2H32A

Crystal structure of the pre-b cell receptor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
111
structure length
111
Chain Sequence
QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEERERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin iota chain
publication title Structural Insight into Pre-B Cell Receptor Function
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h32A00
2Y06H 3V6ZA 5L2KA 1E6OL 3H0TA 7FABL 3BRGC 1JGDA 1QO3A 4LL9A 2FZ3A 5C0AB 1XR9A 4X8JB 4PRIE 4ZUVA 5HHME 2DI7A 5HHQA 4U3XA 1F6LL 1IMHC 5DRXB 4HIXL 2IFGA 5T1KD 4FQLL 3IU4L 1OHQA 3GB7B 4S1QL 5F89A 5DZOA 4P5MB 4H0IA 3ZL4L 5IR1B 3E3QE 3VDAA 1BECA 4FFVC 3LCYA 1TMCB 3H42H 4PRAB 3RWJB 2OTUA 5JXEA 2D7OA 3D18B 4PS4H 1J87A 3GSWA 1G7JA 4XPTH 2XPGA 1UG9A 4M62H 2HKFL 1JPFA 5D7KD 1S7UA 2MCPL 1C5CL 2X4RA 4OFKA 5JDSB 1XF4A 1KYOK 5T1LB 3E2HB 5DUMH 3QQ3B 3FQUB 3T0VA 1F97A 2VISA 4NWUL 3GRWL 3ARUA 3PDOB 3V95A 3NZHL 3UEZA 1JFQL 2ZUWA 1T04A 2Q76A 3R06A 1NUGA 4X8XA 2QSVA 5I75B 1HSAB 3JWOL 5FHBL 3ULUH 5L7XH 2YRZA 5AZEH 5DK3A 4C55A 4XCEB 3KJ6L 2O5ZH 1DQJA 4MDJB 5D71H 1NEUA 1DQML 4KKAD 4ZYKB 3CFBB 4HIEB 4QXUH 4YDIH 1C16A 3MR9B 4GUPA 4OD3H 2D4FA 3VWKA 4IBLT 4JFEA 4N8PA 3S37L 5CKAA 5BQ7B 4MJID 1O7VA 3SN6N 2QADC 4K55A 1PY4A 2VDRL 2APVA 4PRNB 1IQWL 3QXUA 4XBGB 4FQJH 1YC8A 1NCDL 1AFVL 3S88L 2FHBA 2F74B 4C54A 1SBSL 2AEPL 1M7DB 1IZJA 5DVOA 1U8QA 2QL1A 3UYOD 3O3BB 3I50L 4E9LA 4U1KA 5LBSL 4K94H 1HHGA 1LEIB 5J1AA 1OPGL 4V2BA 5ETUB 5FF6B 4HJJL 3TYFA 2DQHH 5LAXB 3RBGA 3RKDC 2VL4A 1CXEA 5BJTB 2UWEB 2HLAA 4G9FE 4EIGB 5H37H 5D2LA 4KDTA 3MYJA 2AXGB 4OZFA 3RI5K 5HHXH 4KMTL 2Q3ZA 3OG6B 1NC2B 1L6ZA 4BH7A 2H9GB 4U1LB 2K1MA 2X1QA 1EHAA 3GMPA 2HT2D 1CIUA 2PR4H 1GGIH 3Q3GA 1AJ7H 3QEHB 4FFWD 4HH9B 4K8RD 2JB5L 3K2UL 3VD5A 3FT4A 4XCNA 2GCYA 3PHQB 1AD0A 3MLYH 1I1YA 5D96B 5IQ9B 4IRJD 5DHYB 4WHCA 4PJ9B 2WLYA 1QLEL 3I85A 1YPZB 2AI0H 3F8UB 4UILH 4X7TA 3TO4D 1RIUH 4L4TE 4MAUL 4QY8B 3EKCA 4P48A 3WDIA 1TJHL 3OAZH 2Q6WA 1IL1A 4XRCB 1QQDA 4JRYA 2ED8A 4WTXA 4QWWC 1LEGB 2WUCL 4XI5D 2Z93A 4LLQB 3HAEA 4XAKE 1A7PH 2IALB 1T1WB 1MCPH 4NOBA 1QBLH 3T65A 2YPKB 1EVTC 1U95B 1C5BH 3I2CL 2J6EH 1P2CA 5FO8A 5ID0B 4CBPA 4QHKI 2EDXA 4QHUA 2BOCA 1L0QA 2FCBA 4M1CD 1W72L 3N06B 1M71B 3BP6A 5DO2D 3CVIL 4QNPF 4Y5YB 4P2YA 2Y36H 1DBKL 5FKAA 1PX4A 3MACH 4HC1A 3TBWB 4DN4L 3QFDB 5HD8C 4FXGA 2QQLL 5JO5A 4YO0B 2R1WB 4HG4K 1BAFL 4A6YB 5GZNC 3SDXF 5IEKB 2X9WA 4RQQB 1QPXA 4OZHA 4LPUA 5A2FA 2AGJH 1FO0H 2DIBA 1JMXA 4MD5B 4OLYH 3QXDA 5E99H 3D5OF 4KHTH 4PJ7F 1A6WH 1E4XI 1N2RB 3O2VL 4LVOC 3QDMB 3WYRA 5C08E 1RZJL 1MFDL 5I76A 1JPGB 2EDEA 2DJ4A 1Z9LA 1K3ZA 4WFED 3H7BA 1OT1A 5FYJU 1CTNA 1M7XA 1R3JA 3V4PL 2YPLB 3KYMA 3EDJA 4NJ9H 4HW6A 2GITB 5E2TH 1G7LB 1ED3A 4JO1H 4QHMA 1AE6H 1IT9H 2P47B 3ARDB 4PJBB 4JAMA 1RJLA 4HUUB 3QUZB 4J3WA 3HG1E 1N64L 5HSFA 4QRQB 1FZJB 4Q0XH 1H3VA 5KJRH 3OAYK 3TJHC 4FFZL 1GZQA 2MKWA 4CVUA 2EDTA 2OJEA 1U8LB 3ARSA 2G9HA 4H5SA 4PJ8A 5D1XD 1TPXC 3BIBX 3SKJL 2MMXA 3IFOA 4YHZH 3T3ME 5DQJB 3AREC 4NO2A 4FQCL 5DJ6B 2HTLC 5CINL 4ERSL 3LEYH 4WHTB 5FM5O 4MNGB 4U6YB 5CWSB 3FQNB 7CGTA 1HXYA 3HN3A 4X98A 4Z7WF 4JQIL 1I8MA 4R3SB 1H3GA 3TNNA 4MD4B 2FD6H 3UPRB 3CH1B 3G5XA 3BP4B 3NA9L 1XMWA 2FJHA 3F7YB 2HVKA 5EFIB 3VD7A 2H26B 4QRUB 3V0AC 1S5HB 1QFWI 1UYWL 1KT2B 5DK0A 4QT5A 1T1XB 4IOFD 4OFYD 2I07A 4OCMC 3RNQA 1EK3A 3NN8B 3VXTA 1X3DA 4J12A 2HWZL 5ANME 2FO4A 4GAFB 4LAQH 4N0YL 4XNMB 2RBLA 2VZ3A 1E6JL 2DLIA 2UV3A 2P7TA 4TVSa 5DFTA 5E08H 2MQCA 4J4PA 4YXKL 4OD2A 5HHOA 1CLOL 5BZDB 5T3XH 5DEGA 5HGBB 3WXVL 1X5AA 4PPTA 1QSFE 3BWAB 4JFDA 5L88L 3LD8C 5HHVL 3P30H 2HJFB 1Q9LB 2DM7A 3ZDYE 4JZJC 2C7UA 3QA3B 2OL3H 4CW1B 3VG9B 1WZKA 4DOHE 2XN9E 1RZGB 2BXYA 3ALPA 2EDHA 3VXUA 3NFNA 1DSFL 4HZLB 1CICB 1K8IB 3O2WH 2VL5A 5DYOA 5ID1B 2G75B 4KK6C 4UTBL 5HYJE 1IM3A 3F7VB 3C2SA 1X5XA 1DQDH 4KJYB 4L1DA 1PKOA 4CJ1A 1TETL 4AG4H 4MWFB 4G5ZH 4QO1A 2EDFA 4W6XB 4HPYH 3BHBB 5CEXB 1FRGH 3O9WD 2DDQL 3JTTA 3MV8B 5IV2A 1MRCH 5C0BE 3VU2A 1INDH 3ZKXC 1MJ8L 1UM5L 1WT5A 1C08A 5F9OH 1RJZA 1EV2E 2ESVD 3SE3A 2IMMA 1FCGA 3UTSD 3V5KB 4N90E 2ADGB 2JK5B 4LCIH 1P9MA 1T5WA 4PTUA 3A6BH 1T7WA 3LDBC 1RIHH 3QI9A 2VZUA 3MNVB 3G6JF 5TDNB 2UVFA 3RY4A 4M6MH 3BIKB 1FDLL 2D03H 3D85A 1KCSL 1T22B 5IFHH 3MBXH 3WLBA 4NZJA 5CEYA 1G9NL 2XZAL 3GMNB 3LS4H 1NCAL 2H3NB 3UZEA 5C9JB 4NQCB 1GPOL 5SWQA 4X80H 2AJSH 4X83A 1KF9B 3NPZB 5I1EL 2M2DA 4ZFZA 3BOVA 1RFDH 5SWSB 2WBWB 2A77L 2X4NA 4WUUA 5DEFB 4PY8J 5C0CB 4NQDE 4JDTH 1F8TL 4X9IA 5T5NF 5EG6C 4JZJA 1I7RA 4OGZA 3QQ9C 3BQUD 1YMMB 3FZUC 2WINB 3OZ9L 4HWBA 4X6FA 4NM4H 1TNMA 4PJ7B 3QDGD 4Q9RH 3S96B 1AR1D 4B7IA 1JK8B 4PREB 1CF8H 2ZKHL 2FYYA 3AXLB 1T6VN 1A7RH 5F7DA 1YEGL 3L5WB 3PF2A 1J5OL 3I6LE 3DNKA 4JFZH 5FUCC 4H1LA 3QEQB 4RWYL 3SE9L 5EC2B 1QSVA 2VZOA 4P9HL 2KQMA 4N8VB 5HYQB 5I71C 2GTWA 3RTQC 3QT2A 3MROB 1JZ4A 3DGCR 2E5EA 1MCFA 4NJAH 4NWTH 1BD2A 3DUSB 4C56B 1JUFB 4L4VA 1NDGA 4G42A 4ZS6D 5CAYB 1A9BB 2KZWA 2YHGA 3TNMB 3DV4B 1GIGL 4I3GA 2VWEC 4WO4B 3X11A 1PG7L 1T0MA 2IQ9H 4LDLB 1KUMA 3SDCB 4XXCC 2KKQA 4Y0GA 5J0BA 2QLVB 3VXMB 4OBRA 4G7YH 3L9RB 3C5ZA 3W0WD 5CUSL 2KL6A 4QRPE 2BSSB 5DJAB 4HXAL 4XWGH 3OAUH 3MRCA 5DTFB 5I1AA 3ULUF 1QRNA 3UJTL 4D9QE 2NY4D 3BGFC 3OPZL 2X4QB 5DGQA 2XWBA 3VXRB 1R5WA 3C6LB 2GJ6E 3QXVA 1IQDA 3MYZA 5BZWB 1T2QL 1JPTH 3SGEI 4WU5A 5C6TH 3LKQB 3U36A 3HB3C 1BVZA 5IB4A 4GRMB 4JFFA 2B8OT 5EA0H 5GJTH 1YEIL 4ZAKD 1IGCL 1F3DH 3U0PA 3CFCH 5JA8B 3TH4T 5ADOH 3HRPA 2OR9H 4KKBC 2GSGB 3MV9D 1ES0A 3G5VA 1FE8H 4PLJC 1UZ6E 2X4SA 2WBJB 4ZO9A 4GXVL 1KIRA 5J12C 5GS0D 4TTGA 1DL7H 2J5LC 5B8CB 2YA1A 4RGND 4PJ5A 2APXA 2OMNA 5EN2B 3MLZL 1ZVSB 2VIRB 3KPMA 1YEKL 4EIZC 5K9JH 2HH0H 5KBNC 1JN6B 4YDLC 5IVXA 1NGZA 1SJHA 4JKPH 3RTQA 1ORSA 4PJEA 3MV7B 5F3BB 5BRZE 1AI1H 2W60B 5C07E 3OJVC 4LSQH 1QFOA 3OQ3B 1JP5A 32C2B 1JV5A 2NX5A 4XVJL 5D7IB 1UA6H 1V3JA 5L2JB 5MEPA 5GRWA 3F6LA 5F7LB 4UT9H 3LKRA 5E2WH 3MRQB 5I1LA 3VFRA 2PUQT 4TRPL 4P2OD 4LKCA 3ORJA 3BN9C 5D6CA 4JVWA 1BQHA 5E2UH 4I3SL 1SJEA 4GXUM 1OQOA 3J7HA 1NCTA 4FA8A 4NQEB 1X5LA 1BIIA 4J1UA 4CDHA 2HG5A 1CXFA 2P4AB 2LABA 4A6YL 3U1SH 1KELL 3RP1A 1UZ8B 5C6WH 3NACL 4Z7VA 3GI8L 3BUYA 4K7FA 5MI0B 3FQXB 5I8KL 5FKPB 1FYTB 3AVEA 3MOQA 4RMSA 4ODHH 1FVDA 3D6GA 3P0YL 3SJVD 3VGGA 1EEQA 4NN5B 5E8NA 5T5NG 3K4DA 3SQOL 3B9DA 1EFQA 4O2EB 1RZFH 4TSBH 5EU6E 3G6JB 4H8WH 1G6RA 5C3TA 1D5MB 2NXYD 4GH7B 3DROB 2C4FT 4O58H 5HXMA 1ZT7B 1HWGB 3GSXB 1NJ9B 3HS0A 5BS0D 1NEZB 5C0IB 3Q5OA 3QIBD 3VGBA 3X3FH 4G3YH 5INCB 4L4JA 3CSYB 1XGUA 1KEGL 5TGBA 2ADJA 1TITA 3PE9A 4LSDA 5IBUG 2E27H 1NC4B 3VD4A 1ZA3B 4JY5L 4MVBD 3IJYA 1RURL 3IAQA 1IGFH 2LFGA 4HEPG 4FG6C 5B38B 2EO9A 3LH2L 5IROA 3HE6D 4S1RH 3VFOA 3HA0A 1PW3A 5ACZB 3VCLA 3HPLB 5DUBB 2AJVH 3HNSH 1P4LA 2EDOA 2R4RL 5TPWL 4HDIB 4YHOH 5SV4A 2IH3B 5A2JH 4F7PB 3MLTA 4YWGL 4XTRD 2P5WD 1JWUB 1VEMA 3PG2A 5I8OH 3K46A 1MCDA 5LXGH 2PO6B 1A4KA 4YLQT 3DJ9A 1QFPA 3O6FB 4XMLH 4Z7UA 3RVXC 3A6OA 4UQ2A 5CZKA 2AJXH 3IDIA 2VDOL 4J3TA 5TE4L 1CZ8H 4KKLC 2GJZA 5DMJB 1A64A 1IGMH 4FP8H 5M95B 2V2TB 4QTHA 4M7LH 3P77A 3IDJB 4OFPA 3FTGB 2BVEA 3VRLF 1R3LB 3AU1B 4P59L 3AS3A 1JHKL 2O61B 4WDIB 4DVBB 1FL3B 3JV4B 1F11A 3EOYG 3RNKA 3PQYB 2OTPA 5HYSB 1CE6B 1RUML 1S7WA 1YNTB 4L8DA 5HDLA 3A0OA 3K8MA 4Y5VB 1BJ1H 3TT3H 3H9SB 1S7TA 1KIPA 1Y18A 5MENE 4L9LC 3ZKMD 2R0ZL 4OCLC 5IBLD 1A7OH 3MA7B 4JRXD 4JR9H 4XNQB 5ALCL 5JOPD 3P11L 1LP9A 3RL2B 2CLVB 1LGVA 4OM1L 3WFDL 2HT4D 3OB8A 1DVFC 1OTSD 5D7LD 1ZLUK 3T3MF 1QKZH 5FYKE 3GGWB 1MCIA 4NKMB 1F4WH 1H9VA 2R1XA 5C2BL 1BVKA 2WUBH 3RWEB 5EORL 2CMRH 2XZQH 1GC1L 1UVQA 4ODXA 2VITA 1CFBA 2FATH 2NY0B 5EBMA 3P4MB 3DYMA 5D8JL 5H37G 4LFHG 1AQKL 1MCKA 3VGAC 2HJLA 3L5XH 4PRBA 5DRNB 4MB4A 2YN5A 2APFA 5ALBL 3VXOB 2YA2A 2D0GA 1U42A 4RRPA 3RU8L 5FYKL 1A6UL 2DWDA 4UDTB 5EBWA 5HDBF 4F3FA 4FS0A 4UT6L 1BX2A 3KPNB 4XC1L 1BFVL 3V8CA 1CFNB 3D3VB 1DDHB 3C5SA 3V5DA 3QDHA 3TC9A 4DKEH 5KSAD 2C26A 1I9EA 1KACB 4D0BB 5D7JC 1R3IH 5D1ZC 4AEHH 1OTUC 2GT9B 3S35H 2CKBB 4OZ4B 1FFOA 2DIJA 4RAVB 4KJQC 1NMAL 2XNAB 1MFBH 1N0LA 3IFPA 5I2IA 5MERB 4HUWB 2XKNB 3ILQC 3N1MC 1FBIH 2VQ1A 3N1PC 4ODWB 2VR5A 2DRUA 4N0CC 4KTEL 4LLYB 4GBXB 1FG2B 2IANA 1CGTA 5I18H 3VGHA 1TCMA 4BJLA 4M61B 1T1YA 2XY2A 4P2QD 4Z8FL 4Z95L 4BZYA 1MVUA 3T4YA 5GQBA 5J6GB 5E8DH 3LKPA 5LWYH 4ZTPH 3SDDD 4ZUTB 4I3RH 4U2YA 1QR1A 1L0YA 1KJVA 1W0VA 4JFEE 3KPSD 4G6KL 2P42B 5ITBH 5H94A 1CVSC 3MXVH 1DVFA 4R8WH 3JV6A 5E9DB 5DSCA 4IJ3B 3WDJA 2IAMA 2VN7A 3MRKB 3HZVB 1HIML 3IU3A 1TIUA 3D25A 3SPVB 3QCUL 3LEVH 4NNYB 5DD5L 5HGDB 3D0LB 1B88A 2F54A 2YD8A 3I3BA 4BSWB 4X0KB 1FNAA 2Z31D 2DF3A 5JOFA 5DD3L 3OJ2C 2CR3A 4TVPD 3UBXA 4JPVH 3TT1L 4CNIB 2CXKA 3U9UA 4M48H 4UOJA 4AL8H 4EEEA 4EN3C 3KGRA 4FABH 1P6AB 3F65A 2V7HB 3ARGC 2MQ0A 1KPUB 5L0QC 2FR4A 2BVOB 5B3JE 2OCFD 3R8QA 5IHUL 4XPGL 1I1AB 4CN1A 5BVPH 1BEYL 1OP5K 5D93B 3GBMH 2AXFA 1BBJB 3RZWA 1WZMA 5FDYA 1R6VA 3TA3C 2H2PC 2QQKL 3U0WL 3MZTA 2FJFA 5EIIB 1OD7A 3C9NA 1WBYA 4KZDH 4XWOD 3X17A 3DMMC 5ICXB 2F58L 4OZFH 3FB8B 4MMZC 5HI3D 4M7KL 4YH6A 2YSSA 4OD1L 3KXFD 4G8FA 5INDB 2XZCL 5IGXH 1HEZA 4PV9B 1NAKH 2QEJA 3EYOB 3MJGX 5EO1A 1GYAA 1G7HA 3ECBB 1S7SA 1WTLA 3QJFA 2X4OB 4RMRA 1WV7T 3BH9A 4GKOA 1Q94A 4JRYE 2H1PL 1LEKB 3QZWG 1W8OA 4D9RE 3TVMB 2CDFA 3RWIA 1U3HB 4NRYA 4P2CG 4TUJB 3NAAL 1MJJB 1S7XA 2HKHL 1ZLSH 5DHVA 1IJ9A 4Y5XC 1M05B 2NZIA 3PJSB 1ZANH 4PRID 5JR1L 2IG2H 4KUZH 1VERA 5C0GA 2G2RA 5HHMD 3OKLB 4HKZB 2R0LH 3HRZA 4G7VL 2GTZA 4PV8A 4MA8H 2CGRH 1CDUA 1FZMA 1Y6NR 1SHMA 4XXDA 4F8QA 1OAZL 1IGYB 4XP6L 1BOGB 3WIHL 3BI9X 5KAQF 1OL0A 2HFEB 3B6SB 5KOVC 1JNHB 4MNHB 5DD1L 1JGUH 4LHUB 1LK2B 2PXYD 3JVGA 1D5ZA 4EBQL 2HVJA 3NOIA 3WHXA 3B9KD 3MGTA 3NPSB 2BJML 2Z8VC 4OZHE 3WKML 4MNQA 4NQSA 4FN0A 3CFEB 1DJSA 2D0HA 1FL6A 3GIZL 1OGAA 3ARGA 4HS8L 4AYFA 1I7ZA 1HHIA 4XCFL 4XPAH 4K3EL 4GW4A 2AQ3A 3QUXB 3WFCH 4HC1H 3VFMB 4R90L 4D0DB 3PHSA 4JANA 1A7NL 4OTXL 1TVHA 5I1DB 4I77L 1B4JH 4YGVA 5FM8A 2XTLA 4QOKB 5CD3A 1Y6MR 3QXAA 1V7NH 5FEBA 3N85H 4HCRA 4XH2A 3FT2B 4U3CA 1OF2A 4ZSOA 5CS7A 1LE5A 4WRLA 4KKAC 2DQIH 5GGTA 4R7NB 4UIMA 1E28A 3BWUC 4HHAA 5JHDE 4PJHA 1DFBL 4BH8B 1NDMB 3HMWH 5B4MD 5IQ7H 3BZ4A 3PV7A 5CJ8A 4E41A 4NFCA 1LDPL 5I8CA 1UZ6F 2V17H 3DHJA 3WJJC 3ZTNH 4YK4C 2OL3B 5CCKH 1JNLH 1YDPA 5HPMB 2Q20A 3VH8G 5I1HL 3EJZD 4M43H 4XPBH 1CN4A 4WGVB 4S1DD 4HUVB 1ACZA 2X7LA 2BSTB 1Z9OA 1XGQA 3LV3B 4Y5XA 3PWLA 3T77B 5BO1H 2EH7L 4R4FL 5T1KA 3VFNB 2IFFH 3RUGA 4ONGL 4BFGA 4JLRB 3GBLA 3DX7B 2QV2A 4JB9L 3STZB 5C8JA 3VFTB 1KB5A 4IRZH 2D31B 3WUWG 1MIML 1ZS8A 5ICZA 4IOSD 5IK3A 4P5TA 4PJAF 3PL6C 2WANA 3MRDB 5IVZB 3HCVA 3ARTA 3O6LL 4JM2A 5EUOE 1FQ9C 4G9FD 4XNXH 3ZO0A 1Q9KA 2DKUA 1I3GL 1FH5L 1KCLA 5DFVC 2W0FB 3DGGB 3UJIL 2BSRB 2HT2C 1U8HA 3EZ8A 4ZQKB 1N5AB 4F7TB 3FFDA 2ZOLB 3BJ91 4FFWC 4OCRL 4K8RC 5JNYB 4OLUH 4H0HB 2A6JB 2Y06L 3L3DA 3CXHJ 2C3GA 2V5MA 4IIQB 1IGJA 2DD8H 1AC6A 3T0DA 4EZMA 1ERNA 2I9LA 3QCVH 4IRJC 2YK1H 3OKYA 4RZCA 3TO4C 3MJ9L 4JFDE 2EYTB 4P46B 4XMKH 5DMIH 3UXFA 5GRJH 3IDYC 4TYUA 2A9NH 2X4PB 3A6CH 2J8UF 1JHLH 2E6PA 3BX7C 2P44B 1XR8A 3CLFL 3BZDA 4L4TD 2ZCHH 1HHKB 1F3JA 1KJ2A 5F9WC 4XI5C 3GMLB 5E56A 3DX9A 2X70B 1I8LC 3VXUE 3ARFD 2MJWA 1ZHKA 1IFHH 3H7LA 3QIUD 4XPTL 3DUUA 4MJIA 4GG6B 4XAKD 2L0DA 3E6FA 3PV6A 1CE1L 3X13B 2NNAA 1ZEAH 2UZYB 2OSLA 4JVUA 4YFDB 5C0FB 4KVCH 4PRHB 5MEQB 3BGMA 1UWXK 4M1CC 1R24A 1WIPA 5J11C 5DO2C 1DEEA 3OHXB 15C8H 2AQ1A 1GRWA 4FTVB 1O0VA 1MF2H 1S3KH 2DQGH 4ZPVA 1A6TA 4L8SB 1J1PL 3J8F7 3O11A 3ULUL 5AZEL 4DKFH 3GSQA 3EFDH 1CGVA 3TEUA 4J3SA 5C0JA 2O5ZL 3TZVB 3L6FA 5KAQG 4P4KD 1YEFL 1NGPH 3FB7A 4G6JH 1N8ZB 4CVXA 1CFSB 3REVA 3ETBF 3DYOA 4MQXD 4I0CC 2VXQH 4N0FA 4MJ5B 5IMMB 1H3UA 3OXSA 3RHWF 5C08D 1J11A 1TVBB 2HMID 5EULV 5CZVL 2C1OB 2V5YA 4JPWL 4J3OC 1NUNB 1PD6A 5DQDH 4OFVA 5DUPH 3EYFB 1R3KB 2C3XA 3KPPA 4IRJA 4LMQE 1JZ3A 2GKIA 1OTTD 2W0PA 4UIKH 2J1KA 2EH8H 3STLA 3F5WB 5DLMH 2YPVL 1I8KA 3FOMA 3HG1D 2ARJA 1ZWIA 2YWZA 4WUUE 1U58A 2CKBL 1U8OB 2EC8A 4I48A 4F15B 3HUJE 5IW1B 5D1XC 4G6AD 1D6EA 5ESVB 5IW6B 4L8CB 1DN0A 5HHXL 4ELMA 3SCMD 2OTWB 2OS7A 4E5XB 3VA2C 2AK4B 4L3CB 5DF0A 5FA4B 3QG6A 2GUOA 1I3RA 4U05A 5GS1C 2E6JA 4JKKA 2OMBA 4P2RB 4HWBH 4JFPB 4KJPC 4M5ZH 3INUH 8FABA 2JIXD 4LCCC 1BD2E 3PIQB 3VWJB 4AH2B 4ZXBB 3ZKQD 1IC4H 4L4VE 4G8IB 4IOFC 2I9TA 4OQTA 4PR5A 2VAAB 4UILL 1RIUL 3GI9H 3GNMH 4HGWA 4H1LH 3QUYB 1YZZA 5EBLB 5TDPA 1LMKA 4PLOB 4RFOL 4HKBB 1ZA6A 5CJOH 2WLZA 2Y1VA 2CPCA 3T0EB 2CR6A 5T1MB 5FAAA 1MFCL 5DVLA 4MJ6B 2Z91A 4M1DH 1QBLL 2VE6B 1D9KA 4GKZA 2P5EB 3L3HA 1MCNA 4WUKH 2J6EL 1T20A 2IADA 4WI8A 3VE0B 4R7DA 1QSFD 3V7AE 3NH7L 3QNZA 5T3ZE 4PJAB 2Y36L 1CGUA 4HBCL 4NHUB 5DRZB 1VEPA 5BVJA 4NT6A 3EAKA 3KYNB 1GHFH 3MACL 5E5MB 4OCNC 1FJ1A 2XN9D 5B3NA 4BQCA 5HGHB 2I25N 5EDXA 2O5XL 4JFFE 5IM7A 4LSPL 4JDVA 3L3OA 3NCCB 1FN4A 1WSST 3MRBB 3GSNA 5E99L 3WN5A 4MDIA 5HYJD 1GAFH 1CFTB 3FO0H 4HFWA 4LCWB 1UQSB 3BKYH 3KLDA 4AMKH 5C71A 2K9UA 3P4NA 1FAIL 4D0CB 3NTCL 3O9WC 3B43A 4GAJH 4PJ5E 1C1EH 2VSCA 1ZHBB 3FRUA 1A1OB 2ZUQC 3IRPX 5GS1A 2EKSA 3BZFB 5C0BD 5E2TL 4AT6A 1WZ1H 4PJCB 5DJ0A 1AE6L 1IT9L 4S1SL 4GRLD 4PJEE 4GW1B 1E27A 4PP2B 4N90D 4K3DL 5CILL 2GK0B 3M8OH 4PB0H 4LLMB 4FQXD 4ODUB 3PXJA 3V5HB 4NPYB 3MUZ1 3DVNB 1TTGA 1XIWD 4JFHE 2XQBH 3UZVB 4EDXA 1RUPH 2PW2B 2OQJB 4ZUWB 3FFCB 5D2LF 4HIIA 2NW2A 4FQQB 4HAFA 4GG8A 4Q74A 2D2OA 2XIDA 4F9PA 1WIOA 5CBEA 3CNKA 3DVGA 2FD6L 4Y5YC 4NCDA 1YY8B 2X4TB 1U8IB 2V9RA 5LCVL 1XGRB 3W9DB 2EXYD 3O3DA 3DI2B 3CFKB 1PGRB 2W9DH 3BQUC 1WWCA 2AABH 4UB0H 5CMAA 3MMEB 4NQDD 3M07A 4R97C 1FV1A 2GSIB 43C9A 1AR1C 4AM0B 4NO0B 4NQVA 5HVHB 2P48B 5E6IB 3IF1B 4UUJA 1PBYA 1JTPA 1F00I 3CFIC 1T1ZA 1IILE 2BY0A 4IRSD 2FEDD 2WMPA 3I6LD 2P24A 2VLKA 4R0LC 4KZEH 4DK6A 1XH3A 4W4OC 1A5FH 4ZUSB 3O9WA 5CD5D 4ZS6C 1NH6A 5IEHA 3ARDC 1G6RH 3PWNB 1RK1A 3P30L 1N7MH 2IGFL 2E8YA 1WBZA 2ZJSL 5CIPB 4YHNA 4JGUA 2ZSVA 4V1DB 2BY2A 3UTSA 4OLXL 1Z0NA 1DUYB 1FPTL 3R0NA 4G6FB 4ZS7H 3S4SA 1FSKB 5D70H 3DX8A 3WJLA 2B1AL 2CDGB 1U41A 3K4ZA 3QFJB 3ZTJG 4KI5E 1MRFH 3GSOB 1QFWM 4QRPD 1FGNH 2NY4C 4OZHF 3KDMA 3L7FB 4GSDL 3T2NH 3UP1A 1IBGH 4KPHH 1VESA 1ZT1B 1XGTB 1SJXA 4MSWA 4UNVA 3C60D 3NMEA 3KJ4B 4D9QD 4Z7UE 5L2KB 3H0TB 3WSQH 1JGDB 1QO3B 1AGDA 4HPYL 1FRGL 1I9RH 5E2VH 2FZ3B 5LGJB 1CTOA 2GJ6D 4HK3N 1WWBX 5CHNA 1RZ8B 1MRCL 1XR9B 1FFPB 3ILPB 1INDL 1BZ9A 1CXIA 4M93B 3BVNB 1RZIA 4I5BA 4U1SA 5F9OL 1J7VR 4OZIB 5F89B 4YHMH 3MNWA 3KPRB 3S36X 4YDKH 4LCIL 1TQBC 1VEOA 5J8OA 3A6BL 3B5TA 5GS0C 2YUZA 3DRQA 4RGNC 1AIFA 1NFDA 1OM3L 4TNWF 2Z35B 1CFQA 1JHTB 1HCVA 3OKKA 4TULL 2D03L 4HT1L 4MX7B 2XPGB 3MBXL 3QO1B 1GOFA 2CIIB 2VDMH 5DDHA 1CWVA 3KPQB 3KLHD 1S7UB 3LS4L 4RISL 4WFGE 1XF4B 4HD9A 4DZ8B 3FB6A 5A2IH 2AEWA 4X80L 2AJSL 5CJQL 1FFQA 3HI6H 4Y4HB 3V6FB 4FTVE 5A16A 4W4OA 1RFDL 4KQ3H 1T04B 2GFBB 2Q76B 1X6NA 5LKNA 3R06B 1SEQH 4XZUB 1N26A 3TV3H 5BRZD 5C07D 5IFJA 3I6KB 4JDTL 5HJ3A 1G9MH 4P23B 4DCQA 5KZCB 3S9DB 1PQZA 1FNGA 4LLUA 3RGVD 3DRTB 4P2OC 4NM4L 2JB6B 1JGVH 1U3YA 4ELKA 2B20A 3PHOB 1C16B 3W0WA 1MOEA 2DQDL 2ZCLH 4R26L 5HGAB 5LGHH 2XA8L 3VWKB 1A7RL 2DMCA 1KLUA 4FNLH 1T6WA 4JFZL 1T03L 5KSBA 3EJJX 4U1NB 1KC5H 1P7HL 1MI5B 4OZFG 2X4UA 4JGJA 3LKOA 2X6MA 2NTFB 3DX6B 5FGCB 2FX7L 4PIRF 1IAII 4NWTL 1G9EA 2IMNA 4ZD3H 2VLRA 1N59A 2EXWD 3VXQB 1A0QL 1KTLA 4O00A 2R0KH 1V05A 2EYRB 3DLQR 3QUKA 2ICWB 5F1NA 4ZAKA 3F58H 2ATPA 4N8CL 2NXYC 2E3VA 2LQRA 3CZJA 3BXNA 3TYFB 1A7QL 5EU6D 3G08A 2PW1A 3QIBC 4OCSH 4G7YL 5D2LB 1IGTA 4OF0A 4PRPE 2N7AA 3HLAB 4TUKL 1RU9H 1WQVT 5IB5A 3OAUL 4BH7B 1EO8H 1A3QA 1KXQE 1AKJD 5IJKC 3Q6GL 2EDWA 1C8PA 3MX0A 1AQDB 3CX2A 3HAEG 4MVBC 4J8RA 5F72S 1HH6B 4I0PA 2WP3T 1FFRA 2B39A 4LRNH 4MJ2A 3HE6C 2BRQA 3DV6B 2W65B 4M6NH 1C7TA 1HOCA 4P49A 2HN7A 4LCYA 3CLEH 3RDTD 3RZCD 4YXHL 2DLFH 1AD0B 1U6AH 4I4WA 2R2BA 5C6TL 3PWPA 1VENA 2RIKA 5SX4H 3WO3B 2GW5A 4BKLA 3SHSA 2OZ4L 2Y07L 5EA0L 5GJTL 2DWEA 4XTRC 1TXKA 4X9GA 3CFCL 3VW3H 5ADOL 2X1WL 1F3RB 4YUEH 3V0WH 1FE8L 4P2OA 1QQDB 2PYFB 3ES6A 1A3LH 5C0EA 6FABH 2VUYA 1DL7L 1JGLH 5TF0A 2W9LA 5IWLA 3QXWA 4GKSA 2R69H 1UGNA 1EBAA 4K9EC 1KCUL 3TBYB 2V2XA 5H35A 5D9SA 2YRLA 3T65B 2HH0L 4JG1H 2QADB 4YXLH 1UT9A 2X09A 1K2DB 3HFML 1F2QA 3O6KL 1P2CB 4KGLA 5DT1L 3R0MA 1MCJA 1HH9A 1AI1L 2RJMA 3HZMA 4LSVL 3BP6B 1NMCC 3IT8D 5EZLB 1A47A 3QHFH 4HF5L 2YC1A 4GRWE 3K80A 4GT7A 4NNPH 5GGVH 3SDCC 2DICA 2XQYK 3ZKMC 3EGSA 3OAZK 4UT9L 1KJ3H 5IBLC 1UEMA 3DOSA 1EGJH 4HUXB 5B21A 5MEND 2NY5L 4WFHE 2HT4C 1H8SA 2NYYD 1OTSC 5BS0A 3DVFA 3GJEA 1HZHH 1U8PA 4DVRL 4WI3A 3ROLB 3OSKA 1LO4H 5HI4D 4Y4FD 5IHLB 5FYKD 2A74A 5FK9A 1HQRA 2CUIA 3U1SL 4HIHA 2LU7A 1V7MH 1LDSA 1R3JB 4JN1H 3KYMB 1PEZA 2QHRH 4LPWA 1OARH 2F53B 4KKNA 1S7VA 2XA3A 3JV0A 4WY7H 4Q6IC 3WFBL 2GEEA 3BRFA 1K4CA 1RZFL 4TSBL 1UJ3A 5DHVH 4ZTOH 1U93B 1NBVL 2P5WA 5KVEH 5L6YH 5A43C 4G6ML 4L1HA 4Y2DD 5B8CC 1FVCA 2FWOA 4QCIA 5KSAC 4WU7A 2G9HB 3VFWA 1QEWA 1BZ7B 1YNLH 4G3YL 2YS4A 4OV6F 1XF2B 4NO2B 1OGAE 4EI6B 3C8KA 2H41A 1G0XA 3LKNA 1KTDB 5CLTA 4LEOA 2AK1H 2E27L 4XVTH 4ENED 4X98B 4QHKJ 3V7MA 1IGFL 3CPLB 4UTAH 3G5XB 3OKEB 5FYJE 3B8YA 3CH8A 3MREA 5IB2A 2AJVL 2VZSA 3HNSL 5LG1A 1CGSL 3HMXA 4JRWA 4YHOL 4U1JA 4YR6A 3SDDC 4F57L 4TNVF 1F6AA 1ND0A 5D2NA 5DK0B 4PJHE 4QT5B 1KSRA 2I07B 2CXGA 5HVFB 5I17A 3RWDA 2EYSA 4X9BA 4JRXA 3VXTB 5IOPA 5I8OL 5GZOD 3W82A 5LXGL 2EO1A 2A73A 4HCRH 1AHWA 1Q8MA 5D7LA 4E41E 1X4YA 4JFED 4B50A 1MY7A 1J9CT 4XMLL 2QJDA 5GGTH 2P7TB 1NLBH 4YDVA 3RVUD 2AJXL 5FOBA 3UTTE 4MZ3A 4BYHA 3X12A 4NO5A 4OD2B 2DQFA 3D69A 5HHNB 5HHOB 1S9YA 4F7EA 1CZ8L 1I7UA 1H8OA 4HKXB 5KS9A 3QO0A 3I6GA 4FP8L 1J1XH 1CD0A 2OLDA 1ZT4B 2Z31C 4C4KO 3GMRB 3IXTA 4ETQB 5E70A 1VHPA 2DM4A 5IVXF 3RUGE 2CRZA 4LU5L 4PJEF 1IEAB 4X6CB 5KN5B 1F90H 1YY9D 3TT3L 3DO7A 4Q6IA 3MLRH 2YRPA 3NFNB 3BUTA 3PGCA 3LQZB 1CT8A 1A7OL 3MRJA 3JWDC 2OX5A 5DYOB 2LE9A 2PN5A 3SGKA 3UROR 1IM3B 5KSAA 3DXAB 4DAGL 1KB5H 1T83A 4M9OA 1TPXB 3L3GA 3ZT7A 3WL9A 3AREB 4EJ1C 5ICYA 3MA9L 4LGSB 2CMRL 4XWOC 1L0XA 1YC7A 1CL7H 1FZOB 4G8GA 4TQEL 5F1IB 2B4CH 2FATL 5HI3C 5KOMC 3MRMA 1PG7W 3ARVA 4GQPH 4PJIB 5GGRB 4JDZA 3L5XL 4G80A 3Q6FA 2B1HL 1HDMA 4Z7VF 5FCSH 4P2QA 3U2SB 1IARB 4GAYB 1JF5A 5DZLA 4HLZH 4R4BB 1ZTXH 2D4DA 5F7NC 4C58B 4GW5A 5L8JB 4AJ0A 4PG9A 4ZFFA 4OF7A 4YE4L 4HIJA 1WZLA 4JRYD 1NGYA 4D9RD 5E6ZA 1HSBB 2BC4A 4B41A 4O51A 4DKEL 1Z9MA 3P0VL 1RZ7H 3D85B 1I1RA 4PJFE 2DLHA 3MRPA 1SYSB 3S35L 2YEZB 1OCWH 3ZYJA 1JI2A 1KJ2H 2R4SH 1VFUA 1SM3H 5SWQB 1MFBL 3RVVD 4OIBA 4H1LG 1FBIL 2R2HA 5F96H 4ZFZB 3E3QC 3LB6D 3HNTH 3CFJA 3JTSA 2Z31A 3D2UD 3NFPB 4NKOA 3LD8B 4X7EC 2X4NB 1N5YH 3IDGA 5I18L 4NIKB 1BVLA 3GIVA 3BPNC 2PXYC 3GK8L 4JZJB 1I7RB 2C3WA 1AO7E 3B9KC 1PZ5B 3IDXH 4NSKB 3E8UH 5E8DL 5LWYL 1OAKH 1C12A 3FKUS 3LEXA 1QSEB 4KK9D 1KPVA 3A67H 3MFFB 4HGMA 3FMGH 4NYLB 4Z7OE 2FYYB 2W9EL 1S7QB 4AIOA 5FO7A 1Q0YL 5ITBL 5F7DB 4G43A 1CDBA 1EUUA 4R8WL 4JHAH 4WCYH 5AD0B 4FQ1L 4JPKH 4Z7UF 1AGFA 3D0VA 5ECJE 5I73C 2NXZD 5C09E 5EIQA 1KCRH 4XP1H 3T8XA 1U8KA 4G42B 1VGKB 4F2MA 4DN3L 1IC7L 2A9ML 4Y4KD 5B4MC 2X05A 2IBZY 5JHDD 5F93C 3MJ8A 5F7UA 3F7QA 4JPVL 4OIIL 2ED7A 3W5MA 3W39A 3DARA 1T0MB 4M48L 1B6UA 4AL8L 2V5TA 4FABL 1A8JH 1S7RA 5AG8A 4JPIA 3F12A 5F7KC 4K94C 3WD5H 3B83A 1RIVH 3LDBB 4PJ8D 5FUZH 4S1DC 1TVDA 5EO0A 1A6AB 4YHYB 3VGEA 4F7CA 3OTTA 1ZLUH 5F6HJ 1LP9F 3C6SB 3LOWA 5AUMA 1QBMH 1QRNB 4QHLA 5FHAH 4KTYA 3TJEL 2XWBB 4JKWA 1TQCC 2XZZA 4KZDL 4CVWA 4GBXC 1IQDB 2BNRB 5I9QC 4U1GC 3FQWB 1BQLH 2X1XR 3GRWA 4Q9BA 5AZ2H 4XBEL 5SWZE 5BV7H 1NAKL 3BZEB 2A83A 5KVFH 4LSRL 2R2CA 3R8BB 5K59E 4OFIA 2C3HA 4WEBL 4BQ8A 2PXYA 1JNNH 4CU6A 2DQCH 3DTXA 5TE6H 3B9KA 4XBPA 3T1FB 2DI8A 4GS7C 3ZE2E 1ES0B 4LPYA 3BPCA 4F58L 3MRGB 1S9WB 3G5VB 3UMTA 2X4SB 1NBYA 2HJKB 3NZ8A 3AY4A 1KIRB 1QVOA 2FB4L 5GGQH 4RA0C 3C8DA 3QEUA 4UDUB 5AAMA 3FB5B 4J4PD 1NUDA 2PYEA 4F80A 2P8PA 1A6VH 1BPVA 1BQHG 1LNUA 2UYLA 1ZANL 2IG2L 5HY9A 3AAZA 4U1IA 1CK0H 1D5BA 2R0LL 4FFYL 1CDHA 4MA8L 4HJ0D 5I71B 5IVXB 5I1KH 3RTQB 5EZOL 1HKLL 1GXEA 3VI4F 1KB9J 4JFDD 5E5RB 5GJSH 4ORZC 1A21A 3NGBC 5DJZA 5J7CC 3ARFC 1JV5B 2NX5B 3QEGL 3TH2T 3QIUC 5MEPB 2DQJL 3VXUD 4BFEA 3LKRB 4W81A 5ELIA 1YEDA 5I1LB 3VFRB 3WIIL 3QQ4B 2ADIA 5MHSE 4LKCB 5CJXC 5D6CB 4RMWA 4ZFGH 4LASL 4EI5D 5D93C 5GRVK 4BZ2H 1SJEB 4ZPTA 5HHPA 1NLDH 1E4KC 1WC7A 1LO2L 3U7WL 3WFCL 5HDQL 1ETZA 4HC1L 4LNRA 1BIIB 1I9IH 3MJ7B 2HG5B 1JRHL 1CDCA 3OJDA 3TBTA 5EU5A 2E7BA 1RULH 1V7NL 3BGFB 3N0PB 1TZIB 2E8ZA 1T7YA 4Z7VB 4Y88A 5AWNL 3OGCA 3GSNH 1EZVX 4NQXA 3S34L 3UYRH 3UTZA 3EW3B 3CX5K 4EOWL 4P4KC 4LARL 4Y1AA 5C0DA 4HMEA 3IFLH 1FVDB 1II4E 3RAJH 2Y4SA 4MQXC 4G9FA 1M7IA 2EIZA 1J18A 5E8NB 2BOBA 1E4XH 1U92A 2VDQL 4ZODA 1U3HC 2RB8A 2V17L 3CC5B 3QI9D 4NHCL 3ZTNL 2XG5A 1JNLL 3HS0B 4BUGA 4AEFA 3BAEL 5ISZA 5J12B 4X6BB 2J5LB 2P8MA 4M43L 3L3KB 4PJDA 3TO2A 1Z0MA 3Q5YA 2KUTA 2ADJB 1OTTC 1J8HA 4NGHL 5EUKA 2JCCA 4U7SA 4YDLB 1FCCA 4ALAH 5JTWA 4U6HB 2JJVA 3VFOB 3CFDA 1U9KA 4L4TA 1EMTH 4OQ1A 3RFZC 3RPKA 4G6AC 4WUUD 3VCLB 1IRAY 4BZ1H 4GRWF 1P4LB 3GM8A 4N1CA 4RA3A 4BQBA 2VXTL 4XNXL 1W72A 2VDKL 3ARFA 3SCMC 2AJZA 3LQMA 3RIFF 3T3PF 2ENSA 3VXPA 3MLTB 3QIUA 4LLVA 2VZTA 2PTTB 5CJ5A 2E7HA 4GXUN 2GI7A 1JL8A 4OLUL 1A4KB 3QQNA 3FOLA 3U83A 5CJXA 5I15L 1MHHB 1T4KA 2VLKE 3RY6A 1E4KA 3WKNA 5FB8B 5L9DH 2GJZB 4PD4K 2YK1L 4DGYH 1HKFA 3K1DA 1QFWH 4IHOA 4NNXB 4QTHB 1BD2D 3O8XA 5DMIL 4L4VD 3P77B 5AAWA 3A6CL 1L7IH 3FRPG 3CZFA 2LV4A 3GJFA 4OKVB 4S10A 4QXGH 2UZIH 3PGFL 4P4KA 5K9QI 4XT1C 4OLWL 4Y8DC 2WQ8A 3EYSH 1AGEB 2FSEA 1IFHL 1IAKA 4JO2H 2FLBT 1KIPB 4R9HA 4YPGA 4RRPG 2AEIT 3BD5A 1KJMA 3F7RA 1YEEH 5C08A 1LP9B 3U4BH 1ZEAL 4D8PA 5E8EA 2SEBA 3NCMA 1XZ0A 5CGMA 1HINL 1A2YA 4NC2B 2BVPA 3S97C 2R1XB 1BVKB 2PKDA 2ZUVA 3SE4C 1MF2L 2DQGL 5T3ZD 5IT2H 3LPFA 5EO9B 5EBMB 4L8BA 3EFDL 1MAKA 4X5XB 2HJLB 4UQ3B 5BOZG 2X9XA 4G6JL 4JFFD 3MPCA 4HX1B 4RFNB 3HR5A 2DWDB 3MBED 2AS5M 4PJHF 3MLUH 2VXQL 3M45A 5C7XL 1DCLA 1JI1A 2F5AH 3IJSB 2Q8BL 2NY1C 4F37K 3P4OA 3C5SB 5CP7B 4H88L 1D3CA 3LKSA 4RGOH 1G6VK 4PJ5D 4GQ9L 3CMGA 1X7QA 4C83A 1YECL 1TZGH 1S9VB 5DUPL 3QDJE 4OAWA 5H2BB 3E0GA 4GRLC 3HC0B 4NCC2 4N0UE 4YIQA 5I2IB 4KMLB 4UIKL 5GRXG 1HXMA 4ZNEA 2DBLH 4PGDA 4ODVH 2CIKB 1UENA 3L95A 3RUGF 4G9DB 2IANB 1CU4L 1A02N 4XAWH 1ZSDA 3O4LB 3KYOB 1XIWC 4KRPD 4X6DA 4UINH 4RGMC 1OB1A 5ANMA 1AXTL 4MA3A 1EAPA 4JFHD 3LKPB 4JM2F 2DOCA 1H0DB 5JLZA 3OL2A 4WW2A 3C08H 3UBXG 1A1MB 1UCTA 1QR1B 2R1YA 3I3EA 1UWGL 4L9LB 1KJVB 1W0VB 1KIQA 3NCJH 4WNQA 1MQKH 1FZKA 1ZVYA 3MUGA 5JORA 5H94B 2A6IB 2AJUH 1F4XH 4R2GD 1DVFB 4KK8D 3JV6B 4U6VH 4FQIL 1ACYH 1CFVL 5E2JA 2FH8A 4JJ5B 2EXYC 5ITFA 2VLME 3ARBA 4J3VA 1F58H 3SO5A 1FGVH 4M5ZL 3NIFE 5DC4B 4C59B 3D25B 3B3IA 1Q9OA 2VLRE 1IC4L 1UC6A 2JELL 2NR6D 4WI4A 2JJWA 3TBSB 1VFMA 2EEAA 2F54B 2YWYA 2XN9A 2QTEA 5F44A 4OGAD 3VFGH 3VGAB 5CJOL 5J13B 4J6RH 3WIFA 3GMMB 4IRSC 1GGBL 1JF1A 2FEDC 1DANT 5JPNB 3D39E 4PY7A 2FR4B 4OZGE 5D1QD 3MCKA 4X8JA 5CD5C 4DK3A 1JJUA 1PDKA 4PJFF 4KWUA 4RIRA 5DRXA 4KQ4L 1UWXH 1MWAH 4LVHC 5D7JB 1H5BC 5D1ZB 4M8QB 4HPOH 3CXDH 3GB7A 4P5MA 2DMBA 2LVEA 3K74B 3OXRB 4GRLA 5GS0H 3C9NB 1QLFA 3WS3A 4V2CB 3RWJA 2Q86A 4KXZI 4QRTB 5BCAA 3RWGB 3PWPE 2YSSB 3IFNH 1PFCA 4FQXA 3EFFB 3D18A 4YAQB 4ISVB 5T33H 2GHWB 1HEZB 1U36A 3AM8C 2VXVH 5EO1B 1G7HB 2J88L 3EO1B 4K7PL 3WNMA 1S7SB 2A6KB 4P5KB 3CVHB 5GHWH 1SJVA 2AV1A 5GGRY 5T1LA 4BQ9A 4KI5D 3QQ3A 3FQUA 4AY0A 3C60C 4AMKL 1F45A 4Z7OF 1P7QD 3WV0A 1MFAH 1YJDH 5C70A 2WWKO 3PDOA 3U4AA 2C9AA 4GAJL 5FUCE 2X1OA 3IETB 4IDJH 4M7ZC 4XPFL 2X89D 1C1EL 4PYHA 5D5ME 1IM9B 4KTDH 3VWJC 1NAML 5C0GB 1WZ1L 4XCEA 4MDJA 1EUTA 5DJDB 1AY1H 4NDMB 4PV8B 4DGVL 1WIUA 2FIRT 3CSPA 4NKQB 4OLZH 4XXDB 3SKMB 3LQAH 4PB0L 3BP5B 1F4YH 3V4VL 5BQ7A 1JYWA 2WIMA 5BXFB 5BMFH 2XQBL 4G8EB 4UI2A 3KLHC 4PRNA 1M1SA 3RBSA 2VXUH 4IRSA 3WHXB 3MGTB 4WI2A 2FHFA 3CMOL 1P4BL 4EN3B 4XBGA 4MNQB 1L9MA 4ETYA 1GOHA 3ARGB 4N5EC 4WFGD 5L0QB 4ELMF 3KR3H 3MCG1 3N1QC 2N1KA 4RX4A 4MCYA 4PGEA 4FTVD 3CDCA 4JANB 1TVHB 1T3FB 2VDLH 3U4EA 2Y7QA 1H5BA 1LEIA 5ETUA 4UB0L 2AABL 1WAAA 4ZSOB 4OM0H 1LE5B 4X7SL 2CKNA 5BJTA 3RGVC 1QRKA 2DYPD 2UWEA 4UIMB 2OBGA 3DMMB 4K3HA 4JFXA 1FL5B 1D5IH 2A1WL 2AXGA 5SX4I 5DD0H 1AP2B 5K59F 1NC2A 1G7QB 2H9GA 4PJXB 4U1LA 4KVNH 5KSUA 2WQRA 2KH2B 3QEHA 4HH9A 2BNQE 8CGTA 1K6QH 1UCBH 3C60A 1RUAH 3NCFB 4H8WC 2B2XL 1IEBB 5T5FH 1A5FL 3PHQA 1MCEA 2GJ6A 2I60H 1NUFA 2EXWC 4L5FH 2F8OA 4P3WA 2HFFB 4Y5XB 1MELA 1YPZA 2KQNA 2BXZA 5I0DA 5T1KB 3REWB 5I0ZA 4APQD 3UBXI 2XTJE 2AXJA 5C8JB 1KB5B 1EERB 1ZS8B 4HV8B 5ICZB 4XRCA 3D9AH 1T80A 3EOBA 1LEGA 5D70L 3WFZA 3HC3L 3HCVB 4LLQA 2BFVH 4K7PY 1M6OB 3BW9B 3ARPA 4D9LL 5KW9H 5TE7L 4M1GH 5D2NE 1Q9KB 1T1WA 4FZ8H 4O02H 3C2AH 2DTMH 4PRPD 4DZBA 2YPKA 1OSZB 2DJUA 4NZRL 1U95A 3FFDB 1RZKC 1IBGL 4KPHL 1AGBB 2YZ1A 4J3XA 3L3DB 3WSQL 3HMXH 1UACL 4WV1C 4TNWK 1I9RL 1IGJB 1M71A 5HYFA 3RDTC 4OCYH 3RZCC 4DTGH 2IAMD 1DN2A 5FO9A 3WFHB 1HI6B 2PF6A 5BRZA 4HUNB 4H26A 3K81A 3TBWA 1T7VA 4P57B 5DVMA 4YO0A 4PJGB 3WS6C 1MCRA 1ROWA 4OSUH 2DQTH 5IEKA 4RQQA 1DBMH 3FO2B 4S0SD 5DR5H 2D0FA 1XR8B 1NCCH 1RUQL 2XFXA 1F3JB 1KJ2B 3EOTH 3QDMA 2OK0H 4POZD 4EVNA 1RUKL 2FJGB 5EC1B 5KTEL 1JPGA 1EEZB 2O5YH 3DUUB 4J7RA 4MJIB 2VDML 2DQEH 2JJSC 3E6FB 3NABH 3PV6B 2YPLA 5F88B 3HI6L 3Q48A 2W0KA 1G7LA 3BGMB 3MLPA 4X4XB 3MOAL 1R24B 4PJBA 1KBGL 3QUZA 2N56A 3G6DH 4G8GE 4QRQA 1FZJA 4DW2H 1NGWB 5EPMB 1FIGL 1I8IB 4ZPVB 5ESAB 1A6TB 3O11B 4BM7A 4I18C 3GSQB 1MFEL 1MJUL 1U8LA 2XT1B 3QRGH 3TYGL 1R0AH 3L6FB 4F33B 5DXWA 5GXBB 5EZIL 3FB7B 3PL6B 2MKLC 1IC5H 3HE7D 4CVXB 4K3JL 3OKDA 4WFHD 5DQJA 5DJ6A 3EYQD 2WAHA 2ZCLL 5HI4C 4WHTA 4Y4FC 1NCBH 4MNGA 4I2XE 2B7DT 4U6YA 5CWSA 3FQNA 4GMSH 3OXSB 3VI3F 4NKIL 1DLFH 1ZE3C 4MD4A 3BKMH 3PWJB 3BE1H 5GGSB 4HJGB 2X44D 4WV1A 3F7YA 1PKQB 3P9LB 4MQ7B 5EFIA 3WFEH 2FBJH 4QRUA 1EHNA 4UZGA 4IRJB 1FFNB 1T1XA 3SE8H 1IGIH 1VPOH 3STLB 3B9EA 4RCAA 3TO4B 4Z6AT 1TDQA 3WXWH 5JXEC 1EH9A 4AK1A 1OSPH 2QQNL 3IDYB 3IDMA 1ZWIB 1VGEH 2ORBL 1U58B 4MA7H 5IKCA 1H3TA 5CEZE 5GSVA 4LSTH 5FYLL 5F9WB 5C2UB 5EB9A 5BZDA 1SMAA 1XF3A 1MHEB 5HGBA 1U8MB 4ELMB 3IAPA 1XGPA 1EO8L 3OG4B 1QNZL 2H32A 2KPNA 1OGAD 1S9XB 5I66B 4ENEC 4JM4L 4TVPH 5GGUA 1B3JA 2XWJB 1I3RB 1QBBA 2HJFA 1Q9LA 1KN4H 4M6NL 3P73B 1IAOA 2YUVA 3QA3A 5CEZL 4PY8I 1XAUA 1Q72H 5J11B 8FABB 5FYJD 1RZGA 1EJOL 1NFIB 3QNXB 1CL7I 3UYPA 2E9JA 4HZLA 1KTRL 1K8IA 2EC9U 3DI3B 1S78D 1IAIM 4YZFE 4I18A 2YBRB 4HGWB 5ID1A 3JUZA 4NRZB 5MENA 1URLA 2IQAB 4MS8D 1AXIB 5TDPB 1NGXA 1ZA6B 3VWKC 4P99A 4FQHB 3L5JA 4NFBA 1QACA 1A3LL 4PG2A 3RVUC 4KJYA 3QG7L 3CU1A 4XPHH 2K7QA 4E41D 4MWFA 4RAHA 2P43B 4Y4FA 4A2LA 1E6OH 1WFNA 1NFDF 3UTTD 4GKZB 3MV8A 1Q9WA 2FLRT 4JG1L 4YXLL 4Q97A 1T20B 3WNLA 4AENB 4KHXL 4U4BA 3EJYD 5TFSH 4FQLH 4XP9H 3IU4H 3QNZB 1AC0A 3VGDA 1YY9C 5JW3H 1JYNA 3S7GA 1G1YA 2ADGA 2JK5A 3GKWH 3LHPH 3QHFL 1O7SA 5GGVL 5BVJB 3ULVE 4P5TD 1BFOA 1EGJL 4JM2D 4KDTC 4CN6A 4Y2DA 4XGZB 4LSUH 1T22A 2BHUA 3TFKD 1FN4B 3GMNA 3GHBH 5D1XB 2MCPH 1C5CH 2H3NA 3GSNB 5C9JA 5JUEH 1YNKL 2Q7NA 4HFWB 4MGXA 1DLHB 1BGXH 2ZSWB 4EDWL 1JFQH 5JQ6L 3ULVL 2PYEE 1V7ML 5DQ9B 5KSBF 1A14H 3FRUB 4XX1E 3CVHL 4LSSH 1N6UA 3MLVH 5GSRA 5DEFA 5C0CA 1YUHB 5GS1B 3LRSA 5FHBH 2QSCL 4AT6B 3BKJL 3ULSB 3KJ6H 3KPRD 2C3VA 2WINA 3UPAA 1DQMH 1GGUA 4WY7L 1E27B 5FECB 4LCCB 3S96A 1JK8A 2FEEI 4OCWL 4PREA 4LIQE 4X9HA 3AXLA 1XCTB 3L5WA 5E6YA 3S37H 1YN6A 4DUWA 2EDLA 3QEQA 3PP4L 4XHJD 1YNLL 2VDRH 3W11D 4N8VA 5IFAH 4TNVK 5E4IA 1BOYA 1CD1B 3O2DL 5DMGD 4HIIB 2NW2B 3MROA 1AFVH 3S88H 3V79C 4OZGF 3RVVC 2AEPH 4C56A 2AK1L 3P4LA 3LB6C 2YUXA 1RHHB 1A9BA 4LIQL 5DJXB 3I50H 3DVGB 4POUB 3TNMA 4PLNC 1EFXD 4DKAA 4UTAL 4P23D 5EOCL 2E6QA 5FDWA 3LN5B 4MQTB 4HJJH 4JKLA 5CMAB 4QRRE 4Y19E 1E4WH 1HILB 1FV1B 4Y1AE 1AO7D 3VXMA 4PJXE 3L9RA 1CGXA 5TQ2L 1FLRH 4YDJA 2ZP0T 4RMQA 2NY6D 3S4SG 5F7WC 1MIEL 1UXSB 3ARXA 3KPOA 1BLNA 2AJYL 2EEBA 2XRAH 2JB5H 2P24B 4F7MA 2X5PA 3K2UH 2V7NB 2NXZC 5ISZE 5BZWA 3KWWB 5E4EC 1VFBA 2MHAB 2P45B 3O9WB 1OAQH 4PJDE 3ZE1F 3LKQA 5C09D 3P0GB 1J8HE 1QYGL 4Y4KC 1FORL 2ZUQB 5DJ8B 2EDKA 1MRDH 3C8HA 3IGAA 2YR3A 1A6ZB 1QLEH 3OJMB 3KHOA 3O4OC 3OKNB 5GGVY 2JCCE 4YHNB 4MAUH 2ESVB 1T5XB 3UTSB 2M1KA 4IOIB 3EYUL 1TJHH 3MCLL 3NCYS 2EE3A 4FFVD 3S4SB 3FN0L 4IS6B 4O2FA 2WUCH 1UH4A 3MJ6A 4PJ8C 4L3EE 3S36H 3VFUA 3IKCB 2NY2D 1SY6A 1T89A 3WIHA 2IPKB 1ZVSA 1JWSB 2VIRA 2WIIB 1OWRM 4FQ2H 4KY1L 3ARRA 4UV4H 1KB5L 3ROOB 1JWMB 3MOBL 1QUNA 1JN6A 4IDLA 4PLKD 3I2CH 4MZ2A 3O81A 1JZ8A 2IH1A 4MSWB 1TZHB 2EIDA 3QCTH 1FNLA 3MV7A 1AGDB 3SDYH 2NY3D 3CVIH 4MQSB 1QSZA 5CHNB 4PUBH 3BD4A 1DQQA 32C2A 1DBKH 3D2UA 4FXKB 4PTTB 5D7IA 5ESQB 1BBDL 4DN4H 3PP3K 1EHLH 1X5JA 5SWZD 3O45A 3MGOB 2QQLH 3RWHB 2GY7B 3MRQA 1BJMA 3BQUB 3DHMA 4YNYA 3UTQA 1JPSL 4OCXL 4C4KT 3IXAA 3O6MH 1CCZA 4R97B 4I9WE 3V6OE 1IKFH 1R3HB 3AB0C 3MLXL 1N6VA 1JTOA 3QDGB 3I84A 1PAMA 3O2VH 1AIFB 1ZGLB 1NFDB 4NQEA 2Y72A 2M26A 4X5LA 4J4PC 1F3DJ 5F8RC 2MCG1 4EKXA 3OKKB 1UZ8A 2QADD 3MRFB 5DDHB 3UAJD 3GJFH 1P53A 1D9KD 1K5NA 4HJ0C 4CUCA 3V4PH 1VFOA 4R0LB 3FQXA 3CCHB 5M94B 1G7PA 1FYTA 2VZVA 3HNTL 4XC3L 5K9OB 1JIBA 2WV3A 4Y4KA 5JHDA 1N5YL 4O2EA 5ACMA 2JJTA 5IFJB 5J6HA 4JREC 1D5MA 5ADPH 4DCQB 2AJ3B 4FFZH 5CP3A 3E8UL 1PSKH 3RKDD 1NJ9A 1PQZB 2GIYA 2H6PA 1NEZA 2GJJA 4MXQD 4QGTA 3SKJH 1TCRA 3K4AA 4EI5C 2YMXL 1ADQL 4ERSH 2I5YL 5CINH 3CSYA 3K0WA 4MLSA 3W0WB 5MHSD 1ZHLB 1H3WM 4HWUA 3AGVA 1KLUB 4JHAL 2R8SL 1NC4A 3QIWD 5KSBB 2NY4B 2ADFL 2KDGA 4JPKL 2P8LA 3RPIA 1QA9B 2X4UB 3H3BC 5B38A 1A6PA 5DWUH 3NA9H 4U1HA 3HPLA 4MXWH 5AG9A 3OB0K 1WT5C 5KS9F 2FEEL 4HDIA 3O41B 1U8JA 3GMQA 3MO1B 3HHRB 5AYUL 3SE3C 2AP2A 1KTLB 4ZNEE 3IDUA 4F7PA 2R2EB 1BJ8A 4BSVB 3QUKB 5F1NB 1P9MC 1YQVH 5EUOA 4K8RL 1JWUA 2ATPB 2BCKA 3BXNB 2HWZH 1MWAB 3MJ9A 3QI9C 2PO6A 3MV9B 4ODSL 5ERWB 5FUOH 3G08B 3O6FA 4X6DE 1TQBB 4N0YH 4ONFH 1E6JH 4JJHA 1RIVL 1MCCA 3ZDXF 3ZLQC 1IGTB 4HMCA 2Q3AA 1CLOH 4RGNB 2J4WH 5EZJA 5I74C 4YEEA 5IG7B 1QBML 2V2TA 3ARQA 4LKXA 3IDJA 5A1AA 3FTGA 1B0WA 5L88H 5HHVH 1SMOA 3AU1A 5HYEA 3BD3A 3FJTA 2O61A 4WDIA 1EJ6A 1FL3A 4DVBA 2DM2A 4LCYB 1BQLL 4NM8L 5HYSA 1YNTA 4MCZB 5FCUH 3KVQA 4I4WB 2R2BB 4Y5VA 5E5UB 3VXSB 1DSFH 1KNOA 4L9DA 1ZVHA 3NFSH 5TE6L 3RL2A 2CLVA 1MH5B 1KCVH 5GISL 2DS4A 3HI5H 4P2OB 4YHKH 2GYSA 4CDGC 4ZDHB 1OAYL 4EI5A 3GGWA 1YEJL 5TDOB 5C0AE 2V2XB 2VLKD 5H35B 5D9SB 3GUTA 5F9JA 2DDQH 3WUZA 5SX5K 1MJ8H 1UM5H 3G9AB 4L29A 5DRNA 1CLZL 3VXOA 5L8KB 4LLWA 1HH9B 3CK0H 3HZMB 1U3JA 3MODL 2WWMC 2HFGL 3LSOB 5DRWB 5EH1A 4UDTA 4Y16D 2YC1B 1CXHA 4HS3B 3SJVB 5F1KC 5B22A 3D48R 3D3VA 3EGSB 3AS0A 2NXYB 3VG0H 3C5ZC 4Z77A 1QPPA 2QHLA 3S3PA 2LU3A 4D0BA 1FDLH 1KCSH 2DLGA 5IHBA 4YHYC 1T21B 1G9NH 2XZAH 4NC1C 1V8HA 3QIBB 4ZFGL 2CKBA 4OZ4A 2FRGP 1BJ1J 2I26N 1NLDL 4RAVA 1GPOH 2XNAA 1Y0LA 3UC0H 1BF2A 4DEPC 2XKNA 1I9IL 2A74B 4XCYB 3W2DL 4ODWA 5FK9B 1HQRB 4HIHB 4PGBB 1RULL 2ZUYA 4LLYA 2A77H 2ATKB 3QNYB 4M61A 4JGMA 1FG9C 3HE6B 2C4XA 2R29H 1WICA 2BDNL 4JO4H 5J6GA 1INQB 3IFLL 1VKXA 3HUJA 3SDXB 1RVFH 3MBEC 5GGSY 4ZUTA 3BH8B 1E4XL 1K4CB 1UB6B 2ZKHH 4K23L 2P5WB 3C5JB 1J0YA 1YEGH 4X4YA 3T09A 1J5OH 5E9DA 1ONQB 4YQXL 3VRIB 2WP3O 1RK0A 4RWYH 4JZOA 3SE9H 3HZVA 3LAFA 5F21B 2NY7H 4RWHA 1NMBL 3RIFK 1UKSA 1CD9B 1OP3K 3C8KB 3P9WB 3P9MB 2MSPA 3I9GL 3QDJD 4MAYD 5HGDA 4LEOB 1WEJL 4X0KA 3BDYH 4ALAL 3GSUB 1GIGH 1PG7H 1EHXA 1EMTL 3MREB 4KRPC 1WAAE 5IB2B 4BZ1L 4BK4A 1NMCB 2UWEE 2DLEA 2V7HA 3KYAA 1B2WH 1FLTX 1WCBB 1XF5A 2YZ8A 5CUSH 1DTUA 3LZFH 2EYSB 4JRXB 1I1AA 4OIAA 4KK6D 4HXAH 4ZFOA 4R2GC 2A73B 4KK8C 4FZEH 5D7LB 2P1YA 2DL9A 4WHDA 4HWNA 3H9HB 2N7BA 2FX8H 1MREH 3HKFA 4Z7WB 3X12B 5L9DL 2DQFB 3D69B 2Z8RA 1I7UB 5ICXA 2VLMD 5KS9B 3QO0B 4JVPA 3I6GB 2NR6C 1OAXL 1T2QH 2G5BA 3FB8A 4PP1D 4DQOL 1QFWL 2BVYA 4H20L 2VLRD 3SO3C 1L7IL 3EYOA 1YPZE 1XEDA 4QXGL 3ECBA 3QHZH 3VJ6B 2APWA 1IGCH 1UM6L 2X4OA 2CD0A 5E8OB 3VDBA 3TPUB 1LO5B 1LEKA 3MBEA 3SBWA 3EYSL 3DO7B 4Q6IB 3TVMA 1I1CA 2JKXA 4JO2L 2J12B 1MJ7L 4GXVH 4X99B 5HI5D 5DJCB 2ZNXA 4TUJA 3PABB 5D1QC 1J86A 1MJJA 1CT8B 3D39D 1D6VL 1M05A 1MEXH 3PJSA 5KSAB 1YEKH 1J10A 3KS0H 3L3GB 1B0RA 3WL9B 2R0WL 5MEOA 1LQSR 4TPRL 4I0PD 4P3DA 2FNBA 4ZNCD 4LNVA 4Q7DA 4JQVC 1FIEA 2ICWJ 1IGYA 1MLCA 5IROC 2ID5A 1R5VB 2HFEA 3MRMB 4MNHA 4XVJH 4LHUA 1J0HA 3PWPD 1HDMB 3SDAD 2D7TL 3VFPA 4P2QB 2EE2A 2BZDA 4KC3B 1MCHA 1NBZA 4KI5C 4MD0A 3RWCB 1OQXA 3CFEA 3MNZB 3SDDB 4GW5B 5DC9B 5DMKA 4PG9B 4ZFFB 2E9BA 2A6DB 3FT3A 1C5DA 4JCLA 25C8L 3QDME 3JXAA 2JTDA 2VH5H 4HIJB 3QUXA 1ORQA 3KPSB 3TCLB 2CDEB 3UDWA 3VFMA 4D0DA 2ZNWA 2EDNA 5I1DA 4QOKA 3RL1A 3MRPB 1F42A 1TZGL 2X41A 3FT2A 2YPLE 1U91B 3H3PH 3NACH 4M4RA 4PJDF 4PJBE 2DBLL 3G5ZA 5HPOA 3P0YH 2Z31B 3EYVB 3KLAB 2NZ9D 3SQOH 3DUHA 2JCCF 4XAWL 4KROD 1I1FB 1G84A 2E9WA 3CUPB 4UINL 5EU7E 4QF1A 2Y6SD 5K9KA 4I13B 3SGJA 5HPMA 4P3CL 3LEXB 3QDAA 3C08L 1G9MC 4JO3H 4O5LH 3HR6A 1NCWH 5D1QA 3NCJL 3QR2A 1MUJB 4MNGE 2BSTA 1KEGH 2ZG3A 1RPQA 5FO7B 2PTVA 3WLWD 2AJUL 3UO1H 1SBBA 3TBVA 5L8LB 4U6VL 12E8L 2R56H 3VFNA 1ACYL 4JLRA 3DX7A 1F58L 4TSCH 2D31A 2VDPL 3WDHA 1U0QA 3LH2H 4NN6C 4MJ4A 3MRDA 5IVZA 3MUHL 4JQVA 3OX8B 2R4RH 5TPWH 3TN0D 1EX0A 3KXFB 3VFGL 4RFNC 2W0FA 1H8NA 1RZKH 2BSRA 1WBXA 3RVTD 1N5AA 4F7TA 3OKMB 2HFTA 4PB9H 4UMGA 3LN4A 4JPIB 1QBAA 4QYOB 3EOAB 4IIQA 1P7QA 1B0GA 2BNQD 3VMPA 1N0XH 3BEVA 5IBUB 2VDOH 4E0RB 4R4NC 4D94A 1IAIH 2X89A 5J9PB 2CLRB 4WTZA 4WEMB 2WK2A 2CRMA 1MWAL 4PRIB 1HN1A 4HPOL 2EYTA 1BM3L 3CXDL 4P46A 4QHLB 4APQC 5HHMB 1WCQA 2VRAA 4NUGL 2X4PA 4NZDA 5GS0L 4BUHA 1JHKH 2ICEA 4RSVA 4XX1G 3VXSE 5IW3A 3U30B 2XTJD 5DHXB 3GMLA 4WWID 3RX7A 3BKCL 1RUMH 3IFNL 2H32H 4LRIA 2PCPB 1N6QL 2VXVL 4GG6A 1RV6X 1TJIH 3BPNB 4QKXB 4KJWD 2PXYB 5E24E 5ALCH 2HA1A 3B9KB 3X13A 4XBPB 4OM1H 3WFDH 5C0FA 2RGSA 2V9TA 4HS6A 3SGDH 4GKNA 1MFAL 3NZ8B 4OF3A 2DM3A 1QVOB 3AMKA 2QR0B 2FIKB 3BSZL 1QFHA 3QUMA 1KV3A 4IDJL 3OHXA 5C2BH 1HWHB 2IAMC 3QWQB 2CUMA 1HHHA 4FTVA 1GC1H 3MV8E 5I1IL 4L8SA 1LNUB 2G60H 3FRPA 2VJXA 4YJZL 3B9AA 4WWKD 3AAZB 5HY9B 4U1IB 3L7EB 1AQKH 3TZVA 5I73B 4YHLH 2BMKB 2DYPA 4OLZL 3G04B 3GO1H 4Q2ZB 5J13C 5JHLH 5FYKH 5JZ7D 3VXNA 4POZC 3MC0A 4UT6H 2F19H 4MJ5A 4XC1H 1BFVH 1FNEB 5BMFL 1AGCB 4QTIH 2RR3A 3Q2CA 3MRIB 1YEDB 5JPMB 4X6DF 3WO4C 2FGWL 2C1OA 1CIDA 2RFXB 4TUOA 3FONB 1I7TA 4NQCE 1P84J 3EYFA 4WW2F 1R3KA 3EDKA 5EWIL 1WC7B 2X2YA 2BERA 3KR3L 5EU3A 1BP3B 4BK5A 1MCOH 4XP5H 4CVZB 3ZTJH 2EE9A 2VYRE 5IVOA 1Z3GL 2VDLL 5SWSE 3OJDB 2WWKT 5EU5B 4LHJB 3BPOC 3F5WA 4W6YB 4MYWB 5DK2B 2CQVA 4G8GD 2XQYG 4APQA 4KTEH 1NL0H 5C0CE 4FG6D 2OI9C 3OGCB 3UTZB 1TQCB 4Z8FH 2XWTB 1S9KC 5I9QB 4U1GB 4JCMA 4Z95H 1YMME 5C0DB 3ZDYF 1D5IL 3EYQC 2AV7A 5ESVA 5F8QC 1I85C 4EXPX 1CGWA 3EDEA 1INEL 4PJ7E 4G9FB 3GM0A 2EIZB 2BOBB 3SKNB 1YN7B 4KVNL 1U92B 4PRPA 4E5XA 1EO7A 2OZ4A 5KVMC 1UM4L 5IESL 3U48A 3QPQD 4ZUUA 4GS7B 1JZ7A 3D87B 3QEQE 4RFEB 4O4YH 4I1NB 1MLBA 1F4AA 5CBAA 1RUAL 3ET9F 4KGJA 3PWVB 1T0PB 2BY1A 5ILTL 2EDDA 2ITCA 3GHEL 3TO2B 3QCUH 4C56E 4ZXBA 3U0TB 4PGCA 4UAOC 2VAAA 3MQIA 5EUKB 3RWFB 3QUYA 5EBLA 1IAMA 4U6XB 4HKBA 5DD6A 1H3PL 1N4XH 3TT1H 4L4TB 4TOYH 3T0EA 4K9EL 1UXWA 3NGBB 3JVGC 5CEZD 5KW9L 3VXME 4HFUH 3ARFB 3B5HA 4FZ8L 4O02L 1RSFA 3C2AL 4M8VA 3TWCH 5ABDE 5KVDL 3QIUB 3VFVB 4X6EB 1RJYB 4YHIB 2Z4QB 1IE5A 4Z7WE 3MGAA 1BEYH 3BEWB 3VE0A 1BREA 4NFDA 2DAVA 3HMXL 3STBA 2QQKH 3VXRE 3MSPA 1T4KB 3U0WH 2R39A 5DRZA 1I9JL 4WI5A 5JDJA 2F58H 1LE9B 2OJZH 1FO0B 5J4MA 4QXTA 5E5MA 1CR9L 3ARYA 4OV5A 2BHYA 4XNUL 5HGHA 2VLJB 4OD1H 2XZCH 4K07A 1UB5B 4Y2OA 3CZFB 4MS8C 3U7YL 2C4FU 4XVUD 4P4KB 1IZKA 4JFQA 3ZYOA 3EOTL 3HE7A 1CFTA 1V3KA 1I85A 1UQSA 3X14B 3MRLB 3DYPA 2FSEB 4D0CA 1Z5LA 3NAAH 4KKCD 1CLYH 1KJMB 2HKHH 3TGXA 5C08B 1ZHBA 4ZMAT 1U8NB 1A1OA 3EJYC 3BZFA 2SEBB 1OTUD 4PJCA 4TN9A 4XVSL 4MXVE 4KJQD 3MV7E 1IC1A 4NP4H 1EEYB 4LBEA 1OAZH 3EO9L 1KYOJ 1SY6H 3UTPE 4XP6H 2BVTA 4LLMA 3HAEH 4P5TC 2W0LA 3WIHH 1IKNA 2D9QB 4KRLB 4L8BB 5D7IE 3V5HA 3HG1B 4JM2C 2MPAL 2ZUUA 3DVNA 3ULVD 5DD1H 3QRGL 1WAAF 2B4CC 1IC5L 4EBQH 2UWEF 3QZWB 2BJMH 3FQTB 2OQJA 4ZUWA 4K71C 3AMLA 3ZYIA 3FFCA 3WKMH 5EOQL 4FQQA 3EO0A 3GIZH 4HS8H 2YD6A 3SCMB 1K3IA 2YKLL 4GMSL 4LVEA 4NQEE 2FL5B 1A3RL 3LKSB 2X4TA 1A7NH 4OTXH 1XGRA 3W9DA 1X7QB 2PYED 4XNZC 4ODTH 3CFKA 3WFEL 3KNBB 4DUXA 4OAWB 2FBJL 3T4AA 1AD9B 3MMEA 2UZXB 2FH6A 1FYTE 2GSIA 2JIXB 1K4DB 3N9GL 1IGIL 1VPOL 4KFZC 4AM0A 3K8LA 4NO0A 1DQLL 2XYCA 1YPZF 2W91A 3SQBA 1TJGH 5FA3A 3L95B 3O0RH 1VGEL 3IF1A 3G6JE 5KVGL 3DECA 4LSTL 4XHJC 3GSVB 3W11C 1LDPH 4LQ1A 5ANMB 4MA3B 2XOTA 4E42B 1H15A 5DMGC 5TQ0H 1KENH 5JLZB 3UTTA 5I1HH 2R1YB 3FO1A 4WNQB 2VC2L 3WE6B 1GZPB 1QD0A 3Q0HA 3PWNA 3PGDA 5MP6L 1ZLVK 4JG0L 4KUCD 1LO0L 4R4FH 1KN4L 5CIPA 5CP3H 4F8TA 3TA3D 4JY6A 1CDGA 3I02B 1QSFB 4OBSA 4ONGH 2ARJQ 1XCQB 1KIUA 5ITFB 4DJMA 3QWOB 1MIMH 4S2SA 2ZPKH 4CADA 2VDNL 2HT3D 3JWDL 3EIFA 4QRRD 4DOHB 4Y19D 1A4JA 2EDQA 2XN9B 4Y1AD 3QFJA 4JY4A 5TF1L 1PX3A 1I3GH 1FH5H 3MRHB 2HRPL 4NBYB 2NY6C 43CAA 3FO9B 1UEYA 3L7FA 1JF1B 5HYJB 5DJYA 4CAGA 3VH8B 1T2XA 4HH8A 4PY7B 4TSAH 1BWWA 2R23A 5LGJA 2NY1B 2E7CA 1RZ8A 3MCKB 1FFPA 3ILPA 5ISZD 4H0GA 3BVNA 4RIRB 2O93L 3BMWA 5TFSL 4OZIA 5C0BB 3MJ9H 4XP9L 2MFNA 3WUWB 3IVKB 1J8HD 2W38A 1WTGT 2NTSP 4PBXA 5CJBA 3KPRA 5JW3L 4Z0XA 3K2MC 3LHPL 3GKWL 4GRLB 4PJBF 1OW0C 2CO6B 4RNRB 1QLFB 1VFAA 3CLFH 3WS3B 3PQYE 4OT1H 1A1NB 4WJ5A 5GPRA 3OF6A 2Q86B 4WIQA 3S5LA 3U82B 3H42L 1WWAX 3H9SE 2H45A 4FQXB 3OKOB 2NY2C 1U2HA 2Z35A 1JHTA 4LSUL 1B6DA 4L3ED 4MX7A 3QO1A 4PS4L 2CIIA 1XIWB 3KPQA 3GHBL 3M17B 5FOJA 2AV1B 3BT2H 4RGMB 3ULUE 1CE1H 4PLKC 5A2LH 5BV7C 4M62L 5JUEL 4DZ8A 3U9PH 4PJFA 4K2UH 4Y4HA 1QLRB 3LMJH 3ME0A 3RIAK 3V6FA 1YA5A 4HG4J 1BGXL 5DUML 4IMKA 3ABZA 2O26U 4JFYB 2NY3C 2GFBA 1DR9A 4XZUA 4IMLA 1A14L 5C1MB 4LSSL 2DTSA 1EFXA 3MLVL 3TIDA 3I6KA 4WENB 3B2UD 1J1PH 4P23A 1KXTB 1PVHA 5L7XL 3DRTA 5E95B 1P6FA 3O8XD 4NQDB 2JB6A 1YEFH 1LILA 1AO7A 5D71L 3LPGA 4UU9B 3PHOA 3GFUA 5I8EA 1DUZB 2DN7A 4OB5H 4I9WD 4OKDA 5HGAA 4QXUL 4YDIL 4HXBH 2VZ1A 4LLDB 2EE6A 4OD3L 3D3VE 2ITDA 4WHYH 4U1NA 3UAJC 4U1MB 1MI5A 5IFAL 1D9KC 4IRSB 3S3JA 5IMLB 1JBJA 5CZVH 2NTFA 3DX6A 4JPWH 2CO7B 4HUMB 5E00A 4JEGB 4FQJL 3VXQA 5C09A 2LTQC 3HZKB 4MCYB 4PGEB 3O3AB 2EYRA 1QHOA 2P49B 2ICWA 1MCSA 3U4EB 4LVHB 2Y7QB 1H5BB 2YPVH 3T0AA 2Q7YA 3ALXA 4K94L 3QAZC 1VCAA 4BA8A 2CKBH 1OW0A 1E4WL 3PL6D 4MXQC 2DQHL 3EZJB 4F37F 4NZTH 4JFXB 1JGEB 1FLRL 3HLAA 3WN5C 2GAZB 2VERN 2AVGA 5DFVD 5KSUB 3L3IB 3QIWC 5E1HB 1AXSA 1AQDA 4NRXB 4QRPB 4Q9QH 1HH6A 4NQUA 5TH2B 1CS6A 2XRAL 5E9DE 1YYLH 2PR4L 1GGIL 3C60B 3DV6A 1AJ7L 2W65A 2DBJA 2GQHA 3K1KC 1OAQL 2GJ6B 4M7ZB 4JN2B 3L3JB 2WNGA 1Q0XH 2V9QA 2RAMA 1MRDL 3MLYL 3BO8A 5SWZA 2RCSH 2AI0L 2VLLB 1GGYA 5B39A 4A2MA 4RFOH 2DQUH 3CXHK 3S6CA 3EOBB 2PYFA 3FAWA 5JQHC 3QH3B 5M7QA 1NPUA 3S36L 1I4FB 1MFCH 3TBYA 3W9EB 3VFSB 3IDNA 4FQ2L 2AEQH 1T0NB 1A7PL 5E94B 1FVEA 4UV4L 4DZBB 1MCPL 1K2DA 4W4NA 4F9PC 3QCTL 4LGRB 4LF3B 4C57C 1C5BL 3NH7H 1NGQH 3SDYL 3QULA 5EZLA 4R6UA 4PUBL 4CN4A 4HBCH 2VLJE 3ARBD 2XXMB 1DE4B 5EOTB 5FO9B 5JW4N 5DURD 5BRZB 4ORGA 4H26B 5C07B 3GMOA 3ZE0E 1EHLL 5F71A 3V8OA 5F9AC 2JF1A 2WM0A 4HUXA 2O5XH 3B5GA 4LSPH 3O6ML 1IKFL 3RGVB 4JZNB 1J0IA 4CMMB 3CDGA 2XFXB 3DBXA 1K8DB 1G7IB 3ROLA 1JCKA 4UT7H 2AGJL 1DBBH 1FO0L 4OLYL 4HULB 3CU7A 4EVNB 5T3ZH 4KHTL 4JFOB 1A6WL 1FAIH 2C1PB 3PDGA 3NTCH 3QIWA 3FQRB 1HHJA 3CSGA 2J7LA 5C0AD 3DWTA 4QRSA 2MTPA 2W92A 1MHPH 3VRLE 2E9IA 2F53A 2VSDA 5C6PB 4NJ9L 4S1SH 1GSMA 4JO1L 4Y16C 4NCC1 2J8UB 5DMYA 4K3DH 5CILH 4EUPA 1U93A 5ADPL 4Q0XL 3WJLC 5KJRL 1PSKL 4HWZA 5EU6B 3KPLB 4X4ZA 4N9OB 1BZ7A 3OKDB 1XF2A 1U2CA 3JWNC 3PXHA 3V0VA 4YBQD 4EI6A 2LVCA 2ZZUT 4YHZL 5T1LD 3JZ7A 4NUJB 1KTDA 3LEYL 1AKJB 5B3JF 4ONHA 4Z78B 1N3NB 3E6HA 3CPLA 4HMDA 4QOKE 5LCVH 3PWUA 3OKEA 4LHQB 5DWUL 4WV1B 4MXWL 5GIRA 4KJPD 3RDTB 1VADB 1WGOA 3RZCB 3Q1SH 4UOW1 5IBTH 5T3XE 5HDBE 3WEXB 1YQVL 3S37X 3AROA 3WBDA 3IDMB 5FUOL 5IKCB 4ONFL 5GSVB 4P4RA 4LAQL 5C0ND 5HHNA 1XF3B 4HKXA 2J4WL 5E08L 3Q5TA 5DI8B 1XGPB 4GAGH 4MAYC 1X5ZA 2H32B 5T3XL 1ZT4A 3QHTC 3W81A 1G7MA 5GRUH 3GMRA 5GGUB 4NQTA 4ETQA 4Z76B 4RX4D 2IGFH 3TP4A 2ZJSH 1IAOB 4MXVF 2NW3A 1IEAA 4X6CA 5KN5A 2EDJA 4YEFA 5FCUL 4OLXH 4NO3A 1FPTH 4Y16A 2OL3L 2W1NA 4ZOAA 3BJLA 4HEME 2R15A 5EU4A 3PP3H 2B1AH 5D7IF 3LQZA 1UFUA 3H3KA 1GH7A 5E1AB 3NFSL 4I18B 5EOCJ 3O2WL 1KCVL 4OLVH 5MENB 4MB3A 1NGXB 1P1ZB 3HI5L 4OLEA 3DXAA 1EXUB 4YHKL 1NC2D 1ZMYA 5KSVA 1ULVA 4YC2C 4GSDH 4POYA 3AREA 1NCUA 4Y4FB 1DQDL 1FZOA 3QYCA 4AG4L 5F1IA 1ZLWH 4G5ZL 4PP1C 3U46A 1Q9WB 3ESVF 3V6ZB 4PJIA 3RX5A 5GRYA 5GGRA 5J1TC 3ZHKA 2FGZA 3MRRA 4ZUVB 4PJ9D 5HHQB 3U2SA 1GVIA 4GAYA 3CK0L 2QKIA 4ZAKC 4R4BA 1RQ5A 4R96A 5HI5C 2UY6A 4Q6YA 1BFOB 1HSBA 1LHZA 2OTUB 2IC2A 1OM3H 3VG0L 4BQ6A 1RIHL 4M7JH 4Y2DB 4GG6E 1LWRA 4LOUD 3MZGB 4TULH 4HT1H 2EICA 5F6HI 3GSWB 1SYSA 2H8PA 2YEZA 3BISA 4M6ML 4RISH 4I0KA 1G7JB 1JZ6A 5IFHL 4PRHE 1JPFB 2X4RB 4I0PC 5CJQH 3UC0L 4M5YH 3QWRA 3QDJA 4M3KB 4MAYA 4LQFH 2VISB 4N8VG 4N0UA 3ARWA 4HKJA 5JIKA 4KXZH 3NFPA 4N0RA 2CUHA 5GSRB 1YJDC 3GSRA 3LRSB 3SDAC 3OB0H 2R29L 4JO4L 1PZ5A 4NSKA 2C3VB 2L7JA 2XV6B 1RVFL 1QSEA 4FHBD 3QUMH 1DQJB 3C87A 3MFFA 4M4PA 4NYLA 1S7QA 2DQDH 4R26H 2XA8H 3C09C 3MRNA 5EUOF 4Q9RL 5IWLC 1CF8L 4CJ0A 1L6XA 1YN6B 3QDMD 2QBWA 4GUPB 2F9BT 3LQAC 3GDBA 4JFEB 4YHPA 5AD0A