5ILTL

Crystal structure of bovine fab a01
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords bovine Fab A01 light chain
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iltL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iltL01
5I66B 3L5JA 1VFMA 2F5BL 3VXRB 5JPNB 1KCUH 3O8XB 5ETUA 4X8JB 4GKOA 4XXDA 4HS6A 1FO0H 3JV4B 3O8XD 1X5IA 5T1DH 2I5YH 4U2YA 3OBAA 3JWOL 1BVZA 3KYKH 3IYLW 5CGTA 4UQ2A 1F2XK 1X5AA 4NT6B 1U0QA 3O0RH 1MEXL 5JIIA 4WU5B 1PG7L 2PR4L 5DJDA 5HXMA 4HUXB 3E2HB 3FQTB 3ME0A 3WV0A 2UZXB 1I75A 1FIGL 4KJWD 2DL2A 3S37L 3ZDZF 1EPFA 1BQHA 2NX5A 1RUKL 5DUBA 5AUMA 5DHYB 1VHPA 5DJ6A 1YYLL 2Q86B 3U79A 3ARDC 4FZEL 2NXZD 1C1EH 1WSST 2D7PA 4OAWB 1M4KA 4MMZC 1CLYL 4TUJA 4DW2L 5FM4A 3VG9C 1YC8A 1OPGL 3W11D 1BQHG 3IJSA 4KV5F 5HY9A 3ARQA 3WLWD 1GYAA 3RL1B 4MHHG 3IGAB 4TSBL 4G7YL 2DLGA 1MLCA 4U1NA 3NABL 2I26N 3B6SA 3NABH 4QWWD 4OQ1A 3MNWA 2VRAA 2UZIH 4JO3H 4GFTB 4HGWB 4L4TD 5IMMA 2AK1H 2ICCA 3VJ6A 3VGAB 5LKNA 1X5YA 3U4BL 4PRBB 1VDGA 1SJHA 1RIHL 4JQIL 3CU1A 3GSUA 3PDOB 5I6XB 4MHHI 1X5JA 2E7CA 4OF0A 1BFTA 1KNOB 5JHDA 2DB8A 4PB9L 1OAQH 4RX4A 5HD8C 4OLEA 1MI5E 3Q48A 5C7XL 3RUGB 3FO9A 4KRPD 3C5SA 2AI0H 2DD8L 5K9QI 4I13B 4K71B 1QFOA 1KN2H 1H8SA 3C9NB 5D7LD 3OKLB 2RJMA 3TO4B 2BVUA 5ECJE 5EO9B 1M71B 3W9EA 4X0KA 3LKSA 4KQ3H 3F58H 4RIRB 3QPQD 1IMHC 1CDUA 1RUAL 1FIEA 4D2NA 1M7DA 4NJAH 1N0XH 5I75B 4P4KD 1NCDH 5DUBB 1LO5A 4L29A 4BKLA 5FO9B 1NAMA 1K4CB 4G6KL 1L7IH 4HPYH 2JK5A 3EHBD 4XMLL 2DOCA 1P9MA 4FQQA 4L3EE 5CJXA 1PVHA 2QEJA 1WEJL 4HUXA 2IF7A 3MRDA 1FYTB 1OPGH 3AB0B 2E9IA 2C1PA 4DVRH 5ESAA 3FT3A 3ZE2E 3CMOH 1F4YH 3S5LG 3T4YB 5CIPB 2W9DL 2PCPA 4KKBC 5DYOA 3IU3B 1FZMA 2CIKA 1K2DB 4MNQA 4H8WC 3VGBA 4RDQF 1Q0XH 4OGXH 1BD2D 3SJVD 5KVEH 43CAA 3RWJA 2UUDH 1FDLL 2XZCL 1Z0NA 2GITB 1CBVH 3DX9B 5IWLC 3NIFF 1TCMA 5K9KB 4PJHA 1OTSD 3JWNC 4IRJD 3IFNH 3GUTB 2GTWA 3C6SA 4DFIA 3RGVA 3UC0H 4H25A 2IEPA 4KK5D 1SMAA 4QCIB 2K9UA 1QQDB 3DX8A 1HIML 3MPCA 3VWJC 1IAII 1EK3A 4PJEA 1LK3L 5C0AA 1A0QH 2QQKL 4NN6B 3SKNB 5FB8A 4GBXC 2BJML 3KPLB 1CICB 5JIPA 3IU3A 3BKYL 3R06A 1X6NA 2DM7A 4LSVH 4MSWB 3ZMRA 2HFFA 4JZOB 4MA8L 1HHGB 3MZTA 1JZ4A 1OF2A 4PJ9B 3WEXB 4NC1C 3HE7C 5FO7B 3REVA 5CHNB 4Y4HB 3HNTH 1JMXA 5LQBH 5CBEA 2BDNL 2NCMA 4G80B 4K3GA 4OTXL 3DMMA 1K4CA 4WCYH 1OB1A 3H7LA 4ONHB 3DX9A 4G8IA 4I0PD 5TDPB 3T04D 4ZSOA 1ZLUK 3U6RB 4X0KB 2XZAH 2VLKD 5IW1B 3RWJB 4CU6A 4EN3A 5BXFA 4Q97A 1U8HB 1NMAL 3UBXI 4FFYL 1T4KA 4PTTB 1Y18A 1XF4A 2W0PA 4AZ8A 5HY9B 3EDFA 4OFDA 4ZOEA 1TXKA 4DUVA 3C5JB 3QUZB 3V9FA 5JA9A 1KCVL 2EZ0D 5CD5C 1V5JA 4KJPD 5J6HB 5GRJH 3O4LB 4XT1C 1QD0A 3ZKMC 1SJXA 4X6FB 3LEXA 4WFFE 5C0BD 3FOLB 5JNYB 1FBIH 2APTA 5K9OA 3VXSB 4C56E 1RZFH 4CVZA 1IRAY 1Q9WA 1P53A 3UX9B 3MODL 5M95B 2A74B 2ICWJ 2PYEE 5AG8A 3SDAC 1HDMA 1UB5A 1AD9B 5IG7A 4LGRB 2VH5H 4TUJB 2YN3A 4OCMC 3EOYG 2EDFA 3GSRB 5IR1B 1JZ8A 5ENWB 1JRHI 3K46A 4N90E 5L8LB 1DBBH 5ADPH 3HC4H 2SEBA 4BQBA 1HXMB 2NYYD 2VUYA 4OQTH 3HKFA 4MZ3A 1W0WB 1B0RA 1OTTC 3ZHLA 1AXSB 1KELL 2LU7A 4WI5A 3FFDB 4WNQA 2JKXA 1EDQA 1S9XA 3MLPA 1ZGLA 5D70L 4MDIA 1FC1A 2EDJA 2EC9U 1IFHH 4CW1A 3BE1L 1WBZA 4DOHE 3CVHL 1OM3L 1RJZB 3JTTB 5FK9A 3TJHD 4LVHB 4M03A 5ICYB 2HTKC 3HUJB 1F4XH 4ELMB 3UTQB 2J8UF 4CVXB 4IRSD 5B38A 1I1FB 1VGKB 3O9WC 4E41B 4OUOA 4P49A 1BD2E 3MRLB 5MERB 4HPOL 3QEQE 1H3WM 2OTPA 4PBXA 1KT2B 2Y36L 2YC1A 5I1EH 4GBXB 4O2EA 1F3JB 1CTNA 1E6JL 3PUCA 1UYWL 2EKSB 5HBBA 1KC5H 5GISL 2FZ3A 2R4RH 3PDDA 5CJQH 4YHPA 3ZDYE 4OLWH 3QIBA 4RCAA 2AGJH 3KNBB 5HGBA 3EZJB 4ZTOH 3L3OA 3MCLH 2PO6B 4G7VL 1RUML 1U9KA 1GZQB 4IHOA 3GSRA 1OT1A 4C4KT 4AT6A 5GSVB 3UBXA 5DQDH 4YGVA 1WT5C 2FX7L 2IADB 1QEWA 1SYSA 5DC0A 4Q6YA 5IW6B 3QB7C 1A1MA 3RQ3A 3CMOL 1VFAB 3MR9B 5DRXA 2W0KA 2XNAB 4LHJB 5TE6H 4EI5A 3Q3GB 2CK0H 3DRTB 1IAKA 4I3GA 5C0CD 3TIEB 4X98A 3X11A 1Z9MA 1I3UA 5ADPL 5TPWL 3GJFH 4S1SH 4LEXL 4NIKB 2E9JA 3WFDL 5F6HJ 1WIUA 4LSQL 5DQDL 5IK3B 4N5EC 4D0DB 4HSQA 3U83A 1KYOK 5FYLD 1KENH 3RPIA 3NFNB 4Y19B 1NAKL 3TCXA 2UVEA 2G60L 2MOVA 1MCKA 5C0CA 1URLA 3UC0L 4KI1A 2R2BA 4M7ZC 2JCCE 3KPPA 3QG7H 1DEEB 1JGUL 3HRZA 5GS0C 1EZVY 3DNKA 1S9WA 2ZOKB 1QLRA 2V5TA 5JXED 1WCQA 4XP5L 2A6JB 1J1OH 4D3CH 4ZS7H 4LLQB 4U1MA 3FQUA 4ODVL 4S1QL 1YEEL 5HDOA 2NY3C 3X11B 2GYSA 5I17B 1GHFH 3REWA 4PJCA 5GS1A 3D2UA 3WL9B 3UTTD 4J1UB 1JNNH 1TMCB 1INEL 3Q3GA 4URTB 1E28B 4D9LH 5HYJD 1LO2L 1I8MB 3B2VL 3CDGA 1YMMB 4ZTPH 1F6AA 3ZZ1A 3CFEB 4U1IB 4AT6B 4OFPA 4LF3B 4XVTH 3PP4H 1XF2B 2J88H 5KJRL 1FJ1B 2FEDD 1U3HC 2EDYA 3MLUH 1KELH 5IEHB 2YK1H 3HZVB 4LSSL 4NQCD 3FTGA 3KLAB 2HT2D 1Y6NR 1A6UL 5C0DB 5HHVH 4HIIA 1F3DH 4KVCH 4LRNL 5D1XB 5EIVA 5DLML 2X4TA 1TJIH 1NGZB 1G7HB 3LKRA 2NLJB 5EU7E 4H8WH 2Y07H 2VMFA 4XRCB 4RAVB 2CR6A 2VR5A 3I6GA 3D39B 5E4IA 4WTWA 4QRSB 1X7QA 1F5WA 2QJDA 3PL6B 4JKLA 1MEXH 4OD3H 2QQKH 4V1DE 4OZHF 3HB3D 1T0NA 1DVFA 1AJ7L 1U8QB 3I75B 4S1RH 4YDVB 5J1AB 4GRWB 1NLBL 4K7PX 2WAHA 2L0DA 4LRNH 1X5FA 3WLBB 1OGAD 2I60H 2X70B 2B1AL 2DM4A 5BVJA 2BNQD 3MLTB 2R1WB 1EZVX 3RWGB 1AXIB 3QG7L 4CDHA 1MJ7L 4F37F 4ZD3H 3AS0A 4XVSH 4JY4A 1CLYH 4NGHH 5GS2D 2F58H 4HWUA 2ZNWA 4U0QB 3RWEB 3QJHA 3HPLB 2D03L 1WITA 4WFED 1CDYA 2GT9A 3J7HA 1T2QH 4NN7B 3QG6B 4ZFOA 4NC2B 1RJYB 1NC2A 4XPHH 2Y25A 1Z5LB 2Z31B 2GAZB 4D94A 1INEH 2XQYG 4JREC 4I4WB 1BIHA 1FO0A 3PWPD 3RNQA 2NXZC 3ARBD 5E99L 4PRPA 5HVWA 3BDYH 3IDJB 4HV8A 2GHWB 2ATKA 4TPRH 5DJ2B 1S7WB 2X2YA 3BVNA 5K9QG 1I8KB 3UYPA 2XT1B 2Z93B 3B83A 3C5ZD 4AEEA 4NBXB 4YEEA 1MRFH 4OM0L 1ES0B 2P24B 1ZA6A 3MLYH 2P49B 4ODTL 4PJCE 1WZ1H 2M26A 1FCCA 3BWAB 4S0SD 3UPRB 2ADFL 2OL3B 4KI5F 4PJFB 1FZOB 2DWEA 1I1AC 1DBMH 4WW2A 2XFXA 2VDKL 1S7UA 4OD2B 1N59B 4OT1L 3K4DA 2OP4L 1FFPB 3VXPA 3TN0A 2BJMH 4LLWB 3SDCC 3D69A 3VH8G 2YR3A 2IANE 1R3IH 4JPKL 1LDSA 3QEQB 4M00A 2EXWC 3HN3A 3PWPE 2YD7A 3BPLC 4XPBL 2WWKO 3EYFA 1RFDH 4Q9QL 4OAWA 3P4OA 3S34H 1CLOH 1OAYL 3X3FL 1LNUB 4EVNA 2GUOA 2CMRL 3TYFA 4G8GD 3LB6C 5IVOA 3EO0A 3D85D 5EUKA 1XF3A 3ILPB 5CD3B 5GRXG 2IC2A 5CEYA 1BHGA 1ETZB 3OR6A 1RUQH 4QT5B 2VC2L 3BP5B 4HK0B 4OFYA 1XCTB 1XGQA 2VITB 3DIFA 3S3PA 2CO6B 3QEGH 3MV7E 2ZOLA 5E8PA 4MXVE 3G5ZA 4TTGA 2Y06H 3QAZB 4IRJA 1QRND 4U6VL 1OP3H 4FQPA 4Z7VB 1MCWM 3H3BC 4HIHB 3K4ZA 1WBYB 4K3JL 2X09A 2O5XH 2DAVA 3ARFC 4Q7DA 3CLEH 1RZKL 2BY1A 4KRPC 4ETQA 2EH7L 4U6HB 3WO4B 2CQVA 1UXSA 3ULVD 1HOCA 1ZS8A 4HF5L 1KTDB 1JPTL 4OGAD 1MJUH 4PJ9D 3CXDL 5DMJB 3KPRE 3I2CL 4Z0BH 3F7VA 1TPXC 3VFRB 1QRKA 1XF5A 5C0IA 5IOPB 5AD0A 1T6VN 3DVNB 2M8XA 3VGFA 4Q6IC 1N5AB 4JJHA 4JEGB 2WSKA 4X6CF 1S9VA 2HFEB 3DOSA 3HC0A 1SY6A 1OM3H 4HG4K 2XXMB 1BBDL 3EFFA 4NRXB 2WLZA 1KCSL 2H2SD 3RKDD 2E9WA 2CKBH 3D3VA 4HJ0D 5DI8B 4NO2B 3RIAF 3N1MC 3IFPA 3T0VA 2EEBA 2EDTA 1ED3B 1ZANL 1F6AB 4PJAE 3MNVA 3L9RA 4Q6IA 5C0BB 4L4VD 2BK8A 4Y2DB 4YBLB 1H8OA 1FYTA 4P2YA 3WFHB 5L88H 1NGXB 4LLDB 3GRWH 3WHE0 3S36X 3P40A 3SN6N 1M7DB 4JFHD 3QUKB 2QSCL 3D39D 5IFHH 2X4RB 5SX5K 3CCHB 3STBA 3PL6D 1XR8B 2P8MA 4M7KL 1O7VA 2J4WL 2Z92B 3L3DB 3PP3K 1T2XA 2DF3A 3TCLB 3LKPA 1BX2B 1EFXA 4JPKH 1ZEAL 2BNRE 1XT5A 2Z0BA 3RWHA 4RRPG 3MRKA 2A77H 4GRMB 4CGTA 1UA6L 2X42A 1A6AA 1N6QH 5CGMA 2F8XC 1KPUB 1F8TH 4KRPB 2AXGB 4R26H 4EI6A 4AK1A 3QIWD 4UT6H 3GMMA 1YEIH 3NAAL 4PREB 4LKCB 2X1PA 2ZP0T 1FL6B 3GBML 1ACYH 2DQIH 3KXFA 1FNSH 1CLZL 2DQTH 4DAGL 4GXUM 4ODWA 4OLUL 5L2KE 2IQAA 3ZKQD 5DHVB 3L1OH 2Q8BH 1MHEB 5C08A 3QUXC 2AJXL 3VXSE 2BVOB 4QTHB 3MA7B 3VWJA 2ZG3A 1HQRB 4J23A 5EA0H 5TE7L 1EBPA 3O6ML 4JM4H 4WW2F 3VFNA 3NCMA 3MJ8B 4NBYB 3VI3E 4K9EL 3MBXL 4X99A 5CZKA 5L6YH 5I19L 4QXTA 3O4LE 3Q6FB 2R0LL 5ISZA 2B2XH 1I4FB 2K3TA 4FQXA 4HQQH 2I9TA 3PWLA 2Q6WA 1UCTA 1G6RH 2OJEA 1SM3H 2CJUL 3W82A 4PJDB 3ZDZE 5DHYA 1MFCL 4KRLB 5FAAA 5D7KD 4PJGB 1KIPB 3FOMB 1A9BB 2OTWA 2MWCA 3NZ8B 4MS8C 1ZVSB 4LMQI 1WQVT 1A4JB 1VENA 1YMHA 4MZ2A 1TITA 3V5DB 1WEJH 2Q3ZA 1EGJH 5D96C 4O2FB 3KS0J 3X14B 1KV3A 2Z91A 2F54B 2B1AH 4LPVA 3FB6B 1BJ1H 3NVQA 4F9LC 4O02L 2HN7B 1HH6A 4PRDB 4GUPB 4GKSB 3I50H 2ICWB 1RVFL 1QKZL 1DQJA 2F74B 3T0ED 4Z0BL 3WBDA 4W4NA 5A3IC 3VFMB 1NBZB 1PDKA 5HGAA 4LKXA 3MSPA 4WO4B 1NMCC 2HMIC 4UBDD 1T7YA 3GMOB 4YWGL 1S7SA 4DQOL 3ULUH 2DJ4A 1TENA 1A4JA 4JO2H 3DLQR 1MHHA 2YUVA 4KI5D 4Z0XA 2XQYK 5FO8A 4PJGA 5IESH 3C5ZC 2HJKA 3SDAB 2CDGA 3NOIA 4XHQA 5HYSG 3V4UL 3MLUL 1VFBB 2P44B 4RMVA 1S7RA 1P5UA 1W8NA 2HT2C 4XP1L 2GY7B 2UVFA 4RFNC 3V5HA 1OAUL 3P9WB 4N90D 2DLTA 4Z7VF 2OLDA 3GSNL 1OW0A 2EH8H 3PIQB 4OGZA 3IAGC 2J1KA 1AD0B 1SEBB 2H6PB 3MRCB 3K8LA 4LVOB 5GIRB 1CFVL 3VXSA 4DKEH 1KGCE 2AXJA 1I8IA 4G7YH 4NWTH 5T3XD 1KF9B 1D5IL 1M6OB 2BXZA 3KJ4C 1T1ZA 5HDBF 4LCIH 3TJEL 5KG9B 4XC3L 3GFUA 3QNXA 5TF1L 4XP1H 2YS4A 5I73B 4JY6A 3WNMA 1IQWL 1S78C 2AEQL 1R3IL 5HYSB 2ZUVA 5TQ0H 2IANB 1I9EA 3HG1D 4JDTH 4HX1B 4FQCH 4K8RC 1HZHH 3QUYD 2X89D 1RUKH 1IL1A 1FVDA 2LTQB 3ROOA 3DARA 4OKVB 2XWTB 5F7HA 4YDIL 3HMXH 4JKPH 4GG6E 1EFXB 3FJTA 4JKKA 5KN5B 4Z77A 5D6DA 4LU5H 4X8XA 1XF4B 4IIQC 4JZNA 3ULVF 4F7TB 1G1CA 4L5FL 1AHWC 4OGXL 1PEZA 4NN5B 3LHPL 4PY8I 4IEFB 4Q2ZA 1AGBB 4Y1AD 4ZO7A 3DURB 2YEZA 1ITBB 2VSCA 2VOTA 1FZKA 2PNDA 4R8WL 1CGTA 2XG5A 3VGDA 4Y5XA 1KCRL 4FP8H 4LNRB 2W9EH 1BWWA 5JW4M 4N9GA 5EORH 3WNPA 1CXKA 2BC4A 3V0VA 3WEXA 1JJUA 2ZSWB 4YIQA 5CKGA 3N85L 3UTPD 1J86A 2E27L 4U0RB 5JR1L 2H26B 3CIQA 4NQDA 3WNOA 1I7TB 5DQ9A 3BQUB 2W92A 1PQZB 3S88H 4C59B 3ECBA 4NQCA 5D7JC 4KTEL 1QSZA 4KXZI 1FNHA 4PLJD 5M7QA 4PV8B 4ZG1A 1S9VB 1G7MA 2VZUA 1N6VA 2APWA 5DD1L 1A6VL 2WBJC 3HNVL 2ARJQ 3JWOH 4RFOL 2APVA 1AXTH 1YPZB 2BVPB 3VI4F 2AJSL 4GO6B 4S1RL 3STZB 4WV1A 3WJLA 2AK4A 4ELMF 5IHUH 5JORA 4HHAA 5L2JA 4AG4L 5JXAH 4NZRL 1E4WH 5F1SA 4I0PB 4WO4C 2E7LA 5DD6B 3OB8A 4HC1A 4R4BB 32C2B 1J8HE 1YNKL 4LAJH 3WFCH 4UOW0 4TOYL 3IF1A 2GY5A 2X4NA 2X4QB 4KK8D 1OP5K 4WEUD 1E4XH 1NKRA 2YUWA 5DSCB 5IB4B 1TJHH 3V0VB 3PGCB 4MJID 5CBAA 4XHJD 3MOAH 3QIUD 4TUOB 2XKUA 5CKAA 4LNRA 4WI2A 2O26U 1G7PB 4W6WB 2DLFH 4MNQD 3VXRE 5CLTA 4Q2ZB 1MVUB 1MRCL 1R3HB 1ZHNA 3FB7A 3GSWB 3ECBB 4NQCB 5E8NB 1KUMA 4G3YL 4HLZH 1NANH 4ZQKA 2V17H 4DK6A 1Q0YL 3L6FB 5HI5D 2QLVB 3U2SA 4LCUA 4MJ4A 4PTUA 3M17A 1OSZB 4QKXB 1AI1H 3C5SB 4YH6A 4P5TD 1GPOH 4FS0A 4RISH 5FYKU 4DKDC 5FIEA 1P4LB 4XNXL 5B4MC 4MJ6A 4RWHA 2VDNL 1Y0LB 1WC7B 4BFGA 4MMXC 3VJ6B 1BBJB 5E8OA 4G8FB 4U05A 3PGFL 3MRIA 5BRZD 4G42B 2HKHH 1FORL 5DJAB 2CRMA 5HHQB 2R2EA 1FNGA 1FVCB 2KZWA 1T1ZB 2BHYA 4KKBD 1HN1A 4OV5A 2OQJA 3QIBD 3DUSA 4UNTA 1AO7A 5EZOL 1S8DB 2VLJA 1MCRA 1QO3B 5MEND 5BQ7B 4FNLL 3ZL4H 4PJBF 4U1SA 3IGAA 3OHXB 1UWEH 5IB1A 2A38A 3RWFA 5IT2L 2Q87A 3R8QA 3CLFL 1K5NA 2PO6A 3MRNA 4ZDHB 5BOZG 4PS4L 3JZ7A 3NCJL 4U6YB 4EIGB 3FQNB 1BFVL 5I1CH 4RQQB 1P84J 5E2VL 2X1QA 1ZT7B 3S9DB 1JE6A 4N1CA 4QWWC 3TNMB 1MRDL 4LPWA 1WLHA 4RGMC 3WIHH 1KJ2B 3HR5B 3GI9H 1S7TB 3ROLA 1BM3L 5E6IB 3WFCL 3WNNA 4R4NC 5MEQB 5JQ6L 1UJ3B 5E6ID 2D7TH 1RULH 4GUPA 5F7NC 3U7WH 5DJCA 2A0LC 2BMKA 1TQBC 1CICC 1JNLH 2ITCB 3DUUB 1GGYA 4O5LL 4WWID 4YPGB 4ZUWB 2FH6A 4QRPE 2H8PA 4N0YL 5ISZD 3BPNB 1TZHA 1NUDA 2DTSA 2B0SH 3GBNH 5EULV 3IFNL 2XZAL 3RY6C 4TYUA 4PV8A 4LEOA 2Y4SA 4FQJH 3NFPA 4N5UA 5FF6B 1DDHB 4TTDD 3AS1A 2W38A 3OAUL 1JN6B 4F33A 5FECA 3D85B 4U1GC 3QDGB 4KQ4H 2ORBH 3V5KA 5HGDB 3DXAA 4QHUB 3ULUC 4MCZB 1SBSH 3IXAA 4HJ0C 2EDBA 4BZ1H 1IGCL 3G6AB 5CZXC 3S97C 5H35A 3EJZC 1NBYA 3S6CA 1A1OB 3E6HB 1U36A 1O0VA 4FQIH 3UTSE 3EYSH 4DVBB 1FYHB 4FQLH 4J4PC 1HSAB 4WFGD 5D6DC 4HJJL 4P3DA 4Z7QE 4KQ3L 4PREA 1N8ZB 2PF6A 5D2LF 3ZTJG 3PHQA 4QRRA 4Z7UA 5EBWB 2VLKA 1A64A 2CR3A 5IFAL 5KN5A 5CCKL 1MJUL 3RFZC 2PXYC 3GGWB 1JPFA 5ACZA 4GRLD 4HD9A 4BFBD 3I3EA 2KUTA 3H9SD 3WS6A 4JRYE 2AP2A 2DQDL 1JRHL 1GGCH 1JWMB 3UTZB 4OKVA 1YQ2A 1QLFB 1FSKC 5MEOA 3B5GA 4IBLT 4OIAA 2R4SH 1IEAB 5EBWA 3I9GL 5MP6H 3BD5A 4RISL 3V4VH 2GCYA 4NHCH 1AGDA 2CLZA 4PGEB 4OCWL 1NFIB 3S3JA 1IBGH 5TDPA 5E1AB 5JDSB 3PWJB 4O51B 4AEHL 4NO0B 3HUJE 5T3XE 5JO5A 5T33L 2V17L 4ZFZB 3QHZL 4F57H 2P47B 3Q6GH 4KRNA 2WANA 3H7BB 5HGDA 4GSDL 4G43B 4R7NA 1EAJA 5I76B 5IBLD 3V6ZB 3D2UD 5MI0B 4YHLH 3U2SB 5HJ3A 1UZ8B 2C3GA 1B9ZA 3V4UH 1NSNH 1ZA3B 4J12A 3FO0L 5CINL 2DMKA 1MSPA 4UIMA 4KHXH 4HWBH 5TGBA 4XVUC 3QH3A 1UQSB 1HSAA 4OF6A 3HC0B 3MMEA 1NGYB 2C4XA 4JQIH 4NM4H 4PRHA 4QHKI 4G9FA 1EAPA 3S3SA 4ZAKD 4TTDC 4AEIL 5I8OH 1CL7I 4LKXB 1BFOB 1RIUH 4PP2B 4UV4L 5BZWA 2DN7A 5E9DA 3V8OA 4XGZB 5JXAL 4IMKC 5JIKA 3QCUL 3VI3F 1KB5A 4JLRB 5C0EA 3QDGE 1I8LA 1X4YA 4IM8A 4DWHA 3WDJA 4D3CL 1FL5B 4XNZC 3MXWH 5SX5H 4Z7VA 3MRFA 4L4TA 5SWSB 4WTXA 5KSAA 3VWKA 1S7TA 2OX5A 4DZBA 2P8PA 3HI5L 3KPSE 5T1KA 2CUHA 3TPUB 1A9EB 4CDGC 1E27B 1CDJA 3VMPA 2HMID 1Y6KR 2H8PB 4JDTL 2DJSA 4RIRA 1PSKH 2DWDA 3MRRB 1SM3L 5F88A 1A3QA 1PAMA 2VTFA 5F89B 4X4XB 4PGDB 5TJWK 5IEKA 1MFEL 2C3HA 4UDTB 4ZS6D 3K8KA 3S4SB 3TJEH 1J10A 4QRQB 1J8HA 4HT1L 5A1AA 3FKUS 5CMAA 5JHLL 4KUCD 2WINA 1G9MH 3VA2C 4PTUB 3FRUA 4GXUN 2B4CH 4XTRD 1P84K 3A6BH 1ITCA 4MD0A 3BUYB 1JYVA 3HPJB 3DYMA 3OV6A 2E6PA 4HFUH 4TN9A 4JQVA 5AWNH 1JTOA 4O9HH 1A7NL 1ZAGA 5IJVB 3KDMB 4HKZA 4PJHE 1II4E 3KYAA 4ZFOL 4GW5B 1JHTA 1IT9H 4WFGE 2F53E 7CGTA 2N56A 5BS0B 3RA7L 5E8DL 1NUNB 4LAQL 2H3NA 3X17A 4LAQH 4MJ6B 1CE1H 5J8OA 1J5OH 4NJ9H 5C92A 5HPOA 3FFCD 5IGXL 2PYEA 4BZYA 2AEQH 4M93C 4PBVC 4WW1A 4WTZG 1A6TA 1LK2B 1IAIM 3KPSA 4HPOH 1ZLVH 5I1KH 3NPSB 3VWKB 1VA9A 3TN0B 2LQRA 5J1SC 4FXGA 3CZJA 4F7CA 4YDLB 4LVOC 4I18C 4P2OD 1QTYT 3GM0A 5J57B 4NFCA 3QFJD 2VE6B 3HZKA 4P99A 5D2NE 2EDQA 1HWHB 4M5YL 3UJJH 5DVOA 4G9DB 4X4MA 2F9BT 2AJVL 4YHOL 1I3GL 1BBJA 4IJ3B 3LD8B 2Z91B 4XBPB 1JZ5A 4P3WA 1FLRH 3G6AA 5EU7C 5I8KL 5IJVA 4YNYB 1IEHA 1MHPL 1H3UA 5IB2A 4K7FB 1LP9F 3UMTA 3U1SL 3LKQB 1YEJL 4PRIE 5LWYH 3OX8B 3VRIA 2ADGA 3INUL 4XP5H 1KBGL 4I9WE 2V2TA 5GS0H 4XC1L 4Q9CA 1G6RL 4MAYA 4JO2L 1UZ8A 1NQBA 4L4JA 5C6TL 5EBMB 5I74C 1GL4B 2AXFB 4ZNCD 3SE3C 1YMMA 4XB7A 3BSZH 5E1HB 2FJFB 1G7HA 4YK4B 3BP7A 2AS5M 1S7XA 4P2RE 3SKOA 1JGVH 3KHOA 2ZSVB 1PYWA 3ARDD 3NIFE 4XC1H 3MBEA 3NFSH 1N7ML 2F5BH 3FO2A 1N26A 3AUVA 1Z2KA 3QH3B 1UQSA 2XN9E 2YRPA 4JO1L 3O4LD 4HIEB 5DURD 4JY5L 1AHWB 1LEGA 1UH3A 4NKOA 3EOBA 1TLKA 4FFVC 1YDPA 3C6LA 5ESAB 2FX7H 3BUTA 4OIIH 3ARVA 3C60D 2NW3A 1U93B 5DUPL 4YDJA 2GEEA 5DZNA 5IB3A 3MXVH 3BGFB 3I6GB 4X7DC 1QRNE 1I9IH 2H1PH 2YA2A 1RUQL 4UILL 4WWKB 5TH2B 1TJIL 3TH3T 3SPVA 4GAFB 1A3RH 3UEZA 4XBPA 3LQAL 3NN8B 2DLFL 4K94H 4Z7UB 3ELAT 1FFOA 1IKFL 1FZJA 4Z7UF 3CVIL 4PGCB 1NGYA 2Y72A 4YUEH 4ZPTA 1ZVSA 5J0BA 2BY3A 5I0ZA 4NQSB 3WUWB 1PG7W 1T03L 1JGEB 4HJGA 2A6JA 4GRWE 5IGXH 4UMGA 1CL7H 4ODXB 4YEFA 1D6EB 2FECI 2GTZA 1CT8B 4L3CB 1U58B 4QXWA 3W9DB 1NL0L 3QDMA 3UDWC 1AO7B 4FXLA 1QLFA 2ZZUT 2OP4H 5ITBL 3BPCB 4JJ5B 4U3CA 4WENB 2D4DA 4JO4H 3TFKC 4G6MH 5I2IB 2AJZA 3HCVA 1GIGH 5TFSH 3VD7A 4K7PY 5B3JE 2FEEI 3U4AA 5JDSA 4MJ5B 4NC0B 3FQRB 4WV1C 2Z8WC 4LPXA 3WUWA 4XMKL 3DETD 1EXUB 1XIWD 5FDWB 3PHOA 1DLFL 4OCXL 5D1QA 3VFWA 1HCVA 1KPRA 2J12B 1EH9A 4HBCH 1FZJB 1QLRB 2NTSP 3LQAH 4HUWA 1P7KA 3MRLA 3PIQA 5BMFH 5ILTH 1KJ2L 3B9VA 2QHLA 4G9FD 5CUSL 1YUHB 4BA8A 4RWYL 4ODUA 1J8HB 2HVKA 1CF8H 1G0YR 1J8HD 2FB4L 3BPOC 3MJ6A 4MQXD 2UYLB 4OGAC 4WRLA 3BGFC 2DI9A 4ZUUA 4QYOB 1RI8A 1U92A 4GRLC 3KS0H 1NAMH 5D7LA 5E9DB 3MUHL 1S9XB 1ZGLB 5KG9A 1XCTA 2R1WA 1EAPB 1G84A 3UYOD 3MMEB 3NZ8A 3K2UL 5F7MC 5GGRY 4YHIA 4IMLB 3UBXB 3WXVH 3MRFB 4L4TB 4Q9BA 5SWSA 1RZ8B 3SE9H 4JM2F 5I8EB 1RFDL 4IIQA 4UB0H 4R7NB 3UAJD 2KQMA 1TETL 4NJ9L 4ACPA 1MLBA 4NM4L 4X7SH 1YUHA 2MTPA 2FLBT 5DJ0B 5CUSH 1CK0L 5BQ7A 3PL6C 5D5MB 4GS7B 3MA7A 4TVSa 2G75A 3G6JB 4XP6L 3IDXL 1GGBH 3RNKB 1C5BH 2CD0A 3ZHKA 3TT3L 1KJ3H 1WT5A 3O3AB 4CMHC 1BF8A 4K71C 3GHBL 1DUYA 2DQEL 2R2EB 4PV9A 5KVFH 5EUOA 2CIIA 2BOBB 4ODTH 2DYPD 3UJJL 4NQDB 3O11A 2VDLH 4OCYL 4DKFH 1X9QA 2BY0A 3BRDA 3S37X 3PWNB 2NY2D 3PV6B 1U8MB 4YXLL 4PY8J 2NY7L 4M1GL 1JF6A 1SVZA 4N0CC 5D1XD 4PD4J 1I1CA 4F9PA 4P57B 3NZHH 3OAZH 1EBAA 2C3VA 5EIIA 1GHFL 2P8MB 4U1MB 3PWJA 3G08B 4GW1A 2A6IA 7FABL 3EJZD 1P7QA 5I1IL 3VFGL 4C58B 5FA4B 4OZIE 2XKSA 4W68A 1U92B 2ICES 4U6YA 1AP2A 2NW2B 1FCGA 3P4OB 1I8LC 4PJ8D 3ZLQC 3SGEH 3PXJA 5J3HD 3EYFB 1UZ6F 3MV9A 2Q7NA 3QQNA 1HKFA 1IC7L 2QR0B 4RMTA 4LSRH 3MNZA 3T0AA 1N64H 4ENED 1ERNA 4ZAKB 3ARYA 4CU8A 5DMGD 4GAYA 5JMRA 3L3KB 3VI4E 1S7VB 1JHKL 2MPAH 5GGTL 1OTTD 4HDIA 2GTZB 2R39A 3I75A 4YFEA 2FX9L 1QSFD 4LVNC 5FKPA 1IGML 3DV4A 4EUPB 5DD6A 4X6FA 3T3MF 3DRTA 5LBSH 4XC3H 3D39A 1N2RA 1OGAB 4F3FA 4PG9A 1SY6L 1WFTA 3OXRA 4IOIB 4W4OC 4PLJC 1FFOB 5FUZH 1DSFL 5IW6A 3TT1H 2D7NA 1XF5B 4YLQT 1RHHA 1VADA 4YFLF 2VDPH 3WSQH 3FO0H 1KTDA 4NQXB 1XR9A 3CNKA 2LAAA 3RDTD 2HH0L 1A5FL 3C60A 4TSAH 1B88A 4NO5B 1CFTB 1FC2D 3B5TA 2DD8H 4R7DB 3D3VB 1GOHA 4MAYB 1C5CH 3OG4B 3GNML 4KI5C 3EFFB 4NRXA 3T2OA 1PX4A 5FOJA 5C07E 3OJVC 1E4XL 3KYMB 1ZHNB 3GSWA 3QCTH 4LRIA 3UPCA 3DMMC 1G7LA 4K2UH 1AJ7H 3QBTB 1XGYL 2E3VA 5T3ZL 4QY8A 2QHRL 1YEIL 1NUFA 3NAAH 4ZO9A 4ZO8A 4OD1L 1E4WL 1OD9A 1R3LB 4MNGB 1L4IA 4QYOA 3I9GH 4POUB 2YWZA 3Q5YA 1HQ4A 3QEQD 4Z7QF 43CAB 1N6QL 1OTUD 3LN9A 1CFVH 1QPPA 1FHGA 4EDWL 2XA8L 4HUUB 3FQXA 4KKLC 5E6IA 2VLRB 4M6AA 3CFJB 3V0WL 4CNIB 1P7KB 3L7EA 3IVKB 4PLOB 5B8CB 4XCEB 4MXQD 1JF1A 4IRZH 3T65B 2ERJC 4QCIA 4PB0H 3UTTE 1GC1L 3W0WB 4WW2B 1W0WA 4XVTL 4PRBA 3TNNA 5DD5H 1T1WB 2CLVA 1A8JH 3PP3H 4WUUD 5DJ0A 3BWAA 4GQ9L 3FQNA 1MCFA 3TYFB 5E8DH 1PGRB 3E3QC 1L6XA 1KEMH 1YJDL 2OYPA 1I7RA 1KYOJ 4PJXA 1HH9B 1ADQL 3BPCA 4HV8B 2XG4A 3T8XB 4P48A 3L5IA 1RZ8A 5EC1B 3TO2A 5CAYB 4FXGB 2VIRA 1TJGH 3D69B 4S2SA 3LRSB 3OZ9L 3PGFH 5C0GB 4G9FE 3W5MA 1IC7H 2AXHA 4OLUH 4OJFH 4U1KA 4D0BB 3RZCA 1QYGL 4ZOBA 3QCVL 2XZZA 5GRJL 2OL3L 1PSKL 1GGUA 5DD3H 4YXKH 2LVCA 5CSZB 1AGFB 4HFWA 5C9JB 3HI6L 1IAIL 3G6DL 1L7TL 3MLTA 4C57C 4UQ2B 3FO9B 3TWCH 4ZPVA 2EIDA 4PJFF 2WW8A 1QFWM 3HE6D 4MVBC 1JZ6A 4NQEE 3DSFL 5IF0B 2EEAA 3MROB 3OJMB 3LZFH 2DICA 1FNAA 2Z9TA 1RZGA 1QFUL 5C9JA 1ZOXA 1C8PA 2GJ6B 4CJ1A 2FBOJ 1X7QB 3IU4H 3N50A 1BMGA 2ESVD 4D0DA 3VFVB 4HS3A 3VD9A 4XVJH 5E7FA 5I1GH 4EXKA 4JO3L 2KPNA 2DKMA 3MYZA 1T1XB 2HTKD 3DI2B 1AY1H 4A6YL 3HFML 1TZGL 3TESA 5DUPH 1Y0LA 3QDJA 4U1KB 1U8JA 4MQ7B 3UTSD 5EU6D 1ZT1A 4MJIA 3OKKB 5JMOC 5C0GA 4XX1G 2R4RL 4P4RB 3BDXA 3ULVE 3GMOA 5IROC 1MWAH 5DZLA 4I4WA 4YAQB 5F1KC 3QISA 1ADQA 4ETYA 3SGEI 4RZCB 2BNRB 4ZUTB 2IH3B 3FO1B 1QSFB 4RMQA 4P23B 2M2DA 3FQWB 4RSVA 3SDXA 3IDYC 3P11H 4YIQB 3PF2A 2ED7A 1J0YA 1E4JA 2R8SL 3RIFK 3CZFA 1X4ZA 2XN9D 3MGAA 2F54A 3ROLB 4HW6A 3UZQA 3KR3L 1KTRL 2W1NA 3TVMB 1YQVL 4LIQE 1QG3A 4PRHD 4JCLA 4XNMA 1SYVB 2RB8A 3OKDA 1N2RB 4F3FB 4PRHB 5EU3A 3FB5B 1G7LB 4IOSD 4UDUA 1FL6A 1JWSB 43C9B 4DKAA 3MJ9H 1V8HA 3LMJH 2H32B 3G6JF 1Q94A 4L9LC 5B38B 1GZPA 2FX8L 4QTIL 1GPOL 4OFVA 4WY7L 5J1TC 2OXGA 4PJ8C 5J3HC 3ZE0E 1IGYB 3IDNB 5EU4A 4OCSH 3SKJL 4YBQC 4I77L 4WUKL 3OAZK 4WI3A 2EDKA 4FQQB 2X41A 5FEBA 2Q7YA 3JV6B 4PJAF 3RHWK 4EUPH 2NTFB 1LP9B 1FL3B 2P42B 3S35L 4ZNEA 5FHBL 2BVOA 5CCKH 3BHBA 5D1QB 3VFWB 4M61B 3O9WA 1FNGB 1FVCA 3D1MC 3OGCB 3MLVL 4WGWB 1LEIA 3SGKA 4JZNB 3P4MA 5IV2B 4LDLB 2ZOKA 1F6FB 2AXGA 4EI6B 3LDBC 4YGVB 4APQB 3GBMH 3VW3L 1UM5H 1YMME 4K8RL 1H0DB 5JQHC 4KTDH 5KW9H 2W0FA 3MA9L 2QQNL 3ZT7A 4BSJA 1KCVH 2XICA 3GSOA 3QXWA 2V2XA 1FLRL 4GAGL 2HP4A 4NO2A 1F13A 2HJLB 4RA0C 5F70A 4ODSL 4AEFA 1UEYA 3SKNA 2NXZB 2W65B 3OKOA 2IPKB 3MJ7B 3WHXB 3OGCA 1R3HA 5GJTH 3ZKNC 5FYLL 2B20A 4NNYA 4PRPB 5C0CE 1S9WB 3QUMH 3MOBH 1NBZA 1ZV5A 5GXBB 3GMRA 4MAUH 1S7QA 3F7YA 3HMWL 2BFVH 3BZDA 1X6LA 1IKNA 1D9KB 3DXAD 4YPJA 1X5HA 2A6KB 3LQZA 4U49A 4V1DB 1PEWA 5IB3B 3GGWA 3GRWL 5KSBF 5ELIA 5I8EA 1T5XB 2FDBP 3TFKD 1ZGLM 3WN5C 2CDGB 1UG9A 3BGMA 3I84A 4R4BA 4PJBA 3B8YA 1MJ7H 4UINH 1FN4B 1QACA 1EFQA 4HK3J 3S5LB 4JFFE 1YEFH 4OZGF 2CDFB 5JZ7C 4RAHA 1JHKH 2MPAL 1UVQA 5GGTH 3MRCA 1QBAA 4R6UA 5CHNA 2W91A 4YE4H 5E8EB 3V5HB 1C5DB 3SE8L 1DQQB 1R5IB 5I8OL 4P23A 1I1AB 3HE7A 3DO7A 4LDEB 4JFDD 4M6ML 4M8QA 4YAQA 3VA6A 3CLEL 3T4AA 5E2TH 3DIFB 2K7PA 4B7IA 3O45A 3GSUB 2X9WA 3OR6B 2ZNXA 3CDFA 5T5NG 1DN0B 4ISVA 4MNHA 4DVRL 5CEYB 1RK0A 4PJXF 4MAUL 1OTSC 4E5XA 4R90L 4PYHA 2OJEB 4FFZH 3DXAE 2ID5A 1LGVA 4LVEA 3VE0B 3C8KA 4UAOC 1NLBH 4NFDA 4XGZA 5DQJA 1O7SA 2XOTA 1S5HB 2AK4E 1DQLH 3X14A 2VYRE 5T1LD 1NBQA 1PBYA 5FHAL 4DTGH 5EU5A 4QTHA 5DRZB 4UV4H 3TN0D 5SWZE 2I24N 5GS1B 1F4AA 5FYLE 2FO1A 1OAKH 2DQUL 4YDIH 1YA5A 4P2OC 2AW2A 3SDCB 1N59A 1EXUA 1ZT4A 5FDWA 3LEXB 4TVPE 8CGTA 4HKJB 4FA8A 3D3VD 3GNMH 3V0AC 4KDVA 3S37H 1FQ9C 1QBLL 2DI7A 5JOFA 4KTYA 1NCNA 4ZDHA 5FOBA 4KUZL 4P5KB 3JTSA 4LLDA 5GGSY 3IJYA 2R2BB 4HUVB 3QZWA 5JHDD 4OV6F 1QKZH 3RWHB 1NMBH 3KLSA 4Z95H 4M7KH 4NRZB 3L9RB 4Q6IB 4NWTL 3SDXE 3FB8B 1NFDE 1UM4L 1INQB 4L3CA 3UXFA 3QUZD 3TT1L 1SEBA 2H6PA 3EYSL 4MDJA 5D7JA 5MHSD 1BECA 4NO0A 3U36B 3BAEH 5C8JB 5FUCC 5JZ7D 3PL6A 1CVSC 2BNUB 4I0PA 3EYVA 3EDDA 1HILB 3N1GC 4M43H 3G9VA 1U3YA 1OAXL 1TZHB 2DJUA 3VMOA 5I1AB 4P2QE 3GSXA 1XEDA 3UJTH 5C0FB 2OJZL 3CD4A 4J3SA 2BSSB 4X5XA 1N64L 4PLNC 1KGCD 5FGBA 4XCNB 2R0WH 3C87A 4LU5L 3X12B 3B9KA 4QXUH 4H0IA 3MGTB 5FGCB 1JGUH 3KR3H 1K8IA 3WO3B 1L6ZA 4IMKA 2XPGB 5IQ7L 3N9GL 3P11L 1TPXB 3M8OL 4ODBD 2EC8A 4JHWL 3RWEA 5EU3B 1QPXA 3QDGD 4OIBA 4YQXL 1U8NA 3H8NA 4OTXH 1L0XA 3K74B 2A83A 5IQ9B 5I1DB 2MFNA 1S7XB 3ARUA 3HLAA 1BFOA 1XGUB 3UTOA 3B9AA 4LCIL 1Z3GL 1HHIA 1WWBX 3FT2B 2X1WL 1RMFL 2VL5A 5E2JA 4BQ6A 1AGBA 1MFDL 1FG9C 1K2DA 1ZHLA 3H9HA 2EH8L 3ARRA 2DIAA 3PWVA 1WK0A 1C16B 3CUPB 1J0IA 5FA3A 3RGHA 3ARDA 2VXSL 3T0WA 3ULVL 5J13C 2I9TB 1BVKA 2ZCHH 3VRIB 3U7YH 3PQYD 3X12A 5TQ2H 5I66A 1QP1A 2HFEA 3LEVL 1C5BL 1W0VB 3C8HA 4PG2C 3CDGB 3BKMH 4K7FA 2BSSA 1NANI 3ARBA 2F54E 1TVDA 4YXHL 4JG0L 1XGPB 5IHZB 1KC5L 2EE3A 3TBSB 1J18A 4NN6C 3D0LB 1NFDA 4KXZH 5I1AA 2BXYA 4P2CG 2AABL 4MAYD 5HI3D 1U8OA 1TQCC 1TZIB 4HCRA 2DDQH 2EYRA 1YEDB 1XGTB 1JVKA 3SKMB 3V8CA 5A16A 2DIBA 4QNPF 3HI6H 4WUKH 4N0UA 4E41E 3DV4B 3CX5K 1AGEB 4YHYC 1F58L 5E4EC 2R4SL 4LF3A 1R6VA 1RZFL 1FORH 2C9AA 2VERN 4ZS7L 2B7DT 4K8RH 1ZLSH 5GZOD 4KY1L 3OR7A 1LEKA 1PW3A 3O3EA 4OJFL 3S35X 5BW7C 4WIQA 3FAWA 1WZLA 2V5YA 5LGHL 3D3VE 3VFOA 4PJ7B 2UUDK 3UPRA 3KPQA 4XH2B 2OTUA 5E5MA 5GRWA 1WWAX 4HKJA 3D2UB 2EYSA 3VXMD 3NTCH 4GRWF 1UXWA 3G04A 4JRXD 5EB9A 5ID1A 4N0RA 1CF8L 1ZT4B 3EDJA 2VUOA 4Y19D 5IB1B 3LIZH 1KIQB 1I1RA 2AK4D 4FQ1H 3UTSB 3CFBA 4GXVH 3A67H 3Q1SH 3KWWB 1KJ2H 5ALBH 4HWEL 2AABH 1FNFA 2IADA 3FRUB 4NRYB 3LS5H 3NIGE 5DK0A 2CK0L 1SJEB 2YZ8A 5C2BL 4POZC 4MA1C 5FYJE 1ZLWH 2VXQH 4Z7WE 2HJFB 3KPTA 4MCYA 1CXIA 1XZ0B 4NKDB 3DBXB 3W39B 2AK1L 4JLRA 5C0EB 1FE8H 2HFGH 3FONB 1T7XA 5DI8A 3O11B 3BO8B 2VXSH 3QDHA 4U7MA 5HYSA 5L8KB 2FGWH 3NFPB 3KJ6L 2DQJL 1T1WA 2OI9B 5E70A 3AREC 2Z31D 4MD4A 1QR1A 2V7HB 3RWGA 1D5XA 4G6AD 4LEOB 1NMBL 4Z95L 4LCUB 4NUJB 4UZGA 3I02A 1DVFB 4YDVA 5DRNA 3LKNA 4P2RD 2COQA 3O8XA 1JGDA 2JJSA 1UXSB 4KVNL 3BEVB 4HQQL 1CD1B 4YHML 3RVUC 3TZVB 1AD9A 4IIQB 2J5LC 5HHVL 3RJDA 4JG0H 4N8PA 2R69H 3WFZA 1FGVH 4OZFB 1BVLB 4PR5A 2ZUTA 1IGTA 2WUBH 3N1PC 2FGZA 5B39B 1V05A 1ZTXL 5CJBA 4YHIB 3P77A 3HE6B 4F7PA 1GRWA 3CVHH 1MRDH 5H37G 3PGDA 3GMQB 4PJBB 5DK2A 4FHBD 3REWB 5I71B 1YMHB 3FTGB 4WUUB 3NH7H 3EFDH 2EXYC 2VXVL 5AAMA 1MWAA 4J4PA 2F74A 4Y4FD 3ZYOA 5ICYA 1LO2H 2WUBL 5GGUB 1Z3GH 4RMWA 3LRGA 4JVPA 2X05A 1BGXH 1I85C 4JDZA 4FABL 3AFLA 5BV7L 2VZSA 2A74A 2BY2A 5BV7B 1PKQB 3RBGA 1QO3A 1EEZB 1P9MC 4HUKB 3P3YA 3AVEA 3ZE2F 4KKCD 2MQ0A 1R0AL 4PP1C 4M48L 4L4TE 5F97E 1EO8L 3OJDB 1DFBH 2OK0L 3MLYL 2AJ3B 4OCRH 3F6LA 2EO9A 5HJ3B 2P24A 3DJ9A 1NAKH 3K1DA 3OPZL 2XYCA 4I5BB 1IEAA 5ACMA 1BWMA 5KVEL 1NJ9B 1A6AB 3OZ9H 4XNXH 4G43A 4L9DA 2AQ2A 4TQEH 3UP1A 2QQQA 4CJ0A 2VZTA 4BFEA 2D0GA 3DGCR 1VKXA 1IM9A 4JE4B 4G6AC 2AJVH 3RY6A 2YPKB 1AP2B 1TNMA 2C5DC 5DHVA 1SEQL 3SCMD 1QNZL 1TIUA 4NHUB 4XCFH 4NQSA 3EFDL 4G8IB 2XNAA 1A6ZA 2ZCLH 4XCYB 5E0QA 2R9HC 3LEYH 3E6HA 5C0IB 4WO4A 5IOPA 4ZUSB 1RPQA 3KPRB 1J7VR 3K4AA 5DJ8A 3QDJD 2FSEB 5E2WH 4N1EA 4WI4A 1J5OL 4O4YL 1BEYL 1Q9OA 5FYLH 5C0BA 3NFNA 4Y19A 5J6GB 1JNLL 5J12B 2XY1A 5ANMB 4NQUA 4CRPA 4R3SA 1OAQL 1XFPA 2G5BA 5DK3A 4FQCL 5K9JL 4UDUB 1UWXH 4P2OA 2O5XL 1DDHA 5SV4A 3ZDXF 1CGSH 4ODSH 2KBGA 3FQTA 4KZDL 1LEGB 1DBML 4NKOB 4LSVL 4HIEA 1XGUA 2R0ZL 4JHAL 5I1HH 3V6BR 5I0DA 1TVHB 4M1CC 1LE9A 5D9SB 5T3ZH 4XAWH 3MA9H 4M9PA 3MLZH 4S0TD 3FFCA 4OCNC 3DSNA 3GUTA 3PQYA 2P5EA 4JQXA 3C2SA 5EN2A 3OKMA 4J8RB 3MV01 1WGOA 5E2VH 4NZDA 5HVGB 4EN3D 3QNYB 4X6BA 3M1BB 4F58H 4Y5XC 4ZUVB 3LY6A 1IC5H 5IHLB 1K5NB 3GMNB 3EYOB 5EZIH 1FPTL 3T0EE 4HKBA 5EO0B 3EZ8A 5DD0L 2DLHA 4NNXA 2E5EA 2NX5E 3G5YA 4EI5C 3HZMA 4FZEH 4YHKH 4OLVL 2YPVL 4U2ZA 5EUOE 2IFGA 2V5RA 5TPWH 1AQDB 1DLHA 2ESVE 3FCTA 5EUKB 5CD3A 1PZ5A 4PJFE 3WXWH 2P4AB 3P9MA 4DGYH 5DWUH 2CLRA 1QSEA 5F7EL 3BAEL 4HGWA 5SWSD 2D4FA 2O5YH 1KPUA 3KXFD 1H3PL 3DURA 4ETQB 4NJAL 4XP4H 4F7TA 1CXEA 2F19H 5KSVA 1FP5A 2RFXB 4GBXD 4HH9B 2VLLA 1Y18B 1VEPA 2C1OA 3CFDB 2P1YA 5DMKA 4G8EA 5INCA 4KUZH 4HBQA 4Y8DC 2QQNH 3MV8A 3OG6B 5CEZE 4UIKH 1MVUA 1RIVL 4K23H 1AC0A 5JHDE 2PO6D 4PJDA 1CK0H 1NSNL 3O3DA 1GGIL 4YO0B 4L8SB 1M7IA 2I9LB 1MQ8A 2ZUWA 5ISZB 2YRZA 2DQUH 4O58H 3QI9C 3U4BH 4G8EB 1N4XH 2A6DB 4DGVH 5HHMB 2CKBA 5E9DD 3KPNB 4GSDH 5EZIL 4Y2DA 5F7DB 5EH1A 5BO1L 4I3SH 5JQ6H 4NZTL 4KK6C 1U3HA 3BZFB 4A6YH 3SE4A 4AIZB 1T0NB 1U8QA 2BNRD 5AZ2H 5DURB 2XA3A 4S11A 4ZUVA 3VXMB 3RY4A 1T6WA 1CLZH 4XAKD 4KH2A 5LAXA 3S4SA 5DJAA 3DX7A 5HHQA 4PJFA 4BUHA 3S8WA 4BM7A 4Z7WB 2QQLH 4G8FA 5F88B 2Y07L 1IGFH 3VFRA 3RWCA 4ODVH 4S1QH 4KTDL 1DBJL 1GGBL 4QRTA 1DTUA 1RZJC 3K0WA 3ULVC 4LPYA 2FB4H 4JFOA 3VXTA 1OARH 3PGCA 4WU5A 4UIKL 4XPTH 5KAQF 3F7PC 2DQDH 5T1KB 1L7TH 8FABB 1UACL 3ZTNL 1C16A 1MCNA 4UTBL 3F65A 3QDME 5HHPB 1TQBB 1DQML 4UB0L 3CVHB 1UH4A 5C0JB 1WTLA 1KXQE 3QUXB 2IAMB 4PJGF 3QUKA 5DJ8B 3VDAA 4GMTL 4HF5H 1KXTB 2E27H 2JF1A 3WFDH 1ETZA 1WZMA 4U1GB 5D70H 3RGVD 4XNYL 4RX4D 1Q0XL 5DFVC 3BH9A 3DPBA 2MKLC 4NKQB 4RRPA 1YEJH 3C5ZB 5H2BA 4QGYA 3VH8A 3AXLB 3N0PB 3NPZB 4P9MH 3VXUA 4QHMA 4HG4J 3IF1B 5FYJH 1LVEA 4JZJB 1P1ZB 3G5VB 4ELME 3EAKA 4NM8L 5AZ2L 2FYYB 4FQHA 5F6IB 4HKXB 3IS0X 5A2IH 1PLGL 3QULA 4AJ0A 4LLMB 4LSTH 3F12A 2EE9A 4TRPL 3HAEG 1K3IA 4NKMB 3VWJB 3ULVH 2IANA 5SWQB 4U33A 5FCSH 2DQIL 4ODWB 1J1PL 1RZJL 1KXVC 1NDGB 3CC5A 4ZXBB 3GIZL 3RVTD 3P73A 3SGJC 5KS9A 2AQ1A 5HI3C 1IGFL 5F7FA 3RBSA 4Z9KB 1LE5B 1YNKH 1FO0B 2DBLH 1VPOH 3IKCA 3H3KA 2NMSA 5H94A 3KPPB 5C0RL 2BHZA 4L8SC 4APQA 1ORQB 5A43C 5ICXA 1NC2B 3P9LA 2UZIL 4FQHB 4UT7H 2R1YB 5BZDA 3B8SA 1LO3L 3KLHD 2DYPB 4QRRB 3L3DA 1QFUH 3U4EB 4QNPE 4LCWE 4ZSOB 4QXUL 3U7YL 4N0FB 4O2EB 3V4PH 2QKIA 2HLAA 3WNLA 2D9QB 4NQEA 4BELD 3ZYJA 4MD0B 1MF2H 3E8UH 3RU8L 4MNGE 4JG1H 3VFMA 1LHZA 4MS8D 5J11B 1MQKH 2ADIB 1CU4H 3T08A 1F4XL 3ZKMD 3G5XB 4OUUA 1LE5A 2HFFB 3GMPA 4JZOA 5DJ6B 4ZD3L 4NQDD 3BD4A 2DQGL 1FYTE 1CN4A 5DRNB 1WIOA 4UTAL 1R24A 4LCWB 3SCMA 2FJHB 1DUYB 4PV9B 5FB8B 3ULUF 5HVHC 2DQJH 4P4KB 4F2MB 5HPMB 3V6OE 3V2AR 3GB7A 3MLRH 5EWIH 5GRUL 2ZKHH 4G5ZL 2CPCA 1LQSR 5JXEC 3KPRD 1ZLSL 1DFBL 5E56A 3RWCB 3ET9F 4NSKA 2E8ZA 1TJGL 1MOEA 2WBJA 4XCCH 4KJYB 3QXDA 5L2KB 5I16A 4TVPL 1JUFB 3P0GB 2HTLC 1AD0A 3A6OA 3K7UA 1DQDH 3L5XL 5KSAB 2IH1B 1A7PL 5C6TH 4KAQH 3M1BA 2Q6WB 4YBQD 4DUXA 3RUGE 4FG6D 5IM7B 1RAMA 2VDOL 1FRGH 2B5IB 5I19H 3MQIA 1KB5H 5I16B 3W0WE 2RGSA 4HIHA 5F3HA 3NIDE 3P4LA 4J3UA 1NGWA 2C1PB 2PTVA 4PB0L 1A21A 4P5TA 3VWKD 3VMNA 4AM0B 5L9DL 1CR9L 5I8KH 1TJHL 3R4DA 3OAYK 5KANG 3UTPE 3FQUB 4H26A 5ESQA 1NAMB 2B4CL 2OTUB 5E5MB 5D7LB 4OZGA 4L8DB 1WAAF 1CG9A 4GW4A 3MJGX 4WI7A 5C0AE 1CGWA 2J6EH 5A40E 3QUXD 3O3EB 3DUHA 5DK0B 4WU7B 1HH6B 5INCB 5DMKB 5I1KL 3K80A 5E9DE 4YX2H 2AVGA 1J1PH 1NCAL 4NZUH 4JFXB 3MV8D 8FABA 5C0BE 1YYLH 1MCIA 4XP6H 5GQBA 1J1OL 1UM5L 5IK3A 3BKCL 1AE6L 4X9FA 1J05A 35C8H 1S8DA 1UXWB 1Q9KB 2W65A 3OKOB 1YY8B 1RURL 4KMLB 4RNRA 2X7LB 1BOGB 4FMFA 1A4KB 4LCWA 3MLVH 3SCMB 2VN7A 1NFDB 2V2XB 4DTGL 4K3EH 1U8LA 4PIRF 2PTUA 4MWFB 2ZCHL 1IM3A 4X4ME 1TZGH 5IMMB 2VWEE 4OZIF 5DMYA 1J1XL 5D6CA 5HDQH 4PJ5A 3WS3A 2Y5EA 3QDMB 5SV3A 5IJKA 2ATPA 4X80H 4FOMA 2YPLA 2VKWA 2RIKA 1NMCB 4R2GD 4LLUB 5L0QB 3CUPA 4D9LL 4YHNB 4ZXBA 3H9HB 5HYJA 2YD8A 1OP9A 4XBEL 4U1HB 1U8HA 2Y1VA 2XWBA 4LHUA 4XP9H 1C1EL 2YA1A 1A0QL 1TZIA 4TQEL 3VRLE 1U91A 3I6KA 2O5ZL 3H3PH 3FB7B 5J11C 1OP3K 4NCDA 4WFEE 2P5EB 2A1WH 1FIGH 3RX8A 4X6EA 5KTEH 1RJLB 3QUMB 5D9SA 4G80A 4ZYKB 5C6WH 2P8LB 4CNIA 4F58L 1N3NA 5IHBA 5DSCA 5IB4A 4NYLB 4V1DD 1CS6A 4RGOH 3WIFB 5TE7H 1Z9LA 4KJWC 3QWOB 4U4BA 5F21B 1XAUA 4WUUA 1CD0A 5J1AA 3FB5A 3HG1B 4FZ8H 1J0HA 1RIHH 1F3DJ 3GMQA 1CE6B 2LFGA 5I30H 5DT1H 1OQXA 3BPOB 5DJZA 1B0GA 2NY0B 3BJLA 1L7IL 1EEYA 2OBGA 3VW3H 1KLGB 3BQUC 4QHKJ 3BP7B 4UU9A 4KHXL 4DEPB 2FBJH 3DROB 1OAUH 3T3PE 3QXTA 5CZVL 3SGJA 4LHUB 1JV5A 2IH1A 2A73B 5LCVL 1G9MC 3QWOA 4QHMB 4FRWA 3KVQA 4C56A 3GBLA 1FGVL 3FT3B 2AI0L 2HRPH 3CH8A 1V7NL 1XR9B 1MREL 3DROA 2BSTA 5GJTL 2QL1A 3DX8B 1JTTA 3HLAB 1DP0A 3IETA 4R97B 1Q8MA 2UWEB 4GXVL 2D31A 3C6SB 2XQBH 1YY9C 3VG0H 1I85A 3O3DB 3LSOB 1KLUA 4K94C 1K9TA 3ZO0A 1Q72L 3QXAB 4ZO6A 5AZEH 4KROC 3GI8H 1WZKA 3V7AE 3MNWB 5C09D 2ZG2A 3OF6A 3IDGA 2ZKHL 3L5WB 3MRNB 4R4FL 4Y5VA 5C09B 3M8OH 2ARWA 2O61A 2JJUA 3IT8D 3QEQA 5DRZA 2YD1A 3QO1B 3D25B 3VU2A 4XPGH 4IS6B 4YJZL 2VXUL 2X4SA 2CKBL 5FYKL 5DQJB 4WNQB 4GLRH 4LSRL 3KPNA 4JRXE 3UO1L 4LLWA 4I2XA 4EIZC 3KPRA 3D18B 1CFSB 4U1JA 1S7UB 3CK0L 4OD2A 5IVZB 1BZ9A 3ZT6A 1H3XA 5BZDB 4ONHA 2R1YA 4L8CA 2VO5A 5ALBL 1A4KA 1VFUA 4RNRB 1LNUA 4EVNB 2G2RA 3ARED 4P59L 2EE6A 2Z31C 1ORQA 4L9LB 3NZHL 2P7TB 1WVZA 5D2NC 5DEGB 1OARL 4XPTL 3QNXB 3SKJH 1ONQB 3JSSA 2HFTA 4PJ9A 4EI5B 5CEZD 4K3JH 2NY7H 4PRNB 1FG2B 3S98A 2FHFA 5LG1A 2XTLA 2BRRH 2DBJA 4U0RC 5C0ND 4G5ZH 1EIBA 4P2QA 4MNQE 3VXRD 1MUJB 2E7MA 5D6CB 4EBQL 1YN7B 1AR2A 1GJIA 2VZ1A 5K59E 4PJBE 3FN0H 4OD3L 1A7QH 1JPGB 3TBWB 3L3JB 3MV7A 1T66C 4LARL 5B22A 1V3KA 2GIYA 1NGQL 2VLME 2AEWA 1CFSA 4MVBD 4OD1H 4P2RA 1A7BA 2B0SL 2OSLB 1V3JA 4BZ2H 2VLJD 3G5YB 4M8QB 4NT6A 3X13B 2C4FT 3L95B 3ZE0F 3U9UB 2AKRA 2NY5L 2X6MA 5HYQA 1EO5A 2BVQB 5GRZA 2BVYA 2H9GA 1UFUA 3VG9B 3MACH 1CFBA 1ZE3C 3QXVA 5JW3H 4PJ8A 1F00I 3SQBA 1I1FA 1M05A 3HI1A 3VH8B 4MXQC 3F7QA 4PRHE 2HKFH 3ALXA 2ITDB 4R9HA 1CCZA 3BIKB 4PRIA 5KS9F 1RJZA 1ULVA 4NRYA 2BX5A 1AY1L 1QBMH 2PYFB 2X4PA 4RAUA 2NZIA 3MRQB 5GS0L 3O2DH 2OJZH 1W72A 2WM0A 3L3HB 2CXGA 5D93C 5D1XA 5LVEA 1K3ZA 1DBAL 1JHLL 3HNTL 4NHUA 2JCCF 2Y5TB 4PGBA 2EIZB 4M6OH 4N5ED 3F8UB 3RTQD 3FMGL 4M4RA 4XAKE 2OR7A 3HZVA 2XXCB 5FYJD 3GK8H 3MGTA 4MXWL 3VFSB 5ANMA 2YPLE 4OLYL 5KSBA 1JV5B 1ZA3A 1XMWA 3OPZH 1YECL 4DN4L 1R5WB 4JGJA 1MIMH 3NFSL 3EOAB 4F7EA 3L3GA 1YN7A 5CJOH 1RUAH 4OBRA 4ZYKA 4LCYB 4XRCA 2MQ3A 4QRUB 4HWBA 4KK9D 2XTJE 4NGHL 3KYOA 1G7JB 2K7QA 2YUZA 4PJEE 1KB9K 5C08B 3K81A 5EOQL 2DMBA 1YY8A 5IROA 3THMH 5I1IH 1NCWL 2QV2A 4N1HB 2ZUSA 3H0TB 3AB0C 4G6JH 3MFFA 4PGZA 5I2IA 4TOYH 4HS8H 1D7FA 3RA7H 1C12B 1F58H 3ALWA 5CFHA 1ZWIB 3E2HC 3VFUB 4C55A 5FV2A 5IB5B 2ADIA 1BZ7A 1HXYB 4GRWH 4KUCF 1D9KA 4K3DL 4LPCA 3VXOA 4JAMB 4N8VB 1CD8A 3H42L 2FCBA 3RWDA 2D3VA 5IWLA 2JK5B 5FDYA 4OI8A 5DJYA 3CFCH 3PNWA 2QTEA 1P4IL 3D25A 1MH5A 3OB0H 1P1ZA 4NZTH 4PLKD 5DD5L 3HMWH 5D2LE 4DKEL 3QNZA 1V7MH 3OWEA 4FFZL 2NXYD 1CLOL 25C8H 5FCUL 5IBLC 2C3VB 1A6UH 1N8ZA 5EIIB 4DN3H 4HT1H 2EYSB 3QFDB 4KDTC 1YEGH 4DGVL 4PGJA 1IAKB 5B21A 4M5ZH 4QGTA 1FL3A 4PJIB 2E7HA 4R2GB 5KSVB 3CZFB 3QRFM 2YD5A 3AY4A 2APBA 1T7ZA 3HB3C 1A14L 4N8VA 1PZUB 4XCFL 1MWAL 4NNPL 2VDKH 3QQ9C 1G7QB 4HMEA 4G8GA 1C12A 2BNQE 4NCC2 4MSWA 3EOBB 1QSED 3T0BA 5IBUB 1JNHA 1QYGH 4JZJA 2ILLA 4NUJA 1TNNA 2Q76B 3AY4C 2FEEL 4DZ8B 4UQ3B 1UENA 5HHOB 2I5YL 12E8H 1QQDA 4NUGH 3K2UH 4X7TB 1MFNA 5EZJB 1XGPA 5IHZA 4NP4H 2AQ3A 3CVIH 4AMKH 2J7LA 1CYGA 1FSKB 1XF1A 4MB3A 4GKZB 2NY3B 4JFYA 1A5FH 5MEPB 4RMRA 1Y6MR 5GGUA 2DRUA 4ZUTA 2BMKB 2Q86A 3MROA 2IGFL 2W9DH 5HHPA 3P4NA 5DD0H 3LRHA 4LSQH 4M43L 3NA4A 4MJIB 2B1HL 5EZLB 3EJJX 4PJAB 3FFDA 4KKCC 1QR1B 3TVMA 5D7KE 4JM2C 4HUVA 3L3HA 4OLXL 2DMCA 4HZAA 3I6LE 5F9WC 3DTXA 3IDIA 1MVFA 4L3EB 4XPGL 3SE3A 1R24B 4N0UE 4E41A 2UYLA 3NCFB 3QEUB 1JPGA 3BDBA 3JV4A 3SDXB 2DIJA 3VFOB 2HT3C 1FAIL 3QCUH 1MY7A 3CVHA 5GZND 3U7AA 2YD9A 4JHAH 4X99B 3ZTJH 3QJFB 2P48B 4Y2OA 1ZTXH 4WO4D 4NNYB 2WK2A 2G5RA 2BCKA 2AKRB 5EZJA 2DLEA 2XV6B 1MI5B 3IDYB 5KANI 1NL0H 5CP7A 2YPLB 5JW3L 5CSZA 3AS2A 4YHMH 1IC4H 1IE5A 3QIUC 4LASL 4JCMA 3M45A 1D5ZB 4L8CB 3JBG7 1OT2A 2HJFA 1L0YA 5BRZE 3ALPA 5CILL 4BSWA 3VXME 3IJHB 1AQDA 1DLHB 3D18A 4U1JB 5A2KH 1JPSH 1IQDA 3DHJA 5D7JB 3CFIC 1S7WA 4OZ4A 5D2LB 5LQBL 2EXYD 1MLCB 3QIUA 3DX6B 4P3CL 5JDJA 4IRSA 5LGJB 2AV7A 5HYEA 3C2AH 2BCKB 4RFNB 3G5VA 3TV3L 1JNJA 4PUBL 3QO1A 1UKQA 5GSRB 5T1MA 2EYTA 5L0QC 2RCSL 2ZPKL 1WIPA 1CFQB 5IUSA 4NHCL 2X40A 4YQXH 3QFJA 3ORJA 2MQCA 4E41D 1OLLA 1UEMA 1QSVA 4U6XA 3SDYH 1KLGA 3U0PA 4YXKL 2V2WB 5FKAB 3ARBB 1E0OB 3MV8B 1MF2L 2AV1B 3QUZC 1Q9LA 1B6UA 1T5WB 1JF1B 1PG7H 3T3ME 5DXWA 4YDLC 5L6YL 1R3JA 2APXA 2ITDA 4TSAL 3LDBB 3O81A 4APQC 1RSFA 3KYKL 3P73B 3MCKB 2Y7QB 3N06B 1QNZH 1VEMA 4FXKA 1FNLA 5JORB 2NR6C 2X4OA 1ADQH 3F7YB 1KLUB 5LBSL 4RDQG 2KKQA 4QY8B 1A2YA 3OKMB 4GMSH 2C3XA 2HT3D 1G9EA 4DEPC 4KRMB 3M07A 1WUNT 1Q72H 4X7TA 4GT7A 4WI6A 4YHZL 1JCKA 3L7EB 2BNUA 1QSFA 4YC2C 3UROR 2ZUQB 4G6FB 2V5MA 4UQ3A 1AFVL 2RBLA 2BSRB 3O6LL 2D0HA 4B53A 4MQSB 2OK0H 1A7OL 3T0EB 2XIDA 4MB5A 3MCKA 2KH2B 3B9KB 5T1MB 3LKQA 3RVUD 4JPWH 5I8CB 4PRPE 4TNVF 1G7QA 4OZHA 1CIDA 5D2LA 4WI8A 3LEVH 2WMPA 5EU6A 5HHME 1BLNB 5E00B 3PWPB 1JZ3A 4QT5A 4NDMB 3VD3A 1J88A 2DLIA 4M3JA 4S10A 1D9KC 5F71A 3H9YA 5JOEA 2V2WA 5FKAA 1GIGL 4NM8H 3WD5L 2IPUG 1ACYL 5DHVH 4X9IA 1BZ9B 3BN9D 4EUPA 2H32H 2XPGA 3QFJB 5E94B 3JUYA 5IF0A 1S7VA 1F8TL 3LS4L 1IEBB 1UM6H 1LP9A 5SX4I 4LBEA 3ZKND 3PNWB 3A6CH 1SVCP 1OLZA 1GGCL 1JWMA 4Y88A 4NQXA 1MCEA 1X5ZA 3RWDB 2E6QA 4JHWH 4WU7A 3RTQC 1FFPA 3VXPB 3BI9X 1G9ML 5ACLA 3UZEA 3RIFF 3S4SG 3ZDXE 3QHFL 4ELKA 4YO0A 5FHBH 2YA0A 1AI1L 4LVNB 5D1XC 2FIKA 3WSQL 3MV9E 1RK0B 1DL7H 5CJOL 1AFVH 1EVUA 1IAIH 4LNVA 4MQXC 4G3YH 3IDMB 2NZ9C 1BP3B 5DJ2A 4U1NB 2PR4H 5EU5B 2VDRL 1IM9B 1T21B 5F3HB 3AREA 3EYUH 5FYKD 1BVLA 4H1LH 4PR5B 5CMAB 3DX6A 3ABZA 4XWOC 3PWNA 2YPLD 4NWUH 3T0EC 1ZANH 3CXHK 4RGND 3BEVA 4FMKA 2PXYD 1JTPA 1YEFL 5JOFB 5JPNA 4P3CH 1NCBH 3C60C 4G6KH 5I74B 1JGVL 4OZGB 2CIIB 3TEUA 3HAEH 1BOGA 3MRPB 3TNNB 3L3IB 3OKNB 1CFNA 3MLSH 4YFLI 1J05B 1QBBA 1MCOL 2FD6L 1S9YB 3BKJL 4N8CL 4XBGB 3GB7B 4W6XB 4I8DA 3T2QA 3I3DA 3JWDL 4JFXA 5IHUL 3ZTNH 4U3XA 4E42B 5C7XH 5CJXC 3P4NB 1AE6H 1WWCA 3RVXD 3TBVB 5BVPL 5I15L 3R0MA 3LKOA 1CDHA 4M6OL 2QSTA 3EGSA 2Y9RT 2D7MA 3HR6A 4OCLC 3QEGL 3PQYB 4LLVA 2FRGP 4JREB 3QXDB 5L2KA 25C8L 5FCUH 3Q0HA 2LABA 4HZLA 1NFDF 1BPVA 1GAFH 1GOGA 1B4JH 1DVFD 1J8KA 5HHOA 1BF2A 5F72S 5I75C 1D5BB 5C08D 1K8IB 2DM3A 4P4KA 5DO2D 1PFCA 5KVGH 5DWUL 1I4FA 3WS6C 1CGXA 4ESKA 4OCWH 3T77B 1A7RL 1MFEH 4Q0XH 3P0VL 4X9HA 4R8WH 1CE1L 3QDMD 1HHJA 3ARWA 3TBYB 4BH8A 1HXYA 5C86A 4JFZL 3SDXF 4CADB 5IB5A 3TA3B 3OXRB 1FG2A 3KWWA 5EC1A 3TO2B 2IPTL 4JPWL 5FUOL 2IBBA 3U4EA 1XGTA 1NCBL 4BQ9A 3QQ4B 1Q9KA 3QIWB 5SWQA 5ID0B 4LLQA 3U0WL 3WIIH 3VCLA 4WTZA 2W59A 4B50A 3GMMB 1QSFE 2GJ6A 5JPMA 3VRJB 5TE4L 5DTFA 2GKIA 2IWGA 4OLXH 1BAFL 1IQWH 3T65A 4LLMA 1LEKB 4R0LC 4U6TA 4YDJB 2ZCKL 4Z78A 1T20A 3BD3A 1BVKB 4YXLH 3FMGH 3CFJA 1CGSL 4GQ9H 1MWAB 3PHOB 3JWDC 1DL7L 1MQKL 3OF6D 3TCLA 4WUUE 4JDVB 5IVXE 1GH7A 2Z92A 5ABDE 3WKNA 1HQ4B 2ZUUA 3D5OF 1MJ8H 4JGUA 5D72H 5EOCL 4AENA 4TULL 1U8KA 4MA7H 1U8OB 3BSZL 1SHMA 1KIRB 1P69B 1WCBB 4FG6C 1ND0B 2FJGA 3LSOA 3MR9A 3MRJA 3F62A 4AMKL 2AEPH 4FFVD 2PYFA 4NZJA 3Q6GL 5CP3A 1WBXA 4JFDE 1IC4L 1NEZB 3IETB 1UYWH 1HHJB 3INUH 4ZTPL 2WZPD 3BIKA 4PRIB 4Y4KC 3HZMB 5LWYL 5IM7A 1J11A 2X1OA 3GSQA 3E1F1 1XIWA 4KK6D 3IFOB 5LXGH 3MNVB 3BH8A 1Q94B 4E5XB 3MFFB 5F7LB 5ERWA 4HCRH 1P7HL 3GEWB 3KXFE 1NGPL 3O4OC 1VPOL 3NACH 3ZKSD 3QQ9D 5C0AB 2IBZY 4LOUC 1Q0YH 1RQ5A 1NBVH 1T7VA 1U95B 1U2CA 2YBRA 5C0FA 4JPVH 1KOAA 2XTJC 1PD6A 2J6EA 5HHNB 1WICA 1HI6A 4TSBH 2FJHA 2H2PC 4R90H 1H5BB 4K94L 1OGAA 2MCG1 1NC4B 1XZ0A 4NKDA 1MCDA 4FFWD 3HS0A 3T2NH 3W39A 3WJLC 3T0XA 3L3GB 2NW3B 1KJ3L 1JGDB 4M48H 4Y4FB 1EO7A 4GG8A 1C08B 1SJEA 3TBVA 3PWUA 1FFNA 1S78D 3TYGH 2C4FU 4JPVL 1LDPL 2IPUK 1JWSA 4DN4H 5DD3L 3ARFA 4NYLA 1B0WA 4ERSL 1E4KA 1AIFB 3VFPB 5HYIA 4MQ7A 2A9NH 2FSEA 2AJYH 4ALAH 2OSLA 4P9ML 2ARJA 4HBCL 4NFBA 3B43A 3LN4B 4KU1A 4YDKH 4RAUB 1L0QA 4JN1H 3RZCD 3L3JA 3MV7B 1CD1A 4LQFL 4P23D 5GRUH 2IH3A 3FO1A 1NDMB 3B9DA 1WFUA 3WCYA 4JKMA 3CSYB 3P0YL 5M94B 3LS4H 4XI5D 1PY4A 5FGCE 3C08L 2H9GB 1RIUL 4BSVB 4I0CC 1R5VB 3GIVB 1CTOA 3BP6B 1I3RA 1AGEA 3QIUB 3MO1B 1H8NA 4QRTB 1F4WL 2YKLL 3G04B 3LCYA 5ALCH 4PD4K 5A16B 3SKMA 3N85H 2NY5H 2EYRB 3AU1A 3T09A 1SJHB 2VISA 3PJSB 4Y1AA 4OLYH 1RULL 3D0LA 4JN2B 3T2NL 1UWXK 2X7LA 1KJVA 1J87A 1O5DT 4S1DC 4CBPA 4HULB 4OCXH 3BIAX 3NA9L 2VN4A 5CGYC 3GI9L 4IOFD 4I2XB 3T4AB 3UAJC 2E7BA 4ODHL 2JB5L 2GK0A 2PO6C 1I3VA 5D96B 2R29L 5IV2A 5TFSL 3ZSSA 2RFXA 1KIQA 5IVXB 2EEDA 1WF5A 1MJJB 3NACL 4UINL 2VDQL 3AMKA 4ZFOB 2PW1B 1P6AB 3IDGB 3L5WA 2MNUA 4KKNA 4LSPL 5ITBH 3NIDF 3BQUD 2VLRD 1JHTB 3KPQB 4XH2A 4JRWA 3GIZH 1T1YA 4O58L 1B0GB 2VQUA 2CDFA 3W0WA 2CH8A 3CAFA 3JV0A 4OI7A 4ZXBC 1CGUA 1AIFA 3RRQA 4MXVF 4V2BA 5GGQH 2A9ML 4KAQL 1NCUA 3LIZL 1RZ7L 3SEPA 1T22A 2EZ0C 4P4KC 4X5WA 3KYMA 2IAMA 5C70A 2GFBB 3UTTA 2VLLB 1HHGA 3WXVL 4LARH 1F90L 4OZFA 5I71C 1SQ2N 2OR8A 2G5BB 1PKOA 3KPLA 5IFJA 3S88L 3CSGA 3CFKA 3WIFA 5KOMC 3MLRL 5EWIL 3LOWA 4UILH 1MCHA 1MRFL 2C7UA 4L3AA 1EGJA 1MFBH 3LD8C 3RZCC 2X9YA 4QRSA 5DJXB 4UTAH 4NKMA 2YBRB 1QFHA 3PXHA 4MNHB 3QI9A 1BOYA 4IOIA 4YZFE 5HHNA 5C2BH 4XZUA 2ORBL 4KROD 5DEFA 2BSTB 2V7HA 3BYYA 3LAFA 5DFWH 4ENEC 2PKDA 5K93A 4RZCA 3KLAA 3MC0A 3WDIA 1LO4H 2HG5A 2WUCH 3EIFA 3IFLH 4KGLA 1YEKL 1KIUA 4OSUL 4HUUA 3MBEC 3QUYB 3EYOA 2ZUQC 1QR4A 2VH5L 5C07D 4ZS6C 3L5XH 3ZE1F 3TP4A 5EPMB 5JW5A 2CMRH 1MNUH 1CIUA 4XVSL 2V9RA 3GSXB 1IAMA 4M62H 1CVRA 5EN2B 5FOBB 2AJXH 5DJZB 4G9DA 6FABL 1LO5B 1UM6L 5EBLA 4BKLB 2YEZB 5AEAA 3QEHB 5HYJE 3STLB 2A6IB 4X7EC 5F96H 2V7NA 4PB9H 4O2CB 4EDXB 5C8JA 1M7XA 5GGTA 5EOTA 4DVBA 4KZEH 4NO3B 4MDJB 3U0TA 2VXVH 3ZE1E 3TO4A 1AO7E 2VDRH 1I3GH 1MFCH 3GMLA 4TNWF 2AAVA 3ZKXB 4Y16D 1UCBL 1T03H 2P8LA 4K2UL 4RFOH 3MZGB 3ULUE 3V4PL 1HIMH 1CDBA 3MTRA 3VXOB 1EHNA 3VCLB 1YEGL 3TVMC 2MHAA 1QSEB 2AJ3A 1XR8A 3RZCB 5BS0D 3KDMA 4P3DB 3QAZC 3STLA 4EDXA 4QRPB 5BJTB 1DBKL 2C3WA 2OZ4L 3QWQB 3BRGC 4N68A 2YOCA 4X7SL 4XPHL 4BK4A 5CJ5A 1FGNL 1DUZA 2FL5A 3WUWG 2VDPL 1HSBB 3IAPA 1MCBA 4M1CD 4WEBL 1VKXB 1GXEA 1OAXH 3KLHC 1RMFH 2CO7B 1ZHBA 1AKJA 5F1OB 1NUGA 4JANB 1ORSA 3JTSB 2VWEC 1JPFB 1ZKAA 1RZJH 4PPTA 1EHLH 15C8H 3FN0L 4M02A 3BXNB 1M7IB 3THML 4UT9L 5FGBC 2R2HA 3QPQC 4ODHH 1YEHL 2VQ1A 4ZAKC 1VCAA 3QEUA 4P0DA 3GSVB 4CKVX 5ESQB 1K6QH 2WLYA 4ZMAT 1D5BA 4PGCA 1KT2A 2P5WE 4P57A 1ZT1B 3QHTC 5F9AC 1KCUL 5FM5O 1X5XA 4HJJH 3WXWL 4GG6B 3FRPA 3QQ3A 2NZ9D 4JRYA 2G60H 1MLBB 3FQXB 2X10A 2GJ6D 1EUTA 3V52L 2CDEB 4R3SB 3WE6B 5DR5H 2V5SA 2YPVH 3ISWA 2HA1A 3RDTC 1MREH 3EYQD 3QUXA 1D5MB 3EJYC 4NZUL 4XP9L 2A6KA 5MEPA 2F58L 3SY0A 3ZKXC 4QLRA 2Y06L 5FF6A 1BJ8A 1NH6A 3V0WH 3DO3A 3FCTB 2HWZL 3EKCA 4XWGL 4WFHD 3V7AG 4Y5YB 5F1IB 4WJ5B 5JUEH 3LHPH 4FQXC 3FQRA 1Z9OA 4DOHB 1U2HA 4JO4L 4G42A 1TVBB 5ESVB 4RFEB 3ULSB 4K07A 3B2VH 3GRWA 5EO0A 3MCLL 4HUNB 3LV3B 4POYA 2SEBB 2X1XR 1YJDH 3B5HA 1A1NA 1T80A 2R0ZH 4X4YA 3G5XA 1KFAH 2IMMA 3U36A 1G7IB 3SGKC 2WNGA 3HPJA 1S7QB 1YN6B 3SDYL 4KKLD 3RWIA 1HSBA 5F3BB 5I6XC 1QHPA 4MX7B 4LSDA 2WINB 2NY6B 2NY0D 4OT1H 1A7PH 1IKFH 3P4MB 3VXQA 4ZQKB 1RV6X 2RCSH 2ZPKH 5TF1H 1KJVB 5E2WL 1G9NL 2DL9A 3VGEA 2CLZB 5AWNL 2CKNA 1MJ8L 3MOAL 5D72L 4RQQA 3BGMB 3PJSA 1JF5A 4TRPH 3RTQA 3BPLB 1MH5B 3EHBC 4QOKE 3TBSA 5J6GA 4UUJB 3GJEB 1H3PH 4FQIL 1QRNA 3BW9B 1GGTA 3O6FA 2NY1D 4OGYH 3NGBC 5T1LA 2HWZH 1IGJA 2VAAB 5LXGL 2GJJA 3ARDB 1KCKA 2JELH 3PHQB 4I3RL 3CFBB 1FH5L 2HLFD 2VZOA 4LRIC 1ODAA 3H9SE 4OV5B 32C2A 3ARFD 1E4XI 3ZL4L 1DBAH 1YEEH 3CC5B 5CEZH 3Q2CA 2K1MA 2PXYB 4QO1A 2HT4D 1OW0C 3FT2A 2VLKE 4M6MH 1UC6A 3LPWA 1JK8A 1R3LA 3NN8A 4MNGA 3T1WA 4TUOA 1QUNA 3WO4C 3ILQC 3QUML 5TH2A 4Y4KB 4ISVB 3RJQB 4PFEA 3E0GA 2OS7A 5ICXB 4G9FB 4J6RH 4NPYA 3OR7B 12E8L 1BQLL 1FNEA 3FQWA 2J3SA 3JVGA 1BIIA 5IMLB 4Y4HC 2YMXL 4EQ2A 1EMTH 3T8XA 4DGYL 2WWKT 3MRMB 3ARGC 1BGXL 4FABH 3MYJB 1YNLL 4J3VA 3DWTA 5JLZB 1SBSL 2BOCB 2WIIB 5TE4H 1I7ZA 3EO9H 5KBNC 3C5ZA 1MFAH 5KW9L 4JFOB 2NLJA 3TF7C 1RK1A 1R3KA 2IGFH 1UB6A 1H3TA 4QF1A 4FN0A 2PW2A 2EKJA 2WIMA 1LILA 1RZIA 5D1ZA 4Z6AT 4HIXL 3BJ91 4TNWK 1G9NH 3GHBH 5EBMA 3MBXH 3EUUA 3IVKA 3BIBX 1E6OH 3IDUA 5H37H 1P4BH 1PQZA 4K55A 2PCPB 5F6IC 1ZSDA 3U9PH 5C9KA 1WBYA 3GO1H 4M1DL 4BH7A 3U9PL 4NQVA 1T0MA 4OQTA 3OKEA 2RHEA 1S5IH 3OX8A 2JJTA 2EIEA 3VGGA 4GAYB 4TUKH 4XPAH 3T4YA 4P2QD 2ZSWA 3SHSA 1WBXB 2Y36H 2XI9A 3MNZB 4OFIA 5E6IC 4F15C 1NCAH 4OM1H 2X89A 4L29B 5IQ9A 4QF1B 4HIJA 1WFNA 4U7SA 4J1UA 5GPRA 4KJQC 2XY2A 1CXHA 4X6EB 5MP6L 4ORZC 3MODH 4XCCL 2F5AH 1YNLH 1CQKA 1JWUA 3TBWA 3EYVB 1A14H 1P6FA 5D7LE 2EDEA 5TF0A 3MUJA 3U46A 5CEXB 3MRMA 3BPNC 1MCCA 4J7RA 4PJ9C 1LK3H 2DTMH 3VFTB 3VXSD 2DI8A 3I02B 2HFGL 2MKWA 4PY7A 3PE9A 4KTEH 1DEEA 4WWKD 4Y4FC 3CSPA 1SBBA 5F7EH 1HYRC 1JZ2A 3E6FB 1MI5D