2H32A

Crystal structure of the pre-b cell receptor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEERERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin iota chain
publication title Structural Insight into Pre-B Cell Receptor Function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h32A00
1TNNA 1A1OB 5GGVY 4KK6D 3BYTA 1U91A 1KELL 3MACH 4GRMB 1DBMH 4M5ZH 4YDLC 1X9QA 1TJIL 3EGSB 3MX0A 2RIKA 3KR3L 3ZTNH 2IPTL 4EUPA 3FB7B 1GZQB 4PRPE 2E9JA 3GSUB 5F8RC 1G7LB 3T08A 4LSTL 4C54A 3DURB 1ZTXL 2EH7L 2IAMA 3VXMB 5ESVA 1R6VA 3IETB 3ARBC 3P2TA 5IVNA 1SY6A 1U8IA 3OPZL 5IIEB 1ZS8B 4QXUH 4O2CA 4LVOC 1IGYA 1IVLA 35C8L 4D9LL 2QEJA 4DCQA 3GMOA 4NO3B 1G0DA 1D3CA 3OKDB 3AC0A 3PGCA 1IGML 1D5BA 5DWUH 3DUUB 5IMKB 5HD8C 3MO1A 5EO1A 1OTSC 1YMHA 1RZFH 4MJ2A 4JO1H 1PBYA 1JNHB 3RPIB 3HE6B 2AXHA 4ODUA 3FONB 1PKQB 4PR5B 2ZUVA 5HI4C 3RWDB 1YY9D 4JVUA 4Y2OA 2O5ZH 2WQ8A 4NKIL 5HGDB 2RFXB 3L7EA 4F9LC 1S9VB 2W9EL 3QEGH 3GSXB 3MXWH 2A2QT 5FKAA 2PYEE 2CK0H 2H2PC 2ZOKA 4MGXA 1FFOB 4ONHA 3UTTE 3GRWA 4QOKD 2IH3A 5EOCH 1JGLL 3W0WA 3RY5A 2ILLA 2QL1A 3LPGA 5D5ME 4OZHB 1HINL 5JHDB 4YHZL 1NH6A 2CRYA 4X4MA 3RIAK 1OT2A 3HC4L 3P4MA 3FOMA 4PP2B 1OTUD 5FYKD 1FVDB 1RSFA 5C0EA 3HS0B 1F3RB 4P46D 1F3DJ 3GBNL 2LV4A 1FAIL 5DHVB 2YR3A 1BBJB 5IF0B 5L9DH 3TT1H 2D0HA 4Z77A 4R26H 3HMXL 3BPCA 2BJMH 2IANB 4WI3A 4KAQH 2ZJSL 4FG6C 3N85L 2LU7A 5J9PB 4RMWA 1QHOA 1QBLL 5IK3B 1OAXH 2CPCA 4Z76A 2FO1A 3RL2A 5AWNL 3B9KA 5TQ0L 2MNUA 1I1YB 4WO4C 3OZ9H 4WRLA 1BIIA 4K9EC 4KXZI 1DFBH 1TVBA 3AMLA 1AGEB 3NFNB 1ODAA 4NBZB 3IU3B 3VXPB 5ENWA 1HHKB 3GI9H 5F7LB 1VACA 2DQGH 4NBXB 1L7IL 2EIZA 1VKXA 2XPGB 3F65A 2N56A 3DTXB 4OZIF 3P4OA 3TGXA 2G60L 5IHLB 4JO3H 1UJ3C 2ZKHL 3SE9H 1U3HC 4R4NC 4ETQA 4FNLL 3REVA 1U93A 3SPVB 4OCNC 5D6DC 5IVZB 5HYJE 5IWLC 4MXWH 1R3JB 2GCYB 4CRPA 4J8RA 3TFKC 2H2SC 4OKVA 1YNTB 2AEPH 4O2EB 4LEXL 3T2PA 2E7CA 2YHGA 3F5WB 1IM9B 4KKCD 5ETUB 4JJ5B 3FQXA 3F6LA 3S4SB 4NZDA 3WFCL 3X13B 4M5YL 4U49A 1QNZH 2VXSL 3Q5OA 4G3YH 1ORQB 4E41E 3RVTC 2RHEA 4HWBA 4N9GB 4NRZA 1BQHB 1T89A 2X41A 4B7LA 3RWHB 3UX9B 3AROA 4Y4HA 4YBQD 5DHVH 3CFDA 4FFYH 4HXBH 5KS9F 1S7VA 5BZWB 4XAWH 4M5ZL 3MACL 5IB1B 1NUGA 2FEEI 1EGJA 1M7DB 1X7QA 5E5UB 3MFFB 2P48B 3EUUA 4NN6C 1JWUA 3BPOC 3RL1B 1EHAA 1TZGH 4Z7NF 3GB7B 4C58B 5TJWK 4H5SB 2Z31D 3KPLA 5B22A 1KCSH 2OJZH 2AJZA 4OFIA 1EFQA 1FL5B 4DN3H 3QJHA 5ESQB 3U2SA 3UROR 3AM8A 1NGYB 4MXQD 6FABH 1FJ1B 4YXHL 2HT3C 3TPKA 1J8KA 1G84A 2PO6A 4O02L 4MSWA 5CUSH 4YZFF 3SGKA 2YK1L 1J1PH 2R23A 2V2TA 5HPMA 2OZ4L 4MZ2A 1JRHI 5AYUH 4JFDE 2AXFB 3Q1SH 2R0ZH 1QSFB 1RZFL 1I9RH 3MRRB 4HJGB 2IC2A 1LDPH 5JMRA 2PNDA 2Y1VA 3B2VL 2D7QA 4QRSA 4HBCL 4FTVB 1AHWC 3J7HA 2CKBB 3MV8D 2HJLB 3PQYD 1H3XA 4RBPH 4ZQKA 3P9LB 5I66A 4KDTC 3QEGL 4ZG1A 3PWVB 1TZHB 1QO3A 1P9MA 3BAEL 4LSSH 2HP4A 4JZOA 5KBNC 4KUZH 1MREH 5FV2A 4M7KL 2XY1A 4CVXB 3JWOL 2I9LA 5EORH 4D0BA 5IUSA 1TNMA 1ITBB 1VENA 2XOTA 3MRGA 3TJHC 1X5HA 1U3ZA 5T1LB 3PWNB 2FECL 2AEQH 4CBPA 2YBRA 1F45A 2QADB 3OKNA 5JW5A 5DQJB 3RY4A 2A6DA 3NFPB 3QZWG 4JHAH 5E5MB 3RFZC 3EYUL 5F6HI 3RGVD 3DMMD 2CIKA 3F7RA 4YEEA 4UU9A 3DECA 3T1WA 4G9FD 4G43B 3QEQD 3ARDB 2CDFA 2VITA 1BWWA 2D4FA 5HYIA 1KN4H 3U83A 3IFPA 1RPQA 2EKSB 2H3NA 3PG2A 5DRNB 1AD0A 1KEGL 5IB5B 5L9DL 1OTTC 2X4RB 2C3WA 4WV1C 3TT1L 4JFFB 2AKRB 3PNWA 2A77L 4XRCA 5H94A 1QKZH 2XTJC 5CD3A 3MNVA 4KAQL 4NQDD 2R29L 4LQFL 1ZEAH 2D31B 2KQMA 5CWSB 4BSWB 2C4XA 3X17A 2XN9B 3SDYH 3X14A 2VDPL 1OAXL 3QAZB 5C0DB 4M61A 2P5WD 3WO4C 4P5TD 2HKFL 2HJFA 1HHGB 1TCRB 3MRCB 2XN9E 5FYLE 1LVEA 2CKBH 4AZ8A 3MTRA 3HA0A 5EH1A 5FYJH 3G6AB 4MMXC 2C4FU 3G5ZA 4WU7B 3MV8A 3PQYA 4KROC 4IRJB 4B53A 5JZ7C 1BIHA 1NAKH 1QFUH 3CFEA 4NOFA 4UBDD 3IF1A 4MWFB 4MXWL 1ED3B 1RZ7L 3HPJB 3KYNB 5F89A 4HC1H 2ED8A 2AEPL 3TZVC 4KC3B 1KCVH 1DBBH 2J8UB 3ZKMC 3AS3A 1I7RB 1FFPB 2P47B 3K1KC 1EV2E 5LKNA 5C7XL 1U8NB 3QDHA 4JFHD 2BK8A 3PWLA 5HBBA 1VFBB 4H0IA 3DMMA 2J8UE 4LLYA 3CLEH 3UZEA 4G9FA 2MQCA 1CGVA 1M7IA 3FO1B 3QEQA 4FFVC 4KTYA 3MRPB 4RGMB 4UQ3B 4O4YH 5ADOL 4HXBL 4WFFE 2Y7QB 4XAWL 3NTCH 4N8VA 4M8VA 1MELA 5GS1A 1YY8B 3F7VA 1S9YB 1A7OL 4TSAH 3WEXB 1T83C 4YHLH 4ALAH 2DLHA 4HS3A 1TDQA 1OAYL 1QFHA 4NQDA 2XI9A 4JFOB 2FIKA 3ILPA 1KCSL 5E4EC 2VLKA 5FF6A 1FZKA 2FIRT 4DN3L 3VI3E 3BQUA 2QQLH 3H6JA 5LXGH 5F88B 1NC2D 4P5TA 4XP1H 6FABL 2EDDA 4ELMF 3ILQC 4DVRL 3ECBA 5CUSL 5CZXD 3UAJD 1AGDA 4XZUA 4R3SB 1J1PL 3X11B 5BW7A 1U8HB 4Y2DB 2IBGA 3AREC 3UTSD 3CFKB 2R0ZL 4QKXB 1I9RL 3MREB 4Y5YA 1LDPL 4HIHA 4ELKA 2ZSWA 2VZVA 4ZODA 5FGCE 4ZUTA 1V7NH 3IDJB 5BJTA 3H9SD 1U91B 2PR4H 3BKJH 5IB3A 1MIEH 4LVHB 3V6ZA 2IH1B 3MLSL 2JCCA 4CW1A 4LSUH 1DVFD 2AJVL 1DQJA 5KG9A 3PHQA 2VZ1A 4LNVA 5EORL 1T03L 4JQIH 5BO1L 1T0MA 4OFYD 4LDEB 1KT2A 1U8IB 2BP3A 3WV0A 3DRQB 4O2CB 1IGYB 5IW1A 2YD2A 2NXZD 4DCQB 3EYFA 2ICEA 3IU4H 5J57B 3E2HB 1CG9A 3ULSA 1R5WA 3MO1B 2D7OA 2X6MA 5EO1B 1YMHB 1KN4L 4TVPD 5CBAA 5BRZE 5KJRH 2DJSA 3VI4E 4ODUB 1ND0A 2P8MA 2W0KA 5B38A 1QKZL 4M3JA 1UWXH 3L7EB 4HFUH 3F62A 4KJPD 1NC2A 3SDYL 4PS4H 5J3HD 1F3DH 3LZFL 5FKAB 4GRWB 4CU7A 3N9GL 2DQTH 1J1XH 4ONHB 1CD0A 2IH3B 5FUCE 5E2JA 3JWOC 4OUOA 4IDJH 4XHJD 2GSGA 4GW1A 4LOUD 4XVSL 5FYJL 3DLQR 1Z9MA 2DQEH 3FOMB 3P4MB 3P0VH 1J0YA 5GIRA 3CXHJ 3T0DA 1P84K 3K80A 4EUPH 5ABDE 4N1EA 5IGXH 3V7AG 1AQKH 5JOPD 4OV6F 1S9XA 3V9FA 1BHGA 1SY6H 5DRWA 5FIEA 4Z77B 2YPKA 3NPZB 3BPCB 1DBBL 3IFOA 4IIQC 4XBEH 2IQ9H 2IPUG 1U42A 1A6UH 3BO8A 1BZQK 5TF0A 3RQ3A 3D0LA 4KU1A 4HUXA 1HXMA 1CICA 1UKSA 2YC1A 3I9GH 1OAKL 3WIIL 5HPOA 4Z76B 1LO0H 3RL2B 1RIVH 4RRPG 3CLEL 2HMIC 1ZHBA 4XHQA 1BIIB 1HZHH 1TVBB 4NSKA 4FMFA 1KLGB 3VDBA 4PJ9A 4X80H 1Y0LA 3KXFD 1VDGA 1VKXB 4ALAL 3P4OB 5FYLL 2GT9A 3UPRA 3JXAA 2VQ1A 4OLZH 4JFEA 3P11L 3BUYA 4PJAA 1PW3A 4ETQB 3HUJA 2QHLA 4GRWH 3FQWA 3REVB 2XG4A 1I1AA 2GTWA 1U93B 3GRWH 3I3DA 1A3LH 4J8RB 5LXGL 5DMGC 4F37K 1JI2A 4OKVB 3RWEA 4RMVA 4QOKB 1KN2L 2W1NA 4OSUH 3FQXB 3FFDB 5LCVH 4P57A 3C5SB 5HJ3B 1KGCE 2A74A 3BH9A 5DQDH 1IAOA 5DYOA 2BXZA 2IADA 2CRIA 4MVBC 3MRJB 1GGCH 2EXYC 3CCHB 4RNRA 4QOKE 2YKLH 1O7SA 4S1SH 4P46B 1JPSH 1A5FH 4OLYH 1S7VB 3QFDA 5I9QB 4MS8C 1WIOA 2MQ3A 2PR4L 1Q0YH 4XVJH 4JZJA 2Q76B 1X7QB 5HYEA 5B39A 4LLAA 5FYKE 1MIEL 1JWUB 3W11C 4D0DA 2DM3A 4WEBL 4Y16C 1ZT1A 1OT1A 2WV3A 1A6WH 3NH7H 5D5MF 4DZBB 1MJUH 2OR7A 4JQIL 2AJZB 4S1QH 3FRPA 2HVJA 4ZPTA 3TPUB 3QJHB 5L0QB 4XCCH 3U2SB 2NTFA 3BDYL 4KZDH 3QCTL 1D6EA 3T2NH 4QY8A 1YEHH 4X4ZA 3WKNA 2R23B 4LPUA 5HPMB 2APTA 4O2FA 3AY4C 4J7RA 3WFZA 3KXFA 3NMEA 5LVEA 1E27A 4F9PC 1MAKA 3OTTA 5FYJU 3U0TA 3S5LG 4OI8A 1XGUA 4QRPA 1OARL 3IDNA 4HFUL 1KJ3H 4ZQKB 5EUOA 1N5AB 4E42B 5I66B 4JG1H 4XXCC 3P0YH 1QO3B 1P4IH 3BGAA 3PABA 3QWRD 4PS4L 1UFUA 3AAZA 4XP9H 3G04A 4JZOB 4Q0XL 1QBBA 3PL6D 5EU3A 4HWBH 2I9LB 2DQTL 1J1XL 1S5IL 3FB6B 5FYKH 4YDJA 3VH8A 4D0BB 4F7CB 2LFGA 1G6RA 3MRGB 4PJ8D 1CI5A 3MV9A 4FQIH 4IDJL 4RFEA 1UM6L 2YBRB 3OKNB 4TSBL 5JW3H 5KAQF 1EGJH 4E9LA 3RWFA 2DQEL 1NPUA 1CLCA 3L9RA 2ICCA 2CIKB 1JTOA 4UU9B 3W39A 2YUVA 2CDFB 3ULVD 5IGXL 3D5OF 1YEEH 2ADIA 4I1NB 4DUWA 1AQKL 4TOYH 2CO7B 3C87A 3WS6A 1P7QD 1R3IL 2H3NB 1SY6L 1AD0B 5CJBA 4YDIH 2Z31B 4F80A 5H94B 4XRCB 3QHZH 3ME0A 4FA8A 3QO0A 4QNPE 5CD3B 5KN5A 2J5LC 2IQ9L 3LDBC 3M1BA 4P4KC 3RDTD 4UOW1 3O6LL 3X14B 2L4OA 1AD9A 3I9GL 2ADJA 4I3SH 2X4UA 1LO0L 4C83B 1HQ4B 1RIVL 2R56H 4M61B 5B4MD 1FE8H 3MRHB 1FFNA 1CLOH 2HJFB 3V52H 4NKQB 5D96C 3MLTA 5ANMA 2Z93A 2VAAB 3FTGA 4UT6L 4UDTB 1YQVL 3QXAA 5D2LB 3G08B 5DEZA 3DXAD 1AI1L 2VLLA 4MDIA 1T1XA 3KYAA 3G5ZB 3MV8B 3CZJA 1X5LA 2J7LA 3PQYB 4I3GA 1CGTA 3S3JA 4OFPA 1T3FB 5F1SA 5DJ2A 3TYGH 1SJHB 2FECI 5HVHC 1CGUA 5F7NC 3SHSA 3WNPA 3VXSD 1NFDA 3CFEB 5D2LE 3QWRA 1WEJL 3IF1B 3NZHL 4RA3A 5HDOA 5TGBA 3PL6A 3BSZH 1IKNC 2EICA 3OGCA 2GTZB 4ZS6D 5C0NC 3VA6A 3WFDL 4PJ8A 4OSUL 4KTEH 5LCVL 5I18H 1I85C 3BDBA 4UOW0 1CQYA 3D3VD 1JYNA 2DMCA 5SX5H 4D94A 1GGCL 4XNYH 5LJYH 3OF6A 4K71B 4ZO6A 3PWLB 5D1ZC 5DJYA 3O2DL 3RGVB 3DMMB 4LLYB 1YPZE 2PW1A 4G9FB 4S1SL 3QEQB 2GITA 5KANG 1A5FL 4PJDB 4OLYL 1ERNA 3ZE0E 3LSOB 1EUUA 1IZKA 1QPXA 1Q0YL 3NACH 4N8VB 4XVJL 1NMCB 5GS1B 4HEME 2ZP0T 3F7VB 1VPOH 3MRIA 2FX7H 1A1MB 4LSRH 3PGFL 4NQDB 6CGTA 4L4VA 1A6WL 4GG8B 3ILPB 4PRAA 1MJUL 3RDTA 4DVBA 3HFMH 2GUOA 4OGAD 1CVRA 5FF6B 1FZKB 3BQUB 3ALXA 3UJIH 2Y9RT 3BT2H 4P5TB 3I50H 4XXDA 2AJUH 4KZDL 5BS0A 1NCBH 4K7PH 4CU6A 3T2NL 3ECBB 3K81A 3U30B 1AGDB 1YEHL 3NA9H 4JY6A 4XZUB 4LHQB 1SYSA 4XWOD 3MJGX 5MI0C 2P5WE 3QQ3A 5T5NG 2NY4D 1GGIL 1KNOA 4HIHB 1ZLWH 2ZSWB 4ELKB 3GJFB 5D4QA 5BXFB 4APQC 5BJTB 2F54D 3ZYZA 3NOIA 3MRNA 3O11A 3QFJA 3MA7A 1KJ3L 5AZEL 2RBLA 3QP3A 1EX0A 4JG1L 4PJHE 3V6ZB 3S35X 2P24A 1YEJL 2VB5A 4XP9L 3LH2H 4GG6A 1DQJB 4HWBL 3D3VA 3PHQB 3DSFH 5FYKL 1RIHH 4OFVA 2B7DT 4RA0C 2E9BA 1KT2B 4FQIL 3B83A 1DLFH 3D69B 5IW1B 4BM7A 1EGJL 1G7JA 1QRNE 4HG4K 4UIMB 1NQBA 3IAPA 4NQTA 1CG9B 3O6FA 2P45B 4KKLC 1R5WB 1KJ2L 4O58H 4OFKA 4JFHE 2NY5C 4PD4K 2AK4D 5CJXA 1XCTA 4M4RA 1YEEL 1Z0NA 2R2BB 1C7TA 1KC5H 4TOYL 4LLMA 1LEKA 3TH2T 1CXHA 1R3LA 5CBAB 2VWEE 5B3JE 4XP5H 3DHJA 4GJTB 4HJ0D 1ND0B 2P8MB 5B38B 2UVEA 3DPBA 3S37L 1NLBH 2A83A 3BN9C 3DROA 1SBSH 1U0QA 3KPOA 5F44A 1NMBL 1NC2B 3BE1H 1RIUH 4WW2C 1AKJD 2E9WA 2J8UF 5C0AD 2FJHB 5SWSD 1CTNA 4P99A 3CSPA 2R56L 1WZ1L 4H26A 1FE8L 2OI9B 1CLOL 2K7QA 1I7TA 5IBLD 1JCKA 2BY0A 1NAMA 5I76B 5EB9A 2GSGB 5GIRB 2BVTA 5I1CH 2F54A 2HT2D 3BJLA 2JF1A 1T22A 3UTSE 4WFHE 4HJJL 4OZFB 3OAYH 5DTFA 5HGGS 3NCYP 3GSVA 1E6JL 4C57C 1MFBH 4G6AD 1S9XB 4Y8DC 2VC2H 5DRWB 2XA8H 3H9SE 2CLRA 1MJ7H 1DVFB 4HT1H 5HYSA 2YPKB 3QUML 3TO4C 3Q2CA 3W5NA 3IFOB 5I18L 2C1OA 5AD0B 2DAVA 3BO8B 4HUXB 1HXMB 1CICB 3S37X 1ACZA 4XNYL 2YC1B 4WUKH 4M62H 1A22B 4OBRA 3SGJC 3VMNA 3RY6A 3PDGA 3HI1A 4OT1H 1YJDH 1ZHBB 1GOHA 1YDPA 4MNGA 1K5NA 2E8ZA 1BF2A 3GM0A 1UQSA 5TDPA 3ZL4H 2BY1A 4PJ9B 1Y0LB 2FCBA 3LN5A 3SDXB 3T0XA 3WN5A 5IHUL 5DVOA 2V9QA 2X1XR 3ESUF 2FX7L 1II4E 2GT9B 5D93B 4F7MA 1LWRA 3LS5L 5FUCC 4LSRL 3M17A 2V9RA 4GSDH 2FATH 3BUYB 4PJAB 1J05A 1AR1C 1AKJA 1QSVA 3FQWB 5C09D 1I1AB 5C0AA 3SDXE 1XGYL 5E2VH 4JGMA 4KRPB 3OKLA 2EIEA 2A0LC 5K9JH 3LD8C 2X9YA 3I50L 1D5XB 1AXSB 2X1QA 3VDAA 2W0LA 1L6ZA 1NCBL 1DCLA 4K7PL 4P57B 5DMKB 2CQVA 1B2WH 3BH9B 2LU4A 1IAOB 5DYOB 3NA9L 4MA3A 1JZ5A 4FQXD 3BRGC 2DQHH 4JPVL 5KW9H 3O4OB 5CAYB 5GGQH 3KPQB 1A14H 1HEZB 3MODL 4OZFH 3QIWA 3VI4F 5J11C 3VXQA 3LOWA 4NQEA 4LLQA 4NC0B 4OQTH 4YE4L 3IGAB 3TEUA 1WICA 4OM1H 5D7LE 1OQXA 2ZUWA 2NY3D 3KG5A 4D0DB 2ATPA 2F19H 4MXVE 4PJ7E 3HZVA 1ZANH 3CIQA 1QLFA 1ZT1B 4XP6H 4I77L 2VZOA 3DSFL 5JXEA 1RHHB 3RVWD 4WI8A 1ES0B 4G6KH 5C07E 2BVYA 2HVJB 4ZPTB 4ZO8A 2AV1B 3U46A 2WIIA 1H15A 5A43C 1G7HA 1R5IA 4XWGH 3RVVC 1OCWH 5C0GA 4ZD3H 2NZIA 2G9HA 2NTFB 4TVPH 4CUCA 5F6IC 4ERSH 3QI9C 4ZUWA 4ZOAA 1TITA 2GEEA 2OJEA 3RZWA 4NC2B 3TBSB 4KQ4H 4YPGB 5GRUL 3V95A 1QHPA 3KXFB 1KC5L 5CGMA 4R97C 1RUPL 4P59H 1F58L 43CAB 2BNUA 3VWJC 2FEDD 4YBLB 1XGUB 3HN3A 3QUYD 3FRUA 5EUOB 1XGRA 5J1AB 5IG7A 4LPTA 3BE1L 5JA8B 1QVOA 1RIUL 3PABB 3V5KA 3AAZB 3G04B 5E99H 1IGTA 3VRJA 5JLZA 4X5LA 1Y6KR 4Q6IC 4R7NA 4BFGA 1T20B 4LVNB 3VH8B 5F7HA 4NZJA 1YEIL 1G6RB 4Y1AA 4JEGB 3MV9B 4RFEB 5IESL 3S36X 4BUGA 3DI3B 1CD1B 4JKKA 1U8LB 1W72A 3RWFB 4QHLB 4ZOBA 4YLQT 2R0LH 3L9RB 3EYSH 2EYTA 4HIIA 1MCWM 4G42A 4Z7WB 3HR5A 1CT8B 1MFBL 4MA1C 1RMFH 2D9CA 3DETC 5JW4N 5I71C 1FYTD 2XA8L 1MJ7L 4Z7QE 1VEOA 4Z7WE 5KN5B 3VW3L 3NAAH 4U1HA 4PJIE 3M1BB 3VE0A 3TIEA 4MB5A 4DKDC 1AD9B 4GO6B 2ADJB 4MNHA 3SGDI 2X4UB 4OCYH 4WUKL 3RZCC 4M62L 1FFNB 4ODHH 2OR9H 2MCPL 5ANMB 2Z93B 3M8OH 4GXUM 5FO9B 3VGDA 2BSSA 4NNPL 5EOQH 4P2OD 3MFGB 1DP0A 2J6EA 3FZUC 3FTGB 2ZSVB 3HE7A 3QXAB 3UDWC 2WQRA 4KDVA 1AY1H 2VLLB 4XPGH 1Q9LB 1U8KA 5GGTA 1BWMA 4MDIB 1T1XB 1F6LL 5C08E 3IDIA 4F2MA 2RCSL 2FGWL 1GC1L 5ELIA 5DJ2B 2FATL 4P23D 5E56A 1AR2A 2H41A 1NFDB 2CGRH 3QQ9C 2BOCB 4K3GA 4UIKH 4XNXL 4X9BA 3F7YB 2LU3A 3GBML 5E2VL 1G6RH 1FCGA 5TGBB 3PL6B 4GMSL 3OGCB 4LSDA 5K9JL 1E4KC 4PJ8B 1FVEB 1JTTA 4CVZB 1CDCA 3VXTB 1K4CA 5KSAD 3WJJA 1T6VN 3CVIL 3L3GA 5E4IA 3T0BA 3CVHA 2DD8H 2DQHL 7CGTA 4OZGA 1A14L 4Y88A 5DJYB 5KSBA 2X4TA 1K8DB 2PW1B 4YGVA 4Q9BA 4OQTL 3SDCA 2EDKA 4MAYD 1OF2A 2XY2A 2W9LA 1VB9A 4OM1L 4EDXA 1OGAA 3PDOA 1MCBA 3D6GA 1KIPA 1P7QB 1FYTA 3GBLA 3L5JA 5C0BD 5DUBA 3D39D 4OB5L 1AGCB 3MRIB 2F19L 3ARPA 5HXMA 3QA3A 3ULVE 1OLLA 4HUMB 1N6UA 2YD3A 1MAJA 1SYVA 4L4VB 2BCKA 3MLZH 4XP6L 4PRAB 5FGBA 3CMOL 4JCLA 3RDTB 2GUOB 4R2GC 4HZLB 2R15A 3DUSA 3S4SG 4QYOB 3ZHKA 4WHDA 1ORSA 4RMSA 1JUFA 4H8WH 5BVJA 3JVGC 1OCWL 1LNUA 4ZD3L 5J0BA 1T1ZA 4XXDB 4TVPL 1PD6A 4FS0A 1BQHG 4R4FH 3H9YA 1U8PB 3EDKA 5BS0B 3KGRA 2XTLA 5EO9A 3GKZA 1SYSB 4AYFA 5GPRA 2Y36L 2E5EA 3L1OL 4KQ4L 2JJSA 3L5XH 3QQ3B 4RIRA 2BNRE 5EBMA 4AH2B 4P59L 2X4QA 4QNPF 4P23A 4FABH 4U0RB 1CIDA 3DXAE 1YMMD 3MRNB 3O11B 1OW0A 3MA7B 4KJYB 4BH8A 1A7BA 2VL4A 2P24B 2F15A 4DW2L 4J3SA 2EEDA 1ITCA 4EIZC 4ZNEE 1NGXA 5EPMB 3VFUB 5E99L 3VXSE 5D8JL 5KSAA 3EAKA 3L3DA 3UPCA 4OZ4A 3D3VB 5IW3A 2E8YA 4G80B 1S7XA 2X4PB 1NBYA 4DGYH 1QR4A 3FQRA 1EH9A 4RAVA 5CEZE 4HFWA 5CGTA 2R0LL 3I6LD 3EYSL 1CIUA 4XP4L 5D2LF 4Y19D 3SEPA 5T1MA 4H88L 1XCTB 4F15C 2FLBT 1B0GA 3D39A 1NSNL 1LEKB 4LLMB 3G9AB 1RMFL 2EC8A 2NYYD 5ISZA 5D7SH 2FHCA 3OJDA 4NJAH 5E6YA 3DROB 4NYLA 2W38A 3KPOB 5CINL 1YPZF 1DEEA 3IJSA 1OP5K 3B43A 1NCDH 4FQLH 4H26B 4QO1A 3IDMA 1LEGA 4JAMB 1Z5LA 3ZE0F 9CGTA 5EIVA 5JOEA 4ODHL 1FNAA 3KPRD 3TH4T 1MJJB 5ECJE 4UV4H 1JZ8A 4AEEA 2NNAB 3T4AA 4JGUA 2J2ZA 4V1DD 1K3ZA 5T33L 3U0PA 4PGDB 5EOQL 2NY4B 4BZ2L 3NIDE 2IFGA 4PJCA 3RAJH 4PJDF 2Y6SC 2XRAH 2F54B 3S8WA 5HHME 1T22B 4PG2C 3RVXC 4ISVA 4M3KB 3I85A 2V9TA 5DTFB 3OKMA 1CFSA 2XICA 3O3AA 4LGRB 3GSVB 4N5ED 3O4LD 4UIKL 3RNKA 5JORA 1G6RL 4S10A 1XZ0A 5DSCA 2FD6L 2O93L 3NCFB 5HYSB 1VCAA 2BERA 2NY1D 5KVMC 2BY2A 3OGOE 5GGVH 1IARB 1MRFH 4JQVC 3PGDA 3ZKXC 4DEPB 2VWEC 1TTUA 2OBGA 3U1SH 2R4RH 4Z5RA 4Q9QL 3HI1B 5LG1A 5JPNA 5HDBE 2MKLC 1YDPB 4LCUA 3ORJA 3TN0C 1UEMA 3LKRA 4HQQH 3MGTA 1S7SA 3BX7C 5JMOC 1UQSB 3MLVH 3O0RH 4G9DA 4XPFH 5TDPB 3RUGA 3H42H 4I5BA 4U3CA 4LNRA 2GFBB 4DTGL 3LN5B 3WFEH 3WN5B 1SBBA 4TTGA 2QJDA 4X98A 2N7AA 4L8SA 5TPWH 3RRQA 2AK4E 4F7MB 3M17B 4G8GD 4X8JB 2NXYD 2DWEB 3MLZL 1J05B 4Z78A 4HAGA 1GC1C 1AKJB 3NFSH 4IRSD 5C0AB 1C16A 2A6IA 3CX2A 2WMPA 3OKLB 1LP9E 4NFDA 5DMJB 1LO3H 4HUUA 3MRDA 1I9EA 3HPLB 4R4FL 4TQEH 1CGSH 2BRQA 1F90H 4MA3B 5SWSE 1K6QH 3MCKA 4YJZL 4Z0XB 3PXHA 4ZFZB 3CXDL 2VYRE 1G7PA 4DKFH 2XQYG 5B3JF 1S7WB 1N5YH 2DDQH 3L5XL 5INDA 1PZ5A 4LLQB 4LKCB 5D1QC 1G1CA 4DQOH 5I75B 2XWTA 4P2QA 2SEBA 3RVUD 4FABL 2N7BA 2DJ4A 5IMOB 4ZFFB 5ESAA 4XNQA 1GSMA 2ATPB 2M8XA 3HZVB 5CJOL 1QLFB 1ZWIA 1KTLA 5E00A 4LHJB 4NM8H 5F96L 1RZKH 3C8DA 2Q8BH 2A9MH 3MRFA 1IT9L 3U46B 2WIIB 1H15B 3ULVL 1G7HB 1R5IB 2Y23A 2P7TB 1VGEH 2IJ0C 1JTPA 2G9HB 3P0GB 4DGYL 5L2KD 2CXKA 2FR4A 4ZUWB 3WHXB 3DUHA 4ZOEA 2FZ3A 2OJEB 1IGIH 1S78C 3U0WH 1WAAA 2BRRH 3FFCD 2W65A 4X5XA 3HNTH 4G8GA 2VLJD 1WCQA 5EOTA 3PP3H 1NBVH 4EUPG 1XEDA 1GH7A 5C09B 3JV6A 1RY7B 3P30H 2VSDA 5L88L 4DKEH 1G9NH 2EDQA 4FXGB 1OOAA 2CMRL 3FRUB 5D2NA 1JYWA 1ZT4B 1QVOB 4OD3H 3V5KB 1GGTA 3D0VA 2MWCA 5E2WH 1IGTB 5HYQA 3VRJB 1JF6A 5J06A 1NCDL 5C09E 3MJ8B 4FQLL 4N9OB 3GDBA 1FL6A 2AJSH 3EDJA 1OP3H 1BVLA 5ITFA 2C9AA 3OWEA 4FQXB 4UV4L 5E1AB 3GFUA 3G5YA 5EBLA 2OS7A 1ZHLB 4K2UL 1U2CA 2NY2D 1W72B 2CH8A 4Z7VE 3WDIA 5F7DA 4KJQD 4OCMC 2EYTB 4AY0A 4IEFB 3H9ZA 4G42B 4JN1H 1RUKH 3SDXF 4J6RH 2NY3B 1CFTA 3HR5B 5SWQA 1JGEB 3HMWL 3FO2A 1KFAH 2E3VA 4NT6B 3WS3A 2VL5A 1IM3B 4AT6A 4DAGH 3TCLB 3UJTH 5CGYD 4GUPA 4CVWA 2OL3A 4MJID 3TIEB 3ROOA 5L2KA 4MNHB 4J12A 3V0WH 3D18A 4FOMA 3F12A 2X42A 4NPYA 1EZVX 4POZC 4K8RC 1U2HA 1KCLA 1QSZA 2PXYD 4OCXL 4AIZA 3MLVL 3FFCA 3DO7B 4XPFL 3HE7B 2ARJA 3H42L 4MXVF 2VLJA 1KXTB 2JK5A 1ZGLB 3MOQA 4F2MB 1NMAH 1E0OB 3C5ZD 2I60L 3QUYB 1KTDA 3FT3B 4GKZB 4GRLA 4OCRH 2IBZX 4TRPH 5D7IE 3CFBA 1CDUA 2VQUA 4H0GA 3GHBL 2X44D 2VUOA 4UILH 3QCVH 5FCUL 4TQEL 1W72H 3BP4A 1K4CB 1BJ1J 1F90L 1X5YA 2WWMD 1K6QL 2DQCH 3G9VA 3OG6B 1KENH 3L3GB 1MCKA 1I1CA 2X89D 3CVHB 3CX5K 3BESR 4YC2B 4OZGB 2ADGA 4L3CA 4H0HB 3O8XD 2DDQL 5KSBB 3NCJH 1MH5A 3S34H 5CZKA 4K3DH 1AO7A 1ZKAA 3HE6C 4YGVB 2RB8A 1A0QL 3MLRH 4DQOL 1Q1JH 1P84J 1OF2B 2NCMA 1C5BH 4D9QD 5B8CA 4EDXB 5HHOD 1JWMA 1FNEB 4KJWD 3QISA 1FYTB 1DN2A 2V5MA 1LHZA 3EW3B 4I8DA 3QA3B 2DM7A 5L6YH 1IAKA 5EUOF 2FL5A 1SYVB 2BCKB 3HNSH 1NANI 3F7PC 4MJIA 1RZKL 3DUSB 3RTQD 5F1NA 1G9MC 3LPFA 5BVJB 2J6EH 4NCDA 2KKQA 1T1ZB 1LMKA 5H2BA 4D9RE 2VE6A 3L5IA 1P69B 2ERJB 5GGTH 4P2OB 5EO9B 1IGIL 1QFPA 4M02A 4L4TD 2YUWA 2R4SH 4RIRB 3EOBA 4KZEH 3C5ZA 1WWBX 4XCYA 4Z7WF 1AIFB 3H3PL 1NBVL 4P23B 1A3RL 4FFZH 4PJIF 4ZUUA 1A7NL 1HOCA 3VG9C 4DKEL 1G9NL 4JY5L 2VDMH 1TQCB 4NHUA 5TH2A 2OK0H 4OD3L 5GHWL 3SE3A 5DJ0A 4NN7C 4OUUA 5IB4A 1NGXB 5HGHA 5E2WL 3X3GH 1NUDA 3CVHH 4M00A 1A4JA 5KSAB 2B4CC 2AJSL 1S7XB 3O41A 2V2WA 3Q3GB 4UTAH 4PRHE 5H35A 5IMLA 5GJSL 4NFCA 5SWZD 1V8HA 1CLZH 3SO3C 4ZNCD 3I02A 1JZ4A 2BFVL 4RAVB 3MOBH 4HFWB 4MAYB 2ZG1A 4HK0A 3IAQA 4U1GC 5HHOA 3ARBD 4JN1L 5DT1H 5T1MB 1RUKL 2DJUA 4J6RL 5C0BB 1VERA 3D39B 1IKFH 1B0GB 5DQ9A 1Y6MR 1HH6B 1XH3A 1KFAL 1UENA 2B5IC 4LLVA 3P4LA 5ISZB 5EC2A 5CJ5A 3MBEC 5D72L 5HD8D 4I9WE 4DAGL 3WDHA 1CYGA 4IOIA 3OJDB 5C0BE 3RTQA 3QUXC 5GZOC 1OTSD 5C0JA 3UJTL 1HDMA 3MOAL 1C7SA 2E7MA 3IDYC 1DDHB 1DEEB 5HI4D 4YDKL 3V0WL 4N0FB 4CN6A 1AFVH 2YPLD 4FFWC 5GS2D 1LEGB 1Z5LB 5EZOH 4ODWA 2AS5M 3OSKA 3QT2A 1J0IA 4R8WH 1TVHA 4XX1E 3U0PB 1TETL 3H8NA 4LIQH 4X7TB 4GW4B 2VNCA 3QPXH 1JF5A 4HV8A 4PJCB 2H2PD 3ULVF 3QEUA 4LGSB 1BLNA 3WXVH 1DSFL 1U6AH 1NMAL 4ISVB 2V17H 3RX7A 4QXGL 1A21A 3OKMB 3MUGB 4OCRL 1NCCH 4TRPL 3RNKB 5JORB 4XH2A 1XZ0B 5DSCB 2ORBL 3BZEA 3VD4A 1YMME 3PWPA 2OR8A 5JR1L 5FKPA 5ADPL 3RKDC 2XZAH 3ETBF 5E8PA 3O6MH 5SWZA 2DQCL 1EDQA 2KH2B 3PGDB 1F4AA 3O9WC 4KQ3H 4PB9H 4X8XA 1UXSB 5BQ7A 3J8F7 5I6XB 3S34L 1KG0B 1J1OH 3ARBA 5JPNB 3MLRL 4FG6D 4Y19B 4LCUB 3LKRB 3MGTB 1Q1JL 1T5XB 1S7SB 1CDJA 1UM5H 4KKNA 3OAZK 2LVCA 2JTDA 4NWUH 3IVKA 3RUGB 3RWIA 4I5BB 3I6LE 5C0CD 4ODVH 2YN3A 1IQDA 5E8EA 4X98B 2JLLA 5D1XA 4L8SB 4Y19E 1UCBL 1CE1H 4WO4D 1OPGL 1V05A 1RZIA 1BEYL 4MZ3A 4Z78B 4P2RD 5FV1L 1C16B 2RQ8A 2A6IB 5I73B 4KI5E 1M4KA 2IMNA 1RUAH 5I17A 5JDJA 2J6EL 2I07A 3KPRB 4F9LA 1RUMH 4HUUB 4D3CH 1MCFA 1U3HD 3FMGL 3QUZC 2ZPKH 4KPHL 4M6ML 4R4ND 1SEBA 3T8XA 1C12B 3MCKB 5DJAB 1G7PB 3TFKD 2H2SD 4HMDA 5TE7H 4XPBH 4N8VG 2R4SL 5DURD 5INDB 1PZ5B 4KZEL 4XAKD 1HHJB 3QXDA 1VESA 4V1DE 3OB8A 1KPRA 3MMEA 1TQBB 2SEBB 4FFZL 5CILL 1J0KA 2CUMA 3O4LB 4X6FA 2VO5A 2PW2B 2I27N 3RVTD 1J9CT 2AQ3A 4M93B 5FHAH 3EDFA 4M6AA 4PPTA 4OZIA 5ESAB 4G6JH 2NY1B 1I3RA 5L7XH 2F53E 2VDOH 4KY1L 3X3GL 1KB5A 2BY3A 1J0HA 4KVNH 1ZWIB 3O4LE 1JZ6A 3FAWA 5IKCA 1MI5A 1Q94A 2CUHA 3B3IA 3B9EA 1LE9A 4LSVH 4C56A 3KPMA 4UTAL 4DN4H 3NIDF 1T5WB 5F9WB 1BD2D 5DRXB 4LMQI 3KJ6H 3JV0A 4HWUA 3RIFK 1CLZL 3VXUD 4TUOA 2FR4B 4M6NL 5CLWA 4XMLL 1F2XK 5DT1L 1D9KC 4MQXC 5FK9B 3KLHC 5C0CA 1MF2H 1MFEH 2RR3A 3VCLB 1K2DA 3VFVA 3U7AA 4WO4A 3KYMA 2W65B 2HT3D 4X5XB 5HHVL 4EI6B 2YS4A 4G8GB 2NXYB 4ZXBC 3HCVB 5F6HJ 5C0IB 4P2RA 2YD1A 5MP6L 1JMZA 1QLEH 3VFWA 4GAFB 4NNYB 5D2NB 1V3MA 4PJBA 4U6XA 2GAZA 4RFOL 3D0VB 1SJVA 2FSEA 3OBAA 1U3HA 5HYQB 4XMKL 1AFVL 3CFIC 2ESVD 3QXWA 4LQ1A 5D6DA 2R69H 5E6IC 5ITFB 4H1LA 5EU6D 5IWLA 5KTEH 5ITBH 4GXVL 1NCWH 2KZ1B 3O3DA 3SDAC 3G5YB 5EBLB 4LIQL 2DI7A 2IQAB 1QRKA 4U1JA 3SDDC 1D5IL 3OB0K 1H8OA 5F7DB 2CDEB 3IT8D 1U6AL 3TJHD 3I6GB 3D25B 1DLHA 1Q38A 5B38G 3DX7A 2EDJA 1IGJA 1CFTB 4OV5A 1A7PL 1NCCL 1UH3A 4Z0BL 5SWQB 3FO2B 1YYLL 1E4XL 3GJEA 2VL5B 2JB6A 2ICES 4AT6B 2BNQD 2D03L 4LEOB 3IYLW 1G0YR 2D2OA 1BD2A 4N90E 4JFYA 1B88A 4GUPB 5MEPA 1MPAH 1T1YA 2OL3B 1FLRH 1HKLL 4KQ3L 4PJGE 3VXUA 4PB9L 25C8L 3ROOB 5L2KB 4EIGB 1OTTD 4P9HH 2HFGH 3P73A 5ACZA 3WIHA 1J1OL 2XTJD 1N6QH 4I3RH 1QD0A 1F3JA 4HG4J 5J1SC 5GISH 5C9KA 3P9MA 3THMH 1MCPH 3FFCB 2ARJB 2C3GA 3WUZA 1BJ1H 4C4KO 2VLJB 5IVXE 2JK5B 3NIGE 8CGTA 4I2XA 5J89A 2GJ6A 1CE1L 1XR8A 2VR4A 7FABL 4KK9C 1PFCA 2IAMC 4N0YH 5FO7B 3HG1D 2VR5A 3T65A 1KTDB 1T2QH 1MCSA 5TF1L 1CU4H 4PUBL 4XBPA 5T3XE 1DBAL 3CFBB 4WI6A 1RUAL 2ZCLH 1RK1A 2ESVA 4KROD 3B6SA 2OM5A 2FJFA 1RUML 4D3CL 5JZ7D 1HI6B 3MV01 4KDTA 2ZPKL 4FQ1L 3LHPH 5ILTH 3MC0A 2I9TA 4WGVB 3BP4B 3QDJD 2VR9A 5C86A 5CZVH 3JWDH 3BIAX 2B2XL 2BXYA 2NY2B 5FA3A 2ZCHH 5DUPH 4XPBL 1K4DA 3TZVD 3ZKMD 3MJ9H 2WBJC 1QFWH 2FX9H 4NQXB 4FXLA 4S0TD 1EBPA 3IFLL 3FQTA 4MA8H 2DKUA 5B8CB 1QSED 1JWMB 4YHIA 4M9OA 3CC5A 4JB9H 1RZJL 4LAJH 5FHAL 1UCTA 4OLWH 3MR9B 4FFVD 2OL3H 3H7LA 4J3UA 5L7XL 1IAKB 3TCXA 4WDIB 4H25A 4MJIB 2Q7YA 4LSVL 2Z8SA 4OF0A 3RIAF 4QRQA 3QHFH 3BIKA 3NPSB 3MXVL 5DDHB 1SVCP 5H2BB 1KCRH 4UUJA 1INEH 1A9EA 4KWUA 43C9A 2PXYB 4XCEA 5BV7B 2WBKA 4JKLA 1EJOL 4XCFH 1DZBA 1MF2L 4HCRA 2D0GA 1MVUA 4NKDA 5T3ZE 5DK2A 2HKHH 3EOBB 5B39G 2OQJA 4NCC1 3C5ZB 3ILQD 1U58A 2VLRD 3BFOA 3HG1A 2XWBA 2X1OA 3QCUL 1HOCB 4IJ3B 4YIQB 3NCEB 3ARED 1QLEL 2YEZB 2YZ1A 1BBDH 4NHUB 3FRPG 1X6LA 3I2CH 5DJ0B 2DRUA 1CTOA 4EDWL 5IB4B 5HGHB 5IHBA 4LL9A 5I74B 2YD9A 3C2AH 1A4JB 3B9KC 4MNQA 3QDJA 5AUMA 3VG0H 1J8HD 4DGVH 4HH9A 4V2BA 5DD6B 8FABA 3GMQA 3CLFH 5KTEL 2V2WB 5ITBL 3O2VH 3OQ3B 3JUZA 5H35B 1MNUL 3C60C 1XF4A 5IMLB 4QRRE 1F4XH 3LQMA 5I30H 3I02B 4HD9A 4PLKC 4XVUC 3HMXA 3O6KL 1BMGA 3ZHDA 5HHOB 4XNMA 2ITDA 4X9GA 5D7IF 1KTKE 5DQ9B 4CL7A 2XV6B 4Q74A 3MLYL 1QLRB 4D9QE 4LLVB 5JIPA 4TN9A 5EC2B 3MV11 1F4HA 4MD5A 4EOWL 4IOIB 1A6ZA 4KMTH 3RTQB 2E7BA 3VH8G 5C0JB 2AJYL 2JELH 2O5XH 4GKOA 5KVGH 1HDMB 3LQZB 3WIFA 1MPAL 1FLRL 4KXZH 5DR5L 1JP5A 2F5AH 1I8LA 2Q86A 2VUYA 2B0SL 1WC7A 1HHHA 3SJVD 4L29A 2JIXD 4P9HL 1LO4H 1ZHNB 4WUUA 2HFGL 1OD7A 4PJ5A 4I3RL 4Y4HC 4Y89A 3DRTA 5D6CA 3FHQA 5EG6C 3LIZH 5DHYB 4ODWB 1ZLUK 4OZGF 5J6HA 4FZ8L 4L4TB 2WLYA 4G7YH 2FJGB 3IJHA 1MCJA 2YD5A 1MCPL 4GAJH 1H8NA 4GKNB 4HV8B 1PQZB 1WZKA 3QEUB 1MWAL 4X6DA 1BLNB 4L4TE 4XB7A 4N0YL 4PLOB 3JTTA 5E2TH 4LP4A 4C59B 3ALPA 1CU4L 3FQNA 4PRPD 5CS7A 4XH2B 1RQ5A 2VTFA 3AM8C 3Q6GH 3BZEB 1J8HA 3PWPB 2E27L 4YDLB 4DGIH 2DLTA 2PO6C 3IXTA 5GRWA 5LQBL 4HKBA 5CZVL 3JWDL 5SWZB 3NA4A 2P8LA 5C6TH 5BQ7B 3K4AA 2ZCHL 5DUPL 4OF7A 3KHQA 3ARBB 3MJ9L 3BUTA 1QFWL 1KCUL 1N59B 2FX9L 5HHQA 1DUYA 4LVOB 3BKML 1J86A 3C6LC 4JRYD 1FNLA 3IVKB 3RWIB 2AGJH 2WLZA 5DEFA 4WVRA 1IQDB 1P9MC 4WFED 3RX5A 2HMID 1HWHB 2X4OA 2NY7H 5FA4A 1N3NA 3G5VB 2YWYA 3I75A 3BKYH 3LMJH 1CFNA 1RZIB 5CMAA 2OZ4A 3LRHA 2WUCH 3T77A 3ZDXE 4ODSL 4DJMA 4M8QB 4R96A 2PYED 3SJVA 5F9AC 2JIXA 3N1GC 1EEZA 3GMPA 5I17B 2YPLB 3BISA 3UTTD 3SGEH 2I07B 4MA7H 4BKLA 1X4YA 1KCRL 4M7JL 2EYRA 1G9EA 1SEBB 3T8XB 2C3HA 5HHXH 4MCZA 1U9KA 3GI8H 4XCFL 1KYOK 3DGGA 5DMGD 1BZ9A 2X9XA 2P42B 4G8FB 3QXDB 4Y4KC 2GK2A 3V5DA 2XFXA 1KPRB 3WNOA 5HI3C 4MVBD 4UNUA 4PRPA 2Z35A 5JW4Q 2EXYD 2VN4A 4GRMA 4OZIB 1RFDL 3GGWB 5ALCH 3DX6A 3EGSA 3I2CL 5JQ6H 1KJMA 1RZJC 1URLA 2AVGA 1KB5B 1XGQB 4PRBA 4MS8D 5AAMA 5IKCB 3FB7A 4DGVL 1Q94B 3B3IB 1LE9B 3DURA 5J13C 3CLFL 3KPMB 4AQ1B 3ABZA 1EA9C 3O2VL 1NLDH 1IEBA 3W11D 2UUDK 4CN1A 1T0PB 4YUEH 3QDME 2IGFH 4IIQA 4S1DC 4Y16D 5IIEA 1OB1A 1ZS8A 5I30L 1A7QH 4X9IA 3CU7A 3QH3B 2MTPA 5HTSA 1CS6A 2IMMA 4J3WA 4PJCF 2D0FA 5C0CB 4KI5C 3DYOA 3VFVB 1K2DB 3LAFA 3W2DL 4WO4B 1A6PA 1NJ9B 3KYMB 4IM8A 3WFHB 4NNXA 3HRZA 1GCFA 3OX8B 1UH2A 2EEBA 3N1PC 1JNHA 4P2RB 3DYMA 3RPIA 2PYEA 4HS6A 5HYJD 1M05B 4KMTL 4PR5A 2DF3A 5T3ZL 5DA4A 1Q0XH 2JELL 2O5XL 4PJBB 3ULUE 4KHXL 4KMQA 3A6CL 2GAZB 4U6XB 3UTTA 3BGMA 5BV7L 4M43H 2F5AL 4QTHB 4K71C 2FSEB 4U1SA 3VXRD 1U3HB 5D5MA 4N0CC 5IOPA 4AMKH 5FUZH 5T5FH 2Y5TA 3LIZL 4H1LB 4E41D 1FFOA 4OQ1A 2FRGP 4G7YL 3O3DB 3DVFA 4LLWA 3QYCA 3TBWA 5DURB 5K9OA 4GAJL 2Z8WC 2FNBA 3SE4A 1JJUA 4U1JB 3P77A 3L7FA 3LEYH 4G5ZH 1PLGH 3X3FL 3RU8L 4PP2A 3RUGF 1DLHB 4UMGA 3G6DH 1IGJB 1KB5H 5F72S 5E94A 3GK8H 3BQUC 3T3MF 4B41A 1MCOH 2JB6B 2V2XB 3KLAA 4M1DH 4PJEB 2APFA 4HZAA 1I3VA 4X4XB 4DGIL 4RMUA 4NN6B 1BD2B 4HGWA 4UTBH 5B21A 4JFYB 3I84A 1T1YB 3BDXA 1GPOL 4LCYA 5MEPB 3TIDA 4Y16A 4G8IA 1ZLSH 1E6OL 3VXUB 4BK4A 1CZ8H 2HRPL 1QYGH 2HJKB 4PJEE 5J9PA 3CAFA 4LDOB 4Y5YC 3UYPA 4QGYA 5ACZB 1VFAB 3MV7E 4JFDD 4K9EH 3JBG7 4P4KD 1ZVHA 4MJ5B 3P9MB 3NFNA 1KPVB 2VZ3A 5I0ZA 4IRSC 3LQAC 4I2XB 2GJ6B 1BQSA 5HYJA 5HYSG 4HPYL 3BKYL 3LMJL 1R0AH 3T65B 4IOSD 2WUCL 4F9PA 3TT3H 4H1LH 5E70A 1AHWB 2XZQH 1AC0A 1BJ8A 2ESVB 3SPVA 3B6SB 1IILE 1R3JA 2GCYA 4MA7L 4AEIH 2FJFB 5EU6B 4E41A 4O2EA 3ALWA 1S7TB 2I9TB 3FL7A 1IM9A 5HHXL 5ETUA 4JJ5A 4G6MH 1RV6X 4TSCH 2W07A 2BC4B 3X13A 2VSCA 3GI8L 4PB0H 3NABH 1K4DB 2L7UA 5C0ND 1E4XI 4BFBD 3O2WL 1MCLA 4N9GA 3V6OE 2DN7A 3LKQB 3WYRA 1MVFA 2B1HH 5I1LB 1WAAF 3L3HA 3FQTB 2EDWA 4YHIB 5LGJA 1PGRB 3CC5B 5D1ZD 1RULL 3VJ6A 3KPSE 2I25N 2EKJA 5JQ6L 4J1UA 4F33A 1WTGT 3BZ4A 3BZFB 3RL1A 2R9HD 4H25B 1NCAL 3UTZA 2Q7YB 1QPPA 2XACC 1IC7L 4JRXE 1AGFA 3UBXA 4QRQB 4WV1B 3BIKB 2NX5E 5FM5M 4YUEL 2BNQE 2IGFL 2XTJB 5IJVB 2CKNA 5ESQA 3A6BL 2AJXH 4UUJB 1NGYA 5FYLD 4P4KA 1KB9K 5DRZB 4WCYH 4BQ6A 1FJ1A 2R2EB 1WQVT 2DBLH 5I8KH 4X7FC 1HIMH 4M4PA 5LGKA 3RX8A 1FNGA 5F1KC 4NKDB 2XTJE 3WO4B 5K59F 1R3KA 2R0KL 4HF5L 4NZTL 3ZTJH 1EFXD 2DOCA 1U58B 1MRDH 1CK0H 3HG1B 1IJ9A 5C9JA 2DMKA 4WHCA 5IT2L 4UINH 3FQUB 3CH1A 1JK8B 2W9DL 4M43L 1IQWL 4EKXA 3HHRB 4YDVA 3PWVA 1Z9SA 1TZHA 4APQD 2AQ2A 5JW4R 2IPTH 5AUMB 5T5FL 3QDJB 4LCWD 4LKXA 1V3LA 4HH9B 5J12C 8FABB 4LSTH 1ZTXH 5CD5C 4U6HA 4KKBC 4CVXA 1IKNA 4ZO7A 3TZVB 4YEFA 1XF4B 4NHCH 3NIGF 4PJ9C 4F7EA 3WNLA 5KSVB 1MOEA 2H8PA 5TE6H 2PETA 35C8H 4WFFD 3LEYL 4G5ZL 4D9LH 5F7EL 1KLFA 4K3EH 1QSEB 4XNMB 5C6WH 4YHOL 5E5MA 2ITDB 4XPAH 3G6DL 4LCIL 5D1ZA 1IGMH 2IFFH 2MPAH 2WAHA 1I1AC 4F37F 3S7GA 3GK8L 1MJ8H 3MRLB 1FZOB 4KRPC 3WNNA 3WE6B 5DO2C 1GGYA 5JDSB 4F7PB 1QSEE 4KKLD 4M1DL 5EO0B 1MFCL 2EKSA 1NGQL 4MD5B 1A6ZB 3C6SA 1AGBA 1H0DB 2AKRA 4UTBL 3SOBH 4XPTL 2YD8A 1CCZA 2W9EH 3K4DA 2Q86B 5MHSE 1WC7B 1HHHB 1MFAL 2NQCA 3U9UA 1QYGL 2XN9A 4HCRH 3DX9A 2H26B 4PJ5B 3BN9D 5E4EB 4HS8L 3DRTB 2DB8A 3ULUL 3BPNC 3KYOB 1TCRA 3IJHB 3MLXL 4JZJC 3RJQB 2F58L 4EN3D 1EFXA 1HINH 2VLRB 4X6DB 5A16A 1RJLA 4J23A 3AREB 5BOPA 4R6UA 5DD1H 3JTTB 3VWKC 3H3KA 3TT3L 2CXGA 1CL7L 2VLRE 3FQNB 4QRUA 4HUVA 2AXGB 1FAIH 2FYYA 2XZQL 1CN4A 1J8HB 4MWFA 3KYNA 3GSRA 5AZ2L 4AENB 1MRCH 3IXTB 3HMXH 3WUWA 2J8UA 3S88H 5DJZA 2ZJSH 2P8LB 1A2YA 1FFPA 3UZVB 1FBIL 4PB0L 3NABL 5DS8A 2UV3A 3TO4D 1QBLH 3OJVC 1BVZA 5HHQB 1E4WH 1DUYB 2VZSA 2B1HL 5TQ0H 2F5BH 3U4EA 3MRPA 2OYPA 5BRZD 2GYSA 5DEFB 3LEVL 1KSRA 2KZWA 1QBML 2X4OB 4R7DA 5FA4B 1L7IH 1GHFH 1N3NB 1S9YA 3WEXA 3QULA 1FCCA 1CFNB 3RWJB 3T77B 1NFIA 5B3NA 4R96B 2ZKHH 2VDQH 3SJVB 1J12A 4FNLH 3OR6A 2GHWB 2JIXB 3BEVA 1EEZB 4OGXH 4BKLB 2IBZY 2JJVA 2AJXL 2EYRB 4LEXH 1TCMA 1AR1D 4WCYL 1ADQH 1GL4B 5J4MA 2DBLL 3GM8A 2W60A 4M5YH 3DGGB 4OCSH 1P7HL 2A0LD 1U8HA 4Y2DA 1BZ9B 1WBZA 3VD5A 3H7BA 2KL6A 5D70H 3V5DB 5CLTA 3VGHA 3MREA 3MNZA 5DVNA 2UYLA 5DFVC 4PRPB 2Z35B 1I4FA 1M6OB 3IDJA 3H3BC 4HHAB 2VH5L 3DX6B 1CD9B 1KJMB 3OJ2C 5E8NA 1IC1A 1QFWI 3FT2A 2IH1A 4PRBB 1K8IA 4HWZA 4U3XA 4WWKD 3Q5TA 5GGUB 5C1MB 4H8WC 1IEBB 3TO4A 4GMTH 4NHCL 4M7ZC 4IIQB 4KVCL 1OB1B 3DRQA 2QQNH 5TE6L 4JVWA 4O51A 4JRYB 4JREC 4JCMA 4K3EL 4YXHH 5BRZA 1EIBA 3FT4A 4O02H 4XPAL 2IFFL 2MPAL 2YK1H 3RVVD 1UG9A 4AQOA 2OZ4H 5J1TC 2ZOLB 1MJ8L 3QI9D 4NNXB 3IRZA 3HRZB 1AQDA 4JRYE 1S5HA 4W6XB 4PTUB 4NC1E 1IAIM 5K9KA 3MSPA 3B2VH 4HWEH 1P7KA 2PYEB 4HS6B 1XIWC 1LO2H 4HBCH 2F9BT 4NKOB 5IM7B 4WFEE 3SOBL 2X09A 5JA9A 3UTTB 3BGMB 4U1SB 2BDNH 4I0CC 3VWJD 2VN7A 3GSWA 5D5MB 1KGCD 5IOPB 4HCRL 5AEAA 3BAEH 2Y5TB 4ZAKC 3LCYA 1F00I 4EXKA 3JZ7A 4M7KH 3EOYG 3JWOH 1FO0A 4OD2A 3TBWB 4LLWB 5K9OB 4HLZH 3D9AH 2WM0A 1H3TA 2JE8A 5HY9A 3P77B 3L7FB 1A9BA 2APXA 5K9QG 4KV5E 3ZDXF 2EE2A 2E7HA 3EYUH 3UO1H 2VZTA 3PUCA 5DD1L 4LBEA 3BI9X 5E94B 5F9DC 3O2DA 5T1KD 4N5UA 2AQ1A 1BVKB 3T0EE 3KLAB 2CD0A 1KEGH 3INUL 1MRCL 4U2ZA 3TYFA 1WT5C 2A77H 4HGWB 3S88L 3TIDB 1PG7X 2GQHA 4LCYB 4Y16B 2R29H 4G8IB 3B9VA 3DETD 4LQFH 1A3QA 3HNVL 4PBWD 2VDPH 3EDDA 5H37G 1NGWA 1ZGLP 1EEYA 1E4WL 5DFTA 4BSVB 1OP5H 2HKFH 2F5BL 1YNLL 3ULUC 4W70A 3QI9A 5DUML 5JOFB 4ODTH 3RZCD 4OTXL 2ITCB 2W0FA 4GH7B 5DI8A 2MSPA 3MQIA 1KLGA 3T3PE 1GHFL 4U7MA 5HYJB 2KDGA 3UZQA 3FZUD 2VDQL 5DJDA 2DQJL 3VXRB 3VWJA 4PJXE 4E5XB 3VFGH 3BP5B 2UWEE 4OGXL 1RZ7H 4ONGH 4E41B 3R0MA 4R90H 4EI5C 2WUBH 3IKCA 3O6FC 4QOKA 3QQ9D 1ADQL 2ZUYA 2OTWA 3VXRE 3FFDA 4MDJB 5CJXC 3C5SA 4IRZL 5HJ3A 5F9OH 3P3YA 2FWOA 4OCSL 5C7XH 3MRJA 5C2BH 4HIEA 5D70L 3CCHA 5E03A 1S9KC 1QZ1A 4JVPA 3ARGC 4MQ7A 3L3HB 1INDH 4OCWH 1H3VA 3UTPE 4ORGB 5ADOH 4NBYB 1OAQL 4P46A 3ULUF 5LGJB 5MEOA 2P4AB 2BSTB 5GRJH 4K94C 3VJ6B 1WGOA 2Q76A 4KKAC 4J1UB 4F33B 4MHHG 3BZ4B 1A7OH 1CBVL 1KJ2A 4C55A 4PJBF 2GSIB 5ID0B 4XTRC 1UWGH 1H5BC 1OAYH 2O5YL 3UTZB 5E8DH 4DZBA 1AGFB 3UBXB 2UZYB 4JKPH 3WL9A 5IEKA 1I7UA 4OLUH 4GMTL 3TPUA 3VA2C 2J5LB 3BN3B 3LDBB 3EOAB 2QQNL 2ZCKH 3EKCA 4JFDB 4P4KB 4MD0A 3IS1X 4R2GD 4X83A 4DVRH 3EJYC 3RZCA 4Z7UE 1FNGB 5J7CC 1R3KB 3SGEI 5D96B 4LLUB 4NP4H 1JN6A 3MJ6A 5C9JB 4BA8A 3UDWA 4F57H 1VEMA 4HWEL 3CH1B 3A67L 3QB7C 1LO2L 1PSKL 4PJEF 1I8MB 4E42A 1N5AA 3BD4A 1GGUA 4YDVB 2BDNL 3V6OC 4ZOCA 5HVHB 5GSRA 3RY6C 4NQCD 3U7YL 3MLSH 4JDTH 4LKXB 3WHE1 3V6FA 1AC6A 5TFSH 4U6HB 2AJVH 2OTPA 4F7CA 3FB6A 5SX4H 5IEHA 1T03H 3Q48A 5BO1H 3D9AL 1E4KA 4F7EB 1F13A 3QUMA 2H8PB 2BHUA 1TPXC 5IFHH 4LPVA 3VGAC 1IC4H 3UO1L 2Q7NA 5D1ZB 4XT1C 1CFQB 1K85A 5I1IL 5GGRY 2DTML 3OXRB 1WSST 4WW1B 1OHQA 4IOFC 4LPCA 2V6HA 4WIQA 2BZDA 1CE6A 4HUKB 3AGVA 3C6SB 2QBWA 1O5DT 1GAFH 2Z31A 1AGBB 2HWZL 3KLSA 3TLRA 3U9UB 1DE4A 3QIWC 3T0VA 1EVTC 3LZFH 3WHE0 3DX9B 1G7QB 3MGAA 4O5LL 2XXMB 4C83A 1HQ4A 3N9GH 3MRHA 1MUJA 3KPNB 5JPMB 4CMHC 2MCG1 4ODTL 1EFXB 4F58L 1YEGL 4JDVA 1DN0B 2VAAA 1W8OA 4UDTA 1RJLB 5A16B 3H0TA 5D2LA 3G08A 4JFZH 4XVSH 1OD9A 5DMIH 5MI0B 4DWHA 4RGNE 5JXEC 2YMXH 3V4PH 1T3FA 4MQSB 2VISB 1SJHA 2Y6SD 4QRUB 5SX5K 3VFGL 4HUVB 5EUKA 4APQB 4WI2A 2FYYB 2Y07L 4LCWB 2EDEA 3RVXD 4ZPVA 1PX3A 3GSRB 4ONGL 2GTZA 4TTDC 4R90L 2WUBL 3WUWB 1YPZA 3DIFA 3QRFM 5DJZB 1A2YB 3LVEA 5F9OL 1Q9KA 1MY7A 1QRND 4LCWE 4F7TA 1RI8A 3ARSA 5DS8B 5C2BL 3WIIH 1OAKH 2F8OA 4UNTA 4YBHA 1KBGL 3RGVA 2J88H 4R0LA 1WV7T 1TFHA 1INDL 4OCWL 3U4EB 1W8NA 3NCCB 4RDQF 4PJDA 2A6KA 3VRIA 3LSOA 5GRJL 1ROWA 1H3GA 1ZT7B 3HI5H 4R7DB 2AP2A 3TN0D 2EXWC 2LQRA 2CR3A 2J8HA 3QULB 4JO2L 3E3QE 5FYLH 15C8H 1A1MA 1UWGL 1NFIB 3RJDA 5E8DL 3P11H 4GG8A 3OR6B 3BEVB 4JKPL 3W9EA 4OLUL 3KDMA 1XF2B 4UT7L 1VSCA 3NGBC 2ZCKL 4GW5A 2P5WA 1ZLWK 4WW2B 2DTSA 3UMTA 1KN2H 5E24E 1YEDA 3VXOB 1J10A 4I48B 1EHXA 3C09C 1X5XA 1CL7I 5FGCB 2W60B 4KH2A 4GLRH 4X9FA 1WFTA 5KOMC 4QHKI 1FNFA 1WBZB 3H7BB 5MEND 4WFHD 4JGJA 4NP4L 5H8DA 1OAZH 4PJHA 2CSPA 4YHPB 2X4NB 5BXFA 3GJFA 4XNUH 3MNZB 4NQSA 4F57L 2UYLB 4Q9RH 3QG6A 1H8SA 1I4FB 4X7SL 4PG2A 5D1QD 5E8NB 3FT2B 4NOBA 2X05A 1K8IB 2M1KA 3CU1A 4HWZB 4JDTL 3QDGD 5IHZA 4WEBH 4HMEA 3DX8A 4NRYA 3TBVA 4PRID 5TFSL 4KRMB 5FO8B 5DZLA 3HE7C 3TO4B 2C1PA 1Y18A 3P4NA 3QG7H 1HSBA 3L3JA 3D69A 4O51B 4JHZA 5IFHL 3BDYH 3QCTH 5BRZB 1IC4L 2NY5H 3FT4B 4UIMA 5IFAL 4OD1H 3ESVF 4X6DF 5TE4L 5TQ2H 4NKMA 2EDHA 1G1YA 1P4BL 4YXLH 1IAMA 1MCRA 3TN0A 2R2BA 1AQDB 1IE5A 1S5HB 3L3IB 3CMGA 5K9KB 3SGDH 4QHUA 1S78D 1UH4A 3MUZ1 1P7KB 1GAFL 4V2CB 3QQ4B 3BEWA 5SV3A 3PWUA 4XC3L 1OARH 3SY0A 1TENA 4JR9L 4HLJA 2VABA 3GSWB 2FJHA 3LKPB 1MY5A 4Q0XH 1MSPA 3SDCC 3ROLA 1FO0B 1U3JA 1S5IH 3MCG1 4OD2B 2YOCA 3LD8B 3UTSA 1UM6H 4ZSOE 5I76A 4NUJA 5HY9B 1T7VA 3ARXA 4TSBH 4JM2C 4N0UE 4JFZL 1A9BB 5DMIL 5D7LD 5DMYA 1NCTA 3H9SA 5FGBC 1UT9A 5J11B 4LBEB 2PTVA 2YMXL 4WTWA 3V4PL 1U8QB 3LKOA 2HLAB 3GIVA 4OZFA 4PGEA 1P5VA 4JFXB 2QSVA 2LVEA 4OQTA 4M7LL 1R3IH 3QO1A 5C07D 1N2RA 1DVFA 5E08L 3TYFB 5CIPA 1O7VA 2EEAA 5HSFA 4OFYA 4HWNA 4N8CH 3MNWA 4WTZA 3WCYA 5AD0A 5KVFL 3BYYA 1XFPA 3V7AE 3O6LH 4NC1C 1CDBA 5CEXA 1NGWB 1EEYB 3T4YA 3GNMH 4IHOB 2J88L 5A2FA 1OW0C 5HGBB 3QI9B 1NL0H 4Q2ZB 1JGVH 4PJFE 2W0FB 4OM0L 2M26A 4UT6H 5DI8B 1YQVH 1AI1H 4POZD 4K8RD 3HI5L 3SDXA 4HUWA 4LRIA 4QF1A 4EQ3A 1ULVA 1I7ZB 1B90A 2GJJA 15C8L 1V7ML 4NN5C 3OHXA 4R97B 4JQXA 1NEZB 2R8SL 4ZYKA 5DJDB 1TXKA 4NO0D 1A6AB 3VWJB 1BREA 2G5BA 1CQKA 1V3KA 1FO0H 1KIQA 1WCBA 1WEJH 4XGZA 1Z0MA 3NZHH 2X40A 4Q9CA 3WFDH 3IKCB 1D5XA 1UACL 2FHFA 1AXSA 3ARFC 2GJZA 2OTWB 5DMKA 1FORH 2F8VA 2FWOB 3H9HA 3L6FA 3T0EC 4AG4H 5D7LA 4HIEB 3KPQA 1HEZA 4WY7H 3O2DH 1S8DA 1OAZL 4MQ7B 4UI2A 1ZLVH 4PJ7A 4XNUL 4CU8A 2FB4H 4Q9RL 5T1KB 3S35H 3IGAA 5MEOB 2QHRH 2QSCH 4U1LA 1GYAA 3HE6D 2PF6A 2PTTA 5C07A 5JO5A 5EFIB 3RPKA 3SKNA 5DF0A 1KJ2B 5DVLA 2MOVA 3PGFH 4MA1B 5I71B 1H9VA 3BP7A 1FSKC 1RHHA 2EDTA 3WL9B 1I7UB 1ES0A 5IEKB 4HUNB 3QG7L 4LAQH 2BVPA 2AV1A 3WJLA 3WNMA 2H9GA 5IR1A 4KV5F 1J5OH 4L8DB 4MD0B 5EU7E 3QWOA 4LHUD 1JNNH 4DZ8A 4BELD 2NY5L 5DXWA 5I0DA 3RZCB 4OD1L 4PGBA 4QXTB 5CEYB 2WZPD 4J3VA 4QCIA 5TQ2L 4YXLL 3TBSA 5C08D 4YPGA 1KLUA 5DJ8A 1JGUL 4CMMB 1GGIH 1JN6B 4X6EB 2NY6C 3ZKQD 43CAA 1FC2D 3DVIA 1PAMA 3FCTA 4XNZC 1TVDA 3SBWC 2I5YH 4L9LC 1P5UA 3F8UB 5DJXA 4AJ0A 4YGAB 2NY0C 5AZEH 5CKAA 5J1AA 1IEHA 3BXNA 2VOTA 5GSRB 1NC4D 3AVEA 3ZYIA 1YEJH 3HTLX 4F3FA 5IQ7L 1FNHA 4JE4B 3V6FB 2CLZA 1T20A 5IEHB 3TWCL 4LASL 2QLVB 5A2JH 4P9ML 2Z4QA 2DS4A 3T3PF 4M48H 1F11A 3QUMB 3SCMC 1GZPB 2VXQL 1CD1A 4X9HA 3I6KA 1RJZA 1JIBA 1U8LA 1I3UA 2F8XC 4QHLA 4PRNA 5F7WC 5ALBL 3DNKA 3UPAA 3V8OA 1KJ2H 3WBDA 5I1DA 2JB5L 4Z7WA 1CT8A 1OSZA 2XNAA 2V7NA 1U8JA 4PJIA 3SE8H 1P4LB 3DWTA 5KS9E 1XGTA 4RMTA 1CE6B 3V0VA 1DQLH 3KWWA 1LE5B 3S37H 2EO1A 4H1LG 3FB8A 4W81A 4WHYG 4N8CL 1AE6H 4PG9A 5FECB 3QJFB 1NMBH 1DE4B 4HX1A 1CFVH 2Y25A 3MBED 4R2GB 3Q5YA 4LHUA 3QUXD 3WLBA 5GZOD 4RQQA 4LF3A 3GNML 1WZ1H 1DQMH 1MUJB 1AXIB 2BNRD 3VMPA 5I8OH 5FO9A 1NL0L 1JGVL 2Q3AA 4EEEA 4JDVB 4FFWD 2H1PL 3VMOA 2ZSVA 3MUJA 1C5CH 4BUHA 3H0TB 4YZFE 1Q9LA 1ZV5A 1GVIA 1CXFA 2DBJA 3B5GA 3T09A 1QBAA 4HJJH 1JHKL 1Z9OA 5EUKB 1E6JH 3R8BB 2BOCA 5GGSA 1NC4A 1FO0L 4NQCB 3F7YA 3PP4H 1Q8MA 4ZPVB 3QUMH 3B2UC 3WD5H 2WWKO 1YPZB 3DIFB 1FVEA 1FORL 1XT5A 4CVZA 3VXTA 1Q9KB 4NQCE 5CEZD 5C71A 1FQ9C 2B39A 3ZE1E 4F7TB 2O61A 5FAAA 4P2CG 2IG2H 4AG4L 3MRQB 4WY7L 4RAUB 3RKDD 1K8DA 3WXWH 4R0LB 4OLXL 2DL2A 3O9WD 2FB4L 1RU9H 3VRIB 2A6KB 3S35L 3ZTJG 1MAML 2HLFC 2R9HC 2QHRL 2QSCL 1TJHL 5CFHA 4PGCB 3BRFA 4CDHA 1P7QA 4BH7B 4NGHL 5IHUH 3IXAB 4F15B 1JV5A 1JVKA 5HHPA 1AGCA 2VERN 3MYZA 4JPWH 3DVGA 3K4ZA 3LS5H 2XG5A 5E95B 4AEFA 3MBEA 4O9HH 4HZLA 4JHWH 1OVZA 3W9EB 3KDMB 1XGYH 4QYOA 5BMFL 3EO1B 5LBSH 4LAQL 4Y5VA 1T2JA 1R5VA 2YXFA 4GW5B 4RGNC 2P5WB 4HIXH 1J5OL 4YO0A 5GS0C 3BOVA 2BNRA 4WI5A 1YEDB 4G7VL 1JNNL 1U8PA 4CKVX 3L3KA 3UTQA 1W0YT 4JPVH 3DXAA 2K3TA 5HHMD 1EMTL 3QUZD 3MODH 4WGWB 3LY6A 1A8JH 4PJHB 4AH2A 4NQSB 4ZNEA 4YE4H 4UOJA 3QG6B 3VXSA 1MQ8A 2I5YL 1OGTA 5EZLA 4GT7A 4P5KA 4YFLF 4KJYA 2HT4C 3RA7H 3GSQA 5EPMA 3VFUA 5IHZB 3DX8B 4NRYB 4PGZA 2BVEA 4W6WB 3TBVB 1EUTA 3S36H 1K3IA 1QRNB 1UKQA 4I77H 2R1YA 4G80A 2Y72A 3VFNA 3R0NA 2C1PB 1Y18B 3P4NB 1ZA6A 4M48L 1HSBB 3L3JB 4F8QA 12E8H 4L3ED 2X4PA 3CGTA 4OKDA 3AB0C 4RDQG 3E3QC 1IGFL 3E0GA 5J56B 1JPGA 3PJSB 3ZKXB 2R1WA 4GRLC 4NKMB 3CFCH 2CDGA 4HIJA 5GRUH 3TN0B 3SE8L 2L7JA 1TTFA 1HSAA 1RUPH 2APWA 1CD8A 1F58H 2OX5A 4QHUB 1D9KD 1DQLL 4MQXD 3KLHD 4UNVA 3LPWA 3PXJA 5K93A 3BEWB 3FO9A 3PWUB 1F8TL 3SY0B 4X0KA 1AE6L 1KIUA 2VABB 4ZXBD 1CFVL 1YEFL 4CDGC 4EN3C 3HC0A 2OCFD 2P5EE 3ROLB 1KB9J 4JAMA 1DQML 1LK2B 1YEIH 1MJJA 3L5WA 2NNAA 4U2YA 5I8OL 5I1GH 3GJFH 1WLHA 3UTSB 3QUZA 4X99A 5MENB 4PGDA 5IESH 4NUJB 4ELME 2QR0A 4I13B 1C5CL 4PREB 4B0MM 5E6ID 3MZTA 1T21A 3BGFC 5E7FA 4NZRL 1HE7A 1WWWX 3SDAD 3H9SB 5SX4I 3WLWC 2WW8A 3PWJB 5IFJA 5D9SA 5I1HH 5MENE 4FQCL 3LKOB 4K07A 5D1QB 3GIVB 4PGEB 3VI3F 3GIZL 3SDDD 4YX2H 1NFKA 3LS4L 4ZS7L 3NPSC 3PP4L 4PRDA 3D1MC 2PTUA 3QO1B 1N2RB 4JM4H 4N0RA 3JTSA 4FHBD 5CIPB 1HK6A 1H3WM 2OMNA 3WD5L 3VW3H 1HH9A 3MNWB 3QDGE 4WW2F 1NDGA 3UBXI 5JIIA 2NXZB 5L8JB 2IG2L 4PRIE 2PYFB 5CEXB 1JFQH 3T4YB 3WXWL 3OAUH 2AK4A 2MCPH 3TVMC 1RU9L 2ICWI 1WK0A 2NR6C 4NNPH 4L4JA 1NANH 4P3CH 5KVEL 2GFBA 1D9KA 2JJTA 3N1FC 4HUWB 4QF1B 1LP9A 2E6PA 3I3BA 2RCSH 4JPWL 2FGWH 4MAUH 1GC1H 4L8CA 3OHXB 3REWA 1A4KA 2FX8H 4X8JA 4ZYKB 2DWEA 1BGXL 4NRXB 2G5BB 4ZXBA 4XNXH 3NN8A 4O9HL 4JHWL 5F70A 1KIQB 1WCBB 5SWSA 4RMRA 3GBMH 4NUGL 5LBSL 4XGZB 5DD5L 3FN0L 4KK9D 2IAMD 3C8KB 5LWYL 4GMSH 4HIXL 3T2OA 5KSUA 4YNYA 3ARRA 3HPLA 2GJZB 3MUHL 4YXKH 2COQA 4M1CC 3N1MC 3CVIH 3L6FB 3H9HB 3VFRA 4Z0XA 4ZFZA 5E6IA 1IFHH 4MJ6A 3BMVA 5D7LB 1MQKL 5FYKU 3IDUA 1S7WA 5IROC 4WU5A 1S8DB 4LKCA 2AJ3B 4Y5XC 2RJMA 3VXNA 5TDOA 4PJ7B 4S0SD 4OCLC 1F4YH 3SDDA 2D7MA 3VGGA 3B9AA 4U1LB 5CIPH 4WWKC 2WBJD 5IMOA 2PTTB 4ZFFA 5C07B 1YYMH 5JO5B 4OB5H 3SKNB 3RA7L 2V5YA 4PP1C 4QHMA 5C6PB 1Q9OA 2XYCA 4YFLI 3S36L 1B6DA 3CMOH 3BP7B 5F8QC 5E9DE 1P1ZB 1OSPL 5EDXA 2BVPB 5IR1B 2H9GB 12E8L 4Q6YA 5A1AA 5AG8A 2P7TA 5GS3A 1BQLL 5F21B 2BOBA 3W0WD 3PP3K 3QWOB 4DZ8B 3WHXA 4BZYA 4HLZG 1FFRA 4PGBB 5I1EL 4QCIB 4WI9A 1N64H 3CFCL 3SQOL 3ARYA 1BFVH 2Y36H 1XR9A 4LCCC 2OXHA 3BKCH 5IB2B 3L1OH 1KLUB 5DJ8B 3MRBB 1DJSA 1WBYA 4EBQL 3IFNL 4OGYL 5D71H 3EO0B 2V7HA 3TA3C 1OP3K 4NO0B 2VKWA 3FCTB 2MFNA 5C09A 4GLRI 5DJXB 4FXGA 1NCUA 3K8MA 1L0QA 1ZT4A 4MMZC 3BXNB 4CGTA 3GHEL 1LD9B 4DW2H 1DANU 4F3FB 3NVQA 4I18C 3MJ8A 5D8JH 2CLZB 1T1WB 4ZUVA 1WWCA 4Z7VA 3QIUC 3H2WA 4PJFF 2Z4QB 4FQXA 5E1AA 3VXME 5I1GL 4MCYA 1C5DA 1F11B 4NQVA 5DD3H 3HI6H 3B9KD 5D1XC 1ZHLA 3I6KB 4KK5C 1G7MA 1RJZB 3T04D 2UUDH 3VFTB 3MRKA 2YN5A 4PRNB 4JKMA 4XP4H 3C60D 5I1DB 4A6YB 5I1HL 4OIAA 2WBJA 4H88H 3BH8A 4YK4C 4PLKD 4YX2L 4XVUD 1OSZB 2XNAB 1NSNH 1U8JB 1BFTA 2V7NB 4PJIB 1JGEA 1XGTB 5EU7C 3UYRH 4OIIH 3V0VB 4ZTPH 4NT6A 4JM4L 4X6CB 3KWWB 1GOGA 4PLJC 1IM3A 3TCLA 1PKQE 3FB8B 4KGJA 5HVFB 2VDLL 2EECA 5KZCD 4PG9B 4D9RD 5CINH 3U4AA 4HX1B 3CUPA 4DKAA 4HBQA 1FIGH 2PKDA 2H6PA 3T1FA 4LHUB 2D4DA 4X6CE 1U8OB 3WLBB 4K8RH 1JFQL 4LF3B 4RQQB 2DKSA 5GGRA 3OAUL 5GRVK 5C08B 1J0ZA 3LKNA 3ZDYE 3MYJB 3OR7A 5T33H 4P3CL 2XA3A 3DO7A 4BZ2H 4Y4HD 4OZHE 3QR2A 5JHDE 5D7IA 3KPPA 3U7WL 3HB3C 2EO9A 5EIQA 2AABL 1ZGLA 1N7MH 4MAUL 1EEUA 5JNYA 3QUYA 4G8EA 4QRTB 2FX8L 2D7PA 3RIFF 3GMNB 3FT3A 4GKZA 1DL7L 5GGSB 1C1EH 1NC4B 3VG9B 1M1SA 2FD6H 3ARQA 4R9HA 4W4OC 3MJ7A 4FRWA 3OKOA 4PRHD 1UB5A 4QT5A 4U7SA 5INCA 1RAMA 4Q97A 4NN7B 4TUJA 4YXKL 1L9MA 5KAQG 2IANE 2O61B 4GBXC 3BD3A 1UB6A 1IFHL 1MIMH 4A6YH 2PO6D 3CDCA 4Q9QH 3C60A 2AXJA 1HKFA 3SO3B 1F4YL 1HN1A 2D7TH 2VQTA 1QTYT 2QSTA 5D7JC 4U1GB 1FNEA 4I9WD 4LGPB 2J12B 4DTGH 3W81A 1YYML 3QIBC 1JV5B 5HHPB 5LGHH 1G7IA 3C6LD 4WNQA 3DVGB 2Z0BA 3WFBL 3BHBB 3BW9A 1OWRM 2B5IB 1FG9C 2ADFL 3MBEB 1G9MH 3K2MC 3G6JB 1K9TA 4R4BA 5BZDA 4MLSA 4Y5VB 3QUXB 4PV9B 3M07A 5L2JA 1R5VB 4GS7C 2XQBL 1I9JL 1YZZA 4QGTA 4YO0B 1S7RB 2BNRB 1OM3L 4WI4A 3IDYB 4NJ9L 2R0WL 3GSNA 3TJEH 4P2OA 3A6OA 3QRGL 3G6JE 3L3KB 3UTQB 1N64L 3STZB 1BFVL 1ZMYA 3CXDH 3BKCL 3DXAB 1CXLA 1KPUA 5E7BA 5F1IA 1FN4A 5D71L 1DBML 4CVUA 1AIFA 2GI7A 3ZTNL 4RFNB 3VXSB 5FFLA 2KPNA 2CLVA 1OGTB 5EZLB 4P5KB 3UBXG 4Y4KD 4K3HA 4PRHA 3GSQB 5MERA 5HI3D 2B4CH 3EFFA 1Z3GH 5CJOH 4QXUL 2APBA 2NMSA 2R1YB 5F96H 5I2IA 2LE9A 3VFNB 3Q3GA 5FM8A 5E0QA 5I8EB 1ZA6B 4PY7B 5EBWA 1QOKA 1IT9H 3ULVH 1KUMA 1KACB 2WP3O 5DD3L 3HI6L 5DWUL 1CR9H 3TESA 1FRGH 3O9WB 1JPGB 4BFIB 3V79C 2R1WB 4CJ1A 3JV4A 4B50A 4MAYA 3E1F1 4JO1L 4YHYC 3VFSA 2CDGB 4HIJB 2BSRB 5FDWA 4S1DD 5CHNB 5C0BA 1F5WA 4ZMAT 3FOLA 2O5ZL 3C6LA 1EO7A 5FB8B 1GJIA 1HH6A 1HSAB 3UYRL 4OIIL 1QSFE 3FJTA 4ZTPL 3MXWL 4KI5D 1RJYA 3FO9B 5L88H 3ZE1F 2CK0L 3ZKNC 4FTVE 2CMRH 5F3BA 4X0KB 5FYJE 2LAGB 1FIGL 5EOCL 2CIIA 3IDGA 1DDHA 1N6VA 4HDIB 1HCVA 3HC0B 4IS6A 4K8RL 1ZAGA 4N0FA 1MLCA 4ZFGH 2GK0A 3ZT5A 2EC9U 3L5WB 1VFMA 3GSOB 5HHMB 5M7QA 2X4SA 3D85D 3QUZB 4LFHG 4X99B 4N0CD 4X7TA 2QR0B 4EZMA 4GW4A 4K2UH 5MEQA 1T21B 3DYPA 1KOAA 4TNVK 1H3PH 5HI5C 1YMMA 1N7ML 3EYQC 3BPLC 5ICYA 5IFJB 1W0WB 5D9SB 3UJJH 4Y4KA 2F53D 1T66C 3MUGA 1XF5A 4DUVA 5CSZA 5CEZH 4R26L 1TJGH 1A1NB 1C1EL 3HKFA 2D3VA 3HMWH 2BJML 4PRDB 2Q1EA 4X5WA 4DUXA 3BIBX 5I16B 1SEQH 3JTSB 3BRDA 2VLKD 3N06B 3BQUD 4JFFE 1HH9B 4L3EB 4JFQA 1NDGB 3OZ9L 2EDFA 3SO5A 1UXSA 1QUNA 1MIML 4A6YL 1DFBL 1PKOA 1ZHKA 4FZEH 3GEWB 1KG0A 5F9JA 3GI9L 1CDYA 3Q0HA 2HG5A 4Y19A 2AK4B 4L3EE 2DQGL 3TC9A 1T5XA 3CD4A 2JJWA 2D7TL 4ONFH 1E28A 4PJHF 4OCXH 4U1MA 5T5NF 4PBXA 4JO3L 4I0PC 3SE9L 1D9KB 4U1KA 4YWGH 5LGHL 4L8BA 2EDNA 1LP9B 2WANA 4GQPH 4L8CB 2I60H 2WIMA 3REWB 1A4KB 1BZ7B 3WUWG 2NLJA 4ZXBB 1U36A 3NN8B 4LPXA 1G9ML 1MLBB 5SWSB 4K7FA 3GHBH 5TDNA 1QNZL 4HXAH 4G3YL 5KSUB 3KPRA 4YNYB 5FCUH 3NIFE 3L5HA 3D85A 4V1DA 2H45A 4U0QB 3TJEL 1C12A 3C08H 2GY7B 5DJAA 1JPTH 3VFRB 3P40A 4KUCD 4WHTA 5E6IB 4MJ6B 4FFYL 4I0KA 1ZSDB 4NO5B 4WU5B 5HHNA 3SDAB 2Q20A 3MROB 1HHJA 3K74B 1A0QH 3VXNB 2EIDA 5TDOB 2F53A 1RHFA 1WF5A 3SDDB 3O4LA 2LTQC 2VLME 2PW2A 1I8LC 1TZGL 2J8OA 5DD0H 1HILB 1O0VA 2OJZL 4N90D 3VDCA 2B4CL 2NW2A 4QHMB 1Z3GL 3EYOA 3KJ4C 5C92A 2QQKH 5DVKA 1Q9OB 4JPIA 2YD7A 1TTGA 2NZ9C 2WWKT 1T5WA 5DRXA 2G75A 2BOBB 1CR9L 1EHNA 1FRGL 5AYUL 4U33A 3Q1SL 4YHMH 3U36A 1WBXA 4JZNA 4AEHH 1XR9B 2R1XA 5FK9A 4QLRA 4J4PC 2ZZUT 4Y4FC 3VCLA 1BFOA 1WBYB 3L95A 3ZT7A 4MD4A 4EI6A