5J4MA

Crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg - e269a/d295n double mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
264
structure length
264
Chain Sequence
TTQNVVLTKYGFDKDVTAIDRATDQIWTGDGAKPLQGVDFTIYNVTANYWASPKDYKGSFDSAPVAATGTTNDKGQLTQALPIQSKDASGKTRAAVYLFHETNPRAGYNTSADFWLTLPAKAAADGNVYVYPKNVQKTTYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVATNVPDGYDAAANTDFKADNSSSDILNAPSGILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
molecule tags Cell adhesion
total genus 58
structure length 264
sequence length 264
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j4mA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j4mA01
3LV3A 1RZ7L 1BD2E 1PG7H 3MRMB 4KQ4L 1SJEB 4KHXL 4QNPE 3JTSB 4LBEB 4YZFF 3UJTH 2ORBH 4OT1H 3UC0H 3RY6C 4WU7A 4MJ2A 1S9WA 1OTSC 4Y5YB 5K59E 1R5WA 4FQJH 3WYRA 4A6YA 1ND0A 3RX7A 3D9AH 4Z7UF 3V7AE 3ARBC 2EEAA 4JPKH 1KPVA 5IHUH 2R39A 4OLEA 4X7TB 3THML 1XMWA 5B3NA 1QSEA 1B2WL 3IXAB 1SYVA 1UEYA 1FPTL 1OTUC 3CNKA 1FIEA 5CILL 4M5ZL 3ZYZA 1ZHLB 5KS9A 1MRCH 4ZFGL 2E27H 1K4DB 2YD2A 3BQUC 1V7NH 2G9HB 1WWCA 3BO8B 3QHFH 5JQ6H 3ZE0F 2CLVB 3HG1E 4JG0H 3UMTA 4FQHB 2H3NA 4Z95L 2V2XB 3W0WE 1Z9OA 4LHUA 3LB6C 4MDIB 2FO1A 2AABH 3DHMA 4K3HA 1NGPH 1U92B 3E6HB 3G6AA 2FX8H 2H9GA 5L6YH 4JGUA 2FHFA 3C6SB 2AXFA 4QHKI 5ID1A 1GXEA 3FQTB 3R06B 5C1MB 2VDPH 2YRZA 5I1CL 3RA7L 2DRUA 4XC3L 2OI9C 3KYAA 5T1LB 3LQMA 3NVQA 1M4KA 4XCEB 4KZDL 5E6IB 1F4XL 3CSYA 3DV4B 2HT4C 4FXGA 4KQ3L 4OLXL 5GRXG 4KRMB 3FT2A 4R3SB 4W4OC 5EZJB 3S4SA 3QIUB 1WICA 1BFVH 1NGZB 2XZCH 4Z0BL 5MENA 5FYLL 4PRHE 1BZ9A 1MFAH 4H0IA 4WWKC 3CVHA 1FBIL 3I6KA 5AZ2H 1TVBA 1KB9J 3QDMA 4IMLA 1XIWA 1RZGB 1GZQB 2JB6A 4K2UL 2DQDH 1FYTB 4P9HL 5SX5H 1UZ6F 4FMFA 4FQCL 4RQQA 3VGDA 2QQKH 1G7IA 3FQNB 3LS5H 4NM8H 3S37X 5A3IC 4P49A 1LVEA 1KTDB 4EEEA 1HXMB 3EJZC 5IFHL 1ES0A 1QEWB 3HAEH 4KWUA 2XRAL 4KUZL 2JJTC 3MACL 4Y16A 3D2UB 5J11B 3MGTA 4HH9A 4PG2A 1DL7H 1EFXA 2GK2A 3QULA 2BNRA 5D2LA 3QIWB 4FRWA 1NJ9A 4G6KL 3D69B 2J5LC 5H35B 4HEPG 4AQOA 2W9LA 4X6FB 5HHOE 4XAKD 5LBSH 2NY3D 2NY5C 4LSSH 4PP1C 3H0TB 3O3AA 4B41A 3DRQB 5GGQH 4WHDA 4U6YA 1JTTA 3I9GH 1JNHB 1RI8A 4LLWA 3SHSA 3UTTA 3O8XD 5JUEH 3MUGB 3MCKA 5DJYB 3OB8A 3K2UL 2FECI 3QCTL 4JGMA 2EIEA 4UT7H 1RUML 1N5AA 3HE6C 4FP8L 1NFKA 1KT2A 3FB6A 2XWTA 5HJ3B 1I8MB 4PJ7A 3VFUA 3C5SA 3MYJA 2EEBA 5D1ZD 1KC5H 2W0KA 4EN3A 1TETH 4HDIB 5HHMD 5JW4Q 1OGAB 1JWSB 5EZLA 1PBYA 1EPFA 3RTQC 3B2VL 3MFFA 1DDHA 4RA0C 2OJZH 1PSKH 4O58L 4RFOH 3U1SL 1CXIA 1G7QB 4CMHB 4LARL 1WSST 5I1KL 4J7RA 5H2BB 4YAQB 1A6UL 2ZPKH 1MCKA 3QXUA 3DPBA 3VG0L 2NX5E 2DLFL 4JRXE 1IM9A 4ZS7L 2E8YA 4X5WA 3Q3GA 1RURL 1U58A 2AK4B 3EDKA 3CDCA 5FA4B 5IROA 2B2XL 2EDWA 1EAJA 3KAAA 4G8IB 4NNYA 5SV3A 2X1OA 1I9IL 2AXJA 3SE3A 1NGXA 4YHOH 1TITA 1ZLSH 3PV6A 3PQYA 1RZJC 4ZPVA 1N7MH 5BZDB 3RNQB 3ULUH 1PZ5A 3LQAL 2DQGL 3SO5A 3U4AA 3PL6A 3WD5L 5ITBH 5JXED 4IRJB 1DBKH 5EOTB 1JPGA 1F6AB 3OKEB 4NKMB 5E9DE 1FRGH 4G8GB 1MFCL 5GS1B 2R4SH 4YX2L 3U36B 1HCVA 2X4TB 4Y5VA 2EO1A 1T5XB 3HE7A 1RFDL 2AK1L 2GJZB 1BGXH 1BIIA 3F7VA 4NM4L 4FQLL 2HRPH 4M8VA 5BCAA 2DICA 3ZYIA 3FT3B 4JDZA 1CIUA 4F15C 4F2MA 3IFOB 1QBLL 2VDLL 3MA7A 5TDOB 4PJBA 3KHOA 4FN0A 5KG9B 3WNNA 1G0YR 4M43H 4MJIA 1JYWA 5IW3A 2BRRH 2OYPA 3O0RH 1WISA 4ELMB 3LH2L 5I1DA 3WIFB 2BZDA 2KH2B 4DGIL 1WEJL 5DZNA 1KB5B 3KJ4B 4LFHD 2B8OT 2ZUWA 3VD7A 3DSFL 2X44D 3JUYA 4XPAL 4MAYA 5C6TH 2HH0H 4JPVL 4W81A 2DQCL 4ZQKB 1QRNB 4MJ6A 1T4KB 2HLAB 3LCYA 5IK3A 5BV7C 1A3QA 1GGCH 2EDXA 4ZO6A 4KJQC 1S7WA 2XG4A 2W92A 3BEVB 3DIFA 1YY9D 2EKSB 2UVEA 1R5IA 4YZFE 4I8DA 4JFHD 3I02A 4D3CL 1KN4L 1EEZB 2HN7A 4LLQA 1BX2B 4P5TA 1JNNH 4J3WA 3QUKA 2IPTH 4RGNE 5C7XH 4PJDB 1NMBL 2ESVE 3G04B 4PTTA 5T1KD 5JORB 1JPST 4H1LA 5TGBA 4PJ5A 1OY3B 4Z7UE 5GRUH 5HVGB 5GISL 1BBJA 2I07A 4G3YH 3DXAD 3K80A 4MXWH 1YA5A 3UAJD 3MOAH 1P7QA 2ZJSH 1DQDL 2AKRB 3AY4C 4Z7VB 1CVRA 2X6MA 1MIEH 4K94L 3DNKA 1T0PB 5CP3A 5CD5D 2GK0B 5EORH 1ZGLM 3RL1A 5DJDA 4HJGA 3FAWA 2NXZC 3QCUL 5HD8C 3G6JF 5E24E 5KANG 4KI5C 5KVGL 1JZ4A 3QHZH 3QUML 1U3HD 4IRZH 2WNGA 2FLBT 3WFCL 4L4VB 1FE8L 4CADB 3PHQA 1U8LB 2YMXL 5GIRB 4WHCA 3ZE0E 5GS0C 1RU9H 2PTTA 4FQXD 4XBPB 4JFEB 4U05A 4YO0B 3QNZB 5CCKL 2IQAA 3GMLB 5FHAL 3HN3A 4W6YB 1B4JL 4N8VG 3HCVA 2AI0H 1CBVH 5CZVL 1F5WA 3QAZB 3EW3B 1GGIH 4S1QL 1U3JA 2GHWB 4P3DA 1H5BB 1A4JB 1SYSB 3T2QA 3NFPA 4XPGH 1UH4A 3QFJB 3A6BH 5IEKA 1LEGB 4NQVB 4HK0B 4GAYB 1EO8L 2H26B 5DI8A 1A1MB 4NJAL 3SJVB 1R24B 3HA0A 4WU5A 3VRLF 4YBQC 1EGJH 4JRWA 3RWHA 4RMRA 3GBML 2VL4A 3FCTA 3O41B 4HEME 3VMOA 2Y5TA 4P4KB 4DN4H 1Q94B 2BFVH 2ZCLL 3MQIA 1D5ZB 4HWBH 2HFEA 3GSQB 4I0KA 4GKSB 4L8SB 3FFCE 1CFSA 4BSWB 1BOYA 1UZ6E 4YXHL 1Y18B 2BVPB 5KVDH 1C8PA 4FTVD 4KRNA 3V4UH 2HA1A 5LQBL 1HINL 4M1DH 5EIQA 5HHXL 5JW5B 5EA0L 5EUOF 3HG1B 4HZLA 3W0WB 4E0RB 3QQ3B 4OIIL 3VW3L 4ODBD 4V1DB 1UZ8A 3EYQC 2NY1B 3C5JA 4KJWC 1KTLA 3GKZA 3HC0A 4PFEA 2VDNH 2CKBL 1ODAA 2FX7L 2Q8AH 4HXAL 4PD4K 1IARB 35C8L 1HHJB 3V6FB 3MJGX 3QEQD 3BE1H 2VABB 2FGWH 3CU1A 4WNQB 5J7CC 3FZUD 1U8PA 4XMKL 4F8TA 1KV3A 1P2CA 3QEHB 5ISZE 1G0XA 2NZIA 1I7RA 2BJML 1JWMB 4KPHH 4EUPB 1U41A 4PRHB 4M48L 3X3FL 1JGVH 2CRMA 4S1DD 3HC3H 2AEWA 2E8ZA 3OAZH 5JR1L 4NHCH 4G7VL 3BP6A 4NZDA 4QTIL 4LVOC 5KSBE 4Y5XB 1T2JA 3GO1L 3X11A 3O2DA 1T7YA 4LSQL 4QF1A 4WHTB 1F6LL 3B9VA 3Q0HA 4WEBH 5JQHC 4BYHA 3FN0H 5J6GB 3VWKD 2Y6SD 4I18B 4ODTH 5J1AB 3JWOH 3S96B 1N8ZA 1IAII 3TCLB 3M07A 4NCC2 2XN9D 3BPCB 4TOYL 3IGAA 3O45B 1A6ZB 5IV2A 3VGEA 4QHMB 3LPWA 3KPLB 1FZKB 2YZ1A 3C5ZC 3SE9L 5DMKB 4C57C 2QADC 1KJ2A 5E2JA 4NO2A 1LE9A 4DGVH 3ZT6A 3ARTA 3CK0L 1NCBH 1FGVH 4N1EA 4J2XA 3DUHA 4OFPA 5GRJH 2ZSVB 2MKWA 4N90D 5HVFB 4PJXA 1JZ2A 5F1NA 5AD0A 2A1WH 3P77B 4MA7H 4FXKA 4WW1A 3BD3A 1KIPA 4LEXL 1EAPA 3GSXB 5EUKB 2JK5A 3PDDA 2Y06H 1NCAH 4P4RB 1EV2E 3VE0B 2NR6D 2ZUVA 5FECB 2B1HH 2QLVB 1G9ML 2YXFA 2I60H 3RX5A 4H8WL 3WDJA 4L9LA 1GPOL 3QCVL 1O7SA 4L9DA 4RAVA 2D4DA 3C6LC 4NO3A 3ZKNC 4OI9A 3UJIH 2NX5B 3M17B 4YHZL 4JRXB 1GIGH 3MRLA 2BNUA 1DVFA 4PR5A 2X4UB 3O6LH 4AK1A 3LHPH 3C09B 4OZFB 2VQ1B 5DHVB 4Z0XA 5HHPA 4QOKE 3IDYB 2R29H 5C0CE 3VXMD 2NY0D 5BO1H 4JM2A 2IFFL 1R6VA 3LKSB 3O9WB 4M03A 2PXYB 2BY0A 4OF6A 4GT7A 4PGDA 9CGTA 4F7PA 3ULVL 1T0NB 2R56L 1MJUL 2XZAH 3DYPA 4X9IA 2Z4QB 1NAMA 3B5HA 3L3DB 3PXHA 3RP1A 5JZ7C 2IQ9L 2FYYA 1LO4L 5E9DB 4NGHH 4JY6A 4Y5YC 3WLWD 1LEIB 5EU6D 4S1SH 2NMSA 2ICEB 4LAQH 2DQFB 4PV8B 1IM3A 3MRCB 4LSRL 2EXYD 3P4NA 1F3JB 2MHAA 2W9EH 4V2CB 5DD6B 4PY7A 4XVSH 4KGLA 2YC1A 3WS3B 1V3LA 5I2IA 4TULH 1I1AD 4LEOB 2VXSH 1JUFB 1KSRA 1VACA 2Z31B 1M7IA 1NANH 4M8QA 4EUPH 3IJHA 4L3AA 1JNJA 2BVOA 2DOCA 2PW2A 2EDEA 2ICCA 4KKLC 1FDLL 1T3FB 1XF5A 4JN2A 4YHNA 3DX9A 5AWNH 1I1YA 3KDMA 4I0PB 5SX4H 5HHQA 3LKRB 4J3XA 3G6JE 4Y1AE 1CR9H 3EYFB 1EXUB 4UB0H 4FZEH 4Q9BA 4ZXBB 1G6RL 3MRHA 3U9UB 3V79C 3ARPA 3TFKD 4MX7A 3RY4A 1OSPH 1QSFA 1MHHB 2FD6H 4IRSB 4Z7OF 3QXAA 4AEFA 5L0QB 3ROLB 2UZIH 1XFPA 1A7BA 4M5YH 1BF2A 4MNGE 3UBXB 1BM3H 4R0LA 4X7SH 5J1TC 2EYSB 3OG6B 5D5MF 1CL7I 4NRZA 5D1ZA 3TIDA 3MBED 4JFOB 4R7NA 1TQBC 5D70H 2XFXA 4DVBB 4ODUB 1I8LA 5EU4A 1D6VL 5CEYB 4AIXA 5HPMB 4O2CB 2EKJA 3IDIA 1RK1A 2ESVB 1ZLVH 5BMFL 1UACH 3QIUC 5HYQA 3VRLE 1TCRB 4PJCA 4C56D 2R2HB 5ID0A 4NQDE 5FUOL 32C2A 5I73B 1ETZA 1RIUH 1AO7E 5C0BE 4OAWB 4JHWH 4LSTL 3TYFA 2P8MB 1RUPL 2XOTA 3MYZA 3BKJL 3HPJA 4AL8H 1QLRB 2IF7A 3D3VB 3TPUB 2DBLH 4PJIF 1NC4B 1FZJB 4I48B 2BXYA 1U8HA 4Z8FH 2RHEA 5D1QB 1MJJA 5C0DA 4QHLB 2Q7YA 4TSBH 4LQFL 5IW1B 3MRPB 2NXYD 3CFKB 4XNYL 3TV3H 1JYXA 2VJXA 3ZTJH 5IBLD 3B2UC 5BW7A 5EBWA 4YC2B 2J8OA 1JZ3A 3NACL 3WUWA 2YEZA 1A8JH 4JKLA 3CH1B 2H2SC 2IG2H 25C8H 3QIWC 4L3ED 3B9KB 2ED8A 4FFWC 5I74C 2GI7A 3OKDB 1D5IL 5HYSA 5DQDL 2UWEA 4BFEA 1N3NA 4G7YL 1ZXQA 4HKZA 1UKSA 4ZDHB 4OZFH 4Y4FD 5DHVH 4PB0L 3SDCC 4KKAC 1IC5H 1Q1JH 2E6JA 4NHUB 1NFIB 5GXBB 1LEKB 5HI4D 1KPUB 1YEIL 1YPZA 4JPWL 2DI7A 5BVPH 4U3CA 4YBLC 2ZSWB 2V2TA 3QWRD 4GOSA 2G75A 3FO0L 4MNQE 4K3DL 4X9GA 4OCWL 3FT4A 1I8IA 2C4XA 4YEFA 1W8OA 5DF0A 5IB1A 2HG5B 3Q5OA 3QZWB 1NGYA 1P9MC 3RGHA 3AMKA 1U8JB 2FL5A 2HVJB 3FFCB 4CVXA 5DJ8B 5IWLA 3EDFA 4ISVA 3R8QA 4MXQD 2YXMA 3E6FA 1I9JH 4ZTOH 4Z77B 4ZNCD 2LTQC 4G6AD 5B39A 3O4LD 2BDNL 3T2NH 3KS0H 3TGXA 5DUML 5MEPB 2YUVA 4QRUB 3CXHK 4WFEE 1T80A 1VFBB 4QXUH 5J56B 1ZGLB 2GT9A 1OCWH 3TJHD 4C4KT 3PWPD 3SGDH 4HV8A 1INEL 5C2UB 2GJ6B 3KPSB 4M1GH 4C83B 4DWHA 5T3XH 4HT1L 4IRJC 5ESQA 3HRZA 2OBGA 2YK1L 2R0LL 5MERB 1PX3A 1RZIA 1F4AA 1BFTA 1U8OA 3DXAA 4OLYH 4YUEH 5LAXB 5I8CA 1DLFL 1PKQE 5D1XC 4BQ8A 2OR9H 3CVHL 4JY4A 5ISZB 2WUCH 1A9EB 2NY4B 5GGSB 2P49B 1A47A 1NGQL 4O2EB 4E5XB 4ZYKA 1NMCB 2VL5A 1LK3L 4YQXH 2QSTA 1U3HA 1MPAL 3SGKC 5KSBB 4K3JH 3VFGH 3RUGB 5DLML 1Z5LB 2VR4A 4XP1H 1MOEA 4U1SB 3LEVL 1UWEH 2D3VA 3FRUB 1W72L 5J9PA 4PBVC 3IAQA 1E27B 2L0DA 4K9EH 5ETUA 3N85H 1FNFA 4NZTH 2J12B 1Z3GH 5JOPD 4NQCE 4ETYA 3O6KL 5IEHA 4OLWL 3UXFA 2ZZUT 3EOAA 4I77H 1BJMA 1DEEA 5DD3H 2DS4A 1MAMH 4NO0B 4G42A 2HP4A 5FGBA 4FA8A 1JZ8A 3L5HA 4TTDC 3T04D 1CDHA 3GI9L 3G6DL 4YEEA 1R3JA 3TH3T 5J12B 2W60B 4U33A 2Q6WB 5EO0A 4L8CA 1NMAH 4PGBA 3H3PL 4GSDL 4Z7WF 2AEQH 2NY6B 1W2KT 1IC7L 2KL6A 4OSUH 3Q6GL 1MCWM 3V7MA 4F7MA 2CJUL 4PP2B 5DRZB 3ECBA 3NFNA 4QCIB 3MNZB 1L7TH 1F97A 1YEJL 3C60D 4PD4J 1YEKH 1DZBA 2HWZH 4CU8A 4HKXB 4FTVA 3MJ8B 1BJ1H 4PJAF 5LCVH 6CGTA 4OBSA 4ZUTB 2A77H 3LIZH 3H7BB 3JWOC 1PEZA 4ZOCA 1P7KA 3MUHL 4RGOH 5H8DA 2X4QA 4OJFH 4JZJB 4QHUA 3BJLA 4XNMA 1FFOA 5FK9A 5GGTH 4LNRB 2F74A 5J6HA 5LGJA 3RGVC 5K33A 2VLLB 5FO9B 2MMXA 5KN5A 3ZL4H 4MHHI 1FNLA 2ZP0T 5J57B 3DO7B 2F5AL 1MIML 3SDXF 4X6CF 4B53A 4NQEE 2VUOA 1OP9A 3HUJF 4PS4L 5E2TH 2B5IB 4WW2F 1YNTA 2XNAA 4PJ9B 3OAYK 1UVQB 4QRSB 4UT6H 2LV4A 4QOKB 5JO5A 1WZKA 2X4OB 5CJQL 5C0CB 4Z7OE 4OQ1A 3GMRA 4KZEH 2F5BH 4NOBA 3QAZC 4JRYE 4OB5H 1ZT4B 1P69B 2GTZA 3H9SE 1YZZA 1F3DH 1H5BC 1HOCA 4P46A 2XTJD 2Z92A 2A73B 4BH8B 3BOVA 3MCG1 3T77A 1TZHA 1CGTA 1SEBA 1T83C 2X4RB 5I1HH 3SKOA 4JFDB 2BSRB 2PYFA 5IJVA 3QYCA 1GC1L 2VIRA 4CN4A 4CN6A 3ARWA 3QA3A 4J6RH 4JQIH 3MLXH 3MNVA 1NLDL 1Q9KA 3VWKA 1A6AA 1A6WH 3KPPA 5C0JB 4P4KC 3W9DB 3MLWH 4NQUA 2Q76A 5IFAL 4PRPA 1QBML 4U1KA 3ABZA 3GJFA 1Q72H 4PJIE 4X6BB 1N6QL 4RZCB 5DO2D 1VERA 2VYRE 1HSAA 1SBSH 4ZUSB 4DGYL 1ZE3C 4NSKB 3DGGB 4PRNB 4YGVA 4LPYA 5F72S 2DM4A 3RNKB 2HVKA 3T4YA 4Y2DD 1U8QA 3ZHLA 4PRIA 5ITFB 3B8YA 3IAPA 5TDNA 4DAGL 1T22B 3MNWA 1LO0L 1FNGA 4YNYA 5CBEA 2VTFA 1EZVX 1NCUA 4XBGB 8FABB 4HKBA 3VFMA 4KQ4H 4P57A 1BVKA 1CG9B 1Z2KA 5E8NB 3T4AA 4NCC1 3TYGL 3V0VA 4WDIB 5EO9B 3FO2B 4RNRA 5E8EA 1T1XB 4JVUA 4N0CC 4PJHF 3KJ6H 4WFFE 3D48R 1FZMB 1ADQL 1SHMA 1CZ8L 1TZGL 4M6ML 2DWEA 1Z0MA 4NP4L 3VA6A 4WO4D 3IKCA 3THMH 4QWWC 3CFJA 3TNNB 3MLZL 1B2WH 4NQDB 1FPTH 4KK9D 3WSQL 1Q8MA 5CILH 1QSZA 5C0BB 2UZYB 1T0MA 1KELH 1MREH 3QUYD 2XQYK 3EYOB 3Q1SL 4JFFE 4ZFGH 3CUPB 4GUPA 4F3FB 5DEFA 1I1FB 2A6IA 1K4CA 4KGJA 5ANME 4DKEL 4I4WA 2B1AH 3JZ7A 1CD0A 3PIQA 3VXMA 2C7UA 3P11L 4JM4L 3WFHA 1NCTA 2AXGB 2D9QB 3BFOA 2WBJB 4MCYB 3HR5B 2YPKA 1QR4A 4YHLH 4F7EA 2DYPB 1FNEB 3DHJA 4M93C 3QPQD 4S1RL 1KG0B 4XC3H 5TE6L 3GIVA 3VXRA 4UT9L 5JMRA 4KZDH 1F4XH 1XGTB 4G8EB 4M7LL 4U4BA 4KQ3H 1M05B 4UTAL 5I1GL 3QNXB 4O2FA 3UPAA 4PJAA 1OLZA 4U1MB 2BNQD 3F7RA 8CGTA 4M02A 1I1AA 4PJFE 3O3BA 2I5YL 2J88L 2AJVL 2KZ1B 4FZ8L 1MQKL 3FO1B 4PTUA 4K2UH 1EVTC 1XGPA 1D9KB 3SKJL 1HH6B 5DQ9B 3BGMB 4IOIA 2VQTA 4NNXB 2IAND 1MLCA 2P24A 5C0AE 4KJYA 1IZJA 4GKNB 3WHXA 3SQOH 4MQSB 2EECA 2P44B 1ZT1B 1S5IL 3VXQB 3P73B 5IFHH 2EZ0C 4OZIA 3EOBB 4WW2A 1LO3L 5GZND 2OL3L 2G5BA 4Z7QF 3ILPB 3QO0A 1X5YA 2UVFA 3VJ6A 1AFVH 4G6KH 3FKUS 1D5XA 3SOBH 1A22B 3RIFK 1IAOA 2D0FA 3U4EB 1BVLB 2BSSB 5LJYH 2CRIA 1CFBA 5E5MB 5FO8A 3WLBA 4YHIB 5JLZA 4HGWA 5ICYA 1FGNL 3C09C 3MBEA 3DRTB 4K8RL 2JCCF 4ORGB 3IDYC 1HHHA 4OKVB 2RJMA 2FECL 2PYED 2XV6B 1MUJB 5DJ2B 3T3MF 3O9WC 2Z8WC 2PXYC 4GXVL 3ZE2F 2H6PB 5F1KC 1RJYA 4C56A 1RUMH 4GG6A 1H8NA 1V3JA 1DQLL 4Z7WE 1C7TA 1FSKB 2SEBB 3AU1A 4N5EC 1PLGL 3RJDA 3OHXB 5K9OB 1QFUH 1G9NL 4JG1L 3I50L 3QQ4B 1KPRB 3I3DA 5JPMA 5DD5L 1PKQB 3O6FB 3B2VH 1NUGA 5FDYA 1L0XA 3EGSA 5C0ND 3L3GB 5JW3H 4O58H 5FAAA 2NY1D 3U1SH 4YIQB 3T0ED 1CQKA 5IESL 4LARH 3OAUL 2CK2A 3K8KA 2HYMA 5I1KH 1F90L 5I30L 1A6UH 2P47B 4RMSA 2Z31C 2HT3C 4OZ4A 1S9YA 3L5WB 4M7JH 5CEZE 1J9CT 2MQ3A 3TZVD 2FDBP 3K1KC 4ZS7H 4N1CA 4ODVL 5F71A 1RURH 4L3EA 2ZG2A 5ACMA 4ODXA 5E2VL 2ATPB 5IOPB 1G7LA 4HX1A 1YEHL 2B2XH 5AAWA 5IFJA 4GRMA 1U8KA 1IKNC 3SDXE 1I9IH 3MA9L 2HKFH 3MRKB 2CDEB 1EA9C 4ZXBC 4D9RD 2QHLA 1KJ2L 1INQB 4Y4FA 3VXSD 1KNOB 3INUH 5KTEH 2CKNA 2BOBB 3F7PC 3V5HA 2WW8A 1OB1A 3N0PB 1EO7A 4X99A 3LQAH 5D2NB 3WD5H 2IGFH 1WBXA 4QT5B 4XNUH 3AAZA 5DJZA 2XICA 1NC2D 5CEXB 1QSEE 5ILTL 2DTML 1A1NB 4X8JB 3QWRA 4LF3B 5A2FA 3CXHJ 4YX2H 2EIBA 3S35L 1E28B 4G6JL 3O6ML 1AD0A 2N1KA 4PJGE 1RFDH 3T0AA 5FB8A 4J3TA 5T3ZE 5F89A 3GSWB 4RGNC 1ZLWK 3NABH 4H25B 1TJGH 5I73C 1J10A 5AEAA 1RZKH 3MV7E 5ESAB 3ARDA 3DLQR 5FA3A 4EQ3A 2VDLH 3O4LA 1R3IL 5E2UL 2FHBA 2WINB 1QA9B 3HLAA 3ZT5A 1Q0YL 5BZWA 1YMMB 3CC5A 4JEGB 5HDOA 3WE6A 2CLZA 4QEGA 2CKBB 1J0IA 4LLDA 1AI1L 3DSFH 1CFQA 3ZZ1A 4OLVL 3LDBC 4PG9B 3PWPA 2AJUL 4LP5A 4WHYG 4XPAH 4M4RA 5J89A 3T1WA 1LD9A 1OTSD 4BFIA 3B8SA 1Q0XL 4MA1B 2AJXL 5LWYH 3RZCB 1S7RA 4R4BA 4OF3A 1KYOK 5EPMA 3BRGC 4E41D 1ZK9A 2HJFA 3JV5A 1VFUA 1J0ZA 3LQZB 3S3JA 1NAML 2X42A 1KN4H 1YJDL 4O00A 1HHGB 3HS0A 4JRYB 4TN9A 4N0UA 3QI9C 4PJHE 3G5YA 3TO4D 3W9EA 2J4WL 4CW1B 3H9SB 3VI3F 3BIKB 3MRBB 1UQSB 3GGWA 1SY6A 3TA3A 2V2WB 5F1SA 1YNKL 1R3HB 1EMTH 5GISH 2EE2A 4N8CL 4OM0L 4HC1A 3DX6A 5FYKL 5D7IF 3CDYA 3BQUD 1J8HE 4GW4A 4UV7L 4PY8I 1DQDH 1T04A 3QIBD 5IW6A 5CIPA 3U0TA 4K94H 2I9TB 1ZA6A 2ZOKA 1O7VA 2VISB 3QCUH 4P2RE 1F13A 5SWSE 3VXUB 2MWCA 1ZT7A 3U46B 1A2YA 4CMMB 1J5OL 3KNBB 3WFCH 4HH8A 1KEML 1M7DB 3MRGA 4XCYA 3U9PL 1CGWA 4XC1L 4AYFA 2YMXH 1VHPA 5ACZA 4X9BA 3U0PA 2P1YA 4IMKC 4HJ0C 3MV9E 4Y7MA 1NCWL 1FN4A 3KPOB 3WXVL 4P2QD 4GKZA 5CUSH 1KLUA 2Y7QA 1FFPB 3TN0A 1I3UA 5E8OA 2H8PB 1CDUA 3BPOC 2ILLA 1H15A 2ATKA 5EC1B 2V7NA 3NIGF 2EDDA 5SWZD 1EO8H 3ZKXB 2ADGA 4MZ2A 4RWYL 3C60A 5E8PA 3HZYA 1WT5C 5DJ6A 4XCCL 1XGYL 5F1IB 2DQIL 3T65B 1EX0A 5A3ID 3QDJD 4OFYD 1MCLA 1DLHA 1UCTA 1F4HA 5CSGA 2XTLA 2ZCLH 3ALPA 4RRPG 2GCYA 3EJZD 5JA8B 1P6FA 4E42B 1K2DA 1RIHL 2EEDA 4IRSD 4P2OD 5T3XD 4U49A 5T5NF 1NMCC 1IEBB 5C8JA 1UM6L 2JJSC 5FGSA 2VXQH 3S5LA 5CSZA 1B0GA 4DVRH 3RL2A 5LQBH 4JFFB 1C5CL 4LOUC 1HINH 1JK8B 5I17B 5HHXH 1VA9A 5EA0H 4Z7QE 5D7LD 5AAMA 5KVFH 5ANMB 4YHML 2APWA 5J3HC 5SWQA 3X13A 4OIIH 1QLFB 3VW3H 1NKOA 4GG8B 5CGMA 3WNPA 5EU3A 2CKBH 1UM4L 3HE6D 3MPCA 4OIBA 3RWIA 1ZHKA 5DJAA 2WIIB 3H9HB 35C8H 1ZTXL 2JIXB 5DVNA 2JCCE 5B21A 5ICXB 3VRIB 5IM7B 3SDDD 3GSUA 2E7LC 4UZGA 4X98A 3GMOA 4KMQA 3T3ME 5DD1L 3ZE2E 5J12C 3X14A 4XMKH 2Z0BA 1ZVSA 2X1PA 4I2XA 1U3YA 1X4XA 1JGUH 4AG4L 4UNVA 2JELL 2Q8BL 4M48H 3X3FH 4PJFB 4LRIA 4BFGA 1NFDF 5JR1H 4G7VH 4QTIH 2ITCA 3L1OH 1XCTA 3GO1H 4XX1E 1KIQB 1UYWH 4LSQH 5F7WC 1T89A 3QUZD 4TQEL 4Y2DA 2AV1A 1Y0LB 3PWNB 1A14H 2DJUA 5CMAA 1G6RB 3UEZA 3RWCB 4ZAKB 1IAIL 3CCHB 2BVEA 4KVNL 2P5WA 4PBWD 2EDLA 1EEYA 2X05A 4TOYH 5KSAB 5E1AA 2ZUYA 4L4TD 3UPCA 3VD5A 3WFDL 3CMOH 4K7FA 3WDIA 1QD0A 4DZBB 2ZCHH 4Q6IB 4CKVX 1R5VA 4EXPX 3LZFL 1QACA 5DRNB 4XPFL 2CLRA 5DYOB 1KCVH 1X5LA 3RX8A 4JCLA 4TVPL 2VLKE 1IEHA 1LP9F 5F3HB 4PJ9C 2K1MA 3VXNB 2VZ1A 5EU5B 4Q2ZA 3HHRB 1FVEB 5IQ7L 5D7JB 3BYYA 1ULVA 2APXA 4NN5C 2X4SB 1KJ3L 3FONB 4LEXH 1T7VA 4I5BA 4Z7WB 2X4PA 2EYRA 2F54E 4HBCL 1QPPA 3PP3H 4XH2A 3F6IA 2A83A 3IDXH 2EDHA 1BBDL 2N7AA 3BYTA 4HPOL 3GI8L 4WI5A 4H88H 4PYGA 4LP4A 1G9MH 5IVXA 1GHFL 2J6EH 1GPOH 4JFXA 2GFBB 4X83A 3MV8D 3ZE1E 5CJOL 4D2NA 2XPGA 3DVGB 3LV3B 3QJHA 1HE7A 3TBYA 1SJXA 4YDIL 3WHE0 2MQ0A 4KDWA 4KJQD 4J3VA 4QXTA 2ZCKL 2VNCA 3BAEH 1S9WB 2VXUL 3V6BR 2WMPA 3QXWA 3SDXB 2NY4D 3JWDC 1A64A 2P43B 4J3UA 3LY6A 2IFFH 1G7HA 4A6YB 2EDKA 1NBVL 5IQ9A 4FG6C 1UJ3A 4ERSL 3ULVH 2BNQA 2R56H 1A3LL 1MJUH 1KPVB 3DMMB 4JVWA 2FCBA 2OS7A 3SO3B 1ACYL 4LU5H 1JZ7A 1QSEB 3V4PL 2IQ9H 1LO4H 1SYVB 4O02L 4JO4L 1OAKL 3VI3E 2QJDA 3OZ9H 2IANA 4LSRH 1LDPL 3RVTC 4P5MA 1OTTC 1CLYL 3QEGH 4PJGB 5GJSL 3GKWH 5D6CB 2NXZD 1OHQA 2HFGL 2FR4A 1CTNA 3IFPA 3PDOA 4KI5D 4C58B 5D7IE 3BHBA 3ES6A 2H3NB 1HWHB 3BZDA 4OTXL 5AUMA 1FDLH 4LHUB 5F9OL 1B88A 3MV7B 4JB9L 4TUKH 5IVNA 1XH3A 5HGHB 3MJ6A 3RDTC 1H3PH 2H9GB 3QG6A 5HPOA 2AXFB 5ID1B 1G6RH 3HZVA 5KAQF 2VLRD 4IOSD 1TJIH 3SDAC 4PJ8C 2FIKA 2KBGA 1GAFL 1S7UA 3I6LD 1HKFA 3CLFL 2PYEA 2R69L 1DEDA 4DZ8A 2Y72A 3FT2B 3S4SB 1BREA 3FQXB 1OT1A 3MLUL 5F1OB 2O5YL 1HILB 3C8HA 1MVFA 1CL7L 4YBQD 2EDYA 1MI5A 1IC4L 3I6KB 2F19L 3QDMB 5ADPL 4IMLB 1H8SA 3NIGE 3W39B 2JB6B 4NBYB 4HUWB 3NGBB 1DBAL 1D6VH 3FB8A 5TFSL 4KDVA 3AXLA 3GRWA 1NLBL 4RQQB 1G7IB 1DANU 5FUOH 1GSMA 5GJTL 4LLUA 4PGCA 3D0LB 2R9HD 1ES0B 4LSTH 1RZKC 1RZ8B 3QUXB 4Y16B 3BKJH 3MGTB 4HH9B 2GSGA 4A2MA 3S88L 4LSVL 2QSCL 3BSZL 3QULB 3D18A 3V6ZA 2IAMC 1A6TA 1TIUA 3C9NA 4DQOL 1MHPL 3GSOB 1NJ9B 3CFCH 5FYLD 4GQ9L 5IF0B 4JFYB 4CGTA 1MCDA 5EOCJ 3K4ZA 4HIXL 5F21B 3EYUH 4P2RB 3O3AB 1YEGL 3VXSA 4WENB 5TE7H 1NAKH 3NACH 4U6YB 1OARL 4NZUL 4URTB 4LLWB 4M7ZB 3MCKB 1XAUA 1E4WL 1NC2A 5I6XC 3C2AH 2RGSA 3MV9B 1D5IH 3NCYS 5DQDH 1CICA 1MFDH 1N5AB 1VADA 3I3EA 3VGAB 5HDQL 1KT2B 3FB6B 2XWTB 5I8OL 3KXFE 3UYRL 4PJ7B 3VFUB 3C5SB 4PB0H 4EN3B 5IMLA 3DVNA 3SCMC 3WN5B 4A6YH 3IKKA 1DDHB 43CAA 1U8NA 3D39D 3KYKL 1VFMA 2CUIA 1KYOJ 1BZQK 4L8BA 1T1ZA 3I3BA 1NFDE 2D31A 3LN4B 3O6FC 1AP2A 1IM9B 1KCRH 1W0VA 2NYYD 3VXPA 4X5WB 3Q3GB 1U58B 3M1BA 3RWEB 2YS4A 1DTUA 3GMMA 3MLTA 5IVZA 1HEZB 4CDGC 2RR3A 3VDBA 2ZUSA 4ONFL 3C5ZD 3RY6A 3PQYB 3KPRD 3F7YB 3ARSA 2BDNH 3BPNB 3PL6B 3QXTA 3V5KA 4OV5A 3R0MA 3IU4L 4PB9L 5F9JA 5IMMA 5D96C 3IFNL 4E41A 4Z7NF 4UI2A 3ARBA 5LGKA 1JPGB 2KQMA 2ED7A 3ARFD 5ERWA 1KUMA 1H0DA 4ZNEE 3MGOB 5EIIA 3TO4A 3MRQA 5ECJE 2F53A 3SQBA 4I3GA 1INEH 3HE7B 1J11A 2FX9L 1LP9E 1KCSH 4HW6A 1LILA 1BIIB 3F7VB 2YK1H 3WUZA 2R0LH 3BP4B 1VKXA 3BQUA 3W2DL 4MJ4A 5EOCL 1X3DA 5EDXA 3CVHH 1NBYA 3QIBA 1RJLA 5BRZE 5CEZL 1T2QL 4UTBL 5HI5C 4JKMA 3MA7B 2R1WA 1NGQH 2BCKB 4PJBB 1AXTL 4XAKE 5FO7A 2BOCA 4OCRL 4MJIB 2C3HA 3C6LD 3ALXA 1YC8A 4RIRA 1MPAH 4WFGD 5DLMH 5I8KL 3OKKA 4G6ML 3BGFB 3CX2A 4ZFFA 4JQXC 1YYLL 4QYOA 2F9BT 3LEVH 5C0IB 4ONGH 4LDLB 4LCCC 4P2QA 1EVUA 1P1ZA 4K3EL 1M71A 1JWUA 3O6KH 4WCYL 4APQD 4OLWH 2VMFA 4RBPK 3WIIL 1MAKA 3LEYL 3MUJA 3REVA 3ARRA 2E7BA 4AT6A 3I02B 2HN7B 5EZOL 4P5TB 4WWKA 3QUKB 5SWZA 4N0YL 5JZ7D 1MJ7L 4PTTB 2BXZA 3GI9H 1OM3L 3G6DH 4H1LB 5TGBB 4MA1C 3R4DA 4PJ5B 4LIQL 4MD4A 2WV3A 3RZCC 3H3PH 4GSDH 1KCLA 1UWGL 3QDJA 1IC7H 2AV7A 2ZOLA 4R2GD 3Q6GH 5ESVA 2CJUH 2UY6A 3DV6A 4L5FL 2JJTA 5C09D 3L5JA 1V5JA 1RK0A 5DJDB 3BKCH 5JHLH 3MO1A 4KKLD 3SY0A 1OAQL 5I8EB 3ILQD 3Q48A 4KC3B 3A6CL 3CAFA 5A40E 3PHQB 2A0LC 4Y2OA 3P4OA 5D7LA 1DQMH 4UU9A 3VFTA 2PTTB 1GOGA 4EIZC 2IQAB 2R8SL 1G6VK 2C5DC 3HCVB 3OXSA 3RWDA 2W0LA 1LNUB 2F5AH 1MIMH 1S3KL 4PJEF 2P5EA 2WUBH 4M6NL 1R0AL 1A7NL 3MJ9A 4Z9KB 1VFOA 2VXVL 1NUFA 3HE6A 4P3DB 1C16B 4PS4H 3ETBF 4PLKC 4Y4HC 3NFPB 1LK2B 2Z91A 3QO1A 1K3ZA 3CLEL 2FIRT 4HLZH 5DMGC 5DI8B 1FVCA 5B38B 2G2RA 5CJQH 5J13B 3P4MA 4WU5B 1S7TA 3RTQA 4BZ2L 3RWHB 3UZEA 3N50A 3RJQB 1MF2H 3QISA 2Z93A 3IU3A 3FCTB 1YEFL 5LGHL 1DBBL 2COQA 2Y5TB 3L3JB 4ZD3L 4LRNL 2J8UF 4AIZB 4GMTL 1GC1H 1CFSB 2DMBA 5CINL 5C71A 1NDGA 3X12A 5DVKA 3P9MA 2BRQA 5GQBA 4HAFA 1KGCE 1NLDH 4YHYB 2YWZA 3RPIA 1MCJA 3KPQB 5D8JH 4XNQB 3B3IA 1QBMH 2P42B 4XTRC 5D7IB 4K7PY 4R90L 4L4TA 1N6QH 4BKLB 4HZLB 5DUPL 4DGYH 3MSPA 1JGLL 4KRLB 1UZ8B 5IB2B 4G9FD 5HDBE 1G7PA 3C5JB 2MQCA 2QHRH 3HC0B 3HB3C 1QFWM 3E8UL 4DAGH 2N56A 5IB3A 5EFIA 1YQVL 4MSWA 4PPTA 3Q6FA 5FYKU 3GUTB 3SDCD 4KKAD 1BVZA 1RPQA 4EI6A 1PX4A 4WI9A 4BUHA 4PREA 5I1EL 1N64H 1HHIB 4BA8A 3TYGH 2YD9A 1U8PB 3BZFA 5BS0D 1YY8A 1P2CB 3QFDB 1IGIL 4NBXB 5INDA 1G84A 1KENL 2X4NA 1I7RB 4HFWA 3QXDA 3AS0A 1CZ8H 4WFHE 5T1DH 3BP6B 1TZGH 4NCDA 1HI6B 4LGSB 3EUUA 1IT9L 4H1LH 3ZHKA 4EVNA 1MCNA 2D4FA 3X11B 3OKLA 2R1XA 3VCLA 4QF1B 2VR9A 2N4IA 2NW2A 4M1CD 3MLRL 4HS3A 4JJ5A 1N8ZB 4EI5C 3TBWA 3FN3A 2BP3A 5CP3H 3SE4C 1XF1A 2F8XC 3IGAB 5IV2B 2L4OA 4RX4D 2VAJA 2XKUA 4WUKH 4WEMB 3G08A 2GUOA 5JXAL 5DK2B 1XT5A 1WCQA 2CRZA 4DKEH 1KJ2B 3FMGL 4NO2B 5KVEL 2V9TA 3WJLC 1LE9B 4YDKL 4HFUL 5L2KD 4XMPL 2ZUQC 4U31A 2WP3O 3B6SB 2AJYL 3CFDA 1QBAA 3KG5A 4PJXB 5F1NB 2VUYA 4OKDA 5JPNA 3ARZA 2FATL 4S1RH 1FVDB 1X4ZA 1CE1H 1FV1A 1EUUA 4UT9H 5ALBL 4Z5RA 2NPLX 4M7LH 4U0QB 1KIPB 3UTSD 3K74B 1EAPB 4OLUH 5D1XD 4AY0A 5I1GH 3MZGB 2JK5B 3AY4A 1F58H 1WWAX 4Q9CA 3WKMH 4QRRE 3DUUA 3F5WA 3EFFA 2PCPA 4KVCL 4P99A 1RZFH 2I5YH 4ZSOA 4LLYA 1OWRM 3FHQA 1KIRA 2J88H 2XXMB 4L9LB 4MGXA 2AJVH 2FSEB 5E4EB 4FZ8H 1ZLUH 5LXGL 1MQKH 3PUCA 3SKJH 1IRAY 4OZHA 4OCMC 1YEDA 3U6RA 1N59A 4WI4A 4OQTH 1MVUA 3MRLB 2BNUB 4R7DA 4ZOEA 1S5IH 4PR5B 2VLRA 3VXTA 1LO3H 3QEQE 4RISL 3H2WA 2IMNA 1RUKL 5CZXC 4JM2B 5A16A 1S7VA 4JHBA 3CSGA 5CD3B 4PGDB 3VFWA 2IADB 2FEEI 2WLYA 3GNML 1B6DA 4F7PB 1X4YA 1QG3A 3A0OA 1NAMB 1XGUB 2J8UA 1VGEH 4K8RH 1C08B 5FF6B 4CVZA 1DBML 1S78C 2BSTA 2FYYB 4JY6B 1VFAB 5CJ8A 1MRFL 2QQNL 3DI2B 4NPYA 2X1QA 5E08L 1IM3B 4GXVH 3P4NB 5TQ2L 3KLHC 2MHAB 3DMMC 4PY7B 3T3PF 1NCDL 2BVUA 2FWOA 2YC1B 1PLGH 5FCUH 5I2IB 5M94B 2XN9E 4NZJA 3SO3C 1X6LA 3GMNA 5C3LD 4KUCD 1VACB 1M7IB 4JG1H 4M8QB 3I50H 3IJHB 3RKDC 3MJ7B 2PW2B 2DQTL 3DX9B 4EBQL 1I1YB 4J4PC 5HHQB 2VO5A 4L3CA 3O2DH 1G7JA 3DYMA 3OKOB 3NPSC 1DANT 3RGVD 3TP4A 3BKYH 1JNLL 5E03A 2NY3B 1F90H 5I30H 4LSUH 5E99L 5FFLA 3AS3A 1JPFA 3V52H 3OGOE 1R3LB 3O8XB 3P2TA 2MPAL 4GXUM 3KLSA 4GAGL 3NIFF 3REWA 4OUOA 4ODVH 4CU6A 4JQVC 1IGCH 3U2SA 4K7PL 1YEHH 1YN6B 2OTUA 3ULUF 1B0RA 4LVNB 1WTGT 1L6XA 3MA9H 3TIEB 1EBAA 4PJEE 1DQQB 4R0LB 1SVCP 5TPWL 1KJ2H 5D1ZB 3TIDB 4UDUB 1ZVYA 5F7EL 5HHMB 3MOQA 1BD2D 4R7NB 4NDMA 3F12A 2XFXB 1U95A 3RKPA 2B4CH 3IDIB 1RK1B 5HYQB 4X4ME 2YD5A 4DEPB 2X7LA 5ID0B 1ERNA 3C08H 32C2B 4ZUWA 5C0RH 1ETZB 1EUTA 5CGYC 4P3CL 3S35H 3TYFB 1FO0A 2W0FB 3O6MH 3QRGH 4XXDA 3HPJB 3RQ3A 5GSVA 1MCRA 3HMXA 1MNUL 3NGBC 2QTEA 5DFVC 4F7CB 1LQSR 2MSPA 3FB7B 5C0DB 2QQLH 3MXVL 4LVHB 2Q7YB 3U7YL 2AJSL 5EZIL 3C5ZA 3CSBA 1NSNL 3KPRA 3BMVA 5EBWB 3QUXC 1AHWB 4Y16C 4Y19E 1V8HA 2AQ1A 1R3IH 2YEZB 4K71C 4XPBL 4XP6L 2WWMC 5E2UH 5FYJL 3WUWG 1Q0YH 2E9WA 5D7JD 4XWOD 2APVA 4M7LT 3GSRA 5HYSB 5K9QI 2DIAA 1SM3L 2GSIA 1AI1H 1N3NB 1L6ZA 5EU6E 5HYSG 4HKZB 4PV9A 5I1IL 3BRDA 5ALCL 2AJUH 1WJ3A 4O51B 4YR6A 5DURD 3HI1A 4XT1C 2QKIA 3N9GL 1YPZB 1P4LA 5T33L 2HT2D 3MLSL 5EU7E 2CUHA 2H32A 3VGAC 1NAMH 1W0WB 1UADC 1YJDH 1YYML 3M8OH 3O3EB 2V2TB 4QWWD 3OR7A 1W0YT 2V9QA 5F93C 1ED3A 2J4WH 3FT4B 1JTPA 1UA6L 4PRAA 4U3XA 5GGRA 1I8IB 3FOLA 1D5BB 1FORH 3WN5C 4NZRL 5IB1B 4LASL 3SBWC 3C6LA 3KPMA 5IP4A 5IKCA 1NGYB 1K6QL 1YQ2A 4OZIE 4N8CH 2FL5B 4OM0H 4CVXB 5FYKH 3MFGB 2EO9A 4ISVB 3RRQA 4M6AA 4HMCA 1BWWA 5C92A 2QL1A 2NNAB 5KJRH 4YXKL 4OLZL 1RVFL 4NC1E 3RVWC 5B39G 3IXTB 5IROC 1F4WL 1J5OH 4MD0A 3L5XH 1KEMH 4Q0XL 2BHZA 3U9PH 3S7GA 4XC1H 4ENEC 1WGOA 3JTSA 4LBEA 2GT9B 4JO3L 2MCPL 1HXYB 4HS8L 3MRIB 3MLYL 3KWWB 4LPXA 1NCWH 2ZKHL 5T1KB 3TBSB 4OCSH 5HHOD 3WXVH 2FLRT 3PL6C 1K5NA 5TDPA 2EDOA 1X9QA 5ESQB 3HRZB 1HHKA 1OF2A 4UINH 1RZIB 1U8OB 3DXAB 4KTYA 4OZGA 4B0MM 5I8CB 3LN5A 3JVGC 3WNKA 1U42A 4JY4B 5H94B 3IXAA 3KPNA 4A2LA 4ZYKB 3STZA 12E8L 5C3TA 4CN1A 4F58L 3GRWL 3LMJH 2YPVH 3LOWA 3LS4L 4XCCH 1XGYH 1U3HB 1X44A 1CN4A 3NA4A 3BD4A 4XMLH 1SJHA 3P4LA 5EOQH 3BN3B 4KRPD 4HSQA 3F62A 2EZ0D 1RIHH 4FQXB 5KSUA 1NGWB 4HIIA 1F4YH 1MY5A 3SE8L 1VSCA 1FL6A 5J9PB 1P6AB 5DZLA 5ETUB 5MEND 3SGEH 4LMQE 5DA0B 3SDYL 1U92A 5IEHB 3E6HA 2YUXA 1I1RA 3EOAB 1QYGH 2PTVA 1C5CH 1MFBL 1Z9MA 2I25N 5F8RC 1DEEB 4ELMF 3O81A 1Z9SA 1XIWD 4ZPTA 4G42B 1J1PH 2FB4H 3FQTA 3R06A 1DP0A 3NA9H 4WGWB 4YHMH 4N0FB 5TH2B 1MWAA 3QUMA 4EDWH 5C07D 2E3VA 4R4NC 5EO0B 4PGBB 1EFXD 1U36A 2BNRD 1ZTXH 5SX5K 4F7MB 5GZOC 1RHHA 4YE4L 2Q1EA 3ECBB 4LSDA 4UIMA 3NFNB 4ODWA 3MCLH 3NCJL 1HKLL 4PJDF 5DD1H 2R0ZL 2O5XL 4FTVB 4HAGA 2ZWLT 1QSVA 3EJYC 3T3PE 1MCFA 1T7XA 3O4LE 5AYUL 3UTTD 2XZQL 1YECH 2JELH 4ONHA 5F3BA 2XQYG 3RY5A 4QHUB 4RFEA 3D2UA 4XNMB 5FK9B 2HT3D 1XF3A 5JDSA 2F74B 4Z7VF 5J6HB 5LGJB 5KN5B 4TQEH 3QIWA 3ZTNH 4FFZL 4G9FA 2JB5L 3QQ9D 3D69A 5H35A 2WQ8A 3LKPA 3QR2A 1CCZA 4P0DA 4P23C 1IAIH 5IGXL 4KVNH 3JWNC 1WZ1L 3FB5A 1TTGA 1N5YL 1YNTB 3SDCA 1KJVB 4MZ3A 2XXCB 3QEQB 3WFDH 3NIFE 2WANA 3MUGA 2WAHA 3GMRB 3ULUE 5BS0A 1BZ7B 2IEPA 3WJJC 4N0UE 4XPFH 3P9LA 4XVUD 2VC2H 1QFHA 2DLEA 2GTZB 4L8DA 4F9PC 1HOCB 2Z92B 4WVRA 3T77B 1HH9A 1TZHB 4X4XA 3QDGD 1UKTA 4QNPF 1J1OL 3C8KA 2PYFB 4G43B 4H20H 4ZUUB 5IJVB 1OGAA 1JWSA 5J13C 2OK0H 3QA3B 4RGND 1P9MA 3MNVB 5F96L 3B9DA 1Q9KB 3PQYD 3VWKB 2CIIB 4JDVA 5SX4I 1G7QA 3G5XA 3KPPB 4PGEA 1JN6A 2Q76B 2XN9B 5JOPE 1KCUH 2DN7A 3GJFB 4HBCH 4R26L 2ERJB 4RX4A 4BJLA 1J8KA 1HSAB 2NY2D 1BBDH 4YGVB 3GI8H 5BQ7A 3STLB 2HVKB 5FA4A 4YHYC 3T4YB 1U8QB 1FYTE 1I7ZB 1GHFH 3LD8C 4NOFA 5HHNB 3MNWB 4LHJB 3UROR 1J1XH 3SN6N 5L2KA 5E70A 2OR8A 3ZDYF 1S7XA 5CJOH 2HTLD 4IS6B 1BWMA 4CJ1A 2R2CA 4M4PA 5JHDD 4HKBB 3VFMB 4P57B 1BVKB 4F8QA 3MUY1 2XY1A 4GW1A 3T4AB 4IRJA 1IGYA 1T20A 2ZCKH 1AD9A 4Q74A 5E8EB 2IJ0C 5HGDB 3OKEA 3UTSA 2IBZX 3N1FC 4EDXB 1DCLA 4PJEB 5D1XA 3RVUD 5JIHA 4Q6YA 3CXDH 1NBVH 4LLMA 3QI9D 1A7RH 2X4TA 1LWRA 4MMXC 3FFDA 1OAZL 1A3LH 4OGXL 4O5LL 3IKCB 5DD0H 4GLRI 1ACYH 2CSPA 2OXHA 4F33B 1SMAA 4MNHB 1TENA 3V4PH 3I75A 2ICWJ 3IJYA 4O02H 4JO4H 3FT3A 4MAYD 5D6DC 1OAUL 2D7TH 1OAKH 2HKHL 1T0MB 2IPKA 4CVUA 3IFOA 4YXLL 1OLLA 4LHQB 5I18L 1CLYH 3TT1L 4MQ7A 1TTFA 4GUPB 5F7DA 5DEFB 4ELMA 4P5TD 2A6IB 1K4CB 5BXFA 4JFPA 4ZO8A 5GGVL 1K8DA 1PQZB 1KB5A 1V7ML 2NY5L 4KFZC 1TZIA 3VXMB 4HD9A 2C7UB 3WXWH 3DARA 2NY0B 5F9OH 4JB9H 3WFHB 4HJ0D 4RRPA 3PWUB 3R8BB 2CGRH 4XHJD 2FJGB 3VDCA 3ELAT 1P7QD 2AK4E 3MJ9L 3MV11 2EKSA 2CO6B 3GIVB 1M1SA 4GXUN 1GAFH 4PLJD 1BAFL 4YHPB 5EU6B 3IB4A 1DR9A 1BX2A 2R69H 2YA2A 2LVEA 4TUJB 3NCYP 4AQ1B 3G04A 4TRPH 4O2FB 2B4CC 5JORA 1WK0A 2BVYA 2XT1B 2O5YH 3K2MC 1CL7H 5DWUL 1H3XA 1I1AB 1MCPL 2X1WL 1IC4H 3UDWA 3L3IB 4ZFZA 2D0GA 4PTUB 1IAKB 1DBAH 3E1F1 4G8GE 4DKAA 5TFSH 2AKRA 4Z7VA 2I26N 4Q9RL 5D72L 5DC4B 1NLBH 2A6JA 2GK0A 2P24B 4H0HB 1DSFL 4KJYB 2MCG1 4ALAL 2JTDA 5GJTH 3RGVA 3WHXB 2GTWA 2WWKO 4FQIL 2R2EA 2NZ9D 4OZIB 1MHCA 2VSCA 4L4VA 2G5BB 3S88H 4LSVH 5F7LB 2QSCH 4CBPA 1RZJL 3GJFH 1MHPH 3AB0C 1ZS8B 3VJ6B 3AS1A 5I66A 4GQ9H 4HIHA 3QNZA 3GMLA 1D5XB 3RWFA 3X17A 4HIXH 3SGDI 4M6OL 1U0QA 5DR5H 1KN2H 1YEGH 3WLBB 2AGJH 1OARH 4HGWB 5ICYB 1F2XK 5JLZB 3MBEB 1XR8A 2GKIA 1BD2A 2MTPA 4UILH 1H5BA 4KKBD 1HHHB 1T83A 1AR2A 5CSBA 1IILE 1ORQA 4HWUA 4D0DA 1A1MA 4C56B 2Y25A 3LRSB 4WY7L 4GG6B 5HDQH 5J06A 1IL1A 3AU1B 3UYRH 3V8OA 4JZOA 2ADIA 5JPMB 4P4KA 3LRHA 1DBJL 3MMEB 1D5ZA 3H6JA 3EGSB 1CE6A 4PJDE 3IVKB 4NC0B 5E6YA 2NXYB 3IRPX 4AMKL 2BY3A 4BSWA 5CKAA 4K8RD 2PW1A 2BVPA 3KYKH 2PF6A 1CD1A 1ZOXA 2LABA 4TSAH 1WQVT 5DQJA 1S9YB 3MRFA 1IEAA 1IGFL 2B20A 2M2DA 3D6GA 1MLBB 4L3EB 3BN9C 2NTFA 5FUZL 4ODXB 4ZFOL 3ZKMC 3HG1A 4NO5A 3NH7H 3SPVA 4XVJL 5IFJB 3RWGA 5HBBA 4GRMB 2ADFL 5BV7L 1SBBA 2K7QA 4Y0GA 2NY3C 2Y36L 3PP4H 2A9NL 4MB5A 4Y4FB 4FMKA 5I1JH 3V5HB 3O8XC 3L7FA 4X99B 2AQ3A 4HS6A 4FFVC 1WBYB 1WBXB 2DLGA 3IU4H 4W6XB 3AAZB 5DJZB 2C1PA 3K1DA 4H5SA 4XP5L 3IFNH 2D03H 1WWWX 3D1MC 3WNMA 3OAZK 1C5BH 5GGRY 4J8RA 4YDJA 2IANE 3ROOA 1AD0B 3WFBH 3BH9A 4OD1L 4EUPA 5D9SA 4K7PX 5FB8B 5F89B 2D7MA 5B8CA 1TTUA 3QFJE 4MQXC 2VDRL 1JRHI 4LKXA 3O3UN 1JFQL 3SJVE 3W2DH 1N2RA 4TNWF 1MCQA 5EOCH 4V2BA 4N9OB 5IB4A 3ZLQC 4WI8A 3O11B 5J6GA 4OCXL 3ARDB 3GSNB 1T2QH 4JREC 4UTBH 3BIAX 3O4LB 4JN1L 2R2BA 5GS0L 3BD5A 3Q5TA 2EYTA 3HLAB 1RUAL 2YUWA 4JJHA 5BZWB 3K46A 1EJOL 1FH5L 4LVHC 3ARED 3CC5B 1X5XA 3WE6B 4X0KA 5C0EA 1F42A 3KPLA 4LLDB 2PYEE 5DHXB 1CDBA 1AHWC 1UKQA 3U0WH 4Y1AD 3PWPB 1VDGA 4PGJA 5D7SL 1LD9B 5HHOA 3ZDYE 3H42L 1FLRL 2DB8A 4BFIB 2XA8L 3G5ZB 4NN7C 4WJ5A 3UO1L 5I0DA 5JXEC 3WIIH 3LEYH 1S7RB 4R4BB 1GL4B 4FG6D 5EPMB 2HJFB 2OXGA 4QY8A 4V1DE 1JVKA 4JAMA 3HS0B 4N0UB 3G5YB 3W9EB 4N0YH 2Y5EA 5B4MC 4XWGH 3T0EE 1MJ7H 4KAQL 4RA3A 1OM3H 1T1WA 5EUKA 5HGGS 3GGWB 1CFNA 1DVFD 3BDYL 5DVMA 1FAIL 1JF5A 4X5LA 1I7UA 5DXWA 3VE0A 1UWGH 3DX6B 4XCNB 3RVTD 3QBTB 3VFOA 5FECA 4YJZL 4P9ML 3LKQA 4GW4B 5FDWB 1T04B 5HHVH 4JM2D 5IW6B 4L5FH 5CIPB 4B7IA 3U0TB 1ZA6B 2K3TA 5D93B 4TSCH 4HPYH 4X6DE 2D2OA 1L7IL 1AO7D 4D9RE 1OAQH 5I9QB 1A2YB 3A6CH 4JRXA 3RDTD 1PG7L 1JHKL 4XCYB 3MRGB 4GRLD 4LSPL 5FM5M 2GIYA 2H1PL 1JGEA 3UJTL 5ACZB 2ORBL 3U0PB 3UC0L 3N1MC 3SDAD 2VQ1A 4PJ8D 1A5FL 4QRTA 1PKOA 5C07A 1FN4B 5FYKD 3ESUF 1JPSH 4JHAL 3KLAB 3D9AL 4M6NH 2PXYA 1A7NH 5BOZG 1R0AH 3HPLA 4BSVA 2VXVH 2VSDA 1T0NA 4BK5A 5I75B 2YPLD 1W72A 3PNWA 1H15B 2Z4QA 2ATKB 3GSVA 2V7NB 3CLEH 4GH7B 1IFHH 1LEIA 3C60B 5E8PB 5M95B 5CP7B 5DJ6B 3MLVL 2P46B 4PV8A 2DI8A 3IF1B 3L3HB 1F3JA 2X89D 1MRCL 3FTGA 5FYJU 5LGHH 3VI4F 1ZSDB 3UAJC 1CWVA 1DLHB 5F97E 4ZD3H 7CGTA 1MCBA 2YZ8A 4LRNH 4NQXA 1QSFD 2GCYB 3CFBA 4LEOA 1FO0L 2ARJQ 4WTWA 2MKLC 4EZMA 5JQ6L 2Q3AA 2Z31A 4NYLB 3HMXL 5CINH 1C5DA 5F70A 2IAMD 5C8JB 2YWYA 4MNQD 1U3HC 4UQ3B 1AGEA 1B0GB 3EYFA 4GBXC 4F7TB 1EZVY 1IKNA 1EXUA 1NBQA 3S5LG 3JV4A 1DUZA 5KSBF 3GSNH 2DI9A 4ZXBA 3RUGF 5MEOA 3U9UA 4DKDC 2B39A 4FQXC 1P4IL 4PBXA 2OM5A 5SWQB 3X13B 4O4YH 3ZDXE 2BX5A 1JGLH 4KY1H 3OB0K 2YN5A 3ROLA 3V4VL 2XTJB 2R1YB 3RWIB 1YQVH 2FBJL 1ZHKB 2EYSA 5ACLA 3IDGB 5EWIH 3QDGA 1Z6JT 3P30H 3BZEB 4UQ2A 4JFOA 4MS8C 3GSUB 4PLOB 3BXNB 4X98B 1ITBB 3SCMD 4ODUA 2DQDL 1Q9WA 4ZO7A 3X14B 4O2CA 2ESVA 1IGIH 1ZVSB 2QQKL 4I2XB 3LS5L 1AXSA 1KENH 2ARJA 1BEYL 4HUNB 4AENA 3QQNA 4Z7UA 4OAWA 1RUQH 2QEJA 1E4KA 4QTHA 2ITCB 5L8KB 4X4YB 1IT9H 1XCTB 3HC4L 1SY6H 1NEUA 1FZJA 1QNZL 4AJ0A 4ZODA 4NIKB 4Y2DB 2AV1B 4EJ1C 4G9DA 4HC1H 5IW1A 5CMAB 5HGAA 1TJHH 3NZ8A 1IVLA 3T1FA 3OJMB 2X10A 5CIPH 4LSSL 5GGQL 3I9GL 7FABL 5E1AB 1Y6NR 4JDTH 4N5UA 5JHDA 4D8PB 2Z8RA 4K7FB 1EK3A 5JUEL 2EDRA 1R5VB 4NNPL 1L0YA 3OKDA 5SWZE 1AGFB 5KVEH 1QLEH 4UT7L 2NY7L 4BH7A 4YDKH 4AH2A 4XMPH 1XF2A 3T0BA 3QI9A 1KC5L 2XIDA 4HJJL 2OTWA 4Q2ZB 1NFIA 4GJTB 4WO4B 2FATH 1WC7A 1QR1A 2W38A 3A67H 2YD1A 1XEDA 5T3XE 4DN3L 3ZKSD 5ALBH 1AKJD 2JKXA 2ZSWA 2AEPL 3QUYB 1YUHA 3CIQA 3ULSB 3OR6A 1XR9A 2ZUUA 1FC2D 3QZWA 4GFTB 3V5DB 3FFCA 3ZYOA 1ADQA 4TVPD 1IJ9A 5LXGH 2AXHA 4R97C 4JFXB 3L7EA 4IMKA 4Z77A 1N7ML 2ERJC 1RY7B 2E6PA 3ULUL 3TBYB 3D3VE 4GRWE 1OGTA 4K23L 1JL8A 4RISH 1KOAA 2LFGA 1RUKH 4HUXA 1NBZA 4CNIA 2WK2A 2HLFD 3ME0A 2JF1A 1G7HB 2R4SL 1MWAL 4OUUB 4YDLB 5IQ9B 2FEEL 1UJ3B 3RIAF 2BNQB 3V6OE 3K4DA 3RVXD 1WT5A 4L29A 1BF8A 4U3HA 1F11A 4DUXA 4N8VB 1BLNA 4OD3H 5MERA 4E9LA 2C3VA 1DBMH 3OJVC 3S8WA 2K9UA 5E94A 4TNWK 5D4QA 1AQDA 4U1GB 1VGKB 2VZTA 3D85D 3WO4C 5ISZA 3OJ2C 3VGGA 5E08H 2IANB 5GPRA 4C4KO 1E4JA 4W68A 4P5MB 4E5XA 2IBGA 1MRDH 1T5WA 4J23A 2FR4B 2VDML 2BRRL 3PDOB 1OPGL 3BHBB 5KSBA 3HNSH 3ES6B 2AAVA 2MOVA 3L95A 2FEDD 3OG4B 4OF8A 5AUMB 3K81A 5DUBA 3OXRA 4EBQH 3CH8A 4U1SA 5KW9L 3FRUA 4MA3A 1XH3B 1RJCA 1E27A 3EYVA 5HVHB 1JNLH 4RAUA 1A7PL 5CJBA 4YH6A 5E99H 1KBGL 1GGUA 2B0SH 1VEPA 2FIKB 1B3JA 2MPAH 1S7UB 3BPLC 4Y8AA 4PLKD 2PYEB 4Y4HD 1JNNL 3VWJC 3W11C 5C7XL 2RIKA 2E7LA 1KFAH 5DJXA 2OL3A 1T6VN 5IMKA 2W60A 2Q6WA 2Q86A 5GRUL 5T1MA 5TPWH 1U93A 4R8WL 5K9JH 4R96A 5F7EH 3WLWC 4MXWL 1FHGA 4HXBH 3EO0A 1F2QA 1MIEL 2OJEA 3G9VA 2EXYC 3FO9A 3T0EB 3TJEH 3MNZA 4X7DC 1A1OA 3U30C 4WFFD 1S7SB 1I1AC 2GJ6E 3KPSE 4PGCB 4HKXA 3MV8E 5HY9A 3MJ8A 1ONQA 3QHZL 4WI2A 3VI4E 4C54A 5EU7C 3BT2H 1JF6A 1B0WA 4WV1A 1LO5A 1F8TL 3TZVB 3V6ZB 3D18B 1MNUH 4BZ1L 4C55A 5JNYB 4LPWA 1A6TB 1AGBA 3C9NB 2Z8VC 1G0DA 4XTRD 2YBRB 5DDHA 3MXVH 5MI0B 1WIPA 3BKML 3U7YH 1XCQA 4LNRA 3B9EA 4KI1A 4X6DB 5C70A 2VLLA 4P46D 5FO9A 5K9KA 1PY9A 2W07A 5EZIH 5C08D 3WIHH 3MOBL 1AC6A 3HI6H 3VXSB 4RMTA 4HUUB 3HB3D 4XPBH 2CXKA 3RUGE 3VFNA 1CLCA 2J2ZA 5E2WH 1NC2B 4JPIB 5J0BA 1OP5H 1CLOL 1SM3H 1ZHNA 1VADB 4NC1C 1PAMA 1EGJL 3KR3L 3L3OA 4PRPD 5C2BL 4S0TD 3EDEA 1ZT4A 1DE4A 5IMLB 3ZO0A 3V0WH 3VFSB 1BQHG 1K9TA 1ZHBB 3N9GH 4HIEA 3VFRB 2H2PC 2X4RA 2BSRA 3MLSH 4ZSOE 1H3WM 4PRID 5I1LA 1YYMH 5GRVL 5GRZA 1T66D 5E4IA 4OZHE 3NCBB 1IKFH 4ESKA 4OV6F 2HJKB 4L8BB 1T1ZB 5C0JA 4EI5D 2D31B 4NZRH 1W0VB 4LASH 3S37H 3VXPB 5IR1A 3M1BB 3AREA 4AEEA 4U1IA 3GMMB 3MLTB 5IVZB 3I6GA 1E4XI 4PRNA 1QO3B 4Z76A 5IBLC 4LCIL 1AGDB 4NKDB 3G6JA 4Y1AA 5ITFA 1KB5L 5C0AD 4YXKH 4OLZH 5E6ZA 1RVFH 3CZFA 5F9JB 5IMMB 1F4WH 4E41B 5FKAB 2FGWL 4Q0XH 1VPOL 3DUSA 5ERWB 3MRJA 2A2QT 3W82A 1H0DB 2MCPH 3WNLA 5EIIB 4IIQA 3TO4B 3MRQB 2BY2A 3UJJL 2ZKHH 2BK8A 4NWUH 1LE5B 4MNGA 4N8PA 3AM8A 2VDKH 1JGVL 3HC3L 1YEEH 4NHCL 5L88H 1BQLL 3BQUB 1NBYB 3FN0L 3QIBB 1RJLB 4Q7DA 5FYLE 1KEGH 4UNUA 4ODTL 3JWOL 4NQDA 4NWTL 3OX8A 2R1WB 4KJPD 3TWCL 1AO7A 12E8H 3LEXA 4F58H 3GRWH 2RQ8A 3LS4H 3OF6A 5DK3A 4RIRB 3U83A 1CK0H 4JFDE 3CUPA 3RDTA 1PYWA 4GRLA 3OKKB 5AZEH 3VXRD 2E5EA 4ZFFB 2QR0A 43C9A 4RMQA 1GOFA 4QYOB 4XNXH 3FQUB 5KAQG 2OI9B 3SDAA 4PJ8A 4P2QB 2F58H 1FGVL 1M71B 1JWUB 5DFTA 1CLZH 2AXGA 5F9DC 4MCYA 3REVB 5EUOA 3UCRA 5CEZD 4QHNB 1MFBH 2YPLA 4DTGL 1NL0L 2YD6A 4AT6B 1G1YA 2OQJA 3O3DA 3TJHC 1V3MA 1L9NA 4NKIH 1DUYA 1ITCA 5SWZB 4RBPH 5H37G 5ICZA 3D39E 1M05A 4MD4B 1NCAL 3P0YH 1J0JA 2Z35B 3IFLL 2EH8L 5DJ0B 2X89A 3QDJB 4U1MA 2AV7B 2ZOLB 5ESVB 3ULUC 5DGRA 2B1HL 1JI1A 2XWBA 3NCFB 5MHSE 3PWJA 4RFNB 4P2OB 3DV6B 4EOWH 2J8HA 2VE6B 5LKNA 2E9JA 3NCJH 2IALA 1I9RH 2IAMA 4F9LC 3SY0B 4MNQA 4B50A 2QSVA 4J4PD 5GRWA 5ENWA 4HWEL 2J5LB 4KK5C 5IB5A 1KXVC 3L3KA 1WTLA 5E6IC 1VESA 1ZANH 3DX8A 1ZT1A 5DK0A 5T3ZD 4BQCA 3P4OB 5D7LB 3SKMA 4O9HH 4ZMAT 3EOBA 3ALWA 3DURB 4M7KL 3LSOA 3LHPL 5D93C 2X70B 2IBBA 1OP3H 3OXSB 3RWDB 4GW5B 5I9QC 1OAXH 3S36L 5IGXH 2HFFA 3HE6B 3EOTL 3RIAK 2BSSA 1Y6KR 4GRWB 1WZ1H 2Z91B 4YHIA 3QO1B 3BISA 4KTEL 1J0KA 3SDDB 3ZDZF 2PO6D 1FVCB 2G2RB 3SCMA 1S7TB 4U6HB 2DD8H 2VDQL 1PG7X 3QJFA 5J11C 2Z93B 3IU3B 4WRLA 1S9KC 2W9EL 3S3PA 3VXOB 1IC1A 1Q9OB 4H26B 3IT8D 2VXSL 3EJJX 3QQ4A 5SV4A 1J18A 1NDGB 3X12B 3O6FA 3C60C 1CF8H 2IPUK 3P9MB 1RJZA 5DFVD 3QUZB 1BOGA 4FQ2H 5F96H 1JZ6A 1B4RA 4N9GA 2MJWA 2YRLA 5DJCA 3NCEB 3RPIB 1QQDA 2UUDH 4HGKC 4UB0L 5AYQA 4FZEL 2XG5A 1UT9A 1NEZG 3B3IB 3IDMA 1R3KA 4L4TB 4X4ZA 1OSPL 2WWMD 2FD6L 4MA8L 2DM7A 3OMZA 2WQRA 4HKJA 5IOPA 4I9WD 5GSRA 1FG2A 4MWFA 3ARGD 1KXTB 3MBXH 3MRKA 5IB3B 5EFIB 4MSWB 1BM3L 4X7SL 3Q6FB 2VWEE 4HK3N 3BUYB 2M1KA 4NQCA 5SWSD 1KNOA 3L9RB 2BOBA 3KS0J 3DECA 4CMHC 4ACPA 5D70L 4PREB 1KF9B 4PGZA 4S0SD 5IHZA 1YY8B 3ARDD 5C09E 3U48A 3ULVF 5INDB 4LVEA 1A1NA 2X4NB 1X5AA 5H37H 4HFWB 1AKJA 3FOMA 3HFMH 3QXDB 4JANA 4JHWL 5E95B 1J0HA 1OL0A 1MCEA 4YHKL 1QTYT 3B4NA 4RCAA 1RMFH 1OAZH 2DBLL 3OKLB 2EH7L 2R1XB 3RVVD 4Z8FL 3NZHH 4O5LH 2FO4A 3P0VH 2NW2B 2YSSA 3KYNA 4HS3B 4JJ5B 4JQXA 3TV3L 1OAUH 4NUJA 1P7HL 2HKHH 5IJKA 3MV8B 1A7OL 4YXLH 2QQQA 4LCCA 3MODL 4PJFF 3TT1H 5BV7B 1QA9A 1T89C 4Y2DC 3Q2CA 5DHYA 2GUOB 4XCFH 5GS1C 4TYUA 1JIBA 2VLJD 4QXWA 3TA3D 5J8OA 4MB3A 2KPNA 4NQEA 3UTPD 3CFDB 3OSKA 3WL9A 3F6LA 2EIZA 5JPNB 2P4AB 1DQJA 3D25B 5BVPL 4K3GA 1WAAF 3QH3A 1FV1B 5F88A 4Z5RB 2EC8A 4GRWH 3LQZA 1JE6A 1BAFH 3BW9A 4NQSA 4U1LB 3D85A 5A2LH 4DOHE 1CS6A 3H9SA 5D5MA 4BQBA 3MRBA 3SKUD 5D2NE 3CVIH 2NXZB 3DUUB 3KJ4C 3F5WB 3EFFB 4WO4C 1OT2A 2AVGA 1MCPH 2X9YA 1B90A 3IJSA 1SEQL 2EC9U 4ZSOB 4LLYB 1ZV5A 1HN1A 1YDPA 1FQ9C 2ZNWA 1MFEH 3QUYC 4U2ZA 4XVTL 4G9FE 4OZHB 2V5SA 1GCFA 3TN0D 1YEDB 3U6RB 3AMLA 2VISA 3T2NL 3EO1A 4FQIH 1BJ1J 2VLRB 4PJIA 4KHTL 3OKNB 4CMMA 3KNBA 4QXUL 3U4BH 3PJSA 4ETQB 1RZJH 4Y4HA 1OCWL 1MH5A 3PABB 5BS0E 5A16B 3PGDA 1S7VB 4DKFL 5FXCH 2VRAA 5F6HI 4XI5D 1MCOL 1WFTA 4M6OH 4LNVA 4M1GL 4WI7A 1CU4L 4PRBA 3EAKA 3QPQC 1FFPA 5TF1L 1YMME 1FL3A 4CVZB 4Y4KD 2BSTB 4OLYL 4HK3J 4YUEL 3DVFA 4QXGH 2YA1A 4ZTPL 1D5MA 2OR9L 1ROWA 4NPYB 2LU4A 4YDLC 2ITDB 2WUCL 2LAAA 4WY7H 3SGJC 5FUCE 5KVMC 1DFBH 4J3SA 2FWOB 5KSVA 3FN9A 2VLKD 1IBGL 3GMNB 2GAZB 2P7TA 3VFGL 1F3DJ 1CFTA 2E7HA 4UUJA 1A4KA 4KMTL 4U1GC 1DBJH 3QWOB 4E42A 2VDOH 4L3CB 2DKSA 1G7JB 5DRXA 4P48A 4AMKH 1IEBA 5CJ5A 3N85L 2XKNA 5C08A 4NZTL 4X80L 5ELIA 5JW4R 5KS9F 5L2KE 1Z3GL 3CDGB 4PJGF 2F54D 5IT2H 3UYPA 3EHBD 5GZNC 4I77L 4P23D 4YWGH 4G6FD 1IGFH 2VB5A 3REWB 5FUZH 4MXVE 5ANMA 4XVJH 2OTUB 1B0RB 3DJ9A 5HVHC 2E7CA 5BV7H 1I3VA 3UTSE 4WI6A 2I24N 2Y36H 1FZOA 1QOKA 4JZNB 4GG8A 3VXUE 2AEQL 4MB4A 3KPTA 4L8SC 3TVMD 1D7FA 4TPRL 4XRCA 2XQBH 4NDMB 1U2HA 3F12B 2JIXA 1WUNT 3ZDZE 5IBUG 5ICXA 5IM7A 2X7LB 3D39B 4M3JA 1AE6H 3HMWH 1L7TL 4ZUWB 3QXVA 4OM1H 2P5WD 5GRYA 4M62L 2X41A 1JV5A 1FO0B 1ZMYA 3CFEA 5LCVL 4U1NA 4XXDB 3LIZL 4EI5A 1RZ7H 5GSVB 1UCBL 1I3RB 2CR6A 4OD1H 4KHXH 4BM7A 1NUDA 4PJFA 5C0NC 2FJHB 1JRHL 3SE4A 1MAJA 2VDRH 2NY1C 3T0EC 5GGTL 4XGZA 1GGBL 3C5ZB 3PWNA 4X5XA 3BP7A 4OCXH 1MCIA 3KPRB 5C0AA 3RWCA 3C2SA 3CCHA 3WJLA 1GZPB 3TZVC 2JJVA 5E2TL 5I19L 1T2XA 1RUAH 3DTXA 5MI0C 3GMPB 3GSRB 4UT6L 5D2LF 2W1NA 3ARFB 1CDIA 2GSIB 3KHQA 4KZEL 4OB5L 2CR3A 4M5ZH 4Y5XC 5D7SH 3QG7L 1FLRH 4YLQT 4WEUD 4YR6B 1QRKA 2IWGA 2R23A 1WFUA 1P4LB 5F3HA 4I18C 5FGRA 3VXNA 4Z95H 2H32B 1FVEA 3ULVE 3PP3K 4HQQL 5FYJD 1ED3B 2D7OA 4PRAB 4KAQH 4PJ7F 1EH9A 4Z7WA 2VZVA 3C6LB 3KPMB 4S10A 5IKCB 5I1CH 3RA7H 2XKSA 3LPFA 1CT8A 2ZNXA 4OD2A 4P9MH 2H45A 4OLXH 5TF0A 3IETB 3ZSSA 4HZAA 2EDJA 4Z0BH 1F00I 5FYLH 1L0QA 3OJDB 2KUTA 5DA4A 4APQB 4ONOA 3NN8A 3DVGA 1FBIH 4MD0B 1Y6MR 1JHKH 4LSPH 3TM6A 2H1PH 5FIEA 1JPTL 3PHSA 1RULL 4P9HH 4FQCH 3VG9B 2CDFA 4LLAA 1KLGB 5DMIL 3WEXA 1A5FH 3SDXA 1CGYA 5IG7B 3FRPA 3KJ6L 4X6CA 5FM8A 4ZUVA 4JHAH 1K5NB 5TDPB 4KKNA 4I1NB 5IUSA 3HUJA 4NC2B 2BMKB 1N0XL 3RI5F 1HHKB 1M6OA 2XRAH 4KUZH 3MACH 4IOFC 1OF2B 2NLJB 3MREA 4DUVA 4OZGB 4R2GB 3DMMA 3LN5B 1WAAE 1N4XL 1C1EL 3TO4C 5C09B 1S9VA 2A6DB 3KPNB 5DTFA 4XZUA 4HWZA 3W5NA 3KXFD 3STZB 4DW2L 5K93A 3K3QA 3MLVH 1KELL 1MREL 4J4PA 3O4OB 1MJ8L 4PJGA 4GQPH 4P2CG 4B5EA 1SJHB 5DGQA 2AJZA 5D6CA 1UWXH 4ZO9A 5FKPA 1FO0H 3QIBC 4S11A 3K2UH 5KSUB 3QCTH 4HIIB 2B1AL 3BZ4B 3HMXH 1FL6B 4FP8H 1HDMA 2NQCA 4QRPD 4M9PA 4JQVA 3MV7A 1CGUA 3EOYG 4PJBF 1CI5A 1MI5D 5HGHA 4YHLL 1EJ6A 5GGUA 3R1GL 5D7KE 4ZPTB 3TLRA 3KYMA 1P4IH 5T5FL 1ZWIA 4D94A 4N68A 1MWAB 2PO6A 4MJ5A 3QUMB 1TQBB 1BPVA 1F45A 4YPGA 2FH6A 4CL7A 5HGBA 4OGAD 3FQXA 2MFNA 1S9XA 2BC4A 1GOHA 3V4VH 3VG0H 2DLFH 3CX5K 1HILA 2FBJH 1JHTA 4WTZG 1AIFA 1RHHB 5DRWA 2A74A 4I0PC 2DIBA 4IDJL 4UIMB 4ODWB 5DEGA 4IHOA 3T0DA 3W39A 3QSKB 4HUWA 4PJHA 4DOHB 1UXWA 3DI3B 2H32H 3G5VB 3JV6A 1BEYH 3SQOL 1HCFX 2DQGH 4ONHB 3D0LA 5B3JE 5F3BB 4U6TA 1RZ8A 4RFNC 4IRSC 4P2OC 4XPHL 3QUXA 4RFEB 5IHLB 1GH7A 3HC4H 5L0QC 2Q3ZA 1CICD 1XF3B 5JDSB 1J8HA 1QNZH 4I3SL 1I1CA 3WFEL 1MFCH 1RV6X 5BRZD 1XGQA 3GSOA 3BN9D 1AFVL 4G9FB 5I74B 5IF0A 3ZKMD 4JFYA 3LKPB 3SOBL 5KS9E 5FCSH 3ARGA 5B22A 1FJ1A 4CUCA 1QHPA 1IGJB 2AK1H 4P2RA 3UYOD 5KZCD 5SWSA 3FB5B 4G8FA 4UNTA 4L4JA 1P53A 7FABH 1CFVL 4NM4H 4FQLH 3SDCB 3PHOA 5EBLA 5DEZA 3JWDL 4FABL 1I7TA 3C87A 4BELD 4FFVD 4KROD 5C9JA 4NNPH 5BS0B 3TBVA 3MV9A 4POUB 1QBLH 3P9LB 2C9AA 2NY7H 4L8DB 4RMWA 4CJ0A 3ZE1F 4YBLB 1ZEAL 1E6JL 1HH9B 5D1QC 4K9EC 4LL9A 5BVJA 1CD8A 4X4XB 1QFUL 3SDDC 3C8KB 2XACC 3LH2H 4HJJH 4DGIH 3WN5A 1WEJH 3SBWA 3S36X 2O61A 2NW3A 5JW3L 4MQXD 3K4AA 4YC2C 4UIKL 3T8XA 4JDVB 4DN3H 5JIIA 2XI9A 3G5XB 4PGEB 4JPVH 3LRGA 4QRQA 2DQCH 3V6OC 1U6AL 3W5MA 5MENE 1JN6B 2AEPH 4FXLA 4Q9QL 3B9KC 1UM5L 2LTQB 3PWVB 1FP5A 2HMIC 4M7JL 3ARBD 3LN4A 3QDME 5FOBA 3QUZC 4D3CH 5BQ7B 3GJEA 5MEQA 3RWEA 1NMBH 3RZWA 1A6VL 2F53D 1I85C 1HEZA 5CAYB 5C07E 2VLJA 2VKWA 1OTUD 2HKFL 5L2KB 4OCYL 2ZUXA 4NUGL 1S7XB 1FNSL 2DQUL 3INUL 5KTEL 3F7YA 2IGFL 4GW1B 2X9WA 2BNRE 4XNUL 5K9QG 4K23H 5D2LE 1IGYB 1T20B 5EO1B 4FQPA 1AD9B 1MSPA 2E6QA 3UTSB 3JVGA 3CPLA 5D1XB 1MHEA 4AEIL 3MGOA 1EEUA 5JW4M 3LB6D 1I8KB 5KVGH 1MWAH 4LLMB 1LHZA 3QUMH 2AERT 5B4MD 3DVIA 1FE8H 3UTTE 3FFDB 3G9AB 2KDGA 1X7QA 1MQ8A 2JCCA 1JF1A 1L9MA 1ZKAA 3BP4A 3NABL 5CCKH 1TJGL 1K8IA 5IIEB 3I75B 5FHAH 5I16B 1PD6A 3IJYB 1B4JH 5CZVH 2HT4D 1RZKL 2IPKB 4PJ7E 3PE9A 1A9BA 4ORZC 4S1QH 3D0VB 2BCKA 1N0LA 4MQ7B 5F7DB 3NFSL 4U7MA 1FFNA 2VDMH 2K7PA 1XZ0A 1OPGH 4WWKD 1WCBB 2EC9T 2V17L 3T2OA 5BXFB 4JFPB 2A38A 1K8DB 4NJAH 5HYFA 4TUOA 4G5ZL 3TCXA 1TZIB 1KGCD 5KW9H 1PJ9A 3GBMH 5C0IA 3IDJA 4MLSA 5I1AB 1FL5A 3ZMRA 1WBZA 5DC9B 3TBTB 5HI3C 1YMHA 1EHAA 1HQRA 1A7PH 2CO7B 1OSZB 4LK4A 5LWYL 1KBGH 3QDGE 4Y4KA 2NY4C 4YXHH 5MP6L 3PQYE 5F7HA 3MRNA 2E9BA 3VH8A 1JZ5A 2WWKT 2VLKA 2HRLA 4PP1D 1EMTL 1OD7A 4PJXF 1QUNA 1CGSL 4R8WH 3DX7A 2W91A 1HYRC 5HYJD 5FGCE 4ZFZB 1PZUB 3H8NA 5CZKA 1SJVA 4X6EA 5DS8A 4AM0B 4YDVA 5DMJB 1NCCL 2A6JB 2P5ED 3UTZA 2GITA 4IJ3B 2FX7H 4WHYH 3RGVB 4HXAH 1QVOA 1HNGA 2LU7A 2O5ZL 2GTWB 2F54A 4WFHD 2R2EB 5I8EA 1MHCB 1QKZL 4P23A 5JHDE 4GBXD 4HG4K 3PGCA 4HIJA 2YN3A 2DQEL 1F8TH 5IVOA 4BZ1H 3RU8L 4Y89A 3RTQD 5A2JH 3MRRA 1QFOA 5I66B 4HIHB 3BKMH 4WUUD 2ADJB 2NY6C 5DVOA 3RWFB 6FABL 2BJMH 4PJBE 4GS7B 3V2AR 1LNUA 5CUSL 3WJJA 3MOBH 4MJIE 3RI5K 3TVMA 4TTGA 1XR8B 1BD2B 5EULV 4F9PA 1C16A 3AROA 1U2CA 1LK2A 4XP4L 2IMMA 4ODSL 1ORQB 4MQTB 4D0DB 2HJLA 4MS8D 5B38A 1CLOH 4JM2F 4M61A 1IL1B 1G7MA 2DL9A 2V5RA 4K07A 3KR3H 3VFPB 3JTTB 1AY1L 5C2BH 4JZJC 1DQTA 1XGRA 4OF0A 4JZOB 2ADIB 1WVZA 2GYSA 3L3JA 3V7AG 4AIZA 1IGTA 5C0FA 3SE9H 1CE6B 2P48B 4DFIA 4PRDB 1C7SA 4OQTA 3CK0H 2B5IC 2PW1B 2R9HC 4PJ5E 4U1JB 1CD1B 2IH1A 2VXQL 3SGEI 4DVRL 1FNHA 5DQJB 3KPQA 1YC7A 4XNQA 3MRFB 4QRRD 1IEAB 3WS6C 5EBMA 5JOEA 5D7IA 3UTQA 2NTFB 5KVFL 5I71B 4BKLA 4NO5B 4XXCC 3SPVB 1E4XL 3RWGB 4QLRA 3H3BC 2W9DL 4LCIH 3TO2A 5IB2A