2Z31A

Crystal structure of immune receptor complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLQVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31A00
1B6UA 2YWYA 4YX2H 4F7TA 3S4SB 3ZL4L 1EXUA 4IHOA 4GBXD 3OKLA 1IC7H 1AO7B 3X3FL 3M8OL 1NGQL 3REVB 1N0XH 3SOBH 2UWEE 1A9EA 2P45B 2VLME 3T4YB 5GRWA 2A0LC 1JI2A 3RFZC 1IKNC 1F2XK 2XV6B 3VXTA 3LPWA 5KOVC 2EH7H 3QFDA 5JDSB 4L8CA 5EC2B 1IAKA 2GQHA 4DZ8A 3FOLB 2NY6D 4UV7H 4LCYA 3F58H 5EBLB 2CDGA 5DMIL 2YUZA 5IWLC 2VIRA 4XH2A 5IMMB 1S3KL 4WY7H 4HCRA 2VYRE 4ESKA 1WWBX 3HI1B 3MV7A 1XT5A 4NRZA 1KJ2H 2DQCL 1HQRB 2AEPH 2FZ3B 2A6KB 4HS6A 4BA8A 3QXWA 2BVQA 2FWOA 5K59F 2BSSA 5DK3A 5DHXB 5EZIH 1UJ3C 1CBVH 3PP4H 4P9HH 1S8DA 4M7LL 3T1FA 2A74A 3LS4L 5D7SH 1INEH 3F5WA 1IJ9A 4Y7MA 1X5LA 1KV3A 5TDNB 4G7YH 4F7EB 2Q8AL 3H9HA 1VFMA 3WHE0 3C60C 1NBZA 1PZUB 1E27B 4MAYB 3MLRL 4X7CC 4C54A 2IQ9H 5FXCH 5DRXA 4FXKB 4UDUB 3B3IB 3GSOB 3LVEA 4KH2A 4JRXA 1MFDH 1TTUA 4EEEA 3LPFA 2I24N 1IM9A 5LBSH 2AKRA 3QPXL 5E9DD 4MB3A 5DSCA 4KKLC 4J3OC 3EHBD 4MD0B 1J1PH 5I2IA 1N5YL 1G9NL 1PZ5B 3KYAA 2L7UA 3VI4E 1CVRA 1OQOA 3O2WH 1MJ7H 5T3ZL 2DD8H 4G6ML 5E5MB 4DVBB 2KQMA 5C08E 4XP6H 4HWBL 3GJFH 3O8XB 1TCRA 4ZO6A 3RPKA 3MZGB 3KPSB 1YY8B 2QHRH 2NXYD 1ZA3B 3D25B 2IG2L 4JFQA 4MAUL 2V17H 1T0PB 4YEEA 4OLUL 1XF4A 1V05A 3PV6A 4PJBE 2C1OA 4K7FB 1KJVA 4H25A 4ODXA 1JHLL 1NGYA 3C6LA 1MJUH 1CGYA 1HH6A 4IM8A 5EWIL 2V2TB 4FQQB 4DOHB 3I6KA 5JW3H 1HEZB 4V1DB 4TTGA 4PUBH 3QI9A 2CIKA 4WW2F 1JNHA 2DLTA 3R8QA 2E27L 4K9EL 2HKFH 1QLFA 1JGLL 4OLYL 3ULVF 1NGWB 5CBEA 4LRIA 5DVLA 1B0WA 1UGNA 5L6YL 1FNFA 4G8GD 5DUMH 3TJHD 1NLBH 5HI3D 4YZFF 5H35B 4XPBH 1F90H 2AEWA 4Y16D 3DETD 1CE6B 4WWKC 2X05A 5F6HJ 4ZPTB 2AK4D 1JPFB 3QHFH 3QXDB 3S35L 1MIMH 1S9YA 4D94A 3R1GL 4JLRA 1T5XB 4IRSD 3A67L 3MRHB 1OGAA 4U1JB 1OAYH 5D9SA 4MNGB 2D4DA 2G2RB 5E1HB 4W4OC 3FZUD 5LQBL 2A77L 1ZHNA 2YPVL 4UB0L 4D0BB 1FN4A 5DJ0B 4RRPG 4NQTA 1KPUB 4GBXB 4PJCF 1IQWL 2Q3AA 1FIGL 4YDKL 3BZ4B 2D7PA 4XCNB 4RFEB 2MHAA 5GGTA 2IFFL 5I9QB 4NGHH 4XPFL 4CMHB 3DX8B 4XMKH 4MA8H 3U36A 2QADC 3PDOA 1T1XB 2ADIA 2W1NA 4YX2L 3FB5B 3T65B 1KYOJ 1I7UA 2IJ0C 5EDXA 5HBBA 35C8H 4NWTH 1FAIL 2LU4A 2CK0H 5CUSH 1D9KD 5CS7A 1AGBB 2ZP0T 5GS3A 3EZJB 4P0DA 1MCCA 4F58L 3M17A 4GS7B 3ARVA 3E2HC 2VLMD 4TUOB 1BD2E 1WBXB 5C3TA 4NO3B 3REWB 4ZAKD 5AD0A 4HCRL 4P2QE 3LH2H 2X4PB 3IAGC 4G8EA 1U8JB 1T20B 2DIBA 3F58L 3IS0X 3IAPA 2YA1A 4F80A 3ARUA 1BQUA 1RFDH 4WY7L 1MQKH 2I25N 4IOIB 1EEYA 5CILL 2P46B 5AEAA 1EZVX 4UUJB 4OSUH 1E6OH 4WU5A 2X1PA 3MNZB 4YE4H 4XBPB 5AAWA 4GQ9L 2W92A 1BZ9B 5DQDL 1K6QL 1CBVL 1FLTX 4ODUA 5DVOA 1XH3A 1HHJB 2BNQA 1AY1H 4PTTB 5D7SL 3TLRA 1AGCB 1INEL 4PRAA 1AD9B 3WS6C 1CXLA 5E9DB 4LVOC 1A8JH 4CU7A 4G7YL 4X9HA 5I8EB 4OCMC 5D7LB 1FDLH 4A2MA 4EZMA 4XBGB 2ZOLA 2HT4C 2NZ9C 4R97B 4IMLB 4HUUA 3QSKB 2XT1B 3VXRB 1IAIH 2D0GA 4D9LH 4OFKA 1AHWA 4G8IB 1MFDL 5F9DC 4KGJA 4U6HB 3TIDB 3JVGA 5LBSL 3KPPA 2MKLC 2SEBA 3P9MA 5F70A 3VJ6A 3CMOL 3VGHA 4LPVA 1FVCB 3GK8L 1NDMB 1KBGH 3O2WL 3SE3A 1NLDH 2DD8L 3B9KD 4JM2D 4WHYH 4Q74A 5HHNA 4L4TE 4MHHG 1J0HA 5HXMA 3K3QA 3EO9H 1G0DA 1KTLB 5C08D 3T3PF 3VCLB 3QJFB 3BDXA 4IRJA 3HAEH 4FP8H 3F7VA 1MWAB 2QHRL 1CD9B 4ACPA 4DKEH 3RVTD 4C4KT 1YEFL 2YWZA 1L0YA 3ARWA 5DK0A 1QRNA 3TA3A 3DVGB 1ND0B 1XR8B 1EO7A 5E0QA 5KW9L 4RA3A 3WLBB 1MJUL 2X1OA 1MFAL 2IMNA 4LNRB 1KTDB 2O5YH 2VLKE 4Y16B 2F5AL 3WE6A 4PUBL 1LO3H 3CFEA 2FHFA 2MSPA 1RMFH 1BBJA 1HHIA 1JYWA 5BXFA 3WNLA 5DHYA 4QLRA 1IEHA 1CDCA 1FRGH 5GRVK 5A3ID 4Z7QF 1MLBB 2FEDC 4LCUA 3CVHH 2XKNB 1Y6KR 5DUML 3VD5A 2GCYA 4P99A 4JN1L 2XPGB 4Y4FD 2BY0A 1F90L 1MY7A 4RGNC 4BUGA 1TVHA 4QRQB 2GTZA 3D39E 3MLZH 4U1SB 3QHFL 3KAAA 1DQQB 5ESVA 4ZFOA 4CGTA 4NWUH 4H26A 1A64A 2HWZL 4HKZB 4NJAH 5JPNA 2EYSA 1JNLH 4ZTOL 4LRNL 1MHEA 2FX9H 4ZODA 3TP4A 3PWPE 4J8RA 1FBIH 1OAYL 4IDJL 4CVZB 5J06A 2P5EA 2XA8H 4L8BA 3BPNB 4HIJB 3PL6A 3Q6GH 2MPAL 3RI5F 1CGWA 2XN9E 4YGAB 5TDOA 1K9TA 1F6LL 1I1FA 4MS8D 5H8DA 3DRQA 5D96B 3OWEA 3TO4C 2X9WA 3O81A 2X42A 5D6CA 3O2VL 5DURD 3R8BB 4NKOA 2BERA 3WXWH 5DD3H 1JRHL 3WL9A 1AR2A 3X14A 5GZNC 1OP9A 2BFVH 4XNUL 4N9OB 2P4AB 1C7SA 1XEDA 4XMKL 4LLDB 1NEZB 2B4CH 1DEEA 2ATKB 1XF2B 3TZVB 1U8LA 4EI5A 4QCIB 3D85B 2Z31C 4PJHE 2DM2A 1UB5B 5BW7A 5FUCE 4LDLB 1Y0LA 4NO0B 4NCDA 5L8JB 3RWFB 4BSJA 3MRGA 4AENB 1YPZE 1SBSH 1RZ8B 3TCLA 35C8L 4NWTL 1J1XL 3V6ZA 1DQJA 4JB9H 3F65A 2CK0L 5CUSL 3WN5B 1B4JH 3P0YH 4R0LC 1CTOA 2VWEE 5K33A 4WJ5B 5F7MC 2CLVA 1RJLB 2VZTA 3ARDB 4ELME 1QACA 4QF1A 1AKJA 3LKQA 4ZS6C 1I7TA 3LH2L 3H7BB 4DGYH 5EO0A 1BD2D 1K8IA 3PDDA 4N0FA 3KPOA 4P2QD 5KANG 3U46A 4MD4B 1RFDL 3IFOA 2VXSH 2EDLA 3RWJA 2PXYA 5DWUH 4ZSOB 4JFFB 1JZ8A 2A6IB 5HD8C 3VG9C 4OSUL 1E6OL 4E9LA 3CFDB 5IB1B 3V5HA 1Q1JL 4YE4L 1DL7H 5EC1A 3ZTJH 1CD1B 2AXJA 2MTPA 3EYQC 3ARGD 4OZ4A 1R3LA 4PJXE 5I17A 3UPRB 1FE8H 5E6ID 2WANA 1AY1L 1QBLL 3NN8B 1NBYA 2CR3A 5CWSA 1TNNA 2E7LA 5LXGH 1KGCE 5JNYA 5DT1H 3NIGE 1RD6A 3QIBD 4JREC 1FDLL 4RNRB 1HCFX 4FTVE 2XWBB 4HIIA 1I1RA 1INDH 4D9LL 4TTDD 3U1SH 4QRPB 3QUYC 2LAAA 4IJ3C 4NIKB 3RUGE 3F7QA 2AXFB 1T1WA 5FCUL 1ZLUK 4NQCB 2HKHL 4OUOA 4I0PC 1QFPA 5T1KA 1KPVB 1KTKE 1KBGL 1F6FB 4JM4L 3BIAX 1NLDL 4Y1AB 3VGDA 3VXPA 5FEBA 4PJBB 5J57B 4OZGA 4KK6C 4N1EA 1EHAA 1JZ4A 4OZHF 1Z6JT 4Y4KD 1WBZB 3JWOC 1NC2B 5IKCA 4ENED 3GSNB 4L4TD 2N4IA 5FO8B 1JPST 2EXYC 4FP8L 4BSVB 2I07B 4GRLA 3OJVC 4DKEL 2Q76A 4NKIL 3QWOA 3MLXH 4LASH 4YDIH 3QP3A 2ESVA 1YEKH 1HHKB 1WTLA 3S96A 4CW1A 1PLGH 2QR0B 4L8SA 4WRLA 2G5BA 1O7VA 5FYKU 2VJXA 3SDDA 5CZXD 4Y4FB 3ZKXB 5C6WH 1ZAGA 2O5YL 5J3HC 1OP5K 2B0SL 1P5VA 1CD8A 4X98B 1IGCH 3BJLA 1RMFL 2VLKD 4HIHA 5DJ2A 4OM0H 3OR6A 3T09A 2H8PB 3B2UC 1G6VK 1HH9A 4GKZB 1OAXH 5B38B 4M02A 4XI5D 3JBG7 2ZOKB 5DJ8A 2JB5L 4X6BB 1FRGL 2P8LA 4W4NA 1J0YA 3RVVD 2FR4A 2DOCA 3O4OC 5E6ZA 4XCFL 4ZFOL 1ZANL 1ZHBA 2R2CA 4DVRL 1X5KA 1W72B 3QH3A 4CADA 5TH2B 5GGSY 2P8MA 3X11A 2RHEA 4NJAL 3D39D 4F37F 3WS3A 4KRNA 4Y19A 2FX9L 3QCVH 3QUKA 3FRUB 5GSRB 2LABA 5GZOC 1FBIL 1S9WA 3R0MA 1G7QB 5DQ9B 3UZVB 3QIWD 3PWPD 4APQB 3Q6GL 4KY1H 3Q5OA 1VEOA 3MA7B 4KK5C 5GQBA 4MD5B 4BSWA 5FKAB 2XN9D 3T77B 5IFAH 4U3XA 1PVHA 4TSCL 2CLZA 1Q9KB 4LPCA 3ZTNH 3NFSH 1W8NA 4LSQL 3BZEA 1C5CL 4FQXC 5DD3L 4HEPG 2BFVL 3SJVE 5HSFA 2J5LB 4PGEA 3BH8A 4YK4C 2GHWB 2B4CL 4MXVF 3VXSE 1DUZA 4Y5YC 3U0TA 5F7YC 2NW2A 3O3EA 2CUHA 3S5LA 3U82B 5MI0B 4X7TA 4XP5H 4Y5VA 5ADOH 4JN2B 3MGTA 3QUZB 5BV7B 4JB9L 4IS6A 2Z93A 2VLLA 5ISZB 1P1ZA 2IANA 2BDNH 2AI0L 1E4XH 1GVIA 3OAUL 4ZOBA 4U7SA 3IJHB 2PO6B 3ARGB 4RX4D 4X6DF 2ILLA 2CH8A 4DGYL 5C0JB 2B5IB 4Z7NE 1EAPB 5GRVL 4KAQH 1DJSA 1JV5A 4AG4H 5DWUL 2WWKO 4LSUL 1MAJA 1GGUA 2FBJL 3H7LA 5LVEA 4A6YA 4N0YH 1ZLSH 4EI6A 3W9DB 4DN3H 2DWEB 3U4AA 2BVPB 1XGQB 4ZUVA 3FFCB 1FE8L 4GT7A 4EDWH 3FQTA 1M4KA 5LXGL 4JY4B 3GNML 5JOFA 3VWKB 4PJEB 1KGCD 3VXNB 4TQEH 5ENWA 3W0WA 1K8DB 5HGBA 3TWCH 2E7BA 3W39B 1AE6H 3O2DH 1FC1A 4R4FH 1H3PH 5GRJH 2O5ZH 4PRPE 3ARFA 3KXFA 2C5DC 2Y07H 1PAMA 4FTVD 4KXZI 1BIIB 4L4TB 4JFOA 4HLZG 1IE5A 3QG6A 1BPVA 4ONHB 4CN4A 2D2OA 2EC9U 4N90E 2X4SB 2VH5H 3A6CH 4PBVC 1CDGA 3PQYE 5EA0H 5TDPB 5FYLE 3HR6A 3VFVA 4HK0B 2WAHA 4YIQB 3QBTB 3MLVH 3DSFL 4OKDA 4XRCB 1SY6H 2PTVA 3T04D 5AAMA 5FA4A 2R2HA 1SVCP 4HFUH 5J1TC 4U0RC 2NX5B 5I1KL 3QEQB 2DQFB 3OR7B 5I0ZA 3MLXL 4LASL 1FQ9C 1YEKL 1F42A 1K4DA 1KLFA 3NH7H 4U0QB 1R3JB 1JF5A 1PLGL 1QR4A 5C8JB 1ZT4B 1A7NH 2HVJB 1Z2KA 4XNQB 4AIOA 5D1ZB 2P43B 3WFEH 1IGCL 3HE7B 3L7FA 4I5BB 2XWTA 4ISVA 1VB9A 3D1MC 4N5UA 1F6AB 1NGXA 3VWJC 4X4MA 3C6LC 3D9AH 2JIXD 4LLWA 1ZLWH 3UYOD 5F9WC 2HG5B 5IMKB 4RIRB 4GAJH 3L3OA 3QAZC 3ZMRA 4QHUA 3MCKB 1UZ6F 4BQCA 5CEZL 1H3UA 1I9EA 4XB8A 3LCYA 4N5ED 1HXYA 3IDJB 2R0KH 2Z4QB 1Q0YH 1F11B 3P4NA 4LAJH 1OF2A 1M7IB 1UZ8B 1NFDA 4XAKE 5EBWA 2D7NA 1JF1A 1CFQA 2X4RB 4YDJA 1F58H 3QCVL 4PB0H 1BJMA 3TO2A 4KZDL 2DYPA 4OUUB 3PWJB 2H6PA 4PRBB 2UY7A 3BVNB 4PRDB 3G6JB 5DJDB 3L5WA 3RKDD 1FO0H 3BT2L 3O3DA 1BQHG 2DDQH 4P23B 5JXED 1WWCA 1RUML 2VXVH 1OAZH 4YXLH 4KRMB 5IR1A 1IBGL 2JK5B 3ZTNL 1FO0A 1OARH 3NFSL 3FN0L 2V6HA 5BCAA 1H3GA 3OXSA 4UQ2A 4RGOL 5C0DA 1NCUA 5FUOH 5E24E 4XZUA 5DJ6A 3HNSH 4J2XA 4EIZC 3QNZB 3QO0B 2PF6A 1S5HB 5DXWA 3SJVD 5FHAH 3IF1B 5JIPA 4V2CB 1BFSA 3HZMA 2WMPA 5JHLH 4YDVA 3VXSD 1S78C 5ADOL 5SV4A 1U36A 4HS3A 3QWRA 2HTKC 3BEWB 2PTTA 4IMKA 4RA0C 5D2NE 2BDNL 4HUVA 5D1XA 2CGRH 4RAUB 2UWEF 4XWGH 1P7QD 5IV2B 5LGJA 2IBZX 3P40A 4KI5E 3MO1A 4K3JH 1BJ1H 2Y4SA 1SMOA 1NFKA 1NGPH 1TCMA 5IB2B 5I73B 2P5WA 4PJXB 5EBGA 5I16A 1KYOK 4KAQL 2D0HA 4UTBH 1LE5A 4WO4B 4A6YL 2FH8A 4N0UA 4AH2A 5K93A 3O9WA 4FNLL 4H1LB 4IOFC 3L3HB 4PJ5A 4N0YL 1ZLSL 3QEHA 1NAMB 1OSZA 3AUVA 2NY6C 2ZZUT 1CZ8H 1MHCB 4EDWL 4TVPH 4CJ1A 4PRHB 4HZLA 3DYMA 2DQGH 5TPWH 2O61A 2P42B 4EN3D 4O9HL 3TWCL 1AE6L 2YBRA 3KWWB 3O2DL 2PCPB 1C12B 4R4FL 1H3PL 1EEZB 2VR5A 5GRJL 2O5ZL 4BH8A 2DKMA 2OZ4A 3OB8A 4N8VG 5J6HA 2VC2H 1H15B 4IBLT 4PRPD 2YN3A 1A2YB 4OZGF 5EA0L 3A6CL 1G7HB 32C2A 5IJVA 3QDME 4GKOA 3ZDXE 4N90D 3PQYD 1ZVSA 5FYLD 3DWTA 5C7XH 2XTJE 1L6XA 1AHWC 3MLTA 5F88B 4N9GA 1I7RA 3L9RB 4M6AA 4DAGH 5KSBE 2OQJB 1AFVH 3TBTA 3CLEH 4NQEB 4AEHH 4ZFZA 3D18A 4LSDA 1FNEA 4KTEL 4S0SD 5E8PB 3IJYB 3IKCA 2FLBT 4NO5A 1MFNA 3SE3C 3EHBC 1FIEA 1T3FB 4JFZH 1LP9E 5EN2A 1DR9A 4P2RA 1TTFA 5IBTH 4Y5XA 1JPTH 3LKRB 1KCSH 1MCJA 2BRRL 3TNMA 3VXUA 4CDHA 3BGAA 3RVUC 3WFEL 5GXBB 5GGUB 3VFSB 3BEVB 1RURH 1UM4H 1CFNB 3D9AL 3KR3H 4FFWD 4ODHL 1K2DA 3FO2A 1JWSA 5D7JD 3ESVF 2CDEB 1YYLL 2F53A 3H42H 3BISA 3OG6B 1FSKB 4AQOA 5BO1L 3OB0H 1U8KB 1QSEE 2R0KL 3LS5L 4HUXA 1Q0YL 4O51A 2K3TA 3SGJA 3PWLB 4M7ZC 2QQKH 3LKSA 1U8IA 1J0ZA 4M93C 1INQB 1QHOA 4RDQF 4HWZB 3D3VE 4PB0L 2CSPA 4XAKD 1IC4L 5HVGB 1JNNH 1L7IH 2FSEA 5CIPH 5LAXA 4JZJA 2DWDA 4L9LA 5HI3C 1FYTE 1FO0L 5KN5B 5HJ3A 1MPAL 3DETC 2DL2A 1YN6A 2VXVL 1VACB 4D0DA 1X9QA 1ZOXA 2FCBA 4PJ7E 4XCYB 1OARL 3EGSB 1AI1L 4LNVA 5F9AC 4IRSC 1M05B 2KUTA 4PJFB 4ZDHA 4NHUA 2EIEA 4JJ5A 1F97A 3HNSL 2BJMH 5HGAA 1R0AH 3FZUC 1FFOA 1HQ4B 2Z0BA 3MA9H 5DMKA 4P48A 2XNAB 4M3KB 4U1MB 4BFEA 5KG9B 3HZVA 4FFZH 4JPIA 4LAQH 1IGMH 1WZKA 4XNXH 1BFTA 1VKXA 3U2SA 4EI5C 4X9BA 2Q20A 3MRCB 2ICEB 2CGRL 4RAVB 5TF1H 3I50H 3G5YB 4KK9D 4YHPA 4LDOB 3NACL 1CF8H 2EE6A 4HF5H 4K3JL 2H32B 4KI5D 4K94H 3GM0A 3GMMB 4HLJA 1MVUB 2QTEA 3I6GB 4JVWA 5IK3A 4RMUA 3VD3A 1D9KC 3MREA 4NQVB 5I30L 3HMWH 2NY0B 3M1BA 1HINH 3DTXA 1QZ1A 4PJ8B 3DUSA 5E5RB 1Y18A 3KDMB 4ZAKC 2DM4A 1G84A 1OP3K 1X5AA 4Y4HC 3L3IA 3MRMB 1MAKA 3EDFA 3W9EA 1E6JL 1JGVH 5HDOA 1IEBA 4YR6B 4YBLC 3EYOB 1P6FA 1VPOH 1CG9B 2OZ4L 3EUUA 5GS2H 1W8OA 4RWYH 3SKOA 3STBA 4KQ3H 1K4CB 1DEDA 3S8WA 1RU9H 1LEKB 3BPLB 2J8UA 1RK1A 2J88H 4TULL 5C6PB 1XGUA 4Q2ZA 2BSTA 5DEGB 3L5IA 3CDGB 3DIFA 4OD3H 1ZK9A 5E1AB 4YHML 1HHHB 2VO5A 3S4SA 1LWRA 3WLWD 1AO7A 2DKUA 5E99H 3G5XB 2AJYL 2JJWA 3QDMD 3REVA 3UTTE 5C7XL 1I4FB 2EKSB 3U79A 3CSPA 1FGNH 3WSQL 4DAGL 4G9FE 4M62H 2XTJD 1BFVH 3T4YA 3MJGX 4HXAL 1P4IL 3CLEL 4M61B 4AEHL 5KSAB 4KJPC 4RMRA 1ZKAA 2N1KA 2V7HB 3AXLB 5JDSA 3B9VA 5EC2A 3MGOB 3JUZA 3V4UL 4WUKH 3FOLA 4WHCA 4WFFE 5C0AB 5EBLA 2PYEE 4FQHB 2L7JA 4HBCH 4JFZL 5D1QB 5E8NB 2QJDA 5IBTL 1EVUA 4B7IA 4F57L 1JPTL 3NIFE 1KCSL 1U6AH 3I9GH 5DDHB 3HI1A 5HHOE 1TXKA 2FZ3A 1HQRA 1EGJH 1OTUD 2A6KA 3GI8H 4WI6A 4FQLH 4C4KO 4JCLA 1PKOA 2WWMC 4HWUA 5EOCH 2PTUA 1UM4L 2GSIB 3SKJL 3JXAA 3O4LE 1QBMH 3SDDC 5HYSB 1EGJA 4KKCC 4GRWH 5TDNA 1EIBA 4F7EA 2GY5A 1DQLL 4RCAA 4R4ND 2CRMA 3QYCA 1FFNB 1BAFL 4UDTB 3K2MC 4LOUC 3GIVB 1E27A 4MAYA 3MRRB 4FXKA 2QQKL 1X5JA 3B3IA 2IH1B 1QSED 4UDUA 4CU8A 4LCCB 3NCJH 2AS5M 4KJQC 2YD9A 4XX1G 5A3IC 5K9JH 1L6ZA 1SJXA 1L7IL 3D3VD 4MD0A 3FB7B 1KN4H 4R4BB 3MLPA 5JDJA 4WWID 5L9DH 1PZ5A 4WI7A 3SO3B 3RL1B 2BOCB 4RSVA 1RK0B 1H5BC 1A1OB 5E5MA 4WUUE 3C9NB 4DVBA 3SKMB 1FYTD 1DZBA 4WGVB 4MQSB 1EJ6A 4OF6A 2QQNL 2LFGA 4NC0B 3UO1H 3O8XA 3FB8B 2JCCB 5ACLA 2FECL 3KPSA 1PY9A 1YY8A 5ID1B 4QT5B 5CJOH 3RP1A 1ZA3A 3D25A 3CNKA 3P0VH 5IVXF 4XC1H 5EULV 1EHNA 5HVHB 1X3DA 5C2UB 2C26A 4K7FA 4LSTL 4MGXA 3MA9L 2V2TA 1HSAB 2J6EH 5I8KL 4FQQA 2I9LB 1HEZA 4V1DA 4HHAB 4FFZL 1TVDA 4JHAH 4JKWA 1IGML 4XNXL 1DSFL 2L0DA 2I5YH 4P59L 4I0KA 2OL3B 3ARRA 4OIBA 2EDHA 2DLHA 1DBAH 4NN7B 1NGWA 2VTFA 2VZ1A 1QSVA 1KLUB 3C09B 3ILPB 1RIUH 4Y5VC 2H3NB 5CJQH 5E70A 4ELMF 2K1MA 2UYLB 5H35A 1CF8L 1Q94B 2ITCB 3G6DH 4K94L 1FFPB 1TTGA 2WBWB 1CE6A 1D5XB 2HP4A 4B53A 3NVQA 4KV5F 4ZPTA 1JPFA 3QXDA 2F54E 2C4FU 3ULUH 2XQYK 1EX0A 1T5XA 2V5MA 3DXAB 4A2LA 3MRHA 4U1JA 1C5BH 1HINL 2W60B 4NN5C 5HDLA 4MNGA 2VDOH 5AUMB 3F7PC 5TQ2H 5CD5D 2G2RA 1X4ZA 2ZUQC 3ESUF 4Z7UE 4JFHE 5GHWH 2EC8A 4GKSB 4D0BA 4KQ4H 1JGVL 5DJ0A 4YXHL 4OTXL 4MLIA 1KPUA 1QYGH 2FBOJ 3KLDA 1IT9L 2I60L 3BZ4A 4XCNA 3OG4B 3Q5YA 4RFEA 4UZGA 5KOMC 3ZDYE 1A0QL 1RU9L 3BRGC 2C3VB 2XTJB 4ZD3H 3DX8A 3ARED 4MA7H 2F15A 2A2QT 4JDVB 4KI1A 1T1XA 1YJDH 3FRPA 3KPRE 5E6IC 1HDMB 5DMGD 1JP5A 3FB5A 3T65A 4U6TA 3QIBC 4H88L 5F6IB 5IFHH 3MOQA 1QFOA 2BY2A 3ARFC 1S7RB 3ZHLA 5SWZE 1FGNL 1AGBA 1YA5A 3NFNB 4M6NL 3UTTD 2DLFH 5KS9E 3DGGB 1BFVL 3LQZB 3UTSE 4NHCH 4FQCH 4G9FD 4TTDC 5C09B 4BK4A 5LJYH 4TUOA 1WBXA 1N6VA 3DUHA 4NO3A 3REWA 1NANI 5TQ0L 4HDIB 2X4PA 1OT2A 1U8JA 3WV0A 2KKQA 3BZDA 3CH1B 2NXZC 1F02I 4WFFD 3C5JB 3E3QE 2PYED 2F74B 4G6FD 5CZKA 4IOIA 1RZGB 4P2OB 1KELH 1U6AL 3I9GL 3SE4C 4UUJA 3VA2C 4ENEC 4DUVA 3MNZA 1EGJL 3DX9B 3GI8L 5FDYA 4FQLL 4XBPA 1RUKH 5HHOD 4I8DA 5EOCL 1BZ9A 5IMLB 1HHJA 4PTTA 3WJLA 5I71B 1AGCA 1AD9A 3UJJL 5BS0E 4X9FA 5E9DA 1IZKA 5ABDE 3O4LD 1AR1C 5I8EA 5CZXC 4J3UA 5EUOE 5D7LA 1CGUA 4GAGH 4R2GC 1J9CT 4BYHA 4XBGA 3KPMB 3LQMA 4IMLA 5DUBB 1FYTB 3VXRA 1JYNA 3M07A 2WUCH 2Z8SA 3NCJL 4G8IA 4U6HA 3TIDA 2OMNA 4YC2B 2YZ1A 5B22A 3V6OE 5K9JL 2QV2A 3RGVB 4N0RA 1H8NA 4NNYB 3VFTB 4C56E 1KN4L 1YY9C 4XPHL 5L9DL 4KRPB 1FVCA 2J4WH 2FO4B 2W0KA 3E0GA 4NUJB 4P5TD 4F3FB 1KCVL 1NDMA 4LARL 1J0JA 2QQQA 4HJJH 5JA9A 4JRYB 3UO1L 1KB5B 2JJTC 4WUUD 1KTLA 5F1SA 3VCLA 3QJFA 1R6VA 4UT9H 5CJOL 5L0QB 1MWAA 3P0VL 3DMMB 3NCFB 4P2YA 4TRPL 4XC1L 5SX5H 1FL5B 3SDXB 3ZE1E 3DVGA 1ND0A 1NBVH 1I3UA 1GOFA 1XR8A 3VW3H 2CKBB 4O2EB 3WLBA 4MJIE 1F4AA 5ICZB 3BDYH 1I9RH 3OZ9H 4POYA 1QR1B 1GIGH 4LNRA 1KTDA 3BP4B 4Y16A 2XZCL 3QFJB 1OM3L 4YEFA 2J8OA 5H37H 4FQJH 2I5YL 3HUJB 3HMXA 1DBAL 4OIIL 1KEMH 1MLBA 5IEKB 4F7MB 2XKNA 4N68A 3ECBB 3BGMB 5AG9A 5CJQL 2WIIB 4KXZH 4GW1B 3GZKA 2XPGA 5E94B 4R90H 3QEUB 3G6DL 2F5BH 4QRQA 4YGVB 3O6KL 2EIZB 5FUCC 4QOKB 4GRMB 2DF3A 5SV3A 1X5GA 3OSKA 4U1SA 2E8ZA 1DQQA 1E28B 2XG4A 2JJSA 3JSSA 4RQQB 3CSGA 3MUY1 3ULUL 4HKZA 4UTAH 2HA1A 2CUMA 3GMPA 3VGAB 5FYKE 1CT8B 1NCBH 1CLCA 2F54D 1TZHB 4M03A 1ZHLB 1QLRB 4EUPB 3QG7L 1OGTB 4PREB 4CVZA 3QQ3B 3SCMD 4HIJA 3FT2B 1WIPA 5TQ2L 4LLMB 1Q72L 4Z7OF 1X5HA 5B3NA 2R15A 2DLIA 4ETYA 3E6HB 2LVCA 3GRWH 2GTWB 4KQ4L 4JFHD 3RIFK 3O9WC 2J3SA 3P11H 5SWSE 1QVOB 3DGCR 1CICB 1QYGL 2QSQA 2J8UF 3FJTA 2FJHB 5HYJB 2EE2A 5T5NF 5IF0B 4ZD3L 4LLDA 1NEZA 2ATKA 1XF2A 2I27N 4J12A 3TZVA 2AJSH 4QCIA 3D85A 1YJDL 1UB5A 4E5XB 4L4VE 5GIRB 4Q58C 3KPRD 4NO0A 4LDEB 3RWFA 5FK9B 3MRQB 4AENA 3BGFB 1RZ8A 5IFHL 3KLHD 1KC5H 4QRSB 3MBED 1I1AB 1LILA 5I74C 3WN5A 2AAVA 2DLFL 4ZXBD 2VB5A 1V7NH 2E9JA 1J8HB 4NHCL 4WJ5A 5SWZD 1SBBA 4FQCL 1RJLA 3ARDA 3UTSD 1T0NB 1WFUA 1AP2B 2DJUA 3H7BA 2D9CA 4UIMB 3NCMA 3X12B 1MCWM 3JUYA 4MD4A 1CI5A 3UPCA 1G9MC 2E6QA 4NQSB 4ZSOA 4JFFA 3JV6B 4Z7WB 5CSGA 2A6IA 3HNTL 3P4LA 1J12A 4WFGE 3CFDA 5IB1A 4ZUUB 1CFBA 4X4YB 1YEIL 1CD1A 1RUKL 2CKNA 1DDHB 4JHWL 5B4MD 5EPMB 1F4WH 1DQML 4XXCA 4L3CB 3IKKA 4Y5XC 3HTLX 3NN8A 4AIZB 3OTTA 2VNCA 3QHZL 5BS0D 4F15B 4I3RH 2WIMA 4I13B 1NMAH 1LDPH 4GAGL 4N8CL 4RNRA 3KVQA 3OHXB 5IW1B 1D7FA 2XWBA 3AROA 4L8DB 4LEOB 5ICYB 2WUCL 5HHXH 1KCLA 5CCKH 4NCC1 4QRPA 4OCSH 4XMPH 3PF2A 4QRRA 3L3KB 4OCYH 3CZFB 5CINL 5LGHH 1MFEL 1ZT7B 3DVIA 4WV1C 2AXFA 3SGJC 4NQCA 2J4WL 1B0RB 3GMRA 5E2VH 4C56D 3WFCH 1KPVA 4N5EC 4OLXH 4Y1AA 1T6VN 4M48H 4PJBA 2D31B 2OR9L 2CPCA 1WBZA 1NC2A 5F1OB 5J6GB 2FJFB 3VRIB 3GSNA 2BK8A 5FO8A 4JZJC 5GRUH 4FABH 5KVDH 4BSVA 2I07A 4GOSA 4KROD 2GAZB 4MCZB 2NY1D 1HXMB 1HHKA 4HWNA 4JY5L 3D2UD 4MQXD 1NBVL 3RKDC 1ZGLB 2QR0A 3O6FD 3Q1SL 1A02N 3BDYL 4FQ2H 3C5ZB 3OZ9L 1GIGL 4MJID 3HMXL 3B6SB 1M7XA 4JFDB 4X98A 4YDLC 2PR4H 1BFOB 2H8PA 1CIUA 4GKZA 1PGRB 3UJTL 5B38A 2BHYA 3RY4A 4RGMC 2ZOKA 1W72H 1MIEH 2DI9A 4X6BA 3JTTB 4HKXB 1WIUA 1S7XB 4GQPH 5B8CB 3SGEI 4K3GA 5I1IL 3LQAC 4XHJC 4KHTH 1W72A 4LEXL 4GSDH 3BP7B 2FGWL 5TH2A 1N59B 4KTYA 1JCKA 1T7YA 3DV6B 3EJZC 4UTAL 5JW4M 1GXEA 1KJ2B 4U7KA 4MB5A 5GSRA 3FRUA 3VRLE 2ADJB 1U2CA 3OF6A 1G7QA 5DQ9A 4MQ7B 4Y2DD 5FYKD 5C07E 1KJMB 4HIXH 4APQA 2DAVA 2VXTH 3G5VB 1A7PH 3FO0L 1CQYA 2P7TB 3MA7A 3TN0D 4MD5A 5FKAA 3GRWL 3T0BA 3T77A 4MXWL 4RDQG 1Q9KA 3TV3L 4ZUTB 4WU7B 1I9JL 1TPXC 5JHDE 1NAKH 4JE4B 5SWSD 3G04B 5AZEH 4N0CD 2FGZA 4JO2H 3MTRA 5EU5B 1YZZA 4B0MM 4EXPX 2C7UB 3DVFA 1ZA6B 4AEIH 3BI9X 4RFNC 1FZOB 3F6IA 4CVXB 1A4KB 5KS9B 4J4PD 5E2UH 1D6EB 5B3JF 4K7PX 4QXTB 4OFPA 4L4VD 4O00A 4JN2A 3ZDXF 3QUZA 1H8OA 5HHPB 4EN3C 3S5LG 3GJFB 1EAJA 1I7ZB 2YRLA 1IGIL 1XIWD 5ISZA 1S9VB 5LWYL 1MRCH 3IDMB 4PGBB 1MREL 1V7NL 1B9ZA 3CUPB 4X6CF 1A3RH 1KCRH 1HZHH 3IJHA 1OTTC 4FHBD 2PO6A 3ARGA 4M43H 1MCRA 2YK1L 5C0JA 3MYZA 4EDXB 3HG1B 1EAPA 3BE1H 2FD6L 5D5MB 1WICA 3ZKND 5I18H 4ZG1A 1TQBC 1GOHA 2B7DT 2F19L 4MJ6B 3MYJB 4WFGD 3ZDZE 2HT2D 3W9DA 2DWEA 5MENE 5FYJL 2BVPA 1XGQA 1NKRA 3FFCA 3L1OH 3TH2T 3E8UH 1C8PA 1YEDB 2IAMD 2PW2B 4JY4A 1U3YA 4JG0H 1QFWL 3VWKA 4PJEA 3S98A 3VXNA 1F3JB 1K8DA 4GO6B 3ZE0F 5HHQB 4ZNEE 3W39A 4P4KB 3SDAB 5CFHA 5EIQA 3RJDA 2X10A 4DKDC 5HHVL 1NC4D 1BIIA 4L4TA 4XMPL 4FFWC 5GGVY 4JVUA 3BWAB 4OCYL 4ONHA 5IMMA 2X4SA 5TDPA 3RPIA 5LGHL 3C8HA 1MQ8A 4HK0A 4MAYC 3K1DA 4MSWB 4UT6L 1E4JA 4YIQA 4U4BA 5F89B 4NCC2 3T2OA 3GSNL 4JFEE 4R7DB 4NFBA 4XRCA 1YUHB 4OLXL 3TFKC 3RIAK 4GAYB 4H8WC 2YHGA 3HNVH 1SYVB 3U7WH 3KJ6H 2NX5A 5JZ7D 3QEQA 3B43A 3LB6D 4NQDE 5KVDL 3VRJB 5KZCB 2DQFA 3OR7A 4BFBD 4EIGB 2X4TB 3O8XC 1R3JA 5C8JA 2CIIB 3HA0A 5C0BE 1ZT4A 3MV8B 4FQ2L 1BZ7B 1R5WB 2HVJA 5T1LD 4XNQA 3V5DB 1SEQL 5D1ZA 1JBJA 3HE7A 4K2UH 4I5BA 1GZQB 3MSPA 1F6AA 2ZUVA 4QGYA 1A6AB 1UWXH 1GHFL 1W72L 2IH3B 1PSKH 3MROB 3BPCB 2EE3A 2HG5A 5IMKA 4RIRA 4Y2DB 4BQBA 3ROLB 4RBPK 2DBLH 4KHTL 2Y6SD 5MEPB 4FXLA 4TN9A 3TN0B 3O3UN 2Z4QA 4Q6IB 1F11A 4ZOEA 1M7IA 4XVUD 2JB6B 3V0VB 1UZ8A 3VGEA 4I2XB 3OKMB 3GMOB 5D7IE 2X4RA 3RU8L 4EVNB 4OUUA 3PWJA 4PRBA 3BVNA 4PRDA 1AXTH 2A6JB 5D2NC 3BAEL 3G6JA 3LMJH 4HIXL 4MLSA 5DJDA 1UJTA 1IKFH 1RJZB 2IFGA 5C07D 4L3EE 4XP9H 2OTPA 4P23A 5DYOB 1IGFH 1E0OB 5DD6B 4QEGA 4PLNC 1HYRC 2A0LD 3RGHA 2LV4A 5D6DA 4XBEL 2JK5A 4OFYD 3DUUB 3HE6B 4ZS7L 1J18A 1FAKT 5CAYB 5JHDD 1OAUH 4UT7H 3QULA 4JO2L 3OXRB 3CFJB 4S0TD 4QRUB 3RDTB 1F4HA 3QNZA 4AEIL 1BVZA 3QO0A 1G0XA 3GSUB 4FFVC 1S5HA 3IF1A 1OWRM 5E2UL 2EE9A 3JV0A 5SX4I 5BV7L 3WIHA 2V2XB 2HYMA 1TJGL 5I9QC 2YD6A 2HJKB 1OOAA 3ARBB 3T08A 3BEWA 4PJ9D 2OTUB 4D0CB 3RTQB 2CDFB 3HAEB 3NTCH 2YS4A 3BPOC 3GO1H 3PIQB 4PR5B 1MRCL 4RAUA 5I1DB 5IV2A 5AYUH 5FGBA 8FABB 3KGRA 5L88H 2M1KA 1KCRL 3H9ZA 4LLUB 1HZHL 2VLRE 3C60D 4M43L 5K59E 3BESR 5IB2A 1PG7X 3RA7H 4PJXA 1OPGH 1DQDH 2DM3A 2P8PB 1I3RB 1OSPH 4WO4A 1Z5LB 2BOBB 4QXGH 4KKLD 5I18L 4H1LA 3L3HA 4RMSA 1KJ3H 1P7KA 2G60H 3OAZH 1NAMA 1NC4B 1CFTB 4V2BA 2ENSA 3CVHB 3U9PH 3AMLA 1IVLA 1MHCA 4X8XA 1TMCB 4AIXA 5MEND 1XAUA 4PRHA 3E8UL 1BQLH 2WP3T 4DFIA 4Z8FH 1F8TH 1JMXA 5T1MB 3VXQB 4LCWB 4JPWH 2DQTH 4HUNB 3KWWA 1OTUC 1SVZA 2PCPA 1C12A 3WJLC 1EEZA 4X99B 2AJVH 3RIFF 4LLYB 1PKQB 2VRAA 1T2JA 4FQ1L 1I8KB 1H15A 4OI8A 3DI3B 2HJLB 2PW1B 1GC1C 2X1WL 1A2YA 1G7HA 4PJIB 5D8JH 3QXUA 3QIUB 4C59B 4WTXA 1LMKA 5F88A 3UYPA 3L9RA 2ICWB 4JFED 4NQUA 2OQJA 4YQXL 1QKZH 3L5XH 3B2VH 3HNVL 5T1LB 2CR6A 4NQEA 2VLJE 2PNDA 4JFYB 4RGNE 3W11C 3KJ6L 5E8PA 2A1WL 3AAZB 1Q8MA 3IJYA 4WWKD 4TNWF 2GIYA 3L5JA 5BMFH 4NQDD 1T3FA 2X44D 4DEPC 4EKXA 3ULVE 3G6AB 4OZFH 2J12B 3LKRA 1RZIB 1MVFA 1U3HD 3IFLH 5INCB 5C0BD 4BFIB 3K4AA 4HC1A 4YZFE 3NMEA 1ZLVH 2VKWA 4JANB 5GGUA 3VFSA 3BEVA 1OL0A 2B39A 1CFNA 4FMFA 3BKCL 2QHLA 3DARA 4GG6B 2CDEA 3I3EA 1JGDB 1G7MB 1B4RA 3DSNA 1CQKA 2XACC 2DBLL 5C07B 3MRDB 1BVKB 4I3SH 1NCAH 2PETA 1U8KA 5JXEA 2EDEA 4JY6B 1LO2H 3PWLA 3V7AG 2R0LL 2QADD 5DRZB 2O5XH 4KJWD 1INQA 2Q86B 4HWZA 5C0FB 3PXHA 1AXTL 3LQAH 4HAFA 5IIEB 3IDYB 3P30H 1OWWA 3QA3B 1IKFL 3ARXA 1QSFE 5KN5A 4XP9L 1IGFL 1NANH 1VACA 4DGIH 4GMTH 4L3ED 1N2RB 3P9LB 1HIMH 1LE9B 5DJAB 2A83B 4XCYA 3EGSA 3BPNC 1M05A 4KMLB 1KIQB 2VDMH 4PJFA 3VXME 1IAMA 4UT7L 4R96B 3MRBB 3WIHL 2UVFA 5CD5C 2LE9A 1HQ4A 2NY4B 3OBAA 1A7QH 2XNAA 4U1MA 5KG9A 2YD5A 4NZDA 1A6PA 1UH3A 3MXVH 1J10A 2LTQC 2M26A 3WUWB 2Q6WB 4PFEA 2BCKB 4HGKC 4E41B 2ZUXA 4BK5A 1T2XA 3NTCL 3MRCA 2ICEA 3GO1L 4RAVA 1N6UA 1TJIH 3G5YA 5AYUL 5JXAH 4ZFFB 2HT4D 3MXWH 3RVXC 4MNQB 2H32A 5IVZB 1UA6H 2NZ9D 5E4IA 2R69H 3GMMA 1MVUA 2VLRD 1AQDB 3GBMH 3I6GA 4PY7B 3VI3F 4ORGB 1CXFA 5MENB 3S35X 1DQDL 1SEBB 3NCEB 1J88A 1OSPL 5I1JH 1CLYL 2VDLL 4NQVA 4QXGL 4GH7B 1S7VB 3HZYB 1UVQB 3WDJA 1URLA 1PBYA 4PJ8A 1BLNB 1U8MB 5F7DB 4KZEL 1KJ3L 3EFFB 3KDMA 4PJEF 3AB0C 1M6OB 1YEHH 3U9PL 4S1QL 5MP6H 5FYLH 2VDKH 4XMLH 3MRMA 1ZVYA 5L2KB 3MNWB 3KJ4C 1BQLL 4YR6A 5FOBB 3EYOA 1F8TL 1ZEAH 1CG9A 2ARWA 4NT6B 3V0AC 1MI5B 1K4CA 7FABL 1WTGT 1LEKA 1ZSDB 2AJVL 4LHJB 5CJ8A 4Z7VB 5JLZB 2AW2A 1GOGA 3TPUB 5DEGA 3MODH 2IADB 3CDGA 5E1AA 1HHHA 4P5MB 1HCVA 2QSTA 1PQZB 2W0PA 5CGTA 2XY2A 4DZBB 2AEIT 2ITDB 3G5XA 5T5NG 5A2KH 1I4FA 3S4SG 2XYCA 2EKSA 2I26N 2FEDD 4PRIE 3MUGB 2NW3B 1QKZL 3MCLH 3PDGA 3L5XL 3VE0B 5C0BB 3B2VL 3QDGB 1WSST 4M61A 3HCVB 4LSSH 5KSAA 5FGRA 2V7HA 3N85H 3AXLA 1BQSA 2VLJD 4RGND 5MERB 3MGOA 5EU6B 2D3VA 1LK2B 5BMFL 1WVZA 5C0AA 4HJ0C 4FQHA 5D1QA 9CGTA 3K8MA 2APFA 4HC1L 4P5TC 1X5XA 2WK2A 1V3LA 4Z7QE 5ELIA 4H8WH 3ULVD 1NPUA 1CDUA 3IFLL 3H9SE 1W0WB 5DDHA 5DD1H 1RHFA 3QZWB 3TIEB 3C2AH 5F7WC 4OQTH 4GMSH 3MJ7B 3TJEH 5FM5O 1J5OL 1MRDH 2IBGA 2GSIA 1B90A 2R4RH 2EH8L 2H9GB 5HYSA 3WNMA 4LPXA 4PP1D 2M2DA 3QCTH 1OCWH 3KLSA 4OD2B 1F5WA 4H0GA 1G7LB 1E4KA 3WJJA 3N1GC 1FFNA 5E8DH 3NIDF 3KPLB 5GZND 4UDTA 4I3SL 2YUWA 3GIVA 3MRRA 3IDGB 4PTUB 2IH1A 3G6JF 1SQ2N 4LCCA 4AZ8A 2O5XL 2Z31D 5FDWB 5JOPE 4OJFH 5I0DA 2OJZH 1T83C 4FQPA 2X70B 4G5ZH 4R4BA 3FB7A 2VL4A 2X89A 4YFLI 3RL1A 2BOCA 2W9DH 1YQVL 5C70A 1RK0A 4L1HA 5BVPH 1A1OA 3C9NA 3SKMA 4DGIL 1QSFD 5CBAB 4GMTL 2VISB 3RWGB 3FB8A 1VADB 1EFXD 2JCCA 4AYFA 3CU7A 4ZS6D 4QT5A 3TYFB 5ID1A 5IHZB 4XPTH 4WW1B 1S7TB 2NY2B 2VDML 1D5IL 2UUDK 1FPTL 4JHZA 3RIAF 4LFHG 3VXMD 4NNPH 1IFHL 1L9MA 3DVNB 4LVOB 3MJ9H 1WJ3A 2W0FB 3TVMD 4OLZH 1GYAA 1HSAA 5A16B 4NRXB 5HD8D 2I9LA 3T2QA 4X9GA 4HHAA 5ILTH 5DQJB 3MXVL 5TF0A 3EYQD 5F9JB 2BMKB 2J5LC 3EKCA 1A6UL 1CVSC 2OL3A 3MV7E 1JHKH 4NC1C 1CGVA 1RULH 3DNKA 3PUCA 5KANI 1AJ7H 1KLUA 1FL6B 1TJIL 3QQ9C 2WNGA 5EZJB 3MRNB 1T89A 2H3NA 1WZLA 5E7BA 2BSRB 2UYLA 3MXWL 3QUZC 1Q94A 2ITCA 1FFPA 1UA6L 2R69L 1D5XA 2ADGB 3N1FC 1UKSA 3GBML 4L4JA 2R9HC 5GGQH 2ORBL 3QUYD 5I1JL 2VAAB 1KFAL 2ICWJ 1OD9A 4OBRA 1WFNA 3DXAA 4XX1E 4JFXB 2FX8H 2PO6C 4G6KH 4ZXBC 5KTEL 2W60A 1KCKA 4JRXE 1FZMB 5C0CB 4I0PD 3WHE1 5AUMA 2J2ZA 2EIBA 1YEHL 5MP6L 3S36H 5FYLL 4GKSA 4XMLL 3PGFL 2EXYD 1YMHB 1ZEAL 3NCYP 3RKPA 3OJDB 1R5IB 3BKJH 1I8IB 4LP4A 2C3VA 4LKCB 5B4MC 2WQ8A 5KVFH 2G5RA 4TNVF 2IPTH 4JDVA 1N64H 3O6LL 1KCUL 1HDMA 1ZTXH 2F8OA 5EBMB 1AGFB 3V4PH 1BX2B 3HKFA 3MFFB 3FRPG 4LVNC 3SGEH 5CZVH 1M71B 1S7RA 4WTZA 3NFNA 4HWEH 4WEMB 3DGGA 2ZCLH 3LQZA 4P3DB 4PRID 1JPSH 5C09A 3T0EB 4LSSL 4KVNH 1FCCA 5HYIA 4YXKH 3N85L 2NY5C 2GJZB 3T8XB 4HDIA 3BD4A 3V6OC 4NYLB 1G1YA 1KOAA 5D2LB 5EIIB 3TO4B 2R56H 3CH1A 2MCPL 1JZ2A 4OCWH 3C5JA 2F74A 5GZOD 1RZGA 4P2OA 4NBZB 3BUYA 1DBBH 3EZ8A 4PV8B 1QA9B 4RISH 5J13C 1T04B 3C2AL 1X4XA 3DX9A 4NBXB 1CGXA 1FGVL 2D03H 3H9SD 3JWDL 3IFPB 4GMSL 3TJEL 1OGAE 2WBJD 1VEMA 2EO9A 3PXJA 2Z31B 2R4RL 5IMLA 4MQXC 2ID5A 2BNRA 5CP3H 1OCWL 4POUB 5D1ZC 3O6FC 3HE7C 5IB5B 4FQXD 2GT9B 2VABB 4PJCB 5E8DL 4WI5A 3VDBA 4R0LB 3KPMA 3LN9A 3QDAA 2R4SL 5DUBA 1FYTA 1RIHH 3UYRH 2XQYG 5L2JB 1NCDH 4OJFL 1CDHA 2OJZL 3RGVA 4K8RC 5JOPD 4NNYA 3VFTA 3CDCA 1UWGL 3NAAH 4MA1B 1LEGB 2FO4A 4NUJA 4F3FA 2W9DL 4G6AC 5BVPL 3WEXB 1KSRA 4PJFF 2EKJA 5BRZB 5HGHB 4MXVE 4JRYA 1CLOH 4UOW0 1KB5A 3RZCC 3NPZB 5IW6B 4XPTL 3VFUB 5I1HH 3LRHA 1T0MA 3P4MB 3DMMA 2DQUH 5HDQH 1JYVA 5KVEL 1FL5A 3SDXA 4XGZB 5DUPH 4NNPL 1TJHH 2EXWC 3MJ9L 5D6DC 3RRQA 2CKBA 1HWHB 2EDKA 4O2EA 4OLZL 2C3WA 5ICZA 1RVFL 1YNTB 4JREB 2CRYA 1WITA 1QR1A 3GM8A 3BP4A 5IBUB 5ILTL 3QFJA 4P46B 1RZKC 3T3MF 4KHXH 4FOMA 2FYYB 3OKDB 4X6DE 5IQ7H 3OGOE 3HI6H 3HUJA 1DLFH 1JHKL 3LEVH 2Y1VA 5F44A 3MV7D 5FM8A 3RWCB 5IEKA 4F7MA 4QHLB 4NM4H 3ECBA 3BGMA 5HHME 2V2WB 1MF2L 3IB4A 2BNQE 2WIIA 4GW1A 5E94A 12E8H 3QEUA 1G7PB 3RJQB 4XNYL 4YGVA 2EIZA 4QOKA 4GRMA 2EDQA 4ZFGH 4BH7B 1E28A 3TH4T 5GGQL 4RQQA 1XIWC 2QBWA 1FL3B 1CT8A 1TZHA 2FX8L 4G6KL 1ZHLA 1QLRA 4EUPA 1OGTA 4PREA 4C83B 3QQ3A 5I73C 3FT2A 3I3BA 3VU2A 4LLMA 3BW9B 4JRXD 4JO3H 3V4VH 1GCFA 4LPWA 1RUPH 5IG7B 4WO4C 3S36L 5F1NB 3E6HA 2GTWA 1ZXQA 3NA9L 5FKPB 2BXZA 4YHLH 2FNBA 1TENA 1QVOA 2X1XR 1CICA 2V9RA 4QRTB 3ZKNC 1VERA 4JAMB 2FJHA 1T7VA 5HYJA 3BKJL 2EDJA 3O4OB 1YEGH 5IF0A 1CD0A 5DVNA 5KVFL 3CH8A 2IPTL 5CIPB 4Z0XB 1N64L 5E6YA 3SBWA 5LKNA 5D72H 4E5XA 5GIRA 1ZTXL 2IAMC 1NEZG 3K74B 2KZ1B 5FK9A 3MRQA 5ANMB 2GFBB 3C6LD 3MFGB 5I6XB 3S88H 4QRSA 1I1AA 2YMXL 1FNLA 4HWEL 2DIJA 3TBSB 1KNOB 3QI9D 4TUKH 1J8HA 1JPSL 1P4LB 3HC0B 4Z5RB 4KVNL 3GSRB 2HFFB 1AGDB 3BQUB 3H9SB 4YXKL 1T0NA 2UZXB 2FB4L 5SWQB 1AP2A 3F12B 4LHUB 3QDHA 4UIMA 2R56L 3X12A 3FN3A 2A38A 3EDDA 4LLQB 4NQSA 5CHNB 3JV6A 2E3VA 4Z7WA 3S9DB 4OCLC 1UACL 1YN7B 1DBBL 4HS8H 4XVJH 4AT6B 2ZSVB 4RISL 5BZWB 4ZUUA 4X4YA 4YK4B 4NNXB 1DDHA 1RY7B 1UEMA 5EPMA 4DGVH 4PGJA 4L3CA 5I1GH 4JGJA 2P5EE 3ZKMC 1OGAD 2Q1EA 4AIZA 1CL7H 3HRZB 3K2UL 3MLYL 4HT1H 3WXVH 4JR9H 5C2BL 4MXQC 2QLVB 3SHSA 5SX4H 4HG4K 1HILB 3SE8H 3OHXA 5IW1A 4LEOA 4F7TB 1IZJA 3UYRL 1J1OL 5HI5C 3RAJL 3VFPB 1WCQA 4GLRI 3L3KA 1FSKC 7CGTA 3CZFA 3U30C 1ZT7A 4OZIB 4WHDA 3FOMB 3WDHA 1MLCB 2EDXA 4U1IB 3NAAL 2JCCF 1EPFA 1KB5L 1B0RA 1HE7A 2EEBA 2Y6SC 4FZEL 5DFWH 5GS1B 5KVGH 4Z78B 1P69B 2D31A 1CLOL 4S11A 4LL9A 5J6GA 2FJFA 3VRIA 4ZO7A 5BJTB 1QNZH 3GJFK 4U1KB 4GXVL 4U1LB 1LO0H 2CKBL 5I1HL 1AXIB 2GAZA 4MCZA 2ZUUA 1HXMA 1TJHL 1ZGLA 3TT3H 1KIUA 2FWOB 1WEJH 5JTWA 3C5ZA 3U4EB 2ERJB 3O3AB 4IOFD 3B6SA 4I48B 4PG9B 4S1DC 1P4BH 4JFDA 3MV9B 1BFOA 3HI6L 2R0ZL 4OT1H 1DLFL 1L9NA 1GPOH 2YPLB 3LEVL 4MWFB 3JTTA 4HKXA 4XVTH 1S7XA 1BBDH 4NM4L 2WLZA 1G0YR 3PWNB 5B38G 3O6ML 5B8CA 12E8L 1QPXA 5HHMD 5MEQB 4FZ8H 5F71A 1YC7A 1WAAA 3BP7A 4U3CA 2BNQD 1N59A 2XRAH 2EYRB 4PJ9C 5HI4D 3DV6A 3RBGA 1KJ2A 3ILQD 3IXTB 2ADJA 1WBYB 4MQ7A 4XPAH 5EU3B 1KJMA 1N26A 3EIFA 4M5YH 3G5VA 2ZKHH 1ACYH 3VH8B 2ZCHL 2P7TA 4GRWB 4EXKA 2AV1B 5DEZA 5DJXB 2OR7A 4K3DL 4WFEE 4WIQA 4ZUTA 4WU7A 4OZHB 1N4XH 4PJ8C 1A4JB 1ZE3C 4OZGE 4DQOH 5ITBH 3G04A 3VWJB 1MFBH 2B1HH 4POZC 4R8WH 1DN0B 2APXA 1BOGB 5EU5A 1UB6B 1GGTA 2DQDH 2C7UA 2YD1A 5F9WB 1ZA6A 4TUJB 2Z8WC 4IRJD 5CEXB 1FZOA 4CVXA 1A4KA 2APBA 5KS9A 4F33B 2ESVE 2WP3O 4I18B 5D72L 4BZ1H 1D6EA 5ACMA 3RVUD 4LCIH 4QXTA 3KPQB 2YD2A 3WNNA 2GK0B 1UXSB 3VDAA 3S88L 2NNAB 5HHPA 3GJFA 1I7ZA 4O4YH 3BPLC 4AM0B 3ZO0A 4YPGB 1JNJA 5EU4B 3IDMA 4PGBA 4TUKL 5DFVD 3CUPA 3W5NA 2R29H 3ZYOA 3T1WA 2YA0A 3FB6B 1M7DB 3P0GB 1PY4A 4OLVH 4EDXA 3HG1A 3QDJB 2OK0H 5D5MA 2BC4B 3ETBF 5KSAC 5B39B 1B0GB 3WD5H 3LKOB 5LCVH 3C5SB 4HS8L 5E2JA 2VDRH 3QB7C 4MJ6A 2NY5H 3MYJA 4Y19E 3ARYA 2BP3A 1OVZA 1WLHA 4DGVL 4JQXA 4OV5B 5I1GL 4MJ2A 1Q9OB 3MRLB 1CL7L 1IL1B 4TSBL 1YEDA 2P5ED 2K9UA 2PW2A 3PL6D 3GDBA 3WXVL 1DVFB 4BJLA 4JR9L 1F3JA 1U3HC 5D7KE 5HHQA 4P4KA 3SDAA 3U7YH 5EO9B 4DTGH 4ZO9A 3G5ZB 5D4QA 1I1YB 3AM8C 3BWAA 5GS0L 3IDNB 4PLOB 3SDCC 2W59A 2YN5A 1OTSC 5DJYB 2HJFB 4MSWA 4ZQKB 4PJDB 5F89A 3BSZH 4LPYA 4R7DA 4LCCC 4EI5D 3SKNB 4JCMA 1YUHA 1NSNL 4GAYA 5KVGL 4NC2B 3SY0B 4Q9RH 3SDXF 1SYVA 4HJGB 4KJWC 4DN4H 1QBBA 3ZHKA 1YEEL 1RIVH 1P6AB 2IANE 5I15H 1LO0L 2NY6B 2J8HA 3VRJA 3T0WA 3CMGA 3FO9B 3LV3B 4X6DB 1IC7L 2X4TA 5FYJU 1CFSB 4FXGB 1H9VA 2IPUK 5EOTB 3TT3L 1XCTB 4IIQB 2CIIA 4ONOA 3MV8A 3HUJF 1BZ7A 1AKJD 1N0XL 3SOBL 1R5WA 1ROWA 3V5DA 1T2QH 2EH7L 1P4BL 5HVHC 1GZQA 3UP1A 1J05A 4UV7L 4Y4HD 5FYKH 5GSVB 2PXYD 1A6AA 4NSKB 3FL7A 1A7OH 2IH3A 3MROA 4ODTH 3BPCA 1BBDL 3LEYH 1JFQH 4Y2DA 3WO4C 3ROLA 3V6FB 3Q48A 2VZUA 1NCWH 3TYGH 1BF8A 2ATPB 5F7LB 4NZUH 3UTQB 1KJ2L 2HN7B 2AEPL 5MEPA 3I3DA 3TN0A 4X5LA 2BVOB 4Q6IA 2XRAL 3MACH 4X4XB 5EZIL 3W0WE 1FZKB 3V0VA 2JB6A 3PP4L 4P9HL 2E9BA 1FHGA 5ECJE 4I2XA 1VEPA 1XFPA 1T89C 3OKMA 3GMOA 2WW8A 3Q6FB 4EVNA 3KXFE 1R3IH 3R06B 2A6JA 4XPAL 4I9WE 1SYSB 2VZSA 4M5YL 5EZOH 2V5YA 1A3QA 1RJZA 4ODWB 2ZKHL 5ADPH 1ACYL 4QXWA 5IROC 2ZCKH 4W81A 2IQ9L 4RWHA 5DYOA 3QEGH 4LSVH 5ICXB 3V2AR 5DD6A 1AXSB 1C1EH 4KJPD 1A3LH 3HE6A 2IPKB 1N4XL 3BDBA 4WFED 4DQOL 5ITBL 2NXYB 5T1KD 2DTMH 2C4XA 5T33H 1D6VH 3WFDH 4EBQH 3L6FB 1J1PL 4R8WL 1QQDB 3OXRA 3CFJA 5DRNB 43C9B 4QRUA 3RDTA 1ODAA 2DQDL 3WE6B 1N6QH 1SJHB 1MJ7L 3GSUA 1UG9A 2MOVA 1MCKA 2EDOA 4XP6L 3HS0B 3OX8B 4JZOB 4BZ1L 4GRLD 4R3SB 1P84J 1KXQE 2V2XA 4LCIL 2ESVD 4XB7A 2NR6C 4M7ZB 2WWMD 1IGYB 4PJAA 1JVKA 2LU7A 4M93B 2HJKA 2V17L 3ARBA 4O4YL 2OTUA 4D0CA 3RTQA 3SDDD 1O0VA 2CDFA 3HAEA 4KKCD 1HNGA 3PIQA 4PR5A 4G8GB 4HGWB 4U6VH 4X4ME 5I1DA 3CFCH 5JW3L 4ZMAT 5EU7C 8FABA 5FM4A 5F6IC 2ED9A 4LLUA 2DQHH 2VDQH 4PRNB 4LOUD 4YHKH 4Z7WF 4R7NB 4JPVH 2AK4B 4OLVL 2HKFL 2DQJH 5DA0B 2OK0L 4KJQD 2P8PA 1I3RA 4IRSB 1Z5LA 2BOBA 3AU1B 4PJGB 3VFRB 5DJCB 3WD5L 3QNYB 5LCVL 5IJKA 1A6VH 2VDRL 1NLBL 1WUNT 4XPBL 4U2ZA 5CEZD 3FONB 1NC4A 4H1LG 1CFTA 3OKOB 3CVHA 4Y19D 2DI8A 1RZJC 4JQVC 4KK8C 1MIML 4WW2C 2DM7A 3CDFA 5T1MA 3VXQA 4BZYA 3ULVC 3RPIB 4LCWA 4M9OA 5T5FH 4QTIH 5I71C 5D7KD 2ADFH 1A9BB 4X99A 1G6RH 4DTGL 4LLYA 4ZYKB 1PKQA 3MRGB 4XAWH 1I8KA 3K0WA 2HJLA 1I75A 1UWEH 4P4RB 4PP1C 1IC5H 4PJIA 4OFVA 4NRYB 5IVXE 1CGSH 2IALB 3BFOA 3BSZL 3QIUA 1FH5H 5ALBH 1D9KB 1CWVA 2VXUH 1LD9B 4NGHL 2RFXB 2VMFA 3SDYH 2ICWA 2YD4A 4MA8L 4YC2C 3B9EA 4Q9RL 4JFYA 2UWEB 1RIVL 3CCHB 3GIZH 3AAZA 5EOCJ 4ZAKB 4KRPC 2VXQH 5I15L 4Y4HB 2IAND 1FV1B 1VA9A 1WK0A 3QO1B 3C8DA 4YBLB 3G6AA 4KDWA 5DR5H 4G3YH 4QNPF 3EYVB 3FQUB 1RZIA 2P5WE 4K3EH 2EDBA 5L0QC 5INCA 4BFIA 2NY3C 3HPLB 3DMMC 1U2HA 3R0NA 1AD0B 4JANA 4N0UE 1EZVY 2MNUA 5J89A 4KV5E 1RUAH 1U8PB 3UBXB 4GG6A 1WAAF 2MQCA 4PJ5E 1A7OL 2RQ8A 4ODTL 5IVOA 1JGDA 1G7MA 1MQKL 3TVMC 1JFQL 1DANT 3TBVB 5FECB 4S1SH 5DK2B 1X44A 4MA3B 4NZUL 1MHPH 3IDXH 3MRDA 1BVKA 3NABH 2R23B 1IQDB 4OGAD 2VERN 4JY6A 2VE6B 4LP5A 4QHMB 4JFPB 1IKNA 1TZIB 2EDYA 5DRZA 5E5UB 1C5DB 1VFUA 2Q86A 3PHQB 1U3ZA 2OTWB 2DICA 3W0WD 2EZ0D 2HTLD 1DLHB 2E7CA 5GGVH 5C0FA 4OGYH 2APWA 4UBDC 1DBKH 4JGUA 4OZGB 5IIEA 4TOYH 3ARFD 3KXFD 3QA3A 3FTGB 5ADPL 5HVWA 4I9WD 4CBPA 3B9KB 4JM2B 3QEGL 2FATH 4LSVL 4PB9H 3VGAC 1IAIL 1WC7B 5C08B 1N2RA 1EERB 2DRUA 3P9LA 1LE9A 1A3LL 1JTTA 2A83A 2L4OA 5DJAA 2IGFH 5C71A 2DTML 2NZIA 1KIQA 2ENYA 3WFDL 5JORB 4L3AA 4R96A 3MRBA 4G43B 1CXHA 1JRHI 1S7WB 2NXZD 3UEZA 4U2YA 5I1AA 3EYSH 3GFUA 4MX7B 4HZAA 1CICC 1I9IH 3C87A 1G7JB 3EO9L 3HR5B 4P2RE 4M1GH 2XWJB 2Y36H 3WUWA 2Q6WA 2BCKA 1NL0H 4LSRH 3VXUE 4E41A 5F7KC 2W9EH 1LHZA 2LQRA 3SBWC 4WI8A 3KYKH 1G9NC 4U6VL 1AR1D 1T7XA 3CFCL 4Q7DA 2FHBA 5CLTA 5C0GA 1CCZA 1V3MA 5D5MF 3BGFC 4R2GD 4PPTA 3CZJA 4ZFFA 1H5BB 2DQHL 2VDQL 1LO3L 2X40A 4GUPB 5FA3B 4MNQA 1A1MB 5IVZA 4TVSa 4JPVL 2F53E 2Z8RA 1AQDA 5FV1L 4PY7A 4ORGA 2DQJL 1BWMA 3V7AE 1SEBA 3I6LE 1BECA 3GUTB 1S7VA 3HZYA 1UVQA 3CVHL 1A14H 4QGTA 3NOIA 1A6VL 1VFOA 1YY9D 4MJ4A 1BLNA 1U8MA 5F7DA 1WT5C 3EFFA 3OL2A 1M6OA 2Q8BH 5CEYB 3V95A 4TYUA 3MLZL 3JZ7A 4NWUL 4E42B 1IAOB 2DYPD 3ARZA 1QSZA 1U58B 3FFDB 5L2KA 4K9EC 5C0IA 1JNLL 1JHTB 3MNWA 5DURB 5FOBA 4QWWC 1NMCC 3GGWB 4NT6A 2XTLA 4F7CB 4F9LA 2XA8L 1MI5A 4PIRF 1DUZB 1BOYA 1ZSDA 4EJ1C 3QUMH 3QUXC 2WBJC 2HT3D 3OJMB 1MCLA 4Z7VA 4XAWL 5JLZA 3DO3A 3GI9H 1HN1A 3TPUA 1EO5A 2IADA 3VMPA 1UWEL 2C3HA 4F15C 5C0RH 4U7MA 4P5MA 2X4QB 5C0EB 2AV7B 4KUZH 2AXGB 1LO5B 1PQZA 2AJXH 2OJEB 3WXWL 4DZBA 2ITDA 1CGSL 5ALBL 2VXUL 5FO9B 3SDYL 5DF0A 3MUGA 2NW3A 3VE0A 5C0BA 3QDGA 3UCRA 3HCVA 1TLKA 1WISA 2ZUQB 3GIZL 3QWRD 5K9KB 1EK3A 1FNGB 4W4OA 2VXQL 1PDKA 5MERA 5EU6A 2APTA 1BD2B 1LK2A 1R3KB 1SBSL 4NN6B 5KJRH 4P2QB 5D1XD 6CGTA 1B4JL 3P0YL 5JIKA 4G3YL 2AQ3A 4K3EL 3IU4H 5JA8B 1W0WA 3MQIA 1SM3H 3H3KA 2P5WD 3QZWA 3TIEA 4DKFH 4CN6A 3MJ7A 4HLZH 4NZTH 5IGXH 1ZT1B 5E6IB 5JO5B 3U6RB 2H9GA 3O9WD 1ZLWK 2VXSL 3QIBB 25C8H 3GKWH 4PJ5D 5CKGA 4OD2A 4S1SL 1ADQH 1G7LA 3KXFB 5HYSG 1FFQA 5KAQF 3KPLA 3NABL 1DL7L 1OAKH 3ROOB 3QG6B 2NMSA 3IDGA 4NFDA 4PTUA 4Z7OE 5ESAB 5ESQB 2B1AH 3CXHJ 5FDWA 3FMGH 2VN4A 5GGVL 3L5HA 1S5IH 4OGYL 5DT1L 2X70A 4Y88A 3AS0A 5J1SC 2J8UE 5GGRY 2GUOB 3QPQC 2Y7QB 2FEEL 2P44B 2Y06H 2VL5B 1Z0MA 3C08H 1INDL 2VUOA 1Z9SA 3U4BH 4PB9L 2X7LB 4Y4KB 1AO7E 5EO1B 5CBAA 5JIHA 4G9DB 3U1SL 2VISA 3RWGA 1VADA 5DHVH 4ETQB 1A6WH 3O2DA 5DC9B 5IHZA 3TYFA 4RZCB 4WW1A 4FFYH 1S7TA 2ICWI 5EORH 2Z8VC 5HDBF 3GEWB 4X7DC 2VITB 3DVNA 3P3YA 4PJAF 2W0FA 3ISWA 3CXDH 3UXFA 5A16A 4NRXA 2YPKB 4NM8H 4NKMB 5DQJA 4M1GL 4PLJC 1SY6A 2VLKB 5F9JA 2BMKA 4C55A 4P2RD 1NL0L 1KLGB 4LSRL 4YDIL 2W9EL 3X3GH 3IVKB 1F13A 5HYEA 3VXUD 3KYKL 5FFLA 3GB7B 4NZRH 1QFUH 5HYFA 1FL6A 1N3NB 5EZJA 4JKKA 3MRNA 4PGDB 2IMMA 2BSRA 4GLRH 4U05A 3GHBH 2P49B 4HUMB 4S10A 2ADGA 2MQ3A 4OM0L 2YEZB 3JTSB 4FQIH 1NUNB 1OAXL 3D39B 2F53D 4OIAA 4OD1H 2XA3A 2VAAA 3MOAH 2LAGB 1RQ5A 2NQCA 3I6LD 1A14L 3QI9C 2Q7NA 3QIWB 1UT9A 1CK0H 3PWPB 4D9RE 5F7HA 1FZMA 1XGYH 5C0CA 4KC3B 1X4YA 3IJSB 3G9AB 4S2SB 2Q8BL 3AVEA 1J86A 2XN9B 4LRIC 4AL8H 4KUCF 4J23A 5IHUH 1BM3H 1YMHA 3DYOA 4JDTH 2VZVA 1UKTA 3OJDA 4JQXC 1R5IA 3C8KB 5IVXB 1I8IA 3KPSE 4KY1L 2AJ3B 4PJIF 3BD3A 3QUML 1IRAY 4L5FH 4LKCA 2YRPA 2UZYB 3GI9L 5IFAL 3CSYB 1IGJB 5C0RL 4PJHB 1TQCB 1AGFA 5EBMA 3ULVH 2DMKA 1BX2A 2YUVA 4KUZL 2AJXL 3MFFA 4DOHE 1D3CA 3TT1H 4V1DE 5EOQH 2MCG1 3IGAB 4W6WB 1XF3B 1YPZB 1TDQA 2JKXA 1QPPA 4GXUN 1M71A 3DJ9A 4M6MH 3THMH 5DVMA 1LK3H 1V3KA 5DS8B 5JIIA 4P3DA 5GPRA 3T0EA 4WTZG 4XHJD 1QFWM 2R1YB 1CR9H 4U31A 3UAJD 1C16B 3NZ8B 3PJSB 4ELMB 4XP5L 5IP4A 2GJZA 2XZQH 3T8XA 1F4XH 4NYLA 5D2LA 5EIIA 3TO4A 4QHNB 3EJZD 3QJHB 1FVDB 3RL2B 1S9XB 4GG6F 1E4XL 4PV8A 1QA9A 1UH2A 1T04A 1VHPA 5TGBB 3BUTA 3IFPA 2Z31A 4NZTL 5IGXL 1T5WB 1X6LA 3L95B 4ODSH 4IOSD 5FO7B 4AG4L 5JOEA 2YBRB 25C8L 3GKWL 1ORQB 5IB5A 1BF2A 5GGSB 2GT9A 2VABA 3MMEB 4PJCA 2GSGB 5I74B 4R0LA 3KPNB 4MNHB 4W68A 5F7UA 2F8XC 3OB0K 4JEGB 4YHIB 1UADC 4DN3L 1KULA 4OKVB 4FTVB 3ZL4H 5L2JA 2BRQA 4WI9A 4Y8AA 4LVHB 4X7FC 2HVKB 1NGQH 1YMME 3AMKA 3V6BR 3RUGB 4TQEL 4Q6IC 2VZ3A 3KYNB 4X6FB 1LEGA 1GGYA 3WNKA 2JJUA 4Y89A 2WWKT 4MVBD 4AEFA 2Y06L 1MCIA 3WEXA 2N7AA 3C08L 5HGHA 5BRZA 3LAFA 3U4BL 3VA6A 5E8OB 2Y07L 5HI4C 2CRIA 1AO7D 5B3JE 1A6WL 1OTTD 5IW6A 5I1EH 3OKEB 2VH5L 3H0TB 3VFUA 1VFBB 3ILQC 2XIDA 3P4MA 1N8ZB 1J87A 3MLVL 4XGZA 3O45B 1SY6L 2VKXA 2DQCH 3RY5A 3HE6C 3CXDL 3JVGC 3PE9A 1YNTA 4NM8L 3AFLA 5KVMC 4HFUL 3H8NA 4X6CE 4P46A 4M7JH 2FYYA 3OKDA 2B20A 3FCTB 3DOSA 2JIXB 3X3GL 3NBNA 3MLWH 2Q8AH 1T22B 3NH7L 4NZRL 2EYTB 3PGDB 4WV1B 4RMTA 4IRJC 3RWCA 2GY7B 4QHLA 1A7NL 4B41A 3JWOH 3K4ZA 1LVEA 2V2WA 4F2MA 4KWUA 5CD3B 1CDIA 3GHBL 4WENB 1G7PA 4OZFB 4GJTB 3CFBB 3TA3C 1Z0NA 4FQIL 1P84K 1RHHB 3QPXH 4BH7A 1YDPB 5D7LE 1G9NH 3MOAL 1FL3A 3WHXA 3VXRE 1KPRB 1TZGH 4LSPH 4GAJL 4G6MH 4MAYD 5CP7B 2J7LA 5DFVC 3D87B 3GMQB 4C83A 3LY6A 4HWBH 3ZE0E 4D9RD 3BW9A 3TFKD 4EUPG 4URTB 5IG7A 5F1NA 1U8OB 5A2FA 3FT3B 1MH5B 5DZNA 1CLZH 5FKPA 4AL8L 1JZ3A 2P24B 2VDPH 4LGSB 5IJKC 5FAAA 5GGRB 3BRDA 1F58L 1BM3L 4QRTA 4JDTL 1UQSB 5CGYC 4JAMA 5EWIH 3ABZA 4RGMB 3DROB 3O8XD 4XNZB 4L1DA 2DDQL 4L5FL 3SJVB 3KPSD 1OAZL 4KFZC 4LFHD 4FA8A 4YXLL 4Z0XA 5CIPA 4K9EH 3VXSB 2V7NB 1JGLH 3K8KA 3PL6C 3ULVL 5ANMA 2GFBA 2UZIH 3AC0A 3TT1L 5B21A 4XTRC 5FUOL 4M6ML 4V1DD 4XCEB 1LK3L 1P7QB 3TBSA 1KNOA 1GGCH 5FHAL 2VQTA 3UTZB 1P4LA 3HC0A 3Q2CA 1V5JA 4Z5RA 3GSRA 1H3TA 1AGDA 2HFFA 3BQUA 5GRZA 2X41A 3S35H 5JHLL 4D8PB 2H26B 2V5SA 5SWQA 3QIUC 2DN7A 3F12A 2XZQL 3A67H 4LHUA 1EO8H 1XMWA 2IBZY 3IYLW 1CFVH 1WCBB 1TPXB 5IUSA 5F7NC 5C3LD 5BW7C 4LLQA 3LDBB 5DZLA 3JV4B 5CHNA 1KG0B 2A77H 4XWGL 5EB9A 1YN7A 1FZJB 4G7VH 4AT6A 2ZSVA 2B4CC 5BZWA 4UILH 3GMNB 4NNXA 3GSQB 4RFNB 1I8MB 4LF3B 1NGPL 4LKXB 1OB1B 1IQWH 3AS3A 4UNVA 4UQ3B 4ODSL 3ELAT 4UTBL 3IDUA 3HRZA 1J0IA 1L7TH 3NGBC 1OW0A 4EN3B 4CJ0A 3FQWB 1HILA 1OAQH 5F97E 3K46A 2RR3A 4FFVD 1CZ8L 3H3PH 4K71B 4PRPB 2PXYC 4TVPL 5IHLB 1FAIH 3VFPA 4UU9B 4PD4K 3MRFB 4M5ZH 2KL6A 2DJSA 2HRPH 2DQGL 5TPWL 4XHQA 4OZIA 1YMMD 1TITA 3FOMA 1MLCA 3PQYB 4U1IA 4DUXA 5ERWB 4ERSH 4F58H 4LK4A 1DUYB 2AJZB 5T3XE 5GS1A 2E7LC 4Z78A 5K9OB 1TQBB 2Y72A 4HCRH 3UTPE 2VC2L 5BJTA 2H2SC 3IDYC 5I1EL 4U1KA 4U1LA 3N1QC 1NCTA 5CLWA 5EZLB 5DLMH 3LD8C 3WNOA 5CILH 1VFAB 1F2QA 5HGDB 5FF6B 4AQ1B 4GQ9H 4M7KH 1AFVL 5DQDH 1K6QH 3U4EA 2CD0A 3LHPH 3O3AA 4I48A 4PG9A 3MBXH 4PBXA 4M7JL 4ZSOE 4JFFE 3MV9A 3AY4A 4F37K 15C8H 3OQ3B 2OBGA 2NY4C 4KDTA 3MLWL 4FG6C 2YPLA 5D7JB 4KTDH 1F3DH 5I75B 4HPYH 4MWFA 4R6UA 2GW5A 2ARJQ 3B5GA 3EFDH 3PWNA 3JWOL 4GRLC 1BWWA 4JDZB 5MEQA 4HK3J 1X5IA 3P4OB 5CSZB 5FYJE 5E8EB 1RURL 2ZG3A 1JGUH 2NLJB 3KR3L 2EYRA 4L8SC 3CMOH 3ZT5A 3O41B 1A22B 4LQ1A 5D7LD 2VSDA 3GK8H 3IXTA 3OAYH 1TZGL 4LSPL 5DO2C 3H42L 1WBYA 3NFPB 4GXUM 1NFDF 4WI2A 5EU3A 4QRPE 4Z77B 3VXRD 4QRRE 5EIVA 2D7QA 3VH8A 1W0VB 1WWAX 4U1GB 3VFMB 1H3XA 2W07A 3GSOA 2AV1A 5DJXA 5IOPB 1CLZL 4NQCE 4X0KB 3W11D 2VDPL 1YEFH 5F8QC 4OZHA 4Y1AE 3CFKB 1A4JA 4OB5H 3VWJA 5KW9H 1JNNL 3FQXB 1MFAH 1DN0A 1BOGA 4W6XB 1UB6A 8CGTA 5C0ND 3T2NH 2F5AH 4TUJA 4NOFA 5CEXA 2EC9T 1OY3B 4F33A 5IT2H 4I18A 3CPLB 3U48A 1VESA 2EIDA 5F6HI 4NO2B 3RHWK 1NUDA 4F9LC 4AJ0A 1CU4H 3ULSB 3KPQA 5DMYA 4CKVX 2E5EA 3H2WA 2GK0A 2UZIL 5J12B 3DO7B 1UXSA 2ZG2A 2NNAA 2ZSWB 5D93C 4AM0A 3EJYD 4JN1H 4YPGA 2BJML 4MZ3A 1R0AL 1MCSA 5AZ2H 2BXYA 1PEWA 5EU4A 5D2NB 5D2LF 1GGCL 2VQ1B 1QG3A 2C1PB 4G80B 3MR9B 2HWZH 3P77B 5ID0B 2ARJB 2YZ8A 4LAQL 3FB6A 1M7DA 1U92B 4ZTOH 4LRNH 2I9TB 2VOTA 2J6EA 1EO8L 1CFVL 3QDJA 4IDJH 1KIRB 1BMGA 2DQIH 2BC4A 4BFGA 2MPAH 1S9KC 5IEHB 5B39A 1B0GA 5TF1L 3I50L 1B88A 3LKOA 2O93L 3C5SA 4G7VL 3O3BB 1JZ7A 3OKKB 4PLKD 4UILL 2MFNA 2DKSA 4HF5L 5GGTH 3O2VH 4OV5A 1Q9OA 3SN6N 3MRLA 3DX6B 1IL1A 1JRHH 1XF1A 3HMWL 1L7TL 1YMMB 4XNUH 2OSLB 1DVFA 4WGWB 2EDRA 1U8NB 4LIQE 4P57B 1GZPB 1HKFA 2AEQH 5F93C 3BPOB 4NP4H 1OAQL 3U9UB 4J1UB 5EO9A 3RX5A 1PYWB 1BREA 3H3PL 5E08H 3G5ZA 1LEIB 1J1XH 4GW4B 4HV8B 1I1YA 3J7HA 4M5ZL 1SJEB 2FIKB 3IDNA 4JVPA 2HRPL 4GBXA 1VPOL 1DFBH 5DJYA 4NC1E 2HJFA 3QDMB 4ZQKA 4PJDA 4RWYL 1BP3B 4ERSL 4KQ3L 3TZVD 3D85D 3SKNA 4OI7A 4OGAC 4WFHE 3SY0A 4NO0D 5KSBB 2J88L 1T1YB 5T3XD 4HJGA 4HH9B 5I76B 3BMWA 1PJ9A 4OFDA 4HFWB 4OD3L 2EZ0C 3VDCA 3RVXD 2HTLC 5ISZE 4X6CB 2FECI 3CXHK 3UTPD 1T4KB 2J1KA 1UXWB 5DLML 5JW4N 3FO9A 3LV3A 2CO6B 4X6DA 1CFSA 4FXGA 5E99L 5SX5K 5EOTA 1Q1JH 1LP9B 3EW3B 1XCTA 3ARDD 4IIQA 2R1XB 4M62L 4M7KL 5BZDB 2NY2C 2O26U 3LHPL 2JE8A 3MBXL 1QBLH 1MOEA 3S37X 4D9QE 2ICCA 4WUKL 1CXKA 15C8L 5GSVA 1T20A 3VI3E 3V7MA 4MDJB 4JFFD 4NSKA 4KTDL 4HBCL 3PHOB 4WHTB 4HPYL 4M9PA 3EFDL 4ONGH 1UYWH 3FFCE 3V6FA 2ATPA 3UTQA 1Z3GH 2HN7A 3VFNB 2VSCA 4OLWH 2BVOA 4LBEB 2AJUH 1QSEB 4PJEE 4X4XA 1JGUL 1FZKA 3ET9F 5FYJD 5FCUH 1QBML 2HKHH 4HUWB 1U8HB 3Q6FA 4JM4H 4PV9B 3D3VB 4L29B 3R06A 1SYSA 4DEPB 2V5TA 5KAQG 1VENA 4LVEA 4PBWD 4ODWA 1XR9B 4C57C 4QRPD 5F1IB 3IDIB 5ICXA 4QRRD 4HIEB 5JW5B 1XF5B 4JKMA 2VQUA 3ZT6A 1I8LA 1AXSA 4NKIH 5DGRA 2QSCH 5DRWB 2IPKA 4NQCD 2H2PD 4PJ7B 4OB5L 1S7QB 1PX4A 5MEOB 1NGZB 5F21B 4Y1AD 1QD0A 3L6FA 2JELH 1QQDA 3GMLB 4HJ0D 4UNUA 3BP6B 2BY1A 5DRNA 43C9A 2NX5E 4U49A 3QEQE 3T2NL 1NC2D 1ZS8B 4HULB 2B0SH 1SJHA 1PW3A 3HS0A 3OX8A 5IT2L 4JZOA 3EYFB 1XGPB 4R3SA 1CU4L 2JB5H 3BZFB 1IGYA 4GKNB 4XCFH 3RWIB 1ED3B 2BSED 4X5WB 2PUQT 1ZANH 2CQVA 3U83A 1MSPA 3BMVA 4DVRH 4WHYG 5AZ2L 4G8GA 4HGWA 2HT3C 2J6EL 3NPSB 3HAEG 4UINH 4GG8B 4J3VA 4PRNA 4JHAL 3CX5J 3GMPB 4R7NA 2AK4A 2Z91B 3EOBB 2IPUG 4ZUWB 1OLLA 3BN9C 2DQIL 1P2CB 2F9BT 4IRSA 3T0EC 5ALCH 3OPZH 3AU1A 3ALXA 4PJGA 2WQRA 4UAOB 3VFRA 5CSBA 5DJCA 1RIUL 3QNYA 3LZFH 4QY8B 2G75B 2H41A 4TSCH 3NIDE 3BJ91 5GGTL 5D71H 3FONA 4IMKC 2Z35B 3OKOA 4CUCA 3C2SA 1T7WA 2X4OB 4LSQH 1C5CH 3G6JE 3V9FA 5D1XC 3OF6D 2LTQB 2BHZA 4APQD 4OF5A 5E7FA 5A40E 1WF5A 1C5BL 4FN0A 5F96H 5E4EB 2X9XA 3MV01 2VDOL 2AEQL 4NP4L 3VXOB 3AREB 4OZIF 5GHWL 1A9BA 1I3VA 3GJEB 4ZYKA 1JK8B 5E08L 5M94B 1ACZA 2XG5A 4P4RA 1DFBL 3GRWA 4NRYA 2AI0H 5D70H 2IALA 5K9QI 1D9KA 3IETB 3OAUH 1LD9A 3UTTB 2RFXA 1GJIA 4MA7L 3QQ9D 4G9FB 2UV3A 3VD9A 4YHYC 2ICES 3MX0A 4WFHD 2FRGP 2UWEA 4BKLB 2Q3ZA 3CCHA 3QUZD 4MA1C 3AB0B 4ZAKA 3RWEB 4Y4HA 3N1MC 5ISZD 4LSUH 1FV1A 2R9HD 4NZJA 3TNNB 4P49A 3KJ4B 2FBJH 1YNLH 1RJYB 3QO1A 2PYEB 4G6FB 4GW5B 2WLYA 2PO6D 2ZUSA 3EYVA 1RPQA 3FQUA 5EUKB 4BZ2H 4J3TA 3HPLA 1DN2A 5HPMB 5HHOB 1AD0A 1GH7A 4ODVH 4EQ2A