2Z31A

Crystal structure of immune receptor complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLQVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
total genus 25
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31A00
1JE6A 3T0EC 3P11L 4X6CB 4MCYB 2VXSH 3E3QE 3MOQA 5BV7H 3UTZB 2NY7L 1S7XA 1X5GA 4JLRA 5BS0A 1KFAL 2DQCH 3V95A 2EEAA 5JDJA 5C71A 1FRGL 4ZPVA 1TETH 4D9LH 1GL4B 4NKQB 2FO4A 1EO7A 4C56E 3SE8H 3SCMA 2VZOA 4H88H 5MEPB 2F53A 4MDJB 3Q6FB 4GMSL 1I3VA 3AY4A 3QDGD 4JPKH 3SOBL 3TCXA 2YSSB 2DM2A 3OKDA 1X4XA 4DKDC 4ZQKB 4H1LH 3RGHA 1DUZB 3HC0A 5ID1A 1U36A 2KPNA 5DHYB 2Q7YA 5BVJA 4XPFH 4NP4H 1P4IL 4NC1C 1BD2E 3PWVB 4J23A 3L5IA 1X4YA 3MREA 3MFFB 3RI5F 3SO5A 2F53B 5LCVL 3ILQD 4MJ6A 1FNSH 3WKNA 4X6BB 4OIBA 2B39A 5D96C 5C0EB 3R0NA 3BIKB 3D2UD 1SEBB 1MWAB 3RVUD 1MUJA 1MH5B 4L9LC 4KMLB 2OK0L 3PABA 1E27B 4XNYH 1BFOB 1MIEL 5T5FH 1M05B 4G7VL 1KN4H 5EOQL 5FYJU 5DMKA 3U1SL 5E5RB 1EEZA 1R6VA 2XZZA 5KW9L 3VH8G 4NFDA 5C9JB 3FT3B 4NQSB 1U8IA 2UZXB 3O2DH 2AJXL 1BECA 1W72B 4KJPD 1U8HA 3W11C 3GB7B 2FATL 4I0PB 5IROA 4PGZA 3GKWL 1KN2H 1OM3H 4XNXH 3U9PH 5K9OB 2BNRE 4UV7H 1IC5L 2DQEH 4LCCB 4R6UA 2XZQL 1ZTXH 4OQTL 2EKSA 3A67L 5KS9B 4TULL 4MJ5B 4U2YA 1XGTB 1D3CA 5D1ZB 5KVFL 1MI5D 5LGHL 2D0HA 3C2SA 4DZ8A 4R3SA 3QEQB 5TE7H 1C5CL 5DJ8B 5DDHA 3KPQB 4HUKB 4XPTH 2P49B 4HULB 3HMWH 4NKOB 5T3XE 3D25B 4PRPE 2VWEE 1ZHLB 3BEWA 2I5YL 1KTRL 3PDOA 4HKZB 2XFXB 4S1RH 4ZS6D 4P5TA 5B3JE 4OGXH 1IGCL 3BKJH 4PP1C 5BRZE 3CK0L 3S35H 1V7NH 2FL5B 4JM2F 3ZTNL 4LSDA 2W91A 1JPSH 5F7YC 2VKWA 2WQ8A 2YPLD 5FFLA 1KCRL 3TZVB 1J87A 3OJDA 4PREB 2NTFB 1Y6MR 4WV1B 1N5AB 5EZJB 1IARB 3W9EB 4NQTA 3P9MA 4HLJA 1ZEAL 3O6KH 4NO0D 3C5SA 4M1DL 4DW2H 4M6OH 1I7RA 1RV6X 4S2SB 2A38A 1Q9KA 5ACLA 1KTLA 3U82B 1WZ1L 4K3EL 1AJ7L 1NBYA 1L7TH 3J8F7 5AEAA 4R2GD 5HI3C 1CVSC 1RIUH 2GSGB 3U0PA 2XYCA 3GRWL 4LNVA 1O0VA 3LS5L 1NFIA 2MTPA 2OSLB 3PHOA 5TPWL 1AP2A 4JO3L 1T1ZB 3LRSA 4KAQL 2YD6A 4XX1G 1P5UA 2EDOA 4MJ4A 1MPAL 2CQVA 1HXYB 2B2XH 1P7QB 3GDBA 4C55A 4GW1B 1NGYB 4JM4L 3SGJC 4QGYA 4LIQH 4MVBD 2HN7B 4EVNA 3ULUC 5HYEA 4WHYG 4Q58C 1JGEA 4FXKA 5T33L 2EIZB 2WBJD 2P45B 4RGNB 4M93B 1DDHA 1RZ7L 2P42B 2P1YA 4KI1A 1NFDE 2C7UB 2X4QB 2KQNA 3VXUD 4GS7C 2DICA 1T0NA 3HC4L 4JPIB 2FEEL 5DEZA 2EE2A 2W0FB 5F1NA 4YHLL 2GITA 5IV2A 1I1FB 3O9WC 5C0ND 1P4BL 4YGVB 5GGRY 4OIIH 1VGEH 3ARXA 5GRYA 2A6JB 2DIJA 5J1AA 4XP4H 1CR9L 5GGUB 3BDYL 4K3GA 1DBML 2DWDA 1RK1A 2DB8A 2R0ZH 4PRIE 5FUOL 5A16B 4FQQA 1A7BA 1OP3H 1HHGA 2MPAL 3U79A 1MJ7L 4JFXB 4XPGH 1QACA 3HLAA 4UTAL 4FXLA 3S4SG 3NFPA 2XN9E 3QDJA 2I27N 4KZDL 1KV3A 4P49A 1J10A 3SGEI 3KYAA 1FO0H 4EDWL 4YPJA 3KPRA 4Y19A 1K8DB 2G5BA 3N1PC 1Y6NR 1CLOH 5D6CA 5EU6A 4M1DH 4DW2L 4C83B 1I9IL 1NAMA 4ZFOA 2CDEB 3VWKA 3L95B 1JF1B 4GG6F 2OLDA 4YHLH 1LO2L 2QADD 1PD6A 2VDNL 2Y7QA 5TPWH 4BK4A 3RWGA 5DJCA 3KPLB 5ICZB 4NN6C 4RNRA 2A9NH 4IOIA 1TCRB 1X9QA 4W4OC 3PGFH 1KEGH 1K2DA 3QIWB 1MHHB 5A40E 3VWKB 4MNQD 3QG7L 2ITCA 1XIWA 5I1AA 4FS0A 4JFEA 4N0FB 2DQEL 4X6DE 3KPRB 2L4OA 2CKBA 1DQJA 2IG2H 3QJFB 2I26N 3PHOB 4LQFH 5HHME 3L9RA 3QDJB 4HWBA 1FPTL 1IGMH 2ZJSL 3SKUD 1Z5LA 3RVWC 4HXAH 1P53A 1ZHNB 4G8FB 1TZIA 1WCBB 1ZHBA 3T0VA 4YQXH 1Q9KB 3OKEA 5ILTH 1K3IA 1S7UB 5CP7A 4IHOB 2I9TB 4NKDA 3PGDB 5EFIB 3SKNA 3QUXB 2HT4D 5I8OH 3MNVA 2IPUG 5FHBL 3BPCB 4F9LA 4XMKL 4DAGL 4X0KA 4XB8A 1HH9A 3RTQA 4WV1A 2R23A 2Z8RA 2DM3A 4V2BA 1HK6A 5L88H 1NANI 5KS9F 1OD7A 1DANU 1QVOB 1R5VA 4Z6AT 1F4HA 5DVLA 3NFSH 3WN5A 2WM0A 4JG0L 1JGDA 3MXVH 3THMH 1X5HA 3RZWA 2F5BL 3UX9B 5IHBA 1S7RB 3CVHH 3HI1B 4FFZH 1ZHLA 2WV3A 3HNVH 3ULUD 3VDBA 1JL8A 3TVMC 2V17H 4J6RL 1R3KB 2ZPKL 3UBXI 1JWUB 2XQBH 1KN2L 4P2OB 4GAGL 5GSRA 3QP3A 4HZAA 1ED3A 3WEXA 1ZE3C 4M4RA 4LLMA 2ZUWA 4ODHH 2VAAA 1JFQL 2I5YH 3DJ9A 4HXBH 4ZOBA 4F2MA 4JZJB 4XCNA 3J7HA 5EZOH 5GS2D 4F3FA 5KW9H 1A4JB 3FQTB 3CXHK 5C6TH 1V7ML 2CKNA 2YRZA 1FCGA 5E8NB 4AMKL 3MLYL 1QFWI 3EYUL 3D0VB 2WAHA 1M4KA 3F6LA 2AEWA 1P1ZB 2IEPA 3WE6B 2NY0D 3V5HA 4M6ML 2CIKA 2Y6SD 3MV7B 4RGOH 4MQSB 1ITBB 1U8IB 4Z7WF 1CGSL 4G9FA 5ANMB 3TYGH 4F57L 2AABL 3FO2A 2NY2D 5KS9E 3IFOB 2CLZB 1FGNH 1JTPA 3QPQD 5C0IA 3H9SE 4GS7B 5AUMA 1MH5A 3P4NA 3EZ8A 3RL2B 3DGGA 3TV3L 2BSED 3IF1A 4YK4C 3T0AA 1S9WA 1S7SA 2ICWI 4MCZA 3WFBH 1LDSA 1V05A 4OFYD 3MO1A 4MJ6B 1MCNA 3HE6C 1MHEA 3MLRH 4NCDA 1K5NB 3VRLF 5DRZA 4PTTB 5INCA 3C60D 4TRPH 3VFTB 3QDGB 4HJGB 5EG6C 3KG5A 1IGCH 3KYOB 2MCPL 3PDOB 3QDMD 1HILB 4JM2D 4Z78A 4CW1A 1B9ZA 4PJCF 4HK3J 2ZSVB 4X7FC 1YMMB 1OVZA 1WZ1H 1WWAX 3KPMB 4JZOA 1N6QH 5IFAL 4I3SH 2PXYA 4PLNC 3NGBC 3FJTA 2A73B 1OP5K 1C7SA 2VDLH 2DBJA 1RUKH 3EYOB 2HWZH 3WHXB 2I07A 4QHNB 1RJCA 5EBWA 3VH8B 1JRHI 1KTKE 4G8IA 4QO1A 3FOLB 3P9LA 4JKWA 1IRAY 1GIGL 1A3QA 1HOCA 5MERB 3MCKB 5I1HH 3WUZA 3L5XL 2CLVA 4K3JL 5BCAA 3HR5A 3ARVA 1G9MC 1XGUB 4GAYB 3S36H 1ACZA 4F15C 3GEWB 4GLRI 4FQXD 1A6ZA 4PRDB 3QDJE 3KPSA 4C58B 1I1CA 1UVQA 2DLFL 1K5NA 5BQ7A 2BC4B 3MV9B 5HHPA 4HPYL 3DMMC 4Z76B 5DD0L 3DVFA 4NZUH 3KPPA 1IAOA 3ARDC 3BP4A 3VFGL 4LKCB 5L2KE 1VEMA 3ARUA 2NXYB 2XACC 4DGVH 3PGCB 1XCQA 4V1DE 2P5ED 4TPRH 4HUWA 1NH6A 5CJXC 4H8WC 2CIIB 4X6BA 5ANMA 1MVUA 1WJ3A 3VJ6A 4PGCA 5HPOA 5FYKH 1N4XL 4RGOL 1C1EL 1JPGB 3QEQD 1S7UA 2EH7H 3BDXA 4KZEH 2PW1B 4P5KA 3NH7H 5I16A 1RJZB 3B5GA 2R8SL 3PWPB 1U91B 3HNSL 3MRNA 1X5AA 3SPVA 1MFBL 3V6BR 1HKFA 4OTXH 2YEZB 3HS0B 4NSKA 4PJ8C 1A8JH 1HXMB 1U8LB 4UQ2B 2VH5H 3L3IA 3WFHA 4RMSA 3TZVD 3OKKA 1U42A 2PO6A 4WEUD 1ED3B 5JZ7C 2Z92A 1G6RL 4OM1H 2VWEC 3VXSD 4QRRE 4LCWB 3KLHD 4U3HA 2K1MA 4JJHA 5GXBB 2E7BA 4HS3A 1YQ2A 1X5FA 3NABL 5ENWB 1CF8H 3QIWD 4XCCH 1T7XA 4XVTH 5GS3A 5JOPD 1QVOA 1S7VB 4R2GB 4WW2A 3JWOC 4N0YH 2I60L 5D5MA 1ACYL 1UWXK 3ZL4H 4WY7L 4X7DC 5DK0A 4MJIB 2GI7A 2R69L 1RMFH 1AGDB 4RA3A 5EA0H 3D0LA 1XZ0B 3QXAA 2EYSA 3CZFB 3SE8L 1A3LH 4PJBA 1C5DB 3QUMH 1QLRB 3ZE2E 4YZFF 4LIQE 1V7MH 3BP7B 3ILPA 5JDSB 4NC0B 4BQ9A 3CU7A 1T2JA 1J0HA 2R4RL 3G9VA 4M7LH 1L9NA 3L6FA 4ZFGL 1EJOH 2P5EA 3AS0A 3QH3A 1KCVH 1RIHH 2ICCA 4HH9B 4I48A 4HWBH 1GHFH 4CADA 1SYVA 5E8OA 4XRCB 3CNKA 5EC1A 1TPXB 4G3YL 1DLHA 2VB5A 1EA9C 4KK6C 1FIEA 1YEJH 5FGBC 4X6DB 2Q8BH 4EDWH 1BQLH 3KPRE 3VXMD 1EK3A 3MJ7A 4OZFB 3C60C 3HI6H 4I18A 3QISA 3FB6A 5ADPH 3X12A 4DGYL 3G5VA 1X5ZA 1NCDH 4LMQE 4LSSH 1FG2A 4OI8A 3TVMB 5LGJA 1IGJA 2LTQC 2HFFA 1YEFH 3TO4B 3UTOA 2ESVB 3UJIL 1P9MC 1F3JA 2NX5E 3WD5H 3MRGB 1J05A 3AU1A 4IOFC 2D7TL 3WFBL 2YD4A 5FAAA 5C7XH 4YO0A 1KJ3H 3BPNB 1UWGH 3DO3A 1S5IH 3QNYA 3VFMA 1GGUA 5CEZL 2HVJA 5ESQB 3GIVA 1NC2B 2HKFL 3FFDB 4GXUN 3BH8B 1DFBH 1RUMH 1A1MB 4UT6H 3OXRB 2X4OA 4U7MA 1BIIB 1JF1A 3V6OA 1R24A 1RURH 5HHXH 2DYPD 1R5WA 4ORGB 4KXZH 3C5JA 3DHJA 4KK8D 5DJ2A 1K6QL 5EO9B 3PQYD 5D1XA 2EZ0C 2VLKD 5CJOL 1ZGLA 2GTWA 3UZEA 5GGRA 1CIDA 3MXWH 3REVA 5I18H 2B8OT 1OSPH 4WFHD 3VFPA 1RUQL 2NYYC 5ID0B 1RK1B 3Q5TA 2AKRA 5TQ2L 3BH8A 4J12A 4X7TA 2ARJQ 3VMNA 2FIKB 1RZKH 4YGVA 1IAMA 3BZDA 3K81A 4OLZH 2X09A 3WKMH 5EZJA 3DTXB 4YE4L 2C26A 1WIPA 4R26H 1U92A 1U8QB 3CX2A 4KROC 3CFDA 2WK2A 5EORH 3MRQB 1MAML 5HY9B 4LSPL 4JFFE 3QDJD 2BOCA 3FOMB 1QSED 5D2NE 5JW3L 5I73C 3UC0L 5JMOC 4OLEA 2DDQH 4WFHE 1D9KB 1KCLA 2B0SL 3EYFA 4LSVL 3BEWB 1H3PL 4JM4H 4WI7A 5EC1B 3LEYL 5DFWH 1FFOA 1VKXA 1LO0L 3OF6D 1JF5A 4OD3L 5B8CB 4GKZA 1F4YL 5ID0A 1AO7B 4ZOAA 3IGAB 3VXPB 1LD9A 2X4RB 3SKOB 5KVDH 2R1YB 2FBOJ 1NCNA 2HTKD 4JFYA 5HYSA 4HPOL 1TJGL 3BKML 4ALAL 5D1XB 4XX1E 2ZCLH 3E8UL 3ZDZF 4KDWA 4L4VD 1S7VA 1L7TL 2G2RB 4FFVD 2EDJA 1EEQA 2E9WA 3BPOC 4G6FD 5GGVL 5I0ZA 2DL2A 12E8H 2NXYC 3ZZ1A 3MV8A 1GRWA 3SDAC 3O9WD 4D0CA 4WI3A 5C0NC 5K9QG 2Y07H 3QNYB 3MRHA 4RGND 1IAKA 1J1PL 1OLLA 5BRZD 5T33H 5HI5C 5EORL 1AGFA 1A5FH 4P2OD 5F7WC 2F54B 1E27A 3PABB 4L1DA 1U8NA 3MRFB 3L3IB 3EIFA 3WNKA 2DI8A 3DRQB 3TVMA 1Q72H 1EAJA 5T3XL 3BI9X 5I15H 1P9MA 2APXA 4QOKA 3HUJF 4OZFA 5TQ2H 4HGWA 1FNAA 1D9KD 2VZ3A 4JQIH 3U6RB 1A6TB 3RQ3A 5LQBH 4RAVB 5J9PA 2YUWA 2OQJA 1MAKA 2D31A 3ISWA 4O2EB 3O41B 1BOGB 5D7IB 5GRJL 4X6CE 1HQ4B 1S8DA 4X5WA 1X5XA 4PLJD 5FM5M 3OB0K 2MPAH 2P4AB 3NCBB 4HD9A 5LGHH 4CGTA 1Q9LB 3MCLL 2VL4A 4Z7VB 2A1WH 2NPLX 1I3RA 5DEFB 4HUWB 1AGDA 5MENB 1DBAH 2YZ8A 5K9OA 1T22A 4TQEH 5FOJA 1PJ9A 1OM3L 2E6QA 1Q0YL 3T2OA 1RZ8A 3D48R 1JIBA 4UT9H 3HA0A 3RZCA 3PIQA 4YDIH 1CXFA 1PG7W 2EE9A 4KH2A 4YIQA 1CFVL 1N64L 3PIQB 4M62L 4KUZL 5DMKB 4LLQA 5BRZB 2IAND 2X4PA 2CD0A 4NQDA 3LMJH 4EIZC 3MOBL 4GG6A 5HYJD 1IM3A 3IAGC 2OK0H 3MLZH 2I9LA 5MERA 1WBZA 1X5LA 3WFHB 3HCVB 3W5MA 2DKUA 4TSBH 2OXHA 3GMPB 2AJZA 5F96L 3WCYA 3WIFB 3VRJB 4NM4L 3UJTL 2XG4A 3U0TB 2B2XL 5CCKH 4NZTL 4NZDA 4JDTL 1JHKL 1WFUA 4RAUA 4HWEL 4ZO7A 4ISVA 4PJAA 3WNLA 3FQXB 1KBGH 2FD6L 3HHRB 5T3ZD 3HZYA 5HHNB 3Q1SH 3O3DB 3P3YA 4HUUB 2OQJB 2FGZA 3MV9D 3B9VA 3P4OA 3QUZA 3CFCL 1X7QA 2JCCA 3G08A 3MLUH 2J8OA 4RAUB 3STLB 5CEZH 5FA4A 1F3DH 1FFNB 4AEIL 3VD9A 2BNQE 2W9DL 3MLTA 1UXWB 3CLEL 2X4SA 5C8JB 4L29B 5J1TC 2XG5A 5AWNL 3L3JB 3QO1B 2ZOKB 3EFFB 4LPTA 4YFLI 3NPSC 1A6PA 2E7HA 4NT6A 2ADIB 4AG4L 5L8JB 2BP3A 1ORQB 1FE8H 3T3MF 2LV4A 2VDQL 4I4WB 4NPYB 5D7SL 5HVWA 2BRQA 2Q8BL 2C4FT 3CK0H 3S35L 4UNUA 1BEYH 1I9JH 1ONQA 4AY0A 5SWQA 3EJZD 4DEPC 1K4DB 4NP4L 4Y4HA 4BZ2H 2EIBA 1FZJB 4OAWB 1MNUL 2X4NB 2XY2A 5DHXB 1I8IB 5DWUH 3BP6B 2H3NB 1JNLL 4LDOB 2I24N 2IPTL 3L5WB 4OTXL 1LE9B 2Q86A 4ELMF 4BYHA 5SWZA 5CEXA 1FIGH 1PQZB 1G7IB 2QHLA 5DFTA 4M7LT 2VOTA 3E1F1 2OZ4H 4BSWA 3TLRA 1UXSB 2B4CC 2ZSVA 1ZVHA 1J0IA 1VGKA 2AJVL 2ARJA 2BNRD 4G9DA 4ETYA 2EE3A 1AO7E 5C0RL 3QDGA 4CVXA 3RKPA 1PX3A 2AEQL 2DQUL 2YD2A 4Z7WE 5D70H 4JGUA 1XR8A 4YNYB 3DV4A 5EN2A 1CFTB 5AZ2H 5E2UH 1UYWL 3BVNB 1KSRA 4IBLT 3G6JB 1PG7X 4P99A 1ND0B 5F6IC 3TIEA 4N5UA 1CG9A 1W0VB 4Y1AE 3IDMB 5CEZD 3FO2B 5JO5A 4FMKA 4HKXB 4PV8B 1DFBL 4Y2DA 3T2QA 4X7TB 3EKCA 3VXOB 3MV8B 2BNQD 4PV9A 2XKNB 5CEYA 2V17L 2OTUA 4KTEL 2I60H 2BHZA 4WHTA 4FQHB 1IL1A 3UROR 1F58L 3RI5K 1QPPA 3LS4H 1EEYA 3VXNA 3PWLA 3RDTC 1YQVH 2P5WE 5TDPA 4NUJA 3TH4T 4PJFF 1NFDB 2VDLL 3OR7B 4HK0A 1ZT1B 3KYNB 3TZVC 1AFVL 5F9DC 5HD8D 3IXAB 4QLRA 4MXQC 4JFEB 5I1AB 4LLMB 3MV11 3AXLA 4O9HH 1MRDH 4P48A 2NY4C 1DQML 3MLXL 1UC6A 1LP9F 4AIZB 1BGXL 2QQQA 1FFOB 3BWAA 5FDYA 1A1NA 3EOTL 2X7LA 1YNTB 1R3JB 4APQB 1HIMH 2O5ZH 4JVUA 3EYFB 3VXTB 2FHCA 1CICD 2F54D 3T1WA 4JY6B 3MRGA 3P77B 2WP3O 2G75B 2Z91B 4NYLB 2NY3B 5J3HC 5EU6B 4LLWB 2DLEA 3CFDB 3I84A 2AK4A 3OJMB 5F9AC 5F9JA 3MQIA 3QXUA 5ANME 2L7JA 1DN2A 3KXFE 1OW0A 1HEZB 3IDJB 4ZODA 1NBZB 4KI5E 4OGYL 1DLHB 2FX7L 1QQDB 2A9NL 5L2JA 5GGVY 1FFPB 5C0AE 4S11A 4QHLB 1E4JA 5B3JF 5DGQA 1F3DJ 4U1GB 3F7YB 1SJXA 2NY2C 1EHLH 5CLTA 3KJ4B 1DQJB 2KBGA 4DKAA 3IU3A 2AK4B 4LCWD 3G5ZB 4PJ7A 1AH1A 4F9PA 4PD4J 4YWGL 3LSOB 4YK4B 2P44B 1A4KA 4KI5D 3W0WB 4MA1B 4UT9L 5FGCE 3NFNB 4ZXBD 3RWCB 1ZT7B 2VXQH 5JIPA 5GJSL 2WW8A 5JW4Q 3CCHB 5FK9A 2Z35A 2E9BA 2B4CH 4X5LA 3D9AL 1BVLA 1KCSH 1D5MB 5LVEA 4Z7WB 3C6LD 4NQEB 4QOKE 3Q3GB 4L4VA 1IT9H 5AYQA 4IDLA 5L8LB 5DUPL 2KZWA 1PLGL 4HS6B 2UWEE 4PJBE 5BMFH 2M2DA 3O2VH 4P23B 5D7KD 3MRLB 3NA9H 3RWDB 3TH3T 2J1KA 2NY1B 1XF2A 4O51A 1NBYB 5FYKU 2VUOA 1DQTA 3R0MA 4YHZL 3O3BB 4P59L 2OTUB 2RIKA 4JFZH 3U4EA 5DJ6A 1A9BB 2Z8WC 1RK0A 2PKDA 3W11D 1RIVH 2A6JA 4IRSC 4U1SA 2GFBA 3K8LA 3AFLA 4L5FL 4NC1E 4UTBL 3TVMD 5E9DA 4H20H 5IBUB 1KXTB 1H0DB 3D0LB 3QXAB 4OBSA 3WXWH 2OJZL 1CXKA 4Z7UE 1VFAA 4HLZG 5HGBA 4NIKB 3PDGA 5FUOH 4JO3H 4L8CA 5GZOD 4WFFE 4N9GA 3MA9L 1XF5A 3NPZB 4UDUB 5I17B 5DWUL 3SQOL 1JP5A 4PY8J 3CDGB 3FQRB 1JGEB 5HD8C 2DQTL 4G8GB 2P43B 4G9DB 2ARJB 3HFMH 1VGKB 3KPRD 2X9YA 4GW1A 1TJGH 4PJHF 2ZCKH 5ACZB 2CRYA 4GO6B 4E41E 2XQBL 3VWJC 4RWHA 3T8XA 1OTUD 1OQOA 2X1OA 4OV6F 3Q48A 3T77B 4HWEH 2UWEA 5F88B 3ARDB 1GPOL 2JJSC 4R4BA 4YHMH 5DJDA 2V2TB 4PD4K 5FO7B 4BZ1H 3UXFA 1P4LB 3OXSB 1AXSB 3D18B 3UCRA 1KXQE 2QEJA 1T21A 5T1LA 3HB3D 3HN3A 5CGYC 5KSVA 1JGVH 2X1QA 1R3IL 4DN4H 2NY1D 4Y16C 1OL0A 5IMOB 1WWCA 4HJGA 1I7RB 4HSQA 5F6IB 4P2OC 3WMSA 1KJ2A 2ZUUA 4TVPH 1CLYH 2OZ4A 4PV8A 4JVWA 2BSTA 3LH2L 5CGTA 5EWIH 3GHBH 5AG8A 1P7KA 2P8MA 4JREB 4WU5B 5A43C 1WBYA 2DKSA 5A1AA 4OFIA 2AP2A 2QSCH 4XH2A 3I6GB 3LB6C 1BQHG 2JJTA 4NN7B 4PRHD 4K23L 2DLGA 4XHQA 1K8IA 1SEQH 4ZUSA 3UTQA 4PJ5D 1IQDB 5I1CL 3MCLH 2OI9C 3ARBB 3MJ9H 3QDHA 1S3KL 5IMOA 3SE3C 3MFGB 4ERSL 3EO0A 1I85C 1WC7A 1CTNA 5CJOH 3ROOA 3BAEH 3VI3F 3MGTA 5IR1A 1EHXA 2KZ1B 1T5WB 5KAQG 5L2KB 3GNMH 3R8QA 3BDYH 1NBVH 3H3KA 1QO3A 4N8VB 1P2CA 5EC2A 3S7GA 5C70A 5DRNB 4APQC 3NCCB 2BVPA 1Q72L 4ZPVB 3SDXB 5HHOB 3ROLB 1I7UA 4LL9A 2ZUSA 3BESR 4NQEE 1X4ZA 4U1IA 2NY4B 2EO9A 5IBTH 2QQKL 2XQYG 4JZNA 1GC1C 3HI1A 1B4RA 2PXYD 1I7TB 3QEHB 2C4XA 5GQBA 4Y5VA 2EDBA 4HJ0D 4R4NC 4R26L 1J0YA 1S7WA 1RZ8B 4AIXA 3DBXB 2FYYA 3T0EB 1FH5L 4KK8C 5GIRB 3C60B 1T22B 5D71L 1FFRA 1G7QA 1MWAA 1SEBA 4P2QE 4X0KB 2ESVE 3O6MH 1QEWB 5HGAB 3DYPA 1MCBA 2UZIH 1QA9B 2E7LA 4MA8L 5FA4B 1F4AA 3MNVB 2BY0A 4G9FD 1OF2B 4JDVA 4NHUB 4P23C 1O7SA 3MODL 4M8QA 5D2LA 1Q9LA 2D0GA 5DJ6B 1AC6A 5F8QC 4JQXC 4PG9A 1GGIH 3FO9B 4MZ3A 1MLCB 4RDQG 3FT4B 4WTZG 4G8GE 2CLRB 3QUMA 1J7VR 2ATPB 3A67H 4OD2A 3U30C 4LSRL 3U6RA 5DURD 1OW0C 4F3FB 1EGJH 3TF7C 1FYHB 4R2GC 3WIFA 2UWEB 5F88A 1LDPL 1KIRB 3EDDA 2NNAA 4JHWH 1RIVL 2ED9A 3LZFL 3RU8H 3BJ91 2EZ0D 5C0JB 1S9XA 3ULSA 4DVRL 4JPKL 4Z9KB 3X13A 4I77H 5TH2B 3RGVD 3ZTNH 4I0CC 4D0CB 5C0AB 2VR5A 4Y4FA 4R8WL 1DQMH 5E2TL 5J0BA 4AIOA 4DJMA 4RIRA 4LVOB 4KDTA 1MCEA 1MFCH 2XNAB 3V4VH 1VFAB 2X42A 1BLNA 3RVUC 3RTQB 2NX5B 1KCKA 5C08D 5TQ0H 3KPSD 5IESH 3JV6B 5E00B 5D2NB 3NCYS 4H1LA 5E9DB 3S98A 4CMMA 4GXUM 3P30L 1K6QH 3TO4C 1V3JA 4NO2A 4A2MA 1FV1B 3BISA 5DVKA 4WHDA 1A14H 4G9FE 4PGDA 4CN4A 1AGCB 15C8H 1VA9A 4M5YL 1QQDA 1CLZH 2OTWB 4GW4B 4R97C 4E41B 1QSFD 4CDHA 4Y5YB 4PRBA 2GITB 3CX5K 5KSBB 3QJFA 1U8PB 1FNFA 3K80A 4M00A 1O7VA 4QOKB 3LQAH 4FZEL 3K74B 1CFQA 1ZV5A 5I73B 3MLWH 3QEQE 3MRKA 1J9CT 3QIUC 4PLOB 3UJIH 4BZ2L 4U1MA 3FFCD 4O2CB 5C1MB 2J88H 2R15A 4OGZA 3VFVB 5DSCA 1RHHA 3ARFB 5BV7L 4CMHB 1M6OB 3P0VL 3H7BB 3VXRA 5I2IA 3KLDA 3V0WL 4LPWA 3ME0A 3OAUL 3MRMA 4HFWA 3VMPA 1QYGH 2FIKA 3H9ZA 1FNSL 5FOBB 3IYLW 1NGYA 1SY6A 2HAZA 1AFVH 3OKMB 3H0TB 3FO0H 1BFVL 1MCLA 5E56A 5C92A 1G9NL 1I75A 5KVEH 2PO6D 4Q2ZB 1YEEH 4Z95L 1NAML 1KELH 2VXQL 5DR5H 5E8EB 1FAIH 4NRXB 2AJUH 3G5ZA 4PJ7B 3HR6A 2FJFB 3LIZH 4I3RH 5KSAB 1OCWH 2FECI 3ECBA 4QCIA 1JPSL 4KJWD 1CQKA 4JFDD 4LP4A 4JFFB 1DCLA 1YEFL 3CFCH 4Y4KA 3PL6D 3JBG7 1EMTL 2HT2D 1MCJA 5ALCL 1ZAGA 2F74B 1BIIA 5B8CA 1IBGH 1OAKH 1NGWB 1YYLH 4QYOA 1Z0NA 5ESQA 1BM3L 1J8HB 1GGCL 1I1FA 1KTDA 1B0WA 2QV2A 43C9A 2HG5A 5DK2B 4GBXB 4U6YA 4R96B 1N2RA 3BXNB 4JRXE 2DLFH 3OR6A 5EZLA 3BGMB 1Z3GL 4X7CC 3LRHA 5IF0B 4FQPA 2JELH 2EYRA 4RFOL 3UPRB 3X12B 4OLXH 4LDEB 4C4KT 4Q0XL 4M7KH 5KSBA 3GKWH 3H9SD 4LCYA 4ZO6A 5KTEL 1IKNC 1JTOA 2JE8A 4N0YL 5E4IA 1ES0A 3RX7A 5DUBB 4HH9A 3FFCE 1UXSA 3WIIH 3DXAA 3V5DB 3S5LA 3JWDC 1CF8L 4HXBL 1KBGL 3T0EE 2BVUA 3ZE1F 4DWHA 4MYWB 2OXGA 1JHLH 2MQ0A 4JG1H 4WWKB 4JO4L 2CDGB 2R2HB 4P4KC 3VGFA 4NO0A 4E0RB 5TDOA 1PBYA 1GAFH 2QSQA 4LVEA 4LHQB 1YC8A 2FJGB 5FDWA 2W60B 5DQJA 3G5YA 1T4KB 3CFJB 1QFPA 4LOUC 5EBLA 5DJAA 4KKNA 1F4WH 1LO3H 3EO1B 2XKSA 3OKMA 2NY5L 2ZKHH 3CLEH 3GIVB 3WLWC 2JKXA 3ZYJA 5KG9A 2V6HA 4LSTH 4PRNA 5E1HB 3RZCC 5DTFA 1YUHA 4K94H 5AD0B 1JPFA 1S9XB 1XR9B 2HMIC 4RFOH 1FZKA 3GM0A 5EO0A 3L5XH 4LNRB 4YXLL 4J8RA 1OY3B 5CSBA 4O58H 4PBVC 2IH3B 4OUOA 3DURB 4RZCB 1U8LA 4FFVC 3G5VB 1T7VA 5GGTA 5KSBE 4XXCA 4X4ME 1DJSA 3RBSA 4HHAB 1DSFL 3EOBA 4QRPA 1X7QB 2JCCB 1WEJL 3WS6A 4P4RA 4PJHB 3EJYD 1DQQB 5HVGB 2HFTA 5HGGS 3QIBA 4OF3A 4Y1AB 1E4WH 4MD0A 4P3DB 3H8NA 4G42A 5K9QI 3Q6FA 3BKMH 4E9LA 4MNQE 3VRJA 2AJZB 3K4AA 2RQ8A 2EKSB 2NX5A 1NUFA 2B5IB 2ERJB 3B6SB 1CBVL 1E28B 4MJIA 4OAWA 3ALPA 1FZJA 1JNNH 4CUCA 4QHUA 2EIDA 3RU8L 2HJKB 4KJYB 4NJAL 4JDZA 2XWTB 5CD5D 4WDIA 1LO2H 3NA4A 3DNKA 2JJWA 3MNZA 3RY5A 1AGEB 1N8ZA 5BQ7B 2VLJA 5C0BB 4XPAH 4DK3A 3VG0L 4NN5C 1MVFA 1D5ZB 3EGSB 5CLWA 5E4EC 3KHOA 4XTRC 3W9DB 5E24E 1YN6B 3MLZL 2MCPH 3HMXA 2DM7A 4LLVA 5E08L 3TYFB 1MUJB 1I7UB 1NL0L 4J3WA 5KOVC 5IB1B 2VDMH 1INEL 3K8KA 4K3DL 1ADQH 4LVHC 3HAEH 2R2CA 3F62A 3BRDA 3NBNA 3GI9H 1X5KA 4V1DB 2VIRA 4PJCA 3RZCD 4JRYE 5EUKA 1QBLL 2VZUA 4YDVA 5IR1B 5D71H 5J57B 3FCTB 5DK3A 3A0OA 1XIWD 1DQQA 5HYJE 1OD9A 2YPVH 5FUZH 1HILA 4Z78B 2PW1A 4P5KB 1TZHB 3HZYB 5B3NA 3IDGB 4QOKD 4NHUA 5F9OL 4PJCB 3T0ED 2BFVL 3VD3A 1FZMB 4KK6D 5IB1A 2F53E 1UCBH 2R0KH 3MC0A 1U8NB 3ARFD 1FL6A 5D8JH 4GLRH 1ZS8A 5I6XC 2YKLL 3IFOA 3WKML 4F33A 1MCOH 4D9RD 2FEEI 1EAPA 4LOUD 1JNHB 5IBUG 4G9FB 1NC4D 3MV9A 5IWLA 1WZKA 4K9EH 2H6PA 4MJID 1KJ2B 3IS0X 1LEKB 4MQXD 2Y23A 1KB5H 5D2LF 5T1MB 2A0LD 2YHGA 3QI9C 1G7MB 1T4KA 4JFHD 2NW3B 4DUXA 4KZDH 3N06B 1XGUA 1MFNA 4NRZB 1JWSA 2KH2B 3CPLA 5H94A 1C08B 3RKDC 5C0DB 4DGYH 3B6SA 4JN1H 3MXVL 5DYOB 4P4KB 3C09C 1F90L 5J13C 3FB5A 3JWDL 1LE5B 4KJQC 5IB2B 5TE4H 3K2UL 4JFOB 1YN7B 3PWUA 5EOCJ 3MV8E 3L3KA 3V6FA 1OAZL 2JCCE 1V8HA 1FNGA 1AXTH 1JNNL 2BSSA 4CDGC 3NIDF 1JRHL 1RZJH 4PJGA 2O61B 4HQQH 2VUYA 4ELKB 3EYQD 4JN2B 4PJ7E 3S34H 3I50H 4XC3L 3I75B 1W0YT 4OCYL 4Q6IA 2A0LC 2AJSH 4IMKA 4KKCC 1WCQA 2NQCA 5HGBB 1C5BL 4P57A 1VFOA 5DD6B 1QSFE 4ZXBB 1U92B 3QUYC 4MA7H 4XMLH 2WNGA 1OSPL 3CJJA 3QIBC 4EQ2A 3FTGA 1VSCA 3ULVH 5TE7L 5I75C 1EZVY 4BFBD 2F74A 3CFJA 3TJEH 4E41D 4KVNL 1TQBC 2A83A 1FL3A 2VABB 1CD1B 1NGQL 1FL5A 4HS6A 1AE6H 5LXGH 3D9AH 5D9SB 4KMTL 2NCMA 2X4RA 3KXFB 1LD9B 5L7XH 3Q3GA 4NQEA 3T8XB 1JGVL 4WW2C 3LKSB 3ZKMD 4PJAF 1HHKB 4OLWL 4LGPB 4RRPA 3H0TA 1KYOK 4KZEL 3WXWL 3AREA 1R3KA 3B9KA 5BV7B 2D9QB 3WV0A 3E6HA 1MEXL 3VGAB 2W1NA 5HYJB 4F58L 4QXWA 5BVPH 3CC5A 4P59H 4R7NA 1PY9A 1KG0A 3L95A 2ESVA 4JO4H 4HF5H 3C6LC 5LCVH 1DVFC 3VG0H 3NIGE 3MRKB 2SEBA 4Y19B 1YDPA 2VZ1A 3PHQB 1U8QA 2R4RH 4GSDL 4M7LL 4NDMA 3RPKA 2G5RA 3GBNH 4MS8C 1U8PA 5L9DL 1CXEA 3QHZL 5D2LE 3FFCA 3SO3B 3PL6B 5GHWH 3W0WE 5J12B 1YC7A 1LO3L 4YC2B 3F5WB 3O2WH 3IS1X 4PJDB 4YHIB 3RWFB 2CRMA 4ZYKB 4MA3A 2NY2B 4YPGB 3PF2A 4AJ0A 1HHJA 4PB9H 3RWDA 2FLRT 3SDCD 4KQ3L 3FRUB 5MP6H 5DK0B 1N0XH 2CKBB 2IMNA 1T0PB 3PHQA 3PV7A 5ADOH 4P2RD 3QA3B 3RIAK 3G5XB 2R2BA 3KNBB 1UM5H 2ITCB 1YYLL 4UBDC 5C07A 3GJFB 1KB5B 3FB7A 1XGRA 3RAJH 3DXAD 4PRPB 2VDML 4UV4L 5EU4B 4JFDA 3NTCH 4LCCC 5B8CC 4Z5RB 2N4IA 3QUML 3U0WL 1MIEH 3ORJA 1PYWA 3D69B 3BSZL 1EJ6A 1FGVL 4ODWB 2MCG1 4Z5RA 3RWHA 2AK4E 3ULSB 3NFNA 4GUPA 1GOGA 4G80B 1ZANL 3N0PB 4JQVA 4X4MA 3BP5B 1U3HB 3I3EA 4J3OC 3KXFA 5E6IA 4LF3B 1M7DA 3LKPA 3DX7B 3S3JA 4BFEA 3QYCA 3GSXB 3WO4B 1WF5A 3BD5A 5FYKL 2DD8H 2ZG2A 2EDQA 4M6NL 5D7LA 3IDIB 4IRSA 1CL7I 1ZA6A 4TSAH 4U6HA 2HFGL 1N5YH 2P8PA 3UTSE 2IAMC 3LHPH 2BX5A 1FFPA 3FO9A 3TNNB 3NN8A 1KTLB 2WBJC 1ZWIB 1QRNB 4QT5A 3VXOA 5D7IE 5T1KA 3OB0H 4PJBB 3U9UA 4P2YA 2ZUQC 5I1IH 4ESKA 3W0WD 4KPHL 3PGCA 3LIZL 4NDMB 3JVGA 5F1IB 4FQIH 4AM0B 1T89C 3FKUS 4LFHG 1I3GH 2DQUH 1XFPA 5E1AA 1DVFD 3I3BA 3BE1L 1KLGB 2EH7L 4H25B 4G6ML 3SN6N 1Z3GH 3CVHL 4AK1A 3ZTJH 4P5TD 3VXTA 2XFXA 4HKZA 3ZHDA 2HN7A 4HS3B 5TF1L 3MUY1 2EDLA 2DQDH 3OAZH 1NAKH 4HCRA 2F8OA 4M3JA 1SM3H 2FATH 3QCVH 2VR4A 2XV6B 3NCFB 5TQ0L 2IPKB 4GQPH 1T5XB 3FQUA 2ADGB 3U1SH 4LASH 4ODHL 3PWJA 3WHXA 1RZGB 4OM0H 3ZMRA 1CGVA 1QSVA 3TGXA 4FN0A 3ARGB 4YHKL 1KC5L 3U0PB 4NRZA 2ICWB 3V5KA 4OD1H 4B0MM 5GGQH 2WIIA 1ONQB 3ZKNC 1HCFX 1WC7B 1EEYB 4N0RA 3VXNB 5SWQB 3GK8L 2B4CL 1A7OL 1MI5A 1H8SA 2F5BH 4M9PA 5E9DE 4M8QB 5D2LB 5DI8B 4PJDF 5T1DL 3GGWB 1SBSH 1SJHA 4PGCB 5D7LD 1I7ZA 3NH7L 3GSWA 1RUKL 3E6FB 5HGAA 1T3FB 1BOYA 3QULA 2JTDA 2KL6A 3QZWG 3HZMB 1KPVB 3SDAB 2ZOKA 4FP8L 1NGPL 5HHQA 2YD1A 3BIAX 3CU1A 1CCZA 4PRAA 5E7FA 1OOAA 5E2TH 4Z7OE 2FL5A 5BOPA 3X3GL 3WDJA 5AYUH 5L9DH 1I7TA 3QEHA 4P5TB 1A6ZB 4PRDA 5HXMA 1TZHA 5L8KB 5F44A 2QSVA 1MI5B 2VERN 5DS8B 5IEHB 4OF0A 3MGOA 5C2BL 5SX5H 4JZNB 3BMWA 3KLSA 4WWKD 1KNOB 2VXUH 2VITB 4YHPB 4ZDHA 1KIUA 1FH5H 3D3VD 3EW3B 2VE6B 4F7TB 2VDPH 2BDNH 1NCWH 2Q86B 2V2TA 4X5XA 5HGDB 2DKMA 4F2MB 1E6OL 3DPBA 3HCVA 1NC4A 4XAWH 1T5WA 1QR1B 5I75B 1LGVA 4MS8D 3TJHC 2X1WL 2IPKA 3OF6A 4GG6B 3GSNA 2BJML 3RIFK 5D7IF 4W6WB 1GGIL 3HPLA 3TO4D 2IPTH 4D3CH 4Z7VE 4AT6A 4KTEH 1A6UL 3ULUL 5JW4M 3MBEB 3QO0A 3WL9B 1T89A 5I8CB 4B5EA 4M3KB 4XPBL 3G6DL 3BZ4B 5D93B 1R5VB 3CMOH 2P24B 3VWKC 4OM0L 2ADFH 5HYIA 3DUSB 1JMXA 5C07E 1XF4A 3PDDA 1CICC 1QYGL 3GSRA 1BFOA 3QXWA 4O9HL 4JJ5A 1MCRA 4YZFE 5EU5B 2ZZUT 4JREC 5CP3H 1UXWA 1WBYB 5SWSD 1KCUL 2IBGA 2WBJA 43CAB 3BPCA 4DVRH 2VYRE 5CSZB 3RGVC 4HK3N 5T3ZL 3QXDA 4U1SB 4EBQL 1RY7B 2NY4D 3T3PE 4XC1H 2CMRL 1ZWIA 2E9IA 3NFSL 2MSPA 1GOFA 1FCCA 4NHCH 4MXVF 3RY4A 4KHTL 4K23H 2D31B 4M5ZH 3SGKA 3R06B 2R0WH 1IM9A 1NGXA 1GH7A 3FHQA 1T2XA 1CLZL 1MCOL 4ISVB 2BNUA 1YEIH 3QDME 3SKMA 3SCMB 1A7RL 3VI4F 5GGTL 4XCNB 1HHHA 1DL7H 5F97E 5E6YA 4LGSB 3BW9A 3BJLA 3GBNL 3ESVF 1CFNB 1FSKB 1N6UA 2FD6H 5C0GA 5CJBA 2UY7A 4HDIA 4TVSa 2VC2L 1UB6A 3A6BL 3N9GL 1X6LA 1MOEA 4MLSA 3OGCA 3NIFF 3RNKB 4FXGB 5GS1C 4XI5D 5E2WH 2FX9H 3HAEB 1B0GA 1NPUA 1C5BH 3X17A 4NOFA 5EBLB 3LMJL 2Y06L 4X6FA 4IRJC 4BFIA 1TJHH 1K8DA 2G5BB 2W60A 3QA3A 4HWUA 5MENA 2C3HA 4K3DH 5FA3B 4JHAL 1LQSR 1WGOA 3HUJA 1CE1H 5DQ9B 4I1NB 2DL9A 3BYYA 3VFSB 4OZ4A 4GW5B 5I76A 5HVFB 3S96B 3VDAA 3Q6GH 3SJVE 2AV7A 4W6YB 4J3VA 4NM8L 1GZPB 3GSVA 2X4UB 4XCYA 1BQSA 4X80H 1CZ8L 3D87B 3HMXL 1FO0L 2CPCA 1N26A 1UQSA 1AR2A 4RMUA 3V8OA 3WHE1 3D39B 2XA8L 2EDWA 5E6IB 3IETB 3JV0A 1T1YB 1FPTH 5CSGA 3UBXA 3U9PL 1UJ3A 4OZFH 3KAAA 3VA2C 5SV3A 1UB5B 43C9B 1S7TA 2H41A 3QJHB 5MI0C 1H3WM 3B8SA 3UTSB 3O3AB 4EVNB 4U05A 2DLIA 2XXCB 5C0FA 3KPNA 1A1NB 4ZNEE 3BWAB 2XN9D 3RWCA 1QRNE 1J8HE 2X4TA 1HHKA 3CH8A 1HYRC 2NXZD 5M7QA 2H2SC 1YMHA 1LO0H 3LN4B 2CO7B 1AJ7H 2Y4SA 4GH7B 4EI5B 1AP2B 4P3CL 2PYFA 4NZTH 2IWGA 4CVZA 1YEDB 3ZYZA 3UZVB 1IKFL 3BWUC 4GAJL 2CO6B 2GSGA 4ZUWA 1CD8A 4JFXA 4NRXA 5HVHC 4F7CA 2A1WL 3NZHL 4ORGA 3IGAA 1AO7A 2DJUA 5DC9B 4D94A 2CK2A 5IMLA 5A16A 4FQ1H 5MEND 3V5DA 3DXAB 5KJRH 1A64A 1UWGL 2XKNA 5CEYB 4WO4D 1N0LA 2DIBA 1H3UA 3FFCB 5LQBL 3ZYIA 3O3AA 4LVNC 3DMMB 3P0YH 1GOHA 3GRWH 1FRGH 3AU1B 1W8NA 1IQWH 2D0FA 3U4BL 3MNWB 2GT9B 2NW2A 2V5RA 2BNRA 5E2WL 3N50A 4L9LA 5LGJB 1T1YA 1FC1A 1A02N 1VACA 3V79C 3BPNC 4I18B 4ETQA 1FDLH 1A6WH 1HYSD 2IALA 3VRIB 3WIHH 2FGWL 1JUFB 2YPKA 4UB0L 4PLKD 2X7LB 4XCYB 3UEZA 3L7EA 4HCRH 4NWTL 5DEGB 2ITDA 5EWIL 1B4JL 4HIHA 2Q20A 2BVQB 3DIFB 3IJSA 4N5EC 2ORBL 5DD5H 4BSJA 5DC0A 5IVXF 4LLAA 4HJJL 5E8DL 4Y7MA 3ULVC 4WUUA 4P9ML 3SCMC 1CXLA 1UJTA 4FHBD 2DJ4A 5BZDB 5IQ9A 1XZ0A 4JFHE 4S0TD 2FJFA 1JWSB 4CVWA 2HYMA 4JRYB 5CINL 1OARL 4KGLA 3E2HC 4ODTH 2L7UA 1INEH 4UNVA 3BHBA 5IWLC 5T1MA 2D7OA 2XA8H 4HKJA 1B0GB 5EOCH 1U6AH 2APFA 3I6KB 4PR5A 2BCKA 1HYSC 4HMDA 2GQHA 5D4QA 1NCBH 3VXME 3JZ7A 1Z0MA 1YJDL 4XMPH 3ZKXB 2YPVL 2V7HB 3WNOA 3JWOH 2R2EA 3OJDB 3TZVA 1FL6B 3MRJA 2UV3A 3BEVA 2RJMA 1IGJB 2DTML 1KIRA 4PS4L 4S1SL 1J5OL 3PV6A 4KUCF 5CBEA 1WZMA 1NAMH 4OLZL 1NLDH 4PRBB 2BSSB 1KIQA 2HKHL 4ONFH 3C08H 4K7FA 2VLRD 1YECL 5HI4C 5E5MA 4PBWD 2VSCA 2GY5A 5T3ZE 1JZ8A 1QKZL 2GY7B 5BZWB 1NMBL 1INQA 3FN3A 5EDXA 2HA1A 4XNYL 4ONOA 3HZVB 3QEQA 5B22A 4N0UE 3BP7A 3IDXL 5BXFA 5DQ9A 3SDAD 4JB9L 4HIIA 1BJ1H 1F4XH 3FL7A 2EYSB 3PUCA 1RFDL 4HMCA 4LCCA 3CFBB 5IW1A 4EOWL 4LLVB 5F6HI 2XPGB 4LLUA 1X5YA 3CPLB 1SYSA 3KPTA 3QIWC 3T3ME 5HHOE 3SDXE 1JGUL 4MD5B 4W4NA 4X8XA 4GXVH 4AEHL 3M1BA 1YEHH 2PETA 3JV4B 3O3UN 1WFNA 5EA0L 4Y5VB 1ZGLP 1HQRA 1R3HA 4O5LL 4P2RA 5EUOA 4ZUTA 5GSVA 3L3OA 4WDIB 4MHHI 4JQVC 3LRGA 4LCWA 1Z9LA 3IFPB 4WU7A 5GS1A 1Q0XH 4U1IB 4LU5L 5C0JA 1YEEL 4Z95H 3RJDA 1ZS8B 2AW2A 1GZQA 4MQTB 4RMVA 5JZ7D 5GISL 2GCYB 4MMZC 4XVUC 2Z93A 4JR9L 4GKSB 3T08A 2AJ3A 5J13B 3HI6L 1DE4A 1CDYA 1NMAL 5A2FA 4DUWA 3WNNA 2Y5EA 4TSCL 4MD4B 5LJYH 3MGTB 3OMZA 1TTFA 2P8LB 4JZOB 3HC3H 2J88L 1YMMA 3TNMA 4HWBL 1KCVL 1P4IH 3C6LA 2W59A 3PXHA 5E5MB 5HDQL 4P4RB 4PJHA 3ARWA 4PY7A 3KYOA 4HGWB 3MV7D 3WIIL 1NUDA 2XY1A 1A7PL 5MEPA 3IDUA 5IKCB 3RUGF 5DA0B 2EDEA 2B1HH 2GCYA 4O2FB 5TDNB 4J8RB 4PJ9C 1RMFL 5K9KA 1TVBB 4MAUH 1UA6H 4IDJL 5T1KD 3IJYB 4DKEH 3DXAE 5KN5A 1T7ZA 1N7ML 4J7RA 3O45A 1UVQB 2GKIA 5JUEH 1XGQA 4L4TB 3X14B 5DJAB 1T6WA 2HVKA 5JUEL 1U9KA 4XHJC 1DVFA 2F15A 3ZYOA 2V9QA 1AXIB 4Q9QH 4KKBC 3QUKA 5DQJB 2A6IB 4V2CB 1VENA 5JPNB 4HS8L 3BQUB 4HUNB 2P5WD 3CDCA 3P4MB 3OXSA 4EI5C 3SDDD 5DRXA 1Q9WB 1QKZH 5FYLE 4NQVA 1EXUA 4LASL 3VXMB 3RWIA 2X70B 4HIIB 5E94B 3CVHA 1QSFB 5JIIA 4J6RH 2YD7A 2LAAA 3W39B 4WEBH 1A9EB 3KYKL 4FQ2H 5CJQH 5IBLD 1VKXB 4RFNC 3S37X 1ES0B 1Z9MA 4GSDH 4EOWH 4A6YA 4PGBA 1GVIA 2Z31D 4Z7NF 5JOFB 1GGCH 4QTHB 2CUHA 3QHTC 3EZJB 2C1PA 2OL3H 1BEYL 4Y16B 5F96H 2F58L 3IAPA 4FQJH 4B50A 4J4PD 1XF3B 2X10A 1OTTD 1NDGB 2H1PH 2P47B 1G0DA 4L3ED 2QHRL 3IDNB 5AUMB 3MZGB 4UT7L 1I9RL 3MOAL 3H3BC 1OGAD 2IH1A 1TTGA 1ADQA 1QFHA 1D6EA 1LO5A 4ZTPH 3T2NH 3DMMA 5CFHA 2AXJA 2ILLA 7CGTA 4LU5H 3K1DA 1I1AB 4JQIL 5DI8A 4KQ4H 3I6KA 3UP1A 3QUYA 3C8KB 4OLVL 1EUUA 4LMQI 3P4LA 4N0CD 5H37H 1I8LC 4UIKL 3BIBX 1RZIB 3G5YB 4KDVA 3OKLA 5C0RH 1ZHNA 3CIQA 3QI9A 4XCFH 3NAAH 3QFJB 4POZD 1QFOA 1GXEA 4FNLH 4KVNH 1NMBH 3TCLB 2CH8A 1EFXA 3CXDH 4G43A 1C16A 3G9AB 4KY1H 5B38G 3WIHL 3C6SB 1CL7L 2E7MA 3WFZA 3S9DB 5F21B 5GRUL 5CCKL 1ZT4B 3S5LB 1A1MA 2AXGA 1NMCC 1XCTA 1ZLVK 4GUPB 3TN0D 5DHVH 2AV1A 5ALBH 2VISB 1BJ1J 1OAXL 3KDMA 3LQAL 1Y18B 2ID5A 4XNMA 5FYJD 5I19H 1OAYL 4WNQA 4OI9A 1J11A 2HLFD 3LSOA 3VFVA 4N1HB 3UBXB 3T09A 3KWWB 5HDBE 1AO7D 2Y06H 4GBXA 2HG5B 5DK2A 4OF7A 1UFUA 3FB6B 2ARWA 2MJWA 5IHLB 4ZO9A 4UB0H 1OARH 3GHEL 1J8HA 3LEYH 4JHWL 5IIEB 4J4PC 5IESL 1GJIA 5ITFB 3JUZA 2ICWJ 3PQYE 1HHGB 1VGEL 3L6FB 2EEDA 1S5HB 1NSNH 4U6VH 4R4FL 3SE4C 1I1YB 2OM5A 2E8YA 3UTPE 1ZSDB 1T1WA 3OWEA 5HGHB 2ESVD 5J1AB 4UU9B 4G8FA 4WFEE 3QUXC 1NBZA 2AEPH 4KHXL 5IFHH 1JYNA 4ALAH 5IIEA 3MV01 5DFVD 5IV2B 3CZFA 1ZGLB 3AB0C 1DBBL 2ENSA 1TQBB 2J8HA 3C5JB 2SEBB 5JW5B 1WZLA 2OYPA 4Z7WA 4EUPB 4F7EB 3V52L 3KS0H 1BVKA 4PUBH 3AROA 2X4TB 1FYTA 4G6KH 2LU7A 4RNRB 4AH2A 4M5YH 4N0UB 1EGJL 1IQWL 5GRXG 1R3JA 2EDHA 1F5WA 4NRYB 3B2UC 4I13B 4I9WE 1ZK9A 5C0GB 3WS3A 1TQCB 1ZT4A 1EO8L 3PGFL 2CDEA 3OKKB 1NAMB 2BVTA 3DSNA 2HFFB 3H3PH 4JGMA 4HWNA 3H6JA 3DUUA 1KLUA 2BXZA 4J3UA 5DUML 3MLPA 1PX4A 3B9KD 4FQ1L 1D5IL 2IANA 4NQDD 3SKMB 3EYSL 4FZ8H 3HUJE 4JRXB 3WHE0 2MQ3A 3TT1H 4D0BA 3SQOH 3EYSH 1NSNL 2JIXB 4Y2OA 2PYEA 1XF1A 3L7FB 5TDPB 2YC1A 4HF5L 1W72H 4NHCL 3QH3B 1JYXA 2P5EB 4QRTA 5DJYB 1U58B 5SX4I 4ZYKA 1H5BB 1R3LB 3MMEA 3ELAT 4FQHA 4WHTB 4X6CF 5L2JB 3BQUD 4M4PA 4WWID 1G6VK 2MKLC 1JPGA 4ZS7L 2BSRA 5KJRL 1Z6JT 4NC2B 1EHNA 1MCKA 5K9JH 4N8VG 4MVBC 2WBJB 3SHSA 43CAA 4BKLA 1OAQL 1WISA 3IAQA 1YDPB 4YDLC 4XVSL 4HC1H 5EIQA 2X89D 1ORSA 2WUBH 3QFJE 3GMQB 3RY6A 1KJ2L 5IT2L 1GHFL 2XTLA 2ZOLA 3MJ6A 4KMTH 5F9WB 5B38B 4K3HA 1XR8B 4ODSL 2C1PB 3RVTC 1MFEL 4KHXH 5IFHL 4JGJA 5E95B 3W5NA 3AREB 4HDIB 2EXWD 2GJZA 4OBRA 1A9EA 4FQCL 3MJGX 4K3EH 4RGMC 5C0CA 3QZWB 3LKSA 3OSKA 3RVVD 4GRMB 3BW9B 4FP8H 1YEKL 5D7LE 5CMAB 3JTTB 2IPUK 3C6SA 5I1EL 1BF2A 2DI7A 2XN9A 5C09E 4BM7A 4XT1C 5I1CH 5EZIL 1IGYA 1JWMA 3MXWL 2BNQA 5IMKB 4NUJB 2A6IA 4OCYH 4TTDD 1OPGH 2NW3A 1UCTA 1TNNA 2FNBA 4OD1L 3GI9L 4K8RC 1P84K 1KIPA 4KJPC 5EUOF 4IRSD 3D85D 5E99H 3MLXH 3BKYH 3TPUB 3RWJA 1KT2B 2ADIA 4YXKL 5JW4N 3QDMB 3MBXL 4U3CA 4ZSOE 4IRZL 4OCSL 2V2XA 2ADJB 4QRQB 2R0WL 4EJ1C 1FBIL 5K33A 1MCCA 1DEDA 4MNQB 4S10A 2JCCF 4MB4A 4QRRD 2C1OA 1J1XH 5JW3H 3N1MC 1FFNA 2D4DA 4NZJA 3DV4B 2BSTB 4X9FA 1PEWA 4Y16A 4RCAA 4AL8H 2O61A 1OP9A 2HJFA 4WCYL 5F1SA 4PY7B 3EDJA 1Q8MA 4PGBB 1KIPB 4A6YB 3VW3H 1IZKA 1PY4A 2X44D 5DJ0A 3HPLB 2VL5A 1AHWC 2DIAA 1MWAL 4QRPE 1BQLL 2R0ZL 4UIKH 2OMNA 3VWJB 4LLDB 5HHVH 1V7NL 1JZ4A 2J8UB 1ZHKB 5HYQB 2X05A 4U1GC 4IJ3B 3FQTA 4PLKC 2YD5A 5F7NC 3U0TA 3ARDA 5EC2B 5CUSL 1EBAA 2A73A 1ZGLM 1MELA 4EBQH 2I9LB 1MCWM 4EUPH 3OJ2C 2LQRA 4JFDE 5D7KE 5GSRB 5SWSE 1DSFH 1OGAE 2X5PA 5J3HD 1L0XA 4MX7A 5F3HB 4YIQB 5HHXL 2FWOB 3D39D 1JGDB 1MHEB 4ZUVA 1S9VB 1YEGH 1MJJB 5DMIL 1H3XA 2NZIA 4XBEH 2BVYA 4TYUA 4LRNL 4GG6E 1UENA 1BJMA 3L3JA 1A7OH 1TVBA 2R23B 3GIZL 1UH3A 3CFEB 4QGTA 2DQGL 2LTQB 4H1LG 4LHJB 5C0BE 3VDCA 2ICEA 3GGWA 5CWSA 3QEUB 4XB7A 4CU6A 1I9JL 4FTVA 4EUPG 2FJHB 3I85A 5D7IA 4M93C 1XF2B 4CBPA 2VDPL 1MLBB 3MRRB 4JO1H 4ZQKA 4MXQD 4OZGF 1T6VN 5JXAL 2A9ML 3DOSA 1IAII 4X9HA 4QRPD 3N85L 2EDKA 3L9RB 4HHAA 3QBTB 3OKNA 4XBEL 2OBGA 3PV6B 5KVEL 1CQYA 3AM8C 5C0AD 2H2SD 3DURA 4QKXB 5LBSL 1U3HA 5DO2C 3RGVB 2WINA 3GM8A 1QR4A 1AD0A 4AEIH 1GYAA 5C0CB 5C0BD 1MJUL 2MHAB 4G8EA 2VLRE 4XGZB 5EUOE 2VLMD 3WUWG 5IMMA 1E4KA 5FHAH 1MCSA 3SJVB 4PTUA 3ARPA 3D3VA 1KC5H 5C6PB 4GRLA 5AG9A 1D5ZA 1ZLVH 4KI5F 2NX5D 5C08B 4M03A 4DKFL 1RZKC 4X99A 1JYVA 4HT1H 4PRPA 1A4KB 4X9BA 1XF5B 4F7EA 4ZFOB 3D39E 5T1DH 4JDZB 1T1XB 3GSNH 1IE5A 3N85H 4JRYA 1SYSB 1WBXB 1DUYB 4TSBL 4HV8B 4OGYH 1SY6L 4Y19E 3R1GL 1ZVYA 2AJVH 4Z0XB 4K7PX 1HH6B 5GS0D 3FB8A 3VFUB 4ZSOB 1A14L 5L6YL 4K55A 3TPKA 3OKEB 4MA3B 4ONHA 5FKAB 3MUZ1 1BQUA 3P40A 1HQ4A 3SDDC 1OB1A 2WANA 4HIHB 4ZAKC 3ZE2F 1JV5A 5GGUA 4L9DA 5DUBA 4TTGA 2YN5A 2Y5TB 1JUFA 2YPKB 3QHZH 3TA3D 4D0BB 4IJ3C 4LCYB 3EOBB 4QRPB 5IFAH 3GSXA 3CDYA 5ISZB 4WENB 3BT2L 2EDXA 5CBEB 2IANB 4JY4A 3O11A 1LVEA 4ZOCA 1I8KB 2RB8A 2XOTA 3O4LB 4RAHA 3HE7B 1WV7T 4R96A 3ULUF 5MEOA 3DV6A 1H3VA 4PJFA 1JVKA 1RD6A 2J7LA 2CXGA 2HFGH 4ONGL 5JR1H 4MZ2A 2YXMA 4APQA 4PJ9D 2OR7A 3WFDL 4M7JH 2Y7QB 4JCLA 5FYKD 4OKVB 4XNQB 4JFDB 2ED7A 3WNMA 1RJLA 4MWFA 5L7XL 3IXTB 4UILL 5F72S 1EPFA 5DD3L 2FRGP 4I2XA 3CUPB 3N1GC 3TBSA 1NFIB 2OSLA 4OLXL 1I3GL 5KSBF 4K7PY 2DQFA 4HFUL 5TGBB 2XZAH 3FMGH 3K8MA 3LN4A 3ETBF 4J1UB 4UU9A 4XAKE 1UG9A 2J5LB 4NFBA 3U36B 2PR4L 5D2NC 4Q7DA 3F7QA 3GBLA 2BVQA 3DIFA 4UOW1 1RFDH 2VMFA 4XNQA 3BUYA 1BM3H 5FO9A 4K2UH 3KPNB 5KVGL 1MF2L 1IGML 1N0XL 5ADOL 2Z4QB 4LARH 4LVOC 4WW1B 4GAGH 1SQ2N 3AMLA 1RUPH 2NXZB 4JO1L 4OF8A 5KZCD 1FAKT 1INDL 1DBJL 2NTFA 3WFEH 1M6OA 3QQNA 4LKXA 1RU9H 1N59B 4LHUB 3G6JA 4LLWA 3NTCL 4U1MB 4KC3B 2ZUQB 1KG0B 4M62H 5I8EA 5EN2B 4DTGL 3IETA 4JY6A 5BW7A 5EIVA 2GSIA 5I1GL 4PJGB 2CK0H 3VXQA 1IAIM 4D9RE 5GGSY 4K9EL 4AENB 4PS4H 4PRHA 3KDMB 3C9NA 4L3EA 1FVEB 1Q0YH 4AYFA 1B0RA 5DDHB 4MSWB 2GEEA 3DMMD 4YLQT 2AQ2A 2JLLA 2Q6WA 1C5DA 3OAUH 2AJYH 4F58H 3ZKMC 5D1QC 1LK3L 4RX4D 1FL3B 1DUYA 5IHZB 1NUGA 3T1FB 1MRCL 1F4XL 2QADC 4IOSD 3NZ8A 2EO1A 1T1XA 3TIDA 1YJDC 3NGBB 3X11A 4EI6B 5E99L 3ESUF 2XRAL 2R4SL 1JF6A 1EFXD 1AQDA 3E0GA 4I8DA 4NQSA 3FT3A 5GGSA 3SY0A 3C5SB 2NR6C 4Y5YC 3EHBC 4EN3B 4OCWL 4X6EA 4P2CG 5J7CC 1BZ7B 3RVXC 5BW7C 1MCQA 3BMVA 1N5AA 2JJUA 4FFZL 1YNKH 1F3JB 3QO1A 2VZSA 3DRTB 1A5FL 3WIHA 1RZ7H 5K9KB 4IIQB 3S37L 2H32H 1IGIL 1T83A 3DLQR 2G60L 3RGVA 2NLJB 1I8KA 4WUKL 1EO8H 1HHHB 1CFTA 3QUZC 5IUSA 1I8MA 4YHYC 2V9RA 4U49A 5GPRA 2QKIA 3G6AB 3NCYP 3QXTA 1BVZA 4UOW0 3ULVL 4EDXA 3M17A 1UQSB 1IGTA 4QTIH 4PG2A 1KPRA 5FYJH 5I8KH 2QSTA 3DX6B 1AD9A 4XPHH 3VFNA 4HGMA 2W38A 1F11B 1S7QA 2UZYB 3IJHB 5DQDL 1NGZB 3QIUB 2H45A 3WXVH 4L4TE 2FDBP 1PZ5A 5D7JD 5EOCL 5A2KH 4R7DB 3TH2T 3U46A 2P5WB 4LRIC 4C4KO 4YC2C 2ICEB 4YQXL 2ICES 3L5WA 1KB5L 3EFDL 5HTSA 1QEWA 2UZIL 1D6VH 3JV6A 3I9GL 5E00A 3CFEA 3QCTH 4G8GD 5DMJB 3O6LH 1GZQB 3MBED 2CKBH 4JKPL 4JE4B 4PBXA 1T03H 5M94B 1BFTA 4F9PC 5K59F 1HKLL 5DLML 4A6YH 2IAMD 5ISZD 3WL9A 4HIJA 2AJSL 3CXHJ 1RHFA 3A6OA 3TJEL 2CUIA 1QFUH 3RZCB 4OZGB 3M1BB 2B20A 4F37K 3S37H 1FDLL 1DL7L 2GYSA 1RURL 1CFNA 3O0RH 1E28A 3ARTA 3O3EA 2VLRB 3NIFE 4OV5B 4JM2A 3OKYA 1BX2B 4XBGA 4U6VL 2IBZX 3EBAA 2RCSL 3OKNB 1JCKA 4TUJB 3FRPG 3BN9C 2XRAH 2R29L 3FONA 4WHCA 3TC9A 4QWWD 4XVSH 3H2WA 3Q0HA 1E4WL 2O5XH 5B4MC 4KROD 5CGMA 4G6FB 5C08E 3KXFD 5JPMB 3GMNA 3FT4A 2OMBA 2Q8AL 3FCTA 4XP9H 4AQOA 1JZ6A 5J9PB 1RJZA 4OLUL 5DS8A 5KOMC 1GGBH 2HJFB 5CWSB 2NXZC 3QXDB 1RUPL 1NCUA 4YBLC 5FYJL 4PUBL 2VLRA 1JN6B 4M6OL 4PJCE 4K2UL 5D7JA 4Z77B 1FJ1B 4Y4KD 3LDBB 1JBJA 3NAAL 4Y88A 5HPMB 2HMID 1OGTB 1UZ6E 2XWJA 2G9HA 1KPVA 3SDAA 4DVBB 1MAJA 2Q76A 1S7XB 5J4MA 5DTFB 2YKLH 2DTSA 3EGSA 5CJ8A 5FGCB 3RWJB 3HZKA 4Z76A 1I7ZB 1S5IL 5I8CA 4NKIH 3SOBH 1TXKA 5T5NF 3MV7A 3KPSB 2ZG1A 4OJFH 4HKJB 1OTTC 2HJLB 2FZ3B 1E4KC 1T2QL 4N0CC 2XZCH 3NVQA 4XAWL 2X9WA 3TIDB 2N1KA 3WLBB 4LSSL 1EHLL 3GSNB 3QUXD 4YHOH 5ESVB 4DCQA 3TP4A 5IHZA 4PJXA 2UUDK 3NIGF 5KSAC 1G1YA 3AM8A 4LARL 5BS0E 1L7IH 4Y2DC 4JZJA 1PKQA 3SBWA 1MI5E 5IJVB 3JVGC 3HE6D 1ZA3B 4NO3B 4GRMA 4ZFGH 1ZHKA 35C8L 4GKZB 2V5YA 1S8DB 4X5WB 2PR4H 4ELME 5ACZA 1JPTH 3PQYB 3L5HA 2ZCHH 1F11A 2CJUL 4WEBL 5AYUL 4DZBA 1JHTA 1CU4L 3U7WL 1HINL 4Q6YA 4UT6L 4OCMC 4M7KL 3M17B 1E0OB 5FHAL 4LCUA 5JORB 1NEZG 5DD3H 3CSGA 2H1PL 1A0QH 2AERT 1OCWL 2XXMB 3VXSA 5F7DA 1C12A 1UM4L 2Y9RT 1HDMB 2IQ9L 4LVHB 4L3AA 1ZLWK 3DRQA 3DWTA 3BXNA 1UJ3C 2C9AA 5C0IB 5B39G 2WP3T 3HKFA 3ZDXE 1OT1A 5F1IA 4URTB 3S35X 5HDQH 3UPCA 1TDQA 2HWZL 2V5SA 1AGBA 2NY7H 1YUHB 1IGFL 4X6EB 5EOTB 3MRHB 4ZFZB 4U6XB 5IB3B 1FLRH 1YY9C 3BPLB 3BUYB 3VGDA 1FQ9C 3SQBA 1SY6H 1G7JB 4LQ1A 1H3TA 4MDIB 4FA8A 1FZOB 1V3MA 4QRRA 2QL1A 1MF2H 3LKOA 2WBWB 1I1AC 1ZMYA 2VLKE 3U2SA 3O2VL 3HG1B 2EDYA 4I0PD 1N3NA 3OX8A 5DRWB 2FO1A 4XZUB 5EO9A 5DJ2B 2R1YA 1C5CH 4LF3A 2WWMC 3QIBD 4NGHH 5E8EA 5D5ME 1R5WB 3CVIL 3FT2B 4RMTA 3V6ZB 1KCSL 4HUXB 4BSVA 3ZT5A 4O58L 1ZTXL 4OQTH 4U31A 1QBML 4Y19D 1T7YA 3MLSH 2YPLA 2DBLL 3WO3B 3VWKD 4AENA 1QG3A 3QRGL 5I17A 4YDJA 1JHLL 2BOCB 3FO1A 1P5VA 5TFSL 3PP4L 3MR9B 3P11H 5CZKA 3O2DL 3OR6B 4ENEC 1FG2B 1N59A 2HT2C 4LHUA 3KPOA 3O9WB 1CDJA 4AM0A 4YAQB 3I2CH 3MBEC 1CDIA 4D9QD 2EDDA 2Z31A 2ZNXA 3DYOA 3ALXA 1FNHA 2EC9U 3IDYC 3VI4E 1IEHA 3T65A 4CRPA 2Y5TA 3LD8C 5IVOA 2EXYD 1OT2A 2BRRH 5AAWA 3VGAC 1WCBA 2CXKA 4LPVA 1A6VH 4E5XB 2XTJC 4XVTL 3B9KC 1QLRA 3AREC 2VDKL 3WD5L 1VESA 4N68A 5IHUL 3BYTA 2DYPB 3CH1B 1I1RA 2RR3A 1N4XH 5J8OA 3F12A 1M7DB 3LKPB 4YAQA 3GSOA 1U8JA 3KGRA 3LKNB 2H26A 3SJVD 3KWWA 2J3SA 3DUUB 3VE0A 4U1LA 3DVNB 1E6JH 1K2DB 4R0LC 4AG4H 2ZSWA 5HHOD 3RAJL 3FHAA 1H9VA 3KPLA 5EZOL 1TITA 5E6ZA 2PN5A 3IRPX 1YNTA 4HT1L 2KDGA 3H7BA 4GT7A 1J05B 3WFCH 4DQOL 3GJFA 2VLJD 3LZFH 3V6ZA 2XTJE 2YWYA 4UUJB 4WFED 2VO5A 5KSUA 2X9XA 4O2CA 2WINB 5GS0H 4GRLD 4W6XB 1MCPH 4JRWA 4F57H 5IB5A 1U8JB 4CKVX 3MLSL 1F42A 4P2QB 2EH8L 2J4WH 4R90H 3RPIA 2FR4A 1T1ZA 3LRSB 1FNEA 2EDTA 4NQCB 3RWEB 4HCRL 2EH8H 1NFDA 3THML 4TUOA 1NFKA 3V0WH 1F13A 1KJVB 4PJXF 3PWLB 4GBXD 2C3XA 4K71B 4PJDA 4UAOB 3ARFC 4MDIA 5SX4H 3V4VL 5JXAH 5GJTH 3QEUA 5IJKA 5I1IL 2RFXB 2DQJH 4XMKH 4ZFZA 5IB3A 3HUJB 1YA5A 5I1JL 1Z9OA 5IVXA 2YN3A 3P9MB 5F6HJ 4HV8A 1BGXH 2CJUH 2H8PB 1BREA 4U7KA 1JGUH 1X3DA 2GJ6D 1LK2A 3IFLL 1MCIA 3VCLA 5ELIA 4YBHA 4ZAKA 5LKNA 3TBTB 4LRNH 1NCCL 4IS6A 2YRPA 5F3HA 3UDWA 4OLWH 1ZLUK 5ENWA 3MYJB 5FIEA 1A6WL 2QQKH 2AV1B 5C0CE 1VEOA 2BHUA 4PJ5A 1MJ8L 1NDMA 4HUXA 4X4XB 2YS4A 1YECH 3DO7B 3W39A 2O93L 4R3SB 4X7SL 1AKJD 5SWZB 3U4BH 2ORBH 1CU4H 3U7WH 3ZSSA 5C09A 2YOCA 3O8XD 1MCDA 5KS9A 2PXYC 3CSPA 5GZNC 1NBVL 4UV4H 1LHZA 3OR7A 1U3JA 4P46D 3SEPA 3CSYB 1U41A 4F15B 2VXTH 4FQXB 3KPSE 2IAMB 4NO5B 4PJDE 2VL5B 1UM6L 4GRLC 4HH8A 3PWPA 3MGOB 5IEHA 4YBLB 2HJLA 1XGQB 3P9WB 2VZVA 2FBJL 1F45A 2DQHH 1I4FA 3LPGA 1U6AL 3UMTA 1AHWB 1L6XA 5I1DB 4M6NH 2VSDA 1EEZB 2D7QA 3NPSB 4P5MA 4ZS6C 3I50L 4GBXC 4XWGL 1CG9B 1CGUA 4I77L 1F3RB 1FFQA 4TN9A 5F7KC 1KT2A 1NDGA 3ARED 2DRUA 3Q6GL 4ZD3H 4QTHA 4XNUL 1QSZA 5JOFA 1WICA 3IDGA 5I74C 4G6AD 2RGSA 4ZD3L 4AT6B 3HC4H 2GJ6E 4DN4L 5ID1B 3L3GA 1FP5A 3MYZA 1B4JH 4LCIL 4P3CH 5IGXL 2IAMA 2F53D 4WI4A 5KSVB 1PG7H 5DD1L 3V6OC 4LP5A 4M9OA 5IQ7L 4I5BB 3H7LA 3FQXA 3G04A 1OTSD 4PJAB 2NR6D 1G7IA 1YPZE 2VRAA 2O5YH 3QQ9C 5E94A 4U0QB 1XGTA 4MJ5A 4DGIL 2I07B 4KKBD 4QHNA 1EO5A 2IJ0C 3AMKA 3GMPA 4JHZA 2H3NA 3BP6A 5KBNC 3P4MA 5C0CD 2FH8A 5FM5O 3TYFA 5H94B 1KF9B 2VITA 3OGOE 1NDMB 3OKOB 4NQCE 4KGJA 3ROOB 2W9DH 2PW2A 1CDBA 3CFIC 4PP2B 1G7MA 5C09D 5J6HA 1QLFA 4WWKC 5E70A 1W8OA 1OAXH 4OUUA 2GUOA 3UTZA 2M26A 2UY6A 2ED8A 4Z7UF 4UDUA 3PG2A 5E03A 1A7RH 5I9QB 1JPTL 2OTPA 4UQ3B 4L8CB 1BWMA 2IANE 3KS0J 3M8OH 3WJLC 5HBBA 4QHUB 3HMXH 4L29A 4NBXB 2X4SB 4NNPL 5TDNA 3BIKA 5CZXD 3QPXH 5B4MD 3CX5J 3E6FA 3GSWB 4HC1L 5IVXB 5J89A 3DI3B 1AHWA 5ETUB 2DWEB 1QTYT 2E3VA 2BSRB 3T0BA 2FBJH 3TBVB 4YXHH 4C56D 3K1KC 4PY8I 5DHYA 1YNKL 1QBLH 1E4XL 1U0QA 1KPUB 3O41A 4O2EA 4NO5A 1BD2D 3ZKND 3DARA 2YA1A 5C9KA 3OKDB 4BUHA 5E8NA 2AK1L 3VU2A 3UO1H 1P4LA 2ZUYA 1DE4B 2E6JA 5FGBA 4U1JB 3RJQB 3CMOL 1F97A 4OGAD 3EAKA 2VXVL 5DZNA 3KLAA 1KLUB 2IQAA 5CMAA 3DUHA 2DQJL 2W07A 5ICXA 4OB5H 1K4CA 4IIQA 1T5XA 3RUGA 3ULVE 4UUJA 3DO7A 5MHSE 4X4XA 4W81A 1WSST 5EIIB 2GJZB 5SWZE 3U7AA 1FO0A 4W70A 5DUMH 4U0RB 5K59E 3GNML 5HI4D 1CTOA 3L3OB 3T2PA 2QSCL 3LN9A 1S7RA 4KY1L 5KG9B 4XC1L 2OR9L 4NCC1 4X80L 1ZT7A 2D3VA 4FFYL 3WN5B 3F7PC 2ZUXA 1KB5A 1MJ7H 1KLGA 2A2QT 1IKNA 2LAGB 4XMLL 4PB0L 5ISZE 3KNBA 2R2BB 2XICA 4EXPX 3DI2B 4P9HC 3JWNC 3CFBA 2FEDD 4N9OB 4N8CH 3N1QC 3UAJD 4KQ4L 2DYPA 4JFYB 5HYSB 3HRPA 3MRPA 1IC4L 2DQIL 4GFTB 5JLZB 3B4NA 1ZVSB 3QQ3B 4F7PB 3OPZH 4PJHE 3WFDH 2VLKA 2PO6C 4TVPE 4HFUH 3D2UB 1BOGA 4KTDH 2QJDA 2QHRH 3L3DA 4LEXL 2YA0A 2VLJE 3C9NB 3RY6C 2KQMA 1KPRB 1ITCA 2IALB 3VRIA 4PJ8A 1WWBX 3PJSB 3H9YA 4JAMA 2V2WB 4C56A 2AXFB 2GSIB 3DX7A 3HFML 1HKLH 3EJYC 2YBRB 2DF3A 1SBSL 1A6UH 2YD8A 3MRQA 2G75A 2Z91A 4Q6IC 4CNIB 5ERWA 1SJEA 4KTYA 3OG6B 1IJ9A 4LSQH 3SGJA 3DTXA 4OF5A 5CGYD 3NA9L 3CCHA 4KKLC 3IU4H 4GJTB 5KVDL 1U3HD 4DTGH 5ICZA 3SY0B 5GGSB 3T4AA 2ZSWB 1NL0H 4JFFD 4H20L 3FB7B 4S1RL 3X11B 1P4BH 2WWKT 5IMLB 4AEFA 2VNCA 1VADA 4XP6H 3TA3B 1JNJA 1HXYA 2XWBA 3S8WA 1U8KB 1WITA 1YY8A 3QHFL 1IEAB 1F2XK 1QD0A 3REVB 5I8KL 3LKNA 5LWYL 4HBCH 1TFHA 1I9EA 3QAZB 2M1KA 5D1QD 4WI5A 4HK0B 1BZ9A 4ZMAT 3RVTD 4HJ0C 4UINL 3MUJA 3HLAB 4WWKA 3TBWB 2V5TA 3V7AG 3VXPA 1YMHB 1BPVA 3VA6A 3TESA 1EDQA 4Q2ZA 5CD5C 3RWFA 4YHIA 4MSWA 1FZOA 3PP3H 4D0DA 2ITDB 3QUYB 5H2BB 3AVEA 3RVWD 5D72H 2R69H 1Q94B 1WAAE 4L3EB 4ODXB 4GAFB 1ACYH 1QZ1A 4WJ5A 1XH3A 3GMLB 3JTSA 4NN7C 1LEGA 2R4SH 4QRUB 2UVFA 2W0FA 8FABB 3ZE0F 4YEEA 2GIYA 3QG6A 1C8PA 3TO4A 3BVNA 2GT9A 2NW2B 2DS4A 3VD4A 5MI0B 1H5BC 5CZVH 1NCWL 5TF0A 2B7DT 3SE4A 3PJSA 4FXKB 4CL7A 2Z4QA 2J6EL 1QBMH 2VISA 3MX0A 5E7BA 4J4PA 2XZQH 1U93A 4Y4FC 3ZTJG 4BSVB 1M7IA 4BSWB 1EVUA 4OZGE 4PLJC 3S88H 4YR6B 2EEBA 3QNXA 5JDSA 2IGFH 2V5MA 1PQZA 3VFSA 4D3CL 1EUTA 3FB5B 4PJGF 1G0YR 1LO4L 4KKAD 1BHGA 5T5NG 2YK1L 1ZT1A 2PYFB 1OWRM 3TM6A 1RVFL 6FABH 1C08A 5C0DA 1YEGL 1WBXA 2JB5H 1ZLSL 4KU1A 5ESVA 4DCQB 3GSUB 1P69B 5DF0A 3QI9D 3FN0L 1RZIA 4MQ7A 2XWBB 4L8BB 3I2CL 1A7NL 5D1XC 2W65B 5ECJE 4U7SA 3X14A 4P0DA 1OWWA 2RAMA 5IW6A 4H0IA 4WV1C 5FCUH 4X6DF 4JR9H 4HKXA 4F9LC 4FQIL 4LEOA 1SBBA 4JB9H 2FCBA 4NT6B 2KKQA 4GRWE 1M05A 4PREA 1RHHB 3ARFA 1P7HL 2PO6B 4CN1A 5C8JA 4PB9L 2D9CA 1UJ3B 2A77H 4OIAA 4O2FA 2IQAB 2YBRA 3C5ZC 1FZMA 4R97B 3VXSB 3B43A 1NEZB 5IKCA 2HKHH 4ONFL 4JAMB 1NBQA 2C3VB 3ZL4L 1NGPH 4UDTA 4WFGD 5GHWL 1CGXA 4RMWA 3U30B 1QPXA 2ATPA 3D25A 3QUMB 4NUGL 2APTA 5HHMD 3T4YA 4QY8B 1U91A 2IGFL 4HUUA 3Q5OA 5JXED 2VTFA 3VGGA 1JPST 3RTQC 4JM2C 3FO0L 3JSSA 4MDJA 1U3ZA 4M7ZC 1NCBL 2A6DB 2J8UE 4PJFE 1BX2A 1J8HD 4M1GH 4KRMB 5CSZA 4KFZC 3DECA 3QHFH 5F7LB 3IKKA 1IM9D 3ALWA 5FECA 4C54A 5JW4R 1A7NH 1H15B 1NLBH 5ABDE 4QXUH 4JLRB 2FHBA 5BJTA 3T0EA 2AI0H 3U83A 1TENA 3LKQB 2LVCA 3BZ4A 1R0AH 2QQLH 2W0LA 3ABZA 5HDBF 4P3WA 4HPYH 4N1CA 3MROA 1UYWH 1OGAB 3TV3H 4RMRA 4ODUA 4YDIL 3O6FC 4KJWC 2GUOB 2M8XA 5IW3A 3HNTH 3MNZB 5GZOC 3SO3C 2DOCA 4LFHD 1OTUC 2DM4A 1WTGT 1G9NH 2HJKA 2X1PA 2MHAA 1FYTD 4G8EB 2E27L 5IW1B 4C59B 1L9MA 5I8OL 1EV2E 5HHOA 3SDXA 1MHCB 5FECB 4WCYH 1SHMA 3VH8A 1UH2A 3K46A 2D2OA 3R1GH 2DN7A 2NMSA 4XP5H 4LBEB 3QFDA 2YEZA 3HS0A 4NSKB 4JDTH 4HXAL 2OX5A 4YHYB 4PG2C 4KKLD 5C6TL 3MRNB 5DLMH 5F7HA 4ZTOH 1G9NC 2Y36L 2E5EA 4D9QE 3GSQA 3L3GB 3EO0B 2J8UF 3OV6A 4PG9B 4NQDE 1KGCD 1UKSA 2OP4H 3MJ8B 1MQ8A 1P6FA 4OKDA 5ALCH 1DQLH 2F8VA 3CAFA 3FN0H 4JDVB 4LVNB 2VIRB 1NKOA 4V1DA 2MMXA 4XBGB 5T3XH 4ZPTA 4F7MA 1EBPA 3HRZA 3EDFA 3RL2A 3P4NB 1KJMB 4XH2B 5BS0B 5I0DA 1L0QA 1JPFB 5AD0A 1L4IA 1IAOB 4HUVB 1P7QD 4LLQB 4ZS7H 2OR9H 1XMWA 4ODSH 1J1XL 1AI1H 1SJHB 3MBEA 3QO0B 4PR5B 1SMOA 4NM8H 3BD3A 3EO1A 2R1XB 1AGEA 4S1DD 3GMOA 4MLIA 4QEGA 5JQ6H 5FYJE 4MQ7B 1UACL 3S6CA 5BJTB 3UTTA 3BKYL 4OZHE 5EBMA 4Y4KC 4DN3H 2GK0A 4HGKC 1T21B 3MCG1 3LAFA 4H26B 5EO1A 4G8IB 3OAYH 3PWJB 1N64H 1DTUA 2A6DA 2O5XL 1X44A 4U0RC 3V2AR 2VAAB 1PAMA 5BO1L 1E4XH 4LSQL 4F7TA 3MLVH 4LLDA 1PZ5B 5DEGA 5BZWA 1F02I 3O8XA 1QLEL 5DJ0B 1DBAL 4WI6A 3O0RL 4OZIA 3WSQH 4WUUD 5ITBL 3A6BH 3N9GH 2R0KL 4LPUA 1KUMA 3H3PL 2QKIB 1T2QH 3G6AA 5CIPB 3GO1L 1TJIL 1J1PH 3MUGB 4OCXH 3Q1SL 1VFBA 5IF0A 1K8IB 3O4OC 3GO1H 4F80A 3MSPA 5L88L 4JKKA 4HEME 5ESAA 4PIRF 4U6YB 3I6GA 3DVIA 2V2XB 4QRQA 1H0DA 4QRUA 1LEGB 1KTDB 4LEOB 3HE6B 4PRNB 1U8MA 1UZ6F 5DMGC 2RFXA 4GKOA 2XKUA 4CMHC 5IW6B 4X4YB 3QDAA 3P0YL 5F1KC 4JRXD 3I6LD 4OT1L 4XBPB 4K71C 2WQRA 5FO8B 5CZXC 1MFDL 4L8BA 1UKTA 2ZP0T 3BAEL 4WI2A 4X98A 4FTVE 3D0VA 2VZTA 4ODVH 2XTJB 3PNWA 5D8JL 5T1LB 4F8TA 1RIUL 4K8RH 4AL8L 4P5TC 1RZGA 1G7HA 1FNEB 3O6FD 1JI1A 4R4BB 5DJDB 2R2HA 2CDGA 3ZDYF 3T0XA 1RSFA 1TIUA 3QPXL 4GKNA 2K7QA 1U8KA 3EDKA 4KRPB 4YR6A 3ULVF 4HAGA 3MRBB 1RJLB 1WAAA 2OL3A 4XNZC 4PJ5B 2Z35B 1TMCB 3LD8B