5J4MA

Crystal structure of shaft pilin spaa from lactobacillus rhamnosus gg - e269a/d295n double mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
264
structure length
264
Chain Sequence
TTQNVVLTKYGFDKDVTAIDRATDQIWTGDGAKPLQGVDFTIYNVTANYWASPKDYKGSFDSAPVAATGTTNDKGQLTQALPIQSKDASGKTRAAVYLFHETNPRAGYNTSADFWLTLPAKAAADGNVYVYPKNVQKTTYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVATNVPDGYDAAANTDFKADNSSSDILNAPSGILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
total genus 58
structure length 264
sequence length 264
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j4mA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j4mA01
4FQQA 4L3CB 3GSNA 4GFTB 1C5CL 1C7TA 4W70A 4R0LB 3MLWL 4YR6B 5AEAA 5D8JL 2CJUL 2PXYD 2X9XA 4LVOC 2AXFA 4MDJA 3OKDB 4ZOAA 3VXRE 4F3FB 4M1DH 1C8PA 2AK4E 4OZHF 1JL8A 4P5TD 4HXAH 2D7OA 3L3IB 4PJAA 3G5ZB 1J05B 4R2GB 4LPVA 3QISA 5E6ID 5GGVH 4JG0L 3HCVA 3K8LA 3WHE0 4OFYA 3LQZA 3GBNH 2WQRA 1RK0A 2HWZH 5IM7B 4M5ZL 3M45A 5BRZB 5MHSE 1S5HB 3P73B 5ETUA 4KPHL 4Z7OE 3FFDA 2FCBA 1A9BB 5EC1A 3E6HB 2HFFA 2HT4D 1ZAGA 1NLBL 1ZWIA 1IGFH 1OQXA 5EOCH 3X17A 2FIKA 4NO0A 3VFUB 3ARFD 1V8HA 2K3TA 1X3DA 4RGNC 4JVPA 1MLCA 1XF2A 3FT3B 3Q6GH 3T0EA 5IMMA 2Y1VA 3QDME 5F96L 1AIFB 4M7LT 3QQ4B 2GUOA 1I9JL 4XBGA 5DFWH 1IEHA 3GEWB 3R1GH 2DQEH 3VH8G 2DKSA 1BX2B 2A73B 4KMTH 1N7ML 4B53A 2AJUL 1AQKL 1IVLA 3IJSB 3K81A 4RMTA 1G7LA 5KG9A 1U92A 3VG0L 4XC1H 4KV5E 3WFZA 3MRKA 1YYMH 2DJ4A 1FVCB 2WAHA 4DAGL 2A2QT 4YWGH 4IJ3B 4KTDH 3BDXA 1CDCA 4BSJA 2VIRA 1YDPB 2C3HA 4HXBH 4JFED 3FO2B 2YN3A 5JOPD 3R4DA 2H2PC 4GG8A 3TIEA 2XI9A 3WNLA 4EXKA 4LRIA 1YNLL 1P7QA 1I8KB 3IJYA 3RDTB 4L4VD 1F11B 4LIQH 4X5WB 3C5ZC 2Y5TA 2BVQA 2GJ6B 4U1GB 1YEFH 5E8EA 4XX1G 1T1XA 2H2SC 2BNQB 5BV7C 1T5WB 3FRUB 4OQ1A 5A3IC 4ETQB 2RQ8A 3PL6D 3TN0B 3IDGA 4MQXD 3V5DB 4BSVA 2P43B 3QHZL 3QO1A 2JJVA 5TE7L 4R0LA 1C16B 4YR6A 4ZO7A 2XXMB 1W2KT 5TQ2H 3BP6B 3WJLA 4OCRL 5DK3A 3WNMA 3OKDA 2R8SL 4F3FA 3JUYA 3ULSB 1ZGLP 3SKJL 4KJPC 4ELMF 1EERB 3NIGE 3L3IA 3G5ZA 3S36H 3ZHKA 4P4KB 1J05A 1UM4L 1DQTA 4JN1H 4MAUH 4YBLC 4PRBB 5CILH 5I1DA 4J3XA 4CMMB 3VGHA 3BGFB 4IS6B 1QLEL 3DETC 3D3VA 1U3HB 1JCKA 4AZ8A 4WUKL 5IM7A 3ULUF 5BRZA 4F7EB 1S5HA 3P73A 4K7PY 1N0XH 4Q7DA 4AENB 3O11B 1HCFX 1A9BA 3E6HA 4J3OC 3O41B 3LIZL 5HI3D 3NABL 1KJ3H 3A67L 2AJYL 1CF8L 3NCEB 4K3DH 5D7LD 3DURB 3FT3A 3HG1E 1AIFA 1WWAX 5F9AC 3QQ4A 4GRWB 1A7BA 2OTUB 3UTSB 1EFXD 2VR5A 1BX2A 2A73A 5C9KA 1DQDL 3IJSA 4XNXH 1T21B 3V52H 3VW3L 5EU6D 2J8OA 4GJTB 2B2XL 1T4KB 1FVCA 5IBUG 1ERNA 1YMMB 3B3IB 3JWDL 5HDBF 3O6KH 5KSUB 4QXUH 3L7FA 4QOKD 2GY5A 1LK3L 4ALAH 3NVQA 1YDPA 1B4JH 1IE5A 2WIIB 1F3RB 3FO2A 2DWEA 4LHUB 5I74B 5JW5B 4Y16D 1WZLA 2NY2C 4NP4H 1ND0A 3ZT5A 1A6ZB 1AP2B 3RDTA 3WL9B 1OB1B 2GJ6A 3DECA 4Y4HD 5BS0E 3D18B 4LOUC 4X7FC 2BNQA 1IGYA 1T5WA 2WBKA 3FRUA 3TPKA 4XNYL 3O6MH 4PJEF 3L7EA 2VZ3A 1N2RB 3W0WD 1FL6B 3V8OA 3QXUA 5D2LE 3TN0A 1N26A 1REIA 4QTIL 3KYKH 2FSEB 3O2WH 2DYPA 4KVNL 1TIUA 4IRSB 4AEHL 1MCOL 3ZYOA 3IU4L 4H88L 4OAWB 3U83A 5KVEH 1C16A 4R97C 3L3HB 2WUBH 3KG5A 4G6MH 3BP6A 3I3DA 3F5WB 4PRAB 1DBML 4JHWL 3OF6A 1F6LL 3ARED 2H45A 1G84A 2X4PB 3DX7A 1DVFD 1VGKB 5JQ6L 4M6NL 5HJ3B 4FQXB 4U0QB 2ED7A 3TO4B 4I0CC 3ILQC 4P4KA 2F54E 1YPZE 4GKNB 3TEUA 3P4MB 1RJZB 4HQQL 4KJWC 3T3PF 3V0WH 4MD4B 4OZGB 3ZE0F 1G9ML 1W0YT 3QI9B 1IZJA 4CMMA 2OMNA 3CSGA 4IS6A 1YQVH 4DKFL 3GKZA 3ZMRA 3B5TA 4F7EA 5J11C 3EFFB 3UTOA 4AENA 3O11A 1KCVL 4N0YH 3FB7B 2AXHA 5KVGH 3O8XB 4HJGB 1U42A 1IC7H 2X9WA 4G43B 1IKNC 1RULH 1ZVYA 4OD1L 3ZZ1A 4S1RL 1F6FB 5T33H 3UXFA 3DURA 3MREB 4GQPH 5I75C 4PJCB 3L9RB 1RIHH 4X6DE 5TPWH 4J3TA 2OI9B 3TCXA 3UTSA 2XA8H 4JZOB 1NKRA 5SWQB 1T21A 3O4LA 4N1CA 1T4KA 4QGTA 1YMMA 3B3IA 4OLUH 4ZOBA 4I3SH 5KSUA 5IVZB 5KSAD 1FNGB 1ZHBB 1FDLL 4EQ2A 1V7ML 5AWNL 1LP9B 4NQCD 2WIIA 3FB5B 3WIFA 4L3ED 4LHUA 3MFGB 5JW5A 4X7SL 4APQD 3U36B 3KYMA 1H3VA 3K2UH 2HFEB 4FFZH 2YR3A 4K2UH 1A6ZA 1AP2A 3QDGE 3WL9A 4LNVA 1DE4B 1OB1A 4NUJB 2FGWH 3H9SE 5JZ7C 1FGNL 3D18A 4HK3N 3IS0X 4TRPL 3VMNA 1JGDB 3VGBA 1N2RA 3C08H 4BZ1L 4XNQB 4FQ1L 2CUHA 1FL6A 1J1PH 2NY5L 3PWNB 1JRHL 4R7NB 3O3UN 2WK2A 4MNHB 2AERT 4IRSA 1CI5A 4XRCB 4OAWA 2HT2C 4RMWA 5C0CE 3RVWC 3QCUL 1PQZB 1GOFA 3L3HA 3MNWB 5CINH 1B2WL 1ZTXL 5JHDA 3PP3K 4MZ2A 3EO9H 5F9JB 3F5WA 3OWEA 4PRAA 3SOBH 4ZTOL 2CUIA 4G6JL 2X4PA 4BZ2L 4TULL 4U6XB 1VGKA 4PD4K 5HJ3A 4FQXA 2Z31B 3TO4A 2E6JA 4GKNA 5H37G 3SDDB 5IB2B 2W9DH 2DLTA 3GMOB 4OZGA 3QI9A 3EZJB 2CO7B 4Y1AB 3G6AB 4M93B 5I0ZA 2R29H 2EDDA 4WVRA 1E4JA 3U6RB 1CXKA 3EFFA 1RJLB 1OAQH 5F7FA 3FB7A 1UKSA 4CVWA 5C6WH 3O8XA 4HJGA 3MV9D 4G43A 4PUBL 3ZKMC 4L8BA 4LSSH 2HFGH 3HN3A 5EPMB 3KJ6H 3IF1B 3QUML 3MA9L 1MQKH 3RZCC 5HHOD 5E2WL 3MREA 3QWOB 4Y4KC 4PJCA 3L9RA 5T1KB 2R0WL 4UTBH 5CJXA 1ACYH 3QPXL 3RGHA 5EBLB 3A6BL 4JZOA 3IVKB 3UO1H 4JFOB 4C4KO 5L2KE 2VXVH 5SWQA 3ARTA 2VL4A 4J3SA 4RDQG 1CDBA 4ODVL 1P4IH 5FF6A 2VQUA 3ARDA 5IVZA 1KIRB 4U3CA 1NCAL 1OWWA 3T4AB 1ZHBA 1LP9A 4WUUD 4K8RC 2YBRA 3FB5A 3MRGB 5DUML 3EDEA 3NH7H 4GXVH 4D3CL 3U36A 1FVEB 1UH4A 2HFEA 3GNMH 5JXAH 1JWUB 2MQCA 4KKNA 4Q9QH 3BN9C 1MCHA 3VD5A 4NUJA 3STLB 4GAYB 1ZGLB 4OD3L 4P46B 3SE9H 4JRYE 4HC1A 4YDVB 3L95B 1JGDA 3I50L 4S0SD 4ZUSA 4PBXA 4WNQB 4XNQA 1CU4H 3PWNA 4R7NA 3RQ3A 1N4XL 3BDYL 5KZCB 4MNHA 3WNOA 1CQYA 4XRCA 3NTCL 3TVMB 1PQZA 1YEDB 4NQXB 2VXQL 2VDNH 1OTUD 5F9JA 5I8EB 5TE6L 3FKUS 4HAFA 4XPAH 5KTEH 3KS0H 4U6XA 4Y7MA 5C71A 4NBXB 2Z31A 3MBEC 2LU3A 5ISZB 3DV4B 3SDDA 5IB2A 4CN1A 4K9EL 1PD6A 3N1FC 5C0AD 3O0RL 1EO5A 3GMOA 2HJFB 5I66B 1FQ9C 3SGKC 4Y1AA 3G6AA 1ADQL 4KGLA 2F9BT 4RSVA 1QSFE 1QO3A 4LSQL 5GRVK 3U6RA 2FBJH 5GRXG 4MS8D 1RJLA 5ITFB 1CD8A 1AI1H 5E7BA 5MEND 1RPQA 3Q5TA 1RIVH 4IMKA 4AEIH 2FHCA 2FR4B 3IYLW 3TH4T 5EPMA 2E7CA 3PXHA 3G04B 4ZS6C 3EYFB 4Z7VE 5F7UA 3QWOA 5T1KA 3EUUA 4ZO9A 1YNKL 1JF6A 2Q7YB 1KIPA 3HPJB 8CGTA 1A6PA 2ZSWB 2IH1B 5D1XD 3T0AA 5EBLA 1HHJB 4LMQE 3IVKA 4JFOA 1NBYB 4PY8J 3U7YH 1P84J 3VXSD 5JW4M 2KQMA 3TBYB 1KIRA 2NYYD 3D85B 5C09E 5E99H 3CLEH 2WBJC 3WFBL 2EH7H 1ZHKA 1GH7A 3MRGA 4NM4L 4YHLL 1OP3H 1H5BB 1FVEA 1RI8A 1FP5A 4WFEE 1NCUA 4PJ8D 1JWUA 4WFGD 3RL1B 5I1EH 4M1CC 5IK3B 1FO0H 2E27L 2IPTH 1U8IB 1AE6L 2OJEB 1JNNH 3STLA 5L88H 3JV4B 4GAYA 1ZGLA 4P46A 4NRYB 5E08L 1WISA 3BKMH 4YDVA 1NH6A 5HGHA 4OZIE 3RY6C 7FABH 4WNQA 1OP5K 3FQWB 4NZDA 3ZO0A 1LQSR 1C5BH 1GRWA 4JQIH 1JPGB 2FB4H 5K9JH 5JHLL 4Y5XA 1GVIA 3MPCA 3TVMA 1PYWA 3GKWL 1YEDA 3BESR 3RWCB 5L9DH 4U6VH 4LSUL 3ZE2F 3JWOH 4R8WL 4RRPA 3HLAB 1T04B 4PTUB 1GYAA 3QXDB 3HAEH 1TQCC 3H3PH 1YEEH 2E5EA 5ISZA 3DV4A 3LMJL 2UYLB 3I3BA 3V4VL 5IFAH 1ITBB 1CXEA 3G6DL 1FFNB 1ZT1B 2HJFA 3IDXL 5IVXF 3NZ8B 5I66A 4H0GA 3GI9L 1C5CH 4ZD3L 3MXWL 3MLWH 5D8JH 4YHNB 2CJUH 5T3ZD 3MRBB 5ITFA 1NC2B 5J1TC 5F44A 1JYNA 4TPRH 3GSUB 4MHHG 4Z7UB 2GK0B 5IMOB 3W2DH 1U8QB 4XCNB 4MNGE 4X4ZA 1E0OB 3G04A 2P49B 3EYFA 3F65A 5E7FA 5DC4B 2Q7YA 4X5LA 4JG0H 3HPJA 5CWSB 2JJTA 2ZSWA 2I60L 2IH1A 3K7UA 1HHJA 1E4XL 4X7TB 4WFHE 3RHWK 3VFGL 2DQGL 3T0DA 1UG9A 4M5ZH 1HSBA 4L4TE 1NBYA 4KPHH 4EBQL 3S98A 3MLYL 1EBPA 2B20A 3QQ9C 1Z3GH 4OZFH 4PJ5E 3TBYA 3KPLB 1NLBH 4NCC2 3D85A 3G5YB 3MNZB 5F88A 4LEOB 5D7IE 4RGNE 1S7RB 4MA1C 2QADD 1MCSA 5MHSD 4KXZI 4WDIB 35C8L 5BCAA 3VFMB 5IIEB 5IGXH 1H5BA 1TTFA 5F96H 3TO2B 5FA3B 4UU9B 1IEBB 1I9JH 1CGSL 3RL1A 2IANB 5IK3A 5D4QA 1U8IA 2OJEA 2PUQT 3JV4A 5MERB 4NRYA 3SKNB 2AJUH 1INQB 4Z5RA 2EDOA 3U0TB 4DUWA 4LVHC 3QDMD 2MCPL 3JWNC 4CKVX 3MRDB 4DAGH 5CS7A 4WJ5B 3FQWA 1G6VK 1NLDL 2ITCB 1H3PL 2X1XR 1JPGA 4MMZC 2R2BB 1MVUA 4NKMB 1WICA 4HBCH 4TTDC 4J4PA 5L8LB 5D1ZD 3RWCA 1OTTC 4YC2C 3ZKQD 4FTVB 4JZJC 4D94A 3HLAA 5C0JA 1T04A 4PTUA 3BI9X 1R3JB 4KRMB 1T7ZA 3QXDA 2YWZA 1AHWC 1IKFH 2P5EB 2UYLA 3GMPB 3RI5F 3GSOB 1FFNA 3SCMB 1ZT1A 1XZ0B 4ZFOB 3NZ8A 3QHZH 4AQOA 5F1SA 3HR6A 1U6AL 4GAGL 5TE7H 4HWEL 5I6XB 2JJUA 4ZYKA 5F6IB 1BEYL 4BQ6A 4X99B 5DJ2B 4YHNA 1DANU 4YBHA 3UCRA 3MRBA 4PGBB 2K1MA 4OCRH 3IAQA 3MV11 1NC2A 2R8SH 1QNZL 3GIZL 2NY0B 1EZVX 3S4SB 3UMTA 5I18L 1U0QA 1DJSA 4WV1C 5DJYA 1EAPB 3SKJH 3O3DB 2GK0A 5IMOA 2EIZB 1U8QA 4XCNA 5F1IB 3LDBB 3S6CA 1Q0YL 5EWIL 5JORB 4XPTL 1G0DA 4PRHE 3WLWC 3DBXB 3OKNA 1TPXB 4GMSL 5ENWA 5CWSA 3T0BA 3RVTC 1QLEH 4ODXA 3SGEI 4JN2B 5JW4N 3HE7D 3GRWL 4HFUL 1EGJA 1X4XA 4PJ7E 1FE8L 3LIZH 3KPLA 1XEDA 4KDTC 5FHAL 3NABH 4PJHE 1WEJL 3G5YA 3MNZA 4LEOA 1A7RL 4RZCB 1X5GA 2AJYH 5ALCL 1S7RA 4PRIE 1CF8H 4WDIA 3DWTA 3QEHB 5T1MB 4P2OB 3VFMA 5CD3B 4W6YB 3UP1A 5FA3A 1G1YA 4UU9A 1IEBA 4MJIE 4Y8AA 3WFEL 2IANA 5DHVB 4XXDB 4K3HA 3LKNA 2AXJA 5D6DA 5J89A 5MERA 3SKNA 1INQA 3U0TA 3D3VD 1DQDH 1ZEAL 2X42A 4OLVL 5TH2B 3VW3H 3HG1D 5AYUL 2B2XH 4X8JA 4JFDB 3JBG7 5L8KB 2XTLA 3MRDA 3F6LA 3JWDH 3QCTL 1LK3H 4BSWB 3ZDYE 4R3SA 2BP3A 4NKMA 3X3FL 3N50A 4O9HH 1F13A 3TWCL 2EE6A 4FTVA 3JWOC 4RA3A 1CWVA 1XF5B 1DN2A 1JYVA 1SEQL 2P5EA 3GMPA 3SCMA 3GSOA 3AROA 4H26B 2JF1A 4QTIH 1XZ0A 4U6YB 4ZFOA 5BS0D 1A4KB 4JKWA 3CFJB 4KVNH 1MFBL 4AEHH 1MCOH 5IB1B 3IU4H 4H88H 2DQTH 3MGAA 4HS8L 5I1LB 2VQ1B 4JJ5B 3I84A 4X99A 5DJ2A 3BHBB 2GJZB 4PGBA 3W82A 1I8IB 1DBMH 4JHWH 2Q87A 3WUWB 4XI5D 1CG9B 1EAPA 1OSPH 3O3DA 2YUXA 5JQ6H 2YXFA 2EIZA 4PRPE 5F1IA 2EO9A 4HQQH 5JORA 4LAQL 3BGMB 5SX4H 3GSXB 3BPNC 2ENYA 2ZUYA 4JVWA 4XWGL 2X4OB 2VMFA 2AJZB 4K7PL 5SX5K 3QR2A 3GJFB 2DYPD 1KYOK 1F4YL 2F54D 4DKFH 2VZSA 3FB8B 2F8VA 1FAKT 1IGML 1BD2A 1PSKL 1KCUL 2VERN 3MUZ1 3G9AB 3QUYD 4MHHI 1KCVH 2ILLA 4MXQC 4ZAKB 2WWKT 4RZCA 4W4OA 3RUGB 4OD1H 4UILL 4S1RH 2YD6A 1VGEL 3GHBL 2UWEF 3QEHA 5CD5D 2APFA 5T1MA 4P2OA 4Q6IC 5CD3A 2HFTA 4JANB 4ZXBC 5KS9E 4ZQKB 4Y8DC 1JPSL 2X1OA 4UINL 3ISWA 4LEXL 5DHVA 2DIAA 1IAMA 4TNWF 1CDHA 32C2B 4O51B 3VXRB 5FYKU 5FFLA 3HMWL 2AK4B 3QDHA 5HGDB 5TH2A 1W0WB 1H3WM 3BKCH 1MCEA 4MNQD 1BFTA 4JFDA 4LARL 4OI8A 4YX2L 4NGHL 4HSQA 3O2DL 3WSQL 1EH9A 1S9YB 4HKJB 4BFBD 5DQJB 1FDLH 1HKLL 1SHMA 1V7MH 5AWNH 2ZZUT 3O9WC 4HWBA 4AL8L 2A6JB 5FYLL 1SEBB 4X7SH 3K46A 1MY5A 3CIQA 3UBXI 1V3JA 4LIQE 3LPWA 4JDTL 1FGNH 1XF5A 5C0IB 4Q2ZB 4KJYB 4LSRL 4TRPH 3SQBA 3K4ZA 1BOGB 1MFAL 2KL6A 4ODHL 3O4LD 3MLSL 5ACLA 1FYHB 1WT5A 1X5XA 1QRKA 4BZ1H 4FQ1H 1KEGL 3QDGD 4H26A 2WV3A 5DMIL 2GYSA 2NY5H 4U6YA 4X8XA 1A4KA 3CFJA 5L8JB 1DBBL 5IB1A 3B9DA 1HILB 3QCUH 2VQ1A 3DX8B 1CVSC 4JJ5A 5I1LA 3AS3A 4NNPL 1B2WH 1ZTXH 4Y5VB 3BHBA 2GJZA 4BM7A 1I8IA 4ZTOH 4NRZA 1NCTA 1FZMA 2HJKB 4G6JH 3WUWA 3EKCA 4BZ2H 1CG9A 5C0CD 1M7XA 2EDFA 2CK0L 1EIBA 4X9HA 1WF5A 3CLFL 3GI8L 3BGMA 4PLJD 4Z78B 1HE7A 3GSXA 3S88L 2XWTB 2GHWB 4XBPB 2YRPA 3UPCA 2L7UA 4RMVA 5D5MB 1ETZB 2MJWA 1A14L 2FIRT 2IGFH 3BW9B 1BGXL 3GJFA 4YLQT 3EDKA 2Y5EA 4RAUB 3FB8A 1IM9B 4XZUA 4NJ9L 2DF3A 4MJ6B 2CRZA 5JHDD 2AJXH 4P23A 4B5EA 5DFVD 4QRPB 4NZUL 4ZAKA 1PKQA 2NTFB 1DN0B 4PUBH 5C07E 3F7VB 1AKJB 2AW2A 3CFBA 3IB4A 4NDMB 5FAAA 3MA9H 1H0DB 2HKFL 5E2WH 3WIHA 4JANA 2R0WH 4JM2B 4ZQKA 1WZ1L 2IAMC 2IEPA 3QPXH 4O51A 2FX8L 3A6BH 3DYPA 4O5LL 3QA3B 1D6EB 2AK4A 5HGDA 2BNRE 1W0WA 4NQTA 5EU4A 2WMPA 1TJHL 4MXWL 1QR1B 2EECA 3FN9A 1S9YA 4HKJA 5EBGA 1NCAH 3FQXB 5DQJA 2H32B 3JWDC 3U7AA 3B2UC 1I1CA 1X5HA 1QD0A 1E6JL 2A6JA 1CS6A 5DUMH 1SEBA 3VGAC 3VFNB 3HZVA 4D9QE 4D3CH 5K9QI 2FHFA 3NCJL 2LTQC 1V3MA 2BRQA 4OD3H 1R3IL 4KQ3L 2EXYD 5IHZB 5C0IA 2KKQA 4KJYA 3CAFA 3I02B 1BOGA 1CCZA 3I50H 1T7VA 3LQMA 1U58B 4TSAL 5EN2B 4P2QB 3QIWB 1PLGL 1J1OL 3ARDD 2Q76B 3CMOL 1N4XH 3BDYH 4HWUA 5GGSB 2VDLL 1CL7H 4JRYD 2DM2A 4FABL 2G5BB 1HILA 1T1YB 4NZJA 3CUPB 5DJ6A 3DX8A 3T3MF 3P77B 4Y5VA 4GRMB 1FIGL 5BW7A 2VXQH 4NRXB 5TE6H 1ZA6B 1V5JA 4N1HB 2HJKA 1X5AA 5GRZA 4FFVC 2EDJA 1SY6A 3BP7B 1UXWB 5DD1H 1OLLA 5EZLB 4IIQC 5JIPA 5F1NB 3IXTA 1JGUL 5F1OB 3ULUC 4K9EH 4Z78A 1MI5E 3O0RH 3H6JA 4LMQI 1HYSD 1BF8A 4XBPA 4DJMA 3EOBB 2F74B 5D5MA 1ETZA 1G9MC 1KT2B 3BW9A 1E6OL 1RUPL 1ADQH 3AFLA 1NKOA 4LCIH 5ESVB 4LCWB 1KTLB 4LSQH 4MJ6A 2VH5L 2B1AL 4PJAF 2E8YA 1OAKL 4WEMB 3MV8E 4WI5A 4QRPA 3RVUC 4DZBB 3C60A 2NTFA 4DWHA 5CAYB 3HE6B 5D2LB 1DN0A 2XY1A 1T22B 4PREB 5FOBB 1H0DA 1IT9L 1EX0A 1NEZB 5CGTA 3PGCB 5INCB 1YNKH 4JM2A 4XCEB 4ZOEA 3ZLQC 1WAAE 2VLRA 1D6EA 3QA3A 4YFLF 3HNTH 4YDLC 1II4E 5FCUL 2YRLA 1QR1A 4HPYL 1NGZB 4KV5F 5HI5C 4BELD 1QZ1A 3EGSB 3TPUB 3NGBC 3FQXA 2H32A 1NFDE 3WFBH 3ARZA 1ODAA 4NM4H 2XN9B 3VFNA 1RIUL 2AAVA 1Z0NA 2AABL 3QEQE 3IKKA 4U7KA 2J8UB 3BT2L 4O2FB 4Z7NE 2E27H 3H9ZA 1AE6H 4PG2A 4RX4A 1FNHA 5LJYH 1MAJA 1HCVA 5E08H 2XKNB 4MAYC 5IHZA 3UZQA 5EU5B 4HF5L 1I4FA 3V6OC 4WFED 2ZOLA 4POZC 1U58A 5EN2A 4LCCC 4P2QA 3QPQD 4RDQF 5J13B 3F58L 4OGYL 2IJ0C 4X6DB 3LN9A 2APBA 2GSIB 2Q76A 5GGSA 2YPLB 5CGYC 1UYWH 2EYRB 2G5BA 1T1YA 1QVOB 3CUPA 3P77A 3GKWH 3L3DB 4GKZB 4NRXA 4LSUH 4R8WH 1ZA6A 2FEDD 5IBLD 3BSZL 4YPGB 4F58L 3U30C 2EIEA 2VKXA 2OQJB 1AY1L 1JPTL 1WLHA 1UXWA 3IETB 3MOAL 3AC0A 5EZLA 3LMJH 2RB8A 1PKOA 5F1NA 3V4VH 3X14B 4UOJA 3G6DH 5HGAB 1NJ9B 4AJ0A 3GMMB 2F74A 5CKGA 1RVFH 3P0YL 3WIIH 2BY0A 4LU5L 1KT2A 3D9AL 5ESVA 4JY5L 4MGXA 5J1AB 4HMCA 3MXWH 3H9SB 4LCWA 1KTLA 3LPFA 3OPZL 4XMKH 1BAFL 1Y6MR 3PJSB 5C70A 4UNTA 4DZBA 4UV7L 3HE6A 4U6HB 3FONB 2E6QA 4JY4B 4UQ3A 1T22A 4PREA 4YE4L 5FOBA 5LWYL 3DYMA 4Y89A 3F12B 1NEZA 2CRYA 3PGCA 1CBVL 1N8ZB 5INCA 1NEUA 3JVGA 1WIUA 3LKSB 4XCEA 4KHTL 4XTRC 2I60H 5FGBC 2A6IB 3S35X 1WGOA 1E4XH 3HZKB 5EULV 4I3GA 1H3XA 5DMGD 3VFGH 2DQGH 1I8LA 3UBXB 2HRLA 4C56B 1TVDA 4EBQH 1NGZA 3MLYH 5IW3A 3TPUA 1ZLVK 3SKOB 4WFHD 4XHQA 3T2PA 4XCFL 4L4TD 1F2XK 35C8H 3V4UL 1IQWL 2XN9A 3VG9C 1KELL 2J8UA 2VSCA 1CGSH 4NKDA 4RGND 3KPSB 1AGBB 1YEJH 4KGJA 5EU5A 1X44A 4LQFH 3BISA 2FEEL 2MCPH 1D9KC 5FDWB 1G7QA 3CDCA 4K3GA 1NLDH 2CMRL 2GSIA 4GG6E 2YPLA 4CVXA 4PJ9A 2E9BA 3JSSA 3H2WA 5A2IH 4A2MA 4PRNB 4HIEB 4A6YB 3VFOA 4Y2DB 1CT8B 1DL7H 4H0IA 4RCAA 3L3DA 5L2KB 4GKZA 5DO2C 1LWRA 1AO7E 4U31A 4YPGA 3D48R 3W5MA 4X0KB 1VFMA 3RGVA 2OQJA 1TVBB 3IETA 2FJFB 5D7JB 4P9ML 4JRXB 4KKCC 2BOCB 3X14A 3PQYE 3V9FA 3VWKB 4K9EC 3B9KC 3WCYA 5HYJB 4KK5C 5HGAA 1NJ9A 1A7OL 4X6EA 2HA1A 1U6AH 4GAGH 1Q9LB 4HWEH 3QSKB 5J1AA 1A4JB 3FO1A 3ARBC 4XCCL 1BEYH 4ONOA 1EVUA 3WHE1 4WI2A 5LVEA 3PJSA 5DJDB 5JMRA 4M8VA 1XF4B 2B0SL 1QNZH 3GIZH 3Q1SL 5I18H 3BPCA 1Q8MA 3VCLB 1CD0A 2HT3D 4MA3B 4U6HA 3AXLB 3FONA 1A5FL 1WCBB 4JY4A 3B4NA 3F7YB 1Q0YH 5EWIH 4XPTH 3F12A 3G6JA 1AGDB 3QQNA 4DVBB 1N8ZA 1N64L 4D9RE 3CGTA 4GMSH 3SJVE 3LKSA 2F8XC 1BVKB 2A6IA 3HZKA 3D39B 3UBXA 3PWLB 4C56A 4HFUH 5ESAB 1FE8H 3BO8B 2CKBB 5FHAH 1WEJH 2MFNA 3SKOA 3ET9F 4G9FB 2Y9RT 3BEVB 3ALPA 2E7BA 5ALCH 4XNUL 1UKTA 1YEKL 2VDQL 1L7TH 5JLZB 5GPRA 5CBEA 1IGTB 3F7PC 1QSFB 2HTKC 3K1KC 1NAMB 3WFEH 4I9WD 2XZZA 4D8PB 3KPSA 3CMGA 3QB7C 4PRID 1KSRA 4O2EA 1BJ8A 1J0KA 1ZEAH 3L3OB 1HQRB 4MLIA 4TVPL 3SE3A 1J8KA 5HYSG 3NCYS 1KPRA 4MJID 5FDWA 1CGXA 3LKQB 1UWEL 3QCTH 1N3NB 5ESQB 5E6IC 3PABB 4UDTB 5DRWB 3QZWB 2IQ9L 4PRNA 4HIEA 4P59L 4A6YA 4NN7B 4Y2DA 1CT8A 4FFWD 2AK1H 5F21B 4FQLH 3BRDA 2MCG1 3VRLE 4X0KA 1J88A 2W60B 3OJ2C 5C09B 2NY2D 1MCRA 1TVBA 2Q3AA 1SEQH 4N8CL 3OAYH 2FJFA 3ARFC 4JRXA 1DEDA 2YN5A 2BOCA 4L9LB 2PCPB 3VWKA 5HYJA 2JJSC 3LRSB 5C86A 1I3UA 1MFBH 4ODSL 3PHQB 4L8SC 4BJLA 4HS8H 1IEAB 3WKNA 2ADGB 4JPKL 4HKBB 1E27B 5E95B 1XF4A 5CBAB 4DGYL 5ECJE 5D2NB 2FECI 1OAXL 3VCLA 3WMSA 3SDXB 4MA3A 1LNUB 3AXLA 1QRNE 3R8BB 1WCBA 5DJXA 1KG0B 2A77L 2G75B 3DUSB 4ONFL 1OAYL 3F7YA 4LAQH 2BVUA 3TM6A 1AGDA 3OB0K 4K7PH 4YHIB 4PJDB 4EIZC 2YD8A 1BJ1J 1BVKA 4PRPD 4KJWD 3T08A 3WO3B 2BSED 1F4YH 3TCLB 4X6BB 2RIKA 3D39A 2EEDA 3PWLA 1IGMH 3NAAL 5C7XL 2NPLX 3LRGA 1PSKH 1QHPA 4CMHC 5ESAA 3BO8A 2CKBA 4F9PA 3HB3D 5JPMB 4QRTB 2BMKB 4EUPH 4G9FA 3BEVA 3ECBB 4N68A 4MQXC 4UILH 1T83C 1FSKC 5CSBA 1VGEH 3GHBH 8FABB 2A38A 5JLZA 1SYSB 3TJHC 1KIQB 1NCWL 1IGTA 4LVOB 3BKYL 1VSCA 2PYEB 1QSFA 4HK3J 1NAMA 3QCVL 1JPSH 1MCQA 4UINH 4LEXH 4V1DE 2VLJA 1QG3A 1U8KB 4YUEL 3UYOD 4O2CB 1F4AA 3HMWH 3L3OA 1HQRA 1KTRL 1KJ2B 1GC1H 2CD0A 5E2TL 4LARH 1BD2D 4NGHH 3O2DH 4HG4K 4F9LA 3WSQH 3LKQA 5C0NC 5DRZB 2XIDA 5ESQA 5TDPA 1HKLH 3PABA 4RQQB 4UDTA 5DRWA 4AL8H 4ZUTB 5FYLH 1ZHNB 2EE2A 3BPOB 3QZWA 3WXVL 4Z8FL 4GOSA 5BXFB 2FH8A 3JV5A 5IHBA 1PAMA 4MA7L 4M8QB 4RAHA 3UTTB 2W60A 4JDTH 4PJ5B 5DC0A 5DVNA 4OCWH 1R0AL 5MI0C 4LSRH 5C09A 5C0BB 1ZT4B 1SBSL 3PV6B 4X6FB 1MFAH 4ODHH 1S9KC 1F42A 3VRJB 3MLSH 4RMUA 1DEEB 4L9LA 2PCPA 3IDYC 1FFPB 5DMIH 3LRSA 3U9UB 5GJTL 2EDYA 1QFPA 4OZHE 1UJTA 2YC1B 2UUDH 4TNVF 1DBBH 3PHQA 3PWPB 4NM8L 1OW0C 4YHZL 3CH8A 3VI4F 2O5YL 1OARL 2ADGA 4NNPH 3VJ6A 4HKBA 1E27A 4WW2B 1X9QA 3NA4A 5CBAA 1QOKA 2IPKB 5D2NA 4NKOB 5C08E 4XNZB 3SDXA 1LNUA 5HHNB 1KG0A 4JFFB 2G75A 2CK0H 3D69A 5LXGL 5EIQA 4Z7VF 2AJ3B 2ESVE 3IFOB 3R0MA 3S88H 5D7SL 3R0NA 4Y16C 4HCRH 4YHIA 1ZSDB 4PJDA 3C5ZB 1S78C 1A14H 1HXMB 1BGXH 2P45B 2VYRE 3KR3H 3RWDB 3TCLA 4X6BA 5BV7B 5KOVC 3SBWC 4Y4HC 2FHBA 4NJ9H 4OTXL 1UM6H 1BWMA 5A2JH 2CDFB 3DMMC 1TQBB 2RHEA 4XXCC 3UZVB 4NQDB 5JPMA 1ZKAA 4O02L 3OGCB 4QRTA 4NN5C 1HEZB 2BMKA 2BRRL 3ECBA 5I71C 3WNNA 2W07A 1EEZB 1KC5L 8FABA 1CIDA 4PTTB 1SYSA 3CFDB 1KIQA 3BAEL 4DEPC 1YEGH 1ZA3B 2PYEA 5SV4A 3QXAB 3ZKMD 2GJJA 1DSFL 1WZ1H 5C07D 2FX8H 1VHPA 4PJBE 1MWAB 1U8KA 3TZVD 4Y4KD 3FTGB 1HK6A 4O2CA 3AREC 2NQCA 4YGAB 1KJ2A 4MXWH 1DVFC 4DVRL 4JKLA 4YBLB 3OAZH 4P23D 5CLWA 5IB4B 2NY3D 5DRZA 4PRHB 4X9GA 1IBGL 1KFAL 3T77B 4RQQA 1E6JH 4ZUTA 1R5IB 3MRRB 3DUHA 1BVLB 1ZHNA 5C3TA 2VTFA 2MPAL 2W38A 5IV2B 5BXFA 4DZ8B 4JG1L 2R69L 1GZPB 4M8QA 2IMNA 3UTTA 5FIEA 4Q58C 2GSGB 5GGSY 3IDNB 4KQ3H 4NO5B 4AG4L 5C0BA 3B5HA 1ZT4A 3PV6A 3EYUL 4LCYB 4ORGB 4QRSB 3VRJA 1A47A 4TSAH 1DEEA 3KLAB 1RJYB 1FFPA 3EW3B 1J1OH 3U9UA 4ELME 3CMOH 4EN3A 3P4LA 1TTUA 2VDLH 2YC1A 5KVDL 3E3QC 3PWPA 4GRLD 3ZTNL 3PWVB 3IAGC 3NFSL 4WW2A 1FIGH 3T1FB 2P46B 1FIEA 1YECH 4P2RE 1KXVC 1A7NL 2IPKA 2NXZC 4NKOA 5EUOB 3CDFA 4U1KA 2V17L 3ZL4L 1LK2B 4GS7C 3NZHL 5KSAC 4JKPL 4JFFA 3CFCL 1RK1B 1CYGA 5FXCH 1PG7W 1R3KB 1JGUH 1T2JA 1SJHB 2AJ3A 4GBXC 1EHNA 5C0FA 3GSQB 3IFOA 1CLCA 3N85L 5HHMD 1CLOH 2OL3L 3C5ZA 2OK0H 3MLXL 3QNZB 1HXMA 3DO3A 1E6OH 1RUPH 3WNKA 1NMAL 4LDEB 4MD0B 5LG1A 4KUZL 1MI5D 2VH5H 3QXTA 4G80B 2CDFA 2E7LA 4MCZB 4YHYC 1OAKH 2KZ1B 5ANME 4NQDA 5KSBB 1T7YA 3OGCA 5IKCB 1HEZA 4EI5D 4IHOA 3M8OH 1EEZA 4UBDC 4R97B 2W9EL 1IT9H 1KCKA 4PTTA 3CFDA 2CPCA 2R1YB 5HDBE 1ZA3A 1MRCL 2JK5A 4OF6A 5L7XL 5C2UB 3HAEG 4NIKB 1OP9A 1P7HL 1MWAA 2GCYB 1YYLH 3FTGA 5IFJB 5HYQB 2NX5E 3ZYJA 4LASL 4JFQB 3GZKA 5FCUH 1T66C 1UB5B 2DMCA 4HPYH 1JF5A 5HHQB 5JA9A 3FQUB 3C60D 2FATL 1KIUA 3T77A 5KAQF 5FECB 4LLDB 5EZIL 1R5IA 1BVLA 1LILA 4PJEE 1MELA 1RIUH 1A22B 1BFSA 1OGTA 1TJGH 2AABH 2DM3A 5J11B 5IV2A 3BT2H 5JO5B 3DOSA 2Z92B 1Q1JH 4GO6B 3LD8C 2GSGA 3IDNA 3V6OE 4NO5A 2AI0L 1UM5L 1UWXK 2VLRD 4HF5H 5CEXB 3GMQA 3QEQD 3L1OL 4LCYA 4ORGA 4QRSA 5I75B 1V3KA 3KLAA 1HQ4B 5IEHB 3F58H 4OGYH 3EOTH 1CFQB 2PTUA 1QBLH 1MCNA 1FZJB 3GSNH 3PWVA 1RUAL 4ZUUB 5E9DD 3S7GA 1HZHL 3CZFB 3T1FA 1MQ8A 4OZFG 3ZE0E 1FL3B 4FS0A 3BSZH 2DL9A 3GMNB 4F58H 1MHPL 1NGQL 4OLXL 4F15C 3L3GB 5EUOA 4HZLB 5B3JE 4RX4D 1JPTH 1GCFA 2D0GA 3MOAH 1RK1A 1ZS8B 3QQ3B 2W0PA 4XBEL 2IALB 1SJHA 3GSQA 5FYJD 4HDIB 3P0YH 2YK1L 3QNZA 4LU5H 3D9AH 1ZMYA 2R1XB 4JY5H 4MD0A 4PJXB 2BSTB 4LK4A 3OPZH 1BAFH 1EJOL 4G80A 1EAJA 1EHLH 4MCZA 2Q20A 4LDLB 4WTXA 3VWJC 1AR2A 3QIUC 2IH3B 4BK5A 5KSBA 5B3NA 3TV3L 4UV7H 1F8TL 2DD8L 3BQUD 3A6OA 3WXWL 5K33A 1HHIB 2VXSL 2OCFD 4LNRB 2VE6B 4U1HB 4YE4H 5LWYH 2X44D 5FO7B 2R1YA 1CBVH 3C2AL 4CU8A 5HDQL 5IT2L 3EYQC 4W4NA 1W72B 4ZS7H 1JGEB 4KHTH 5DA4A 3U4EB 5DJCB 2IWGA 5EU7E 5FA4B 3LZFL 1KB9K 5IFJA 5HYQA 3H9HB 4JFQA 2I26N 4L8CB 1G9NL 1X5FA 1UB5A 4I8DA 4L29B 5HGGS 4PYGA 5HHQA 3D0VB 3VGEA 5IB3B 2P7TB 5FECA 4LLDA 2V9RA 3QQ9D 3V4UH 1IQWH 5HYFA 3HPLB 3L5JA 1FC2D 3QH3B 1KELH 4OFIA 4GUPA 1EXUB 2OSLB 5JO5A 1MIMH 2Z92A 2B39A 2LAAA 1WFOA 2XZCL 3DVIA 1IKNA 4YGVB 2XZAL 5T3XD 2AS5M 5EOQL 5CEXA 3RZCB 3HC4L 1MUJB 5SWSE 4YEFA 1HQ4A 3V0AC 5IEHA 2DQJL 3LQAH 5FV1L 2CMRH 2M1KA 3D2UB 1U36A 3UYRL 1FZJA 1A1NB 5D1XC 3L5XL 4ZUUA 2DL2A 5E2VL 3CZFA 2BNRB 1FL3A 3OB8A 2R9HD 1U8JB 3GMNA 2OYPA 3L3GA 2Q86B 4S1QL 4TTDD 4JQVC 2NYYC 2Y06L 2XQYG 1FZKB 1MREL 1ZS8A 3QFJE 4P9MH 2IALA 1AO7D 4XH2B 3VMPA 1BFOB 4XAKE 2DLFL 4OIIL 4HDIA 1A7OH 2W65B 2PW2B 5ICXB 2R1XA 4XCCH 2BCKB 2HKHL 3PF2A 4NO3B 4PJ9D 4PJXA 3L5WB 2BSTA 3PQYD 3MV7B 4XAWH 5ID0B 2B0SH 4IRZL 3Q1SH 1NDGA 2P42B 1FHGA 3T65B 2IH3A 5CJBA 5E4IA 5J7CC 4MZ3A 4Z7WB 3RGVD 1HHIA 4LNRA 1Y18B 2VE6A 4U1HA 3DRTB 1HXYB 1N64H 5I9QB 4JHZA 4QRRE 2FO4B 1PG7L 1W72A 3H0TB 2ZUQC 1JGEA 2XWJB 3DYOA 4XMLL 1AGEB 4OJFH 3E2HC 3U4EA 5DJCA 4KRNA 5FA4A 4GKSB 3WLWD 1BFVL 3H9HA 4U1LB 5DURB 5HI4D 4L8CA 3MBEB 4X7CC 5B8CC 4L29A 4D9RD 3RVTD 3SJVD 4C59B 5L0QC 3D0VA 1EO8H 5H8DA 2NY4D 5IB3A 3NCYP 2P7TA 4LLWA 5FYKH 4XNUH 1BZQK 1I3RB 1QBML 1YEKH 2VDQH 3HPLA 4JFXB 1ZOXA 3QH3A 3MACH 3MUGA 3KYOB 5I1JL 1EXUA 2OSLA 1ITCA 4LHQB 3PHSA 4IM8A 3RTQD 4HIIB 3MV8B 4KZDL 4H8WL 4YGVA 4TVPH 4QHMB 1QFWL 4QXTA 3RZCA 4KUCD 5GRJL 1MUJA 3V4PL 1VDGA 2K9UA 1UWEH 2VKWA 4NNXB 3D2UA 2EKJA 1CXFA 2CQVA 4ZFOL 3FT2B 1A1NA 1U8MA 2IQ9H 5D96C 1IQDB 4G6FD 4YNYB 4P59H 2X4SB 3V6ZB 4R90L 5I1HL 1S7WA 2PYFB 2QQNL 4EZMA 5DMYA 4MQTB 1U8JA 5T5FL 3WKML 1HHHB 2ADFL 2WBJB 3GBNL 2Q86A 3TA3B 3VE0B 2F5AL 1QLFB 2HWZL 4N8CH 1FZKA 3GBML 1S7TB 3VD3A 3IS1X 3W39B 1MLBA 1MCFA 4XH2A 2W65A 2PW2A 5ICXA 3S97C 4ODSH 3T2NL 1FPTL 1OHQA 4XT1C 2BCKA 2J6EA 3UTZB 3FAWA 4JPKH 2NXYC 3MV7A 2YZ1A 5I76B 4LVNB 5ID0A 4XMPH 4DGYH 5FGCE 3T65A 2PETA 3UEZA 2DQEL 3TBVB 3RWHB 4NFBA 1OAXH 4KMTL 4LKXB 4WWID 3LN5B 2PKDA 2A77H 4Z7WA 4QTHB 4ONFH 5JOPE 1D6VL 2BVOB 3DRTA 4U1JB 1HXYA 2BDNL 4YWGL 4KTDL 3TYFB 2FO4A 3SY0B 3O3BA 1JZ3A 1AGEA 3E6FB 5L2JB 4WFFE 1NMBL 1NPUA 4E42B 3TT1H 4U1LA 4KRPB 4KK6C 2FLRT 1LEIB 1N5AB 3NAAH 1O5DT 1VB9A 2UZYB 3AUVA 3MBEA 5C7XH 1JFQL 4U4BA 4RGOL 2QHRH 1T3FB 3T0VA 3OX8A 2Y23A 4PP1D 2P5WB 2NCMA 3SGKA 1RSFA 1I3RA 4J2XA 4OFKA 4HWBL 4HH9B 1NCWH 4JFXA 1HOCB 3UAJD 3BKYH 3KYOA 4N8VB 2YZ8A 3IGAB 1Z9LA 4HIIA 4HJ0D 3MV8A 2ZUSA 4YUEH 4DK3A 1ZLSL 4CJ1A 2C9AA 2XTJB 4I2XE 4ZXBD 1O7VA 3GFUA 4QHMA 1Q72L 5E2TH 1H8SA 3ZE2E 4R4NC 4OM1L 3FZUC 4EDXB 4Y4FB 3HZYB 4V1DD 4KK8C 4WCYL 5DZLA 4NNXA 4PLKC 1CXLA 4EOWL 3FT2A 4TSBL 5SX5H 3WXVH 4Z8FH 4G7VL 4YNYA 1J8HB 2X4SA 3V6ZA 4GT7A 2EICA 3O9WD 4RGMC 5IVXE 2PYFA 3OXSB 1HHHA 3WJLC 2WBJA 3TA3A 2FO1A 3V7AG 3VE0A 2VLJD 5F9OL 1A6AB 3N1MC 4DKAA 2WP3T 3SGDI 3F7QA 1SBSH 4P4RA 4LGSB 4LLYB 4PJIB 1MCDA 1S7TA 5I16B 1N0XL 3ROOB 3W39A 5D1QA 5F72S 3KLSA 2GW5A 5GZOD 2R2CA 5GJTH 3H42L 1AGCB 4PJGB 3S96B 2OZ4A 4OCLC 1NSNL 2F58L 4NM8H 4YHZH 1ZXQA 2O5YH 1OARH 5EU6E 2DLIA 1VFOA 5I76A 1R3HB 2Q3ZA 3I6LE 4M4RA 4QOKE 3TBVA 3RWHA 3P40A 3QO0B 4LKXA 4XNXL 2OMBA 3LN5A 5D5MF 4AYFA 2D2OA 4NNYB 4QTHA 5LXGH 4GG6B 2BVOA 1V7NL 4U1JA 2R4SL 4E41A 2ICWJ 1OT2A 4X5XB 3TYFA 5D7SH 3SY0A 5DQ9B 3T09A 5GRYA 4ZODA 3WIHL 3E6FA 5L2JA 4E42A 4JZNA 2VOTA 1P5VA 4RMRA 4YPJA 1LEIA 1S7XB 4OTXH 4QHNB 2ESVD 1JHTB 3KS0J 1T3FA 4IEFB 5I73C 4NQSB 3W0WE 5GISL 3MLZL 2P5WA 4I0PB 2X10A 4O02H 1NFDF 4JM2F 2BRRH 3D5OF 5HGBB 3VXOA 1HH9B 4IJ3C 4XB7A 2EE3A 1KC5H 3O6ML 4M03A 2Z8VC 3BAEH 1HOCA 5JDJA 2J12B 4N8VA 4ZSOB 3RWJB 4OV6F 2VISB 5C3LD 3C8HA 4Z7NF 1DSFH 3IGAA 4WV1B 4WEUD 3VXUE 1EV2E 3ZTJG 4XI5C 4XHJD 4U1GC 2IAMD 4DVRH 4HC1H 1ZLWH 4LDOB 4EDXA 4Y4FA 2NY1D 3HZYA 2YD2A 3QULB 1NC4D 4N0UE 1IBGH 1KFAH 3DX9B 4HMDA 5I8KL 4FOMA 3MRMB 2Q6WB 1H9VA 1OQOA 2MPAH 4MQ7B 2ID5A 1J8HA 3B2UD 4JG1H 3VFVB 3UPRB 2R69H 5AAWA 5DMJB 2UV3A 1A6AA 4AG4H 5SX4I 1TNMA 1D3CA 3MX0A 1LO4L 1SY6L 2C26A 3EYUH 3JZ7A 1AQDB 1FYTE 4PJIA 2W0LA 2Y7QB 5I16A 3MSPA 4LLUB 5CD5C 4LQ1A 3K1DA 3NACL 2A74B 2VZUA 4KROD 3BRGC 1AGCA 1RULL 4PJGA 3S96A 4BYHA 5JXED 5KVDH 4JO4L 3ZTNH 4HH8A 5T33L 3BGFC 3NFSH 3RU8L 1RIHL 3N06B 4NSKA 3IRZA 1R3HA 4LPUA 1DR9A 1A7NH 1F3JB 5DD0L 2DLEA 1L0QA 5FM5O 2D31B 4S1DC 4O00A 2V17H 3MJ9A 3QO0A 3ZL4H 3A0OA 4NQCE 1LMKA 4JKPH 2VDRL 4OBRA 3CFCH 4NNYA 2ZG3A 4KQ4L 5F3BB 4CL7A 4FFVD 4P2RD 1WBYB 4I3SL 5DQ9A 3N85H 2OL3H 1OAZL 1XCQB 1VKXB 3LS4L 2XV6B 3MLXH 4ETYA 4EN3D 3EO0A 1NMAH 5AG8A 1S7XA 3JXAA 4KUZH 4TUOB 4QHNA 2GKIA 1JHTA 1YEIL 2F53B 2EEAA 4M6ML 3ESUF 1N59B 4NQSA 4I0PA 2EYSB 5HGBA 5BJTA 3DTXB 2DWDB 5E03A 1KN2L 4WTZA 5DUBA 3BUTA 3DHMA 2PO6B 5I74C 1ORSA 1Y0LB 1K9TA 4ZSOA 3RWJA 4AIZB 2VISA 1MRCH 3SE4A 5L7XH 1F4HA 1XIWA 4W6WB 4LASH 1BJ1H 3GM0A 5CINL 1G1CA 3RX8A 1QRNB 1JRHI 2D7TH 3WO4C 4KI5D 3BPNB 3T2OA 5J12C 1YMHB 2GK2A 5FYJL 3QULA 2FATH 2J8UF 3DVGA 4ISVB 4M7ZB 5EA0L 2NX5D 2QKIB 3DX9A 5HI5D 5FYLE 3MRMA 1UJ3B 5DZOA 5EBMB 2IPUG 4RFOL 4IRSC 1EFQA 5ACZB 4HLJA 3VFVA 1QFUL 3UPRA 2YPKB 3CU7A 3BD3A 3EHBD 4KDTA 4KU1A 4U7MA 3MV9E 5DFVC 4MDIB 1EUTA 3SDCA 3PUCA 4PR5A 3ARGD 1UM5H 3QDJB 4KFZC 1F58L 2XXCB 1AQDA 3L1OH 4NBZB 5HHOE 3VXTB 1F00I 2Y7QA 1CICD 4LLUA 4OLEA 1OGAB 5E2UL 2A74A 5B38B 2I25N 4POZD 4LSSL 4W81A 3KJ6L 4XX1E 1MQKL 4K07A 1RUAH 2YPVL 2X7LB 1HZHH 4F37F 2OM5A 1K8DB 4FXLA 4OKVB 1MHPH 1F3JA 3PGFL 4JHAL 2OR9L 4OLXH 2D31A 2YSSB 4WUUE 3PP4L 4G8GB 2QV2A 3IU3B 3O8XC 5F3BA 4XBEH 3QBTB 1P4IL 5LGHL 4HPOL 3NOIA 3CXDL 4X6CA 2VLKE 1XCQA 5JW4R 5CJXC 3O6FB 4GXVL 3QWRA 5T3XL 4KC3B 4TUOA 1EJOH 2M26A 1NFKA 4HS3B 2F53A 5FM8A 1SVZA 1N59A 4NZRH 3G6JF 4PJFE 3TV3H 1NCBL 1F8TH 3UTPD 5DTFB 2EYSA 1LO5B 2NR6C 3WXWH 4HUKB 3DTXA 3ARDC 3KXFB 3ZKXB 2VXSH 2DWDA 1T03L 1XGQB 2CLZB 3SDYL 1MAML 1CE6B 2PO6A 1CU4L 1Y0LA 5IT2H 4TVSa 4AIZA 4PLOB 3X13B 1I7RB 2VAAB 3DHJA 3KDMA 5TDNB 4CRPA 5C0GB 3LZFH 2E7MA 1JI2A 5A16A 4AIOA 1MNUL 3SE8L 1G9NH 4FXKB 1QRNA 3KPRE 4IOFD 1EEYB 2B1HL 2ZCKL 4K71C 5C0AE 5CJ8A 5KANI 1YMHA 4XPAL 2SEBA 4ISVA 2QKIA 2D7QA 1NCNA 1UJ3A 5EBMA 1LHZA 5I1IL 1I1AD 1U3ZA 1DQLL 3HRPA 2FD6L 1S7UB 2OX5A 5ACZA 4NQED 3P4OB 1RZ8B 4KDWA 4Y19B 5MENE 4G8IB 3HI1B 3ULVH 2XZCH 4MDIA 2XZAH 3OG4B 3QDJA 3S9DB 5EOQH 1MCBA 1JK8A 3ME0A 4WI7A 3WDIA 3HC4H 12E8H 4X4ME 1AI1L 3H7LA 3BD4A 2Z31C 5BZWA 3TLRA 1OGAA 3WJJC 2DQJH 5B38A 3BVNB 4NHCL 5IMKB 3LOWA 2XICA 5F8QC 2D9CA 3L5XH 4M93C 5E2VH 2V9TA 3BP4B 4ZTPL 4G7YL 2X40A 1K8DA 4OKVA 3VGGA 1UA6L 5CEZL 3MROB 2C7UB 4S1QH 2YSSA 2HLFC 2Y06H 5DO2D 4G8GA 3IU3A 1MREH 5DXWA 1VCAA 3NFPB 1BZ9B 4HK0A 2DLFH 4OIIH 5IFHL 3CK0L 2LTQB 3I85A 4G6AD 4KKCD 1RFDL 5I8CA 3O6FA 2HKHH 1Z9OA 3B9KD 4MVBD 4KK5D 1VPOH 2A9NL 4HS3A 4M62L 4XAKD 4QT5B 1B90A 4IRZH 1DLHB 4FQIL 3ARBD 2ZJSL 4TUJB 1C08B 5EU3B 3QPQC 5DTFA 2ZOKB 3CZJA 3KXFA 4ELMB 1J18A 4JPVL 1XGQA 2CLZA 1TTGA 2VQTA 3NCFB 1CE6A 1H15A 4Q9RL 1E4WL 3WS6A 2I07A 3X13A 1I7RA 4XMLH 2KBGA 2VAAA 2JIXB 5K9JL 5A43C 5C0GA 5IBLC 3RJDA 4ZNEE 3S5LB 4OI9A 3R06B 5GXBB 1BFVH 2XRAH 4H1LB 4FXKA 5IHUL 2HVKB 4IIQB 4QRRD 4P46C 1DFBL 2R2HB 2MKWA 4HWZB 1UB6A 1QBMH 2X9YA 1K4DB 4UNUA 4P0DA 1YC8A 1S7UA 4Y5XC 1PJ9A 3FFCE 4A6YL 5I1JH 3P4OA 1RZ8A 4Y19A 1X6NA 5T1LB 3EDJA 4KY1L 3HI1A 4KDVA 4YDJB 3B9AA 4KZDH 4H8WH 2EXWD 2HTKD 2P8PB 3T3ME 5E8NB 2E9IA 1QFWH 1I9EA 3CX5J 5E8OB 3HUJB 4G9DB 3D25B 4I1NB 5GRJH 3V4PH 1FLTX 4TPRL 1DTUA 1RUML 4YBQD 2E8ZA 3FO9B 2XKSA 3QNXB 5B22A 3VD9A 1QSEB 3W2DL 3BVNA 1LO0L 3TFKD 4XPFL 3CXHJ 2CLVB 5IMKA 1XGTB 3MXVL 5E0QA 4R90H 5I1HH 3BP4A 5DMGC 2VN4A 1P4BL 2QQNH 2NLJB 5DDHB 4EUPG 3L6FB 3KLDA 5T5FH 3WKMH 2ADFH 2DAVA 2CR6A 4P3WA 1J9CT 2F5AH 1QKZL 1RD6A 1DQML 1WCQA 3QIBA 3RIAK 4XWOC 2GTWB 3NFPA 3GBMH 4PJAE 1BZ9A 2NY6D 3LEYH 1KB5B 3QUXA 5KOMC 5CCKL 5I8OL 1K85A 3DRQB 1Z3GL 4H20L 1HINL 2AXGB 4NCDA 5TQ0L 3NFNB 5DRXB 4LSDA 1KPUB 3T2NH 1FPTH 1DBJL 1TZIB 4MAYB 1BLNB 2JJTC 5IGXL 4R6UA 3SDXF 1ZANL 4WTZG 4G3YL 1GAFL 4QT5A 2CRMA 1DLHA 4X4YB 1SQ2N 1KOAA 5SWZB 1C08A 1T0NB 3BYTA 5EU3A 3NCBB 4C83B 1RZFL 2ZOKA 4FMKA 4PJDF 1Y6NR 3BKJL 1D6VH 3QUZB 3RBSA 2BDNH 2GITB 4IRJB 4R7DA 1ZGLM 3T0EE 1MCKA 4WWKB 5DJZB 5F7DA 1H5BC 1NAML 1HWGB 2JIXA 5GGRY 4OV5B 1NMBH 5DHVH 1RZIA 4PJBF 3S5LA 5I19H 3AVEA 2XWBB 4HUWB 4QRUB 1U95B 4H1LA 4HBCL 1L6ZA 1JFQH 1WC7A 2HVKA 1G9NC 4RGOH 4N9GA 3DARA 2RFXB 2R2HA 4X98B 4WFFD 3KPOB 3QHFL 3SHSA 2H8PB 4HWZA 4OGZA 1IKFL 4HWBH 3CVHL 1K4DA 3S34L 2IC2A 4YHML 1PFCA 4L3CA 5F7HA 4YDJA 4ENEC 3TJHD 4HWNA 1U2HA 1ZLSH 2R39A 2IG2L 5E70A 3P0VL 2P8PA 5E8NA 1Q72H 2HT3C 4HUNB 5E8OA 3HUJA 4G9DA 3D25A 3LB6C 3QUMB 4JFHE 4OM1H 1F02I 1RZJL 3FO9A 4WCYH 4YZFE 1K6QL 3KYNB 3UDWA 4EOWH 1QSEA 4MJ5B 3OB0H 2C4FU 4TSBH 3FJTA 3DXAB 2C3VB 1ZV5A 3HI6L 1XGTA 2YA1A 4G7VH 5C0ND 4FRWA 1P6AB 1DQQB 1GGUA 3BEWB 2QSQA 4KVCL 2NLJA 5D71L 1KTDB 3KPQB 3L6FA 5DDHA 5GGTA 1JI1A 2NNAB 5F9OH 4QGYA 2D0HA 1KB5A 1U91B 3BUYB 3I6KB 3DRQA 5C2BH 1OD9A 4I48B 4WW2F 4CU6A 1XCTB 2GT9B 3K4DA 3H42H 3VFUA 5DRXA 4I77L 1NSNH 2F58H 1VADB 3CH1B 1R6VA 3GJFH 3D3VE 1BLNA 3VXMB 3MTRA 4XPHH 3KLHD 3LS5L 5BRZE 3EFDL 1D9KB 1KCLA 4U05A 5EZJB 3THML 5SWSB 4HT1L 5SWZA 1T0NA 3X12B 3TA3D 1HH6B 4C83A 4AEFA 3B2VL 5EIVA 4X4XB 4Z76B 2AJVL 1V7NH 3QUZA 4JQXA 2R4SH 1RY7B 4IRJA 3I6LD 3P3YA 3WIHH 4WWKA 5DJZA 4HBQA 5D1QD 5F89B 4FFWC 5KBNC 4KI5F 5EBWB 2XWBA 4QRUA 1U95A 4PY8I 2VR4A 1S78D 4O9HL 3ZYZA 1I8KA 1KJ2L 3QFJB 1F11A 5GISH 2RFXA 3MLZH 4X5WA 4X98A 3OV6A 4FZEL 3KPOA 5FYKE 3VGDA 4J7RA 3DMMD 1I85A 4FQCL 3EDFA 1B0WA 3VD7A 4E41D 4ETQA 3V5DA 4OGAC 2FGZA 2FJHB 1SMAA 1VEMA 4LLVB 5B38G 4RWYL 2DQTL 3SN6N 1TFHA 4H8WC 4TVPE 4GAJL 3U4BH 2BNQE 4CN4A 3O2VL 4HUXB 1MJ7L 2IF7A 3QUMA 2O93L 3ULSA 1EHAA 2R23B 2X89A 3VXUD 2VZ1A 3KYNA 1OSPL 4K23L 1I7UB 2MQ3A 5I8KH 5D70L 3VXQB 3DXAA 2C3VA 1FV1B 2BC4B 4PRBA 4UQ2B 2C5DC 3BEWA 4M1GL 2CSPA 1KTDA 3KPQA 3KPPB 2NNAA 3BDBA 3CCHB 5HTSA 3HB3C 1U3HA 2XT1B 4E5XB 2NY0C 5B3JF 5IG7B 1LO4H 1SY6H 2E9JA 3UTQB 1CD1B 4MWFB 3BUYA 3I6KA 3OXRB 3BIBX 3O41A 4I48A 2PXYB 3NACH 1XCTA 2GT9A 1VEOA 2FYYB 4JO4H 3WFCL 1VADA 4KXZH 3CH1A 1FYTD 2JTDA 3VXMA 5AYQA 3RU8H 3ZHLA 1QEWB 4MNQE 1Z6JT 1U8NB 4P5TB 1D9KA 3SDAD 5K93A 2OTUA 4LPCA 3O4OC 5DD0H 5E6IB 3X12A 5CUSL 1HH6A 2VDRH 3BKCL 5HPMB 4X4XA 4KQ4H 2NXZD 5F9DC 1OP3K 3QJHB 1J7VR 2Y07L 1OAZH 3RIFK 5F89A 2X5PA 3LS4H 1M1SA 1BWWA 3P9LB 3UTSE 4GBXD 5EBWA 5KSBF 4WHYH 4ZUWB 1MWAL 1DLFL 3O4LE 1YEIH 1TNNA 2YKLH 4M6MH 1S9XB 3QFJA 1YMME 1GPOL 2VABB 1K8IB 2H32H 1K4CB 5CHNB 3SKUD 4Z0BL 5IROA 2AEQL 1KN2H 4LSVL 1KBGL 4PLNC 1U8PB 3WBDA 1QFWM 2FJHA 2FSEA 4UBDD 3INUL 1R5WB 4LLVA 1I75A 4GXUN 1L7IL 2JCCB 1BQHB 4H0HB 4JFEB 5AZ2L 4HUXA 1F2QA 1M6OB 1T6WA 5GGQH 2R23A 5FYJH 4S11A 1A21A 4JLRB 3W9DB 1T66D 1I7UA 3WFHB 1QFHA 5EA0H 5EO0B 3VXQA 4L4VB 1CDJA 3NIDF 2Q8AH 4C4KT 3P4MA 1RJZA 4P48A 1FV1A 2BC4A 3QEGL 2V2WB 4RFOH 1TMCB 4ERSL 4MD4A 5JHDE 4CMHB 1QFUH 5EO1B 3KPPA 2IGFL 5FYLD 2DOCA 3SGEH 5E5MB 1XIWD 3CCHA 3PL6B 2VDKL 4E5XA 1JTPA 5IG7A 1F58H 2HTLD 3UTQA 2AJXL 1CD1A 4MWFA 1GL4B 5E2UH 2PXYA 3BE1L 4OZGE 3LEXB 3KHQA 1ZHLB 2FYYA 1PX4A 1BF2A 4PBVC 1CDGA 2YPVH 3TZVC 1QEWA 1JYWA 1U8NA 4P5TA 1TJIL 4Z77B 4H5SB 4CVUA 1WBZB 5BZDB 3PGFH 4JHAH 2OR9H 1HSAB 4V2CB 1FCGA 4NQUA 1URLA 4P23C 1OD7A 4POUB 4DFHA 2NY3C 3SDCD 2EH8L 3PP4H 1JMXA 3PIQB 4ZAKC 5HPMA 4OQTA 2DBLL 3QJHA 4PJXF 5LGHH 4HPOH 1FNGA 3CXDH 4PJCE 4QHKJ 3CC5B 5IVXB 1CGTA 3ABZA 3P9LA 4X7EC 4TQEL 4EDWL 4JO3L 5BO1L 3ARPA 4ZUWA 3IFPB 5T3XH 5HVWA 2VLKD 5HVHB 5D7LB 3IDYB 1DE4A 4CADB 4OB5L 1NCBH 3U0WL 2VABA 3D6GA 1K8IA 2Z0BA 3OR7B 1K4CA 3ZE1F 1LP9E 3VWJD 3CSBA 1MFCL 1EFXB 1T03H 3QIUD 3SDYH 1MAMH 4GRLC 3HA0A 1U8PA 2PF6A 5EU6B 1CIUA 3G5XB 2B5IB 5K9KB 1CL7L 1R5WA 4XPBL 4ZDHB 4UIKL 4QOKB 5B39B 4WY7L 3RPIB 3EYQD 3MNWA 1MNUH 3SE8H 2JCCA 4EIGB 1BQHA 1TCRB 3QWRD 4JFEA 2B1HH 2ZCKH 4H25B 1MAKA 3GSRB 3TESA 2VITB 4Y16B 3ZDXF 1XFPA 4CDGC 3W9DA 2NY7L 3WFHA 1NANH 4BH8B 4L4VA 4Q0XL 5DD1L 2G2RB 3KPRD 3SQOL 2R4RL 4Y4HB 5I1IH 1DQLH 3DUUB 4R4FL 2V2WA 1KPVB 2FD6H 3O3AB 5EO1A 1U3JA 4Y5VC 5BW7C 4RIRB 4LCIL 4NN5B 5EH1A 3W0WB 5FM5M 2DQIL 1T2QL 3PL6A 3VI4E 4KTYA 4EI5C 2LFGA 4N5EC 4D9LL 2QQLL 3FQRB 4Z0XB 5IESL 3G08B 2D7PA 4NBYB 3WV0A 4YK4C 3LEXA 1S3KL 2AQ1A 1ZHLA 4MA8L 2GAZB 4NHCH 4Y1AE 2HAZA 3IF1A 4WHCA 3AREB 1L0XA 3DO7B 3L3JB 4DUXA 1DVFB 4S1SL 2QR0B 5CZVL 3RVVD 4ZTPH 4G7YH 3NPZB 4H5SA 1WBZA 1UA6H 5CEZH 5BOZG 4GW1B 3HNTL 3PIQA 1TCMA 2W9LA 1KLGB 3C60C 3H3BC 1F45A 5GS1B 2KZWA 2XQYK 4RBPH 3JTTB 2AKRB 2JE8A 3T4AA 1NCDL 4UT7L 3KAAA 5IFHH 3CK0H 3CC5A 5IVXA 1W72L 4JM2C 1RFDH 1KNOB 3VFWB 4HIHB 2RR3A 1P7KB 3IFPA 4Z7WF 2A9NH 4M62H 3P11L 3FOMB 4MSWB 4FQIH 3MRHB 5D7LA 2IADB 2ZJSH 1NDMB 4GMTL 2Y6SD 1ZK9A 2X4TB 3OR7A 2AVGA 4P2CG 3B8SA 2V5MA 4TTGA 3L95A 3VGFA 4JPVH 1EFXA 3O3EB 3MFFB 4Q9RH 4JFYB 5EU6A 3JTSB 1E4WH 3G5XA 3PXJA 5K9KA 1UYWL 5D93C 1MPAL 3C6LD 5KSAB 3X11B 3GJEB 2EDHA 4WO4D 5B39A 2FZ3B 2CR3A 3MOBL 3RPIA 1BREA 1V3LA 4PG2C 2QHLA 5IHUH 1TCRA 3G9VA 1Z2KA 4NQXA 5I8EA 5J8OA 4L3EB 1DFBH 2XFXB 4H25A 3GSRA 4APQB 3V5HB 2VITA 4N0CD 1LDPL 4Y16A 5GS3A 3TBTB 5IBTL 4BH8A 3MZTA 1MHEB 3SBWA 3DUUA 4PYHA 4HKXB 3TT3H 1JZ8A 1KPVA 3O3AA 1IGIL 4ODUB 4A6YH 4YHYB 5TF1L 1YEHL 3GRWA 2I5YL 1RVFL 3WIIL 4KY1H 4YXLL 4N0RA 4RIRA 1E4KC 3EYSL 3RWGB 1T1ZB 3HFML 5MEPB 5I0DA 5A1AA 3BQUC 4XMKL 1INEL 3U82B 3I6GB 3FFCD 5ISZE 3FQRA 1RUMH 3G08A 2ATKB 5DR5L 5FKAB 4AH2B 1DCLA 4PGZA 2FR4A 3VA2C 3TF7C 1LO0H 4JHBA 4XPFH 2GAZA 2NW3B 4FQPA 3VFTB 3AREA 4OCNC 3DO7A 1A2YB 3MXVH 1MFEL 3L3JA 2ZKHH 2J6EL 1DVFA 2FL5B 1T1WB 2OTPA 2QR0A 4JM4L 1P4BH 2DJSA 2R56L 1DP0A 1NUGA 4YFLI 2XG4A 5JOFB 1QYGL 5E5RB 2UVFA 4MYWB 1QKZH 5D7KE 3V95A 1DQMH 1MCWM 5CZXC 1OCWH 4LHUG 2YD1A 1WWBX 5J06A 1WFNA 2P1YA 2YA0A 4MD5B 5GS1A 5CCKH 5I8OH 2AKRA 4H20H 3D87B 5FK9B 1HINH 5TQ0H 1I7ZB 4KH2A 3LD8B 2IBBA 1DBJH 3RKDC 5I1GL 2FJGB 4DQOH 3DGCR 3MV9B 2XA3A 1P7KA 3MJGX 2HRPL 1ZANH 3MBXL 3FOMA 4G3YH 4MSWA 1GAFH 1YQ2A 1I8LC 3MRHA 2IADA 3RPKA 5HHOB 1NDMA 2AV1B 4OFYD 1YEJL 2CKBH 2R0KL 3HTLX 2NXYD 2X4TA 1RZFH 4I18B 4LQFL 4NT6B 3QIBD 3BKJH 1FJ1B 1JNJA 5DEGB 4DKEL 3MFFA 3QUXD 4I4WB 2AP2A 4JFYA 4I0KA 3JTSA 3TC9A 5D72L 5CP3A 2G60L 4U1IB 4F15B 1NAMH 4NO0D 5DK2B 1R5VB 2R9HC 3B9VA 2D7MA 3OL2A 5KSAA 3X11A 3GJEA 2JKXA 2FZ3A 1DL7L 4WUUB 2VDOL 3T0ED 4L3EA 3EJYD 1J0JA 4OCSL 2XFXA 1FG9C 1WZKA 1I9RL 3F6IA 4WI9A 4APQA 3V5HA 1QA9B 4KK6D 5AUMB 1I1FB 3WS3B 1P9MC 3CDGB 3QHFH 3NCCB 3TBTA 5HD8C 3UC0L 3CVHH 3S34H 4HKXA 2UWEB 3HRZB 5GS2H 4PJ9C 1K5NB 4ODUA 3U7WH 4YHMH 2BOBB 5HSFA 4MMXC 2NZ9C 1EO7A 3ULVE 5ADOL 2AEIT 3RWGA 1T1ZA 1JP5A 2IG2H 3P0VH 5MEPA 5DUPL 2AGJL 5JR1L 3HC3L 3I6GA 2WZPD 5JOEA 4WHDA 3RGVC 1P7QD 4JKKA 1NGPH 2DM7A 3GSUA 1RZJH 1F97A 2ATKA 5FKAA 4KJQD 4Z7UA 4AH2A 1K6QH 1QLRB 1UWGL 2Y36L 1RZKL 1UT9A 4R4ND 3FZUD 2NW3A 3VFTA 2OZ4L 2ZCLL 4OCYL 2EZ0D 3HI6H 1A2YA 4JFHD 4KK8D 3LKRB 2IBZY 3U79A 4PLKD 3H3KA 2FL5A 1T1WA 1I8MB 5HI4C 3Q3GB 4PP2B 1IMHC 4KVCH 4PJIF 5D71H 3MO1B 5JOFA 5C0AB 5FGRA 3S36X 4X7TA 4PD4J 2VLME 2NY4C 3SGJA 4PJGF 2ZNXA 4MD5A 4K94L 5FK9A 2DTMH 1IC4L 2AEPL 1I7ZA 4I9WE 2YWYA 4HIJB 5IBUB 2DQFB 4I77H 5MENB 5EOTB 1WUNT 4OKDA 1L7TL 2DKUA 2FJGA 1HHGB 4R2GD 3RTQC 5IIEA 3MV9A 3P30H 4DUVA 2BJML 1IAOB 3TO2A 3LS5H 5BVPL 3EFDH 4W68A 1EVTC 3THMH 4XNMB 4HT1H 2AV1A 4MB5A 3PDGA 3GO1L 4I18A 3B2VH 4CVZB 5DI8B 3VDCA 5D1XB 5IW1B 5BRZD 2AJVH 4OBSA 5DEGA 4WJ5A 4I4WA 15C8L 3QG7H 2ITCA 1OVZA 2KPNA 2IANE 3VXSB 2R2BA 3ARRA 3IFLL 4JJHA 2AK1L 3ZDZE 2X41A 1KJ2H 4FQLL 3IAPA 3SE3C 1QA9A 5AUMA 3WS3A 1R3JA 3CDGA 4FZEH 4PJ8B 4XC3H 3RA7L 5C6PB 1BBJB 4FQCH 3OKKB 5C9JB 2UWEA 3HRZA 1MOEA 2M2DA 1K5NA 1IGJB 2BOBA 4HS6B 5FKPB 4MXVF 5FYKD 5E8DL 4Y2DC 4FTVE 2J3SA 1WQVT 5KSVB 4HHAB 4RWYH 5E4EC 5KJRL 4OF8A 4Z18A 4GAJH 3O2VH 1MJ7H 4YFEA 5K59F 4QLRA 2P5EE 5MP6L 3S4SA 4JO1L 3RDTD 5F97E 5DGQA 1QLRA 3L3KB 2D4FA 2GJ6D 2X4UB 3PWUB 4K23H 4QXWA 1VFAB 4QHLB 3E2HB 4TVPD 5D70H 3VWKC 2BNQD 2NW2B 3BD5A 3MRQB 2ZUTA 5HHXL 4U6TA 1YY8B 3FQNB 5B8CB 6FABL 3KNBB 1I8MA 2PTTB 3DBXA 3TBWB 4M1GH 4PP2A 1GOGA 3TN0D 5DHXB 3MO1A 3Q48A 3OSKA 2C3GA 4KK9C 4PP1C 5GGUB 4JN2A 3MJ9L 1FORL 6CGTA 4Y0GA 3WHXB 3KJ4B 3RAJL 2V5RA 2K7QA 4M5YL 3OF6D 1B4RA 2VWEC 4RWHA 3UAJC 3C8KB 4HIJA 1XF3B 1KTKE 3QJFB 3WFCH 1I9IL 5EOTA 4LVEA 1HHGA 4P4KD 4KKBC 4HJ0C 3G5VB 1IAOA 3WUZA 1BD2E 4XNMA 2AEWA 4XXDA 4YDKL 4PJFF 5CUSH 1NGYB 1XGPB 4X6CF 4F9PC 1U3HD 4CVZA 4Q74A 3MLPA 1GC1L 5DI8A 2ZG2A 5D1XA 1XH3B 5D96B 5IW1A 3ZYIA 1S9VB 4S1DD 2Y07H 2FDBP 4WI6A 1VESA 3HNVL 4RRPG 4BSWA 1X5IA 3VXSA 1KENL 5F7LB 5F7YC 4YXKH 2UZIL 4U7SA 1MWAH 4HFWB 1DLFH 2QADB 4JFDE 4PJAB 4J3UA 4QO1A 1GPOH 3UTSD 3QRGL 1JHLL 4OCWL 4PJ8A 4F9LC 5GZOC 1BBJA 4Z0BH 4N5UA 2AEQH 3OKKA 1PZUB 4LSVH 1KBGH 5C9JA 3LQZB 1KEMH 1D5ZB 1YMMD 1IGJA 4HS6A 3QDMB 5FKPA 1LVEA 1SVCP 5EFIB 3INUH 3MRLB 2J5LC 5KSVA 4LHUD 4WRLA 1L7IH 3L5HA 5DEZA 4EVNB 5IOPB 5AZ2H 5F70A 1HI6B 1AH1A 1MLCB 1RZJC 3L3KA 5D1ZB 2X4UA 3PWUA 1VFAA 4QHLA 1CFSB 2PTVA 3BXNB 4UAOC 2NW2A 3MRQA 1CFVL 5DD6B 3QEGH 4G5ZL 3ZKND 1YY8A 3FQNA 4HLZH 5B8CA 3KNBA 4ERSH 4OFPA 2PTTA 2X4OA 3TBWA 2WIMA 4DN3L 2AJZA 4HCRL 4NJAL 2X1PA 3KR3L 3C5JB 4JGJA 1ZE3C 1JPST 4IRSD 4NO2B 2VDKH 2MOVA 4AEEA 5D2NC 1UM6L 3WHXA 1A6WL 1WSST 5IJVB 1R24B 4M7LL 5KAQG 2BFVL 4J23A 3BE1H 4F8TA 3TGXA 3RUGA 1XF3A 1UC6A 3QJFA 5DYOB 4FQXD 5J1SC 3TO4D 2E6PA 4LPYA 1YEGL 3NCMA 1TJIH 4EJ1C 4XHJC 1IILE 2OJZL 1U8HB 3QI9D 4HEPG 3GM8A 32C2A 3MYJB 3VXRA 4HZAA 1A3RL 2NY1C 2COQA 1XAUA 1NGYA 1PKQE 1XGPA 5DJAB 2EH8H 3WN5C 3NPSB 5CJ5A 1X5ZA 1XH3A 2DBLH 1S9VA 5DA0B 3HE7B 4RGMB 4YEEA 2GY7B 3O8XD 5JTWA 4LSTL 1F5WA 4TYUA 4TQEH 4EDWH 4JO3H 4WU7B 5BO1H 5TE4H 2VXTL 4HFWA 3AMKA 2VB5A 2HMID 3S35L 5FHBL 2PR4L 3UJJL 3T2QA 3T1WA 5GSVB 4OB5H 1M05B 3U0WH 4K3EL 4NKQB 4N90E 4Q2ZA 2FWOB 5I1DB 3QAZB 1NMCB 4KROC 5C0RL 5F6HJ 1LE9B 1MFCH 1KCSH 5JXEC 1J87A 4X80H 3K3QA 3IRPX 3D3VB 1D5ZA 4QKXB 1G6RB 2NR6D 5CSGA 3BPOC 5JDSB 3HG1B 4LKCB 3QDMA 2E3VA 5EFIA 4R9HA 3MRLA 4XPBH 4UIKH 2R0ZH 4WY7H 5HDLA 4F7PB 4EVNA 5IOPA 1YECL 1ZLUH 2H1PH 2PN5A 1HI6A 4AMKL 5GS0D 2CIIB 5HHME 5D1ZA 2NY7H 3K2MC 1CFSA 3OAUL 4Q0XH 3BXNA 1AD9B 1BECA 3SQOH 3ZTJH 2R4RH 5DD6A 4EN3C 1RUKL 4R4FH 4Z7QE 2XWTA 5I73B 1CLOL 1RHFA 5DD3L 3QNYB 2OK0L 4ZFFB 4WW2C 2R2EB 3C5JA 2DQIH 1T2QH 5JMOC 3GDBA 4NO2A 4RAUA 3PDOB 2YD9A 5BS0B 5CFHA 4YHOL 1IM9A 3L7FB 4LAJH 3QYCA 4D9LH 3BZEB 4XNZC 2QQLH 2DWEB 5IJVA 5IESH 1R24A 4HGMA 4XP9L 2A83B 1S3KH 4U49A 3F7VA 5D5ME 3IJHB 4MA8H 1ND0B 3M8OL 1AKJA 5DYOA 4NDMA 2OLDA 2Z31D 1BM3L 2VDML 1YN7B 4ACPA 3SDDD 4S1SH 3PGDB 5CZVH 1N5YL 1IGYB 1U8HA 4QEGA 3MYJA 3L7EB 4QRPE 2E7LC 4Y1AD 4KI5C 1YYLL 2MTPA 5DJAA 1TQBC 4BA8A 4PV8B 2DYPB 5LAXB 2F54B 1YPZB 2HLFD 1NCDH 3HE7A 4UT7H 4G8EB 5IVNA 2MMXA 1W72H 3QUYB 1UZ6E 3AS2A 3EHBC 4LP5A 4WU7A 4Y5YB 5LBSL 1TJGL 2VLRE 3DX7B 5C0EB 2DI9A 3ARGC 1A7PL 1XR9B 3P11H 5T1KD 5GRVL 4GMTH 5HHPB 1Q1JL 1C12B 1W8NA 5GSVA 1CICC 1M05A 5E00B 1P84K 1ES0B 1MRDL 2Z4QB 2FWOA 3ARSA 3I02A 1LE9A 2APWA 5E9DE 4JREC 1QFOA 3RI5K 3QIWA 1CGWA 1G6RA 5JDSA 3EOTL 3HG1A 4LKCA 4MNQB 3S4SG 3KPTA 4XPGL 1QBLL 2NY5C 4KZEL 1MPAH 3GSNL 3GBLA 4OFDA 4G42B 2DIBA 3MOBH 3P9WB 5GIRB 4GRMA 4F7PA 5INDB 3OAYK 5IJKC 1QBBA 4WI3A 4P2QE 5FYJE 2CIIA 1LDPH 4YZFF 3ELAT 5H2BB 5IBTH 4P46D 3BP7A 1T0MB 1NCCL 3QHTC 1AD9A 1IGIH 4JE4B 3RHWF 5TF1H 1YEHH 3EOBA 5DZNA 4CN6A 2I5YH 3HUJF 3O4LB 3QNYA 4XVSL 4ZFFA 4YXLH 4OF5A 3T04D 5KZCD 2R2EA 3EYSH 3QDGB 4MJ4A 3RNQB 3PDOA 3HFMH 3HHRB 5BS0A 3TVMD 4K8RH 1XGRB 4IMLB 1INEH 3BZEA 1EHLL 3WIFB 5K9OB 5DR5H 1GGTA 3LH2L 3MA7B 2A83A 5D2LA 3KYMB 3IJHA 2BVPB 2N7AA 1MFEH 2J6EH 1CR9L 5ISZD 1KF9B 1YN7A 4LCWE 5A2LH 5C0CB 1G7PB 5JW3L 3PGDA 4JM4H 2R56H 1UQSB 3FRPA 3WO4B 4ZS7L 5J12B 4IOFC 4U1NB 1QYGH 1MF2L 2Y4SA 1NGXB 2ICES 1T7WA 2ZPKH 5EU7C 3QWQB 5D9SB 1GHFL 4KTEL 1B9ZA 3V0VB 4PV8A 5LAXA 3DSNA 2F54A 1YPZA 1C1EL 3EGSA 4WI8A 1I1AC 1B88A 1JGLL 4JFZL 2H9GB 4G8EA 4Z9KB 4XWOD 5ADPH 2BNUB 5D7KD 5JHDB 4QWWD 1KYOJ 3QUYA 1RZGB 5DT1L 5I1GH 4Y5YA 3RWEB 1T89A 5T3XE 3P9MB 1P53A 4UTAL 2HRPH 5C0EA 1U3YA 3MBXH 1XR9A 4O2FA 5CSZB 2F19L 1FAIH 3ULUL 1MIML 5HHPA 1C12A 4FA8A 2R0KH 5E00A 2XKNA 3MCKB 1ES0A 1JYXA 2Z4QA 3RL2B 4NC1C 4CW1B 4DFIA 2EDBA 3UX9B 2XN9E 4DKEH 3LQAL 5ABDE 1DANT 4MNQA 4X6DA 2J8UE 1HNGA 3D85D 5D72H 5GRUL 2G60H 4QY8B 3HKFA 3WUWG 1MIEH 2EYRA 1QVOA 4G42A 1B6UA 1WWWX 2LAGB 5GIRA 1QQDB 3VDAA 5INDA 2I9LB 2VDOH 4OCSH 4L8BB 1FN4B 1I9RH 2IFFL 1JHKL 1GGBL 5H2BA 2UUDK 3UJTL 1T0MA 2YPLE 4G6AC 3UC0H 1T0PB 4UOW0 2FX7L 2HG5B 5FUZH 4N8PA 4UDUB 2IQAB 4LSPL 4MVBC 5GHWL 3GMMA 2KH2B 3S3JA 1EJ6A 5ADOH 3QDGA 2CUMA 5GGTL 1GGCH 1NUFA 2BSRB 1U8OB 2FX9L 5FF6B 3RNQA 3H9SA 1CZ8L 3ARDB 5DUPH 5F9WB 2AGJH 5JR1H 2DRUA 1XGRA 3HC3H 4IMLA 1ORQB 1XMWA 4JRYB 4XAWL 4J4PD 4BH7B 4ONGL 3VRIB 1YA5A 2YBRB 4ENED 5K9OA 2EO1A 1KB5L 5J9PB 5JQHC 3ULVD 3MA7A 2Y36H 1UWGH 3J7HA 4M48L 1RZKH 3LB6D 2UY6A 4HGWB 4KHXL 2E9WA 2OZ4H 2ZCLH 2BVPA 4OCYH 3MRFB 4V2BA 2VZTA 2DN7A 5C0CA 1G7PA 1MCJA 4K71B 1UQSA 4OM0L 4U1NA 5CEZE 1E28B 4OJFL 4TNWK 4ZUSB 1NGXA 1KJVB 5C6TL 4ZFZB 5D9SA 1H8NA 3T8XB 1YJDL 3V0VA 4NFCA 3G6JE 4K94H 1NC2D 1EO8L 2H9GA 1IC4H 2AEPH 3REWB 3NIFE 1BBDL 2BNUA 2VLMD 5FYKL 1IM3B 1RZGA 4GRWF 2WWMD 4OUOA 3RWEA 2EKSB 3P9MA 2EXWC 2BJMH 3MACL 4UB0L 4C56E 5BVPH 3OAZK 5CSZA 3IXAB 3GMLB 4IDJL 1AGBA 1INDL 4OF7A 3GO1H 1U41A 4YBQC 3MCKA 2YMXL 3ARVA 3RL2A 4PGEB 4CW1A 3TFKC 3OHXB 2O5XL 1EMTL 3AS0A 1KXTB 4M43L 3J8F7 1Y6KR 3AB0C 3SKMB 4Z7VB 1XF1A 15C8H 1NL0L 1RJCA 4JO2L 4HJJL 1QO3B 2EDWA 43C9B 1QFWI 4QY8A 3SO3B 3KPSE 1RZ7L 4DN4L 1ZVHA 3OZ9L 2V7NB 3IFLH 4LLAA 4Q97A 1QQDA 3TIDB 5L2KA 2I9LA 1Q0XL 1FFQA 4P5MB 1FN4A 2HYMA 2NY6C 2IAND 1H3UA 3RA7H 2OL3B 2VC2L 1JGVL 3Q5OA 1KIPB 5D7JA 5IP4A 2V2XB 2HG5A 1FNSL 4UDUA 2IQAA 1WIOA 5E8DH 1Q9LA 3EYVB 4LGPB 1A4JA 3NA9L 5KJRH 3MLTB 2BSRA 1U8OA 3T0WA 4OGAD 2L0DA 5IWLC 1ORQA 4FQ2L 4JRYA 4BH7A 5DJDA 1LE5B 3VRIA 1ZHKB 4XMPL 2MNUA 4JRXE 5MP6H 4OZIB 4JO1H 5J9PA 4FTVD 3C09B 5HYJE 4OZGF 2HVJB 4WHYG 2OS7A 4HGWA 2QBWA 3ZSSA 2FBOJ 5HHXH 3LN4B 2H3NB 3MRFA 2P5ED 4DVBA 6FABH 5DS8B 3SCMD 3LPGA