3RPIA

Crystal structure of fab from 3bnc60, highly potent anti-hiv antibody
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
VHLSQSGAAVTKPGASVRVSCEASGYKISDHFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRQASWDFDTYSFYMDLKAVRSDDTAIYFCARQRSDFWDFDVWGSGTQVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain from highly potent anti-HIV neutralizing antibod
publication title Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rpiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rpiA01
1ZV5A 5A3IC 1KXQE 1KSRA 1VFBA 1D5MB 3DMMB 4M00A 1XIWA 3A0OA 4UBDC 4ZNEE 1NJ9B 4KJQD 1A3QA 3MLSH 1M7DA 2RB8A 3S5LB 4G7YL 3RWHA 4XC1L 3H8NA 5MEOA 2J1KA 3LH2H 3IAQA 5HHMB 5I8CA 3H3PH 5C0CA 3GKZA 2Q1EA 2HKHL 4YFLI 3MUZ1 3WUZA 5F6HI 5KSBF 1IGYB 3QA3B 1J0JA 2XTJD 3G9VA 2PW1A 4KRPB 1H0DA 3RNKB 1LEGB 2HWZL 1YY8B 2FX7H 3DROB 1XGYH 4NQXA 2UY7A 1SJVA 1JN6A 3HE7A 4J3UA 3OKMA 1BFTA 1Z9SA 3MV7D 4NRZA 1MVUB 4MA3B 3F62A 4LSQL 4MJ5B 2BNQA 3KYKH 4WV1C 3RGVD 1ZE3C 3TJHD 1RZJC 1LNUB 1FDLL 4TULH 2EYSA 4IRZL 5CIPA 4V1DD 4Z8FH 4Z7WF 1MEXL 2ZUYA 1V5JA 4IJ3C 1MF2L 5IIEB 2XV6B 4WI2A 1QSFE 3QO0A 4PLNC 2FBJH 4OD3L 3O4LA 1KLUB 4JY4A 2FIKA 4M62L 1J1XH 4TNWK 3C5ZD 5JDJA 3IKKA 5LGKA 4DVRL 3VJ6A 2KUTA 5FCUL 5F89A 5I1EL 5A2LH 1H8NA 4Y4KB 3ULSA 3PHOA 2GSIA 3ILPB 1RZFL 2HFEB 3UZEA 4A6YA 5C0IA 4JPKL 4ONFH 2J88L 5D7LB 2Q8AL 3IJYB 5JHDA 3TIEB 1SJEA 4JG1L 1OCWH 3F7YA 2UWEF 2DQJL 1G7PA 4GBXB 2WLZA 1JZ5A 1CF8L 3IFLH 4GW5A 4X98B 4LCWD 1CK0H 3RTQC 4MXQD 3SJVB 3DRQB 5IQ7H 4OLVH 1NGZB 1PBYA 1PG7X 4NNYA 1F45A 3L5IA 3QCVH 2YXFA 3FQTA 4Y5YB 3QEHA 3VXSA 4H8WH 4NNPL 5K9JH 3WXVH 3ALPA 1VEOA 3CVHH 4G8GB 4Z5RB 3BVNB 4WDIA 2X4TB 4MXVF 5DK0A 4PJ7A 1WF5A 4G8FB 5CD3B 2HRPL 1LP9F 1TZGL 1CT8A 4OCYH 2YOCA 3F12B 4WU7B 2DDQH 5K9OB 2XA3A 1J05B 4K7FA 4IMKA 1AR1C 4XCCL 4HZLB 2AJVH 2J6EA 5F7KC 1QZ1A 5DJZB 5ADPH 3CSPA 5KSBE 4AIOA 1RFDL 3O6FB 2NXYB 3IFPB 3QNXB 4LGPB 3V6ZA 4Q0XH 3N1GC 2CDEB 4XT1C 3PWPB 4GH7B 2ATKA 5D1XB 3IFOA 4OLUH 1GOFA 1MCCA 1CD8A 1LK3L 3O9WA 2AJYL 4P99A 1BP3B 3RJDA 2XFXA 2G9HB 3MPCA 4NQED 4M8QB 4ALAL 2BOBB 1ZLSL 3WKMH 2Z8RA 4QF1A 1E4WL 4N0FB 4PRPD 4HBCL 2I5YL 2F8OA 4KZEL 3TWCL 1U41A 3QH3A 4Z7WE 5EC2A 4JLRB 4YHYB 1TZIB 4KJWD 5TQ2H 3CXHK 5F6IB 1BQHB 3S34L 1UKQA 2GHWB 1B2WH 5LBSL 5DA4A 1P4LB 4O00A 2VXQH 1KB5B 3RUGA 4YFDB 4L4TB 3KS0J 1J8KA 3BZ4B 2XYCA 5AYUL 1CE1L 3GI8L 5KANI 1YUHA 1AGDA 4YUEL 5DD1L 1CTOA 3UJIH 4S11A 2P8LB 3AXLA 3QEQD 2NPLX 4GW4A 3FONB 5JORA 3IU4L 4LQFL 3RZCC 3C2AL 4QRSA 4HUVA 4WO4C 3S96A 4I2XA 4DW2H 1N3NA 3WE6A 2Z9TA 3BPCA 4RNRB 2D0GA 2ARWA 2UWEE 3F8UB 4FQXD 1I85A 3DARA 3O3DA 3OF6D 2BSSB 3UJTH 1P5VA 4Y8AA 3U9UB 1PYWA 4QHNA 3RAJL 2P49B 3A6BL 5DDHA 4D8PB 5KN5B 4GRWH 3PL6B 3DTXA 3PP3H 1HYRC 3NZHL 4DKEL 4JB9L 5BXFB 2D31B 1N59A 5ICZB 4KQ4L 2P45B 2WM0A 3VXOB 1P9MA 5I1DA 1S7XA 3GSOB 4D94A 4M5ZL 4MXVE 4JO4H 2F5BH 4O02L 1PKQA 4KVCH 4Z78B 4PD4K 2C3WA 1LP9E 3MRCA 3SOBL 4XCNA 4XMKL 2YN3A 3KPSB 4OF5A 1R3HB 2EE6A 4YO0A 1FL5A 2BVUA 4ZQKB 1ES0A 5DUBB 4PG9A 5CCKH 1CD9B 2VTFA 4JJ5A 5GIRB 1PQZA 4ORGA 4P4RA 4JFFA 2EDXA 5DA0B 3I6LE 4N8PA 1A6AA 3SE4C 4HGWA 4V1DE 2V5RA 3E2HB 4U1GC 5TGBB 1JF1B 4U6VL 3MLWL 1NLBH 1IGIL 3LEXA 2A6KB 35C8L 2FL5B 3FQUB 3STBA 3FKUS 3TYGL 1UB5A 4JY6B 5LG1A 3MV8E 3FQXA 4LIQL 3UTZA 1RIUL 1F3RB 2X9WA 4JREC 1OF2A 1CLOL 3G5VB 1T5WB 3T1FB 4YEFA 5H35B 3D2UB 2GCYB 4LCUB 5ERWB 2W9DH 4ISVA 2XQBL 3UBXA 5ACZA 5F96L 1AH1A 4WWKB 4O4YH 4UUJA 4F9LC 5IKCA 1U8HB 2FLBT 2HJFB 5GJTH 3T4AA 1X4YA 5IMLA 3GHEH 4F7TB 1TJHL 2PKDA 3GMLA 3GNMH 5E9DE 1ZGLM 3D69B 4LEXH 3WUWA 1MI5B 3S97C 1NGXB 2VYRE 3EJZD 1NFIB 1GOHA 4NN7C 2BNRD 2IF7A 1S7QA 3GSUA 4JREB 3TH3T 2A6JB 4N0UE 5C6TL 3T3MF 4ENED 3D25A 5I15H 4RGNC 4LPVA 4XPBH 2WIMA 1KJVB 4JN2A 4LASH 2X7LA 5EZJA 5GGQL 4MXWL 1RUAH 4ODHL 4GT7A 4PJXB 4UILL 4EBQH 3UTTD 3HFMH 4JHAH 2GAZB 3HR5B 4R6UA 1IAIH 2QR0B 3TO4A 5I6XB 2MWCA 2VSDA 5DD6B 3BKML 1NCDL 3VWJD 5IB5A 1FVEB 3LEVH 4JQVA 2CXKA 5EBLA 3SKUD 4G3YH 2YD8A 4UI2A 4Z7UB 4ZD3L 5F6HJ 1A6VH 1MFBH 4CMHB 4EI5A 2F53A 3X3GH 4B0MM 1E0OB 2YR3A 2IQAA 5ICXA 5AD0A 2B5IC 3L5JA 3MRLA 2R56H 3MJGX 4OB5H 4OCXL 2ZUWA 5D8JL 5J6GA 4OZHA 3SBWC 5MI0B 5IM7B 2HFFA 3MLYH 1QFHA 4OJFL 5CWSB 2FB4H 2DAVA 2DQTL 4CKVX 3P4LA 5CJQL 3VGGA 3I84A 4GAGL 5J13C 2A9MH 1YN7B 4APQC 2A1WH 3AM8A 5TF1L 5GSRB 3AS1A 3MOAL 4R26H 5ITFB 3O11A 1ZT7A 4JQXA 4AEFA 3KXFE 4KK9C 1QRNA 2WWMC 1TCRB 1U8NB 4YNYB 5DD3H 1OPGL 5ID1B 5DJ2B 4PB9L 1DBMH 3HUJF 3MRFB 4IRJB 3NCJL 4AMKL 4HUKB 3RY6C 4DVBA 1U92A 2AJZB 5F9JB 4KDTA 4HHAB 5KS9B 3ZKMC 1IC5H 3FQRA 2W0PA 5GPRA 5J13B 4ODVH 3WD5H 5I8EB 5FYKD 5HDBF 2VLLB 5F7EL 1D5XB 1GIGH 3FMGL 4XP9L 1T22B 2ZUQC 2P5EE 1A9EA 4I5BA 3TBSA 2R1XB 5D2LA 2VL5B 3WN5A 4UTAH 4HS3A 2YPVH 3CZFA 3QFJB 4KK8C 1XEDA 3GHBH 3VGFA 4NZJA 3FT2A 1MIMH 1BBJA 1CGSH 3OJMB 3PWLA 3E6HB 3GIVA 2CIKA 2V2XA 4LKCA 3C09C 3T3ME 4YX2L 3G08B 2NY4C 1EEYB 2YC1B 4XNXL 3SDXB 3QIUC 1BFVH 4RA0C 3CMGA 3QHZL 2AXGB 4OZ4B 4M5YH 1S7WB 2YD4A 4C83B 1G7HB 3M8OL 3MV7A 4JM2B 1ACYH 3V4PH 4QRTB 4R8WL 3OV6A 1XH3B 4NO5A 5GISL 3ESUF 3O8XC 3RGVA 3EOBB 5DMIL 5IB4B 2NNAA 4R90L 5JO5B 1ODAA 1BWWA 5BJTA 3TNNA 3N50A 4G7VH 4N0CC 3NFNB 5JA9A 4IRSA 3C09B 2OMNA 1D5IL 2D9CA 3NOIA 3KWWA 4PJGF 1MCJA 3VWKB 5F9WC 1DLHB 1FV1A 3O41A 3HE6A 3MYJB 1XF4A 3C5ZA 4P2OD 2WW8A 4WW2A 2CDFA 3M07A 3OMZA 5KSAC 5CUSH 1FL6A 4M61A 1UM4L 3TVMD 4EI6A 1MJUH 2OI9B 5L2KB 4P5MA 2IBZY 5DI8B 3HNTH 3VE0B 1DBJL 3DIFA 5BRZB 4L4VE 3HB3D 2PCPA 4WJ5B 4LQ1A 1WK0A 3MLRL 1XIWC 1NSNH 5ESAA 3B9KD 4KKAC 1KEMH 5T1LB 1DJSA 2R23B 1N5YH 2PO6D 1WC7B 3KPRD 3NIGF 4I9WD 3ARSA 4YE4L 4AM0B 5E2UH 5DT1L 3ZT7A 5EO0A 1OT2A 2NW3A 4XRCB 2OZ4H 3G6DH 4BFBD 1I7ZA 5B21A 1U42A 3HUJE 4LCWA 4RA3A 4Z77A 4UV7H 3TV3H 2AGJL 4G9FD 5B38B 2V9QA 3BHBB 4TUOA 2NY7L 2IEPA 1U8JA 5D2NE 5JPNB 2ZCLH 4LCIL 3INUH 3UTPE 3HE7C 4DTGL 5HDBE 2EDEA 5FGRA 1M7DB 5KTEL 2W0LA 2VC2L 4KK6D 3RL2A 3BI9X 1Q9KB 4ZNCD 5FGCE 2PXYC 1OT1A 2GFBA 3U0TA 2HTKC 3UTTE 1WISA 3WNPA 3MCLL 1RZGA 3RX5A 2GJ6D 5IBTH 5DLMH 4HV8A 5KG9B 3QDJB 4JFPB 3EYQC 3MRPA 4MNQD 2K1MA 2GUOA 4MNHA 2YKLL 5IFAL 3JTSB 3LKPB 1M6OA 1MHPL 4NQEA 1AGCB 2FGWL 3K8MA 2EYSB 2OJZL 1IBGH 4LPTA 12E8H 5SWZB 3OXRA 1PZ5B 4CMMA 4HWEH 4PRPA 5GZND 2XACC 4GQ9L 1Q0YL 2DJUA 5L88H 1C1EH 3X3FL 1NCWH 3VXQA 3GBNH 4D0DA 2AJSH 2YZ8A 3KJ6H 4MJ2A 4JM4L 3AB0C 4PJGE 5FB8A 3IDGB 4X99A 5F7WC 4QO1A 1G7JA 3Q0HA 5CLTA 3Q5OA 4D9QE 2CMRL 1NCNA 4J2XA 2QQNH 4OD1L 3FO2B 4RGMC 5MERA 1IT9L 2MQ0A 3HNVH 3W39B 2NY5H 3HZKA 1XGRB 2EIEA 3BSZH 4KXZI 3IF1A 1MRDL 3QEQA 2V2TB 4EOWL 5J3HD 3BKCH 5GGSB 4M1CD 3VA2C 4NQSA 3CU7A 1A0QH 3P0VL 4HAFA 3IRPX 3NIGE 1FZJA 4FQXA 4ZSOB 3D3VE 5K9QI 5FYKE 3OF6A 4JFQB 4L9DA 4ZFOB 4IMKC 2ESVD 1IGML 3L3IA 4LLYB 4ODWA 2JB5H 1TMCB 3D48R 3T04D 3FQTB 1T04B 4XI5D 4HGMA 4ZMAT 3V6OA 5L2JB 1ACZA 5HHOE 1K8IA 1OSPL 3O9WC 4KI1A 4C56D 2DQEH 4FQQB 3I6GB 1FGVL 5ALBL 4YIQB 1G9MC 4NNXA 4AEEA 3PHQA 2Q7YB 3CC5B 2YSSB 4U1SB 5C2BH 1AO7B 5D7SL 3QNYA 4I0PB 3SDAD 5KVEL 4POUB 2Z93A 4MYWB 4PRNA 4XVSL 3MV9B 1G7MB 3V6ZB 4NQVB 4XX1G 2FLRT 3FTGB 2DLEA 3WJJA 2W92A 4OZGF 1ZK9A 2ADJB 5DMKB 1N6QL 1ADQH 4K3HA 4Z0BL 4K8RL 4XBEL 1A6UH 2X4SB 1MPAL 3HMWH 1F4AA 3ZZ1A 4YC2C 4XAWH 1EPFA 2A77H 1RZ7H 3ZKQD 1UADC 4RQQA 5CEZD 3LKOA 1QLRB 4U1MA 2FX8L 4PRAB 4RAVA 4BH8A 3STLB 5C0FA 1X6NA 3GB7A 4ETQA 1I85C 2ITCA 2IPUK 1A3RL 1MCOL 4G80A 1M1SA 3TA3D 3U2SA 1I7UB 2NX5D 1AXTH 4ZXBD 5E5MB 1KTRL 1AGDB 4ZFFB 1P4IL 4M1DL 2HKHH 5C6WH 1YEIL 4QT5A 1HSAA 3GMQB 3JV5A 1ZHNB 2BNRA 1FSKB 3DVNA 4MDIA 5KZCB 1BVZA 4X9BA 2CQVA 4OZIF 1EHLL 4JPWL 2VZTA 2HG5A 5F1IB 1P9MC 3CDGA 1G1YA 4HS6A 4JQIH 1W2KT 2LVCA 2LTQC 1L4IA 2X4OA 1B0RA 1BM3L 3O3DB 3WIFB 4Z6AT 2DYPD 2DJSA 1MWAL 5T3XL 5CGYC 1J7VR 2OYPA 1JFQH 1SJHB 1A9BA 4NZUL 1H15A 1BD2D 2V9RA 1QEWB 4LHUB 1OAZL 4ZFGH 1WITA 2E27L 2O5ZL 1NCUA 4HDIB 3TFKC 3VWJA 1MH5A 4KHXL 3MUY1 1F2QA 4U1IA 4FFYL 5DJ6A 4LEOB 1F3JA 2VLRD 3QQ3A 5CMAA 2J5LB 5FUZH 2DLGA 5E2VH 4UOW0 1JP5A 3OAYK 4QY8B 3IXAA 1BGXH 1UA6H 4DAGH 5FYLH 1QSFB 4Z76A 2DQGH 4YDJA 3AY4A 3OKOB 5SWQA 1T20B 4KMLB 1PQZB 4UB0H 3BGMB 4YWGH 2A83B 4OCRH 4JPKH 3TPUB 2J88H 2YEZA 1BIIA 4MD0A 3HZYA 3GMOA 5JXED 4Y2DD 5F8QC 8FABA 3ZT6A 4OZGE 5DFVD 4HH9A 2NY3D 5FAAA 3VFUA 2E6JA 3FQXB 5C2UB 3L3GA 4XNYH 1NLDH 3GFUA 4ELKA 5E6YA 2EYRA 3CVHA 4BQ6A 4PRDB 4YDIH 1RZJL 3IXTA 3EO9H 4NNPH 4YHNB 4F9PA 4HPYH 2VN7A 3JUZA 4GRLB 1OP9A 3FO9A 4ONGL 3QHFL 3UBXB 1IFHL 2E3VA 2ED7A 3VFOA 1BZQK 3LQAC 4FQLH 2A73B 3E1F1 2HRPH 4Y5VB 4F57H 3D18B 2N7BA 5HYQB 3PGCB 1YQ2A 4GUPA 3GMLB 4WNQB 3TO4C 3AC0A 3LMJL 5HI3D 4F80A 3TZVD 2B1AH 3Q2CA 3H2WA 1MHEB 4JQVC 3MRJB 4OCLC 3ARYA 3MREB 4KFZC 4NUJB 5F93C 1WUNT 5D96B 3RX8A 2MCG1 1EV2E 4OZIE 4EI5C 1R5IA 1QG3A 4WTXA 2VERN 1KCUL 4E42B 1LK3H 3ARDA 3MRNB 4FTVD 2AV1B 4JG0L 4K71B 2A6DA 2DD8L 4I8DA 4JPVL 3TLRA 3T2PA 3IETA 2R4RH 4HCRL 3WNOA 3L3JA 5LJYH 2RR3A 4JZNA 3TT1H 1DUYA 4BQCA 1E4WH 5DF0A 5C0NC 2VXSL 4NDMA 5K59F 2I5YH 5KSBB 1YQVH 3I9GH 4AT6A 5F7DB 1VCAA 2VXUL 1NAML 1V7ML 3MACL 2M2DA 3AM8C 6CGTA 5IBLD 4EDXB 5TE7H 4XPGL 4X7FC 1YYLH 3O81A 4JQXC 3VXRE 3EZJB 1SBSL 4TQEH 3WIIL 3DVFA 4M6NH 5AD0B 1YNKL 3GMMB 4O9HH 4P2OA 5HDLA 4JVUA 3BPOC 1JGUL 2XZQL 4AZ8A 1QUNA 3UTQA 2CR6A 2ZKHL 4KDTC 4LSDA 3DX8B 2GJJA 1CXFA 1ZS8B 3GUTB 3QEGL 1EO7A 4QNPF 5I9QC 4M7KL 4HK0B 1M71B 2D0HA 4UV4H 3BFOA 1BHGA 3B9KA 3H3BC 3MRBA 5F88A 5CEZE 3T08A 3AU1B 1NC2A 3WN5C 2PO6A 3KPRA 3QUXB 4YFLF 2MJWA 3VFMB 3LEYH 1YEHL 1YEFH 1E27B 2WUCH 3DO7A 1KB9K 2YRPA 3KPMA 4DVBB 2W0FB 3L3DA 2ZSVB 4M3KB 4XWGL 2CGRH 1UACH 2XTJC 4G9FA 5IOPA 2UWEB 1UCBL 2IMNA 4OCWH 2G2RA 4O02H 4DUWA 1EHNA 5LXGL 2FWOA 3S9DB 5CZVL 1PG7W 3SOBH 4I5BB 1MFEH 2ZUUA 5JW3L 1HK6A 5D2LB 4NGHL 4XBGB 1LO0L 3RGVC 3TJHC 2XPGB 3E8UH 3U9PH 4RWHA 1LO5A 3P0GB 4WHTB 2A38A 4X5WA 2H8PA 4HLJA 4IRSC 4M9PA 1REIA 2Y6SD 3OXSB 5JA8B 2GJ6A 1B6DA 3HE6C 4YBQD 4L4JA 1S7RB 3HN3A 3C5ZC 4IMLA 3WFHB 35C8H 3MXVH 1LP9B 4WW2C 2DJ4A 3U36B 2EKSB 1PZUB 1JV5A 1EFXA 3BDXA 1KCRH 2H45A 4MNQA 5JW4R 2BSRB 3MV7B 5L6YL 5C0AA 4HKJA 5ABDE 4MVBD 3BH9A 5K59E 3VCLB 1VGKA 3ES6A 4N8CL 4V1DB 3C6LD 1DR9A 4DKFH 1G0XA 5T5NG 3LRGA 5C09D 1T66D 1IGCL 2F19L 1TNNA 4MNGA 4ZTPL 1YEGL 2IFFH 1DVFB 4UT6L 2YK1L 3AAZB 3MV8B 2W60A 4PGJA 1PSKL 1NMBL 3DLQR 1IM9A 4G6JH 5E6ID 4KKNA 3QQ4B 2XWTB 4OFYD 5LAXB 5EOCL 4MXQC 1XGPB 3WDIA 1QKZH 3OAYH 3MOBL 4ZAKD 3VMOA 4B7LA 1PKOA 2PCPB 2IH3B 1X5XA 4QNPE 1NMCC 2FJFB 1HILA 1I75A 1J0KA 1P6FA 2JF1A 2GK0A 5E9DB 3C6SA 4HKXA 1BX2B 4L3ED 3V5DA 5DVLA 3P9MA 3SCMB 1T83A 1FFNA 4YDVA 3DETC 5EU7E 4CN6A 1KN2H 4N0UB 1I8KB 3BKMH 1RK1A 2ESVA 7CGTA 2AK1L 1HXYA 2X4PB 3QUMB 1RIVL 1KJ2B 2DMCA 3BGFC 3H0TB 3P77B 1U8JB 1B6UA 5FYLD 4CJ1A 2KQNA 4HG4J 4RSVA 2LAAA 4C56A 1RUQH 4X6DF 4HIXH 2G5BB 5D71L 2XWJB 3ZSSA 2B1HL 3TJEH 1KPUB 4NQCD 5HHVL 1NL0L 4HZAA 3SKJL 3DHJA 5DTFB 2GFBB 2R69H 3V7AG 2WSKA 1D9KD 2X4NB 3VXUE 3CIQA 1DDHB 5FOJA 1WFOA 4GG6A 3SDAA 4KJWC 5I30L 1EGJL 3LV3B 3SHSA 5DEFB 2YS4A 1RVFL 2B2XL 5IROA 4MJ4A 1RD6A 1YMME 1NFDA 3O6ML 4X9GA 2I60H 2FHBA 1HINH 1QFWM 4PB9H 4PRID 1OM3L 2RJMA 3C8KA 4NQEB 5D6CA 1U8KA 5HHXL 2H41A 3G6JA 4AMKH 4PJEA 3ZE0F 2ZG3A 5GRYA 5I73C 4D3CH 3RWFB 3QIBC 3D6GA 4UQ3A 5J1AB 1AQDB 2ZUVA 1GL4B 2R8SL 3VXME 4NFCA 3KXFB 4HF5L 1PLGL 5F7EH 3GM0A 2DWEA 4HX1A 4XP9H 2EH7H 4FQXC 6FABL 3L5WB 2ZPKL 4CDHA 4L3AA 1HQRA 1JPFA 1QLEL 5GHWL 3O2WH 4TPRH 3TA3A 4M3JA 3H9YA 5LGJB 2NX5A 4TOYH 4L1HA 5CS7A 5FGSA 5E24E 3M1BA 4OKDA 2F74B 1VFAA 3UYPA 5JMOC 3RWEB 3V6OC 2MFNA 2DBLL 2R1WB 3REVA 3QPXL 4OFPA 4PBXA 4B41A 1XZ0A 4YJZL 1D5BA 2VN4A 3L1OH 1FZKA 3QHZH 4JFEE 3WLBA 5J6HB 1XF5B 2XNAA 1KNOB 3FT4B 1T1YA 5IFHL 1V7NH 4X80L 2LFGA 1QFPA 3M8OH 2FZ3A 1CU4H 2LVEA 4MQXD 5MEQA 3P0YH 1FO0L 2DYPA 3JV6A 1EEZA 2G75A 1RJZA 4FQJH 5FV1L 4JRYE 5E08L 4W6YB 2N1KA 1CFTB 4K07A 2IAMA 5I1JL 1BD2A 1IAKB 4XXCA 5CSGA 4X5XA 5IB2B 3WEXB 2HT2D 1B0GA 5HYEA 3GMNA 2IGFL 1KJ3L 5GRZA 3TBTA 1GGUA 1BVLA 2BMKB 4OSUH 1ZANL 1NKOA 3WJJC 3DXAE 4Y0GA 2VLRA 1SHMA 1I8MA 1FFPB 4X6DE 3OB8A 5CP3H 4JVPA 5JIIA 3RNQA 1ZHBA 3PHQB 1CS6A 3DSNA 4WCYL 4NHUA 1QSEE 4NHCL 4PS4H 1MREL 1DBJH 1MAMH 3LPWA 1CICC 5C8JA 3ULUL 2VLJD 3MROA 2CLVA 4PLKD 1JPGA 2YD2A 5HVFB 4H5SB 5DVNA 2ZCHH 1K9TA 2OZ4A 5C09E 3KG5A 1JF6A 2VH5L 3OL2A 4MGXA 1JRHL 5JXEA 5C0DB 4Y2DA 5AAWA 4I3GA 4KPHL 4XP1H 5DVMA 3FRPA 4MB5A 3UAJC 4N9GB 1EEUA 3HPLA 3IDNB 4L4VB 5JW4Q 1UM6L 3ZE0E 1FG9C 4HC1L 5INDB 4Y5XB 3LRSA 4ENEC 4PY7A 3QCUL 4RAVB 4HPOL 3BQUB 3QDGD 1G6RB 2B0SH 2IAND 1D6VH 2J4WL 3PV6A 3OGCA 4OLYL 2QSCL 1FC1A 3HUJB 2EH8L 3TH2T 1GZPB 4U6HB 1HHGB 5ESQB 1RUPL 3KLAA 1E6JL 1KIQA 1D6EB 2X1XR 5B8CB 3QWRA 3MR9A 5DD5L 4L3EE 3MCLH 4JCLA 3VWJC 3QO1A 1C7TA 3DVNB 4DN4L 3EHBC 5EH1A 4HFWB 3PXHA 4QGYA 1HN1A 5IJKA 1XR9B 4GMSL 3D85A 3O2VL 3MRGA 3GEWB 3OWEA 4GKZA 3C60D 1E6OH 4A2LA 1B0RB 1AD9B 1Z6JT 1CL7H 1ZTXL 4H1LG 5FGCB 3VH8A 4FTVA 3QRFM 1JYXA 1CLYH 1G7IB 3KR3L 3UTTB 4NQDD 2BRQA 3AY4C 4OIBA 3DX7A 4EUPG 5FDYA 1JGDB 1LDPL 2PYFA 3MRKA 3PQYE 4NQCE 4HD9A 4Z7QF 5J9PB 1Q0YH 1EH9A 5DWUH 5BOPA 4U1IB 3ZTNL 4K3EL 3NZ8B 3GSRA 5FO8B 3QQ3B 1OTTD 4QXTB 2VXTL 3TYFA 3HLAA 1S7UA 1DQDL 5FKAA 2CMRH 1EO5A 3G6AB 3DBXA 4OD1H 1JHLL 1YMHA 4H8WC 4X4XA 3GSWB 3PNWB 1NAKL 4X6CF 5GS2H 4P4KD 2BHZA 5E03A 3B2VL 1TENA 3FB5B 5SWQB 1SVCP 3RBSA 5FK9B 4F9PC 1HH9B 4J6RL 4PRIE 1U9KA 3SGEI 4PJGB 1NANI 2WANA 1PJ9A 5MP6H 3G5ZB 5HI4D 5JXAL 3HZYB 5KOVC 4YHLH 4ZOEA 1J1OL 4HFUL 1U6AL 2IH1A 1CVRA 2HLAA 1LWRA 2BCKA 2EYTB 1DCLA 1FYTD 1JMZA 4M7LL 4JY5L 2PN5A 4KROD 3PGFH 1H5BB 2F54E 3ARED 4NJAL 5SX4H 5GRVL 4A6YL 3H9ZA 5IGXL 4TRPL 5TPWL 1SYSA 1F6FB 1OSPH 1N8ZA 3QDME 3ZYJA 3ARDC 4LLDA 3BP6A 1EAJA 2YPLA 5FM5O 4C55A 3D3VB 5H2BA 1FGVH 1ZT1A 2XY2A 2BXYA 2CKBH 4MZ3A 2V7HB 3VMPA 2YBRB 2E9WA 1JWUB 3BZFA 4PJIE 3V0VA 2ILLA 4CADA 3V0AC 3B3IB 4JN1L 1FIGL 4F8QA 5J7CC 1YNTB 3K2MC 2X9YA 1HXMB 1PAMA 4MAYB 2DS4A 5IV2B 1AJ7L 1ED3A 2D0FA 4NCC1 1CE6B 2FECL 5A16A 2HVJB 2YWYA 1ADQA 1FORL 3ZKND 3QZWB 4ODBD 1F4XL 1A5FL 5DS8A 2LV4A 3LN4B 1JRHI 2CD0A 3OPZH 3BIAX 5HGGS 1O7VA 4P2OC 2DQCL 5EU6E 1N6QH 1BFSA 3IETB 3PHSA 4U6XB 4QRRE 5KVMC 3CDYA 5SV3A 3RKDC 4LVNB 1PX4A 3OKKB 2X6MA 3QUKA 5FV2A 4AT6B 5KVDH 1CDGA 2J6EL 2BOCA 1T4KB 3WNKA 4EDWL 1UWXK 1DUZB 4G9DA 2X89D 3DHMA 4Z7QE 1CFBA 1DN2A 3HB3C 1LEIB 3C6LA 4KTEL 5E94A 3B9KC 2VWEE 4WFFD 4CU8A 5C3LD 2GJZB 4XZUB 3FQWB 2MCPH 1MCOH 4QYOA 2XA8L 1A1MA 3FCTB 3ZKSD 3V5HB 4DN3H 2PO6C 4HIEA 4DKAA 2I9TA 3BXNA 2NLJB 1YDPA 4LARL 2R0KH 4F7EA 5LVEA 4M1DH 3FAXA 5E6IA 1G9ML 1NGPH 5IW1B 1T21A 3TVMB 3WYRA 1GC1L 4X6CE 4UNUA 4OFYA 5GS1B 3KPPA 1ZA3B 3L7EA 5DGRA 4GLRH 3LKNA 2XIDA 5D5MF 3EDKA 3P11H 2EIBA 2BC4A 2LQRA 3VGDA 1QBLL 4AEIL 3CSBA 1MJ7H 1K2DA 3KJ4B 4QOKE 3CSGA 4G6FB 1MLBA 5HYSG 5HVWA 4S1QH 2ICCA 4LLQA 1FL3B 1MWAH 4QRUA 5T3XH 3KPRB 3S36H 2AAVA 4PJFA 1Q9LB 4KK6C 1UWGH 4HJJH 4BFIA 5FKPA 2HJKB 5E8NA 2C3GA 1OAZH 3GBMH 2E27H 4G6AD 4LVOB 3VD5A 4L3CB 3HCVA 3P9WB 1QFWL 1RY7B 2NYYD 2D03H 4NFBA 4UT9L 5IOPB 5ILTH 4E9LA 2F5AL 5EOTA 3D9AH 5C9JA 1N2RB 2DWDA 3UDWA 2Q6WA 1TJIH 3RPIA 4LIQE 3WFCL 5MEPA 1JHKH 5E8OB 3LZFH 5GZOC 5I76B 1AE6L 3JWNC 2EXYC 5F44A 1A1NB 3RY4A 2MHAA 5GZNC 1VKXB 1ZVYA 3HNSL 4F15C 5IVXA 1UXSA 4PJHF 1G0DA 3EO0A 5DQDH 3EKCA 1RHHA 1B9ZA 5FGBA 4FFVD 3MRMA 1ZHKB 2VR5A 2ED9A 3MUGB 2H6PA 3IVKA 3NFPA 3WFBH 5DJCA 1LO4L 3HI6H 3C08L 5D1QA 3ES6B 2X4RB 2EDQA 4B7IA 2IJ0C 1KLGA 2JJVA 4NN5B 4GG8A 2DKSA 4OZGB 3CLFL 5CINL 3KYNB 1VERA 2W60B 2HVKA 3FFCD 3RDTC 5SWSD 1EJOL 1OSZB 5K93A 3SY0B 1TZHA 1T83C 2O5YL 3CFEB 3BDBA 4XTRD 2R2HA 5JIKA 4K7PL 1A7QH 2JCCF 2C4XA 2Z4QB 5C0BD 2GITB 5EZOH 3MNWA 2Z31C 1Z9MA 3FQNB 4Y19D 3QSKB 5I1CL 1I7TA 1B4RA 1OAXH 4XI5C 3UEZA 1KCUH 1AC0A 4MA8L 2I9LB 2Z35B 5B39B 1HILB 3SE9L 5KAQF 2LU3A 2QSVA 1MSPA 4IDJL 4JPVH 5EOQH 4XCEB 3V8CA 4HCRH 3PDGA 3V5DB 1VEMA 4J8RB 4WEMB 4XVUC 4NKQB 5C0RL 1JNLL 1K8DA 4O2EB 5FDWB 2V5YA 3K4ZA 3SDAC 3O4OB 1FNLA 5IROC 3WIHH 3WHXA 2BNUB 4P5KA 3AFLA 1FNGA 4HKBB 5GS2D 1TIUA 1VB9A 3FO1B 2VDML 4OGXL 1N5AB 4LSUL 4JRXE 3LQAL 4J3SA 2AJ3A 5HGDB 1CG9B 1R5VB 2ERJC 4OGYH 5BW7A 4LSTL 3G5YB 1AP2A 1DLFH 5BO1L 4M7JH 2ZKHH 3L7FA 1A64A 2OR9L 3QEGH 3T0AA 1NPUA 3UTSD 1U8LA 2EIZB 3O6KL 2VLJA 3VXRB 4NC1C 3CFKA 3RVWD 4H0HB 2IG2H 4PJHE 2V9TA 3MXWH 4K7PY 3RVVD 1R3IH 2VE6A 4IOIB 1MAKA 2VAAB 4NPYA 3TA3C 4BZ1L 1QLFA 4KTDL 4EVNA 1Z5LA 4WFFE 3DUUB 4DOHE 1EO8L 2C3VA 3G6JB 1GGTA 4U1JB 4BK5A 1FHGA 1QFWI 3LHPL 4WRLA 5HGHB 1ORSB 2NZ9D 2P5WE 1YC8A 5ANMA 5C70A 3EOTH 4KJPD 1Z3GL 3PDOB 3LDBB 3VFRA 1CR9H 5CSZA 1UWXH 4F7CB 1M7IA 3QDGA 3V4VL 3VW3L 3PWJB 4F7PA 4XMPL 5BS0E 1UENA 3HG1E 1EDQA 2IANA 4LMQI 4ODSH 1ZLVK 4HWZA 4ZXBB 1LVEA 2D4FA 2BY2A 3M1BB 2ZSWA 2JCCE 2IAMC 4XXCC 1UJ3B 3QAZC 4LDEB 4GMTL 1E28B 2FSEA 2V17L 2HKFL 2LAGB 4GSDL 3BIKB 4Y16D 1OB1A 2DQFA 2FO1A 3U0PA 4EQ3A 3ULVH 3Q6FA 5GS0H 3NCMA 3TIDA 1QA9A 4XCYA 2DQUL 3L3OB 4LLMB 3C60A 3GMPA 3T4YA 4FG6D 3SQOH 3DNKA 2DYPB 2G75B 1GSMA 4X5LA 3FOMB 4LSVL 4HGKC 4NQDA 4ZUUB 1A6TA 4OAWA 2FYYA 3QAZB 3IJHB 4GOSA 3RWCB 3CFCH 3BP5B 4Z7VF 5TDNA 1FAKT 2QSQA 4FS0A 3TBTB 4ZTPH 4P23D 1YEGH 2VQ1B 5ADOH 4MHHI 2YRLA 1R0AH 2J8UA 5JXEC 1AHWC 4X7CC 4Y2DC 3EYOA 5FO9A 5DFVC 5KOMC 1ZHBB 2NY3C 4OF7A 5EOCH 2QADB 2AXJA 1J9CT 4OZFB 3MOBH 1CQYA 4LSSL 4P4KA 2AKRA 4HUXB 3FB8B 3MNVA 3STZA 1RZIB 4JRWA 4ZPTB 5T3XD 3H7BA 3UBXI 3KLHD 2QKIB 2EO9A 2P43B 2UYLB 2BY0A 1J8HE 1T1XA 3MCKB 1JHTA 1MFCL 4DUVA 2CRIA 3V52L 1MUJB 5DFTA 4XP6L 4P2YA 2QHRH 3BDYH 5D70H 1EXUB 3LVEA 3Q5TA 3U7WH 4P2QE 4XH2B 4DGVL 4OFVA 4R4BB 1KV3A 4I3RH 1XCQB 3BUYB 1JWMA 5CKAA 1AQKL 4F58H 3FFCE 1FYTA 5I18H 2AK1H 3MJ8B 3VRLF 4UBDD 1JNHB 3MRRB 5GRJL 1OQXA 5C07E 4NJ9H 4XNZC 5ISZE 4PR5A 5IJKC 5HHPA 4ZTOL 3AREA 3MMEB 5L0QB 1K6QL 2VDLL 4P3DB 4IS6B 1DN0B 4OLZL 4Y19E 5C0JB 4M48H 4TSAL 5JNYA 4AL8L 5C0EB 3LRHA 3PWVA 4BZ2H 2DLFH 1NL0H 5ETUA 4TVPH 5D2NA 4G42B 1F11A 3DVGB 1KJMB 1JZ4A 3TZVB 3QI9A 1R3JB 2BVOB 1WV7T 5I16B 4GAYB 4QXGL 2E6PA 5HYJE 1K3IA 1L7IL 3RKPA 3MLUH 3ZTJG 1T2QH 1FAIL 4XNZB 5IBLC 4F3FA 3ZYZA 4P9ML 4CN4A 2E7MA 1BPVA 5EWIL 2NY5C 1FNSL 5T3ZL 5TH2A 3OJDA 3O6MH 3MODL 2HJLA 2P7TA 1OM3H 1MFNA 2M8XA 5DJ0B 5EIIB 4G43B 3VXUB 4UT7H 5IFJB 4YPGA 3R1GL 3BIBX 4EIGB 5BQ7A 4PP2A 1HH6B 1AKJB 5BV7B 4DQOL 1INQB 5J11C 2H3NA 4EN3D 4Z7VE 2X89A 1IRAY 3FN3A 3NTCL 4AH2B 1N64L 1YMMB 3ETBF 1PLGH 2HP4A 1G7LA 5F9OH 4L9LA 3OR7B 3UTSE 1F4WL 1CDJA 5D6DC 2Y5TB 5TFSL 4JDZB 3IJSB 4NYLA 1JZ6A 1TTGA 2P46B 1XCTB 2VDRL 3C2SA 2EKJA 4X6EB 2YD5A 3K8LA 2EDJA 3SDCB 1OVZA 2XKNB 4BSWB 1NEZB 4F37F 1TPXC 1BLNB 1LDSA 3S37X 3PDDA 4ZPVA 2DBLH 1I4FB 3QUYB 3VXMB 2EEAA 3BGAA 3QXAB 2K7PA 2KKQA 4R7DB 1LO2H 5IWLC 1UVQB 2BHUA 1C12B 1AY1H 1XF1A 2XRAL 3KHOA 1T3FA 3V5KA 4ORZC 1N0XL 1DANT 1MLCA 4U6YA 5GGVY 1S7TB 4X80H 1IMHC 1WJ3A 2WP3O 2EDYA 4N8VB 3SKNB 4WUKH 3CK0L 3GMRB 2PTTA 2OCFD 3GKWL 3OTTA 1AI1L 4N0YL 4P9HL 5FFLA 3VFSB 5E08H 1IL1A 5EU3A 4R0LB 2H32B 1JNNL 1C5CL 4UAOC 3U82B 1WAAF 5I1JH 1MIEH 4U1NA 3VRLE 1VADB 1VENA 4NKDB 1ZGLP 2YN5A 4HIIB 3QCTH 3P9LA 3OKNA 4Y1AA 1A21A 2OP4L 2Y6SC 5CP3A 1W72B 4H88L 2OJEB 5I8KL 1PG7H 4L29A 4YBQC 4DGYH 4U1HA 4X6BA 5H2BB 3IT8D 4RRPA 4CVWA 1TTFA 1FZMB 4CJ0A 4NP4H 4XBPA 1HDMB 4JRYB 3AGVA 1C16A 4EQ2A 3V0VB 4NHCH 5FUOH 1T6VN 2APWA 3T65A 3ULUH 4F33B 3C6LC 1ZLVH 5I2IB 1INDL 3UC0L 4HMCA 5LCVL 3VXPA 1QSVA 1TETH 2E6QA 5A16B 1UZ6F 1NCCL 3RU8L 2VH5H 1A7RL 1UT9A 3OAZK 1B4JL 1Q94B 4Z0XA 2HT3D 5E6IC 1QSEB 4QRPE 5JDSB 1KCVH 1QQDB 1RUML 4NSKB 2X4QB 1IAIM 3GI9H 4RAUB 2BOCB 1ZLWK 4TYUA 4IHOB 4R97C 2VL4A 5C09B 1BFOB 5I1IH 1MQKL 2AK4E 3C9NA 1WBYB 1YECH 3KYAA 1IZJA 4EZMA 4HIEB 4S1RH 1S78C 1XF3A 3GO1L 4K2UL 3RZCD 4RGOH 1KN4L 1A4KB 2NW2B 1FG2A 3V7MA 5SWSA 4YHIB 4QHLA 4ZO9A 4X0KB 4FN0A 2X1PA 3QXDA 2VABB 3KPLA 5C0BA 3E3QC 3H7LA 2GI7A 4ZAKB 1UKTA 3TBYA 2VZ1A 3MLSL 4PIRF 4QTHA 4R97B 3X17A 1UQSA 3UDWC 5M94B 3O2VH 3H3PL 3QDHA 2FD6H 4YK4B 1RZKH 2FNBA 3OG6B 4XB7A 2VLKD 1KELL 4KVNL 3VD3A 4ZUVB 5C71A 4L3EB 5EU4A 3RIFK 3KYOA 2HYMA 1FNEA 2E5EA 5E8NB 3HC0A 1WAAE 3Q1SH 3GGWA 2FX7L 1J5OH 1XGYL 3ZTNH 1WEJL 5ITBH 5EOTB 1KTLB 2OR8A 4PFEA 2FH6A 5DQJB 5FA3A 5DHVH 5FGBC 3S4SB 3UJJH 3GSXA 4JKMA 4PJ9D 3KYKL 4E0RB 1DQDH 1A7PH 1JGEA 2QQKH 1IEBB 5HHQA 4TULL 4Z8FL 1J1PH 3KPNA 4CVZA 1L0XA 2Z92A 3TF7C 4P2RA 2EO1A 1JCKA 1FN4B 2XQYK 4NQCB 2FBJL 2JK5A 4LU5H 5D1QC 4P57A 4CU7A 3KYMB 1JPST 4Y7MA 1J1XL 3ZHKA 3NCYP 4JZJA 1D9KB 3BW9B 5D7LE 5I1GH 1SBBA 5C08E 1DE4A 2ATPA 2EDKA 2GSGB 5JXAH 5INCA 1J10A 3HC3H 1YEKH 1UZ6E 1I9IH 1J1OH 4Q6YA 3U30C 1A4JA 2XY1A 4NBZB 1EX0A 3MRMB 1WFNA 3BN9C 1NC4B 2IC2A 5IVNA 1HKFA 1SY6H 4PRIB 2IALA 4GQPH 4CNIB 4D0BB 1LEKA 4NRXA 4HAGA 1DBKH 5JW5A 2R2BB 4RMSA 1S3KH 1OCWL 4MWFA 4EIZC 4PRBB 4H26A 2PW2B 4XPHL 2CKBA 5J8OA 5KJRH 4TVPD 5T33H 3IFLL 4NN6C 5DC4B 4MSWB 1CK0L 1S7SA 1P7KA 5IJVA 4HG4K 3RIAF 5IQ7L 4OLVL 2GK2A 3D39A 1RQ5A 4JFDD 1R24A 1AIFA 3ISWA 4RGND 5A40E 1FCGA 3GSVB 4H8WL 5CP7B 5K9JL 1FIGH 3WXVL 3S8WA 2VDOH 5EU5B 1DQQA 3CVHL 5AG8A 2VKXA 5KVFH 1AJ7H 4R3SB 3QDMB 1IGJB 3WO4B 1AGEB 1XR8A 4OGAC 4Y16A 4WI6A 4RWYH 3DGGA 1A5FH 4XVTH 2IADA 4BYHA 2PYED 2JB6A 2DDQL 2DQCH 4PJIB 3U7YH 2AJVL 5ADPL 4OV5B 1CZ8H 4H1LH 5HVHB 4ZFZA 2XN9E 1IGTA 4LPYA 4EXKA 4Q0XL 5J4MA 3IGAA 1KBGL 5T1KD 1N7ML 3C5SA 5EB9A 1OTSD 4OLUL 3K80A 4EUPH 1NUFA 1W0WB 3VD7A 4PJBE 2C7UA 5DD0H 5LGHH 4KTEH 3PGDB 1OGAA 4QWWD 5EU6B 1E4XI 3W2DL 4P23A 1M05A 4HS8H 2Q86B 5EORH 2AJ3B 2CKNA 4QRRB 1T7XA 5F7UA 4LARH 4OLEA 3V9FA 2FR4B 2D7OA 4KI5D 5TQ2L 4X4MA 1GC1H 4APQD 1RJCA 4ONOA 1U2HA 3MFFB 5DK2B 4XP4H 1B2WL 5F1SA 2WQRA 2VXQL 4GW1B 1I9JH 1QBLH 4MD5A 4AEIH 2WWMD 4XCFL 3CFKB 5J06A 1MWAA 2PTUA 5I1AA 4L8SB 32C2B 4PJXF 3ARZA 1U8IB 3DI3B 3MRHA 1LK2A 3CSYB 1FRGH 4WHCA 3BPLB 3UJIL 5FECB 2NTFB 2N4IA 1I3RB 3OAUH 5F97E 1XF2A 2P24B 4X6CB 2EICA 5JIPA 1T0NB 5IMMB 3OKEA 1CFNB 4WEBH 3ZKMD 3TN0B 5IHLB 3DX9B 3OZ9H 4X7TB 4DW2L 3OAZH 3H9HA 3QNZA 4PGBA 5D7IA 5DVOA 3VFWB 5GGRA 1JUFB 1NUGA 2AXHA 4QOKB 3L9RA 1P2CA 3UJTL 2H26B 4YHOH 1RJYB 1ZT4A 4KK8D 1ZLWH 3ULUD 3C60C 5C3TA 4FQIL 1CI5A 3QRGH 2IANB 3QQ9D 3ZKXB 1JPSH 3CX2A 4HWZB 3DJ9A 4LLVA 1HNGA 1NCAH 2CSPA 2ICEB 3KPQB 4LP4A 2RQ8A 2GTZB 3HNSH 4JO4L 2F5BL 1JK8B 3CH1B 4KVCL 4P5TC 1ORQA 4H25A 3W9EA 4HJGA 4D0CA 2HTLD 3DRTB 1T0MA 4JDTH 1A7NH 5DQ9A 3TBWA 3K7UA 3SDYL 1DQLL 1QA9B 4XCYB 1OTTC 4N90D 2X1OA 1WCBA 1IC1A 3ILQD 3QJFA 4WUUD 2E7LA 5EPMA 4MD4A 3BD5A 3T8XA 1JPTH 5F3HA 1Q1JH 1T5XB 4P48A 3C08H 4P4KC 4OAWB 4U0RC 1MCWM 4G8IB 4MCZB 1NLBL 4D9RD 4NKOA 3UYRL 1XGQB 3MOQA 3GZKA 4HWNA 5IQ9A 4UIKH 3ARVA 2QBWA 1GYAA 4EN3A 4M4PA 5I66B 5HI4C 4ZOCA 5MEND 1KIPB 5JUEH 5E8PA 3EOYG 3PWUB 3ECBA 1WT5A 4KMTH 2EDDA 1X4ZA 5ACLA 3P4MB 4Q6IA 4LDOB 1CD1B 4OI7A 2A6IB 4J3VA 4LCCB 3LS4H 4P4KB 3QULB 4GXVH 4GRMA 2NXZB 1F6AA 4KROC 4O4YL 1D5ZA 1I7RB 4PGDA 5KVGH 3AREC 5GJTL 4MS8C 1N26A 4MA8H 3MGOA 4HCRA 5HY9A 3FB6A 3RWGA 5DRWB 4MX7A 3GNML 4L5FH 5F3BA 4PJXE 5JQHC 3MBEB 4LEXL 1WBXA 3PABA 1FYHB 1EBAA 4IDJH 1R3LB 5BZDA 1KTDA 3L95B 1MNUH 5D2NC 4PRHE 5DEGA 2JJTA 5F9DC 5I15L 3QI9C 4M4RA 3WIHA 1FYTB 4XPBL 5L9DH 4WGWB 1KXTB 3L3KA 4LASL 3QIWB 4JFDE 3HS0B 1TVBB 4RGNE 2V7NA 2GYSA 3BWUC 1RUAL 1CLZH 5CEXA 1BZ7A 2JIXA 3EGSB 4EBQL 3TCLB 3HFML 4LF3A 4OGXH 3ZKNC 1URLA 3LKSA 4LSUH 5JNYB 2PXYD 1IAIL 2XZCH 4Z95L 4MJIE 3I02B 4PGCB 4CRPA 5E1AA 3IFNH 5TE6L 1BVKA 3P4OA 5L8LB 5ETUB 3FHAA 4ZUWB 1GH7A 1RIHH 2PYEE 1B3JA 1U8MA 3MJ7A 4G3YL 2OLDA 5TDOB 1ND0B 1HOCB 1A6VL 1MFBL 43CAA 3CPLB 1QR1A 3X3GL 2NY0B 3O6KH 1A1OA 2R56L 2MMXA 3LQZB 4L9LC 1MY7A 4OB5L 5CKGA 3EJJX 2AEWA 3CNKA 2BDNH 1U8PB 3MLYL 4KJYA 2FB4L 1PEWA 2MQCA 3CVIH 1NBYB 1F90L 5EC1A 1OAQH 3QWOA 3Q6GH 2A9ML 2A1WL 2EC9T 3I75A 1A6ZA 1MCSA 2WIIA 4OD2B 4PJ5D 3VXTB 4PJHB 2Z91A 5SX5K 4R2GB 3VFNB 5DD3L 2VXVL 1ZLUK 4NBXB 3B6SA 3V4VH 3FRPG 4DOHB 4NYLB 3MNZB 1WZKA 1QPPA 4ODXB 1RZ8B 3QFJE 4GXUN 3U4EA 1IC5L 4PJCA 2Z8WC 2C9AA 3UPCA 2P5WB 3T0DA 4ODVL 3UO1H 2V17H 2ZNXA 3O3BA 4G6AC 3WD5L 1N4XH 1Z2KA 3U4AA 2RCSH 1GIGL 4XNQA 1B90A 2NYYC 3ZDXF 5DSCB 2BY1A 4Q9QH 2ORBH 1UB6A 5BS0B 4LAQH 3HG1B 4UTAL 4WTZA 2R2CA 1NDMA 3CD4A 5F1NA 3GHBL 3BEWA 1SJXA 1MIML 1CGSL 3LN5B 2JCCB 1OTUC 2VLKA 1Y0LB 1AD0B 5CBAA 2GTWA 3O9WD 2YUXA 4KC3B 1BFVL 2EDTA 2Q76B 2VNCA 4NZTH 4M5YL 2AERT 5IR1A 5AZ2H 1DANU 1HNFA 1ACYL 4ZS6D 2Z0BA 4KAQH 3V4PL 1HHIA 1T1ZA 1PW3A 4PJ9A 5T1MA 5CHNA 2LE9A 4X7DC 4HJ0C 3FN9A 3QJHA 3NACH 3CFBA 4QHUA 3DV6B 4G7VL 4LGSB 1RULH 1S9YB 2E7BA 2EE3A 3TBVA 2VZVA 4LSSH 5DRNB 2UUDH 4PJAA 4JAMA 3W0WD 1X44A 3MJ9L 1W0YT 1BJMA 3QXUA 5CUSL 4UDUB 1F4YH 1MJUL 2K9UA 3T2OA 3MSPA 4MQTB 4E41A 4K9EH 4Z0XB 3HNTL 4DGVH 3QBTB 4I77H 4KKLD 4XTRC 1PDKA 3KNBA 1U91A 4DCQA 2R9HC 1U95B 1KEML 1J8HB 1I1AA 3HTLX 1N5YL 4PJ7F 5E2UL 1TLKA 3VFPA 1QBMH 1IAII 1K6QH 4P2QB 4AIZA 3C8DA 3G6DL 4YDLB 2RFXA 4UV7L 4POYA 5C0CE 3FFCB 4L8CB 3TV3L 1FG2B 4U1LB 5SWSB 1XGUA 5IMOA 3MV11 5C07B 5E99H 1YJDH 5ISZB 3CAFA 2ZCLL 1KULA 1KYOK 5FIEA 1SMAA 3RIAK 3INUL 1L7IH 3FRUA 4LPWA 5EBWB 5K9KA 5KW9H 3O0RH 1Q9WB 3S35X 4NRYA 4Y19B 4PBWD 2APXA 4Y4HD 4BFEA 3ZDXE 4YBLB 5EWIH 4WFGD 4G8EA 3TESA 3EO1B 2BNQE 2IQ9L 5FOBA 3TFKD 1AXSB 1AGFA 1EZVX 2VDNH 4ODTH 3SN6N 4Q9CA 1H3TA 2ZP0T 1HHJA 1KPRA 2EDNA 3MRIB 5HYJB 1ZSDB 3O4LE 4JZJC 5DLML 3GGWB 1SYVA 4WVRA 3ARWA 4LSRH 7FABL 4K3GA 3BZEA 1SEQH 5T1KA 1DQJA 3MV01 4XC3L 1N64H 3RUGF 5FA3B 3ARBD 1V05A 3RVWC 5IUSA 1NH6A 2CXGA 3GSXB 5KSUB 3RVVC 3HI1A 4K3JL 5T5FH 3MUJA 5TFSH 1Q9OA 4NWUH 1R3KA 2VDRH 4YGVA 2Z92B 12E8L 1MFAH 3REWB 4HWEL 3VG9C 5IG7B 1NGWA 1GZQA 3NFSH 5L88L 1C1EL 4P57B 3T0ED 1NCWL 2AJSL 3KJ6L 4M03A 3GJFB 3MRDA 1HHHB 5JHDE 5J12B 3UTSB 2WINA 3ZE2F 3HRZB 4KJPC 2UZYB 2QQNL 1CVSC 4YR6A 4X6FB 3UMTA 2HA1A 3HNVL 4HKZB 2NY5L 2J8OA 2OTUA 4J23A 4XHQA 3BSZL 4P9HH 2FEEI 3AROA 4U3XA 5CBEA 5CJ8A 3BKCL 1FZOA 3VXSE 4NRXB 3SKMB 1S9WA 1A0QL 2AW2A 2RGSA 4Y16C 3K74B 2CJUH 2OP4H 3B5TA 4H88H 4O5LH 4PJ7E 2OS7A 3RWDB 4AQ1B 1T1WB 3OGOE 1P7KB 1CFQB 1T7VA 5E7BA 2QL1A 2F54A 4YHPA 5SX5H 2F8XC 2JB5L 3BH8A 4FG6C 4O51A 4MZ2A 1FP5A 4Q7DA 4EI5D 1ZGLB 3CUPB 1J18A 1TQCC 2DQEL 1KPVA 1ZWIB 3IAPA 5LCVH 3MO1B 3BJ91 5IF0B 4P46A 1AGBA 4P23C 3DGGB 3VGAC 1NCCH 5BCAA 1IAOA 3L6FA 4I3SH 3ZTJH 1A7RH 2BRRH 3X13B 5C2BL 1XGTA 3FOLA 3KDMB 4X8JA 3PXJA 1R5WA 3WSQH 5D1ZD 4WUUA 1CGUA 1RUMH 4F7MB 2P8MB 1ERNA 4PB0L 2ADIA 1MOEA 4FMKA 1GCFA 3LS5H 1O5DT 3SPVA 1YZZA 2ADGA 2OBGA 5DJXA 1FGNH 4BKLA 4IIQB 1DBAH 4J1UB 2C7UB 5AZEH 3KLHC 4NT6B 2O61B 3RUGE 5IMKB 1ADQL 1P1ZB 3SDDA 5GJSH 1S5IH 3VGAB 2AS5M 1RJLA 1A6UL 4QRPB 3T3PF 4OBRA 5MENA 2OSLB 3HMWL 3M17B 1KN4H 4FP8H 3MX0A 4MMXC 4ELMA 4L8BB 4XAWL 2A77L 3I2CH 1RZ7L 2A74B 4FXGA 4V2CB 3OKLB 4XXDA 3O3EA 3V0WH 1U8QB 4QRQB 3VGHA 4I2XE 1KB5H 2AK4B 2P47B 5D7JD 4DZ8A 1A22B 2BVQB 3NAAH 3ZE2E 5I1AB 2ZOKA 1AXTL 2Y4SA 3H9SD 1BAFH 1LK2B 4RFEA 4TNVK 4C58B 4EJ1C 4LMQE 3RWJB 1NGQH 2YA1A 1KELH 5T1DH 3AS3A 4XGZA 3TO2B 4CW1A 4KVNH 5IEKB 4YPJA 1FVDB 5HJ3A 4L8DA 1CIUA 3QFDA 2R29H 1BQSA 2C1PA 1ZA6A 1YEEL 5CEYA 5D72H 5DHVA 4PGBB 4MQ7A 4JQIL 5HPOA 4UU9A 1WEJH 5EBMB 1ZXQA 5IHBA 1CDIA 1H3UA 3L9RB 1P2CB 2KH2B 4P2CG 1DQMH 1PKQE 2EDOA 4BJLA 2HT4C 1JFQL 2XT1B 4OUUB 2E7LC 3K46A 4OZHF 2ARJA 2PXYA 5DJ8B 4ZFGL 4WFGE 4IRSD 2VITB 5DJYA 4M02A 4DZBB 3C8HA 5I8OH 4JFFE 4YDKH 2E7CA 3HE6D 1I1YA 5IW6A 4UDTA 2F9BT 1HSBA 3NPZB 4KUCF 5FUZL 5E2VL 5EZIH 4EN3C 4OT1H 1NBVL 2DF3A 1BGXL 1UA6L 4DAGL 4WV1B 5FYLL 1SY6A 3CDFA 1WT5C 1S7VA 3QJFB 5I1LA 1W0VB 2DQGL 4MD4B 4WFEE 4IJ3B 4Q6IC 2CDGA 4UB0L 3F5WA 4YWGL 1PFCA 4OCRL 1FLRH 5C08B 5AUMA 3DECA 3IYLW 5J1TC 2DTMH 2VIRB 2KDGA 1U93A 4XPHH 1K4CB 3UTOA 4PJ5A 2JJUA 1I8IB 3FN0H 3VRJB 2ZOLB 4EN3B 3I3DA 3SE3A 5EO1B 1DSFH 1HYSC 5FYJE 3W81A 1Y18A 5D2LF 3DMMD 4XNYL 4JHZA 1NLDL 2Q3ZA 3T3PE 2DM2A 2JJTC 3ECBB 1KGCE 4YDIL 4C59B 3EO9L 2P44B 4LNVA 2SEBB 4OM0H 4HIHA 4OM1H 4HPYL 4W6XB 3CFDA 5HHMD 5T3ZD 3MC0A 2D7QA 1LD9A 4FQLL 4JCMA 1W8NA 2FJHA 4LNRB 4F57L 3MGOB 2IPUG 2ITDB 1DEEB 5LWYH 1OAUH 5F3BB 1WBXB 4C57C 4KRPD 5DO2C 3DETD 4H1LA 4KDVA 5EUKA 3BPNC 3RTQB 2B1AL 4QTIH 1C5DA 1NAMB 4PJDA 5D5MA 3QG6A 1KCKA 5IB1A 4O2FB 4EUPA 5DMYA 3L3HA 2BY3A 4GAJH 4Q58C 1KBGH 1N7MH 4GKSB 4XPTL 3QR2A 5HSFA 3LCYA 2F53E 4NQUA 4O2CA 5JPMB 1N0LA 2VRAA 4WW2F 2UZIL 2R4RL 3W2DH 5DJAA 1P7QD 4TUJB 3DYMA 4FQ1H 5EFIA 5AYQA 2QQLL 5FO7A 3TT1L 2P8PB 5J89A 1F58H 3P4NA 4P59H 5JMRA 3VA6A 1YQVL 3I9GL 4OZHE 4GKNB 2XN9B 1IC4L 2HT3C 2FO4B 3TM6A 2OTWA 2CLZB 3HZVB 5TE7L 1QYGL 4Y4KD 4F2MB 5D4QA 5DRZB 1YYLL 4PJBB 4OTXH 4TQEL 4XCFH 4M6NL 4BM7A 3B2UC 3I50H 3DUSB 3BKJH 4O9HL 3W0WA 1QRNE 3RBGA 1WZMA 5ID0B 1CFSA 4LKXA 4NCC2 3QIBD 1NGYA 4BK4A 4NZRH 2AV7A 3BOVA 3W9DA 4I4WA 1A7BA 1CCZA 3QQNA 1FPTH 3ULVC 5GS0C 1KG0A 5GS3A 3SJVD 1A6ZB 3NGBC 4UV4L 4XPAH 4NO3B 2X09A 1HCFX 1NDGA 3CXHJ 3B43A 3RWIB 4W68A 4FQ2H 2OM5A 3LEYL 4G8GD 1YEFL 2WUCL 4FQIH 5D2LE 1QO3B 3BP7A 3P73A 1K4DA 3JTTB 3N9GH 3RZCB 3U4BH 3DURA 5ACMA 2CGRL 3EFFA 2EC9U 1UACL 3I6KA 1F42A 4UQ2A 2FJGB 3SGEH 4WO4B 1NANH 4OCWL 5DRXA 2GEEA 1MHCA 2XTJE 4XHJD 2BJMH 5ICYB 2ARJQ 1MFEL 2NXYD 2BX5A 3SDYH 1DQLH 1U2CA 4PJ9C 1QNZH 4Y4HA 2B4CH 3D0VB 3BEWB 3MV7E 3PWPD 3E8UL 3U9PL 5DJDB 5D1XD 3JV4B 1HHKA 1KENL 1HEZA 4HIJA 2FEDD 4JKWA 2YA2A 1ONQB 3WO3B 2VOTA 3P3YA 5A2KH 3VU2A 2VLKB 3R0MA 1BZ9A 1G7QB 1JTOA 1VSCA 2FATH 1RK0B 4HUWA 4WFHD 3OHXB 4JFYA 4NQTA 3MXVL 1S9VB 3UYRH 3MRQB 1FBIH 2Y7QA 3U0WH 4ZOBA 1KCRL 4PTUA 1HWGB 1L0QA 1U3HA 2ICWB 4OCNC 3ARBA 3KVQA 4PJ9B 3IDYC 1I3GH 3A6CH 1MJJA 5EN2B 1CICD 1S9XA 5D9SB 3NH7L 3FFDA 3X11A 4E5XB 4DKFL 1X5JA 2VISB 2ZUSA 4L4TD 3HPJA 3S3JA 1I1AC 3T0EA 4U1GB 2IFFL 3FB7B 5KSVA 1P53A 4MB3A 1YEDB 3IDIB 4JAMB 3PP4H 1FJ1B 4MA7H 2AEIT 4G6JL 4QLRA 5HYSA 5TDPA 3UAJD 3ARFD 1S8DB 5C7XH 4MAUH 5EO9A 3SGDH 3B9AA 1QKZL 4PBVC 4R7NA 5JR1H 4LCWE 2FIRT 4JZOB 4FXKA 4XNMB 5JOEA 3EDJA 3DX6A 4TVSa 3OX8B 1IEAB 2XTLA 1EMTH 3ESVF 2KPNA 5DZLA 1MRCH 4J12A 3NN8A 4JE4B 5IBUG 2AABH 2HN7A 2X4UB 3PL6D 2V2WB 1ZHLB 3LSOA 5GGUB 5H94B 5T3ZE 4NO0D 4AIZB 4Z95H 4HK3N 4PRHB 3IRZA 1KN2L 3DYPA 5TE6H 4NN7B 3G5XA 3U6RA 3PE9A 5CD5C 3PWNB 2EEDA 2W65B 4JFOB 3EHBD 4JFDB 4FZEH 2EE9A 4RGNB 5F9AC 3KPSD 2AI0H 5E2JA 1RURH 3LKRB 4ZS7H 1OTSC 2HFTA 5IESH 1RUQL 4NRYB 1UYWH 4HIXL 5GRXG 3V6FA 4RRPG 4MJIB 2XKSA 3TJEL 4QWWC 5TE4H 2R69L 2PYEB 1J11A 3KPOA 4U7MA 3EYVB 4NQEE 5DMGD 2I07A 1FVCA 2R1YB 1T2XA 1F90H 4MDJB 1U3ZA 4KI5C 1HI6B 3QZWG 5C0GB 4PRPE 1WBZB 5D1ZA 4OKVA 3EDEA 3DV4B 1MFDH 3RPKA 5E00A 1IQDA 1LE5B 3IDMB 2F15A 5IEHA 1K5NB 4BQBA 1QTYT 1QR4A 3N1QC 4TSBH 3OKDB 2IBZX 2GW5A 5BZWA 2B5IB 3LAFA 1JWSB 1U36A 2I60L 1HINL 2VXVH 4UIMA 5HGAA 5DXWA 4KDWA 2GT9A 3MA7A 4YGVB 3F7QA 1TQBC 3V4UL 1CXEA 1KC5H 4PV9B 1NGWB 4D3CL 1B88A 4DK3A 1SM3H 3VGBA 3QEQE 1BOGB 4APQB 4ZUSA 1MI5D 3PIQA 4ZO7A 5IHZA 3IDJB 3MRDB 5JLZA 1JIBA 4X7SL 4NWTH 2EH7L 3HAEB 5A2FA 1TTUA 1QVOB 1T80A 3O2WL 2BSTB 4TPRL 1FO0B 3WNMA 5D7JA 3BWAA 1VFOA 1OL0A 4TOYL 3ULUC 3H9SA 2RIKA 2OTUB 5EA0H 4B50A 3QQ9C 3I3BA 4I48A 3RL1B 5CBEB 3ZYIA 5HGBA 1EVUA 1QFUH 2IPKA 3BO8B 3VG0L 3ARDD 4PGEA 4KZDH 5CJXA 5CAYB 3V6OE 3JXAA 4JFHD 2O5XH 3L1OL 3X14A 1WFTA 4PREA 4P46C 1U58A 3C5JB 3V6BR 2HTLC 2ZUQB 1V7NL 3ARUA 1CU4L 3P0YL 4WU5A 2H9GA 4FQJL 4JANA 4HEPG 3K1DA 4HBQA 1W8OA 3ILQC 2H1PH 3EYFA 1OHQA 4JGJA 4YXHH 2NY4B 1JZ7A 3GSQA 3QIUB 3K2UH 4OSUL 2H2SC 4PG2A 3MJ9H 3PJSA 3SDDC 2R2EA 4LLWA 1VACB 1EAPB 5DHYA 3A67H 4HULB 3RKDD 2N56A 4PS4L 3O8XB 1O0VA 1MAML 3BP4A 3CLEL 2CK0H 3OR6A 5BVPH 2VWEC 1SEBA 4CVXB 5EZLB 3VXNA 4UNTA 43C9B 5MHSD 2ZCHL 3LY6A 1NC2D 4IRJD 1RZKC 5F9WB 3V95A 4NIKB 4KU1A 1ZVSB 4JKKA 4N1CA 3NABH 3F7VB 4XP1L 1MVFA 5KSAB 1I1FA 3HRPA 5TJWK 3VFTA 1IKFH 5GSVA 1ULVA 3DMMA 1D5MA 4HQQH 4JFZH 4OIAA 4RFNC 4XMLH 1JI2A 2OQJB 5HYFA 2WUBH 2BNRE 3QG7H 4MA1C 3HI5H 1VFBB 5EULV 3S5LA 1OQOA 1XIWB 1ZVHA 2B0SL 1D6VL 3KLDA 3RWHB 5MEOB 4HWBH 5I8CB 1IGYA 2WMPA 3QA3A 1NEUA 5DUML 5C0CB 2IQ9H 3ARGD 3RNKA 1LEGA 3MCG1 2H2PD 2IPTH 1YY8A 1DTUA 5CGMA 3DROA 4FNLH 1LQSR 3UROR 2PW1B 5B39G 1H0DB 2C1PB 2CLRA 4JM2D 1MCPH 1MVUA 4MA3A 1TVHA 1QSZA 1KF9B 2K7QA 7FABH 1RMFH 3U46A 5JOPD 4NQXB 1EFXD 4POZC 1JN6B 3HE7B 1E6OL 3OKMB 1LNUA 4NRZB 2VLMD 1CL7L 4XC3H 4FQCH 5C0AD 5IIEA 1CLYL 2JJSA 2BNQB 4K3JH 1ITCA 5GZOD 5CIPB 1KLUA 1P7QA 2EXYD 2PXYB 3VWKD 4NKIH 3QO0B 4D2NA 3O4LB 5DWUL 4LSPH 5FHAH 4JY4B 2FIKB 1WTGT 2YD6A 2ZG1A 5L2KD 4UDTB 4Y4KA 1I9EA 1IM9D 3VJ6B 5BRZD 5F89B 4A2MA 3ILPA 1OARH 3SE3C 2HFEA 2YRZA 3ULSB 4GRWF 3PHOB 2A9NL 2GSIB 4S2SA 4TSCH 3ALXA 3IJYA 3EFDL 3TIEA 2VAJA 3QIBA 3F5WB 4A6YB 4GBXA 1CLCA 5C0IB 4NM8H 3NPSC 4H0GA 1PY9A 1XFPA 5MP6L 3SO5A 5JHDB 1SJEB 3F7YB 5I71C 4X98A 1G7PB 3AB0B 3SJVA 3CGTA 3RDTD 3DRQA 4YHLL 5E95B 4PJ5B 3SE8H 8CGTA 1WZ1L 4GW5B 3MTRA 1EHXA 1OAKH 4Y5YA 4RGMB 3GSNL 4NNYB 4Z9KB 2E7HA 4G8GA 4Z5RA 2Z31D 3BVNA 4LPUA 3QEHB 3VXSB 3PGFL 4G8FA 3TP4A 3VFGL 3LKQA 5CD3A 4WDIB 4J7RA 5DK0B 4PJ7B 1LD9B 5I71B 4WU7A 3MLPA 2FJHB 5K9OA 1J05A 2CKBL 5FYJH 1CT8B 4HZLA 3GK8H 5CJBA 5DJZA 4AK1A 4XVUD 1GC1C 1V8HA 3O6FA 4H1LB 4ZS6C 4D9LH 4K7FB 3IFPA 4MCYA 1OY3B 1YYMH 2CDEA 3PWPA 2JTDA 5D1XA 2W59A 3W11D 2EDBA 4PB0H 3JWDH 1H8OA 2ATKB 2G9HA 4RDQF 4X9HA 4M8QA 3IFOB 2DQDH 3O9WB 4S1SH 5SWZD 3OPZL 2XFXB 3S3PA 4N0FA 1X5FA 3W5NA 4LRIA 1X5LA 5L7XL 4JLRA 3SKOA 1TZIA 1TCMA 4QF1B 4JHWH 2A2QT 3CX5K 3QH3B 5KVDL 5EC2B 3TPKA 3R06A 2OK0H 1P4LA 4KKLC 1CICA 3ZE1F 1KB5A 2WWKO 2OTWB 4DK6A 1WSST 3WCYA 2BVYA 4L4TA 3F7PC 1BREA 3BZ4A 3QEUA 5GRUH 2MCPL 3RUGB 5JOFA 5CZXD 2P8LA 4DN3L 1YUHB 3FONA 2R0KL 4OZFG 2YZ1A 1NGPL 4GRWE 3KPRE 4I9WE 3AXLB 3C87A 4GW4B 5JORB 1IAMA 3ARFA 1KCSL 4QRSB 4YC2B 5DC0A 3P11L 4QHKI 4RNRA 4HUVB 3S96B 4I2XB 1YEEH 2WBKA 1D7FA 3HKFA 2BSSA 1KG0B 1MJ7L 1N3NB 4X83A 3WE6B 3U9UA 5EIVA 3BPCB 4G9FE 4BFGA 5HTSA 2Q87A 1K85A 4S1QL 4PP1C 3FHQA 4D8PA 1NDGB 5KN5A 4N68A 4Y4HC 3RZWA 3V2AR 3S36L 3PL6A 1PYWB 2BSED 1UWGL 4QHNB 5BXFA 4HJJL 4NO0A 3J7HA 2D31A 5DDHB 2IAMD 5ICZA 5B22A 3VXOA 3DTXB 3GBML 2Y06H 3GSOA 1IARB 2CO6B 1OLZA 1N59B 2XZZA 4GG6F 5ILTL 4Z78A 2D03L 5I1DB 1S7XB 1BBDL 3D9AL 3N1MC 5DRXB 3TT3H 1AO7D 1PKQB 3KPSA 1R3HA 2GJ6E 2LTQB 1TJIL 1NBVH 1U3HC 4ZQKA 5FUCC 3MRCB 1P84K 2MNUA 4XCNB 3MV9D 5DUBA 3ARBC 1ETZA 2KZ1B 5JOPE 1JHKL 5GIRA 4MNQE 4YO0B 3LZFL 3WFDH 3RJQB 2BZDA 1FL5B 1ES0B 2RAMA 4PG9B 3G6JF 4JJ5B 1GPOH 5C0AE 5LQBH 5TGBA 1JF1A 4ORGB 4P4RB 4JFFB 2D7NA 1A6AB 2A6KA 4FMFA 4HGWB 4JDVA 3T0EC 2FL5A 5D7KD 4JY6A 5DQDL 3LEXB 4MNGE 5HD8D 5E4EC 4PTUB 1UB5B 1DL7H 3G5VA 1T5WA 3T1FA 5H35A 4JO3H 3UTZB 2GCYA 4LCUA 3WFBL 4J3WA 5ERWA 1OF2B 4G6MH 3V79C 3HI6L 3QXVA 4WHDA 5SX4I 4W4NA 1JVKA 3ZE1E 4ISVB 1U8HA 2HJFA 1UH4A 2CH8A 4F7TA 5ACZB 1JZ2A 1VPOH 5D93C 4GS7C 3QT2A 1P6AB 4UUJB 3D69A 5FM4A 3NCCB 5IKCB 1MI5A 1OW0A 3T4AB 5IMLB 1NFIA 1TITA 1WWCA 1NEZG 4IOFC 3WUWB 5TDPB 4N1EA 2A6JA 5HYSB 3QWRD 2VUYA 1A7QL 2C1OA 3JWOH 4V2BA 1S7QB 1YY9C 3GSUB 5EO9B 3E0GA 1KJVA 4AJ0A 4R7NB 1A2YA 5EZOL 2MTPA 5GGRY 3LD8C 3D25B 4FXKB 2ESVE 1OAXL 4F8TA 2AJXH 4JN2B 3D85D 1H3PL 1PD6A 2X7LB 4M93C 5EZJB 1HKLH 2GAZA 3HR5A 4XPTH 1OLLA 2G5RA 4N8VG 2QR0A 1FNHA 4LHUD 4WTZG 5DD6A 5EOQL 2UZIH 2WP3T 4C56E 2QQLH 3TO4B 2X70A 5C9KA 4Z7UA 1JGLL 3RVTD 5IB5B 3SGKA 1SVZA 5GGVH 1IC4H 1L7TH 5EBLB 5D1ZC 3QUMH 4U33A 2ZCKH 1KJ2H 1KUMA 1QYGH 3WIHL 4YXKH 4GG6E 2OX5A 4EI5B 2F53B 2PR4H 5CGTA 4K55A 2NTSP 4DGIL 4NUGH 1QSFD 2IQAB 4O58L 5ICXB 1EEQA 2JELL 5IM7A 3MRLB 4LFHG 5JHLH 4HLZH 5CWSA 1NFDE 5J6GB 4OGYL 4OZHB 1CGYA 2HFFB 1IE5A 4GLRI 1DLFL 1YN7A 2PUQT 4M7JL 3L5XH 5GSRA 3G6JE 2ZJSH 4PJEE 4KUZH 2BP3A 5ITFA 1YN6A 5EUOA 1TCRA 4RMWA 2IG2L 3MXWL 1U8NA 4YNYA 1R3IL 3O11B 4M43H 5ID1A 1ZT7B 5DJ2A 4NC1E 5LKNA 1QRNB 2V6HA 3MRFA 3P2TA 4IRJA 5D7JC 5I19H 3V8OA 4YHZH 1OD9A 2AJZA 5F9JA 5I0ZA 4GRLD 4UIMB 3BPOB 5KS9A 2GT9B 1GGCH 2NX5E 1U92B 3CMOH 5I8EA 1T03H 4YLQT 2VLLA 2KZWA 3FQRB 5IT2H 5KANG 5CJXC 3SO3C 3EOTL 4YAQA 5EIQA 5I9QB 2FGZA 2YPLD 3PV7A 5IHZB 2R1XA 1CR9L 2VL5A 1QFOA 1VHPA 5IVOA 1A9EB 4K3DH 4R96A 3TBSB 1RU9H 1HE7A 4ODSL 2Y25A 3WN5B 1UEYA 4HS3B 3E6HA 3CZFB 3S37H 3MLZL 3FT2B 2NY6C 1IVLA 1KENH 1BBJB 1LO3L 3G08A 1EEYA 4RMRA 2YC1A 3PWLB 3SDXA 5CILH 3GIVB 3ARGA 2CIKB 2V2XB 4I48B 3S3SA 4LKCB 4PJ8D 2IPKB 1BD2E 2AXGA 3Q3GA 4OZ4A 1S7WA 2XTJB 5HDQL 1G7HA 3RRQA 1A14H 3ULVL 1KB9J 4JM2A 3QPQC 4PG2C 5GS0L 3LIZH 4K9EC 1XH3A 3WS6A 3G9AB 1YNLH 3EOBA 2VLRE 5IB4A 3SQOL 2EE2A 5JO5A 1OGTA 4NO5B 2H9GB 3FT3A 3WS3A 3RGVB 3Q5YA 3BJLA 3NH7H 2NNAB 5BJTB 1MCRA 3TNNB 3VWKA 1KEGH 1DLHA 1VDGA 3CFCL 2C26A 4OF6A 3MYJA 2MQ3A 4IRSB 4AQOA 3DSFL 4DEPC 3KWWB 5ADOL 1FV1B 3O41B 3HE6B 4FZ8H 1R0AL 1XF4B 1KIRA 3C5ZB 5L2KA 4WW2B 1UKSA 2CDFB 5DI8A 5D7KE 2W91A 1DZBA 1FL6B 4LLWB 4M61B 5BRZA 3VE0A 4EI6B 5H8DA 1WIPA 5JZ7D 3NCBB 4P5MB 1YJDC 3DMMC 4HMEA 3DIFB 2KQMA 4JKPH 1KXVC 3OR6B 4P49A 3CZJA 1YPZA 2R23A 1SEBB 5ESAB 2BVPA 1WC7A 4AM0A 4PGZA 3EJYD 1CFVH 2WAHA 4XRCA 3WXWL 2QHRL 3BDYL 5D70L 1S78D 1X5HA 3U7WL 5JIHA 2NW3B 5EO0B 4YBHA 3RDTA 2HFGH 5FYJU 4I3RL 1I7ZB 4KRPC 5JQ6H 4LCWB 3FZUD 4F58L 4Z77B 5I18L 1KOAA 5JPNA 2Z31A 4NJ9L 4TUOB 3WHE1 1Z0NA 2OTPA 2COQA 3U79A 2D7TL 3ABZA 1NMCB 4QHKJ 3WMSA 1Q9KA 1G6RH 4M48L 1X5KA 2JJSC 4BZ2L 2DLFL 3RL2B 4FTVE 3WFEL 4TVPL 3MFGB 1FE8H 1G6VK 4NOBA 3U0TB 3BX7C 4CDGC 2D3VA 1NCBH 5A43C 3LB6D 5KG9A 1RZGB 3QDJA 4JFPA 4XPFL 3MLUL 1PY4A 2CLRB 1T2QL 3BGFB 4H20L 4PV8A 2E9BA 1TVHB 4DFHA 4Y4KC 4HV8B 3JTSA 3LKPA 3U46B 3MRPB 3NA9H 2FDBP 1AGCA 2Y07H 5IB3A 3I6LD 2GUOB 3D87B 4MNHB 4P9HC 3CU1A 5SWZA 1PZ5A 1M6OB 1NBZA 1CBVH 5D1QD 1P7QB 4HH8A 4UT7L 1DVFD 3OXRB 3VI4F 4CMMB 3V4UH 1JGVL 4PRPB 4GBXC 3MV8D 3IDGA 2Q8BL 1IQWH 4WI8A 3VXQB 2A0LD 4D0DB 4ZYKA 2F8VA 5DR5H 5HI5D 5FB8B 4X99B 3FO2A 4UTBH 5F9OL 4X7SH 5CJOH 1G7JB 4HSQA 3W39A 4J3XA 1XGRA 3BN9D 4FXLA 4Y5YC 1OOAA 1CGTA 5MERB 3LQMA 4PJFF 1JF5A 2V2TA 4XP5H 4S2SB 3HZKB 5GGSA 3IF1B 5DURD 3QEQB 5E9DD 5I73B 3QIBB 3VD9A 5EBGA 3VG0H 4QXWA 3WFZA 4NQSB 4M1GH 1LO2L 3SCMD 4Z7NF 2HH0L 4ZSOA 3ZL4H 2DI7A 1B0WA 1AY1L 4JFQA 4XHJC 4ZFOA 1FZJB 4FQXB 2YPLE 4LLYA 5CJ5A 3NCFB 2PNDA 3O6FC 1LHZA 2NXYC 4WUKL 5DK3A 3BUTA 1KACB 1RHFA 4X4YA 3L3IB 1T04A 2YPKA 5L2JA 4ODWB 5F7YC 1T7ZA 5D1XC 2VJXA 2FEDC 4L1DA 1MIEL 4FQQA 5I1KH 4OGAD 3LKQB 3QCTL 3I6GA 3MJ9A 1K8IB 4YIQA 5IVXF 4FFZL 1GJIA 1PG7L 2Q7YA 3CC5A 5F7MC 3ZHLA 5E7FA 4DGYL 2YSSA 4U1SA 4LRIC 5FYKH 1AO7A 2ZUXA 2D2OA 3EYSH 4NP4L 2ICWI 4I0PA 4NNXB 4FFWD 4YHYC 3MLTA 5F6IC 3MV9A 2DL2A 1G7MA 4MCYB 2KBGA 2GKIA 3QNYB 4NQVA 5FUOL 4ETYA 3CLEH 3FTGA 2W0KA 2Z93B 5H37G 4PRNB 1UM5H 1CDYA 3T2NH 1J88A 1TETL 1F00I 2ADJA 5DMKA 4PUBL 1U3YA 1IGFH 5BVJA 2X4SA 3HC4H 1AHWA 1CXKA 4TTDD 3SKOB 1BF2A 1KCVL 3ARFC 3KXFD 2WBJD 1QLRA 3GI9L 1UC6A 4PRAA 3R06B 3VI4E 1II4E 3NA4A 3STLA 1CICB 2NMSA 4RQQB 2DL9A 3LKOB 4U1MB 1I7UA 1YA5A 4HWBA 3QEUB 4BH8B 5I1IL 5C0FB 3GB7B 5E5MA 1EIBA 4ETQB 4MLIA 2ITCB 5L8JB 4ZFFA 4G80B 5JOFB 1YECL 3GIZH 3CFJA 3U2SB 1J0ZA 3PL6C 4S1RL 4HW6A 3BKYH 1GGBL 3GMQA 4PJIF 1ZHNA 4RGOL 5DUMH 4UMGA 5JW4N 4PJFE 2HMID 4QT5B 5F1IA 2P5ED 1HSAB 3ELAT 4ZNEA 3ARFB 3IS0X 2BNRB 4MDIB 3RA7L 2HG5B 3CDGB 3WIFA 4C4KO 3E3QE 4HS6B 4I18A 4Z7NE 4G5ZH 5HHNA 1SJHA 2X4OB 3PF2A 4AENA 1MRFH 2FD6L 4PPTA 1NCTA 1RZKL 5FYLE 1QEWA 4LHUA 1A9BB 4HDIA 4NO0B 1X5GA 1H15B 2IBBA 5TQ0H 3E2HC 2ICES 3O6LH 4LEOA 5DMGC 3QHTC 3Q1SL 3VWJB 1MH5B 4EEEA 4P5TD 1J5OL 5GRWA 4R4ND 4S10A 5DJ6B 4QY8A 3U83A 5ITBL 1F3JB 2YUVA 3BE1H 5IVXE 1NFKA 3UJJL 5E2TH 5CMAB 4KV5F 1A7PL 2QQKL 1QSFA 1IZKA 2X42A 1J1PL 1ETZB 3IXAB 3OKOA 1T20A 4LRNH 3BGMA 2A9NH 5L8KB 2A83A 3WNNA 4OUOA 3TPUA 4Z76B 4DUXA 4LU5L 1A3LH 4YDJB 4WWKC 3EFDH 1T7WA 2J3SA 4JDVB 5I1GL 2YEZB 2AQ2A 3DI2B 1BIIB 4MD0B 3CXDH 1OW0C 3GMOB 1RUKH 2DQIH 3F7RA 3HC3L 1YEKL 4L4VD 1I9IL 1TFHA 5FCSH 8FABB 5D6DA 1WZ1H 4PRDA 2EZ0D 3F58H 4HH9B 1EVTC 2BFVH 3AS0A 4LBEA 5DUPH 3VFUB 3GSNH 3L3GB 4YHNA 4ELKB 1YC7A 1SY6L 2EYRB 3BQUD 3CVHB 4GRLA 3IXTB 2DLTA 2YMXH 1DBKL 4KHTH 4IDLA 1S3KL 1G9NH 1LILA 3VFGH 2A73A 3CDCA 4MS8D 3FO9B 2G60H 4Y5VA 3D18A 5HYQA 3PGCA 5KJRL 5T33L 4WNQA 3VFOB 5IWLA 5I6XC 3RGHA 2UY6A 5CSBA 1MHEA 4GUPB 3MRJA 1AFVH 3MLXH 3MREA 4NUJA 3UTPD 1BJ8A 3QI9D 4PLJD 1S5HA 2C1OB 3SGKC 4CMHC 2VDOL 1TJGL 4WGVB 1A2YB 1BQUA 2ADFH 4LGRB 5KVFL 4E42A 5JTWA 3MRNA 2VDQH 2DIAA 2VQTA 2J7LA 4RBPK 1R5IB 5DC9B 5K9QG 2AV1A 4GKOA 4OQTL 2R0LH 4PJ8A 3TNMA 1MCDA 4U2YA 1BQLL 4RWYL 4XVTL 3ARDB 5MI0C 3GRWH 1OAYH 3EDFA 2LU7A 1UGNA 2FX9L 5KSBA 2A6DB 1CXLA 3U7YL 2J8UF 1FH5H 5L7XH 5F7DA 2L4OA 3L3JB 4JZNB 1HWHB 1DUYB 2X70B 3N85H 2XZAH 1CZ8L 4NDMB 3U48A 4EDXA 2RBLA 3R8QA 3O2DH 2CPCA 4K23L 1YEJH 5KAQG 3EW3B 4YHMH 4RISH 3GMMA 5DD0L 5IK3A 4QEGA 5LGHL 4M6AA 4JR9H 2VLJE 1A6WL 2DMKA 4IRJC 4HS8L 4Z7WA 4KV5E 4B5EA 5EORL 4P2OB 4GXUM 3DX8A 4WY7H 2C4FT 1ZS8A 2MPAH 3GUTA 2IBGA 1J0YA 2XQYG 3UTQB 4HMDA 1A6PA 1FCCA 4D9QD 4HK0A 4XP4L 1M71A 5F7LB 1KCSH 1YN6B 3KS0H 5C1MB 1PVHA 4OLWH 1I9JL 2I27N 4Q97A 5HXMA 1V3MA 3AU1A 5EUOB 4S1DD 3G04A 3EIFA 4RFOL 5ANME 3QUXA 2B4CC 3B9KB 4GAFB 1C08A 3VFMA 3MRBB 5F88B 1E27A 1FRGL 1NC2B 4PTTA 4GRWB 2PO6B 5FF6A 3OAUL 2W0FA 3QDGE 3BESR 1IC7H 4NOFA 2ZSVA 1A7OH 4U1KA 2FHFA 2IANE 1KLFA 4WEBL 3DO7B 3KPMB 3OZ9L 5E2WH 2X1WL 4P3CL 2UWEA 3ARGC 3L3DB 3FO0H 1RPQA 3D3VD 2H2PC 2YXMA 4HUUA 4Y1AD 4G9FB 4YAQB 9CGTA 4LLUA 2Y36H 1BBDH 4JM2C 2G2RB 5CEZH 3FAWA 4YHOL 3WS6C 2FWOB 4XBGA 2XPGA 3ARRA 4R96B 4MAYD 5HHOD 3QRGL 1JZ8A 3DYOA 4WHTA 1JPSL 1OTUD 2P48B 1NCAL 1LO5B 4ONHA 3OXSA 2XWBA 1H3GA 3VWKC 5F71A 4I0CC 3ARGB 1XAUA 4X5WB 1S7RA 2H8PB 4NQDE 1U0QA 4YQXH 3WFHA 3U36A 1LP9A 3Q3GB 2EKSA 1T89A