 5EU4B 3HUJF 4TQEH 2D7QA 4E41D 4A6YA 5LQBH 2VDKH 4UILH 2UZIH 4PJDB 5DEZA 1VFBA 2QSCL 2RCSL 3RWDB 5CCKL 3ARGC 4LSRH 4R4BA 2Z8VC 5F7FA 1NDGB 3TT3H 5K9QI 4G8FB 4XNXH 4L8BB 4P2RD 1MPAH 4OZHE 2C9AA 5A16A 3UAJD 5HHMB 2DLIA 3EO1A 4XNZC 1TETH 3U30B 4R2GC 5LCVL 5MI0C 5GGRB 3ZDZF 4YUEL 5HGBA 3UO1H 1SBSH 4RA0C 4G7VL 3QHZH 3JV6A 1BLNB 4K9EC 4ELKA 2QQLH 3HE7B 1ZGLA 4NO2B 4O5LH 3Q3GB 3IDYC 1EGJH 3LIZH 3TA3B 4JM2C 4L4VE 4ZD3H 5J57B 1JPSH 4XVUC 2PN5A 4M1DL 1A4KB 2NY3B 1MJUL 1HSAA 3RWHA 2VABA 1RJYB 4KWUA 4AEHH 1IBGH 5F7HA 3FO0L 2BSRA 4OM1L 4N5EC 4LNVA 3BEVA 4LVEA 3CNKA 3JTSA 5IG7B 4K9EL 4KGLA 5IJKC 1KT2B 4TUOA 5IVZA 1K4CA 4U2ZA 1GHFH 1RZKC 3UTTD 3STLB 5HHNB 1KCKA 3QUZD 5INDA 3RZWA 3K3QA 2FX8L 5IMMA 4OZGB 3FTGB 4YHIA 5ESQB 1BFVH 4XCNA 5HYJD 3R0NA 3QDJE 3MOAH 1H9VA 4OBRA 3THMH 3O3BB 3CFBB 1W2KT 1P7QA 4HLZH 4Z7QF 3CSYA 3MROB 4AIZA 4JKMA 4RNRA 1R5WB 5DTFB 1IVLA 3RKPA 4QNPE 4E5XA 3RVTD 3O3UN 5HGHA 2XN9D 4RA3A 1X9QA 3VRJA 5IFJB 1BOYA 4FFWC 2W07A 5DMIH 3TYGH 3KPRA 3WNPA 4P3DA 3REWB 1GC1C 1RZKL 1ZHLB 4DUVA 3MTRA 2ED7A 3RZCD 4WY7L 3X11B 1HILA 5JW5B 3U9UA 1ZOXA 4QHMB 4OZHA 3C6LD 4OCRH 4K8RH 3TWCH 4JO3H 5F8RC 3C87A 3F12B 2JJSA 5E1HB 3QZWB 3OAUL 1BPVA 5LAXB 3CPLB 1BMGA 1OGAD 1HHIA 1JF5A 2M2DA 1U8PA 5D7KD 2N7BA 1HCFX 2ZCKH 2H2SC 4OCMC 4NNYB 5IGXL 5D2LF 5IF0A 1GYAA 1M05A 4L4VA 3MJ9L 1PSKH 4TTGA 1U3HA 3O6KL 4H0HB 1GC1L 2ERJC 1WZMA 3ELAT 1QBMH 4Z77B 3MX0A 3MRGA 4YXLL 3FOMB 2AAVA 2WWKT 4U1KB 1ZEAL 1FO0H 2AEIT 3N1MC 5SX5K 1T03L 1U8HA 4P57B 5FM4A 2GY5A 1IRAY 1X5JA 1OPGL 4HV8B 1CFSB 4U3HA 3TO4B 1WIUA 1JGDB 2P5EB 4KI1A 1KB9J 5KVEH 3VFWB 2F5BL 5GGUB 4FQIH 3LKNB 4GRWB 4BM7A 4YDJA 1OT1A 4WCYL 3FT3A 3VFTA 1INDH 3U0TB 4LOUC 4HS6B 2NY7H 4Q9RH 1MY7A 4NN6B 2GJJA 3ZKMD 1PG7W 2LE9A 1HH6B 3QDJA 5FO8B 4L3ED 1UM6L 4JFEE 5FV2A 3KLDA 1A7QL 2IADB 3QXDB 1S7VA 5K59F 3WNMA 3F7PC 4QOKD 5C9KA 1S8DA 5HI5C 2BVQA 1MIML 2DWEA 1IGJB 1YY9D 5FYKD 4HBQA 2NW2A 3TV3L 1F6AA 3E6HB 2XA8H 3KDMA 3U9PH 1X5HA 1MOEA 2WQ8A 4AG4L 2HFEA 4YX2L 5GGSA 4JRXD 2XWBB 1A7PH 4H26A 5M94B 4DTGL 2P8PA 3SE3A 2H26A 3ROOA 3F7VB 1FYHB 4PJEB 2HRPL 1OTTC 3D39D 3NCEB 5L88H 2GT9A 4JFXA 4Z5RA 4ZDHB 4XVTH 2FB4H 4V2BA 4F33A 1RHHB 3JBG7 1T89C 1IAIH 4ZAKA 2HTLC 5IB3A 5E2WH 1U8JA 2Z93A 2HMID 3HFML 1FN4A 4WGWB 2ENYA 1B4RA 1M4KA 3RWCA 3CH1B 3BP6B 3RGVD 3ZYIA 4OSUH 5BCAA 1DANT 1UWGL 2MKLC 5E0QA 4Z18A 3T4AA 4M5ZH 5E6IA 5GISL 1PD6A 5IMKA 1W72B 3H8NA 2IMNA 3ZDXF 4Q9QH 2JIXB 1A1OA 5FK9A 2XWJA 2ZUYA 1BM3H 4DCQB 4KDTC 2ZG2A 4WI2A 2E3VA 2XPGB 4M7ZC 4NNPH 3W5NA 1EEUA 3I6LD 4QRUA 2BVOA 5HI4D 3QXAA 1H3PH 1P4IL 1XGUA 4OIIL 3IJSA 1AGFB 4BA8A 1FRGL 4WI9A 4LEXL 4JZJB 4PYGA 3RVXC 4RISH 4G6KL 5INCA 1GZPB 3IGAA 4R7NB 5JPNA 2PW1A 3LEXB 2NYYD 5ALBH 4R3SB 4JDVB 1K5NB 3V79C 1NEZA 1OP5K 3CSBA 4HGKC 1H0DB 5E8OB 2XTJB 1P2CA 1UYWL 2FR4A 2E9WA 4WWKB 4IOFD 2HN7A 5FGBA 2JB6A 1TZGH 4K7PX 3P4NA 1U92B 3ES6A 2NQCA 5FV1L 3WXWL 4ODXB 4JHWL 3TO2A 2GKIA 4KKLD 3IU4H 1MWAL 1H15B 1VFMA 3AC0A 1CLYL 4ETQA 3HNVL 4YAQA 4QRSB 1GGTA 5FAAA 4ZTOL 1N7ML 3FMGL 2GSGA 4Q58C 5EN2B 1JI1A 2X6MA 1JF1A 3CK0H 4CNIA 4KMTH 3O9WB 4NC1E 4S1DC 5I30L 1ZHNA 4Z7NE 3R06A 4Y5YC 1C16B 1MF2L 4N0YL 4FQLL 4XRCB 3QJHA 4Z7UF 5I1EH 4B53A 5I2IA 2XWTA 3L3HB 3T3ME 4QT5A 5IEHA 5DLMH 5D1XC 4EKXA 1VKXA 4MNGB 4LKXB 4YFLF 4GS7B 5F7UA 3BGFC 1G7JB 3C5ZC 4W6XB 1NCTA 2A74A 1XZ0A 5B8CB 1U8IB 1FNHA 4PP1D 1BQHB 4DKFL 2NZIA 1UB5A 2P5WD 3REVA 5ENWA 1MHEA 3H9SE 4N9GA 2VKWA 1BGXL 3BDXA 3VFOB 2P7TA 4S1QL 1QRKA 1IEBA 2W9LA 4Y16B 2YD3A 1HYSC 3VI4E 4LHUA 1C12A 1BHGA 3BHBA 4Z0XB 4JR9L 4A2MA 3S3SA 5B22A 4PJ9B 4PR5B 1P7HL 3BXNB 2Y5TB 5IVXE 2X4PB 1VFUA 4Z0BH 1N3NA 3C5ZA 3E8UH 4MQSB 2ZUUA 3U4BH 5HYQA 3GBNH 3TT1L 2GK0B 5GS1B 2W9EH 4KUCD 1LWRA 4JG0H 5DD5H 1CWVA 3Q5OA 2E6JA 2VSDA 5TFSH 2ZSWA 1NGPH 5ICZB 3FONB 4Q2ZB 4LFHD 4KJQD 4QHLB 5CGTA 5HSFA 3SE8H 1JGVL 4Y19E 4RBPH 4NC1C 2NX5D 3BW9B 2VLRE 3MLSH 1B0GB 4L4TD 3WS6C 2EDNA 4HIXL 4E0RA 3QG7L 1A7RL 3VW3L 1A6VL 4NSKB 3K7UA 3S35X 2HAZA 3WIFB 3SY0B 3HAEB 4NKMB 4UV4H 3N1QC 2ADIA 2R56H 4OQTL 3MRNB 3MBXH 1AGEB 1BVZA 3D87B 4RGOL 1QSEE 1P5UA 4GW4B 3RX7A 3GMLA 2PW2A 2DQIL 1NCAL 2QSCH 3U7AA 1LO0L 2RCSH 3DMMB 2E6PA 4KJYB 5CCKH 3VDBA 5F71A 3BP4B 5F7YC 3WS6A 1WZLA 5HGAA 4P2QE 1W0VB 1F8TH 1MFAH 3UTSE 2QQQA 4R96A 1D5MA 5FO7A 4MSWA 3LPWA 5CEZE 1N59A 3WDJA 1PKQB 3LKPB 3GM8A 1NGQH 3WFCL 4Y2OA 2A2QT 5GIRB 5I1JL 2WP3O 3VWJB 1RJLA 2VZSA 3KPPA 3NAAH 2AV1A 1AQDB 1VFOA 3SDDB 2F54B 1AR1D 3AU1B 4PGCA 3H9SA 3QA3B 4YFDB 1NAMA 3OHXA 1DVFD 1JPFB 1V3KA 5EORL 2VE6A 1NAML 4M1DH 3V8CA 4MJ5B 4R7DB 4WUUD 3B8YA 4ORGA 5EU6D 1MJUH 1KCRL 2KPNA 5I1HL 5ESAA 3BPOB 4MNQA 2QEJA 5FF6A 1CTOA 5IVXA 4YBHA 3FHAA 1UH3A 2MKWA 3LCYA 3TBWB 4GH7B 3HCVA 1WTLA 4NM4L 3FO0H 4OD3L 5FXCH 4G8GD 4OM1H 4ZTPL 5I71C 1MRDL 5I73B 4DK3A 5E00A 3RU8H 4JY6A 1JCKA 5JR1H 4K9EH 4X4YB 2OJZL 3SJVB 4Y19A 2KBGA 3MRBA 2VLRA 2D7OA 3RL1A 2VQ1B 2QR0A 3QPXL 1JUFB 5E2UL 3BZEA 1MEXL 2HP4A 4X9FA 5DT1H 1MFCL 5D1QB 3DO3A 3G6JB 3QIWD 2AEPL 3IDUA 1NBQA 4PJBE 3NN8A 4XC1L 3U4AA 4JJHA 1S5IL 1T66D 4LP4A 1DP0A 3HR5A 5DMGC 3D69A 4U0QB 1QSEA 4FFVD 4PRBB 1OSZA 3FJTA 5D7JC 2IAMA 4WGVB 4APQC 2E8YA 4X5LA 4HPOL 3LRSA 5K9OB 1WF5A 2XV6B 1IKNC 3IETA 1NANH 1RZKH 4RSVA 4P2QA 4WY7H 3B9KA 3UTSA 2D3VA 1IAKB 2QSQA 4GQPH 3MLYL 4MCZB 4ZXBB 1K8IA 3OAUH 1EHLH 4RRPA 1H3VA 2B8OT 3Q1SL 4NO0A 4AZ8A 1UWEL 4KKBC 5CEZL 3W39A 2DQDL 2DI9A 1J1XH 4G5ZL 4APQA 3P77B 5C0NC 5H35B 1PDKA 1UJ3A 4OIAA 4BH7B 4LFHG 3SDAD 1Z0MA 1IKNA 5IGXH 4WHCA 3WFHA 3RDTA 4QRPE 4G80A 3MJ9H 4MDIA 3OAYK 5IB1A 3O6KH 3E3QE 1GC1H 4EN3D 4HC1A 4YXLH 2DLEA 5C0IA 1ZEAH 3IKKA 1YJDC 2LAAA 1FYTB 5D72L 5CD5D 4RX4A 3DO7A 2CRZA 4S11A 1OPGH 2I27N 4G9DA 2APVA 4UV7L 1T21B 1R24B 3V6FB 2F5BH 5ABDE 5C6WH 3DROB 2OBGA 4XXDB 3B2UC 4HK3J 5IMLA 3O4OC 2Q86B 3KLHD 4WCYH 3VRLE 4ZYKB 3KYNA 3MGTA 4OI7A 2EICA 3QEHB 5MENB 1IILE 4NCDA 5IWLC 4JN1H 5JOFB 4L9LA 5F44A 4O00A 1M71B 2G9HA 1BVLB 4PGBB 3L3OB 3PL6B 5DD3L 3LS5H 1EZVX 3KPSB 4HF5L 1TNNA 1UM6H 3EFFA 3ECBA 1F13A 1A7QH 3OL2A 3C2SA 3EYUL 4L8SA 4JREC 1YJDL 1KPUA 4PJBA 3RBGA 1MIMH 3QPQC 4Q7DA 3NIGE 5FGRA 2HT3C 4PRDB 3RNKB 3TV3H 4U1JB 2W60B 1TTFA 4RGMB 3DTXA 1NLBL 4AG4H 1KC5L 4F80A 1JZ3A 4JFDB 5IWLA 2K3TA 4YX2H 1DCLA 5FO9B 1S7RA 1NBYB 4GBXB 1LEGB 4DTGH 1TPXC 1EX0A 3FO1B 1KB5B 1HCVA 2ZUWA 3SGKC 3E3QC 3DVFA 2ARJB 4MQXD 4YPGB 3TPUB 2XKSA 5JDSA 1S9WB 3FZUC 3CCHB 4K2UL 4FXGB 5A1AA 5DD0L 2O61B 3O6LH 5B39G 2IH1A 1IT9L 2EIDA 1ZK9A 3HFMH 5MEPA 3PGDB 5KSAC 5DFTA 5E1AB 1Z3GL 1BZ7B 1J7VR 3T09A 1D9KC 1QFWL 2YS4A 2YD2A 1EEQA 4QRPA 1FE8L 1FLTX 4M7LL 1UWGH 3QRFM 1A2YA 3SKJL 2BY2A 1IM3B 3IXTB 5GISH 2NY2D 3VGFA 4LLDB 1OQXA 5GRUL 1M6OA 4X98A 4WNQA 2C4FU 4LCCA 4MWFB 4HQQL 4ZQKA 3K1DA 2A77L 5EUOF 2GTZB 2IGFL 3ULUF 1P4IH 4OIIH 2BDNL 1FRGH 4QRRE 3RWFA 2VLLA 4LEXH 4JN2B 5I15L 4PJGF 3TZVB 3MFFB 4CBPA 3RZCB 3QP3A 3ZKNC 4G6KH 4UTAL 4IDJH 3L5WB 4GRLD 4DN4L 1INQA 1BFOB 2J6EA 5DURD 1AY1H 4KU1A 2OSLB 4XPGL 5J3HC 5ERWB 4PRIE 5KSBE 4KVCL 1R0AL 1NGWA 5C0CE 4K7PY 1QLRB 4TTDD 1GPOL 3PNWB 4JANB 3GSUB 2VZ1A 3UZVB 3BPLC 1CGSL 5HDBF 1UYWH 4HPYL 4YH6A 4JZOA 1J1OL 3EGSA 4M1CD 4P4KC 2E7BA 3ZDYE 2CLRB 5HYEA 4NKDB 3WXWH 4JHWH 4LLUA 4HKXB 5SX5H 3QIUC 3HZYA 1MWAH 4UQ2A 5I74C 1PY9A 9CGTA 3RWGB 1CLYH 4OGAD 3HNVH 3SDCC 3W9DA 1N5AA 5MERB 4ZTOH 1N7MH 3FMGH 3B8SA 4M61B 1TZHB 3EOBB 5C6PB 3T2PA 3LZFL 4NO3A 4HDIB 4ELME 5I30H 3INUL 3Q2CA 4PRPD 5E08L 1JHTB 2BNRE 3MA9L 4P4KA 4OKDA 1PYWB 1MF2H 4N0YH 3BQUC 5JNYA 2HLAB 1C08A 3F65A 1G6RA 4KHTL 1X6LA 3BRFA 2PTTA 1IQDB 4KK8C 2HJFB 1RD6A 1G6RL 4PB0L 5FB8A 1OGTA 5EC1B 1IAOA 1NJ9B 3WYRA 4S0SD 4X6BA 2APWA 1JWSA 1Q94A 2R1YB 4XBGB 2AERT 2DB8A 4KROD 3BGMB 3QDME 5C86A 4DKFH 3GJFK 5JIIA 4LVNB 2X4UB 4X80L 1BGXH 4S1QH 2HLFD 1UZ8A 3KLAA 2PCPB 3PV6B 4U0RC 1S9VA 1N6UA 3GGWB 4RDQF 2NY6D 5EOCL 4ETYA 1MCEA 5HJ3A 1DQQA 2HA1A 1P84J 5F6HJ 5DK2B 5J1TC 4FS0A 4QRRA 3ULUC 4QYOA 3MV7D 4LCIL 3NIDE 3ARFB 3TT1H 2ZOLB 1YMHB 3BZ4B 4XI5D 1T1YB 1MHHA 1MRFL 2B5IB 2GY7B 1IC5L 3QG6B 3ZE2F 4PRIA 4U6YB 2VLKB 5DD6B 4W70A 5C0CA 1M7IA 1JGVH 5C8JA 1CLOL 2NLJB 3KHQA 4MXQC 1XCTA 3NFNA 3MNZB 3QNZB 4PBVC 3QEUB 1J8HE 2AK4E 3QUML 3MRDA 2PTVA 4HIXH 1KTKE 3QG7H 3P9MA 1A7RH 4Y4HA 1UXSA 3C9NA 3VW3H 1U91A 2R69H 1HQ4A 1RZGB 1U8OA 4ESKA 2E27L 3ULUL 3RNQB 5KANI 4QTHA 1UEMA 3C8HA 4OQTH 3ALPA 4CN6A 4RGOH 3ULVF 4M1GH 2CJUL 3ARDD 4OZGF 1U8QB 2DQIH 1NCAH 3F7YB 3LKOA 1ACYL 1LO0H 4ELMA 4I18B 4NQXB 1B0RB 3LD8B 2QKIA 1CGYA 3QQ9C 5GS2D 5I8OL 2QHRL 3NA4A 4AM0B 2Y23A 4WHYG 4NRYA 3U0PA 5KOMC 1YUHB 3MV8D 1DZBA 2UV3A 1MFNA 4CU6A 1WGOA 1KCSL 1JE6A 4R90L 2XRAL 3MV9E 1MLCA 4WEUD 5HGDB 3H7BA 4OV5B 4QXTA 5I1JH 5I0DA 3MCKB 2V2WB 4PJIF 2VITB 3IVKA 4XTRD 3QFJD 3BIAX 5DJAA 3QDMA 3VD5A 2CRIA 5IVNA 3HMWL 2ATKA 5JHDB 3EW3B 3WD5L 1CFBA 3FT4A 3AM8A 5DGRA 5EORH 2OK0H 1NFDE 2JTDA 3K4DA 3T8XB 3BT2H 1NAMH 3UTPD 4E42A 1MVUB 3EYVA 4OGXL 3U30C 1FCGA 3T77A 1KCRH 5I1HH 3L7FB 5EBLB 3TVMB 3SHSA 1CT8A 4PJDA 1FJ1B 5C09E 2X4NB 3KAAA 5IQ9A 3PGCA 4CVZB 3HE7C 3MGOB 1WCQA 1A9EA 4OCLC 4OD3H 5CMAA 1KTDB 4LF3A 4DGIL 4ZTPH 2I5YL 5F9JA 1MRDH 5T3ZD 4G8FA 1EO8L 2X1XR 5IHUL 3IXAB 2F5AL 1A7OL 3W5MA 4UT6L 1YNKL 3GJFA 1U2CA 3GEWB 4FRWA 4HWEH 4KZDL 2VXUL 2NY3C 3O6ML 4PTTB 1J8HA 2AK4A 4LSVL 4PJHB 2MCPL 3GMNA 3QR2A 1TVDA 4YGVB 1J05A 2D7MA 1QRNB 3ZE1F 3MNVB 3QPXH 4OCSH 5E2UH 1MEXH 1HQRA 4NN5B 4GRWF 3S34L 3ARBD 1TQBB 2AEPH 2ZUSA 2QL1A 4XC1H 1EA9C 3V0WH 1S5IH 3SGEI 1C1EL 4KRNA 1NC4A 1GOFA 4FQXA 1FNFA 2CIIA 1P7KB 3ULVC 2DF3A 1RUKL 4ZPVB 4NNXB 1K8DB 2FBJL 3HTLX 3V7AG 3GUTB 3KPTA 4PRHB 1NCWL 3DX9B 3AY4A 1DQLL 1I1YA 2X4SB 4MMZC 3NCYP 5DDHA 3D5OF 3BESR 5BV7B 2ICWA 4X7TA 1KFAH 5GSVA 3MLYH 2F53B 3EFDL 4MYWB 5ISZB 3Q1SH 2A6KA 3EYFB 2MWCA 4JEGB 3MV9A 1UWEH 5CEZH 3T2OA 5FECA 1LVEA 3QFDA 2DQDH 2QHLA 3STLA 2I9TB 4G5ZH 3QDHA 4U6VL 3WUZA 4PJEF 2V2XA 5EZLA 2A9ML 3GHEH 3JV0A 3ULVL 1RK0B 5JW4R 2XQYG 3RVUD 5DJZA 4KK6C 5AZ2L 2VLJE 5A2LH 3V95A 3X3GL 1P6AB 1NFDA 1ZT4B 4IJ3B 4RCAA 3RI5F 2EYSA 1J0JA 5CZVL 3QISA 1HK6A 1KV3A 3IB4A 5C09A 3BRGC 5D72H 5J9PB 5E7FA 5C08D 4G6JL 5IFJA 1DSFL 1BQUA 4PYHA 5TE4L 4UV7H 4OLUL 3BKJL 5IROC 2DM2A 2AJVL 1QA9A 1BJMA 5T1MB 1VEOA 3C5JA 3GSQB 4JZNA 2ICES 3OBAA 1EZVY 1SY6A 5E8NA 2EE3A 3CIQA 5M95B 1A1MB 5DMKB 3O41B 3L5HA 4JFYB 1SY6L 4X0KB 1UVQB 5DD3H 4V1DB 3S98A 1MCWW 2P24B 3VXME 5IV2B 2YD5A 3TO4C 4NBZB 3EYUH 4XCCL 3GSNB 3HPLA 5C07B 1YJDH 4FZEL 4NO5A 2GCYB 5IROA 3JWOH 4NNYA 2OMNA 4QHNB 2Z4QB 3QQNA 2Y9RT 2OX5A 2V2TB 2F58L 4Y4KB 1VFAA 4MD5A 2Y5EA 4K3DL 4S1RL 3ESVF 4XAWL 3ZYOA 4X6FB 1NLBH 3QDGD 1KC5H 3FQXB 15C8L 4O2EB 4NN6C 1LE9A 3FOMA 5DMYA 4ZMAT 5HYIA 3PWVA 1F6FB 1MCPL 3CDGB 1KLUB 1GGCL 1NFIA 3S3PA 3D1MC 1A14L 2LV4A 4HAFA 1ONQB 2XICA 2R4SL 4HCRA 3BMVA 4PJCB 2BOBB 4K2UH 4JKKA 5DD0H 3MRJB 4U4BA 43CAB 2FYYB 4TVPL 1IT9H 5CJ5A 3RIAK 3TBSB 4S10A 1QFWH 5KSVB 2ESVE 3CJJA 5DR5L 1FE8H 2V5RA 1EHAA 4M7LH 2IADA 5GRYA 1C8PA 2VLJA 1MCHA 4MAUH 3EYQD 4LIQL 2PR4L 3OKEB 3UTQB 1IJ9A 1CDHA 4IDLA 5A2JH 4X4XB 3E6HA 1J1PL 3AREA 2XKNA 4HQQH 2J12B 3TJEH 4YDIL 2A77H 1CFNA 2IGFH 3B9AA 3HR6A 3RWJA 2BDNH 5FUZL 2R0ZL 5H94B 3ARPA 1G1CA 5I15H 1FFPB 2RFXA 3FO9A 4UTAH 3EOAB 4HMDA 1BP3B 1ORSA 4ENED 4DN4H 1XF5A 1F3DH 1QFUL 4XPGH 5D7LE 5E8PA 3BIKB 1UZ6E 4KVCH 3VXMA 3KYOB 4HUWB 4ZUTA 1GPOH 3QNXB 4JPVL 4HK3N 2H9GB 2ITDA 5TE7L 2YMXH 1FNGA 1CGSH 1UWXK 4RIRA 2EDXA 1CK0L 3OAYH 4HPYH 3D85D 4AQOA 1J1OH 1UQSA 3VG0L 5IUSA 1Q72L 4JZJC 5JXED 1TDQA 5DHYA 2AJUL 4PJ8B 2X40A 2FX7L 4EI5D 1A6PA 3PP4L 3O6FD 4IHOB 4JRWA 4MD4B 5GS0D 5EDXA 1W72L 4IRJB 2VQUA 5I17B 2NW3B 3O3DA 5CJBA 4JKLA 1DJSA 2XTJC 43C9A 2R9HD 3LZFH 4WWKC 1A4JB 3INUH 2W91A 4IS6A 4X7FC 5E08H 1YPZE 3MA9H 5HYSB 3U46A 4XAKE 5CLTA 2YK1L 4KHTH 1I9RL 2W59A 1R5IB 2VNCA 1H5BA 3U0WL 1BF8A 4R3SA 1G6RH 2Z35B 4Y8AA 5DC0A 4PB0H 4BH8A 2ESVA 2RB8A 2OQJA 4JDZB 1MIEH 3FN0H 4U1MB 4KY1L 1LMKA 3O9WC 1N0XL 4KMLB 1JNNL 4LCUB 5C0DB 5DHVA 5J6GA 4X80H 3FFDB 2J5LB 1P4BL 1QSVA 1U92A 4L4JA 4WW1B 4R6UA 2XT1B 5GSRB 3IF1B 5C9JB 3NTCL 3T1WA 5EOCH 4KKCC 2W65A 3QT2A 2C3GA 3QXVA 4P5TB 2A83B 5HVGB 2WW8A 1A3LL 1IGCL 2FO1A 4GS7C 2R2HA 3OR6B 4NQCD 3HE6C 5D4QA 1DBBL 2SEBA 5C0BD 4P3CL 5B8CC 5F7EL 5EU3B 3RWEB 3O9WA 1G9EA 3MFGB 2H32H 3KWWA 1MRFH 4Y16C 5D7LA 3QCTH 2C1PA 5F9AC 1S7TB 3OXSB 4U2YA 4F37F 1CLOH 4LEOA 1PKQE 1TJIL 5KVDL 4PJ9C 1W0WB 3QUMH 1PG7X 2ZUQB 4MZ3A 3HE6A 1UGNA 1MCJA 5DI8B 2CGRL 2UZYB 5GS1C 1BQHA 3K46A 3PWLB 3MUJA 1S9YA 2E27H 1BIIB 4M7LT 3DECA 3SQOL 3I02A 2LQRA 2EZ0D 2AJ3A 2CJUH 3VXPA 1CGXA 1EFXA 5EUKA 3ZL4L 1ACYH 1FNEA 4OCNC 5FHAL 1ROWA 4DAGL 4XNQB 3RWIB 1UXWA 3QEGL 4JY4B 1KEGL 4NQDD 1YPZA 4JO2L 3EHBC 2I07B 5I8OH 3G6JF 5D8JL 1N64L 4KV5E 2QTEA 4BFIB 3C09B 4HX1A 1S7XB 2VDRL 1AR2A 5HGGS 4LBEB 5EO9B 4HD9A 1X5ZA 3D25A 4GRLB 4UQ3B 1KCSH 5TH2A 3VI3E 4R90H 1G7PA 2XRAH 3FONA 1AKJA 4TNVK 2EYTA 3X14B 3DMMC 5DQDH 2OJEB 3BW9A 4PV8B 3QCVL 3I3BA 5L6YL 3P9LA 3VFVB 4RZCA 3HMWH 1K2DA 2Y25A 5D9SB 2P8LA 1E28B 3WD5H 3CD4A 1DEEB 3SY0A 2DJSA 2AXGA 1XF4B 2DJUA 2X1PA 3DLQR 4OGXH 4RWYL 3WLBB 5D6CA 1CXLA 3MRNA 2XNAA 3LDBC 2JELL 5IJVA 3VWJC 2BNUB 3CVHB 4ZS7H 2DQUL 3D48R 4RGNB 1ED3B 3SDDC 4NZRL 4KJYA 1WEJH 1F4HA 2Y6SD 4DGIH 1T7VA 1T5WB 1JZ4A 1XIWA 1FFOB 3GZKA 1EO8H 2DMKA 2NR6D 3H7LA 3PQYB 5IHUH 1A7OH 3BP5B 3EJZC 3MOQA 4YQXL 1MI5D 4TPRH 4UT6H 5DQJB 4FQCL 4BQ8A 1D3CA 1JIBA 4TRPL 4GW5A 2FO4A 4XNYL 4OJFL 1PKQA 2FJHB 5EBWA 2VXUH 1CYGA 1PZ5B 3O6MH 3TN0B 4D9QD 2MCPH 3BPOC 3GJFH 3L3JB 4G9FD 1S7QB 4QF1A 3SE9L 1F4AA 2ZOKB 1GIGL 1KENL 1I4FB 1LILA 3MV11 4C83B 3UBXG 4OZIE 3S34H 4O58L 5I73C 4NJAL 1T3FB 3EYSL 1NGZB 4KVNH 1C1EH 1EO5A 1G7MA 3G5XB 4XHJD 2IBGA 2H2PD 4GKSB 2PYEB 3VXRE 2C7UA 2PO6D 3L1OL 5FYLE 1VB9A 5JQHC 4MJ5A 1RUKH 3C5SA 3P4OB 3CUPA 3FOLB 3X12B 2FBJH 3OX8A 3PABB 2WBJA 1HHJA 3NGBC 3R4DA 4WV1A 4E41E 1NCWH 1BD2B 4PG2A 5D1QC 1FZMA 2IAND 4JHZA 4CW1B 4CMHB 4WU7B 1IM9D 2X4QA 4JRYD 3EFDH 1CICA 3BAEL 4U3XA 3UTZA 2WANA 3L3GA 1D5XB 3ROLB 2W0KA 1Q9KA 3G04B 4P2RE 5EG6C 2GI7A 5ICXA 5C0AB 3CFKB 2V7NB 2OZ4L 4GAYA 2BVTA 2GTWA 2R1WB 2W38A 1ZE3C 1JTOA 3VFPB 7CGTA 1ZSDA 2A9MH 2VAAB 3ULVH 3FB5A 4HZLB 4RFEA 1WK0A 1JUFA 4RAVA 4AEEA 1F45A 5AZ2H 2VSCA 3X3GH 4ZUUB 2LABA 1U9KA 4ZXBC 2FWOA 4PY7A 4XP5L 4OZ4A 4DZ8A 5CZVH 1IGFL 5E9DD 3QUYB 1QQDA 3TCLA 4N0CD 2PUQT 3FRPG 5GRWA 3BVNA 3U79A 5KN5A 3BP7B 3L9RA 1DQML 4Z7WB 2NY4D 5TE4H 4OLUH 3BKJH 2BVPB 4AT6A 1YA5A 2AJVH 3VXNA 2FEEL 3SO5A 1BREA 1MVFA 4ONHA 1IAKA 4RMWA 3ARSA 1Y6NR 5AG9A 4YXHL 4HUUA 4MCZA 5IW6B 2WAHA 4LHJB 4CVXB 1X5IA 1SY6H 1VHPA 3MJGX 2YUZA 4J3XA 4CL7A 1MELA 3MRIB 3TBVA 1OLLA 2O5XL 3DHMA 3ZT5A 3UTTE 4OZIA 4FZEH 1RUQL 1OAKL 4YO0A 5GRVL 5DO2D 4Y5XA 2F58H 2NNAA 3DGGB 1VACA 3VXRA 4K3DH 4S1RH 4XAWH 5KAQG 1D5ZB 4U1HB 1T1XB 3PL6C 5E4IA 4E41A 5CJXC 1MCPH 1EUTA 2XN9E 1GGCH 5AZEL 5FDWB 1T21A 2X9YA 3V52L 4YHLL 4K71B 4C4KT 1A14H 3MJ7A 2HG5B 4HKZA 4PRNA 5BQ7B 2R4SH 4O2CB 4RGMC 5TPWL 1OB1A 3QEHA 5MENA 4BSVA 2GFBB 4GRWH 1UM4L 4P2RA 4TVPH 4GBXC 4PGBA 1BBJA 5DR5H 1FFNA 3O2DA 1OGAE 2NY0D 4XBPA 2M1KA 2PXYD 3H0TB 5BW7C 5D7KE 3W0WB 3EYOB 1KNOB 2PR4H 3O2DL 1YEKL 2QQNL 3RTQD 3ARUA 1HHHB 1J1PH 2L7UA 3WFEL 1DL7L 2VLMD 3W9EA 3AXLB 5DVOA 1AIFA 4YDIH 3FFCB 2G2RA 4F3FA 1ZS8B 1KIPB 2APFA 1RZ8B 4NZDA 5HXMA 3WS3A 2R0ZH 5D2NE 3R1GH 1MUJA 4QRQB 1KB5A 1QLFA 4YZFE 3FQUA 2ARJA 5GPRA 4LPVA 2DLGA 1KB5L 1F4XL 1HDMB 1PEZA 1JYWA 2NXZD 2UZXB 3ULSA 1AGDB 5L2JB 4JPVH 5D7IB 2BFVL 3UTTA 2AI0L 3QUZA 5TE7H 5GJTH 3PGDA 1CK0H 5H37H 1SYVB 4DGVL 4PJ7E 3VG0H 3OPZL 1AP2A 1LO5B 1SVCP 5E2JA 3TZVC 3B5HA 3OF6D 3RZCC 1T20B 3N1PC 4JHBA 4KK5D 5CBAB 4L3EE 3NMEA 5J06A 3C08L 2AJUH 1MJ7L 3BWAA 2FX7H 3VXUD 3HG1D 4QOKE 3UPRB 2IALA 5FYKE 1WCBB 3QUXD 1P1ZB 5EIIA 3OV6A 1W72H 1W8NA 3ZTJG 1E4KA 1K4DB 5F3HB 1D6EA 3PWPD 2XN9A 1N5YL 1FVEB 1PX3A 4P23B 1I1AD 4KDWA 4FABL 2V5SA 1A6TA 3QI9D 4JRXE 4BKLB 3IKCB 5DRZA 3RZCA 1S9XB 3FAWA 5FYJD 2YK1H 3IJYB 3D39E 1I9RH 3C6LA 5ACLA 1FC1A 1Q38A 4N8VG 3EBAA 5JQ6L 2VKXA 4YLQT 1AD9B 1FGVL 5ERWA 2E9BA 2CPCA 5D2NC 4MCYA 4XZUA 5DZNA 4LLQA 1OGAA 4FFYL 2DYPB 1RUAL 2GJZA 3GSUA 3T0ED 4KY1H 4JQVC 4IRSB 1N0XH 1A6UL 1JNNH 3T0WA 5DUBB 3AVEA 1P4BH 5EC2B 3IJHB 1FORL 1QVOB 5EOTA 2I9LB 3H9YA 4TSAH 3CX5K 3NTCH 3UTOA 2YA1A 3RWGA 2CRYA 4PRAA 3FQTB 1A3LH 2XYCA 1IGCH 5CSGA 5D2NA 5I1KL 4M48L 1TZHA 3EOBA 2YPLD 3TNMA 4P3CH 2ICWI 5F7EH 1QPXA 3F6LA 2AW2A 3I6LE 4LVNC 4M6ML 1JHTA 3QIBB 1MFBL 2V9TA 1MLBB 1HHKA 4HIHA 4G6FB 4MQTB 4U31A 3SEPA 1HKLL 2CKBA 3KPNA 4FFZL 4UZGA 4MA1B 3DXAD 5F7LB 5KVDH 3AUVA 4PJ7A 1JRHL 4H25A 3VWKB 2WLZA 4LAQL 3MBEB 1WFOA 4L3EA 3L5IA 3HLAA 5JOPD 3ARFC 2CGRH 4GAFB 4R4NC 4QOKA 5HVHC 3HMXA 5K9KA 2B5IC 5IKCB 2IBZX 3SQOH 3T4YB 3PV6A 5T5FL 1LP9B 5DSCB 4P46D 4U1LB 1JV5B 4PJHF 2Q7YB 1QFHA 5I8CB 2YD9A 3W82A 4YHPB 4I1NB 5FHAH 3GRWA 3O8XB 4JRXA 4NKQB 4S2SB 3QEGH 1KEGH 4Z78B 4HS8L 2VXTL 4JO2H 3SE4A 4JFOB 5D8JH 1N64H 2FGWL 1KBGL 3WEXB 3KGRA 3D39A 4X7SL 2VDRH 4NZUL 3KYMA 3BZ4A 3KPMA 4O2FB 2Y7QB 4IRZL 5J89A 4GG6B 4K7FA 1KJMA 3HZKB 1RZ7L 4U6HA 1UWXH 1G0XA 1OLZA 2WUCL 3KJ4B 4QHUA 3VFSB 4M5YL 1L9NA 1ZHBB 4XMKL 5EO1B 3AROA 4KHXL 5K9JL 3QNZA 3QEUA 3QCVH 1YMMB 4I18C 4G42A 3LD8C 3RGVA 5KG9B 4LCYB 4OFDA 2DTML 3STBA 1B90A 4JPWL 32C2A 3PWUA 4RWYH 2P5WE 3M8OL 4YXKL 1AI1L 1D5IL 3HAEH 2EEAA 2JELH 1A64A 1T4KA 1E27A 2KDGA 4O9HL 4X6DB 2DQUH 1U8QA 3F7YA 4PD4J 5CD3B 3C6SB 4NZRH 5JTWA 4I18A 2EXWC 4MA8L 4LAJH 4WJ5B 3IDMB 4PLKC 4F2MB 4AM0A 3LSOB 1GAFL 4YQXH 4DOHE 3AB0B 2DOCA 4JFFD 4Q9BA 4DW2L 4XNYH 5MP6L 2IBBA 1U6AL 1VESA 1SM3L 4NM8H 4OJFH 5ISZE 1ZLWK 2YC1B 3TVMC 5HGDA 3U2SA 1GGIL 4FQQA 1JVKA 2VITA 1KENH 3HC0A 4KJPD 3T1FB 3FB6B 3D6GA 4Y2DB 1ZT1A 1KCVL 2NX5E 4O58H 5EPMA 4NJAH 4L4TE 3LS4H 5DRXA 4A6YB 4M93B 2MQ3A 3NPZB 5ID0A 4IBLT 3T65A 1VFBB 1DANU 4KK9D 4PJGE 3AS1A 5F6IB 4R4BB 3L1OH 2ZP0T 5EIQA 1AXIB 4U1SA 1DDHA 2DM4A 3CFCL 1F02I 5EBLA 2VL5A 2EKSA 2X10A 1ACZA 4J3SA 5A16B 1TVBA 4NN5C 3EO1B 1FNLA 1FZOA 2OTUB 1TQBC 5IP4A 3NCCB 1KTDA 5IBTL 1FPTH 1UA6L 1RJZA 5HGBB 3BAEH 3K2MC 3JV6B 2KUTA 4MXVE 4ELKB 4OV6F 4NCC2 2B20A 1ZGLB 1KGCD 3K4ZA 5E5RB 2OZ4H 2DAVA 2FLRT 2C4FT 3LKQB 3T2QA 2VXSH 3JSSA 1A02N 4JAMA 3HB3D 4LARL 2BC4A 4J3OC 5BV7C 3G08A 1XF3A 5C07E 2BXYA 4F7TA 4XP5H 4PJCF 5HI3C 4IEFB 1HSAB 2P5WA 4UDTA 1AXSA 3QYCA 3RWHB 1IGFH 1XCQA 3OJ2C 3K4AA 2ADGA 4DUXA 3VCLA 5IVOA 4TUKL 3C2AL 1JK8A 2BSRB 2R8SH 4MJ4A 1DQMH 3BEVB 5ETUA 4NNXA 4EXPX 2AV7A 4WUUE 1AE6L 4ZFOA 1GSMA 4TUOB 2A6DA 1K4CB 1NUGA 4YK4B 5DZOA 3QB7C 5INDB 3L95B 5CILL 5AG8A 1U41A 4O51B 5IMMB 4YHIB 4MB3A 4IJ3C 4YXHH 4G8GE 5ISZA 5IFAH 3VA6A 3D0VA 5BV7L 2ICEA 2BRRL 1P7QB 2O5XH 3K0WA 3CSYB 4AIZB 1A0QL 3QCUL 2Z31D 4RNRB 3GSRA 2NX5A 1RUQH 4HFUL 4E5XB 5KZCB 4L4TA 4I0PD 1OAKH 1NC2D 5HGHB 3QRGL 3U82B 1XGQA 1EPFA 1H3UA 2EIEA 3VRJB 2EDOA 1RSFA 2FD6L 4IMLA 5KVFL 8FABA 4P3DB 4YPJA 2H41A 3DOSA 3V5DA 5AUMB 5IEKA 2RR3A 2LVEA 4KQ4L 1HILB 5JA8B 3BDYL 2BHYA 3U9UB 4OZHB 4Z6AT 2BNQD 5AZEH 3V52H 3A6BL 3GJEA 2YXMA 1I8IB 5T1MA 1HHIB 4G43A 5T5NF 3PG2A 2OYPA 5SWZD 5TPWH 4K7PL 4DGYH 4Y4FD 1A1MA 5DMKA 1JZ8A 2BZDA 1ZWIA 2OR7A 5BXFA 3U4EA 2UWEE 4OI8A 3S37L 1M05B 4L4VB 1RPQA 4J7RA 1U3HB 4XB7A 2ADJA 2XG5A 1I3GL 1MFEH 1T2QH 3GSNA 5C07A 2B0SH 1WFUA 1DBML 4JE4B 4ODHL 2B39A 3O2DH 3TEUA 4OAWA 2DQHL 1FBIL 1U8HB 1YEKH 2QQNH 1GXEA 3GSNL 2V2TA 5DK3A 3BH8A 3WFEH 3V6BR 1DL7H 1DVFA 5T3XL 3ME0A 4XBEL 4X6CE 1QLEL 1SMOA 1TNMA 2CDEB 5D6DA 4WUUA 4NHCL 4YDJB 1BQLL 3FT3B 3VFTB 5TJWK 3LOWA 3I6GA 5I1LA 3CDGA 5BS0B 3GB7A 1JNHA 2IH3A 3QDJB 3MV01 4G8GA 4LSSL 1KB5H 1ITCA 1A8JH 1F4XH 3SCMD 3MRPA 4OUUA 3SN6N 1T66C 5B39A 1S7VB 1S8DB 4OCWL 1RZFL 2BK8A 4PJ5D 2BFVH 2AI0H 2RBLA 1EH9A 4FQHB 5I76B 5IT2L 3EJYD 1F6AB 4BUHA 4DGVH 2R1XA 3KDMB 2VDQL 3OPZH 1KPRB 3ZE0F 5KSVA 4KI5D 2EH7H 2D0FA 2FEDD 3SDXB 3C08H 1CG9A 4QWWD 4H26B 1HOCA 4B0MM 2VISA 5EH1A 3OKEA 3QIWA 2P8PB 3UTQA 4KRPD 2H26B 4FZ8L 3ROOB 4X4XA 1YN6A 2CMRL 4KQ3L 2A0LD 3O2VL 4FNLL 5C70A 4JFXB 4ODTL 4Z5RB 4FABH 1PJ9A 2OLDA 4QLRA 3V6OE 5E4EB 1V5JA 4ZAKB 5IB3B 5ADOL 4LLYB 2YA2A 2Z93B 3GNML 1WT5C 2NZ9C 4XPAL 3DVGB 1FN4B 3GMRB 4QTIL 1INEL 5TGBA 3QNYA 3MRQA 2UWEA 4QCIA 5JQ6H 4LU5L 5AYQA 4IRJC 4NKOA 1FGVH 4GRMB 5JHLL 3VE0B 2VZTA 1GZQB 3T4AB 2Y72A 1QEWA 1T0PB 5E6IB 5IMKB 2BSTA 5GGVY 4FFYH 5CD5C 2DWDA 1RUAH 4F7PB 5FK9B 2XWJB 2EDDA 1JGEB 1QHOA 2Z9TA 5CHNA 3SDAA 1DQDL 1FORH 4P2OD 4ZFZB 1ZVSA 1XR8B 2XY2A 5CGYD 4QRUB 1D6VH 2AABL 3QXAB 4G6AD 4R26L 4WEBL 3IJSB 4ODUB 4HJJL 4EN3A 4X6CA 1IGYA 3F5WB 3MUHL 4LCWD 3PGFH 4IRJA 5I17A 1IAIM 3SPVB 5CP7B 5INCB 5I1KH 4M48H 4OT1H 2X89D 3IGAB 5FUCC 3OKLB 1AXTL 2PW1B 1CFQA 1KPVA 2EXYC 1RFDL 4M6MH 3OMZA 1NEZB 2J5LC 3PUCA 3Q6FA 4JFEB 3WSQL 5KBNC 2R2CA 1HKLH 1NGYA 1ZLUH 1P2CB 2FR4B 4BQ6A 1OY3B 4P5TC 2HN7B 3P4NB 3K81A 3ES6B 5IBUG 1JRHH 2CUMA 3TO2B 1MRCL 4LAQH 3UYPA 2J8HA 1XH3A 1TLKA 4Y1AD 3BD3A 4KH2A 5J56B 2RGSA 5DVNA 1KN4L 2GSGB 3O2WL 4PLOB 2GJ6D 3HMXH 5GSRA 3JV4A 1XGPA 3QQ3A 5FYKH 1ZHNB 4MVBD 4ZO6A 3R06B 4K3HA 4L5FL 4KC3B 4JPKL 2XA3A 2ZUQC 4FMFA 3QJHB 3V6OA 1KIRA 3BJ91 4HS8H 1R3JA 2VXTH 2FJFA 5I2IB 3WMSA 2XWTB 5I1IL 1KBGH 5EU3A 2CDFA 4QT5B 4POUB 1F11A 4NZUH 4X7SH 5IEHB 3LPGA 5T1DL 4JLRB 1F58H 1VKXB 4IRZH 1RZ7H 1J0HA 1RY7B 4PRPE 1FC2D 3G6AA 1I7UA 2WUCH 4M5YH 1XZ0B 5EB9A 4XMKH 1UB5B 3NCYS 3REVB 5ENWB 1DFBH 1MHEB 4KHXH 4N9GB 4OLXL 2P7TB 1JYNA 1IEBB 5ECJE 1RUPL 4YDKL 1J0KA 4IM8A 4LHUB 1M7XA 2RHEA 1C12B 3C09C 2FJGA 3BHBB 4HGWB 4LGSB 3SKUD 4BQCA 2DTMH 2HVJA 3RY6C 3NA9L 4UB0L 3BPCA 4XNMA 1LDPH 4OCXL 4CDHA 4GRLC 3M8OH 4YXKH 4D0BA 3Q6GL 3QUXB 1AI1H 1D5IH 1OCWL 4XWGL 4L3CA 2DRUA 4HXAL 3MRMA 3P0VL 3V7AE 4DFIA 2M8XA 3B4NA 3NZ8B 3VFGL 3RY5A 4NWTL 3RRQA 4BYHA 2ZSWB 3V5HA 4MA8H 4M1CC 2D7NA 4BZ2L 4UNVA 2DD8L 1GAFH 3MV7E 4WTWA 3RY6A 4FXKA 4DW2H 2EO9A 5CEXA 5MP6H 4GRLA 5L9DL 5A40E 2Y06H 1SM3H 3UZQA 4Z7WF 1FL6A 1GGIH 3NVQA 4RGNC 3EDFA 5L7XL 1OTUD 1E6OL 2ADIB 1KCVH 2UVFA 3RP1A 2YA0A 2PW2B 4MLIA 4LK4A 3TN0C 5DRWA 5HGAB 3TFKD 1Y6MR 4R96B 2VYRE 1D5MB 5FO7B 4MSWB 4OF8A 1I9IL 2C5DC 5T1LD 4EIGB 1N59B 3WO4B 3S36X 2YOCA 3CMGA 1FQ9C 5IBTH 1A6AA 3CVHL 1UA6H 2PYFA 4PRPA 4KKAC 1FFOA 4DJMA 1KJ2A 1RJLB 1ZA3A 2HLFC 4XPTL 3KPPB 1BZQK 2AV1B 3U7WL 4WO4D 3QHFL 4PGCB 1NFKA 1C5DA 1CL7H 3ZZ1A 3MV8E 4D9LL 3ZLQC 2H6PA 3OHXB 3CU7A 2IPUG 2MQCA 3BJLA 2ZOKA 4WHDA 5E2TL 4C83A 5J0BA 4CJ0A 3CZJA 4LARH 3OZ9L 4CMHC 2E9JA 3QFJE 2AJZA 4ORGB 4N1EA 5ESAB 3EDEA 3NPSB 5FF6B 3G5XA 5D1ZD 3JZ7A 4GKSA 5J6HA 3HCVB 4TUKH 1CS6A 3C2AH 3BKCL 5DZLA 4Y8DC 5E00B 3UTPE 4C56D 1AE6H 2Y4SA 3PABA 3T08A 5LBSH 3R8QA 1ODAA 1CE6B 3FHQA 4Y19B 3MV7A 3QUKA 5CILH 4F9PC 4QKXB 3MRBB 3HI1A 2VLRB 4CW1A 3RL1B 3I9GL 3B6SA 3QUYC 4U1IB 4WW2A 5BV7H 5T3ZE 3ARGD 4R9HA 3BZEB 3LN5A 2BRRH 3MLXL 1DQTA 4AIOA 4ONFL 1AJ7L 3NN8B 1A0QH 3HZMA 3QCUH 2V7NA 3RX5A 2QJDA 2R1WA 3HR5B 3WFDL 4HFUH 3D69B 1QSEB 4WDIA 4HZLA 1OSZB 1XF1A 4W6YB 2IAMB 1J10A 3MZTA 4R2GD 4X8XA 4F9PA 4KXZI 2FD6H 1TQCB 4X7CC 2VDNL 2CIKA 3LRSB 2BHUA 5KVFH 3IETB 4NT6A 3QUYA 4NHUB 4KQ4H 2NY5C 3B9KB 5D7IF 1L4IA 3RBSA 3L3KA 3BDYH 4AEHL 3UTSB 3BP7A 3TPKA 3ARDA 5HHPA 1X5AA 4JM2D 1K8IB 4W6WB 3KVQA 2W0LA 4NO0B 1I8LC 3A6BH 2BVPA 4XVUD 3DPBA 4XHQA 3W39B 5SX4H 3NZHL 1ZKAA 4OLWL 3CFEB 4XNUL 3H3PL 3T3PF 1ZLWH 1UJ3B 4K7PH 2MNUA 4FTVD 4K8RC 3QEQD 2F8VA 4PTUA 3MV8A 4ZS6C 4HIEB 1SJEA 3RDTB 4G80B 4OD2A 4N5ED 4MDIB 5IB1B 4MB4A 2KZWA 3UDWC 1I3GH 2NY5L 5C0IB 4K71C 5LG1A 1DBMH 3PE9A 4MAYD 3H3BC 4ODHH 4XP6L 2DQHH 1FBIH 1BQSA 1V7NL 3KPRD 3GSNH 3DO7B 4KGJA 1AH1A 1TITA 5DMIL 5T3XH 3KS0H 3GMPA 4XBEH 1EMTL 1D5ZA 1QLEH 1IEAA 5IMLB 2OTPA 4NHCH 1QSFD 1BQLH 1FSKB 4TNWK 1RK1A 3KYNB 3MGTB 4P5KA 1U42A 2UY7A 4K8RL 5ITBL 3VH8G 4TNWF 4L9LB 4P5MA 5C08E 2WNGA 3MUGA 2X70A 2G9HB 4MJ6A 4LSSH 4H1LG 3EFFB 3ECBB 4FFWD 4O2CA 4AL8L 4HIIA 4OCWH 1RZFH 4L8SB 1KPUB 4PJBB 4RMTA 3PIQB 1T83C 2YBRB 3S96A 1MNUH 4Q74A 3ILQC 1QHPA 1UB6B 1AO7D 2VDQH 5LGHH 3Q5YA 2CLZA 3H0TA 3I50H 1S7RB 3TGXA 3EYOA 1KNOA 1XT5A 3MOBL 5IOPB 4QO1A 4LRIA 2H2SD 2DDQL 4HLJA 4JY5L 3O2VH 5KVEL 2VZOA 4ODTH 1MJ8L 2EH8L 5JDSB 3W2DL 3QDGE 1KIPA 3SBWA 1F3DJ 4W4OA 1M7DA 3ZO0A 4KJWC 5ADOH 3KPOA 2NY7L 3GNMH 4N9OB 4XPAH 1MY5A 2IH1B 4D0CA 4XCFL 1B9ZA 5MEPB 3SGDI 1LK2A 4QTIH 3G9AB 1INEH 5E2VL 1VGEL 1LP9F 2YEZA 1HDMA 4NQUA 1CR9L 4QRPB 1WAAF 5DJYB 3CLEL 1S78C 1QOKA 1A2YB 3PHSA 4DQOL 3BKML 4Z7OE 5JHLH 5B38G 1AGDA 5L2JA 5KW9L 1ADQA 1OL0A 4K3GA 4P23C 3V6ZA 2IQ9L 2FNBA 2JCCE 2Z92A 1M6OB 4LOUD 4X98B 4WNQB 1YYLH 1AQKH 1ADQL 2R4RL 4LCCB 4ZQKB 1T20A 1DQDH 3NCMA 4GG6F 4EUPG 5GGTL 4HKJA 2AABH 4R26H 4WEBH 2UY6A 4HJJH 1DEDA 4ODSL 5DFWH 3RWFB 2VLLB 5HI5D 3BPNB 1E6JL 3BO8A 1OTSC 1AXTH 2EC8A 1FVEA 1INQB 4W68A 5C08A 4IRSC 1G7HB 5EULV 1S7SA 2HWZL 1RFDH 4BKLA 2D2OA 5DQ9A 1CL7I 3IKCA 5E2WL 3WSQH 2JJUA 5HY9A 4QEGA 3O4LD 3MRCA 1U58A 4POZC 4R97B 1S7UB 3EGSB 1OTTD 4EDWL 3P11H 4X6DF 4OSUL 1F90L 1XGRB 2VDOL 4LLUB 4M5ZL 2AEWA 3IFLH 1EXUB 3HZYB 3LEYL 5EOCJ 2F8OA 1X5XA 5EZJB 2HTLD 3FAXA 1JZ6A 1YMME 1MAKA 3W9DB 1N5AB 2BY1A 3QIBC 3CFIC 3NH7L 1FVDB 1LEKA 2R0WL 4YDLB 1NAKL 3O2WH 1U8LB 2VDMH 2BP3A 4NO3B 3OTTA 4YWGL 5BZWA 4MA1C 3QDGA 2LTQB 5DHXB 4L5FH 5JNYB 3VWKC 4JPKH 1C08B 5JZ7C 2ZNXA 1IL1A 2PTTB 4DKAA 4GLRH 5IBLD 5SV3A 5AD0A 4MX7B 2WBWB 5T1DH 5FB8B 2IQAA 1OGTB 2DS4A 3PWJA 1YEDA 1P6FA 4RAUB 3UC0L 1AHWA 1Q94B 5JUEL 4HWNA 3LY6A 3WJLC 1F6LL 2ZUXA 1EHXA 3RVXD 2JCCA 5L8KB 3O8XC 4OLXH 4G7YH 5FKAA 3GSXA 2I60L 1OM3L 4HUMB 3CH8A 1RUPH 3KLAB 3KLSA 4YDKH 1S9VB 1UM5H 3IU4L 1VDGA 1I3VA 5HJ3B 3WLWC 3KPLA 1T0NA 1DQQB 3NA9H 4UB0H 5FM5O 2YWYA 4OCXH 4ENEC 3WFBL 4QRRB 2EIBA 4QYOB 2WZPD 3KJ4C 3D2UD 4KAQL 3Q6GH 4L1HA 4IMKA 1OCWH 4XWGH 4YNYB 3DJ9A 4Q9CA 2EDFA 5B4MD 4X5XB 3WJLA 5KS9E 4DEPB 3VFGH 1HZHL 4NWTH 4PRIB 5KSBB 4BSWA 4MJID 5I1EL 1TZIA 5C0CB 1M7IB 2BERA 4BZ2H 4NQCE 2DD8H 3WEXA 2MPAH 5C8JB 5C0BE 5F96H 1XCTB 5DJ6A 2CUIA 1IQWL 2NCMA 3NFNB 2C3VB 3MRDB 5L9DH 3HZKA 1IAMA 4ERSL 3UJTL 4Y4HB 4S1DD 3C9NB 3VFSA 1QO3B 1SVZA 1U91B 1HQ4B 1U8OB 5JO5A 3VXSD 5JIPA 5L7XH 4QTHB 4CRPA 1E6OH 1YMMA 3GI8L 3D85A 3F6IA 3CSGA 4M8VA 5GZNC 5JXEA 4LCYA 3SGJC 3LKOB 5D1XD 3PP3K 3FQRA 3JXAA 2AKRA 4ELMB 1NBVL 4EI5A 5GJSL 3ARZA 3C5ZD 3MC0A 4JO4L 2BNRB 2QKIB 3O6FA 4RMRA 3V4PL 1UKTA 4NRYB 3PHOA 3U0PB 3CC5A 1I9IH 1UG9A 4JG0L 1SEQL 4Y2DC 5DD5L 1HYSD 6FABL 1I1FA 2A38A 4PJXE 4ZUVA 1KSRA 3CVHH 4M93C 1MLCB 1QNZL 3DI3B 3LB6C 4NQDE 1IFHL 5I1CL 5DWUL 1ES0A 2X41A 3SGJA 3IVKB 4XPTH 3U7WH 5F1NB 5F6IC 4YR6A 5DJAB 3QDMB 5JDJA 3QHFH 3RJDA 2IPTL 1KJ2H 4OZHF 2ATKB 2HRLA 2VR9A 5MHSD 2FBOJ 4C59B 1YQVL 4D9LH 3UBXA 3FT4B 5I75B 5E2TH 2ARJQ 4UV4L 4E42B 1ZMYA 3EYVB 3OZ9H 3MBXL 3U7YH 1TCRA 5IB5A 4EZMA 1CT8B 4BELD 1CD1A 5IQ9B 3PGCB 5C3LD 1A9EB 5CMAB 4A6YL 4LF3B 3BKCH 5F9JB 5KS9A 3LV3B 1F8TL 4X9IA 1MFAL 3P4MA 4ODVL 3CFDB 2ICWJ 4YIQB 2DKSA 3GJFB 4LPWA 4NQCA 2DQEL 5C0BA 4EXKA 2OTUA 1J8HB 5CEYA 2AK4B 1NGQL 3GMNB 3I9GH 2VDPL 4HWBA 1J05B 4QGTA 5I1AA 5JPMA 3NAAL 2VN4A 1HQRB 3H9SD 2QV2A 2VL4A 3MLXH 4ONFH 4QXGL 1RIHL 1AJ7H 4I4WA 1QFPA 2DI8A 1NC4B 2UYLB 4YHKL 2P8MA 3WFDH 3LKQA 4D9QE 1J18A 4FQXB 4YK4C 4U05A 4F7MA 4G9FE 1NSNL 2CIIB 3RX8A 4BK4A 4MNQD 5HPMA 2VDNH 3D3VD 2AVGA 2BXZA 4YHNA 3FRPA 3GSOA 5KVMC 1I1YB 1I1CA 2YUWA 5DDHB 4QXUL 4BZ1L 2ICWB 4X7TB 5KSUA 4QNPF 5A2FA 2AXJA 5GSVB 1OD7A 3QXTA 5GQBA 2CH8A 5A2IH 3RU8L 2A6KB 4PJXA 5JORA 1PQZA 5JR1L 1OW0A 3MV9B 5FECB 4NQDA 3QFDB 3NZHH 2XOTA 3L95A 4OLWH 4XNUH 3H3PH 5BS0E 1HXMB 4O51A 4PGEB 2IANE 1PGRB 2V2XB 1BFTA 5EZLB 5GS2H 2WMPA 4JRYE 5DT1L 4LSPL 5DJZB 4MS8C 3OB0K 2X7LA 4K94H 1NFDB 2JJSC 3H6JA 2EYSB 5DK0A 2NY5H 3RVVD 3QO0A 4XP6H 5C09B 1IKFL 1V7NH 4HUVA 3SDXE 2Z0BA 1U8MA 1F3JA 1UC6A 5BRZD 1EMTH 1QA9B 4WFED 2GAZB 4GLRI 5AUMA 3C5JB 1JWUA 4JZNB 5CEZD 5E9DE 1U3HC 5A3IC 3QXUA 5E8NB 5ITBH 3MA7A 2ZG1A 1EHLL 2CR3A 3PHQA 4B50A 5F89A 4NQVA 5D7JD 1SJVA 2IMMA 1I8IA 4APQD 2D03L 3SQBA 1UCTA 1J1XL 2D4DA 4AL8H 1IGTA 1LK3L 3DURA 3HPLB 4NO5B 3MMEA 4RFOL 4ISVA 1D7FA 1NCBH 4KKNA 4HBCL 4HGMA 5FIEA 3VFMA 1VFAB 4MD5B 3QULA 4G9FA 3NCBB 2F74B 1LE9B 4OM0L 5CP3H 4DVRL 3O11A 4KKBD 5D93B 3MOBH 2P42B 3PWVB 2D9QB 3DETD 5C0ND 2DDQH 4UTBL 4JY5H 1X6NA 1NFIB 3PV7A 5F9DC 2PO6A 1MJ8H 2EH8H 3GKZA 3W2DH 5I0ZA 4M9PA 5AAWA 2CDEA 5CSBA 3DX8A 3F7QA 1SEBA 1X4YA 3VD3A 3PF2A 4XPFL 1EAJA 5BS0A 4JN1L 4XCFH 5ANME 4X9HA 2IANA 3SE3C 4PP2A 3LS5L 1T5XA 4ZFFA 5E2VH 1VGEH 1IM9A 4JRYA 1CR9H 3CLEH 3K8LA 4H20L 2VLJB 4HWZA 4DQOH 1G7LA 3BKMH 2EDLA 4I48A 2C3WA 1LD9A 4MB5A 4HHAB 3B2UD 4I2XE 5KW9H 4FQHA 5I76A 2IQ9H 5E4EC 3AREB 2E5EA 1EDQA 1KPRA 4ZAKC 2XKNB 2R4RH 1ADQH 3VXQA 2ZPKL 3SDXA 1CFNB 2OL3A 1WICA 4AEIL 4OLZL 5GGTH 3ZHKA 4WU5A 3RWJB 4ODSH 3X3FL 4UIMA 4S1SL 2QADD 3E2HB 5E9DA 5E6IC 3T0VA 2I26N 2RFXB 3BISA 1E6JH 3FO9B 4FXLA 2BOCA 1ORSB 2VLME 1XF5B 4YEEA 2OP4L 2GEEA 4GAJH 4AYFA 3FQWA 3P0GB 2HWZH 5E8PB 1QFWM 3VXMB 3ZKXC 5IQ7L 3O6LL 4LLYA 4ZUTB 3RAJL 5DO2C 2ITDB 3DVGA 4N8VA 3MRRA 1FNGB 4J12A 4RIRB 3GMRA 1T22A 3OKDB 1UQSB 3QH3A 4EDWH 3QEQB 3H3KA 5SWSD 3QJFA 4GRMA 1F90H 2L7JA 2VDOH 5DHYB 1GZQA 3VE0A 3NCJL 1CIUA 1YYML 5D96B 3K8KA 3T0BA 3MODL 5E03A 2YD8A 3LEYH 4F7PA 3FZUD 4N0FB 5T1KD 1CGTA 3RIFK 1JGEA 2WWKO 4HS3A 1MCNA 3O3DB 2V5TA 3VGDA 3OXRA 3NH7H 4EI6A 1REIA 3RIFF 1N6VA 1H3WM 2R0WH 1GOHA 1NAKH 4D8PA 5KSAD 4ZFZA 43C9B 1EEZB 1XR8A 1D9KD 4HH8A 5J12B 2AEQH 1PZUB 3PXHA 4YWGH 4ODUA 3VXUE 2DBJA 1U36A 1UKSA 5FGBC 4IS6B 3F5WA 1MFDL 5FA4A 5F1KC 3U46B 2AJXL 3SPVA 1CDGA 3RJQB 2H1PL 2NY1B 5MEQB 4IDJL 5CP7A 2V7HA 2APBA 1T7ZA 1ZHKA 2PNDA 3OKLA 1H5BB 5ANMA 3PWPE 1AY1L 1OP3H 2OTWB 4BH8B 2ESVB 1OSPL 3L7EA 2OQJB 4JFEA 3RTQC 4Z7NF 4UNTA 3UC0H 2BMKA 4I2XA 1WBYA 2CDGA 5JUEH 1OWWA 4X5WA 3ZKND 5DHVB 5J6GB 2I60H 1OM3H 3T3MF 3O81A 2HVKB 3OGCA 1V7ML 1G0YR 2W65B 5J3HD 2C1OA 1TVHA 3AFLA 3T0EE 2PXYA 2XTLA 3DUUA 4K3JL 3WFBH 2R2HB 3M1BA 1LO2L 4KAQH 2SEBB 3RTQA 1IC4L 5JMOC 1KUMA 2OXGA 4P4KD 2YUXA 4ODWA 4WI6A 5TDNA 3VI4F 3KWWB 1HZHH 4LP5A 2ZCLL 5D7LB 3QIUD 3GBML 2C1PB 4R4FH 2NXYB 5K93A 4KK5C 3SDCD 5KVGL 1XAUA 2J4WL 4U49A 2YPLE 4LEOB 5IVXF 1IQWH 4JLRA 3TBTA 2FRGP 5FKPA 3QUXC 4JKWA 3UJTH 4ERSH 3HE6B 3P40A 3CLFL 1S9YB 3BQUD 2N4IA 5C1MB 5HHXL 3MRHA 1I1AC 3I02B 1QPPA 3DXAE 3GI8H 4D9RD 3QI9C 2AJ3B 5I8KL 2C26A 4AK1A 4KK8D 3VXPB 2R29L 4HGWA 1EFXB 4XXCA 5EUKB 1FNEB 5JOPE 3QBTB 1NBVH 3VXUA 5GJSH 1UXWB 2IG2L 4JO4H 1YPZB 1ZVHA 2AXFA 4JFPA 3QUXA 2Q8AL 4HX1B 1ZLVK 3V4PH 5I16A 4MGXA 2A6IA 1SEQH 2NMSA 3D25B 3EAKA 3PWPA 3NZ8A 1MHCA 1I1AA 2ID5A 6FABH 4HJGA 5TH2B 1G7PB 5FEBA 1KJ3L 1AKJB 3QI9A 1QNZH 2JK5A 3QXWA 5I1GL 1IFHH 1DTUA 2EYTB 5I1CH 5DWUH 1PKOA 1ULVA 1CDYA 4F8QA 3ULUD 1FH5H 2IPTH 1F97A 3P9LB 4RZCB 2NTFA 3V4VL 3KXFD 4N1HB 1K2DB 1F2QA 5DA0B 1G7QA 1YQVH 1LE5A 2P8LB 5LJYH 4HG4K 2R69L 3WO4C 5L2KD 2AXGB 3DVIA 3T0EA 4XB8A 5D6CB 1HH9B 3S5LG 4HXBL 1XEDA 4J23A 2XNAB 4M1GL 2ZG3A 3UEZA 5IJVB 3IAGC 4MXQD 1CDCA 1BOGA 1DQJB 1JP5A 3W11C 3BEWA 2Q3AA 4A6YH 1NCDL 4TULH 5F21B 5TQ2L 1XIWB 4Z7VE 4ODVH 4LPYA 4DVBA 4PJFE 4WFFD 3MLZL 4GW5B 2FO4B 1KTRL 3AS2A 4PGDB 2DQEH 2YPLA 5EBWB 4TSCL 2YN3A 1C5BH 2VDPH 3S6CA 4NIKB 3NPSC 3LDBB 4KTDL 4QF1B 4U7MA 4XWOD 3KYKL 5HBBA 3QQ9D 4QXGH 1RIHH 4JFFE 2F8XC 2DKMA 2P44B 5EU5A 4LGRB 5J1AA 4NQED 1JI2A 3DXAA 1G7MB 1ZXQA 4YHKH 2H3NA 4NYLA 4X9BA 4XPHL 2DN7A 4QHKI 1NSNH 2OK0L 2C7UB 3OKYA 3BT2L 4ORZC 2DQTH 1JFQL 4MA3A 3C5SB 2X4OB 3CUPB 4C55A 2VAJA 4AH2A 3OX8B 4OLYL 2WBJB 1HHJB 4WV1B 4PJBF 2ZCHH 1KEML 4UIKL 4QXUH 1FZMB 4ZO8A 4BZ1H 1YEIL 2OS7A 4P46A 3G5VA 3RY4A 2X4QB 1CICB 3PDGA 1K3IA 3JWNC 3UTZB 3L3GB 5HHMD 1CE6A 1IARB 2BSSA 2IAMC 1Q9KB 5C0RL 3ETBF 3OKNA 5ICXB 4HWEL 1TQCC 4XMPL 4GAYB 1MAML 2EO1A 2GTWB 3JUYA 3EO0A 1ZSDB 3HE7D 3FB5B 2FECL 3B9KC 3NGBB 4OCSL 1OVZA 2QLVB 4RFEB 4U1IA 4EDXA 4LSPH 4RAVB 2OXHA 3TA3D 4WVRA 4M4RA 2FWOB 3LQZA 3VJ6A 3HNSL 4PY7B 4OZ4B 4DZ8B 1KGCE 3BH9A 4TSBH 3V0WL 3PP3H 4MDJA 1QQDB 3TCLB 3ABZA 4JJ5A 3BVNB 3RUGE 5KN5B 1IKFH 3L9RB 2NY3D 4JFHD 4ODBD 4WRLA 2HJLA 1UJ3C 1FVCA 4AT6B 3VXNB 5HD8C 3VGHA 3RDTC 1SYSA 4QRTA 4NHUA 4Z7VA 3S9DB 1B6UA 4PJFA 4ONHB 5FCUH 1KFAL 4HUUB 4R8WL 3WXVL 1R6VA 4JQIL 4EQ2A 1KACB 4OLEA 5CZXC 3ULVD 2D03H 4GW1A 3TBVB 4MJ2A 3CFEA 5DJ8A 2IC2A 1LK3H 5IK3A 4OZIB 2R2BA 5GGVL 5DJ0B 4JFFA 2VC2L 3FB8B 3GKWL 3VRLF 4RFOH 1WV7T 4YO0B 3GHEL 4HIEA 3JVGA 4HBCH 4Y5XB 1FSKC 2NNAB 3ZT6A 3BE1L 1VACB 3VXRB 1OQOA 1XGTA 4L9LC 1O0VA 3B83A 4OM0H 4GXUM 4DVRH 4I9WD 3EDDA 1O7VA 4PUBL 4YDVA 2ORBH 4CADB 3JWOC 4HC1L 4E41B 4HH9A 1G9NC 1MCQA 4M62H 3NIGF 4UTBH 1P53A 3V9FA 5IB2A 4L8SC 1A5FL 4OKVA 4GKOA 1KIUA 4JG1L 3MJ7B 3OJDA 1WTGT 1KN2L 4KK6D 3BN9C 4HKZB 4PRNB 3WKML 1CFTA 4GXUN 2DIJA 2FGZA 1I7ZA 1OB1B 4XPFH 4BSVB 4P2RB 3IFOB 3OKMB 2XZZA 1MH5B 5D5ME 4FG6C 4Z76A 1BBJB 3DI2B 5DGQA 1QFOA 3FL7A 1FFNB 1UH2A 1Z9MA 4XBPB 4WTXA 4H20H 3SO3B 2JKXA 1OF2B 5SWZE 3PIQA 1C5CH 2YBRA 4ZFGL 3JWOL 3E1F1 3NFSL 1G9NL 1UB6A 3SKNA 4X6EA 3HZVA 4ZSOE 3RUGA 3W9EB 5C3TA 2ZPKH 1AIFB 1IZJA 2G2RB 5CINL 3BMWA 4F3FB 3DVNA 1JNJA 4AEIH 4OLZH 1IGIL 3N0PB 3BOVA 4U6TA 4Y89A 2JJVA 3TO4D 3WS3B 3X3FH 5IOPA 4S0TD 1MUJB 2OL3H 2P5ED 4S1SH 1QLFB 3CX2A 3FQUB 3GIZH 1AC0A 1OAQL 3ZTJH 4TVPD 3LKSA 1HXYA 2OP4H 1J11A 1I7TA 4LCCC 1IGML 4J4PC 2IWGA 5IQ7H 3DNKA 3ULSB 2A1WL 2L0DA 3RAJH 4UT9L 1R3KA 3UTTB 3QUZB 2EE2A 3BRDA 1YECL 5DXWA 4RDQG 5HYJB 1EGJA 1AP2B 1EO7A 3DRQB 1VA9A 3WE6A 5DJYA 3UBXI 3BPNC 1SQ2N 4UU9A 3EZ8A 1KYOK 1MHPL 1RU9L 4MAUL 3NCJH 3BWAB 1YYMH 5E8DH 3MODH 4PJ5E 2IALB 3WDIA 2Z31A 5EIIB 2YD7A 4J4PA 4I0PA 3TJEL 1NC2A 1D6EB 2EIZB 4KI5E 2XN9B 3EOYG 3SGEH 2GYSA 4R97C 3ZDYF 1A6TB 3DV4A 2LU4A 1PX4A 4CN1A 1MFDH 4HK0A 5DRZB 2V5MA 2H8PA 2AJXH 2H1PH 5AEAA 3U48A 3C6LB 25C8L 5D5MA 5KOVC 1G7HA 1T80A 3UYOD 2EEBA 2DQFA 3PXJA 4MCYB 4XZUB 2J6EL 1OSPH 4LLQB 4YDLC 1OGAB 4ELMF 5EBMA 1CLCA 2GJZB 2YMXL 2X5PA 4LNRA 4EBQL 5SWZA 2OM5A 1S7UA 2LFGA 4Y4FA 3LHPL 1F00I 2LTQC 4LQFL 1XGRA 2JIXD 5EOTB 4ZSOA 2IFGA 1A22B 1EJ6A 1EXUA 1V7MH 8CGTA 2F9BT 4CMMA 4PRAB 4K3JH 5EZJA 2AJYH 3LRHA 5D2NB 2IPUK 1LO2H 3SOBL 1FVDA 4W81A 3SCMC 5C0JA 3U83A 1U8LA 3TNMB 2HJKA 1IC4H 5SV4A 3VRIA 1KLGA 2DL9A 4F9LA 5FUOL 1OAUL 1HHKB 4HWUA 4WFGD 4HIHB 2ZCLH 5IR1A 4LCWE 2XFXA 3GBMH 3L3DA 2CKBB 5FDYA 4KI5C 4CUCA 3KPNB 1WUNT 1MQKL 5CIPB 2EKJA 5KVGH 2E7MA 2J4WH 1FZKA 3WFZA 3QZWG 4PJDF 4PJ7B 4MX7A 4KDVA 5B3JE 4H25B 1CBVL 1FGNL 2XTJD 3NIDF 3GMQA 1A6ZB 5HPOA 1MIEL 3FN0L 4L3EB 4WWKD 3SCMA 3HLAB 4RAUA 1R3HB 2RIKA 3KG5A 2HT4C 1KCUH 1FNAA 3CLFH 5C2UB 4QOKB 4PJ5A 3ARRA 4DEPC 5HHXH 5K9KB 4M4PA 1L6XA 1FO0A 2FSEA 1ZT7A 2JJTA 5I8KH 3WCYA 1JZ2A 2R29H 2ZNWA 1WIPA 2ZJSL 3LKRA 2G60L 4KTYA 2DTSA 4JRXB 4Y1AE 4Y5VA 3VXOA 3P30L 5DVKA 2IG2H 3AS0A 1YC8A 4Y4HC 2EEDA 3O9WD 5FOBA 2Q8AH 1A9BB 3D39B 4L8DA 4YNYA 1Z0NA 2GJ6E 3KYMB 4GMSH 3KPMB 5HVHB 4FQPA 4X5XA 4K7FB 1KJMB 1T6VN 4U6HB 1WFNA 4UUJA 3QCTL 5KSBA 4QHUB 1KJ3H 4KKCD 3QAZC 3BGAA 5I1GH 3MUY1 5CGYC 2GHWB 2C3VA 5ACZA 4G42B 1A7BA 1T0MA 3V4VH 3CX5J 2XY1A 3HS0A 3RGVB 2O5ZL 1BBDL 1S5HA 1QO3A 1WC7A 4HULB 3S5LB 3B5GA 4Y16D 32C2B 3PWUB 4HXBH 4AY0A 1UACL 1A1NA 1F42A 1T4KB 5ITFA 1E27B 4NCC1 2J8UE 4PJ9D 5GZOC 1NCDH 4XAKD 5E94A 5TQ2H 2BNRA 1G9MC 4PB9H 1NFDF 3L6FA 4J3UA 4LCWA 3AM8C 5I75C 4YBQC 4LDOB 3OAZK 3MLZH 1OP5H 1D5BA 3HC3L 2X89A 5BZDA 5F72S 4TSCH 3UJJL 3J7HA 4G8EB 4QGYA 2RJMA 4XGZA 2P49B 4KTDH 3U2SB 5H37G 3MO1A 4FQQB 3KYKH 3HC0B 5DFVD 5DQDL 5F1NA 3JTTA 1ZT1B 3EHBD 5EPMB 4RBPK 5DRXB 5IMOB 5ID0B 2B1AH 3T65B 1I9EA 2COQA 4N5UA 5F9WB 2YKLL 4RMVA 4XPHH 3DIFA 1JFQH 1G9ML 1HNFA 3ARVA 4Y1AA 1TFHA 4U1SB 1XR9A 2W0FB 1DDHB 2ZZUT 4OLYH 2VL5B 5DEFA 3DMMD 2EKSB 4ZS7L 1KEMH 1TVBB 2MTPA 4Q6IC 4XVSL 4UIKH 4ZPTA 1FZOB 1FZJA 1YEIH 2GJ6A 4J6RL 1WEJL 4J1UA 2Y36L 2WIMA 2N56A 3LV3A 1RJZB 5CJ8A 3N1GC 1YEHL 4FQXC 4TPRL 3CFDA 4YIQA 5C0RH 3VD4A 5I1DA 4XMPH 1MAMH 3VWJD 3DBXA 4PFEA 3AY4C 2F54D 3SDDD 4JAMB 1WBZA 3GO1L 4N8CL 4Q6IA 2BC4B 3OB8A 3G08B 1XF3B 2WWMC 5AYUL 5DJXB 4F7TB 3HNSH 3UMTA 3EJZD 2VWEE 2P5WB 4KVNL 1AXSB 1KTLA 4UDTB 4ZUSA 2UYLA 1XCQB 3ARQA 4D2NA 2ADGB 3VCLB 1J5OL 1JK8B 2J8UA 5ETUB 3HRPA 2AV7B 1RURH 4ZFOB 1HEZA 2A6DB 2R2EA 3RVWC 3V5KA 3GMOA 4OFPA 4Q97A 3HHRB 1YY8A 1GRWA 4NQSA 3LEVL 4DOHB 1EBPA 2N7AA 2YPKB 2G5BA 5CWSA 2ITCB 4R8WH 3WXVH 1PLGH 5HHVL 3VMNA 3IDGB 2YRZA 4JQIH 3SJVD 3OKOB 1H3XA 3D0VB 2ICEB 4NUGL 4C56E 5TE6L 2BY0A 4G6ML 5F88A 4LLMB 1HXMA 5D70L 4FHBD 5GGVH 3GSRB 4PGEA 2NX5B 2VC2H 3GKWH 4L4TB 5LXGL 2G5RA 5D1QD 1DE4A 4WI4A 1XGQB 1YEFL 4PJGB 5F1SA 3BE1H 1CF8L 4OZFG 3PJSA 4IMLB 8FABB 1BQHG 5GRJL 3BX7C 3KS0J 3V5DB 1HI6A 4YJZL 5IEKB 1JPGA 4F7CB 4PUBH 4MXWL 5TDPA 5BVPH 3NIFE 3DV6A 4HC1H 4UAOB 3SKMB 3IFPA 1A5FH 1AFVL 2QBWA 3TNNA 3GJEB 4JG1H 4NBXB 5E6ZA 2GAZA 4G43B 1KN2H 3MREA 3WKMH 2C4XA 4ZXBD 3VH8A 3MQIA