3RPIA

Crystal structure of fab from 3bnc60, highly potent anti-hiv antibody
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
212
Chain Sequence
VHLSQSGAAVTKPGASVRVSCEASGYKISDHFIHWWRQAPGQGLQWVGWINPKTGQPNNPRQFQGRVSLTRQASWDFDTYSFYMDLKAVRSDDTAIYFCARQRSDFWDFDVWGSGTQVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain from highly potent anti-HIV neutralizing antibod
publication title Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 212
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rpiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rpiA01
4LQFH 3ULVE 2PETA 4QYOA 3V4VH 2CIKB 3IF1B 3QEQE 1TZHA 2AV1B 4OLYH 5I74C 2IG2H 5L0QC 1G6VK 4JRYE 3O45B 3CH8A 2D31A 1J0HA 1IARB 3RKPA 5DYOA 1LDSA 4PP2B 3FT4A 2VDML 3OHXA 1DBJL 5DR5L 1NC4B 5I30L 1RZ8B 1CLOL 2Z4QB 1MWAH 3OXSB 1CWVA 2CGRL 5BS0A 1ADQA 4XHJD 4XBPA 1WCBA 3FMGH 2BZDA 5DQ9B 1CFVL 2I07B 4S2SA 4P2RB 5F7NC 2ADFL 3SGDI 1KPUB 3K80A 2FB4L 1QSVA 4X6CE 1HHHA 5CBEA 2ID5A 5LBSL 2PO6D 4QRPB 2X4OA 3FB6B 2XACC 1SEQH 5IW1A 2GY5A 4UINH 2C1OA 3GJFH 4YFLI 2IFGA 2AJYH 1JF1B 4KVCL 4L8CA 2X42A 2BY0A 1L6XA 1T04B 3NFPA 4LVNB 4ZO6A 4RQQA 4OAWA 4M1CC 4Y16B 2CUMA 4TPRH 5F6IB 5HI4C 1MJJA 4FFVC 5IR1A 4UTAL 2PTVA 5D7LA 5E03A 2Y07L 5EFIB 4Y4FD 2YPLB 3F7VA 4BELD 2BNQA 3MXWH 3FO2A 1EX0A 4G6KH 3O2DA 5C09D 5ADPH 1RHHB 1PKQE 2HT2D 4S1QH 4K3EH 2HAZA 2WP3O 3CPLA 3PHQB 1I3UA 4KAQL 5J9PB 1INEH 4WHCA 4FTVB 3CGTA 4I3SH 3UTTD 4DEPB 2VLRD 3MLWH 3AB0B 1KXVC 5MI0C 3VFPA 4N0FB 1ZWIA 4HCRA 1PEZA 4TNWK 3CFEB 1UH2A 3SJVD 3MJ6A 5FYLD 4KJWC 2DYPA 5JXEA 3KPTA 1JGUH 4WFHD 5T3ZH 3TA3D 3BKCH 3MRNB 4OCLC 3L7EB 3L3OA 2CPCA 4L4VE 4LGRB 1U93A 5CCKL 3HRZB 1ZT7A 3I84A 3QUZB 4LP5A 3IFPB 1EO7A 3QISA 2BSRA 2VDMH 2B5IC 1DBJH 1YPZB 4Z78B 4G6ML 2PW1A 5I30H 1VEMA 1CLOH 3QXAA 5ANMA 2CGRH 2EYTA 1GJIA 1CFVH 1BF2A 3ILPB 2R0WH 4QXUL 1R0AL 3M1BB 2ADFH 4MAUL 2GJZA 4ETQA 1NEUA 4PTTB 2W1NA 4JM2F 4KXZI 5MENE 4QHUB 4D9QE 2FB4H 4M61B 3I6LD 2CRMA 2DWDB 5BOPA 2EXWC 5GZND 5JOFA 3LQZA 5LBSH 1I4FA 4YO0B 1IM9B 1DJSA 5ESVB 5FV2A 4ZFOA 5LGKA 1VKXB 5F7DB 4ZMAT 1FYTB 5DUBB 1G7QA 1KNOB 4KVCH 3B8YA 2XN9A 1NBYA 2XA3A 3BKYL 1L0QA 3T0VA 4UOW0 5GZOD 1I1AC 1CICD 3FFDA 4C57C 1T1XA 2ZCLL 4HJJL 1T7ZA 3MROA 3CD4A 2ZSWA 5DHYB 4KZDL 3HZVA 4M00A 2Y07H 4X8XA 5CIPA 2DQTL 4KKBC 1QZ1A 1XGYL 2HTKC 3IJHA 4LGSB 1P7KA 2ADJA 3UPRA 4Y7MA 2A6DB 4RFNB 3KLSA 2ZOLA 4JFFA 4CNIA 3ARFA 2QADC 1B3JA 5DUPL 3MODL 3R0MA 4H1LG 2J7LA 1S9KC 5JNYB 4P48A 4KAQH 2MQ0A 1OGAB 1EBPA 3AXLB 3NBNA 3GSVA 3VCLA 5C2BL 3TCLB 5HDOA 5DK2A 2C3GA 5AZ2L 5F7WC 3RWHB 2DAVA 1M71A 1XGRA 5FXCH 4JPIA 1I1RA 2LU3A 3T09A 3G5VA 5CCKH 5F8QC 3X11B 4CW1A 2GUOB 2YA1A 3BIAX 3HG1B 3JTTA 1P6AB 1CXHA 3O6ML 3LPGA 4LLMB 1RJLA 3FFCD 3IU4L 1LE5A 3KPLB 4QRSA 1AC0A 4G6MH 3U4EB 4C59B 5IB3A 5D1ZD 1B6UA 1D9KC 4AYFA 3TC9A 4UIMB 1R5VB 3IDNB 2XZCL 2BVOA 3S5LA 1Q8MA 4XI5C 1ZLUK 3MFFA 4QXUH 3PL6D 4MAUH 1R0AH 2VTFA 1SEBA 3GM0A 1EUUA 1D9KA 4BZ2H 3UTTE 4GKNB 1ZTXL 3P73B 3MUJA 4WV1C 1IGFL 4KK6C 3D3VA 5HVWA 4G6AD 1N5AA 1ODAA 3BAEL 3O81A 2D0GA 4LBEA 1DFBL 5FYLE 3RQ3A 3T4YB 4PJ8B 4WFHE 2E7BA 1S7VB 3ZDZE 1XGQA 1ZVSA 4ONHA 4CKVX 4LSSL 3MRHB 4DFIA 4NN7C 5IHZA 4EDXA 4O51A 4WV1A 3L3KA 1MCNA 2XXCB 4KKLD 4L1DA 3RIFF 3NPSB 3TN0A 3VI3F 2ZCLH 1JWMA 3B9DA 4HUUB 4Z7VB 3W0WD 4EOWL 3AS0A 7FABH 4Y4KD 2NPLX 3L5XL 5GRUL 2DQTH 2AEPL 5T1LA 5C0BB 1AGCB 5HHOA 1U3HD 1XGYH 4ODUB 4PJ9D 1PX4A 4ZTOL 4Y89A 2DLTA 2IADB 5DUPH 3MODH 2H1PL 3RUGB 2OL3A 3K4ZA 4Q6YA 4Q6IB 5AYQA 3D85A 1TIUA 4L5FL 4NQCB 3I6LE 1MVUB 2LV4A 1BVLB 5D2NC 1WGOA 1J7VR 3T0ED 2V9TA 1SYVA 5C2BH 2O5ZL 4H8WL 3MRRA 4IMLA 4JFPA 1AY1L 1P84J 2GHWB 4P5MA 5AZ2H 1SYSB 5E00A 3CFIC 3D0LA 5D2NA 1MHHA 1X7QB 3B9KB 5MERB 2WW8A 1BPVA 3FO1A 5I75B 1FAKT 4ZO8A 4AEHL 3ULVF 2GSGA 4AM0B 2YSSA 5ISZB 5D6DC 5IMKB 4HKXB 4EI5A 3A0OA 3O6MH 3IU4H 1AKJD 3GKZA 1K5NB 2PR4L 4FQCL 4LPYA 1UADC 5C92A 3G04A 3R8BB 5IBTL 5D6DA 4LKXA 1CGSL 4KTEL 1CBVL 3G6JE 4R7NB 3NCCB 4YUEL 4YPJA 3ARED 1X5FA 1S9WB 1M1SA 3GJFB 1KIRB 4KQ4L 5TPWL 1VB9A 3DX6A 3LN4B 1ZTXH 4PJEE 2COQA 1IGFH 4X6CF 3GKWL 4WWID 3FHAA 5J3HD 1A6ZB 3BAEH 3QBTB 1DFBH 1RK0A 2NY6D 3HC4L 5AD0B 1X4YA 2NXZC 4XXDB 4FQ1L 4I1NB 2FZ3B 4LSSH 4OZFH 1BBJB 3WO4C 5B38G 1YMMB 1JK8A 2O5YL 4PRPA 4NN6B 4NP4L 1S5HA 5B38B 3CZJA 4EJ1C 1M7XA 4DGIL 1MCLA 1EK3A 1A9BB 4TUJA 2HFGL 4EOWH 1FFNB 3D0VA 2EICA 3CSYA 3L5XH 3V4PL 1F4HA 2MNUA 1NGXB 2AEPH 3RL1B 1BEYL 1OTTD 4WDIA 4XPGL 1NDMA 1FHGA 2DM2A 5C08B 4Y2DB 2H1PH 5D7KD 5DZLA 3EOTL 4RIRA 5F9WC 3UJTL 2XZZA 3C09B 4L5FH 2MPAL 3BW9A 4PG9A 1MRDL 2LTQB 1GVIA 1NC2B 1DANU 1KCUL 2APBA 1LE9B 4IDLA 2O5ZH 2DQFB 3KLHC 1B0GB 4CMMB 3QIUC 4H8WH 3OKDA 4OGYL 1U8HA 5DJDB 3X14B 1AY1H 4JO2L 1OTSC 5DURD 3OZ9L 4MA1C 1KLUB 4Z95L 5T3XE 5J89A 3C6LB 1EHXA 1LMKA 3P9LA 2RFXB 1HE7A 2LQRA 4KKCC 2IPUG 2HFFB 2ZUTA 3QUYA 4AEHH 3QIUA 2A0LD 4L3AA 1DLHA 2AKRB 2X4TA 3KNBA 1QFUL 5CKGA 3G6DH 2P24B 4BUHA 1F2QA 3HLAA 4GG8B 3W0WE 3PP4L 3T08A 4LAJH 5JXAH 4GH7B 4WI3A 4P2CG 3QJHB 4Z77A 2PR4H 4FQCH 1MF2L 4GG6E 3FZUD 5DRXB 5AAWA 1W0WB 1JGEA 2P49B 4KJQD 4KRPB 5IBTH 4FA8A 1CGSH 4KTEH 2XA8L 1BZ7B 1CBVH 4YUEH 3TFKC 5F1SA 3TO2A 4PJFB 4GRLB 4KQ4H 1U8LA 4R97C 4YHPB 4PLOB 5TPWH 3E6FA 2VISB 5HPOA 4YWGL 3T0AA 1UEMA 3H7LA 3IGAB 5D5MB 2VXUL 4UTBL 1MJ7L 3ARGD 3GKWH 2LAAA 4UQ3A 1SM3L 2YUVA 5D96C 2BRQA 3G5ZA 5F7YC 1ADQL 3HC4H 2ADGB 4HK0B 4FQ1H 3H42L 1LD9B 2V9RA 2VNCA 3WJLA 1S8DB 2IANA 4OCRH 3MOAL 3ARBA 1C1EL 4NP4H 4WW2B 5J7CC 3VMPA 5KVFL 4DGIH 4M6ML 1F6AB 1AXSB 2HFGH 4BKLB 1I3RA 3V4PH 4PD4K 1AI1L 1BEYH 3KVQA 2Z31D 3QQ3B 5C0FA 3MGAA 4XPGH 1S7UB 5MHSD 2AJ3B 3F7YA 3GB7B 1KF9B 2QQKL 2WWKT 5E56A 4OFVA 1ZOXA 3KJ6L 3O3EA 1CF8L 3LV3B 4NKOB 3EOTH 2GAZA 3UJTH 4MDIA 3KXFD 5C9JB 2MPAH 4YK4B 1MRDH 1KCUH 4IRJB 3MRCA 5D6CA 3DVNB 1ED3A 3RKDD 5HYSA 2W0LA 2X89A 5DMYA 1Z5LA 4OGYH 4P5TC 2HMIC 4JO2H 3OZ9H 4KMTL 4Z95H 1EO8L 4JEGB 3TT1L 3UJIH 2R1XB 5JOEA 1AO7D 4YNYA 1YUHB 3O2DL 1E28B 3CDFA 1CTOA 4DVBB 4M48L 3QIWB 4LK4A 3BP4A 2VXSL 5JLZB 2ARWA 5E70A 4PJXB 1IC4L 1QFUH 5C0AB 1H3WM 4P5TA 3WS3B 2RJMA 4GAGL 4XCEB 2JB6B 4HBCL 3UAJC 3DETC 2AAVA 1CXLA 5BCAA 1HEZA 3HPJB 2EECA 2NYYC 3IXTA 4HCRL 1MF2H 3DPBA 3PWPE 4XCYA 1PZ5B 3V6ZA 4R4BA 5FB8B 5E1AA 2B4CL 5EUOE 2CDGB 4G42B 4WU7B 2XA8H 1EA9C 1SQ2N 3NABL 1YY8A 5DVLA 3RWCA 1AGDB 1XF2A 2IH1B 1U8JA 2ICWJ 1AGBA 4YWGH 2B0SL 3HKFA 1GZQA 3S8WA 1QEWA 2VXUH 4UTBH 1MJ7H 1SM3H 4PJ7E 2OQJA 2E7CA 1ADQH 4LIQE 3BEWA 5LVEA 3QPXL 3RVTD 3H42H 5IB1B 3ZDZF 4NT6A 4QKXB 1DCLA 4PJAE 4HBQA 1F02I 4OI7A 4OM1L 3N85L 4WHYH 3MOAH 1XAUA 2VZ3A 3LEVL 4AIZA 1C1EH 3QI9B 4RX4A 1UWEL 3UP1A 5JTWA 5KVFH 3FQRB 5JIIA 2H2SC 4M6MH 2GTWB 3ALWA 4L29A 3DTXB 1TTUA 5FA4A 2DTSA 3KDMB 3W81A 1AI1H 4ZFOL 4X4XB 2A83B 3EO1B 3GMQB 3MLYL 2QQKH 1CL7I 2MOVA 3KJ6H 3WUWG 1CF8H 1XMWA 4RNRA 1KEMH 1KJMB 1OB1A 1QSEE 1EJ6A 3FB7B 4P2OD 5FHBL 2DTML 5JQHC 3WKNA 2F53B 3WUWB 5CWSB 1ND0A 2BOCA 1WV7T 5DJ6B 2J4WL 4ZUUB 2NY2C 5DJ0A 3BPOB 1JF6A 3VFMB 3WHXA 3P4LA 3FB8A 5I1JL 2Y1VA 4RA3A 2D9QB 5CGYC 3CZFA 4KMTH 1EO8H 1ZHKA 3TT1H 2FRGP 3CFJB 1B88A 1OARH 1XH3B 5GGUA 4RRPG 4KUCD 3O2DH 4I3RL 4M48H 1Q94A 5IFHL 2VXSH 3CVHB 4JHWL 3FAWA 4R2GC 1OL0A 3PHSA 1IC4H 3QNZA 1SJHA 4GAGH 3SKJL 3OJ2C 2R23A 2XQYK 4HBCH 1MCFA 5E1HB 4ODTL 5J1AA 4LEOB 3REWB 4HCRH 1HILA 4JKLA 3RFZC 2J8UE 4HUVB 3O4OB 5FM4A 1MIMH 2B4CH 4P0DA 3TP4A 3OGCA 1L6ZA 1DQDL 2DICA 4XWOD 4HX1B 1CFTB 4RGMB 2HJKA 1J0JA 3S3SA 3NFNB 3G6JF 3QDGB 2IBZY 4OZFG 3KXFE 3NABH 3BPCB 3I02A 4P9HC 3RX8A 3N9GL 5J8OA 2NMSA 2HG5B 3W9DA 3GMNA 1UKSA 3P9MB 4TN9A 5F7KC 4QHMB 1IAIL 2B0SH 4PGEB 1DUZA 4UUJB 3PP3H 4PJDE 5IBUG 1TPXB 1AO7E 4U49A 3OKNA 1CGUA 3LQMA 3O6KL 3INUL 3X3FL 1QRND 3TO4C 3QPXH 4ZG1A 4YHMH 3JTSB 3AVEA 3HHRB 3VW3L 3TBVA 1PW3A 1F11A 3MRDA 4I2XB 5D7SL 4OM1H 3N85H 3LEVH 5EOCL 4LSRL 2J88L 1UWEH 3KR3L 3BFOA 3KPRA 4PGDB 5FKPA 3TO4A 5C0EB 4CN6A 4X6DB 5DA4A 4N0CD 5EZJB 1QR1B 3QFDA 4PD4J 4HK3N 4XH2A 3UBXI 1T0PB 1V3MA 4L4TD 3DUUB 1YDPB 4M7ZC 1H3UA 3SGKA 2FO4B 1XCQB 5M7QA 2YA2A 4I48B 1QVOB 2OR9L 5FHBH 2DTMH 2VR4A 3DRQB 4IOIB 5IEHB 5KSUA 2J4WH 5IHUL 5CIPH 4KKNA 1G7PA 1S7SA 1VGKB 4WUUE 1JZ5A 3GSRA 4QHKJ 5I1JH 2FJGA 2JF1A 1NGYB 3G5XA 3RZCB 3VXTB 2GY7B 5IW6B 5HSFA 4QHLB 4JDVA 3CLEL 4NO5B 4XP9L 1UWXH 4I3RH 3V6OC 2BNUA 2OL3L 4UT6L 3STZB 3H7BA 2MJWA 4H20L 5IFHH 4JHWH 2WBJD 4ZNCD 4HKJB 4KC3B 1JPFB 3MV8B 5GS0C 3WD5L 3SKJH 1X6NA 2QHRL 5C07D 4ODTH 4XVUD 3LQAC 4PS4L 4E9LA 3V6OA 5KOVC 2FH8A 5GIRA 3PHOA 3QWRD 4NKIL 1MHPL 4PLKC 5INDB 5T33L 2JK5A 3PQYD 1DQDH 4K71B 1F3DJ 1SMOA 4LGPB 1KULA 2CLZA 3JV6A 4J4PD 4BH7A 3AC0A 4PJGA 1B90A 2Q3ZA 1JNHB 2C3VA 4GXVH 1H3PL 1B0WA 5HD8D 4C56B 5JW3L 3BEVA 2AXJA 3N9GH 3FN3A 5CFHA 4U1JB 5C0IB 1IAIH 2EZ0D 4FFZL 5SX5H 4MJ5A 1A1NA 5SWQA 1CGXA 5ID1B 4F80A 3O6KH 1PX3A 3INUH 3QPQD 3X3FH 5KS9E 3RPKA 3D2UD 4Y1AB 3VW3H 4A2MA 25C8L 5D7SH 2YD9A 5EOCH 4G8GE 1ZEAL 4LSRH 3VXRE 2E9IA 4M5YL 2J88H 4O2CB 1UYWL 2BOBB 3KR3H 4GMSL 4QCIB 1NGPL 5DXWA 1FV1A 1I8MA 4QO1A 1S7XB 4IEFB 5DJ2B 2A1WL 3OKEB 2G9HB 2MHAB 3Q6FB 3KPNA 4R90H 1XF4B 5C6PB 4NQSA 2ED9A 4OLZL 4UU9A 3MYZA 4P4RB 4CVZA 4JRXD 4HEPG 4GUPA 3CUPA 2OR9H 4BUGA 3QHFL 3QEHB 1SJEA 1O0VA 4IJ3C 3LKPB 3N1QC 2E3VA 5IHUH 2NZ9C 1QQDA 3VFGL 2YBRB 1NANH 2WV3A 4PJIB 1U8IA 4N0UB 1HDMA 1KTLA 1A6PA 1FE8L 3H9ZA 4V1DB 1WT5C 1R5IA 2CDFB 3RWEB 3CLEH 5F96L 4XP9H 1HOCA 2V5SA 4U6HB 2YRLA 2OL3H 4UT6H 4H20H 4F7MB 2FEDD 1MY5A 5E8EB 1NL0L 3IDGA 4U3XA 4RFEB 1WT5A 3QDMA 3WD5H 2QHRH 4G8FB 4N5EC 1TZHB 3Q3GA 4PS4H 2NR6D 3O3UN 1QFPA 1KJVB 3KWWB 5HHNB 2BNRA 4LVEA 1F00I 4EBQL 1QFWL 4NKIH 4M6NL 1MHPH 4F3FA 3GZKA 1ITCA 5FYKL 2RR3A 5T33H 2OJEB 2LFGA 4H0IA 4GBXC 5EUOF 3TJHC 3SDAD 5KJRL 3SHSA 5ELIA 5I74B 4WUKL 2JJVA 2P8PA 1H3PH 1FVDB 1U8OB 3DMMB 4B5EA 4WHYG 3LN9A 3EOYG 1FP5A 3U0PA 1G84A 4MJ4A 4Y5XC 2G5BA 4D0BA 1B6DA 3DBXB 4GBXA 4FFZH 4NHUB 3VRJB 3SKNB 1OAYL 4ZPTB 2ICCA 2ICWA 2AXFA 1BWWA 5JDSA 3CDYA 1AHWC 4FQIL 1HHHB 3B8SA 1AD9B 4PJ7F 2VB5A 1Z9SA 3R06A 5IG7A 3B2UC 5FFLA 25C8H 4PJAF 2DKSA 2XKUA 1YQ2A 1ZEAH 3N0PB 4M5YH 1HCVA 2RQ8A 1UYWH 5C07E 3QQ4A 3HE6D 4GMSH 3VXNB 4L8CB 4JFXA 1NGPH 5EWIL 4Y88A 2A1WH 4YDJA 4X8JB 3B43A 4C4KO 2OZ4A 4MNQA 3PQYE 4OLVH 5GRJL 2VXQL 2GT9B 4OLZH 3OAZK 3BD4A 2AK4A 3BP7A 5GS3A 3VFOA 3ILQC 3O4LB 3WLBB 1DQQB 2X4SA 2BNQB 4LSDA 3C8HA 5HVFB 4QXGL 3FO2B 3QHFH 4HJ0D 1OD7A 3UTQA 2PCPB 3FO9A 3ULUL 2ZJSL 1HIML 5L2KA 3B2VL 4LOUD 5EBMB 2ZG1A 1WSST 5KG9B 3VFGH 1XGTA 1FN4A 3HZMA 4QF1B 1ZLWK 4ZUVA 1FE8H 2Y25A 4JM2A 5T1KB 3LY6A 3MV7B 3QO0A 4I18C 3VFPB 5HYQB 1Z9MA 3F12A 4Y8DC 4KKAD 3X12B 1NL0H 1NCUA 4PBXA 1J5OL 2VMFA 1IGYB 4K23L 2AJSL 3CFKB 5DFVD 5MI0B 1JBJA 4I18A 3K1DA 2RAMA 3KLDA 3MRLB 4EBQH 2OR8A 1QFWH 4M6NH 3QUKA 5FYKH 2J8UF 3T1FA 1MUJB 4HH8A 5IIEB 2ZCKL 1JNJA 5E6IC 3T2QA 3D39A 5CEXB 4YH6A 4WUKH 4M1GL 2YRZA 3IRZA 2AJZB 8FABA 1WBZB 3EFDL 4PY8I 2B5IB 1DQJA 5DQJA 2CDEB 4QXTB 1CFBA 1OAYH 5E6IA 5JW4R 4PYHA 2YPVL 4MJ6A 5HYFA 3SO3B 4PJDF 4NZTL 4FQIH 1RUKL 3QULA 4X6EA 2ICES 4OCNC 4TULH 3TV3L 1FNEA 3EYSL 4ZXBD 2IBBA 4UMGA 1NFDB 4MGXA 2V5MA 4MYWB 4M02A 1AP2A 4XNMB 1D6VL 2A6IB 1KSRA 1NBYB 2ZWLT 4HQQL 4UQ2B 1FL5A 5EWIH 2VABA 5FUOL 4Z76B 2FX9L 1WF5A 1EEQA 2BY1A 5IMMA 3L9RB 3IDUA 3NIDE 5EO0A 4BQBA 3MROB 1MCCA 5GRJH 5A2FA 4WI9A 2OP4L 2VXQH 3HZVB 3KPSE 5GRVK 1H0DB 3P0GB 4NBZB 3ZYOA 5FECA 4OLUL 1VFAB 3SGEI 3WIFA 1I1AB 3UPRB 1IVLA 2IC2A 3D69A 2H26B 3NCYS 4L9LC 4JFFB 4QXGH 3GDBA 3ULUH 2ZJSH 1HIMH 4K3GA 1YEJL 5LAXB 1JN6B 1E4XI 1TVDA 4K8RC 4LLYA 3B2VH 4AJ0A 3QHTC 1HI6A 3MSPA 3DUSA 4UT7L 1IAOB 5D1QC 5IM7B 1IE5A 1F8TL 2ZNWA 1G1YA 5C6TL 5CEZD 1M7DB 1A7RL 4PJBE 4EUPB 5D2LB 5GRYA 1FZKA 5FAAA 2O93L 5KN5A 5E4EB 3SGJC 1G7LB 2VLJD 2ITDA 4JPIB 1LO3L 4LHUD 1J5OH 1D5MA 1TNNA 5EZIL 3QIBB 4MLSA 3GM8A 4K23H 3QCVL 2AJSH 4X5XA 1JP5A 1IEAA 3G5VB 2XY2A 2PYED 3MUGB 3MXVL 3SDXE 4E41D 4BH8B 2EE3A 2Y72A 5DA0B 1C8PA 3B5TA 1E0OB 4Y5YC 3RJDA 1LE5B 1KIPA 1SJVA 3GBNL 4BSWB 3HC0A 5CJ8A 4Z5RA 4KJPD 5TH2A 1CIDA 3ZMRA 1G6RA 3S5LG 4M1GH 1EPFA 2UVFA 4JJHA 1MCKA 5K9OA 4M43L 4Y5YA 4B0MM 2OI9C 3FOMA 3EFDH 3C8KB 1C16A 1FG9C 2MTPA 2Y7QA 3STBA 4B7LA 5I1LA 4OZGE 1G7IA 4X5WA 3UTPE 3O3DB 1RJZB 2GW5A 4NNYA 5C0CD 2HLFD 2YPVH 3QFJA 3T8XA 3HE7C 4NZTH 3MFGB 3VWKD 1RUKH 4PREB 5KS9F 3U30C 3TV3H 1TITA 3EYSH 1X5HA 4HF5L 1ZGLM 2AQ3A 2PTTA 2E9JA 5IMLA 3U9UB 1ZVSB 1D6VH 1X5KA 5IROC 4ZYKB 4ZFZA 5IHZB 4EDXB 4O51B 4WHTB 4JKPL 4WGWB 4WV1B 4W6YB 2EXYD 5EBLA 5CKAA 5FUOH 3VXSA 2FX9H 1QLFA 2XWJA 6FABL 1FNGA 3QEQA 1BQUA 4PR5B 2DQIL 2OP4H 3C5ZA 5IROA 2XWTB 4OLUH 2NX5E 4JO4L 1T7XA 4DVRL 3MYJA 1FFRA 5HJ3A 2KQNA 1RULH 4GQPH 4Z0XB 3H9SB 1YEJH 3F5WA 2JJTC 4NO0D 2YD2A 5JZ7D 1SHMA 4G43B 4LLQB 4UT7H 4C58B 1P1ZA 4HEME 5ACZB 4O4YL 1F8TH 4BK5A 2UWEE 3PF2A 1U58B 5C6TH 1MCBA 1DBKL 4JY6B 2BMKA 3BH9A 1A7RH 3HNSL 1VERA 3TBSB 4X6CA 4KROC 5E00B 5DJ8B 5E8NA 3MV9A 3LPWA 2JTDA 4U4BA 5MP6L 1LDPL 3TVMD 1LO3H 5EO1A 5IF0B 1WLHA 5KSBE 2PXYC 2D7TL 3QCVH 2FCBA 2MWCA 3EKCA 4TTDC 4U1LB 5JMRA 1JF5A 3BSZL 2BK8A 3VGEA 3EYVB 3U7AA 4ZUTA 4EXKA 1Q9LA 5B3NA 5ERWA 3QUMB 4P23D 4PRHE 1JGDB 2M8XA 3PV6B 2EEBA 4MQXC 1JHKL 2DI8A 3WNLA 3VJ6A 1T20A 2FD6H 3O9WD 4M43H 4TUOA 3MRIB 4UOJA 3NIGE 5JW5B 3VXMB 2XZAL 2EO1A 4DOHB 1PKQA 2BJML 2WMPA 2XWBA 5T1MA 1P5VA 1P9MC 4ORZC 1NC4D 2CLVB 1ZLSH 4LSPL 6CGTA 4UZGA 3LQAL 4HF5H 2VLJE 1LO5A 1MRFL 1FCCA 3Q1SL 5IGXL 4X98B 3CIQA 5AG8A 4R7DA 4UNUA 1QNZL 3DRTA 3AAZB 3TPKA 1IGIL 3PGCA 3UYOD 3ZKQD 2EH8L 1S5HB 3I6GA 5CUSL 3MR9A 3NN8B 4L4VA 4P3DA 6FABH 1A6TA 4TUJB 2W0KA 5DMKA 4QRPD 2DQIH 3OKLB 3CSYB 5TFSL 3WO4B 4WI6A 4G8EB 4JO4H 3DHJA 3KYMB 4DVRH 3BWAA 1NBQA 4WDIB 4JHZA 5A1AA 5HY9B 3TBTB 5DHVB 1WK0A 5BZDB 2J3SA 4Y16D 2OTWA 5DI8A 2XPGA 5C0CE 2FO1A 5CGTA 1CXFA 3HA0A 3OKOA 4M4PA 4NZDA 3GO1L 4O4YH 3P0VL 3MCKA 1AJ7H 4ETYA 4NQXA 4U1IB 1Q0XL 2RHEA 3IKCB 5HDQL 5J6HB 3SDCC 1DBKH 2YPLD 5MENA 4Y4FB 4TTGA 4FFWC 5DC4B 1U8HB 3HNSH 4PRDB 5F9WB 5FF6B 3W39B 1H5BA 4QTHB 3RDTB 4XGZB 4XX1G 5MP6H 4JM4L 5C09B 3SBWC 1LDPH 4HS6B 3OG4B 2D7TH 3CFDB 1BFVL 2NTFA 3HUJB 3BSZH 1H15A 4FTVD 3U46B 3WN5C 2AEWA 4MA1B 1HHJA 2VLRB 5IJKA 1N59B 4XHJC 1QHPA 2D3VA 1CGTA 3SBWA 3OF6A 2E27L 2Y5EA 1YA5A 3OBAA 5C0ND 1GHFL 3SJVB 2D7QA 3MJ8B 1JHKH 3T2NL 1IQWL 3UCRA 3DV4B 3WN5A 5DFTA 4GW1B 3MNVA 5I66B 4CJ0A 4GAJL 3DX7B 2KDGA 2FJFA 4GS7B 3WHE1 2XZAH 3QUZD 2PO6C 2VZSA 2ZUWA 1XT5A 1TZIB 1D7FA 1JPGB 1DDHA 2DM4A 5FDWB 4MNGB 1U9KA 3C8DA 2BJMH 4OZ4A 2M26A 5TE6L 3L6FB 3WFZA 5LCVL 4LSPH 3LRSA 3Q48A 4UQ3B 3TPUA 1T4KA 2AV7A 3LQAH 3WFHB 1L4IA 1EFXB 1UQSB 2PO6A 1EAJA 1MRFH 4YHIB 3B6SB 1ZLUH 4R97B 3Q1SH 3ZSTA 5IGXH 3DO3A 1QNZH 4LASL 4XCFL 1IGIH 1E27B 1J0KA 1UZ8A 3C9NB 2Q1EA 4EI6A 2HTLC 2EH8H 1UB6A 2AQ2A 4FS0A 5CUSH 4DZ8B 4MQ7B 3OJDB 2W07A 1EUTA 3NIDF 5DK0A 3K4AA 1IM9D 2VZOA 3G6AA 5DK3A 5I1AB 1VADB 2LU4A 4Q2ZA 5TFSH 5FYJE 1FZOB 3L3HA 1FVCB 3REVA 1FJ1A 4Z7WF 1OSZA 2R1WA 3S3PA 1OGTA 2GAZB 5EH1A 4YEEA 2QHLA 3GGWA 3D5OF 5AUMA 5HYSG 4JPVL 1JUFB 2OZ4L 3RVVD 5TQ2L 3GO1H 3P0VH 3AY4A 1ED3B 2KKQA 3DECA 1Q0XH 4WGVB 3QZWB 5E7BA 5HDQH 3TA3C 5JR1L 4HPOL 3UTTA 1P2CA 2HN7A 1A1OB 1U91A 4PJBF 5C0DB 4QY8B 1TXKA 2ENYA 3GSNA 1UKTA 1T1WB 4P2RE 3ZYIA 2VAAB 1XGPA 2D4FA 4FG6D 1UZ6E 2HA1A 3TA3A 5JPMB 1BFVH 2OTUA 2DLGA 3RNQB 1OGAD 4P5TB 3SDXF 1A7OL 4NFDA 4QRPE 4Z7OE 1OAUL 4ODVH 4Q0XL 2E27H 3IXTB 1T0NA 4GT7A 4ODWA 1AR2A 1GHFH 1NEZB 3V6ZB 5HGHA 5HGDA 1V3KA 3T2NH 1IQWH 3V8CA 1T0MB 1T21A 2WAHA 3EJZD 4GAJH 3IDJA 4YBHA 5I73B 1KYOK 3KPPA 1UVQA 4GSDL 2X5PA 2QSTA 5GZNC 2IGFL 3HG1D 5CSZB 4OZGF 2O5XL 4RAVB 1XF2B 4HIEB 5TE6H 1AGBB 2IMNA 3N1FC 2YPLE 1P7QA 1GZQB 2UY7A 1QBLL 1UFUA 4U1NA 4JFYA 4IOSD 2DIAA 1ORSA 4F7PB 2GTZB 4IOFD 4XTRD 4BJLA 5ENWB 2Q6WA 1N0XL 3WLWC 1WTGT 4N0RA 4PV8B 4LASH 3O0RL 3PL6B 2CXGA 5BXFB 4FTVE 4MCZB 3WFCL 1WEJL 3PGDA 5C9KA 4NRZB 1CICA 4HJGB 2Z92A 2UYLA 4Z7UB 2JIXA 1GH7A 4PJ8D 15C8L 3ZHKA 3O41B 1U92A 3FL7A 1CE1L 3FOLA 5L88L 5HPMA 2H32H 4YGVA 3MJ9A 4GW5A 1WITA 1JRHL 4RNRB 5DMJB 4PY7A 2VLKB 4LFHG 3G6JA 3ALXA 4DKEL 2F9BT 3IXAB 1YPZE 4JHAL 4JPVH 1F45A 2OZ4H 5E94B 5TQ2H 4LDOB 3QR2A 3O3BA 4WJ5B 5C0BD 4MA3B 2UWEF 2J1KA 5JR1H 1NJ9B 2WIMA 1NCCL 1KG0B 5HI5C 5BJTB 4HUWA 4A6YB 1S7QA 3BKML 1MCOL 2UVEA 1X5ZA 5JIHA 3IYLW 2ED8A 3MRGA 3CK0L 5HDBF 2AS5M 4NQCD 5KSBF 3BP5B 1VFMA 2FATL 1DQTA 4X6BA 3T0EB 5D1ZC 1A7OH 1D5BB 1OAUH 2OLDA 1RK1B 4Q0XH 4JY4A 4DK3A 1X5AA 1S9VA 4YX2L 1YMHB 3WE6B 3BO8B 4JZOA 5IB4B 4TSAL 1S9YA 1HILB 4R2GB 1DSFL 1FYTE 4GLRH 4KWUA 1JZ8A 4ACPA 3B9KD 1T2QL 1OD9A 5D1ZA 4Q58C 1GCFA 1TVHB 2J5LC 2HJKB 2Z91B 5ISZD 4GSDH 4KHXL 5C7XL 2R2BA 1H8OA 2IGFH 3NIGF 3EDFA 3T65A 5HYJB 4KI5D 2O5XH 4LNRB 4WFGD 4I0PD 1DN0B 2EDNA 4WI4A 5D70L 1CD0A 4FZ8H 1DTUA 5I8KL 3BESR 1QBLH 4C83B 2XFXA 2XRAL 1G6RL 3RJQB 2WANA 5CBAA 4HH9B 4JLRB 1N0XH 2CRYA 2GSIA 1CQYA 3NFSL 4NCDA 3O0RH 4O00A 2HT3D 1F11B 1OGAE 3MRDB 5EC2B 2FWOA 1W72A 4Y4KC 4I9WD 4R6UA 3WFCH 1MHCA 1FO0A 3GSOB 4NC1E 3SE8L 1ZT1B 3I2CL 1LNUA 2X4PA 3TO4B 2EC9T 1T5XA 3QFDB 2HFEA 4XH2B 3IAPA 3W0WA 2O61A 4MXVE 15C8H 2VYRE 2NY6B 2JLLA 3NGBB 4Y4KA 3RBSA 4YPGA 3VD9A 2F8VA 2A9MH 3HZKA 1CE1H 2CRIA 1YMMD 5L88H 1NGZB 1UGNA 3D1MC 3UEZA 4PJ9A 1JRHH 5DSCB 1QLRA 1REIA 3HG1E 1A6WL 5IVZB 4YR6A 3VG9C 1F6LL 1QPPA 2W65A 3LKNA 3ULVL 4OD3L 4JFZL 4HMEA 4DKEH 4JHAH 4UDUB 4OFIA 3RWIA 1BIIB 1C7TA 4TRPL 1G7PB 1EXUA 1KB5A 4OGAD 1RZJL 1NCCH 4NDMA 4NKQB 2FSEB 2NNAA 3RIAF 3FQTB 1U8NB 5C08D 2EKSB 4Y2DD 2EE9A 4ZS6D 3BKMH 1MCOH 1Y6KR 4WTZG 4F9PC 1HYSD 1G0DA 1LILA 1QYGL 3BZEB 3CK0H 1BZ9B 2BSSA 3B3IA 1NC2D 5IB2A 2FATH 4JFHD 3WS6C 1QTYT 4JKMA 2NW3B 3RY5A 5I76B 5KAQF 1RUPL 4NRXB 1LEIB 3IETA 4F9PA 5ICYB 3QCTL 1NCAL 4RZCA 4K8RH 4YX2H 1GSMA 1AKJA 2XIDA 3V7AG 4GJTB 1DSFH 4HZAA 3C6LD 3QH3A 1F3JB 5IESL 1T5WB 3WS6A 3NA9H 5HGBA 1WBXA 5IWLC 4GFTB 5CAYB 4U6VL 3MUY1 2H6PA 4JFDB 4Z7VE 4KHXH 3U79A 5C7XH 4NC0B 5C0BE 5D70H 2Z0BA 5AAMA 4BFEA 5I8KH 4MJ5B 3U7YL 1A1NB 3PNWA 4Z7QE 4KRPD 1WUNT 2DI9A 1F3DH 2WIIB 2XRAH 3Q6GL 1G6RH 5DGQA 1A7BA 1ZS8B 2AEIT 1RVFL 2YEZA 3RUGE 2BCKB 3CDGB 3EYQC 3HB3D 3NFSH 4NQCE 4GRLD 2ITCB 2FLRT 2GCYA 5CJXA 1MAML 1UXSA 5EG6C 4P5KB 3V0VB 4R3SB 1OTTC 5DJYB 1HHIA 1PLGH 3IDIA 3SE8H 3SKMA 4N8VB 1OSPL 3I2CH 1M05B 3ARGB 2R4SL 3BD3A 4L3CA 2BVQA 1H8NA 4XC3L 5LJYH 4E5XA 3ULSA 1RSFA 2EDWA 3PWPA 3QJFB 4L9DA 4WY7L 2AXGA 5BVJB 5ISZE 2JCCB 3CC5A 4M6AA 1AFVL 5E2WL 5EUOA 5BV7B 4OCSL 1A6WH 4XVJL 3FCTA 1AGEA 1X5JA 1Z3GL 2UUDH 4OD3H 3ULVH 4JFZH 5CP7A 3GMMA 4U0RC 4J8RB 3ZTJH 4PBVC 4HULB 4IRSB 4H5SB 1JGLH 4TRPH 2FGWL 3S4SG 1RZJH 5I0DA 1JI2A 1INDL 2WWMD 2EDXA 4P46B 2VQ1B 4HWUA 1LK2A 3CX5K 5SWZB 3S4SB 4CU8A 5ID0A 3CH1A 2PUQT 3B5HA 1NUFA 5F7UA 4IJ3B 1QYGH 4PJ7A 2FIKB 1HYRC 4G80B 4I9WE 4RBPK 3ROLB 1UZ6F 4M9OA 1YEDA 4K3DL 3F6LA 1B0RB 3V6FB 2HT4D 1J05A 1WZ1L 3FZUC 4IRJD 4PJAA 3V5HA 4K7FA 3C5SA 4MSWB 4KJQC 3N1MC 1RFDL 1RUPH 4URTB 4PJHB 2C1PB 1UENA 3QCTH 4Z7OF 1N5YL 2V2TB 1ETZA 3JUYA 4QRTA 4ZFFA 2ARJA 2XKSA 2WLZA 2EIDA 1YMME 1AIFB 3MLVL 5IESH 4N1EA 1QO3B 4JANA 3VGAB 3QIWD 4JQIL 5FOBA 4U6XB 4U6VH 5C0AD 3FB5B 1KTKE 4F2MA 1J88A 3SGDH 4NNPL 4WFFD 2EIEA 2NY3B 3LN5A 1QSEA 4OCWL 2G5BB 2P8LA 1W0YT 3P4NB 1HQ4A 1KJ3L 3C5JA 3U7YH 5ADOL 4XRCA 1CGVA 2F15A 3Q6GH 1CFQA 5FCSH 4QHNB 1OTUD 5C08E 5IBLD 5ICXB 3QAZB 1RVFH 3IDYC 3FQXA 1OM3L 3R06B 4HGMA 2HRLA 4Y5XB 2HJFB 3KJ4C 3QO1A 4AMKL 3GJEA 1MAMH 2MKLC 3ARDB 2BHUA 3MGOB 2H32B 2Z31C 1AHWB 1KEGL 1OSPH 4MD4B 2R4SH 4Y8AA 4MXWL 4BK4A 4XC3H 3QG6A 1JPTL 3L3DB 1BIHA 1C12A 2Z31A 4EIGB 5GSVA 1WZMA 3BP7B 3CXHK 4PBWD 5DDHA 1H8SA 2J8UA 5E08L 1JHLL 3QI9D 5E2WH 4P2QE 4OCSH 4XVJH 1Z0NA 2WUCL 5D7IB 1DVFC 2AEQL 1PY4A 5F9JB 5L2KB 1S7WB 4NYLB 1X4ZA 3KXFA 1YPZF 4XBGA 1V8HA 4GO6B 3FT2A 5DGRA 2FGWH 3UMTA 4YQXL 2DQDL 3DIFA 1INDH 1MCHA 3W5NA 1W2KT 1RZIB 1KUMA 1JYVA 1JMXA 1FZMA 4JZJC 3FQWA 4PJDA 4PJFE 1AO7A 3L3JB 5TDPB 2R1YA 3MRFA 3SKOB 2F53D 2BRRL 3HI1A 4K3DH 1WC7B 1WZ1H 1DBMH 2GI7A 5D5ME 3U4AA 2LVCA 3A6OA 3C08L 3MZTA 3DROB 1VFUA 1RFDH 3AU1A 4JZJA 3LKQA 2X05A 1N5YH 3SY0A 1KPRB 3GSNL 4Y4HC 5TGBA 3RL2B 4MXQC 2KBGA 3CVIL 3OR6B 3KYNA 4HIJA 3MLVH 5HHXL 4BYHA 4U6YB 4QT5B 3VFWA 4JQIH 4KDTC 4OFKA 5IMOB 1LEGA 5FYLL 2NLJB 1BQSA 5CGMA 2YD7A 3BVNA 1S7RA 5C3TA 5IVXB 4MS8D 1A4KB 4NNPH 3LCYA 4Y4HA 2SEBB 2PYFB 4LLDA 4K3JL 1SJXA 4OCWH 4H0GA 1A4JA 2D03L 2YUWA 3TH4T 3JV4A 1KJ3H 3CFBB 3WNNA 1X5IA 5ADOH 1XF1A 2FBOJ 5K9QG 4JAMB 3UBXA 1BQHB 1A02N 2RB8A 5L2JA 4WUUA 3W9EA 3MCLL 4H26A 4CU6A 1OM3H 3D87B 3QDGD 2EC8A 4Q7DA 4JFOB 4M62L 3L7FA 3NH7L 1VEOA 4LLVB 4L8SC 1MFCL 4ZPVA 4AMKH 1FL6A 4F7TA 3RIAK 2MSPA 4AENB 3DSFL 4GRMA 1KPVB 4M8VA 1R3LA 3S34L 3T0BA 5K9KB 1KEGH 1P4BH 2XICA 2FHCA 2ZG3A 5EZLA 4KY1L 3RVWC 5C3LD 2E6PA 5IMMB 3ZHDA 1MFBL 4L8SA 2E9BA 3HMWL 4MXWH 1UJ3C 1J1PL 4PGCB 4YHNB 3LIZL 3JSSA 1OWWA 4P2OC 3MBEB 3OKYA 4MXVF 3QHZL 5E8OA 4XNZC 2UY6A 1QR4A 3DURB 2R9HD 1JGVL 3GBML 4PJXE 5FECB 5C0AE 5IK3B 3WIFB 5E08H 1JHLH 3ZKND 3D69B 3QCUL 1LP9B 1TVBA 1UJ3A 2WUCH 4JZNA 2HKFL 2YC1B 2AEQH 3H9HA 4P2OA 2VAJA 1EEZA 3WIIL 1PYWA 3RY6C 4L4TB 4YQXH 2DQDH 1XCTA 4L9LB 4UNTA 2C9AA 3CX5J 3C6SA 3MJ9L 2DWEB 5GISL 1RAMA 2ZSVA 4X99B 5DTFA 3RY6A 3QQ9D 3DX9A 2BRRH 5KS9A 4X9IA 5D1QB 5JW4N 3DX8B 3O2WL 4J1UB 2DRUA 3K74B 5D71L 3VXQB 5F3HB 3C08H 1IEAB 3VWJC 4XCCL 4G8GA 2C4FU 2ATPB 3VXRA 2VITB 4P57B 3HCVA 4BQCA 1FCGA 3GSNH 4LVOB 1SY6A 1YNKL 3CVIH 1WISA 4MWFB 5HHXH 1DUYA 1WBYA 2R2EB 3U83A 4G9FA 5FYLH 4BZYA 5EA0L 1HSBA 1BHGA 2YN5A 4LARH 1G6RB 3MV8D 5FKAB 2A6JA 1IBGL 4DAGL 5I19L 3SKUD 3O6FB 4ODSL 3VXPA 4Z7VF 3ZE1F 4WO4B 3FJTA 2DBJA 1JWSA 1KTRL 4K3JH 1I9IL 4OF5A 2D03H 2CKNA 5I1LB 2ZUXA 3NACL 5ITFB 2G2RB 4LCWE 4O5LL 5EU5B 4NNYB 5B39A 3T8XB 1U2CA 4Z7QF 1A7NL 1JCKA 3VFUB 1XR8B 1BX2A 4NN5B 4EZMA 3MCLH 2OI9B 3RUGF 1RQ5A 4JREC 4M62H 3NH7H 2F53E 4XPTL 3TH3T 1BVKB 3U9PL 1MFCH 4C56D 2PTTB 5LGJA 1KT2A 1N6VA 1FFOA 3KYOB 2X70B 3DSFH 3VG0L 1I8KA 1NCDL 3UC0H 3HE7B 3LKSA 4U1GC 3K8MA 3LZFL 3S34H 3TWCL 2IAMC 2D7OA 3BPLC 3ZTJG 3U30B 4KY1H 1I7TA 5GGQL 3QNYA 1MFBH 3HMWH 1FNGB 1J1PH 3LIZH 3TBYA 1P4LB 3HR5B 4KJYA 2L7JA 2Y6SC 5DLML 2A6KB 4Y1AD 3QHZH 2KPNA 3VDBA 3P3YA 1JGVH 3GBMH 5HVGB 5T3XL 1NQBA 4JFQB 4K7PL 5E4IA 1W72L 1N0LA 2VKXA 2OK0L 4U3CA 3QCUH 1EEUA 3LD8B 4XNQA 2VZTA 3MRPB 2R39A 2HKFH 5HI3C 5J1TC 3WIIH 4EXPX 2VWEC 4OI9A 5FO9B 1R3JA 3MO1A 2X4RB 2QR0B 1FG2B 3BRDA 3WNOA 1RV6X 4S1DD 3HS0B 3ME0A 3DI3B 1HNGA 3EZ8A 2YPKB 3QDGE 1F4AA 3BUTA 4Z7NE 3MJ9H 4JRXB 1DQLL 5GISH 1ZANL 2Q7YA 4X80L 3OG6B 1BFTA 3OXRB 4XVUC 5E8NB 1DE4A 3MV9B 1ZA6B 3UXFA 3O2WH 4LLWA 3X13A 5EO1B 4QRRD 3OB0H 2WBJA 2B1HL 5D71H 1IT9L 1WZLA 1ZLWH 1E4WL 5I8CB 4XCCH 1KB5L 3RHWK 4PGBB 5INCA 4V1DD 1A2YA 4J4PC 5C07A 4KROB 1HXYA 1BOYA 1HQRB 3QA3A 1IGTA 2JJWA 1INQB 1YNKH 2C7UA 4I2XE 3QWRA 5D9SA 3TNNA 3I75B 3TCXA 5ERWB 4Z8FH 3KHQA 4YAQB 2PXYB 4JRWA 2R0KL 5E5MB 4Q9BA 3UTOA 5EA0H 1VACA 3EYFA 3L5WB 4DJMA 2WLYA 4DZBB 4J4PA 4HKBB 5JO5A 1IBGH 4NRYA 4DAGH 5I19H 1OF2A 5L9DL 4ODSH 4X6DE 4FZEL 1JE6A 3A6CH 3CJJA 3QPQC 4NQDB 5EC1A 5F89A 4K55A 3NACH 3V4UL 4O5LH 3T1WA 2CLRB 2BXYA 4LEXH 1G7MB 1A7NH 1BVZA 4PIRF 4XP6L 2BY2A 3VXUB 3CCHB 2DJSA 3JWOL 4MD5A 1ZGLA 5E8PB 3DVGB 1P53A 4XPTH 3MV01 4UILH 3DMMD 3U9PH 3D2UA 5I1GL 1NMAL 3VG0H 2B7DT 1NCDH 1R3KA 1N7ML 1FIEA 4X7EC 1KCLA 3LZFH 2XV6B 4WRLA 3GIVA 2J12B 3DV6A 5MEPB 3TBWA 3TWCH 4K9EL 3QSKB 1IC1A 5GGQH 1Y0LA 4D3CL 5DVNA 2CRZA 2X4UB 2IFFH 1DP0A 4U1SA 5DLMH 4ZD3L 3U0TB 5HGAA 5T3XH 3E3QE 3MV8E 4K7PH 2Z93B 1W72H 2OK0H 1R5WA 4N9GB 4GAYB 1FO0H 1KJ2A 5BZWB 2PF6A 2VIRA 3U2SB 1K8DA 5JQ6L 3PDDA 4AQ1B 5BRZB 1MCEA 4J3SA 4W4OC 1KIQA 2XOTA 3EJJX 4OZHB 1BD2A 4M03A 2XKNA 3O4LD 1MPAL 2P7TB 2BNQD 4S1RL 4RAUB 1RPQA 4F58L 1ZANH 4X80H 4C56E 4I3GA 4PJFF 5IKCB 1YNLL 5HI4D 4Z9KB 4W4OA 1KCKA 2X1OA 1YN7B 2GEEA 3P11L 4D8PA 1BECA 1JZ3A 2B1HH 3LMJL 1IT9H 4IIQC 5D5MF 1W8OA 1E4WH 3KYAA 3VFSA 1LK3L 4YXKL 3SDCB 1KB5H 5B8CB 4GXUN 3SDAC 1I9RL 3HNTL 5T1KD 3MV7D 1JJUA 3UZEA 1QSFA 1CLCA 3VRIA 4IHOA 4BQ9A 4IIQA 1G0XA 2R0KH 4N1HB 4LIQL 3KPSA 3SDAA 3JZ7A 1K6QL 5C70A 2Q8BL 4RWYL 5GGSY 4FZEH 2YD6A 2EDBA 4Z7WA 5H8DA 3MLPA 1R6VA 3MLTB 4MVBC 5DS8A 5KOMC 1AE6L 3L3GA 1HH6B 3V4UH 4KJWD 4JJ5A 2VN4A 2F74A 4YC2B 4ODXA 2K7PA 4XP6H 5KANG 5SV4A 5HYIA 3BGMA 4PV9A 3HE6C 5GJTL 4PRAB 5I1GH 1NMAH 4PJBA 1ZXQA 1N7MH 2JKXA 2NY4C 3VH8B 3EHBC 4PJIE 3VFRB 4N0UE 1UZ8B 4V1DE 4PRIB 1ZMYA 3HE6A 5IV2B 2ZPKL 3SE3C 2X4NB 4K9EH 4D3CH 3VFTA 4YDVB 4LPTA 3SDXA 3MRBA 3G6AB 3IRPX 2V2WA 4ZD3H 2ZUVA 3GHEL 4JDZA 4ZXBB 3ZKMD 4HGWA 4FQHA 4PJXF 3F7RA 1R24B 4APQC 4E42B 1MCPL 1R3HA 2P8MA 3LDBC 3T3PE 2AQ1A 3V52L 5DJXA 4KK5C 2ATKA 5KSVA 5JQ6H 4TNWF 4X9FA 4XMLL 3UTSB 4EN3C 1KN2L 1ZHLA 3IDMA 4APQA 4OZGA 3F7PC 2CIIA 1HKLH 3HAEB 1I1AD 3KPOB 1KCSH 1MPAH 4S1RH 5M95B 1Z2KA 4F58H 1A6AA 5FA3A 3UO1L 2QKIB 4JFFD 1YNLH 1A1MA 2E5EA 3P11H 4NJAH 3PWVB 4ALAL 3LMJH 1MHEA 5J12C 4MJIE 5AYUL 3TIEB 2OX5A 2ESVE 1LK3H 2DMKA 4NUJA 4YXKH 3SCMB 2CO7B 2WP3T 4IM8A 5K59E 1I9RH 3HNTH 3RWDB 3G08A 2Y06L 4HWBA 3EFFA 3UZQA 4DCQA 4CL7A 1S3KL 1CG9A 4JO3L 4GRWB 2XQBL 4LKCA 1HN1A 4N9OB 5DC9B 4LIQH 4XP1L 5F6HJ 1JIBA 1XGUB 2EYSA 3STLB 1K6QH 4RWYH 2Q8BH 2NX5A 2EDEA 5DJAA 3MREB 1KIUA 1AGFB 1MLCB 1Z6JT 2PYEB 2JE8A 1TFHA 2YD1A 1GGYA 3LEXB 4F8TA 5E5RB 2GK0B 5EN2B 1PEWA 1N8ZB 3SDYL 3O4LE 3L95B 4FN0A 4TVPD 4X5LA 3DOSA 5CSBA 3QUXC 1NMCC 1K4CA 2VXTL 5GJTH 2UWEA 5I8EB 5H2BB 5CD3A 4DWHA 4NQVB 3TM6A 1WIUA 3H0TA 1FAIL 5DRZB 4P4KC 3WL9A 4ONFL 1CE6B 4YBQC 2I9TA 3CX2A 2W0PA 3GJFK 3MMEA 43CAA 3E0GA 3QUXA 3RZWA 5I1DA 4OZIE 2ZPKH 5AWNL 3MV7E 5KSBA 2F8XC 3QEUA 5EIIA 1Q1JL 3GBLA 4XI5D 3EDKA 1K4DB 4Y19B 3GHEH 5IUSA 4BFGA 4HHAA 1DEEA 3OKMB 5DJZA 1MCPH 4OD2A 1U92B 1I7RA 3FQNA 4JQXC 1HHKA 3GEWB 4PRHA 3L3IA 4OV6F 3V52H 2V6HA 4LRNL 1S9XA 5CMAB 4XMLH 2G60L 5BMFL 1KN2H 1I8LC 4HMCA 4HPYL 4JQXA 2QQQA 5F1NA 4GKOA 3RWGB 3DJ9A 1MLBA 3GUTA 4K3HA 4Z7NF 3MZGB 5IQ9B 2A73A 3PJSA 4MAYC 3UO1H 1BWMA 4BFIB 4HG4J 2PW2A 3H9SD 5TE7L 4PRNB 4ONOA 3BZFA 5GSRB 3P4MB 5CJ5A 3O3AA 3MRGB 4ALAH 2VLJA 3LHPL 4OGZA 5F88A 1TNMA 4RISL 5AYUH 3FQUB 4ZSOB 2A74B 4LHUA 5I2IA 1GL4B 3RX7A 4FMKA 1TQBB 4NKDA 2QBWA 5FM5M 4MAYA 1CD1B 3V0AC 5H94B 1GIGL 2Y06H 3CLFL 1NFDE 4JY4B 3NOIA 5EIVA 2YRPA 4PJ5B 3DGGB 5IVOA 3I3BA 4F7CA 1S3KH 4U1MA 4JO3H 2Q86A 2XQBH 1PG7L 1S9YB 5FHAH 4XP1H 4HKZA 4NSKA 1OAQL 1ORQA 3B9VA 2V5YA 4M5ZL 2H9GA 2HLFC 4NO3A 3GI8H 1AQDB 1JYXA 5CS7A 4LPCA 4X6DF 4LCYA 4KK8C 2HVKB 3I6KA 3V8OA 1UA6L 5DRNB 4TSCL 1QA9B 2A9NL 4H25B 4FQPA 1SY6L 4ZAKB 1PG7W 3SDYH 1Z9LA 3WYRA 3F65A 2J5LB 3ROOB 1FVEB 4F7EB 3WEXA 2D9CA 3VWKA 3MOBL 2VXTH 3VD5A 5GGSA 4RMSA 4XPFL 1WWCA 3BUYB 3O9WB 1FAIH 3DXAA 2Q76A 3VXMD 3D9AL 4ONFH 5KVDL 3P4OA 4PG2A 3T4AB 1U8MB 1KB9K 4NPYB 1QFOA 4OIIL 1MHCB 5AWNH 1FO0B 1QLEL 5ICZA 3ARSA 1NAMB 1OVZA 3IJYA 3DVIA 4M6OL 2NCMA 5D2LE 1Q1JH 2BY3A 2DL2A 3V0WL 4P3WA 1MI5B 1BGXL 4JPWL 4ZOCA 2O61B 3MGTB 5H37H 3LB6D 1HXMB 1NGWB 4CGTA 2AXHA 2I27N 5HHPA 1BOGB 4HWZA 5GS1B 2W9DL 3NCFB 5D7JB 4LRNH 3IFLL 1Q9KA 4U1HB 2DD8H 5ACLA 5I16B 2G60H 5BMFH 1EEYA 5CHNB 4NO0A 4HPYH 1OP5K 4TVPE 4L8DA 2DQHL 1EXUB 5C0JA 2APWA 1DR9A 4XPBL 3VG9B 1UWGL 1X5LA 2Z8WC 4NZUL 1FL3A 4U7SA 5TE7H 5D93B 4GKSB 4X9BA 5DUML 3LHPH 4PGZA 5FK9A 4RISH 3P30L 3TVMA 5ETUA 1D3CA 3MA7A 4WU5A 2FR4A 3G5YB 4P23C 4M3JA 4OGXL 2BHYA 4LLUB 3CLFH 5DZOA 1NANI 3OR7B 1RJYB 4GW4B 3RDTD 2W9EL 4MNHA 1PG7H 1I75A 1F58H 5FYKD 4WNQA 3F6IA 1OAQH 4P23A 2H2PD 4M5ZH 2XG5A 4N8CL 4X6FB 3ZE0E 1GAFL 4AEEA 4NNXB 5I17A 2I25N 4U1KB 1WFTA 2B4CC 5JXEC 3IF1A 1OTSD 3WDIA 2AV1A 3PDOA 1UA6H 4I5BB 4TSCH 2ICEB 2A9NH 5FYKU 1SY6H 3O45A 1YEEL 1A5FL 4PP2A 1XF5B 4PYGA 2NY0B 4HXAL 3MOBH 1NC4A 1RZ8A 2H3NB 1F2XK 3H9SE 3OXSA 1OPGL 1H3GA 3KYKL 4XPFH 3VA6A 2CR3A 4F9LC 1RURL 1MCJA 5DQ9A 3D9AH 4GOSA 1U3YA 3S36X 5KVDH 2I07A 5IHLB 1YY9C 4P2RA 1KPUA 4OIIH 1UXSB 3PDGA 4PJIF 3UROR 3TIDB 2VQUA 1CT8B 3I9GL 1O7VA 2BC4B 5JHDB 3BIKB 1IEBA 4M6OH 5DR5H 2V17L 1M6OB 1S7TB 4F9LA 3AS3A 5ALCL 3TFKD 1OOAA 3V0WH 4OT1L 1EFXD 2BVQB 1BGXH 4JPWH 1I85C 4LVNC 4QRPA 3FB6A 1T22B 4Y16C 2Q87A 2W60B 4XAKD 2W0FB 5F6IC 3MRMB 1JF1A 3SDDB 3CC5B 4W70A 3M45A 2W9DH 3MNWB 3T3PF 4XVTL 1T04A 3IFLH 4NFCA 1I85A 4Y16A 3OGOE 4P3CL 1T1ZA 1G1CA 5I18L 2XG4A 4PPTA 2DQHH 4JGMA 3RRQA 5EFIA 4XPBH 3SOBL 5FDYA 2V5RA 3MUZ1 1UWGH 2YPLA 1XZ0B 4RGNC 4CVXB 4NZUH 1KJ2L 4U0QB 1C5CL 4U0RB 3VXME 3MCG1 3OPZL 2NW2B 5DUMH 4K94L 3AB0C 4DOHE 4ELKA 1RHHA 2DQJL 2XZQL 3ARFC 3P30H 5HHVL 3PHQA 1F97A 3VGHA 5C0NC 4UTAH 1I7UB 2IF7A 5J9PA 4PJAB 4K7FB 3NIFE 1NMBL 4OGXH 4FTVA 2EYRB 1FRGL 1LHZA 2V7NB 4AEFA 2KZ1B 4ZOAA 3VA2C 1F4XL 2W9EH 2YZ8A 4N0FA 2ARJQ 3WHE0 3CFEA 2YXMA 4YIQB 1PSKL 2V7HA 3MRKB 4N8CH 3SQOL 3R8QA 3MRNA 1GAFH 5CD5D 4H1LB 4P5TD 4MDJB 3HRZA 3L5IA 1C08B 4HIHB 1QSEB 3DYMA 1YEEH 3IFPA 4D0CB 1EH9A 5EU3B 1YPZA 1VFOA 4Z78A 5DRWA 1XIWC 2R15A 3ARRA 1OPGH 3KYKH 4X0KB 3DETD 1Q9WB 2DQCL 2DLEA 1RURH 3FONB 1TENA 5EBWB 1KTDB 3P77B 3I3DA 4NM8L 3M1BA 1PAMA 4JE4B 1GGIL 4NQEB 4XP4L 5CZXC 5JPNB 1XIWA 4PTTA 4Q74A 1IAKB 3I9GH 1A7QL 4OZIF 4RMRA 4QHUA 5SV3A 2FDBP 4JCLA 3IDYB 4M61A 2Z8VC 2BHZA 5ALCH 2DWDA 2Y23A 1F13A 3GSUA 4OT1H 2HLAA 3TLRA 4YO0A 1IM9A 3OB8A 5C09E 2GFBA 1ITBB 1MCWM 2NQCA 5ESVA 4S10A 3BXNB 1VKXA 4TOYL 5F7DA 3HUJE 5SWSB 3T2OA 1FYTA 5DUBA 2J8UB 1NCTA 4XVTH 2PTUA 2QLVB 2VLRE 2VDQL 4FQQB 4K2UL 2Z35B 4P3CH 1CGYA 5DHYA 3TN0C 3SJVE 2EDJA 1BJ8A 1U42A 4KVNL 4FQJL 3SOBH 4YDLB 3LKRB 3BKYH 2H2SD 1KJ2H 4QNPE 2A6DA 2EDFA 1FZMB 1DVFB 1C5CH 5FEBA 4HXBL 3OPZH 2VLKD 3W5MA 2F58L 2DDQL 4K94H 4NC1C 4R4FL 1X44A 4MNGE 4HJJH 2DQJH 2HKHL 1I1YB 1IL1A 5HHVH 5JNYA 2VSCA 2AP2A 3ARPA 4KZDH 1OGAA 1NMBH 3AXLA 2M2DA 3EDJA 3AU1B 4ZDHB 1FRGH 3GIZL 3TCLA 2NXYB 5F72S 1NFDF 3T0WA 1F4XH 4XAKE 2WSKA 1T3FB 2L4OA 3IJSA 1T03L 1A9EB 1JHTB 4TVSa 3RWHA 3CMGA 2FX8L 5H35B 1PSKH 5KSAB 3SQOH 2RBLA 5I1KL 3S3JA 5EUKB 5HGGS 3UTZB 4OJFL 1CFNB 4LSUL 4TSBL 2X6MA 4Y4HB 3X11A 2GUOA 3HG1A 5J13C 4LLDB 4LLMA 4HWBL 5GGVL 2F5BL 3DI2B 3DWTA 1A4JB 1ONQB 3KPLA 1A6VL 4R2GD 3UBXG 4EI5C 2QL1A 4HIIB 2P5EB 1MAKA 2F19L 3ZT6A 2WK2A 4IMKC 5E5UB 1FZJB 2DQCH 1MWAB 3QXDB 4NIKB 2X9YA 5H37G 4Y0GA 3TYGL 3L7FB 1R5VA 2GITB 4ZPVB 1M4KA 4NM8H 1PQZA 5HYJD 3FT3A 1GGIH 4XP4H 5C2UB 4I0PB 4GRMB 2YR3A 1A7QH 4IMKA 2AERT 1JTTA 3P73A 5D2LF 3DGCR 1RIUL 3PWJB 2AGJL 2H8PB 2GJ6B 5GPRA 3NPSC 1AD0B 2BX5A 4YE4L 3SGEH 2XZCH 3O11B 2Q20A 3T4YA 5JDJA 4A2LA 1NBVL 1S7VA 3VD7A 4TOYH 2ZUUA 3MRHA 3MPCA 3JVGC 3IKKA 1F42A 1EHLL 5IOPB 2KQMA 4ELMB 3MA9L 4WWKB 2VDQH 4HWEL 2M1KA 1C5DB 3KPRD 4K2UH 3LS5L 3TO4D 4HUUA 1Q9OB 1KC5L 4Z7VA 1BBDL 4NKMB 4XNZB 3KPQB 3JBG7 3JVGA 3PABB 4KVNH 4Q6IC 4FQJH 5ESAA 4Q9RL 5C0BA 4NBXB 4ODUA 5F1IB 5KBNC 1RU9L 2IADA 4HLJA 4HXBH 4QWWC 4XBEL 2F58H 5JOPD 2DDQH 4R4FH 2X1QA 3FFCE 2HKHH 3RUGA 4AH2B 4Q6IA 1Z0MA 4JVWA 4KQ3L 4U7MA 4KH2A 4NQCA 5GRUH 1MVUA 1BVLA 1YEFL 3B9KC 1BM3L 3GIZH 5GRWA 4YFLF 4ZTOH 3PV7A 3I50L 2VUYA 3W11D 4ZO9A 3T0DA 1SYSA 1T03H 4RBPH 2FX8H 1DUYB 1WBYB 4QRQB 2YMXL 3MLUL 4G9FB 4IDJL 1X7QA 1NSNL 3B9KA 3VWJB 5I1KH 2ERJC 3S35X 1QG3A 3ZKXB 1HSBB 3ZE0F 3QDJB 3VGDA 2A6JB 1ZHNA 4OJFH 12E8L 4AM0A 2IPKB 2OJZL 3OX8B 5ISZA 5LXGL 1T2JA 4XB8A 4Z7UE 4DKDC 3U82B 5IMKA 3QUYC 2DQUL 4HKXA 1FH5L 3V5KB 4HWBH 5GGVH 2F5BH 1A6VH 1K5NA 5EPMB 4FQXB 1KOAA 5GS0D 2NY1B 3RWJB 2F19H 3BDXA 1DQML 4R4NC 4NZRL 1GGTA 2GYSA 1A22B 4JFDD 2VLKE 2X2YA 3TYGH 3RTQC 2R0ZL 4R7NA 3OAUL 3VFVB 4ENEC 1S9WA 2DL9A 2VLMD 5FUCE 1KT2B 1FFOB 3HI6L 4PLKD 1KIRA 1ZA3B 1GOGA 4HW6A 1CTNA 3LN4A 2G75B 1RIUH 4GAFB 3IFOB 4JREB 3RTQA 1HH9B 2AGJH 4NN6C 1A14L 1WWAX 1A6ZA 1WTLA 4YE4H 1CDBA 5AD0A 1NBVH 4XXDA 4U1GB 2FZ3A 1TJIL 2WBKA 3RGVC 1BBJA 5A2IH 4L3EA 4YHOL 1YMMA 4JHBA 3T0EE 3BQUC 2IAMB 4LL9A 1EHLH 2OMBA 5AEAA 3MA9H 4OGAC 3WJLC 4HWEH 2JELL 5B38A 3A6BL 3ARBC 3KLAB 1U36A 2V9QA 3LS5H 4W4NA 2CK0L 1BBDH 1A9BA 4ZS6C 3BP6B 3RGVA 3ULUC 4PP1C 1NGXA 3C09C 4MCYB 3BQUA 3TYFB 4Q9RH 4HUKB 2LTQC 1YJDL 1K2DB 1RU9H 2O5YH 3PWNB 3V79C 5T1DL 4XBEH 2OR7A 4MMXC 5C08A 5HYJE 1MAJA 5HHQA 1EBAA 2AJUL 1KXQE 1Y18A 4KQ3H 4IRSD 2BSTB 3F8UB 1NC2A 1YEFH 3GMOB 1A6UL 3NIFF 1LE9A 4G8IB 2EDRA 5JORB 2DQFA 1B0GA 2DOCA 4CMMA 2WQRA 2F54B 4P46D 3I50H 5DJDA 1HXYB 3B5GA 4ORGB 5SWZD 4HS3B 2FX7L 3E8UL 3X14A 4X4YA 5E9DB 1KLUA 3ARQA 4V2CB 5T5FL 4HFWB 5IFJB 2NZ9D 2YMXH 3MLUH 1T1YA 3MLRL 4IDJH 1NSNH 2HFFA 3QDMD 2OS7A 12E8H 2AKRA 5DEFB 2OJZH 4KRPC 5LXGH 5MEOB 2P24A 2DQUH 4GG8A 1FH5H 1I1FB 2H45A 5J6GA 4P2QA 4WEBL 4KK9D 4FXGA 2CJUL 5E2UL 2FL5B 3D18A 3QJHA 4IS6A 3V2AR 1BFSA 5DEGB 1VEPA 3HB3C 2DKUA 1FFPB 1QBBA 5DRXA 1GZPB 2X7LB 1DQMH 1W0WA 4NZRH 1NKRA 5FYJL 1OAZL 4N5ED 4MD5B 2OXHA 3PP3K 5JOPE 2AABL 1J86A 2DMCA 2R0ZH 5TE4L 3OAUH 3TGXA 3MJGX 3PP4H 4X7TB 3UPCA 4CRPA 3HI6H 2NY3D 3MJ7B 4PJFA 3EYOA 4GBXD 2LABA 4YHPA 1I1CA 3C60B 2VISA 3FKUS 3H3KA 2MFNA 5SX4H 3DV6B 1UEYA 3IGAA 5D5MA 4S11A 3PWLB 2XTJB 1D5XA 1XEDA 3H9YA 2B20A 5D7KE 1A14H 4LSVL 5DMGC 1F4WL 3EOAB 2OSLB 1A3LL 4N68A 3U7WL 5HVHC 2ADGA 4HK0A 2F5AL 3JWDC 1LD9A 1TJIH 3HUJF 1ES0B 2P5WB 4YHOH 3ARDD 5K33A 4QOKB 1S8DA 4M8QA 2JELH 3A6BH 5L6YL 3NZHL 4L8BA 2CK0H 3B2UD 3EJYC 1AXSA 4BKLA 3GNML 4JN1L 1OCWL 5B4MD 3ZE2E 4MNQD 4KTDL 1W0VB 4HC1A 1YJDH 2ADIB 3QQ3A 4JFDE 4LVHB 2HT4C 3V95A 1BD2B 1S7UA 2AVGA 4OKVB 1H9VA 3GSWB 2AJ3A 4IRJC 4RMVA 5CINL 5FO8B 3GB7A 4QNPF 3PWUB 5IB5B 5T1DH 3GMLA 4D0DB 1KLFA 4ISVA 2HRPL 4NFBA 4RDQF 3LV3A 2VLME 4R0LB 4NKOA 1CFSB 2AJUH 4PRBB 3GK8L 2BVYA 4RFOL 5L2KD 1SVCP 4M7LL 1T83A 1UWXK 5C9JA 3LKOB 2FNBA 1A6UH 2B2XL 3VE0B 2QTEA 3ILQD 4IRJA 1G7JA 2AJXL 1D6EB 1D5ZB 4OFYA 2FX7H 4NZJA 3BGFB 1QSFB 2JJSC 5T5FH 2R1XA 3DO7B 3CSBA 2FECL 1E28A 1HSAB 3MLRH 4DVBA 5EU6B 3QIWA 3LRGA 2ZOKB 5JLZA 3KPSB 4PJXA 4BSVB 1A7PL 5C0AA 3WS3A 1MOEA 1OTUC 2JJSA 2JB6A 4XCEA 5IBLC 3RNKB 4WEBH 2OYPA 4Z7WB 3ZDXE 5E2UH 2CJUH 5JHLL 3HPJA 1PY9A 2FEEI 3FRUB 3JUZA 5J11C 4Q9QL 4WI7A 1PZ5A 1V7NL 1BFOB 2F74B 2JCCE 5FB8A 5HXMA 5SX5K 4KRNA 2CDGA 4G42A 5FYJH 1OAZH 2CKBA 2EH7L 2R2HB 4WU7A 1YEHL 2AABH 1U6AL 5TE4H 1PDKA 2FLBT 3GMPA 1IMHC 1AGDA 1MEXL 3MV11 5TDNB 1VENA 2IH1A 5L8JB 5MHSE 2AI0L 5SWZE 1WIOA 3ORJA 1PFCA 1IGJB 4LSVH 3S96B 2VLLB 1LEKB 1F4WH 1JZ7A 1A3LH 3U7WH 4R96A 2V2WB 3EDEA 2F5AH 4PJCB 2NY4B 5IB1A 4FXKB 4XB7A 4OZFB 4J23A 2W59A 1IQDB 1FFQA 4PJHE 2P8MB 1AC6A 3QI9A 4WCYL 1W8NA 5FGCB 1JV5B 1RMFL 5L6YH 4PJEF 3NZHH 4XHQA 4OF7A 2ICWI 1MCIA 1ZLVH 2FYYA 3GNMH 3DTXA 2VC2L 4ZQKB 4JN1H 1OCWH 3J7HA 3MBED 1YNTA 2VKWA 3IDMB 4QEGA 3NCMA 4TUKL 5IBUB 3ECBB 1KACB 4KTDH 4C4KT 3BHBB 4LCWA 4LF3A 4X4XA 2A83A 3EO1A 3GMQA 3QXWA 5CINH 3V6BR 3M17B 5CEYB 3SGKC 32C2B 2HRPH 4M93B 4EN3B 1KJMA 3FRPG 3E2HB 3FB7A 2X09A 3GK8H 4RFOH 3QXTA 4M7LH 5TF1L 4J7RA 3WUWA 1DBAL 1NBZB 1B9ZA 5GGRB 1MHEB 5DJ6A 2B2XH 4ZUUA 1WCQA 2AJXH 3HPLB 1A0QL 1UH3A 4XAWL 3ZZ1A 5DMIL 3E6HB 3VFMA 5EU4B 1UCTA 3QNXB 1X5XA 4F33B 3G08B 3MLYH 4GKZA 4MS8C 1WFNA 5E6YA 5LG1A 3VDAA 3CFJA 1XH3A 3OMZA 4K8RD 4NWTL 1KFAL 5J12B 3FN9A 3D25B 5D1QD 3CVHA 4S0TD 5IJVB 2WBWB 2DIJA 3O4OC 1A7PH 4Z7UF 5IEKB 1QFHA 5JHLH 4LEOA 2IH3B 3ARVA 4Q9QH 3REWA 3DYPA 1V7NH 4HUVA 1J18A 5MEQB 2EH7H 4LDEB 4GLRI 1DN2A 1YEHH 4HX1A 1CFTA 5D7IE 5TQ0L 5K9JL 1U6AH 3EGSB 1K3ZA 1YN6B 3O6FD 3NFNA 4WO4D 5GHWL 4NOFA 2IALB 1TPXC 3BPCA 3U1SL 5GS2D 3DSNA 1MEXH 2HG5A 3FTGB 1EAPA 3KPMB 1U3JA 4QHMA 4OV5B 3QUXB 4Y5VC 2R9HC 1NMCB 4GG6F 2AI0H 2X44D 2VE6B 1LO4L 2HVJB 4PGEA 1I8IB 5HHMB 4HUXB 3ZKNC 1CIUA 4RAHA 4BQ8A 4P4KB 3HZYB 1YC7A 2XNAA 1FGVL 3EO9L 3JTSA 4Y5VA 4I2XA 4LMQI 1I7RB 3HE7D 1HINL 1N2RA 3RVUD 2L7UA 4WCYH 4LNVA 3ELAT 1GC1C 3WFDL 1HKFA 1RMFH 1UB5B 2DF3A 4PGDA 5C0EA 9CGTA 2VC2H 4X6DA 4O2FB 3CU7A 4ZO7A 5C86A 1QR1A 3IVKB 2DN7A 4TUKH 3DUUA 1YDPA 4HV8B 2P1YA 5K9QI 4XCNB 5IVXE 1XCQA 5A16B 2R8SL 1A8JH 1MH5B 3PJSB 2HJLB 3RZCC 1QVOA 3U36B 2VJXA 1D5IL 1MRCL 5TF1H 4IOIA 1JRHI 2EDHA 1DBAH 5IEHA 4POZD 3T77B 1FSKB 3WCYA 1A64A 4XAWH 4DN4L 3UYPA 1PD6A 1VGKA 5DMIH 5BQ7B 4MAYB 3E3QC 1NGYA 3VXTA 3RZCA 1FYHB 2IQAB 5IW6A 1X3DA 1P6FA 2BXZA 4QHLA 4OQTA 4NWTH 4NO5A 1L9MA 1KFAH 3MV9D 4PFEA 2FJHA 3WFEL 3STZA 4NSKB 2Y5TB 1ORQB 4QRRB 1U95B 2OXGA 4HKJA 4K71C 1EZVY 4KROD 5C8JB 1QRNE 1N3NB 3D6GA 5C71A 4NWUL 1CVRA 4OUUB 2Z8SA 5FGBA 2PXYD 3K8LA 4TTDD 1CXEA 3NZ8B 1LP9E 3GMRB 1RIVL 4M4RA 5TQ0H 5K9JH 2DLHA 1KGCD 5GHWH 4QYOB 5I9QC 1JNHA 1WWBX 2YD8A 2YD3A 5EU7E 3DXAB 4G7VL 4L4TE 4NQDD 3OAYH 1IEHA 4U1JA 3BJLA 2D31B 2DM3A 5C0IA 3S97C 5DYOB 4DKFL 1LO4H 3FT4B 5KAQG 1NFKA 1UC6A 5CLWA 3OHXB 3VXUD 3ZT7A 3IJYB 5ID1A 4DN3L 5L0QB 3D48R 1BQLL 5K93A 5BS0B 3P0YL 1FGVH 4XBPB 1WCBB 3EO9H 4OF8A 5JW3H 3O8XC 1HINH 4S2SB 4WEUD 1CZ8L 2AW2A 4O2CA 2YWYA 4LPWA 5HHPB 2BOBA 3WFDH 4ZUWA 3VI4E 4CVUA 4QCIA 5GRZA 1P5UA 1S7XA 4OF6A 5EOTA 4XNUL 4L4VD 5DJ2A 3OKEA 2G9HA 5D4QA 5CBEB 2APFA 2MHAA 3Q6FA 2K3TA 4BFBD 3ZE2F 2X4OB 3O8XA 5IW1B 2C26A 2C1OB 4LCUA 5F97E 2VRAA 2R8SH 3TZVC 2X10A 4G9DA 3NFPB 4NCC1 1D5IH 1MRCH 2VDRL 4RQQB 3K1KC 4W6WB 1ZKAA 4OAWB 5BRZD 4DK6A 4CAGA 3LKPA 3UPAA 5ETUB 1MJJB 5IR1B 1CCZA 4DN4H 3TZVA 2KL6A 2PKDA 2YBRA 5D7LB 4B50A 4PJIA 4UV7L 4YGAB 4N0UA 4V1DA 4WI5A 2CDFA 3F7VB 1OAXL 3RWEA 4IRZL 4Z18A 3HTLX 4JM2C 4U6HA 3WFEH 4L1HA 4OBRA 4F7MA 1JZ4A 4JR9L 5E8EA 1ZHBA 3CPLB 2X1XR 3SDCD 5IP4A 4RFEA 5I17B 4FFWD 1IZKA 4CVWA 4G8FA 5F93C 3PDOB 1GPOL 3ZDXF 5CJOL 3G9VA 4NWUH 1KJVA 3KWWA 5HHNA 1I7ZA 3DMMC 5F96H 3OF6D 1ZWIB 2JCCF 2OJEA 3WKML 1RIVH 2DYPB 2APVA 3RVXC 4EEEA 3L3OB 1H3TA 1U93B 2YUZA 1LQSR 3NPZB 1FVDA 4QRUA 1U8OA 3DMMA 4G7VH 1HZHL 4YEFA 3K46A 1ZT7B 1J0YA 2CSPA 5JA8B 2R0WL 5HDLA 3DBXA 4ZUSA 5DJCA 4NHUA 3VRJA 3SKNA 4DKFH 4ZPTA 2BSRB 4JRXE 5F9DC 5LWYL 1IEBB 1VGEL 3BZ4A 4MJIA 1CI5A 4FOMA 2ESVA 2PW1B 4LU5L 5KJRH 4QGTA 4DN3H 1E4JA 3QXAB 1AD9A 5ANMB 5I6XC 3MV9E 2GJJA 3OSKA 5E8DL 1BQLH 2EYTB 3P0YH 4DW2L 2W38A 2I26N 1J11A 5DVOA 4KMQA 3N50A 1CZ8H 1OAKL 2GJZB 5DVMA 4ETQB 4PJHF 4PRID 1AXIB 3VXNA 4XNUH 4BZ1L 4X8JA 3SPVA 3LQZB 5JOFB 1I4FB 1ZVHA 1T1ZB 5A2JH 43C9A 4ZFOB 2GT9A 2HTLD 4WI2A 1KGCE 1JYWA 3O4LA 1G7QB 3WLBA 1DQQA 2X4QA 2XN9B 4NQDE 3FFDB 5DQDL 2VDRH 2I9LA 2PCPA 3UTSD 1T1XB 4ELKB 1WICA 3V7MA 3JWDL 5EBMA 2ZSWB 3Q0HA 5KG9A 3VXUE 5J06A 4HC1L 4QF1A 5CIPB 1QP1A 4RGNB 4UV7H 3IJHB 5T1KA 1P7KB 2ADJB 4OIAA 1OAXH 3SQBA 2B1AL 4OZIA 4IRZH 1WVZA 3MV7A 1YYLL 2ZOLB 4CNIB 3ARFB 5HYQA 1P84K 4JR9H 1S5IL 3X12A 5F3BA 2GK2A 2V7HB 3SCMD 1IGYA 3CFKA 4ESKA 3DLQR 3GSVB 3VCLB 1GPOH 4NJ9L 5CJOH 4JFEA 2QADB 3K2UL 5DK2B 1NAKL 3MRLA 2RGSA 1MIEL 3ZDYE 1MUJA 4XNXL 1XF3A 4I8DA 5C6WH 4GQ9L 3WKMH 1M71B 1XGRB 5DRWB 5IIEA 5F9OL 5D7IF 5CEXA 2G5RA 2DKMA 3SO3C 1N26A 2AJZA 5BRZE 1UXWA 1HZHH 1WBZA 4CW1B 4Q9CA 3JTTB 1RJLB 2CDEA 4OZHE 3ZKMC 2YKLL 4QXTA 4QRSB 1XIWB 4FRWA 4HDIA 5LWYH 1VGEH 1P7QD 4BZ2L 5IB3B 2ZCKH 4LU5H 2CKBL 3GSUB 3LS4L 3S37L 5E8DH 1WFOA 2HLAB 1LO2L 2GFBB 4DW2H 2BP3A 4CMHC 5KVEL 1NFDA 2PNDA 2BVOB 3S5LB 3MFFB 4XNMA 1OAKH 1SEBB 2A6IA 1J8HA 2J6EA 1D9KB 2P48B 4UQ2A 1A21A 4Z76A 4BZ1H 4D9LL 4MHHG 3L9RA 3D3VB 4KUCF 1TCMA 3WLWD 3B9EA 1N5AB 4Y19D 4E0RA 2JIXD 3TNMA 3ULVC 1O5DT 4JY5L 2VL5A 4LBEB 4YBLC 3ES6A 7FABL 3VGGA 1H0DA 5KANI 4JKKA 1VFAA 1XGQB 5IVXF 4ONHB 3C5ZC 4K7PX 5I1EL 1I1AA 3T3ME 1T80A 1IC7L 2H26A 1GGUA 1YEIL 4HQQH 1RZJC 3L3KB 5DQDH 3TN0B 5LAXA 1JN6A 1IC5L 1JWMB 1OP5H 1OP9A 3JWDH 1IL1B 1BMGA 3KG5A 2P43B 5E4EC 4NN7B 1IAOA 4JRYA 4HC1H 5IM7A 2MQ3A 3MNZA 5T1LB 5CSGA 5HHOB 2MKWA 4CU7A 3QIBC 5D1XC 5DVKA 4KV5E 2B1AH 5GQBA 1YYLH 1M7DA 3LOWA 4EUPA 5D2LA 1WFUA 3IJSB 1DBBL 4OQ1A 5B3JE 1S5IH 2OL3B 4TNVK 1G7LA 2EDQA 3D85B 4PRIE 3AS1A 3QIBA 5D1XA 2EC9U 5HI5D 3MUGA 3QWQB 4HAFA 1SYVB 4NJ9H 1JFQL 4BH8A 4DTGL 5E24E 3K2UH 3MRRB 4IMLB 1NAKH 3K4DA 4PJ5D 4JFPB 1MIEH 1NH6A 4P5MB 5DWUL 3BPNC 4XNXH 3N06B 4BSWA 5DD1L 4GQ9H 3K7UA 3D0LB 3HNVL 5D2NB 1LP9F 1MHHB 5DT1L 3CVHL 5F9OH 3FO1B 5EZIH 1J10A 2GSGB 3UTSE 3MXVH 2YSSB 4X4ZA 5J13B 1IM3A 1BREA 3C8KA 3BRGC 4EI5B 4W6XB 1GRWA 1PQZB 1OP3K 3FT3B 4ZAKD 2YKLH 3GBNH 3QDAA 3O3DA 1RJZA 3L1OL 2VZ1A 4FQLL 3M07A 2CKBH 3G04B 3LS4H 4LKXB 1MJUL 4PREA 3S37H 1LO2H 1CS6A 1N6QL 4KUZL 5KVEH 4LAQL 3U9UA 5T3XD 1OY3B 4ZYKA 2ILLA 4WHTA 3ZO0A 2N4IA 3VI4F 3DX6B 5CEZE 2E8ZA 3LVEA 4D9LH 3BYYA 4KRLB 2VL4A 2IJ0C 4GRWE 1MI5D 5ILTL 4AQOA 4PR5A 4JY5H 1RK0B 2K9UA 4PLNC 2XWTA 5ESAB 2WM0A 1G9ML 5I1EH 5FM5O 5B21A 4JDTL 1U41A 2PYEE 4JKPH 1JK8B 4E41E 1IC7H 5E2JA 1YEIH 5ITBL 4PRPB 5D7JD 5ALBL 4Z0XA 3H9SA 1IC5H 4YDKL 1V5JA 5F7EL 2NXZB 4G43A 3WO3B 2YOCA 4LLQA 3D0VB 5ACZA 3DNKA 4OKDA 3P2TA 1GC1L 2E9WA 4NHCL 4P59L 5I1HL 1U58A 4PLJD 4JY6A 3RI5F 1NDMB 4PGJA 1KBGL 1WZKA 3EO0A 4WTWA 3TBSA 5DJ8A 4TQEL 1DBBH 4RIRB 4PB9L 4M9PA 1H5BC 3HRPA 4N0YL 1EMTL 1GOFA 4LPVA 5IF0A 3BW9B 4PG9B 2QSQA 2J8OA 5KZCB 3NCYP 2CD0A 4U1LA 1ZHNB 2N7BA 4U3HA 1JFQH 3G6DL 4DTGH 3OKDB 4Y19E 3EYVA 4UBDD 3H2WA 5JXAL 5DWUH 4OQTL 3R1GL 3JV5A 2ERJB 1PZUB 2CO6B 5DD1H 5IJKC 3QUMA 1DZBA 5DT1H 3HNVH 3P9LB 1JGDA 3PV6A 3CVHH 4LDLB 4WI8A 4B41A 1HCFX 1LGVA 4G6FB 3QUYB 3QIUB 4MZ2A 1DLHB 2X4TB 3KNBB 5C1MB 1YEGL 4PB0L 4PTUA 3HLAB 2EO9A 4NC2B 4HD9A 3MRIA 5JW5A 3VXMA 1R3IL 2A2QT 4Z77B 4AK1A 2B8OT 3LB6C 2BVUA 4LSTL 4M3KB 2NY0D 3FN0L 3L1OH 4HK3J 4FQLH 4OCXL 1QSZA 5JW4Q 2CLVA 1JGEB 3RTQB 1NCWL 1MJUH 5HTSA 5E6ZA 1N6QH 1LO0L 4KUZH 3OKKA 1CVSC 3ARZA 3BKJL 1U8QA 3B4NA 4ZSOE 4LAQH 3TO2B 5F1OB 3HR6A 3RPIA 4X98A 1G9NC 1U8LB 4L3EB 3AAZA 3QQNA 2KH2B 1RD6A 4OCRL 1UT9A 3E6FB 5JHDD 3MX0A 5DO2D 1UH4A 3SE9L 2NY7L 4PJ5E 3EYQD 3NN8A 1N6UA 5ILTH 3MRJA 3G5ZB 3OKLA 3RGVB 3AMKA 4G8EA 5I1CL 3BQUB 1G9MH 3KYMA 4JDTH 3PWPD 1MREL 3SDDD 2IANB 5HY9A 4JO1L 3TBTA 5DHVA