5ILTL

Crystal structure of bovine fab a01
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords bovine Fab A01 light chain
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iltL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iltL01
1WV7T 1ETZB 3UTTA 1T1XB 4HUWB 2VTFA 2IBZY 4YIQB 1SEQL 1VKXB 1AGCB 5CBAB 1AP2B 1Y18A 3BD4A 4AJ0A 2VLRA 1QBLH 4AL8L 1QD0A 3NCYP 4LGPB 1DCLA 2OCFD 4XMKH 5CBEA 4C58B 2OK0H 4N5ED 5SWZA 1MHCB 2P5EA 4PV9A 3OAUH 5KSUB 5DFWH 4ELMA 4LFHG 4I3RL 4KJYA 3SGJA 3EOTH 1UZ8A 5J1SC 1A3RH 1A0QH 1MRCH 4QXGL 4IOIA 4RNRA 1A3LL 1Q9KA 2I24N 3VA6A 1G7LA 4HG4K 5JDJA 2DI8A 5FCUH 1RZJH 3KPNB 2BVUA 2YA1A 5FCSH 5J1TC 2VXQH 1XZ0B 2DJUA 4XMPH 5EU6D 1F3JA 1N59B 2G2RB 3MUJA 5JPMA 3QEQD 2HT4D 1L9NA 5E5RB 4RA0C 1C5DA 2V7NB 2Q7NA 3V4UH 3WKMH 1NQBA 5I6XB 1U93B 7FABH 4U6XA 3DECA 2VLKA 1INEL 1NC2B 4HKBA 1G0XA 2GEEA 3QIBA 3WJJC 4QNPE 4HCRA 5HI5D 4PS4H 2W59A 1YPZE 1A7BA 4XGZB 5MI0B 1RZFH 1BOGA 2P7TB 4HBQA 4UT9H 3B9VA 3MOBH 1GGIL 3T0DA 1KENL 5HVFB 3ZDXE 3G04A 4WUUD 5JDSA 2NY1B 1TVBA 3ZT5A 1EXUA 5C08D 3UPRB 1VADA 3GHBL 4V1DA 1LO3L 3TGXA 1IILE 4JKMA 3MRMB 1NGXB 4JY5H 1WZLA 2UZYB 2V5RA 4HLJA 1Q9WA 4JQXA 1JUFA 5E5MA 2YPKA 4ONOA 4R8WH 1NBVH 2NZIA 4U6VH 3D2UA 3I75B 1EEZA 2ADJA 4XPFH 4ZO9A 3QP3A 5JQ6H 1A1OB 1F4YL 4G8GA 4YX2L 4OKDA 3UJTL 1U92A 3BESR 3MV7D 1Q9LA 3JBG7 1A6TA 2YD8A 1IGIL 2YN3A 3BPLB 1AQKL 4RGMC 1KPRA 4G6AC 5HD8C 4MWFA 4P46B 3UCRA 1HILB 3BGAA 3MRPB 5C9JB 3SE9H 3GSNB 5GGTA 5L88H 3BHBA 1AI1H 4JO1H 1N8ZB 2QV2A 4F9PA 2Y7QB 4KZEH 3BHBB 3QDJD 3MNVB 1A14L 3FKUS 4OT1H 4F15B 1DLFL 4XAKD 4X80H 2FHFA 3LQZB 4NRYB 4G43A 4HFWA 3N1MC 4K3GA 3KJ6H 5DS8A 1DBJH 1A6WH 1T6WA 3OPZL 4POYA 4OFYD 5HJ3B 1IGYA 2LAGB 4OCWH 5J13B 3QRGL 5JMRA 5KN5B 4NYLA 3ZKMC 5J11C 3QEHB 1U3ZA 3G9AB 1U8PA 3LB6D 1OAKL 3BIAX 2GTWA 3MOQA 5DD3H 4WW2A 2YUWA 4PJCB 3VXSE 1YQVL 1A6VL 3IDGA 1XF4A 4HS3B 2NXZB 3DX9A 1UM4L 3KYOA 2Y06L 4KK6C 4PJFE 3UJJH 2E7LC 1P6FA 1S3KL 4QHUA 1HHGB 4JFXB 4TQEL 3GM8A 3LKSB 4JFQA 1MCSA 2Z9TA 3WFBH 2E6PA 3ES6B 3C6SB 4R97C 4TUKH 2BNRA 5DD0L 4RZCB 4EUPB 3ILQC 4U7SA 3OAZH 1BHGA 3BQUD 4KQ4H 1JMZA 1P9MC 1TMCB 3B3IB 1AIFB 4KJQC 3I9GH 4XHQA 5L7XL 3DOSA 2ED7A 5MENB 4FABL 3IGAB 3LIZH 4DEPC 1TJGH 5DK2A 3KPMB 1RPQA 4KKNA 4NNPH 3G5VA 3V52L 2VMFA 3HZVB 5JLZB 5KVMC 2P5WE 4YDVA 1EO8H 1FG9C 1F8TL 3MJ7B 3WIFA 3EYVB 1I1AB 1N6UA 3OX8B 2QQQA 5CEZD 1PX4A 3T1FB 4IMKC 5I73C 4JO3L 5FDWA 1QLRB 4F58H 2X70B 2VE6B 2BNUB 1JGVH 1S7XA 2PF6A 4MB4A 1JF1A 4OAWA 5E99H 5AYUL 2BSTB 3E6FA 5K59E 1U95B 2DQHL 2PN5A 1PG7L 3QUKA 4OFDA 3KPOA 1U8IB 3ARBA 4UOJA 1KENH 2MFNA 3A6OA 5FGSA 2IWGA 3VGAC 2UUDH 3HR6A 4K2UL 2WINB 2XZCL 4P4KC 5GS3A 1LQSR 1RUAL 4PJDA 3LS4H 3I3EA 3WFCH 4ZYKB 4UNTA 5HVHB 5TPWH 4R2GC 3O6FA 3R8BB 4KROB 3GSWB 3KPPB 4PGBB 1JTTA 3KYKL 2ZG3A 3OKNA 3QA3A 4GAYA 1CXIA 1YYML 2V2XB 5T5NG 1JE6A 2XRAH 4G8GD 3CSYA 5INCA 4S1QH 1WWBX 1YPZA 5I1LB 3VH8A 2I9TB 2QQKH 3CVHB 5INCB 1HXYB 1PG7X 2FEEL 5TGBA 1FPTH 4ZFZA 2R15A 3BPCA 4YH6A 1YY8B 1RZIA 3VXMB 4PLJD 3C8HA 5C09E 2VWEE 3I6LE 1O7VA 1YMMA 3FFCA 1GIGL 1KACB 4BK4A 4KXZI 1BGXH 5DMGC 4EVNA 4C54A 2IANA 3ZKQD 2Y25A 2B5IC 1JYNA 4M1DL 3SDAC 1HE7A 2B0SH 4S11A 4Y2DB 6CGTA 4PJ9B 5EO1B 3Q5YA 1I8KA 4GRLC 3EYQD 2R4SH 1U3HD 4GKNB 5JXEC 2VDRH 2CLZA 4YIQA 4F7TA 1ZLVH 1F4XH 4PJ8B 3EYOA 3GSQA 4GRWB 2C5DC 3CZFA 1GH7A 4HUWA 4P46A 1TNNA 2H9GA 3W39B 4PRPB 1XCQA 3FRUA 5IBTH 5C9JA 1D9KB 4AENA 3MRRA 2HTLC 4OF8A 1LEGA 2XZAL 1UADC 3WNNA 1GZQA 1JP5A 3ZDZE 5ICZB 3OGCB 2IPUK 4L3EE 3SGJC 5LGKA 4U1HA 3WEXA 1UM6L 2BZDA 3T0WA 1KTDA 4LIQH 3PV6B 3MGOA 4G43B 4CL7A 3QHZH 4P2RD 3NCBB 3OGOE 3GSUA 3QEGH 2HLFC 2NTFB 4YHPB 4HJJH 3HB3C 1H0DA 3R06B 1CL7L 4D94A 1XH3B 3ARGD 3O6LH 4D9LH 1IMHC 4MQXD 1OLLA 2Z4QB 3TZVB 1A22B 3HCVB 4OKVA 3PHOA 2IBGA 3EOAA 2AK4B 1S78C 4RX4D 2PO6B 3ZKND 5F21B 3RWJB 3RVXD 3KXFD 5HYFA 3TIEB 4YDLC 4PUBL 2DKMA 2LVCA 1NCBH 2RCSL 5GHWH 1N4XL 1I7ZB 1I7TA 2ZG1A 2HWZH 2XWBA 3E1F1 1DL7L 1I7ZA 2F5BL 3D0VB 5EIVA 2IALA 5GGSY 3QSKB 1XEDA 1OF2A 3KYOB 4HCRL 4Z9KB 3T3ME 4KI1A 4KKCC 4O02L 3V5DA 3PGCA 2ICEA 2ADFH 4LHUB 1EDQA 2LU4A 3O3EA 3PP3K 4MA7L 1II4E 4PP1D 4W6YB 1DQQA 1G6RA 4MQTB 4PJGA 1IE5A 3ORJA 4X6EA 2FWOB 5EOQH 4J1UA 1H3WM 2MTPA 4OI8A 1KEML 4ODHH 2FWOA 5GJSH 1QFWL 3ARGB 5HHXH 3K2UL 3V6FB 4M1GL 2VIRB 4NNXB 3T0BA 5KBNC 4QXTA 3VXRA 4LCWA 1DEEA 3MLYL 4PB9L 4RBPH 4AEHL 1X5XA 1NMBL 3H3PL 4OB5L 2BVPB 2HVJA 5FIEA 1TIUA 2B4CH 1Z9MA 1D9KD 2GITA 1NSNL 5GGTH 4KXZH 4JGUA 1MIEL 5F1NB 1B9ZA 4IEFB 3N50A 1I9RL 4HZAA 2BY0A 3OJDB 1FO0L 1FP5A 5C0EB 5C0ND 1H8OA 1RMFH 43C9A 4CN1A 4MSWB 3RDTB 3RVVD 2A0LC 4ZS7L 3S96A 3O81A 1J05B 4JN1L 5F7MC 5IMLA 3BH9B 3NIGE 1FGNH 1LO2H 4BZ2L 2VXUL 1F00I 4MNHA 4PJ9D 1CFSA 4HIJA 2WBJC 3IDYB 3VW3H 3L3GA 3JTSB 2R0ZH 3DLQR 2LU3A 5D72H 2KL6A 3OKNB 5DS8B 3L3GB 1I8IB 2ZUWA 4JM2D 3Q2CA 1A1NB 1K8DA 1GC1H 3RTQB 1VFAB 4LPVA 4WEBH 3UC0L 4KKLD 3LCYA 2WBWB 25C8H 1UGNA 1YNTA 4HWZB 5KOVC 2IMMA 5ADPL 2H26A 3Q3GA 1IM3A 1JBJA 2ITDB 3TM6A 4PD4J 3LD8B 3BEWB 4FG6D 2ITDA 3E8UH 4G5ZH 1Z6JT 4Y1AD 3RUGA 2YHGA 1KCUH 1EPFA 2IGFL 4Y5XA 2EXYD 4QXUH 1JZ5A 4JFQB 3SDYH 5FYKL 2JELH 3WLWD 2WANA 4HS6B 4GS7B 5D1QB 4ODSH 5B39B 5TFSH 4JFOA 4KI5E 3BZFA 1N0XL 4LLDB 3S35L 3STLB 2IFFL 3O6LL 4JN2B 4GRWH 3CSPA 5C0AB 3OAYH 4JN2A 2R4RL 3PWUA 5EULV 5F7LB 4JZNB 5BV7H 1MQKL 3KYMB 4AEEA 4JZOB 5J9PB 2XWJB 1I9IH 3M07A 2X40A 1FL5A 2P5EB 4OGYL 2P8PB 4IIQC 1IVLA 4EUPH 4L3ED 3ROLA 2D7NA 3MRBA 5ESVA 5I6XC 4OFYA 4YBHA 3OQ3B 4D0DA 1MAMH 2NY7H 3MRBB 4OSUH 5D7IA 3S97C 4PJ7E 4Z5RB 2BSSA 4UILH 3IJSA 5FM8A 1JPGA 2NY3C 4NO0B 2X4UB 1IKFH 2VXSL 3QO0B 4G6KL 4J3WA 1BFVL 1AJ7L 2GJ6E 5D1ZB 3BAEL 2MPAL 4N0RA 5FAAA 2H3NB 3RWCB 1T20B 4JKPL 1GGBL 1TZHB 1BQLL 1CDUA 4NNPL 5DVLA 1KB5B 2DLFL 3BKJH 3PABB 3QZWG 3KVQA 1NC2D 4OIAA 4HUKB 3IDNA 4KDWA 1AFVL 3VWJA 4I3SH 5HY9A 2NXZD 3MO1A 1OVZA 4OJFH 1TJIL 1JNHA 3E3QE 3LN5B 1OY3B 4V2CB 2R23B 5FFLA 1U6AL 4NWTH 3ARUA 4G9FD 4PJBF 3V5DB 3BZ4B 1ZGLM 2ICEB 4NJAH 2A6DA 5KG9B 4P5KA 3L7FA 2GT9A 2GK2A 2P7TA 2Z8WC 1IC7H 2PXYB 3FQXA 4EIGB 1TCRA 3B9DA 4FNLH 4QTHB 4JHAL 4ODTH 2NX5A 3T8XA 4PJ7B 5JW4M 4KKAC 2E8ZA 1RUAH 1QRKA 4DN3H 5D2LB 1N7ML 3QH3A 5D6CB 1BIIA 5EO1A 1FN4A 2D03L 3S7GA 3NCMA 1AC0A 1E6OH 1K6QH 2ZUUA 1I8KB 3QYCA 3N9GH 2BCKB 2ZSVA 2RIKA 3DX6A 3MACL 4FMFA 1LEIA 2BRQA 5IFJB 3EYQC 4I9WE 1BF8A 1MCCA 1CL7H 4H0HB 4YZFF 4M43L 3OKKB 4ISVB 1PZ5B 5SWSA 3FT3B 1KT2B 2ARWA 4ORGB 4M8QB 3MCKA 3RKDC 3WUWA 3EBAA 5HYJE 2CXGA 2GI7A 2KQMA 2YC1B 3SCMC 2DWEA 4PJBE 3D69A 4HLZH 4ZOBA 4BSJA 1F5WA 1ZT4B 3F7VB 3QEUB 1RUMH 4XC3L 3DMMC 5CLTA 1RJZA 4MS8D 2FH6A 2Y06H 4O2CB 3PL6A 4Y4HC 1WEJH 3EO0B 1FCCA 4PRDA 1EZVY 1JPST 1R3JB 3PWNB 4Y5XC 1VFAA 1UM5H 1EEYA 4P9HH 5JR1L 1S7TB 1ITBB 1JGUH 3GO1H 4OZHB 1X4YA 5IB4B 4MDIA 1IEBB 4X6FA 4IDJH 4NPYA 4PJFF 1JYXA 3VGEA 1MI5E 5E4EC 5BO1L 4LQFH 5E08L 3KDMB 3G6AA 1Q1JL 2F9BT 1LK3L 5DSCB 4HW6A 4XXDB 5LXGH 2H45A 5FKAA 1KTLA 5F3BA 2E7CA 4DK3A 3R0NA 5IBUG 3PWPE 1YNKH 3O2VL 4LSTH 3BRDA 3CFDA 4HH8A 1YEDB 2NY5H 2VXVL 4OFKA 4Y2DC 5ITFB 4B7LA 3VMOA 3TNMB 1FNFA 4QOKD 2WNGA 5T3XD 2D7PA 3KNBB 3VFWB 2O26U 1ZLUH 1D5ZB 4QO1A 5J4MA 2EDLA 4HK3J 2JIXD 4KRPC 1RZGB 3NFSH 3S34H 4FQ2H 1A7OH 2Z31C 4P4KD 3UPCA 4OLVH 4Z7UE 4LNRA 1S7UB 4Z7OE 1PW3A 3LVEA 1OARH 5HVHC 1NJ9A 4Q2ZA 3OB0K 2X7LA 3OJ2C 3VGBA 5B8CB 1U6AH 1J0HA 4G6MH 2WIIA 4P57B 1YN6A 1DFBH 3DI2B 1NKRA 5DJ6B 2FH8A 5TDPB 5CILL 3SCMD 5SWSE 4U1SA 3NAAL 5D71L 2BOCA 3S96B 4BKLB 1VCAA 3WYRA 1JRHI 1U8NB 2NW2A 3CFCH 4D0CA 3MFGB 1H3PL 5LBSH 5IK3B 1ZWIA 1KB5A 1CT8B 2R1YB 3CH1A 1J88A 3K8MA 1X7QB 4A6YB 3MLYH 1XGTA 1M7IA 4GG8A 5EZJB 4Y5YA 2YKLH 4HMCA 2FL5A 1JPTH 3VWKA 3LN9A 2JK5A 3MV7A 5FA4B 1FNGB 3IDJA 1JI2A 4F57H 2YOCA 2QLVB 3EO9L 3HNVL 4QRRE 1ZTXH 1FVEB 5C7XH 3K2MC 4MJ6B 4HAGA 1XF4B 3LH2L 2VAJA 4PYGA 4K8RC 1UT9A 4IBLT 4NGHL 4YDJA 3LPGA 3SGDI 4G8EB 4UB0H 4K9EL 2UV3A 4M5YH 4H0GA 5SX5H 4XX1G 3V0VA 2A77H 4C55A 3VI3E 3QDMB 3PWPA 5DFVD 5KSAA 4UDTB 3BEVA 5FUCC 3EOYG 2BVOA 1U8HA 4LF3B 2BCKA 2EDEA 5CCKL 4FQCL 4UIKL 1TZIA 3H2WA 2NQCA 3EYOB 1E0OB 2VL4A 4TTGA 1A3LH 2CDEB 4YR6B 4ZTPL 4JDZB 3OKYA 4M5ZL 5C86A 1AY1H 4Y19D 5IEKA 1I1CA 3DMMA 1IKFL 5GZNC 1QO3A 4GG6E 2IFGA 1FAIL 5DA4A 2EDBA 4FMKA 5IOPA 2CXKA 4LSRH 1I1RA 4JG1H 5D7IB 4L8CB 4HH9A 3OXSA 5ESVB 3VA2C 1F4AA 4D0DB 1R3LB 4JRXD 1R5VB 5ISZA 4MDJB 4KTEL 5EB9A 2HTKC 1DUYB 1A7RL 3SDXE 2Y6SC 4LEOA 1XR8B 5T3XL 5HI3D 1R3KB 5IEHA 3L3JA 5EH1A 4LPYA 5F1OB 3VMPA 3FN0H 2DYPA 2IQAA 5DMJB 5D9SA 2A38A 1RULH 8FABB 2BRRL 2X9XA 1OARL 1DN0A 4MXVE 2R2BB 3AU1A 2FYYA 3VXUE 4FOMA 1MNUL 2UWEA 2YPLA 2J8HA 1EJOH 3KHOA 2XKSA 4M93B 1JNLL 3PWPD 4UBDC 4NDMA 5FKPB 5L9DH 5JXEA 1U8JA 3H8NA 3QXAB 4Y4KD 2BVYA 4GW4B 4P5KB 3D3VE 3FZUC 5I8EB 5LQBH 2DQDL 2CO7B 1TCRB 2J8UB 4HWEL 5CKGA 4KK5C 1NEZA 4Y88A 5DJ0B 4Y4FA 1HHIB 4F7MB 1WF5A 5DTFA 1A1OA 1OSPL 1JNJA 3D5OF 1A6ZB 2W92A 2FO1A 3G6DH 2FCBA 2ZP0T 4ZS7H 4MCZA 4IDLA 4JRYB 3NIDE 5EUOF 4KKBD 4KK6D 4PIRF 5B8CA 1B4JH 1RZKC 4NWTL 1JPSL 3GMMA 5C0JB 3ILPA 5HGDA 4HUXA 4F57L 3O6ML 1QEWB 4PV8B 1CLYL 3FB8B 2AKRA 2V2WA 4MNQA 1BQHB 5J12B 4M9OA 2AK1H 3ZKMD 4OCSL 4LPXA 1TLKA 3O2DL 3WSQH 3UBXA 1P1ZA 1MCWM 1QUNA 2JELL 4N0UB 1D6VL 1RFDL 4XH2B 4LP5A 1RJZB 4ODSL 3QWRD 2NW2B 4JY6B 4N0UA 5KZCD 1OAQL 4P2OB 3B5GA 5D2LE 5J57B 3UAJC 1JF6A 5F7HA 1D7FA 3SGKA 4F8TA 3TZVA 3SQOL 1TVHA 3GGWA 2NMSA 3LQAH 1R0AH 2QKIB 3QEHA 4OKVB 3QXVA 3BIKB 3WUWG 1MAKA 2YUVA 3UJIH 4DKDC 3WMSA 1MFBL 1YYLL 2R1XA 2OTWA 1LVEA 3CSGA 3MRFA 5EBLA 4F37K 2PUQT 4M7ZC 3TPKA 5T1LD 4Y8DC 4PJXA 5I1EH 2Q8BL 4YFEA 4WDIB 1ZEAL 3BP6A 2YSSA 4KHTL 2UY7A 4MLSA 2I9LB 35C8L 1KCVH 3RGVD 3WS6A 2IADB 5EU4B 1D3CA 5DD6A 5EIIA 1KIUA 5K59F 3EHBD 5ECJE 3LPFA 3U1SH 2EEDA 4WFGE 2C1OB 3CC5B 5EFIA 4KUZL 3TO4A 1P84K 3S88H 1NBYA 5C07B 2G60H 4AQ1B 5L2KB 2NXYC 5AYUH 3MYJA 1T0MB 4JLRA 3GDBA 5D93B 5GS0C 2PYEA 2ZJSL 4J7RA 2UZXB 5TDOB 2VIRA 1OAXH 1MCIA 5C0BA 4ZUWA 1U91B 2CR3A 4EN3D 3S98A 4O2FB 4PGJA 3KXFA 1MRFH 1MFNA 1F2QA 5HYIA 1BVLB 2J4WL 5B38A 3LQMA 2EDRA 4XPTL 1VPOL 1J86A 3LN4B 3MV8A 4OM1L 1MNUH 3BO8A 1MF2L 4MQXC 4DAGL 4P3CH 4S1RL 3RI5F 3BO8B 4KI5C 1J0JA 2AABH 3BPOC 4N5UA 3EDJA 4RNRB 4IRZL 4YPGB 5FO7A 3OJDA 3WNLA 2WM0A 5EOCH 2XQBH 3FJTA 3O2WH 1HEZB 3MXWH 3IJSB 3MREA 2YS4A 5ESQB 5FK9B 2CDFB 5C07E 2FO4A 1S7SA 3WUZA 3NH7H 4FQLL 1KCKA 3KPTA 4WUKH 4L8BB 1T4KB 4GW5A 1M7XA 2FDBP 3BE1H 3QI9D 4HK0A 3ZE1F 3QIBB 1ES0B 2J5LB 1XGTB 4M48L 4NP4H 5IVZB 1ZLSH 2JJUA 5C0CA 2DL9A 4PY7B 3WO4C 2AEPH 3GI9L 3TP4A 1S8DA 3BDXA 1DLHA 2R0KH 3DTXB 1U8KB 2HFGH 4KK9D 4GRLD 4M7JL 2B39A 5JORA 4MQSB 5IMKB 5FGCE 4RFOH 4ZAKB 4ZUVB 5LCVH 1JK8A 5JORB 1A2YB 2CSPA 4K23L 4NBYB 2VDNL 4HHAA 5MERB 2DQCH 1VADB 1XGRB 3CFKB 1CLZH 3G5XA 1LD9A 4WI7A 3KLAB 1KXTB 4J8RA 3PWLA 5FYKD 5I1GH 1VFUA 4HIEA 4Z95H 1ADQH 3V0VB 4NKDB 4K94C 1DN2A 3RU8H 4Z7NE 4J4PD 1UYWL 3FOMA 4TPRH 4NRZA 2APFA 4P49A 2ZSVB 5DWUL 2X1XR 1IAOA 1ZS8B 2W60A 3GSQB 2VERN 4QRRD 4FABH 5I0DA 2A9NH 6FABL 3QHZL 5I73B 3DMMB 1MWAB 2FZ3B 1MWAL 2GUOB 4C4KT 2DD8L 4WFGD 4JZOA 1QEWA 1CDYA 2P49B 4LOUC 1G7MB 2ATKB 1IAIH 3GSRB 4K3JH 1FORH 3QUML 3DHMA 3T0EB 3UPAA 3U4BH 2FATL 5DEGA 4BSVB 3CVHL 3U9UA 3O2VH 4Q6IC 3MODL 4L9LB 2APWA 5KS9E 4HMDA 3U9UB 2V5MA 4M6AA 5HI4C 3OL2A 5F8QC 4NQEE 5GIRB 4X7CC 4P4RB 4NM4L 5ICXB 4P2OC 3L9RB 3NPSC 1GGIH 2AV7A 3MBXL 5I71B 1FZKB 3FL7A 1IGCL 3RVXC 1S9VA 1TZHA 5LQBL 1R3JA 3C5ZD 1OAXL 2VZ3A 4HWEH 1U2HA 1HK6A 1WT5C 3EHBC 5JA8B 3N06B 2IAMD 3TN0C 1CD1B 3P0VH 1OP3H 3HR5B 2ZNWA 1JGDB 3ARPA 4OM1H 3UTPD 2IADA 4FFVC 2VR9A 3MXVL 5DJCA 4KH2A 2VISA 5CWSB 3C6LA 1F13A 3WXVH 1AQDA 2GT9B 5E00B 2UVFA 2YXMA 3IJYA 4KGLA 2WUBH 3FB6B 4IIQA 3ZKNC 3WIIL 3UTTE 3DHJA 3VFWA 4CJ0A 4EDXA 1WISA 4FTVB 2CO6B 1YNLH 4OCLC 4YLQT 5E56A 4PJXF 4XVUD 1FFNB 1KFAL 1Q9WB 4FQHB 4RMQA 2O5YH 2NX5D 4HF5L 3BKJL 1BIHA 3BWUC 3DX7B 3C08H 3W0WD 1ZGLB 4UV7H 1BQHG 2DBLH 5D71H 3IU3A 4ZS6D 2QJDA 2X1WL 4AL8H 1QSFE 2WWKO 1KNOB 2XNAB 1EO5A 1KJMA 5IKCB 1MI5A 1S7VB 2BXZA 5GJTH 5JPNB 5C2BL 1U8MA 5F7FA 3HTLX 1UH3A 5CD5D 4FFWD 1EAJA 2NY2C 5ACZA 3H6JA 4D3CL 1EUTA 4I77H 2AXGB 4LASH 2YD3A 3DRQA 5B21A 4KDVA 3SQBA 4LRIC 5JR1H 5M7QA 1QBMH 4UUJB 1MJUL 3ZSSA 1P7HL 2XA8H 4X98B 3KWWA 1FRGH 5DQJA 4GXUM 3RJDA 5ESQA 4HPYH 1KN2H 4D0CB 1NPUA 2FO4B 3PHQA 1CFNB 4MX7A 5EUKA 3TJEH 5I30H 3F12B 4FQXA 5IHZA 4WWKA 4HQQH 3SDAD 1IEHA 1QSZA 1WBZB 2XPGA 4CBPA 3TZVC 3TNNA 4PPTA 3AMLA 4K9EH 4PREB 4RIRA 2OTWB 4RX4A 1MHHA 2M1KA 3O3DA 1N5YL 2CRIA 3DTXA 5BZDB 3HC3L 1VGEH 3I6KA 3DYPA 2IFFH 5IB4A 3QUXB 1FBIH 3O6MH 4M8VA 3P11L 4NPYB 5I1IH 2F54B 1A7NH 5DMYA 1O7SA 5SWQB 3LRSB 4LSQH 5SWQA 1CXFA 1A4KA 5C0FB 3JWOH 3NPSB 2MQ3A 3P30L 2R0LL 3CVHH 5EU6E 3CH8A 1BF2A 4Y5XB 3TO4D 1HQ4B 3IAQA 1U9KA 3D0LA 4WI3A 5CJBA 3G5YA 1X5JA 3MYJB 4OGXH 3BEVB 2O5ZL 1NAMA 1OW0C 3S4SG 3TO4B 4NRZB 1DQML 3HRZA 1UJTA 1WEJL 2IPTH 3B43A 3KPQA 5GQBA 3QUZC 3PF2A 2E27H 4K7PH 4LCIL 3HNTH 1W72B 3UJIL 4CMMB 3MZTA 3ULUC 3SKMB 1AKJD 5IG7B 1CD8A 1D9KA 5KOMC 4YUEH 2NYYC 4RAVA 3SE4A 2Q8BH 1HOCA 1NSNH 3J7HA 4QTIH 1C16B 2CLVA 1NCWH 4NC0B 1SJEA 3V5HB 1XF3A 4QEGA 3IT8D 3DBXA 1SYVA 3QFDB 4PRBB 5FO9B 5CIPA 2ZOLA 3QWQB 3SE8H 1PEZA 1UZ8B 4OCMC 5FO9A 1HQRB 2IC2A 5CGTA 2Z4QA 2R0KL 5DYOB 1T1ZB 3MRGB 5F9OH 2YA0A 2R8SH 4PJDB 1TVDA 2A9MH 5DJAB 1E4XH 3GKWH 4M7KL 2NY2D 2VO5A 3MLPA 4QY8B 4KJPD 3GBNH 1S7SB 5FO8B 4YXKH 4BQ9A 3RWJA 5D72L 4ZSOB 1ED3B 4OBSA 1HN1A 3ZTJG 4U6XB 4HIHA 5JPMB 1GZPB 5EU3A 4PRAA 4NRXB 4PJGF 1A9EA 5EOTA 5BRZE 2CGRL 1JNHB 3LN5A 3BGFC 4N8CL 5F96H 3RWFA 1U93A 1MY7A 3IKCB 1UB6B 3VWJB 4MHHI 2VWEC 4PJ5E 2F54E 5IMKA 5KSAC 2WWMC 3K8LA 4CU8A 1LP9F 1JPSH 5DUML 3H9SA 5SV3A 4WHCA 5C1MB 3W82A 3F7RA 3RIAF 2I9TA 2R29H 1CDBA 4KRNA 1JL8A 1NH6A 3U82B 3PL6D 2D0GA 4U05A 2H2PD 4JRXA 1EXUB 1FDLL 5EOCL 5GS2D 5IB2B 4V1DE 1WK0A 1T2XA 1HI6B 1AY1L 3GRWA 3MXWL 5DD0H 4KZDH 3CFJB 5J6HA 3MRQB 2FD6L 3S35H 4S0SD 1S5HB 3MRNB 1IM9B 5GRUL 1Q0XH 3F7YB 43CAB 3QUYD 3MRNA 4KUCF 4LRIA 4MLIA 5EUOE 4EDWH 3U7AA 1NAMH 3MV9D 4I1NB 4J3TA 5JW4R 1TITA 2I5YL 5IJVB 5TQ2H 1T1XA 4OGAC 3OKKA 1DANT 1CK0H 4OZIA 3LKPA 4I48B 1NCAL 3DPBA 3EO9H 5DR5H 3FT3A 5DO2D 1KJ2H 2R2CA 2VXTH 4Z7UB 3C5ZB 3MROA 2NY2B 3O11A 5LWYL 4ELKB 4P9HL 4KRPB 3ZHDA 4PJIE 3PV6A 3O11B 5KSUA 3BH9A 1Q8MA 1N6QL 4TSBH 4UT7H 5DC4B 4JDTL 4U1NB 4B41A 2FBJH 5BO1H 3SDDA 3VXNB 3MR9B 2CKBH 2HYMA 4OV5A 4I18B 1UZ6E 1OAYH 3GFUA 1P4LA 35C8H 3L5WB 3JVGA 4MMXC 4TPRL 3L95B 1S9VB 4J2XA 3TIEA 3W11D 4YBLC 3KYKH 5D7JB 2EEAA 5JW3H 3WO4B 3PIQB 4UTBH 1C12B 3WHE0 5SWSD 1WT5A 2PTVA 1NLBL 3U48A 1IM3B 3VD9A 4HBCL 5B3NA 3L3HA 2YSSB 4R90L 5KVDH 3LRSA 4YPJA 3DX9B 4ZPTB 2GY7B 1HYSD 4OZGB 5F88B 5EU4A 1KFAH 3ZYJA 4P3WA 4RDQF 2NNAB 3RHWK 5DSCA 4NOBA 4XP1H 1SYSB 2AABL 2C3GA 2HMID 4NUJA 3I85A 4AEHH 4FHBD 2XQYG 2OJZH 1OAUL 2BC4A 1S5IL 4NUJB 1JN6A 5DDHA 4JFED 5FYLD 2E9JA 1MH5B 1ZT1B 2VDKL 3OHXA 3QQNA 2BVTA 5FM4A 3KPQB 3KS0J 4WEMB 1FNLA 4HFUL 3VWJC 3EFFA 1QBAA 3GK8H 1D6EB 1IC4H 2P48B 3O8XB 4Z0BL 1MCJA 1P4BH 1ZK9A 4WO4D 1NCCH 1KGCE 3GMLA 3U0WL 4IRSC 4I0PA 5C3TA 3FB7A 4G9DB 3X3GH 2OI9B 5GISH 3FB7B 4G9DA 5ID0A 3NH7L 3O9WA 4LEXL 4TUJB 3BPLC 1WICA 1I3GH 4W81A 3CX2A 4YDIL 1L7TH 3SDAB 4PV8A 4YFLF 1QNZH 1HKLH 3D39D 3P77A 2AQ3A 3MMEB 3LEVL 3FFCE 4PBVC 3OKOB 5FCUL 3MJ9L 4NWUH 1W0YT 4EBQL 3ARQA 1EV2E 4U1SB 1WIPA 2F74B 2AJ3B 2X2YA 1OL0A 1FPTL 4MS8C 3RWCA 2CJUL 1IEAB 4RMRA 4V2BA 2YD1A 1GZPA 3F12A 5SWZE 5IHZB 4KV5E 4JPIB 5F9AC 1YY9C 3KLDA 4IS6B 3BFOA 3C60C 4L8BA 2R0WL 1X5FA 2APBA 2XXMB 2OXGA 3MV01 5J89A 1FNEB 4L3CA 4WHDA 1E6JL 3HZKB 4NCC1 1Q0YH 2ED9A 2AJSH 1PFCA 2X4PB 3EJZD 2JK5B 5C09B 2BK8A 4HLZG 4LASL 3NFPB 5MEQA 4ZODA 2PXYA 1WC7A 2NY1C 2J6EL 2R2EA 1EVUA 4M6NL 5D70H 4M1CD 2W0LA 1MQKH 4TNWK 4LPUA 1KELL 1VDGA 1F11A 7CGTA 3IU4L 1V7NH 1DDHA 4U31A 1GGTA 4LSTL 1EJ6A 1HXMA 1QP1A 1A02N 1RD6A 2FBJL 4PJ9A 4XPHH 3JV4A 3JWNC 2JF1A 1B0WA 3RWIB 4HT1L 5IW6B 1QFUL 1HZHH 3RAJL 4YXLH 3DSFH 4HQQL 4XRCB 2E7LA 4LLYB 5JQ6L 2P8LB 1ACYL 1AH1A 4L9LC 1UJ3A 2P8LA 1ZVSA 1T0NB 4TOYL 5DK2B 2ED8A 4RA3A 5FYJE 2J2ZA 2VDPL 2VDLH 5C0BB 5F9JA 4D9LL 5TF1L 1PY9A 3CZFB 3WJLC 5IOPB 1MHCA 3P11H 5I1IL 2VLRB 3VRJB 2H9GB 4LK4A 4ZUUA 1J10A 3M8OL 4FP8L 3QXWA 3DVNB 3MXVH 3VJ6A 2EEBA 2ZOLB 3TT1L 2HLFD 3DVNA 4BH7B 2PYED 4OIBA 4R96A 4ZG1A 3RJQB 1XF3B 4U1NA 4RGNE 3TN0B 1NGQH 1X4XA 4M7LT 5FYKU 3DX8A 5I66A 4OQ1A 1B3JA 1NUNB 1IGML 4I18A 4P2OD 1J5OL 4S1QL 3N1PC 4XP9H 4HUMB 4N9OB 3VW3L 2Q7YA 2O5ZH 5DJZA 3SO3C 3C5JA 4D0BA 3HMXH 4LLWA 4IJ3C 1R3KA 5IEHB 1JZ6A 4O9HL 4KKBC 5ERWA 5E2TL 4L4VD 3NCCB 4TVPL 4WHTA 3MGTB 4IRSD 3B9KA 5EU3B 3VXUD 5F44A 4DQOH 2F58L 1CL7I 4HKZA 5BVPL 5DJXA 3RDTC 5IV2B 4B5EA 2OM5A 1MUJA 4N0FB 4XAKE 1BMGA 3CSYB 4TSAH 3D0VA 4NDMB 4Y16C 3HUJA 3S5LA 4GW4A 2YPLB 3D2UD 1JWSA 1R24A 1AHWA 1LE5A 1LNUB 3H3BC 5CWSA 1Q94A 4UQ3B 5HHQB 1Z2KA 4X99A 4QXUL 1IGIH 2YPLE 3J8F7 4QT5B 1BJ8A 2CIIB 4ODXB 2VYRE 5IB3B 1JZ3A 5IT2L 2IANB 4YEFA 4GXVL 4XTRC 1I75A 4D9RD 4PR5B 4WFEE 4ZOAA 4JGJA 4PJDE 4OI7A 3QNXA 2BY1A 5DEFA 5DXWA 4ZAKD 2QADB 4PBWD 5BV7L 2R2HB 5TH2B 1MJUH 3EGSB 3NCJL 1A6ZA 3ZSTA 3FMGL 4FQHA 3OXRA 3QQ3A 1YEIL 1P69B 2CGRH 4PJEF 2FX8L 2OTUA 2EIEA 4XBEL 1AGDB 4OZIB 1R3IH 1WFTA 3QIBD 4JZJB 1VSCA 4K3DL 4YEEA 3IRZA 4Y5VA 1LO3H 1KT2A 4PRPA 2NR6D 3WFDH 1JV5B 2RFXB 1JPFB 2EIBA 1D5XA 5LCVL 4AENB 5C0EA 2PYFA 4HC1H 4X4XA 2OR7A 4UUJA 1EVTC 4R8WL 4GBXA 2XICA 4I3RH 4RWYH 3HRPA 4PJCF 4LSVH 4H1LA 2XI9A 4LU5H 1ZLUK 2JTDA 1AXIB 1DL7H 5ADPH 3SDDC 4LQFL 5E08H 4UTAH 4H1LB 4X4ME 1AJ7H 3RWDB 1YQ2A 2YD6A 3T1WA 5BJTB 5TF0A 1U42A 4PRDB 1H0DB 5CGMA 5IR1B 2NY6C 5IQ9A 1LEKA 3TA3D 4XMPL 3K4ZA 4OGAD 4RIRB 1U8LB 5IIEB 3P9WB 2A0LD 4G42A 3BOVA 3CMOL 4F7PA 3TVMB 3WKML 4BJLA 3MOAL 1K8DB 2AV1B 4EN3B 1FNHA 4GG6A 5D5MF 1NCUA 4KUCD 3WO3B 5GRVK 5JIPA 3H7BB 4LDEB 4M7ZB 5FF6B 3SOBL 1TETL 4TULL 4OLWL 3PP3H 1F58H 5D8JH 5E70A 3ZTJH 2XYCA 3TWCH 5ALCH 5L2KD 1MCPH 3MJGX 5DVOA 2GJ6D 5AZEL 1SYSA 5F9DC 2NY4D 1C7SA 3GMRA 1GXEA 2ADGB 4HKJA 1CCZA 2QR0A 3T3PF 4K8RD 4NHCL 3I3DA 2BNRB 3VWKC 4NQVB 4PRHD 4JFOB 4NN7B 4K3EL 1MCWW 3IFOA 4XB8A 2PKDA 2WWMD 2XY1A 4NT6B 3Q48A 1VESA 4ZDHB 3RGVB 5TDOA 2O5XH 4RMUA 3U36B 3PDGA 3WNPA 5T3ZD 3H9SE 3ZDYE 4U0QB 4UILL 3GNMH 1K6QL 1CGSL 2ZPKL 2W0KA 5K9KA 1JRHH 3TESA 4HULB 3UDWA 1ONQB 3GSVB 1DBKH 4AT6B 3BI9X 3MACH 5IBUB 4HUVB 4G8IA 4LSUH 4R2GB 3IU3B 4WENB 3ABZA 3JWOC 5I76A 4P9ML 4GS7C 5D1QC 3WE6B 5FDWB 3CVIH 2XZZA 2E6JA 4KVNH 3LZFL 2VE6A 5ESAA 5FO7B 4N0CD 3UTPE 1RAMA 3QRFM 5C6TH 1CI5A 1ZSDA 5LGHH 5ISZB 5IVXF 1S78D 1RK0B 2Q7YB 3MMEA 4ZPVB 5DC0A 2V9RA 4U6HA 3SGEI 5JW5B 3NFNA 3OKLA 3OKOA 3ALXA 1IC5L 1M7DB 2CK0H 4XC3H 4PGBA 1T20A 4LSSH 2YR3A 5J3HC 4OV6F 4E41E 3VXOB 4KQ3L 5AG9A 5HGBA 3DXAB 2HJKA 3H42H 4HGWA 3MV8D 4P2QB 3W9EA 3IXAA 5JNYB 4N0FA 5I1GL 5AD0A 3BH8B 2Y72A 5HYJD 2XZCH 5JNYA 1PX3A 4LEXH 5DK0A 4I0PD 1OGTB 4KY1L 5FKPA 5E2JA 2AP2A 1KIRB 3GIZH 4GRWF 2ZOKB 1T21A 4X9HA 5LXGL 1NUFA 2NY5L 2LFGA 1K2DB 2GSIA 1N6QH 4HHAB 5MERA 3U1SL 3MRMA 1DVFD 3WKNA 3ULUF 2Q20A 5DR5L 4K07A 2GSGA 3RNQB 4MNGA 4YHOL 1TNMA 4LLDA 5DVMA 1Z5LB 4KK5D 4W6XB 3VD5A 2RR3A 4MCZB 4JCLA 4LPTA 4PYHA 5BW7C 4XPBH 4QCIB 4EI5A 1R5IB 3QPQC 3QPQD 3D39A 1HH9B 4UT6L 4GAGL 1MQ8A 2CRZA 4RRPA 1G1YA 4M00A 3GMOA 4XP9L 3QCVH 1VKXA 1HILA 1AGCA 2ATPB 4WI4A 1I3VA 4RBPK 3WS3A 4HZLA 2C3XA 2K7PA 1FL5B 3MCKB 4JPKL 1CBVH 2ARJB 1X5HA 2WSKA 3UBXB 1PZ5A 5BMFH 3AVEA 4ORGA 4YWGH 5CP3H 5FUZH 1MEXH 3DBXB 3VXRE 4YHZL 3QIUC 2KDGA 3MRLA 5F9WC 1QLEL 3P4NA 1RJYA 5C9KA 1FCGA 5BQ7B 4KDTC 3N1GC 3RPIA 3MV7E 3MJ6A 3P4NB 5IFAL 3ULVD 4LSDA 3WL9A 4HUUB 3BQUC 5D1ZA 3BIKA 1TTFA 4W70A 3C09C 4HUNB 4OZHA 3O6KL 4EXKA 1G9NC 4GG6B 1JRHL 4CDHA 2RQ8A 3U4EA 5DGQA 1WTGT 4WFED 3ULSB 1KPUB 3NA9L 4F15C 3FO0H 1MVFA 4GW1B 2X9YA 4JHBA 1KPUA 5F6IC 2CPCA 4QHUB 3UO1L 4GW1A 4R4BB 3ES6A 1FQ9C 4R4FL 1GVIA 1S9XB 2ZWLT 4UNUA 2OSLA 2P42B 4K7FA 3CCHB 2DJ4A 3FQUB 1DSFH 1AO7E 2MQCA 1B0RB 4LSPH 5HHQA 2YBRB 5BOPA 3BKYH 3RHWF 4EBQH 1KXQE 4P59H 1E28A 4AM0A 5C0IA 2XKUA 1I9EA 5E0QA 4NFCA 3RFZC 4G8FA 1FO0H 4UDUA 5D5MA 3FO2B 4X7DC 1YPZF 4YHKL 4J3OC 5C8JB 1XGUA 3SJVE 3T2NH 5M94B 3KAAA 1I1AA 1L7IL 5CJ8A 1OP9A 1BQSA 1F4WL 1ZT7B 1QLRA 3CX5J 1NCDL 1NUGA 2V5TA 2RAMA 1IFHL 4GQPH 5EN2A 3RNKA 5F1NA 2H41A 1KEMH 1T5XB 2XA3A 2QQLL 2ZUXA 1CLOL 5I15L 4WRLA 5IBTL 4OLUH 2X7LB 4PGDB 1XR9B 4TUJA 4M3KB 5ANME 3Q6GH 4K7PY 4M1GH 4Z6AT 1IAIL 4GBXC 5JW3L 5INDA 4F9PC 4ZO8A 4R3SB 5CEZH 5D1ZD 1Z9LA 3DV4B 1HDMB 4OLEA 5IQ7L 1NBZB 4I13B 2P5WD 3CPLA 3S35X 5DJ2A 3SN6N 3L5XH 3PWVA 4LOUD 4P2RA 3AY4A 5IK3A 2VLJA 3U0PB 2EICA 3OF6A 3O9WC 4WCYH 4MJID 4KFZC 2VLJB 3VFGL 1EEUA 1UKQA 3QCTL 1FJ1A 2DMBA 5EBLB 1EUUA 4XPHL 1S8DB 4WU7B 2P5ED 3QIWB 5CLWA 4CU6A 1JZ8A 2VXUH 1BLNA 2D9CA 1EFXB 3V8OA 1U3YA 2R2EB 3RUGB 3R0MA 3RL1A 3DGGA 1T22B 3WFHA 3D85B 4TOYH 5BMFL 1A6PA 2ITCA 1ZXQA 3F5WA 3SKNB 4U33A 3WLWC 1MEXL 4EEEA 5JOEA 1Q9OA 3F8UB 4NFBA 4PTUA 4XBGA 3GSXB 2HT4C 1HQ4A 2D03H 3TA3C 3C60A 4DFHA 5IMOA 1U8OB 3ZE0F 5GJSL 1K5NA 5IMOB 4ETQB 3KNBA 2W60B 3NZ8B 3BMVA 3LV3A 2IPKB 3RVTC 3TEUA 1NKOA 2CIKB 2R56L 4GKZB 1L0XA 4XPFL 3HUJE 1MCQA 3AS0A 3INUH 4L4TD 1UJ3B 3ZZ1A 4Z8FH 1B4JL 1ZVHA 4RAVB 3C6LC 4AG4L 1PSKL 3BYTA 4PP2B 4E41B 1UQSB 5ID1A 5BVPH 3PQYA 2H8PA 3GJEB 4LVOC 1SBSH 4OD1H 3RTQD 4Z7WB 4PG2A 4NZDA 4S1SL 2HLAB 3GSOB 4O9HH 5IF0B 1XF1A 2WIIB 4WNQB 2F8VA 1I9RH 3V8CA 4L29B 2FECL 2OJZL 3V52H 1FGVH 4U1KA 3MZGB 1BWWA 3DUUA 4R7DA 1ORSA 3MRGA 5I75B 1WIUA 1NEUA 4PJBB 4XWGL 4O51B 4U1JA 5KVEL 4P59L 3JV5A 3MLTB 4ZXBA 3O41A 3LDBC 3QBTB 1NANI 5KS9F 5CINH 4G6FB 4CRPA 1QLFB 2QTEA 1RQ5A 3RDTD 4LLAA 2P1YA 4QF1A 1RIUL 4E0RA 4UB0L 1A0QL 3DO7A 1KCSL 2B1HL 4FXGA 4GMTH 2VLLA 4I2XB 5EG6C 1P2CA 4K2UH 4YHIA 1CLCA 2X4NB 1NC2A 1T83C 3MO1B 3SDXA 1QACA 4F7EB 2OQJB 1YY8A 1MUJB 3WFCL 4XNUL 4KJWD 4OLUL 3MRDA 2W65B 4LSQL 3BZ4A 4APQD 4JRWA 5E2UH 1G6RB 3D87B 4ONGH 5CAYB 4FRWA 2ZG2A 5ABDE 5T1MA 4FTVA 4ZOCA 4KI5D 1BBDH 1OLZA 3ARED 5L0QB 2J8UA 1E4XI 3T09A 3VFPA 4WUUA 1G0DA 2VR5A 3CFJA 5JHDD 2B2XL 1F42A 1RZFL 3QHTC 2K1MA 3HAEB 3LIZL 4X5WB 3SJVD 2CLZB 2AJYH 3HG1E 3KPRB 5L7XH 5EZIL 3HAEA 2AI0H 4X5WA 5F7UA 4G9FB 4LGRB 1BFSA 1KUMA 4H0IA 3KPRA 1MWAA 5CEZE 2HVJB 2JJWA 5C71A 3X12B 5J6GA 3ARVA 5CBAA 3WXWH 1FL6A 1I7UB 1A6TB 4M1DH 3IDUA 4X7SH 2P24B 5HBBA 2AJZB 3TCXA 5BOZG 3FQNA 3GI8H 1GZQB 3S37L 3CGTA 3QISA 3UEZA 4TULH 4U1HB 1JV5A 1MPAL 2M2DA 4OF7A 4P3CL 4S1RH 1S7WA 4B53A 1IGTB 1HSBA 2XQBL 3MLSL 1YJDL 3O2WL 4LLMB 1W8NA 4MZ2A 3LKOB 1IGTA 3FAWA 1UA6L 4IOIB 4OB5H 1K4DA 5BQ7A 3TYGL 1T80A 3EJZC 4P2RB 2YK1L 3RGHA 3JSSA 5DLMH 5DJZB 4U1LB 3GKWL 4U2ZA 3BUYB 3EKCA 1B6UA 4GRMA 5HHME 1RIHH 5DD5L 1TVHB 2D4DA 1HCFX 5E6IC 1G9EA 5D7JA 5DI8B 3WIIH 5FOBB 4NOFA 4KVCL 4JFFD 4MJ2A 3P73B 1PSKH 3H9HB 4PRPD 2CRYA 2EE2A 1XIWC 1C12A 3CZJA 3F6IA 3KPSD 1DJSA 1HHGA 4X5XB 4PJCA 4PJ8D 3F7QA 1AC6A 4L8SC 2JCCB 1P4BL 2NX5E 5C0AD 1CGYA 4HS3A 3BGMB 1S7QB 5C0GA 3QFJB 4QHMA 3V79C 2AJVH 1UM5L 5GGUB 4F80A 1G7IB 1X5AA 3OJVC 2Q76A 5KANG 1IT9H 1CQYA 2J5LC 4AY0A 2MOVA 5BS0A 4G6ML 4DAGH 4QHNB 5HGAA 4FFZL 3MJ9A 3NCEB 1T89C 2Y1VA 1NGWB 4QNPF 4PR5A 5C0IB 5C6TL 3P40A 4JZNA 3B3IA 1KGCD 3T3MF 1F3DJ 1BEYL 4BZ1H 1KLGA 2VNCA 3U36A 1EFQA 2AVGA 4C56D 3WD5L 1QFWI 3NACL 4XI5D 3MRIB 3UX9B 4JM4H 1MCEA 1RV6X 2N4IA 3TYFB 1U8MB 4EI6A 4EJ1C 2XTJD 1V8HA 1S7UA 4RMTA 3LY6A 3D48R 4WY7L 1JHTB 5H2BB 4OIIH 1KNOA 2XNAA 5GGRY 4JM2B 5T1KB 2YRLA 4CMHC 1U95A 2VLJE 5M95B 3FQWB 3N85L 3IJHA 3ROOB 4LQ1A 5INDB 1D5XB 3S34L 2P43B 1KCRH 5FYLL 1QBBA 12E8L 1HQRA 3TV3H 1X6LA 5DD1L 3KPOB 5KSBB 2PW2A 1P1ZB 1F8TH 2VLKE 3G6JA 3L3KA 3OKDB 3PWJA 1NMAH 3L3IA 4WI5A 5FB8A 2DDQH 3OB8A 4JO3H 3BJLA 2FRGP 3ZDYF 3MUGA 1JGVL 4LFHD 4BQCA 3PHQB 2AJ3A 2Z0BA 2HT2D 4UINL 2ZKHL 2Y9RT 1OPGH 4ZO6A 2HKHH 3V4UL 4HAFA 4M7LH 3DO7B 1GL4B 4JFFB 4FQ1L 2DBJA 1IZKA 5EO0A 3U0PA 3O9WD 2FX8H 2JJVA 3FB5A 4U6YB 3EAKA 3B83A 4DKFH 4OUUB 1MI5D 4HK0B 4Q74A 1CDJA 5DK0B 4Z7VB 5IVZA 5C0CB 3HZMA 4LCUB 4BFBD 5I18L 3BH8A 3QIWC 5C6WH 5ANMA 1KB5L 4LL9A 5D7KE 5L9DL 4JO4H 5IVXE 3PDOA 3NIDF 1JTOA 2Q6WA 2YD9A 4QTHA 1ZHKA 4CVXA 5I8OH 5CIPH 2DLFH 3P4OB 3WFHB 1T2QL 3KLAA 4OFVA 2J8OA 1DBKL 4YAQB 1QVOB 1YEFL 2DIBA 2YKLL 1K4CA 3C8DA 5E6IB 2YWYA 4XPTH 2HN7B 1S7RA 3T77A 3ZL4H 1J8HD 3K46A 3VDCA 4RGOH 3VDBA 3PE9A 1AO7B 5IHBA 2NTSP 2VABB 1F4YH 4YX2H 4PB9H 5HYSG 5KVGH 4L8SB 2UY6A 4NO2B 3PWUB 4XNYH 1SJHB 3G5VB 1VENA 3U0WH 4S2SB 3RWGB 2MNUA 2QSTA 1IAMA 1W72A 4MA1C 4O2FA 3KXFB 2FZ3A 4WU5A 4F33A 4AK1A 1JHKL 3O3AB 1DE4B 3SJVB 2A2QT 5L88L 3K80A 3SOBH 5L8JB 1EZVX 4KI5F 3BD5A 2MSPA 4P2QE 1LEGB 1CXHA 3RBSA 2BSSB 1KJ3H 5JA9A 3ZT6A 2ENSA 3K0WA 4C56B 3DV6A 2J7LA 4L8CA 3VFTB 4QRQB 1S9KC 1QBML 2EDQA 1JJUA 1UACL 1ZT4A 3F7VA 4GMTL 4H8WC 4HC1A 4IHOB 4U1JB 5K9QI 2ARJQ 4LBEA 3EOBA 5EDXA 1KJVB 3BUYA 4ONFL 4WI2A 3RWEB 4MD0B 1BX2A 3QDJB 2YN5A 2DI7A 3GEWB 1N59A 3PHOB 2ZNXA 4FFYL 3EOTL 4Y1AE 4JKKA 5ALBH 2VDOH 2X4SB 5EZOH 1P7QD 2I60L 1CLZL 5IP4A 1H8NA 4QRRA 4IOSD 2DTML 4I5BB 4F3FA 1CVRA 2BVEA 4WW2C 2VLLB 4PY7A 3RWFB 4DUXA 3HG1A 3VH8B 1W0WB 3QNZA 3CCHA 3VCLA 1PKOA 1S7QA 1EHLH 4MD4B 1G7QB 3MV9E 1RIVH 3E8UL 4G5ZL 4JAMA 4M6NH 4MMZC 2BJML 4NN6C 2OSLB 5E24E 5GRWA 4J12A 4XVSL 1KELH 1UWGL 3IDMB 4OGXL 2EDXA 1F4HA 1TPXC 1IZJA 3VG9B 4UNVA 1CLOH 5I15H 1SMAA 2OBGA 1S5HA 2FJFA 3VXMD 3ESUF 4Y2DA 4HWBH 1R5WA 4WUUB 3D9AL 1A5FL 1UJ3C 4WHYH 4E41D 4NNXA 4UIKH 1QSFA 2EDHA 2XTJE 4LPCA 4A6YL 2A1WH 4G8GB 4X4YB 3ARZA 1YEGL 1H9VA 5E1HB 4MA8H 3NABH 4RAHA 2JIXA 3V5KA 3STZA 2XKNB 3KPLA 1R6VA 1G7JA 4HWNA 5GS1B 2IH1A 2LTQC 3M8OH 4IRZH 2VSCA 1FHGA 4LLMA 4DZBA 3EIFA 5JHDE 3CSBA 5CZVL 1UCTA 2XN9B 1YZZA 1NC4A 1HDMA 3G6JB 3PWJB 2DQTH 3QQ4A 4X6CF 2P5EE 2Y23A 1XT5A 4P2OA 2NPLX 3RKDD 3IDYC 5JHDB 2EYRA 4R90H 5KVDL 3ZE2F 2PTUA 2WQRA 3MUY1 1YEEL 3UO1H 2EDNA 4OV5B 5BJTA 1JZ4A 3MLZH 3DI3B 3WN5B 3FN9A 2FJHA 5FDYA 1JHLH 4UI2A 3FB5B 2J88L 1L6XA 3CLFH 3WCYA 4UT6H 4APQB 1FZKA 4RFEA 2PO6A 3VFUB 1A1NA 1FV1A 4ZNEA 1RVFL 3DYOA 2A73B 5IVOA 4U1MB 3OAZK 5DUMH 2DM7A 4KPHL 3TJHC 4EXPX 3O4OC 1JHKH 2FIRT 3D85A 2ZSWA 5L6YL 1OGAD 1IC7L 1RUKH 4NUGH 5FF6A 4XP4L 5E2WH 1AD0A 2B20A 4YWGL 3CFBB 2D7TL 5JIIA 2VLMD 1VB9A 3LQAL 1G7IA 3KLHD 1R0AL 1PGRB 4MHHG 4B50A 4QHMB 4FTVE 4G6FD 4X9BA 2W9EH 4HS6A 1T7YA 1MF2H 5IWLC 1WLHA 3QG7H 1QKZH 4FXKB 4Q9BA 1NBYB 3IGAA 1QHOA 4OLXL 3QUZA 3T04D 1XIWD 3HRZB 2EXWD 1Q0XL 3GMLB 5HHOD 5K9KB 2X4RA 3RRQA 2JLLA 4OF3A 2IGFH 3O8XA 2IMNA 4QXTB 5I19L 2BERA 3WLBA 2LE9A 1FLRH 4TUKL 3VRJA 5J9PA 3W81A 1GCFA 3VWKD 4PG9A 1YEKH 5LAXB 3FRPG 1WZ1H 4Z7QE 1MJ8L 3F58H 1CLYH 2VXTL 4D8PA 1T5WB 4PGDA 5B4MD 4L4TB 3ULUE 5IF0A 1T3FA 2NY3D 4JE4B 3IFLH 4DGVL 5L8KB 4N8CH 5F96L 3MBEC 2F15A 3S37X 5BCAA 5C3LD 3QIUA 4M5ZH 4LCWE 1FNSH 2BDNH 5KSBE 3O0RL 5BVJB 1FVDA 2YD2A 3VGFA 3GIZL 1SHMA 3OKEA 4GAYB 3PABA 2ZCHL 4LAQH 5DJYB 2V2XA 2ADIB 2V9QA 5EWIH 3IXAB 3QA3B 3MV7B 4M62L 4DVRL 1C8PA 4WY7H 4MA8L 3F65A 2UWEB 1EFXD 4UAOB 5MEQB 3I6KB 3RU8L 1GSMA 3P0GB 4HWZA 1MJJA 2WUCL 4FFVD 3QIWD 4ZNEE 5I17B 1FL3A 4NZRH 3UTSB 3RL1B 4JO1L 4MJIB 5E4IA 5HDLA 4EVNB 1N3NB 3AS1A 1EO7A 1YJDH 3MLSH 4KHXH 4P2YA 3UYPA 2FIKA 3SGEH 1K2DA 1J7VR 4N1HB 2NY1D 4NQEB 1AO7A 2VR4A 2P5WB 1AGBB 4FG6C 1CBVL 4KJWC 3M1BB 2YMXL 3ZMRA 1FO0A 1G7HA 3I75A 4M7JH 4UINH 1AGBA 5TH2A 1LGVA 1OPGL 1Q38A 1RHHB 4OTXH 2ERJC 1REIA 4P48A 2EDYA 5IFHH 5DRWA 3LPWA 4OLVL 2AERT 3C08L 3S3SA 1UZ6F 4WCYL 4M61A 5F72S 1FYTD 2IBZX 4XPAH 1TJHL 4U0RC 3IETA 1FSKC 1F3RB 5C2BH 1P7QB 3BVNA 3RY6C 1N7MH 4PRIB 4LLUB 3UXFA 2BNQE 5AZ2H 4IJ3B 1MRDH 3MA7B 3CXHK 5DZLA 4Z0XA 1HHKA 4MNQB 5I71C 4JJHA 1QNZL 4FQQA 4OQTL 5EU6B 5EPMA 5B8CC 3QIBC 3ROLB 1FFRA 4XHJC 3RPKA 1RU9L 4JN1H 4KV5F 2AK4E 3UYRH 4GSDL 4JFYA 4PRPE 4WTZA 4PJ8C 3MGOB 3DROA 1ORSB 5LBSL 4P4RA 3VE0A 1CGUA 1F97A 2C4FU 4U2YA 3I9GL 4ZSOE 3RPIB 3WXVL 3STBA 3WL9B 4R26H 1BREA 3HLAB 3C6LD 5CJXA 1U8PB 4P5TA 4OCSH 3HMWL 3QXDA 1YMHB 1A3RL 1PY4A 2VLRE 1J9CT 5AWNL 3VXME 1S7TA 3VFMA 5MI0C 2X4SA 4KZDL 4NBXB 4U49A 4I2XA 4X5XA 3WNMA 1P4IL 4XMKL 1OD7A 2MHAB 4ZPTA 1YEKL 5DUBB 3C5SB 5L2JA 1YECL 4OZ4B 1AO7D 2LABA 4XAWH 1BOGB 4UQ3A 3HUJB 4GQ9L 3S5LB 4QT5A 1FGVL 3E0GA 3ZYOA 3QJHB 5KSVB 2CDGB 1HWGB 3OTTA 1NCBL 2RCSH 2FJFB 1D5ZA 1JGEA 3KYNB 5DURD 1NGWA 4YXLL 3BDYH 3QUZB 3MCLL 4KKCD 1LK3H 5BS0B 5J6HB 2A6IA 4F37F 3DRTA 2OR9L 5D6DA 1ZLVK 4JR9H 3EFFB 3HZVA 3TBTB 2JB5H 1U92B 3MNZB 1EEZB 4WWID 5F7DB 3T1FA 3OXRB 4KMQA 3WDHA 5GS0D 5I76B 4KMLB 4Z77B 1IBGL 2DRUA 3V6ZA 2NW3B 4P57A 5FA3A 4Q2ZB 1WBXA 1FL6B 3STZB 3BN9D 2F8OA 4M7LL 2X4QB 4NKMB 4PLKC 1CTOA 4JPKH 3QJFB 4FP8H 3P77B 4LSRL 3SDAA 4OD2B 4X7TA 3K1KC 1T83A 4AH2B 4XVTL 4NQCB 3MV11 2G9HB 2NY4B 2Y7QA 1MCDA 4R3SA 1MRFL 4X9FA 4FZEL 4LHJB 3D69B 4XH2A 2VQ1B 5F1IB 1KB5H 1CT8A 2R1YA 3CH1B 2NY0D 4JKPH 5B39G 1ZHBA 1EERB 3U4AA 5KVFL 5EU7E 5T1KD 1IEAA 5KN5A 1OB1A 4MAYC 1LILA 1WBZA 1XAUA 5HHNA 4AQOA 3MPCA 4WW2B 1A7QL 3PG2A 2ZZUT 3NABL 1CFQA 5D1XB 5DHYB 3CVHA 4LCCA 2E9IA 3VRLF 4TSAL 1FH5L 3BP6B 4WU7A 4MDIB 3JUYA 4U1MA 2A83B 2DM4A 3CFCL 3RX5A 2IF7A 4UAOC 3NA4A 4Z0BH 4ODVH 1M05A 2Z31A 3S36X 2F53D 4XPGH 2PCPA 3DXAD 4GRWE 2YD5A 3OBAA 5D1QA 4YDKL 4F2MA 2Q3AA 4X80L 3SO5A 5E9DE 2M8XA 2MJWA 4DCQA 1H3VA 3CFEB 2XOTA 3QFJD 4XVJH 3AAZA 3EZJB 3CX5K 5C07A 4NNYB 1QRNE 2HRPL 1T0MA 4F7TB 1WZMA 5C0BE 4F7CA 5ISZD 3CXDH 1NFIA 5HDQL 1XCTB 1OGAE 5GHWL 3MJ9H 1ZVSB 4LVHB 4H20H 2DS4A 2AAVA 1FYHB 2H8PB 3B8YA 5JO5A 2BNUA 2DDQL 3VXPB 2XWJA 2J8UF 1C16A 2QADD 3BT2H 1P5VA 5L0QC 3UTOA 3GSRA 5IVNA 3UZEA 2C9AA 1PQZB 4GT7A 3D39E 3SDCB 2IAND 5HXMA 3LKRB 2ADFL 1J0YA 4PLJC 4ALAH 1VHPA 2YEZB 1MAJA 2AJVL 1D6VH 3SDCA 4NO0A 4OI9A 3DSNA 2J6EA 4D9QE 4RWYL 4L1HA 4UBDD 3TN0A 2CKBL 5JQHC 1LP9B 1H3TA 3TCLB 2AJSL 2YPLD 2ICWI 3OKDA 4XNUH 3E2HB 1HYSC 1FAIH 1T4KA 4GW5B 4ZSOA 3ARRA 5IGXL 5I30L 2NLJA 3PNWB 4YQXH 4UOW0 1XGQA 4LKCA 5JUEL 2D0HA 5CZXC 2EDKA 3NACH 1MAML 2E6QA 4JPIA 4OSUL 3HS0A 3ULSA 3BSZH 5CEXB 2G75A 1MCNA 3U7YH 4DTGH 2VLKB 1BBJB 4PJXE 5A43C 4ODUB 4I5BA 2AXFA 4QLRA 1C08B 1JMXA 2FYYB 4LRNL 2YUZA 5EZIH 4WV1C 1NGYA 5D2NB 1GHFL 3RWHB 5AZEH 1UEMA 2QQNH 2X9WA 3X11B 5MHSE 4LNVA 3WNKA 1ZHLB 3RZWA 1PLGL 2C4FT 4JEGB 3GB7A 1F11B 5IESH 2GSIB 2BRRH 5EBMB 1IGFH 3M1BA 3NZHH 5MP6H 5DMKA 4I3SL 1HHIA 2OP4H 5DO2C 1FFNA 3QCUH 4F7MA 3MX0A 3O0RH 4V1DB 1G9MH 3BKMH 1UXWA 5DEFB 3SDXF 3T77B 4Q97A 3FCTA 3ECBB 4I0KA 3DIFA 3E6HB 5I16A 2ZJSH 1JCKA 3DIFB 3X12A 1GC1L 1R5IA 3INUL 5K9OB 4GBXD 2H32A 3O4LA 4OCYL 4ODHL 4GUPB 3DURA 2X4OA 1E4KA 4M8QA 4CVWA 4WU5B 4F33B 3VGGA 4OD2A 1DUZA 2X42A 3RY5A 4NQCA 2IH1B 3MBEB 3MLVH 4HIXH 4EQ2A 1CFVL 1I7RB 1GIGH 1GRWA 4IRJC 4IRJD 1KC5H 4IM8A 3ARBD 4PJIB 3M17B 1MWAH 5ICXA 1UENA 4KMTL 2XPGB 4OLXH 5HHMD 1IGJB 3VE0B 4M7KH 2X1QA 4PJAE 4Y4KA 2VZVA 4MD0A 3I50L 1SY6A 1VFBA 4OGZA 1RMFL 2FJHB 5HJ3A 1BD2D 1IEBA 4X6FB 5IIEA 5B4MC 5EZLB 3VI4E 3TBSB 2IALB 4LIQL 1YDPB 3KPSE 4E42A 1A7PH 4HPOH 3ZTNL 1I7TB 3TFKD 5TE7H 3P73A 1RJCA 1CD1A 2NZ9C 2WBJA 4BFIA 2J6EH 1OAYL 1QFHA 3FQRB 4U7KA 3DVGB 3HPJB 4IRSB 1JZ2A 5DQDH 1W0WA 2DQHH 3QNZB 1P53A 1Q9OB 5GPRA 1BZ7B 3GSNL 4Q58C 3MGAA 1UM6H 1JN6B 4HKJB 1JWSB 5DDHB 5A3ID 3B5HA 4U6TA 4XBEH 1MFBH 1JIBA 3W9DA 1T1WA 3L7EB 3IFPA 4G7VH 4G8FB 5IROA 2BDNL 2Q76B 3BPNC 4QRSB 3LZFH 1TXKA 4YDIH 3RY4A 2NYYD 1QSED 3TBTA 3ULUD 4C56E 4R26L 1EBAA 2IAMC 3TN0D 1ONQA 1U91A 1VERA 2PYEB 2ADJB 3MJ7A 4POZC 3KPMA 4PP2A 1X5ZA 2BOBA 1Y6NR 5CZXD 5ID0B 4LU5L 3QQ3B 4ORZC 4X6DE 2FR4A 1CU4H 3D3VA 5DC9B 2GYSA 4L8DA 2C1PB 2Z8RA 3TA3A 1ZV5A 2CJUH 1CK0L 3LSOB 5ICYA 4JJ5A 4XCFL 4YHNB 4P23D 5A1AA 4LLQB 4N9GB 3DRQB 3QFDA 1EAPA 1URLA 3TPUB 3UBXI 2XT1B 4NN7C 2AXGA 3AGVA 2X4QA 4NKMA 1NFDB 1K85A 2WINA 4M62H 4DVRH 3IFNL 4JREB 4RAUA 4ERSH 1NMBH 4BSWA 1RK0A 4QHKJ 5A2FA 5FYJD 1UA6H 4MVBC 2Y6SD 4I8DA 5IMMB 5DZOA 4ODVL 4NM4H 4NUGL 1HSAB 3ARSA 4K9EC 4NRXA 5EOTB 5HHNB 1VACB 2NY7L 1INQB 4KWUA 3TT3L 3T0AA 3R1GH 4HD9A 2NXYB 5IBLD 3Q1SL 3TVMC 3LKQB 4PTTB 3RAJH 5DT1H 5F9OL 1FFOA 3OF6D 3QDME 1E4XL 1UB5A 2VSDA 3WDIA 1QYGL 1NLDH 1AI1L 3P4OA 2B8OT 3HE6A 4XP1L 3TBYA 1QSEA 4BQ8A 2Q6WB 5C08A 1IKNC 1A4KB 5DZNA 5HPMA 1FZJA 4H20L 4HS8L 1OP5H 4F2MB 1U8OA 4N68A 1YMME 1SQ2N 2QR0B 4HJ0D 2BVQA 3BDBA 2IANE 4MA3B 1ORQB 4JB9H 4JVWA 4YHYC 1W0VB 5E1AA 4BFEA 3RNQA 3H9SD 4KMTH 3SKJH 3ZHLA 2VL5B 3VD3A 5FOJA 1ETZA 3FMGH 5JOFA 3X3FL 4LF3A 4WHYG 3C8KA 5CD3A 1U58B 5HYSA 4R0LB 4NCC2 1J5OH 4LMQI 4M5YL 3GJEA 3WIFB 5KVEH 4ISVA 3EYUL 1D5BB 3TFKC 3IYLW 2CUIA 3PQYB 1ZA6A 2WWKT 3MRRB 1I3GL 5DEGB 4BSVA 4XPGL 2WZPD 1F90L 5KJRH 5HHOA 4XNXL 2HVKB 1NDGB 1D5MA 2HFEB 4DZ8B 4KC3B 1MHPH 2WIMA 4JQIL 2VDPH 1KJVA 3QDGA 3PL6B 1JPGB 2W07A 3CDFA 2NLJB 5ILTH 4XP6L 2EH7H 1XGQB 4LKCB 5BVJA 3A6CH 4Z7OF 3WV0A 1NCWL 1YMHA 3ARFC 5H37H 1MCFA 2A74B 2ORBH 2CMRH 3U4EB 3IS0X 2AV7B 2FATH 4YE4H 2VJXA 2ESVA 3OG6B 3KDMA 1VGKA 1CGWA 5ITBL 1BVKB 5GRXG 4MAUL 5HY9B 3VFNB 4YHIB 5I0ZA 2R23A 4O00A 1Z0MA 1A5FH 1HXYA 4JPWH 2HJLA 2AGJL 4ZAKA 4ZUVA 2VISB 5I17A 4TN9A 1NGYB 4CNIB 1A2YA 2DQUL 3UPRA 3UTSA 1YEGH 1T1WB 4Q0XH 2ZOKA 1DVFB 1JGEB 4X99B 4FA8A 4OCYH 4WVRA 4PGZA 3KR3L 2BMKB 1RZGA 3K7UA 1M71B 3T0EE 3GI8L 2D9QB 5JIHA 1FN4B 4HK3N 4TUOB 3AUVA 4ZTOL 2X89D 4NQDD 2WV3A 1NAKH 3OZ9H 1TQCB 4NZTL 3L1OH 4I0PB 5IB1B 1HHJB 1FE8H 1M4KA 1IAOB 4LSVL 3RX7A 4LCWB 2GCYB 3U30C 1YY9D 4EZMA 4RDQG 1ITCA 3T08A 5HGDB 1QLEH 3L5XL 3L5JA 4QHKI 2AKRB 1KTRL 4TTDC 4CW1B 3EYFA 5GSRA 4H1LG 3HC4H 2NR6C 3GMMB 1S7WB 5C0JA 1A3QA 4DZBB 5FA3B 3H3KA 3PGDB 2Z91A 4P46C 4QTIL 4YHYB 4P5TC 1U3HA 1KEGL 1DZBA 5D96C 2CH8A 3FTGB 5T3ZL 1IAII 3MV9A 3QUYB 5EU5B 3U9PL 5FB8B 5DJ2B 5AYQA 3IVKB 4Y16B 2GW5A 4ODWB 1A9BB 2QL1A 5F7KC 1ZANL 3RWDA 1LDPH 3CPLB 4PB0L 3B2UD 1F6FB 1BWMA 2D7OA 2W0FA 4B0MM 4DWHA 4YDKH 4KAQH 5EZLA 3QI9C 2C3VB 4PD4K 2HRLA 3SEPA 1YDPA 4E42B 1GC1C 2JB6A 1FRGL 4TVPD 4YC2C 3M45A 1B6DA 4XVJL 3GJFB 5F7YC 3BZDA 3RVTD 1HKFA 4EOWH 1A1MB 1KG0B 2APXA 1CXKA 4GFTB 5EIQA 1BLNB 2WAHA 4PJDF 3IDGB 2HAZA 3QAZC 3MRHA 3CJJA 5ISZE 4W4NA 2C7UA 4K71C 5E2UL 1WBYA 4KKLC 3NVQA 3U7WH 3L7EA 1RUPH 4AG4H 5CFHA 3A67H 1KTKE 3VXSD 3AXLB 2VH5H 1SBBA 1DQQB 4PJGB 4UTBL 5E9DA 5I8CB 5F89B 1BBDL 3FB6A 4IIQB 1AIFA 3W9DB 3IDXH 4YFLI 5MENA 1DQJB 1A7NL 2AJYL 3HE7D 3STLA 1E28B 4F9LC 4PJHB 5DJDB 1QHPA 1Z9SA 2A9NL 6FABH 1G1CA 5LJYH 5JUEH 1FLTX 1CXLA 2FX9L 4QRPB 5BV7C 4O5LH 4PUBH 4XCNA 3GO1L 2FSEA 2E8YA 5JW4Q 3A6BH 3HMXA 3AS2A 3MJ8B 1MCBA 1OWWA 1JVKA 2XN9E 5GS1C 1R3IL 5JIKA 3RY6A 4LLQA 2NXYD 1N0XH 2BVPA 1I1AC 5EBWA 2PTTA 4E5XB 2IQ9L 3TA3B 1A6AB 4Y5YC 4YQXL 3S9DB 2VRAA 32C2B 4NJAL 1ZGLP 1ZAGA 2HVKA 2I07A 3GUTA 1IL1B 1AKJA 2R4RH 1YC7A 2AGJH 3S36L 3EDDA 4G3YH 4MCYA 4YO0B 1IARB 3V6OE 4DZ8A 4ZNCD 1SYVB 3RZCD 4ODTL 1LP9A 3LKRA 4DKFL 3V0WL 4Q6IA 2F74A 4YXHH 1H3XA 4RISH 3ARYA 1FSKB 2Y36L 4NCDA 5IMMA 1YEHL 4BKLA 4JY5L 3QDJA 3WN5C 1MFDL 1BJ1J 1LO5A 3QO0A 4FQ2L 5SV4A 3ARDC 1NLDL 4I18C 1MFAH 2OMBA 4Z7UF 4UU9B 4NQXA 1KPVA 3IF1A 2Z35B 1VGKB 2BXYA 1NGZB 1RZ7L 3MYZA 4Y89A 1IAKB 3HS0B 3O4OB 3BN9C 4QRTA 4CADB 5AEAA 3QUYC 4YHML 5AUMB 1KBGL 1CIDA 1YNTB 4DN4L 3MNWB 1FG2B 4XZUB 3HMXL 3JZ7A 1FNGA 3IDJB 2X10A 5DFVC 2B1AH 4JAMB 1I8MA 4XPBL 1KCLA 3Q0HA 5AG8A 4R97B 2E3VA 3AM8C 1F58L 3ULVE 3CD4A 3BE1L 2W1NA 1JFQH 2LVEA 1Z9OA 3MLXH 1G9NL 3FFCB 3VFPB 3FO9B 5T1MB 4M4RA 4Y5VC 1HI6A 1HH6A 3D2UB 2P46B 3UAJD 3HI6L 4MNGB 4MB5A 1OT2A 1B90A 3T2NL 1JNLH 2VABA 5D7LB 1KIQB 4XC1H 5A2KH 1H15A 4XNMB 5E6YA 2GJZB 3U2SA 1OHQA 3LKPB 4QHLB 3DURB 4HZLB 2E7HA 1U3JA 3B9KD 1DQLL 3L3DA 3B2VL 5CBEB 3WJLA 3O4LB 4LKXB 3V7MA 2HTLD 3MCG1 1ADQL 3C09B 4DVBB 3I50H 4DVBA 2L0DA 2YZ1A 3DX8B 4YZFE 1I85A 3S8WA 3QIUD 1INEH 5DRNA 3BIBX 3QDGD 1YN7B 4X6CE 4XCEA 5JXAL 3SKOA 1A9BA 4LVEA 4R7DB 3NTCH 1XZ0A 3HCVA 2V17L 2G60L 4PJBA 5DUPL 5GGQH 2G2RA 4FZ8H 3KPNA 3WFDL 1CTNA 5DQDL 5GIRA 2R0WH 2ZCLH 3MGTA 4CVUA 2GTWB 4X6DF 2HFFB 4HKZB 5CHNB 5CEYA 1T04A 5CSBA 2XY2A 3GM0A 3QI9B 1A9EB 1OF2B 4I3GA 2R69H 1A1MA 1KG0A 1I1YB 4TTDD 1MCLA 3L3HB 4M3JA 5D4QA 4C57C 1K9TA 2IQ9H 3GMPA 1QPXA 3HI5H 4CKVX 2L7JA 5KSVA 2OLDA 3QAZB 3RVWC 1S9XA 3JVGC 4I4WA 4EUPA 1MVUB 3RZCB 1HCVA 1YEJH 3VH8G 1TQBC 4G6KH 3IFOB 1TQCC 3CK0H 4NO5A 2ZCKH 5ILTL 3QPXH 1DEEB 4U1IB 1X9QA 1BQLH 4P99A 3WS6C 1KV3A 3HNTL 1ZLWH 4ESKA 1MCOH 5IFHL 5EC2A 4PP1C 4RFNB 4JFDB 4NQSA 3OB0H 1PYWB 1T0PB 1RULL 5IQ7H 5HYJA 1T7XA 1KPRB 1ZGLA 4UOW1 3SGKC 4X83A 3WE6A 5E8OA 5FHAH 1Q9LB 3DGCR 2ZUQC 1A6WL 3HE7B 4Y5VB 2ESVD 5C7XL 2XKNA 5CMAB 5KAQG 3QULB 5C07D 3O2DA 5TDPA 5T5FL 4TSCL 1JWUA 1KSRA 4Z78B 5D7LD 1MFCH 2OL3H 3LQZA 3Q6FB 4BQ6A 1MHEA 1EBPA 5KAQF 1F4WH 2G9HA 3PWVB 4GSDH 2AJUH 2P47B 5IR1A 1W8OA 1G9ML 4NM8H 3SCMA 1OP5K 1Y0LA 4HEME 2AJXL 4HEPG 1XF5A 1X7QA 4A6YA 5IM7B 3L5WA 4ZUSA 4C4KO 1M7IB 5CJXC 5JZ7D 3B4NA 3ARDB 1I8IA 2I60H 5BZDA 2UZIL 4PREA 5JZ7C 4X6CA 4QRTB 3QUXA 4N90E 4YFDB 2CLRB 3VG0H 1MCRA 1CDGA 1AXSB 5HGGS 1UB5B 1CFQB 4QXWA 4J3SA 4WO4B 3F62A 3TBWB 2C7UB 4HX1B 1RZ8A 4ONGL 3VRIA 3MLVL 4G8EA 4HIXL 4HX1A 4PJAB 2VZOA 2DM3A 4WIQA 1FC2D 1AD0B 5F93C 4JFEB 2HN7A 5IT2H 5EORH 5J11B 4MA3A 2AEPL 2EH8H 5EA0L 4KK8C 1I3RA 2V17H 3NZ8A 4GKSB 1FNAA 3T0VA 1BFOA 3HNVH 5I1EL 2KH2B 2VDMH 4HWBA 4XCYB 2F53A 4RRPG 2NXZC 2DM2A 2W91A 1CE6B 3SBWA 4NIKB 4ETYA 4WV1B 1TZIB 3UTZB 4LCWD 4NZUL 5DGRA 3WFEL 2JJSA 1MLBB 4XNZC 3WLBB 4M03A 1N2RA 3UP1A 1FFQA 4NHCH 3SKMA 3RIAK 1Q1JH 3HFML 4QGTA 5E03A 3G9VA 1BFTA 1D5BA 4O2EA 3DETC 5TDNA 4ENED 5C0DB 1S7XB 5CZVH 4PJEE 7FABL 3HZYA 3RVWD 4WNQA 4K7PL 4DEPB 5T3XE 2NY0B 3TYGH 1GAFH 4WFHD 1OM3L 2DLEA 3BQUA 4PJEB 3QR2A 2VDQL 2DKSA 2D7MA 1NEZG 3IDXL 2HG5A 4LRNH 4KRPD 1B4RA 3C5JB 4OUOA 3JWDC 2R9HD 1KLUB 1NBVL 4U6VL 4PJ7F 1ES0A 1CYGA 1BX2B 2LTQB 1NL0H 3THML 4XI5C 1UWGH 2R2BA 3AU1B 1I9JH 3ALWA 1LO4L 3L3OA 3P4MA 1OGAA 3NGBB 3ULVH 1FNEA 4J3XA 2FECI 5IV2A 1I8MB 3LKQA 4PTTA 3GMPB 4NQDE 4I0PC 1X3DA 3ETBF 4PBXA 1UKSA 3QWOA 4Z7WE 4XC1L 3LOWA 5D8JL 4XPAL 4G7YH 3L7FB 1S5IH 1LD9B 1NGPL 3V0WH 4OT1L 4JRXB 1QRNB 1G6VK 5HHPB 5E8NA 3B6SA 2AQ1A 2W9EL 3P9LB 3QHFL 5D7SL 1EA9C 2P5WA 4XXCA 3BP4A 4DQOL 3EFDL 3G5XB 4XMLH 3B8SA 2A6IB 4Y16D 4UDUB 5D5MB 4UQ2A 1E4WL 3B9KC 1HH6B 4KK9C 4Y4FB 1BEYH 4BZ1L 3SQOH 3ULVF 5DTFB 3VD7A 3EO1B 2E7BA 4G9FA 1UACH 3RBGA 4LSPL 1AD9B 2WUBL 4RFNC 4CU7A 3MA7A 1MCHA 5K9QG 4U7MA 3CVIL 3MRPA 2KZ1B 1MREH 1P7QA 3BVNB 3VRLE 1J0ZA 3JWDL 5D2LF 2OX5A 5F9JB 1H5BB 4P9MH 4MD5A 5J7CC 2FD6H 2P4AB 2BSRA 4KHTH 3T0XA 1UM4H 2MMXA 4MD5B 4KVNL 2XG5A 3QDMD 4MZ3A 5LGHL 1AE6H 1J1XL 4OZHF 2VDNH 5IB5B 3MLWL 3QG6B 3BWAA 3BZEB 4AZ8A 1BQHA 1X5KA 2R0LH 1N4XH 2P8MA 1ZHNA 2DBLL 4M4PA 2MCG1 1BJ1H 3MV8E 5E8DL 1A6VH 2CUHA 4GAJL 2OXHA 1IFHH 1ULVA 4FQXB 1L0YA 5I74B 4DKEL 1EEQA 2HH0L 2HKHL 4M6OL 4ZFFA 1P7KB 2A6JB 4NN5B 4F7PB 1PDKA 2MCPH 2Q8AL 3QDHA 2R1XB 3PWNA 1OTSC 2A73A 5D1XA 5DHYA 5FGRA 5EO9A 1UEYA 5I1AB 3LRGA 1EEYB 2DB8A 3MODH 4KQ4L 2IEPA 1I9IL 1V5JA 1WAAE 3I84A 5D93C 1UKTA 5E2VL 3VFOA 3FQRA 5FYJH 1J11A 3QPXL 3LKSA 3QUXC 4K7FB 3IB4A 3C6SA 4NZTH 1F90H 4R4BA 4OM0L 4O5LL 4I4WB 3BP7B 4JFXA 3PGFH 5FGBA 3DO3A 5KS9A 2C1OA 1FLRL 3MOAH 2EDFA 1YYLH 1GAFL 4YDLB 1NMCB 4CMHB 1DQJA 3UZVB 3NA9H 4HBCH 1WGOA 1RUQL 3FO2A 3OV6A 5C8JA 4CUCA 5KVGL 3VGHA 3UTSD 4N8VG 5DJDA 3P2TA 1WFNA 5KSBF 2NY4C 3TV3L 4DGVH 2R2HA 2HKFL 5IG7A 5EC2B 3U9PH 3V6BR 3VXPA 1F6AB 3OSKA 5F7DA 2Y36H 5IUSA 3BRGC 3HE7C 5MHSD 3S88L 2DN7A 5TDNB 3OKMA 4M02A 4Y19B 3ZKXB 2KZWA 5T33L 4CW1A 2CRMA 2DF3A 1WSST 5B3JE 1QOKA 1IQDB 2Z92B 43C9B 4QOKB 3TT3H 5AAWA 3QZWA 4H8WL 2OYPA 4HF5H 2R1WA 1HEZA 2RB8A 4Z7VF 3QZWB 3TCLA 5HSFA 3HC0A 3Q6FA 5F1IA 4DN3L 4JREC 2XTLA 4ZAKC 4AIZA 2EE6A 1FC1A 2GY5A 3DARA 3BN3B 4U3XA 4UU9A 1UYWH 1K3ZA 1ZWIB 1FJ1B 5CGYC 4HIIB 3H0TB 3BGFB 4I0CC 3S6CA 4DK6A 4XNQA 3H0TA 4LCCB 5K93A 3REWB 3MRKB 3TIDA 3MRJB 3PP4H 4WO4C 1K8IA 1KIPA 3W0WB 4ZFZB 1MIEH 1DQDH 4NKIH 2W65A 4WI8A 1RZ8B 1DLHB 2G5RA 1KIRA 4P4KA 5E7BA 4RWHA 1RZKH 4JFZL 5CJOH 4DW2H 3EJJX 3O2DH 3WSQL 4YAQA 4XAWL 1DP0A 2ZUYA 4M93C 2XA8L 1QSVA 4MA1B 5FYJU 1BIIB 1GPOL 3C60B 4M48H 4NP4L 3B2VH 4JM2C 3EDKA 4Y2OA 1ORQA 1V7MH 1Y6KR 4ZO7A 1EHNA 2VN4A 15C8H 1J1OH 4GKNA 5D5ME 2F5AH 3GMNA 3EW3B 2XV6B 1T0NA 4JO4L 3SKUD 2CDEA 2QEJA 4L9DA 4XCYA 2XWTB 5DHXB 4QHLA 4WEBL 5D7LA 2IAMB 4NO2A 3V6OA 3BXNB 2FEDC 3SHSA 4K3DH 3IU4H 3IETB 4RISL 1XMWA 1IC1A 3PJSA 4YHLL 2Z93B 2HLAA 4ELMB 1KCVL 3OGCA 3I2CL 3MBEA 4OCRH 2PR4H 2XZQH 3HNSL 3MLRL 4GJTB 3HI5L 5ALBL 32C2A 2P8MB 5C0DA 1ZHNB 2YRZA 4WGVB 1TZGL 4LBEB 2R69L 4DTGL 4MDJA 4ENEC 4DKAA 4YUEL 4UV4H 3CLEH 4PGEA 4WUUE 4NKOA 2YD4A 5I8KL 4DOHE 4ZYKA 3NFSL 4R7NB 3VXUA 3AB0B 4HGMA 4K55A 4LCIH 3EOAB 1OAZH 2HKFH 5D9SB 2J12B 3VFGH 1Z0NA 4JDTH 2Z35A 3MC0A 3BW9A 4RCAA 2I25N 2Y5TB 3HG1B 2MHAA 1I85C 4QRRB 1UB6A 4W4OA 5L6YH 2DQJH 5FV2A 3NGBC 3L1OL 4KRLB 4RGND 3Q5OA 4WJ5B 1MCPL 3X13A 3X11A 5T5FH 4LGSB 3F7PC 1QRNA 5HHPA 4NO0D 1F4XL 1RZIB 5K33A 2MKWA 3QUMB 4JPVL 3GBMH 1VEPA 1B0RA 1IBGH 2H2PC 5DJ0A 1OM3H 5FXCH 2DIAA 1CZ8H 1WFUA 2D31B 4L3EB 3P4LA 2H6PB 1NGXA 1TENA 2O5XL 3AREC 4QRUB 4LIQE 3E6HA 5IB1A 1MLCB 3I6LD 3K3QA 3C9NB 2XFXB 4IRJB 4ZQKA 1IM9A 1JYWA 3RUGF 5KTEH 4GRLB 2OL3L 4JY4B 1I3UA 1W72L 3MBED 4G80A 3EO1A 4PLNC 1GOHA 1N5AA 4NM8L 1VGEL 2NW3A 5BZWB 1JYVA 4NBZB 1L6ZA 4Y19A 1KJMB 1EAPB 4ZUTB 3V2AR