2EUZA

Structure of a ndt80-dna complex (mse mutant mc5t)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*TP*AP*AP*AP*AP*AP*C)-3'
molecule tags Cell cycle/dna
source organism Saccharomyces cerevisiae
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
total genus 84
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euzA00
2EUZA 2EVJA 1M6UA 1M7UA 1MNNA 2EVIA 2EVFA 2EVHA 2EUXA 2EVGA 1MN4A 2EUWA 2ETWA 2EUVA
chains in the Genus database with same CATH superfamily
4U1HA 4AVJA 1CGSH 1WJ3A 1TR7A 5EULV 2Y72A 3U46B 3DX9B 1F6AB 5CHNA 3TJHD 4GKSA 5SWSB 1XTLA 1BVOA 4M7JH 1D5MB 3RFZA 1U8CA 1UZ6F 4FNLL 3C8KB 3GS0A 2EDDA 3G6DL 2OMVA 2X7LB 1KUMA 2JXMB 1ZIAA 4LASL 4HGMA 1KZQA 2E86A 3MV9E 3K46A 1UXSB 2DBLL 3LIZA 2IAMC 4P4KB 1GGCL 1INQB 5DJAB 4P2AA 3EKCA 4QYAA 2DIEA 1CBVH 2PYFA 4J28A 1I1AD 1U3YA 2NR6A 1TEYA 1MJUH 4LLUA 2WYIA 3LAFA 4PRIA 4IU3A 1QZ1A 5FF6B 5I0VA 2EUWA 1QFUL 1HC1A 4PJIB 4YLBA 1VFUA 2HUEA 1ZS8A 3VYNA 3MV9B 4X8XA 4L1LA 1EZVX 2IAMB 4X5QA 3AXLA 4AG4L 1JSYA 3MLYL 4M1DH 4GW4A 3V0DA 2HVKB 4LZKA 2IANE 4OIFA 4H0LC 4H20L 4X7TB 2CLZA 2V4LA 2KDGA 4NO2B 3B2UD 4W70A 5DSCA 2ZUXA 5CZXD 1NAMH 3VI3B 4JO3L 2H0PA 4X98A 4K7FB 2BW4A 3C09B 3CVHL 3ARBA 3QJHB 4LAQH 3SDDB 3RIAF 4M8QA 1MIEH 1IKNA 43C9B 2X2IA 4MDIB 5ALCL 3AS1A 1NCDH 5B8CB 3QDGE 3VXSA 4S1QL 3S96A 5KZCB 1LO0L 1A9VA 3C9NA 1K5WA 5EU5A 1B2WL 3ZMRA 2G5RA 2BVEA 1MUJA 1NEPA 3C09C 1E4KA 3QNZA 4HQQL 1HZLA 2E5EA 3RKDC 1IQDA 2DD8H 5I1LA 1EEYB 1N6VA 1BAFH 3BVNA 2GUOA 1D5XB 5ECGA 4KY1H 3V0GA 4LCWD 5KSBB 5ACLA 4YBQC 2ZP8A 3APFA 1GR7A 2GAZB 5FYLH 3ISWA 3UTPD 2M26A 1H9DA 1XH3B 3J7HA 4QHMA 4HJSA 5F1OB 5EU3A 3MTXA 2WYHA 2PF6A 2FLBT 4WWNA 3MR9B 2NNCA 3MGTB 1INDH 3MJ9L 4N0UE 2RMNA 3U6XA 2Y07H 1CK0L 4K3EL 3QFDB 4KUZH 1F45A 4EKJA 1EHXA 1XBDA 1WICA 3CXDH 4BFEA 3FCSB 4WF7A 3DHUA 1NOFA 4WDIB 4XPTL 1XF3A 1TITA 5CGBA 4FI8A 1MI5D 1CICA 2VUOA 2E9WA 4PJ5E 2IJ0C 1JNLL 4RGMB 5I16A 2H41A 2NCEA 4F9LC 2YAOA 3AAZB 2I85A 4QF1B 3U7WL 5HPOA 3QEUB 2NX5D 3P4MA 3C5SB 4M6OL 4GT0A 4RESB 4WTWA 3GPSA 3VFOA 4L3EB 1HYRC 5HHNA 2GITB 1DBAL 4HIJB 1FSKC 3K71B 2OYLA 4P2YA 1T83A 1JPST 1PDKB 3AT9A 4NZ8A 2XYBA 3OZLA 4JAMB 1HHIB 1UJ3A 4MQTB 2CR6A 2XWJB 3D09A 5IQ7H 5JDSA 4WFHD 1UM4H 3TN0A 3MACH 1U92A 1NCIA 1FSKB 1S7TA 2C9XA 4BA8A 3SPHA 5BCAA 2A74A 4OQTH 4CVXB 2YD0A 1GYVA 1BOGA 3Q6FA 4TSAH 3Q1SH 3W11D 1YHPA 2VZOA 1PZSA 3FFCA 5TDNB 4AVKA 4QRQA 3WDIA 1WBZA 4F7CA 4JN1L 4OIIH 1TVDA 1FYTB 3T3ME 3A6BH 1W16A 5IBLD 2WLIB 4JM4H 2XWDA 1JRHL 4GKZA 1E4XI 5SWQB 3OKOA 3K4DA 3QHZL 5K59E 4OVVA 1XT5A 4NRZB 1M1XB 1DDTA 4E5XG 5ADPH 2AXHA 4FCAA 5JUEL 2B2XL 3D0AA 4L4VA 3QDMB 2P43B 4GUPA 1ZT1A 2VYRE 4RWHA 2IH3B 4ELMA 4XO4A 4C83A 4MX7B 3B1TA 5DTFA 4J3UA 5LBSH 2ICWJ 1G7PA 3ULUL 3DIFB 2W5PA 1J5DA 4LGPB 1Q9OA 2GCYA 1LD9B 4UILH 3RDTA 3AW5A 2O6FA 1IGFH 1VEMA 2E76C 4MCMA 2IFFL 1CLOL 2ZUVA 3ARUA 2KLTA 3ULUE 9PCYA 3B7SA 1FNEA 4JY4B 4L1SA 4G6AD 4WCYL 1NJ9B 1NGWB 1F5WA 1G1KA 1WFNA 2VDKH 4HHAA 3S5LG 2EVFA 2J72A 4JM2A 2HJFA 5CD5C 1XQ4A 1GCYA 3BKJH 3CZKA 2Q8BL 3TBCA 3ZIMA 4YFDB 5E0QA 5FM8A 4DGIH 5BO0D 2VH5L 5DO2C 4A66A 1VAHA 4YSUA 5LUMA 3FHEA 1EO8L 3T3PE 1HXKA 3EXJA 1UOLA 1J88A 2YGNA 3OPZL 3ESUF 1FGNL 3DBXA 4OCRL 5EZJA 2RD0A 4IBZA 4KROC 3X11B 4L8DB 3GM0A 3STLA 3L5WA 3VH8B 4MVBC 1TYRA 5C2UB 1XMEB 3NJGA 5AG8A 4WWKA 2ZWYA 4FFYH 4XWOC 2XVLA 3SDCA 3X13A 3KPTA 1K5NB 1OAKL 1PLGH 3R7QA 2ADFH 1OANA 2IBZY 4POUB 2ENSA 3OKLA 2Y7OA 2VDLH 3D2UD 3L1EA 3ROLA 2A73A 1GKOA 4Z77B 4YHNB 5IFAH 1ZGLA 3MRCB 4F2MB 1OLZA 2J6EL 4PR5A 4QXGH 1AIFB 3IMBA 1Q90A 3FBKA 2APVA 1U2YA 3SO3B 1JHLH 2PMZA 1KBBA 4EAEA 3FQTB 5D7LE 5FFLA 3SGEI 3CSYA 1DJWA 4IJ3B 2PKDA 4X4XA 5AYQA 2CKBA 4HEPA 2WKGA 1T6BX 4MD0B 4IRJD 5G2NA 2BSDA 3KPPA 1SOKA 3BWAB 2JCCF 4D9LL 3OAZK 3ULSB 4WFHE 2BS8A 3U4EA 5C7ZA 1TTAA 4AYMC 2CO1A 4W9KC 1QQDB 2LU4A 4JFOB 5IOKA 2EYSA 2I60L 2EIKB 5CLYA 1FL6B 4HKJB 2EE6A 3CPLA 4JKPH 2F54E 5CSZA 1UASA 5ABZA 3BH9B 3MNWA 1L0PA 2UY6B 5K5YA 3CLFL 4F80A 2J6WA 4PRBB 3DMMC 1CFTA 3U0WH 3JYBA 1BPLB 3BKJL 3VXPB 4OH2A 4MRBA 2AQSA 3RWJA 1HH6A 4JLRB 2FECL 2VXQA 5CJQL 4ZW8A 4YH6A 1CL7I 3S7GA 4NAQA 4JPSA 3H54A 4OGAD 3DK0A 3L95A 4BWWA 3WNPA 4YJZL 4PRAA 4XNUH 2VC2L 3UEZA 3MRLB 3LS4H 2C9VA 4JFHD 4X5WA 2W81C 2QHLA 2Y2TA 2HMIC 2X2UA 5D1XD 1U95A 3RI5F 4MAZA 4S11A 1JZJA 1AO7D 3TJHC 4QRRA 3LRSB 1WDAA 3HG5A 4NOFA 1KLFA 5DDHB 3CCHA 4QRPA 2H2PC 1PZAA 3BZFA 1YJDL 2WWMC 1QFWM 1DVQA 2L7JA 4C4KT 1AFVL 1QI5A 1QQDA 3VSUA 4ZMYA 4GO9A 3DXAE 1FFTB 3LKNA 4FNQA 5GZND 3AXHA 4N25A 2DS4A 3IFNH 1YMHA 1YPZB 4JREB 3KL0A 3DUUB 1IM3A 4NXKA 1TQSA 1KBGL 4UTBH 4AJ0A 2J8OA 2CQVA 4MMXB 3IFLH 4WFFD 3TBTA 1INDL 4LEOA 1Z7JA 4DUWA 1D9KC 4OLUL 4NDMB 3WMPA 5TK2A 1XF2A 3OHXA 1N5AB 1FAKT 1X4ZA 3WKNA 5DFWH 1GMIA 2WMPB 4ZPTA 3CSFA 3EBIA 1ORSA 4R7DA 5E1AB 4OZHE 3RZCA 4PRNB 2WQUA 4NPJA 1OAXL 5E6IC 1NC2D 3WJJA 4EXPX 3MRFA 4Y1AB 5BOJA 4ODVL 1GS7A 1UM4L 4HWBL 3LXCA 1R3IL 4IBSA 2A9MH 1HEHC 3EJZC 1DYZA 5EA0H 5I15H 3IJYB 3CFKA 1A0QH 4N2IA 4ODUA 3SE8H 4S1QH 3AITA 1NCDL 4NHCH 1GZPB 4FYRA 1MIEL 1P4UA 2VZSA 5KVEH 2E27H 2WBWB 5AVRB 1JWSA 4B9PA 5AD0A 1SUHA 5CMAA 5ALBL 4IRZA 2C7UB 1U8OB 3CN2A 3WIFB 3P69A 1CGTA 1I8IA 4ANXA 5IJCC 4FG4A 4YSDA 1WEJL 2HJFB 4PJAA 1FFNB 4I2XA 4ZMQA 1C5CH 1WIOA 3V4LA 2A9BA 3O2DA 3PXLA 2AEQH 2D7TL 2ZUQC 1R0AH 2VDPH 5JOFB 3P30H 2F61A 3JWOL 4XO5A 3PHQA 3MLWL 3MFFB 4QO1A 3MJ9H 1RZFH 2Z34A 2KBGA 1IZJA 2W80C 2QFPA 2H8PA 3TEZA 5SWZA 3ZKND 1JNJA 3BVVA 1N26A 2GTZA 3EF7A 5KVDE 3MNZA 3DIFA 4KZ0A 3HAEH 3QDHA 1OE1A 2WZ6A 3OM3B 1E43A 1RUKL 3LPGA 4JRYA 2IH3A 4ELMB 3VFRB 1KCSH 1S7RA 4J8RA 2EUVA 4PJHA 3DURB 4BRVA 2YWYA 2EZ0C 2XPGB 5DC4B 3HKFA 3V2AR 3F7LA 3RFZC 1WWWX 1OW0C 3QUGA 5DRNB 1UB5B 3FSWA 2FO1A 3QIUC 3MOBH 4LCCA 1WAAA 1NOLA 2JE8A 3OKOB 4JFHE 1U30A 3V6ZA 1S7SA 3B9KB 1N6QH 5F1IA 4ZD3L 5FM5O 3QARA 1KPVA 1FYTA 1A3ZA 5I1JL 4CN1A 5D7IB 3LQMA 1KYUA 1T2QH 3LEXB 1ANUA 1AHWB 2ZOOA 2FJHB 1CF8L 3WAKA 3RJOA 1MHEB 4ILDA 2FZ3A 2VDRL 3OXRA 4PWEA 9CGTA 3HE7C 1LE9A 3DI2B 1L0YA 2FEDD 3P9MA 4DP7X 3RYMA 4YXLL 2BFVH 2QEJA 3D3VB 1E8XA 2C9QA 4K55A 1H15A 4P5TB 4ZMWA 5DJCB 1ZTXE 3B2VH 4FL4B 1A3LL 4LFHD 2DM4A 1F8TH 4QKTA 4UQIM 2FWOA 3S3PA 1JF1A 4F58L 4RFEA 2FR4B 4QRUA 1L0QA 4L8CB 1E42A 3E6FB 1CE1L 1UKSA 5DWPA 2FX9L 3NFPA 3VI4A 2NT1A 2WLKA 3G6DH 3V0VB 3HAEA 3QQDB 3ECBB 2NSQA 4FFWC 2YHGA 2WXJA 1OTSC 2ZNWA 4AYFA 4M7JL 1ACYH 1JNHA 5DJXA 3UJJH 3LEYL 3VVWA 5IT2L 1JPSH 3CHRA 4OAWA 5DFVC 3QR1A 2OJEA 1CGSL 3LNEA 4EDWL 5MENB 3HEIB 3S0PA 3MZTA 4HIQA 3E9TA 5CGTA 2EIMB 1JPTH 3O2DH 5GS1A 1QSZA 3PLYA 5GXBB 1A9EA 4GAGL 1OARL 2NZ1A 4L8BB 5EU3B 4QHMB 3ZDYF 1TPXC 2UZXB 3JWNG 3LN5A 4MBOA 3GBMH 3UPRB 2X88A 5HSFA 1UH3A 2E9GA 2L7EA 2VN6A 2C3VA 3ES6A 5BS0B 5I1CL 2LVEA 1H8OA 2BXZA 1P7QD 3IJ8A 3MFGB 1ZSHA 1HXYB 4PY8J 1ROCA 3CVIL 5I30L 2BSRA 1UD4A 2NNRA 4XNQA 3FOLA 4CBZA 1RZGA 2WN3A 3DOHA 1RZKH 2V2TA 2FIKA 2Y3NA 5BUAA 1FZMB 5DHDA 5IB4B 4XTRD 4FF9A 1OP3K 2DQJH 1KFAL 3D2UB 4E9LA 5HD8C 4YHML 5JYMA 2HH0L 4JL2A 3GMMB 3S96B 3I6KB 3VXSB 1P84J 4LVOC 5T1KD 3VFTB 3REVA 3IT8D 3PDOB 3EBHA 1CTMA 1NM4A 2A83B 4WFED 4HH9B 2VLRD 4X98B 3S5LA 2LFGA 1E90A 2D9QB 3GSWB 4ALAH 2BY1A 1SN0A 2H32A 3ZUCA 3RIKA 3E8UH 2CLZB 1Y18A 4X7TA 1L9NA 5D8JH 2J8UB 2KLSA 2HVKA 2HT4C 2IOMA 4DP1X 2OTUB 4MMYB 2OTUA 3BIAX 4MMYA 4YVNA 2Y23A 3SJVB 1CT8B 2EDYA 1KCVL 4KOCA 3KEHA 1NL0H 3FBQA 5F72S 3VD2A 5KBLA 3B8SA 3GSWA 3DVGB 4MWFA 4ZMTA 5ID1B 5CZXC 5I6XB 2PYFB 5ECJE 1XDTT 1GGUA 3BDYL 4HZLA 4B0MB 3N85L 4N1HB 3VFTA 2R0KL 1UXSA 2XTJD 3RPKA 3HRPA 2ADGA 1C7SA 2OYKA 3QYCA 4JDEA 2X4UB 4FXKB 4U4IA 5HYJB 1NCNA 2XKNB 1SMAA 2YFNA 1COBA 1R19A 3UP1A 2W60B 1S5IH 4M1CD 4A7GA 4ZXBB 4GO6B 4CNIB 1GL4B 2DY2A 1ADQH 3S3DB 3ZHKA 3DX9A 4GXUN 4U1IA 2G60L 3D69A 3ES6B 4PWKA 1B2YA 1KIPA 5I71B 4HLZG 3ALWA 3VRIA 1UT9A 3HI5H 3FAXA 4K3DH 2NY6C 2XQ0A 5HHMD 4ZO9A 4K7PH 2PTVA 2VCOA 1BCIA 3QJQB 4LOEA 2HAZA 3UFIA 2GBAA 3MX0B 5K9QG 3GS4A 5AAMA 1V7MH 1NCGA 2ALWA 3RKPA 1JDCA 5MENA 5DC9B 1GRWA 4JFFE 3FSVA 1AY1L 1D9KA 2NY6B 3IGAB 4HS3A 3VE0B 2YUXA 2WSDA 4JM2F 1YY9D 1JNHB 1OE3A 2NZ9D 1G84A 4M6NH 4NM8L 2PPAA 2N3JA 3HCVA 5ENWA 3BRGC 5TGBA 2R0WH 1O6TA 1DVYA 4WGKA 1DJGA 2ICCA 3TNMA 4KKLD 4YSAA 4UTBA 3A67H 4W4OC 2GT9A 5BRZD 1ZJBA 3O2VH 4CSZA 1OHZA 3ZTDC 5KVGL 3KWVA 3TIDB 1S3RA 2KKQA 4WSJA 1WHOA 4L8CA 4X6DF 2Y6SD 4XPAL 2VLJA 3WEOA 4XXDB 2DF3A 3O2WH 3MUUA 3I2CL 4PGZA 4KKPA 5DJCA 4K94C 3VI3F 1I8KB 2XQBL 2QVMA 3EDFA 5LNGA 1U4EA 3NSDA 4K2UL 4ZOBA 2R1YA 3TJEH 1SOQA 4L3ED 4P9ML 2DI7A 3ULUD 1OTTD 2FJSA 2EDMA 2P1YA 2CKNA 4TQPA 3BEWA 1KGWA 3T0XA 4ENED 4M5ZL 1CYXA 5IFJB 3BT2H 4BFIB 2FJHA 5F44A 2VL5A 4O02B 5FO7B 3WJMA 3T8XB 4TMPA 4TOYL 1E67A 2JQAA 3RTQB 5C9JB 2DIAA 1S7SB 1KIQB 2HLEB 4PJ7E 2JH2A 2E7DA 3DO4A 2IEPA 1KCRL 3U4BL 4IQHA 1A6UL 5LAXB 2O4EA 1UB5A 1ZLSH 4C4KO 5E8NB 5D1XA 5HYIA 1T7ZA 2C1OB 4MNGB 4NOBA 5I73B 4AYSA 1WHPA 1XBRA 2JCCB 4HWZA 4PJHB 3RTQC 1UM5H 2JJSA 2WW8A 4N2MA 4L37B 4NT6B 2QGDA 1FPTH 4FLOA 2MQCA 1KJMB 5LO7A 5D4QA 5C09B 3MUY1 4HEPG 5HXMA 3UTZA 1KOAA 3VNYA 5ID1A 1EUUA 1PMYA 4BUQA 3ESPA 1CFNA 5DD1H 2YN3A 1U8PA 3WHXA 1NWPA 2UX6A 4ZQKA 1A1MA 4NP4H 3VXOB 3T77B 4EXKA 5DEZA 1K9TA 1HWWA 4F58H 3UC2A 1NFDA 3UABA 3HZVB 3LD8C 1YLBB 1NIBA 3N44B 1UOVA 3HFFA 1TF4A 3APNA 4I2XB 4NQCB 3DYPA 2EVHA 1HSBA 4HH9A 2EKSB 1TQWA 2FIRT 2R4SL 4YXLH 4L1TA 2K6YA 2AKRB 2ZCZA 3SYPA 5C2BL 1IC5L 3IU3A 1A8ZA 5FYKD 1BAGA 1NC2B 4B3EA 4B6ZA 1AANA 1JFHA 2BS9A 5C0JA 1U8OA 3QDJA 1MHCA 3GMMA 5JXEC 1P2CB 1VPOL 1S3KH 1CL7L 2X2JA 4X8JB 5HHOD 2EVGA 5CS7A 4NQSA 4IMKC 1FZMA 3KGSA 5IVXF 4WW1B 2V2TB 4KXZH 5I6LA 3FTGA 5D5MF 4JHVA 4KZDH 4AX3A 1KBVA 2X6AA 4ZD3H 5EUKA 5BW7A 4KKBC 2LW3A 4L48A 3PIQA 4OLZL 5BS0A 2C3VB 3UC0H 4OZIE 1BREA 1WQVT 1CE6A 2HKFL 4XP6L 3V4UH 3K7UA 1NGQH 2WXLA 4MZ3A 5F9WB 3UTSB 5IVZB 4PRNA 4MJ4A 1MFBH 1FNGB 4R7DB 3NCCB 2Q3ZA 4EI5D 4KNUA 1ITBB 1QUNA 5LBVA 1B3JA 2DWXA 3QUMB 5JIPA 5EDSA 1N5AA 3Q01A 4G71B 1TU2B 1RUKH 1HCFX 3ARFD 2XYCA 2P49B 3L1GA 5ISZA 2HKFH 1LO3H 2RGSA 4WNQA 1KWGA 1MPAL 2YEVB 2VXVL 1LEIA 4NNYB 4MMXA 2EEXA 4FNSA 4P05A 2ZT9C 4AL8L 5JHLL 2Z0UA 1ZHNB 1ZCRA 4K5OA 4UMSA 3NIGB 4YBLB 2CDFA 1BZ9B 5FA3A 4LNVA 3ECBA 4Y9BA 5A43C 3SCMD 2WB7A 5IB1A 5C1MB 3QCTL 3MXVL 3NFPB 2BVOB 2HKAA 1YEKH 3CVDA 3Q6GL 5B4MC 2F53A 2HFEB 3D48R 4PJFB 2J21A 3N42B 3OWEA 4AYID 1UOKA 4OJFH 5C97A 2P46B 2D7TH 1YEIH 3BZFB 4NN6B 3CCHB 1BDYA 2F58L 3OD3A 4QRPB 5SV3A 4F15B 4RWYL 4GI6A 2FWOB 3IS0X 3O0RH 1A6TB 4FHJA 4RGMC 5FGBC 4QRRB 3QA3B 3IU4L 1KBPA 4Z5RB 4LLMB 2P5WB 5TTRA 5L8KB 5BXFA 5AEAA 3T6ZA 1UC6A 2V2WA 4HSAC 4ZOEA 2BNRE 3CWGA 2DTSA 4NN6C 1A5FL 5B3SB 4RISH 3FK3A 4BK5C 3E2HB 4NHCL 4NP4L 3DHMA 2AW2A 1JWMB 1QBAA 4MRCA 4AL8C 4OGXL 2GJZA 1N5YL 1G7MA 3LEXA 4GQPH 1YPZE 5FIEA 4Y19B 2O5ZH 1ETZB 2WPGA 1JYVA 1RURL 2UY6A 4MAUL 5ESVA 3BH9A 3MNWB 1HHJA 4OZGE 3ZKNC 1G1YA 2CXKA 5HHPA 2YS4A 4LCCB 3L9YA 4P2QD 1SDDA 4N3TA 4JZJA 2EYSB 3HVDA 4PLJD 4QXUL 4XVSH 4JFOA 1HYSD 3UZEC 4YDNA 5DJZB 1BFVH 1XF4B 1U6AL 4AKQA 1AQMA 4NGHH 2M1KA 4K71C 1MWAA 3FB8B 1WZKA 2BHYA 3OKEA 3QDAA 1A02N 5H37G 1NAMA 3MRNB 5F7AA 3IFLL 3NCJL 3CDZA 5LXGH 2KI6A 4MXVF 5EZLA 3S35L 3IFOA 3SKUD 1S9KC 4H8VA 5GGRY 3S97C 4YE0A 1J8RA 2GHWB 2ZF9A 3U0TA 4K3JH 2JV6A 4HUXB 4JRFA 4WY7L 5T33H 4YHOH 4OI9A 4M9PA 1I7RB 4MNQD 4FS0A 1MF2H 2J88H 3ZE2F 1UADC 3MRCA 1JL8A 3RWFA 1WF5A 2A73B 3GWJA 1OAZL 4MJ5B 1D5IL 4JPIB 2FJGB 5EWIH 3GS7A 5JOFA 2KL6A 1NCJA 4NWUL 4JB9H 4X80L 3VGHA 4LPCA 3PWUB 1HFUA 4ZSOE 3V0HA 1UA6L 2BVPB 1GGTA 2VW6A 5DMKA 3L1OH 2F5BH 5D1ZI 5IESH 3O2WL 5CMAB 3BUIA 5AD0B 2D3JA 2W65A 4R7LA 3DBXB 3ILQC 2E6QA 1DJHA 2CWRA 3BO8A 4MA7L 5D7EA 4JNXA 4WHTB 4WJKB 3AABA 2NY2C 2E46A 1ONQB 3ZZLA 1BECA 4G7YL 1DQLH 2J5LC 3OXSB 4U3CA 5I6XC 4PJAE 5E51A 5AOZA 2UYLB 2BVPA 2QHRH 3CFKB 4WV1C 1IILE 4I0PD 3GMOB 1J8KA 4LLVB 1TZHB 2NY2B 4AGLA 3MRFB 5EH1A 5AKSA 5FUZL 2MNJB 1M42A 1NLDH 2CRIA 1MW2A 4O02L 2QLVB 2VLRA 5BQ7B 3WNJA 3VXQA 3E3QE 4HP5A 3GSQB 2XQYK 3HC2A 4P9HL 1YYML 1XIWD 4YGAB 3RX5A 4Z3GA 3CHQA 3ROOB 4LEOB 3ZQXA 1CD0A 4XMPH 3BKCL 1G7PB 1HE8A 1U3HD 5LLIC 4PCKA 3MRNA 2AEWA 1JHLL 5F21B 1C16A 2QQNL 2YA2A 1B90A 5IHUH 3NA4A 1B88A 1YMHB 4LCIH 1CGYA 4FFVD 1HKLH 3S37X 4BA0A 1UWGH 4GUPB 4KK5D 2WQSA 5GZOA 3VWKB 1IV8A 2JMRA 3ULVL 1CFVL 1NEZG 1M1XA 2Z7YA 1H0DA 1YA5A 5IHHA 2XTLA 3LXBA 1KLFB 1IT9H 2PW1B 4A2FA 5L0QB 4NAJA 3IWUA 1HINL 1QO3A 2OBGA 3EHBB 4TSCL 3QGVA 2A6KA 1R1CA 1I85C 4YSTA 3ZGIA 4AUYA 3K0WA 1USZA 1JK9A 3BYTA 4WO4D 4WAFA 5EBLB 1GIGL 1ZIBA 2EC9U 3ZGHA 3IN2A 1LXMA 2Y4SA 5I18H 3S4SG 4PMFA 1HH6B 1I82A 1MVUA 3EHBC 1TO5A 2VJXA 4MQSB 4C8XA 4KK8C 4Z5RA 2XTJC 3BKMH 4GIAA 3GRWA 5J1SC 1DBJL 4XH2B 3RY6A 3HHSA 3O6FA 5T8IA 4HIJA 1FL5B 1NPJA 1SXNA 4MMXC 1KSRA 4NP9A 3C8DA 1OW0A 1W91A 2YXWA 1Q94B 1FZOB 2F8OA 3FTXA 3SBPA 5CFAA 4JFFD 5L9DH 3U4EB 4KRNA 1EDQA 2GIXA 3LZLA 5DXWA 4YSQA 5D7IF 2H6PA 4GMTH 3L3HA 5GHWL 3CZEA 1ZLDA 5T3XD 3ZE0B 5EU4B 1XF3B 5LBSL 2WLHA 4AV4A 4CMHB 1LEIB 4MA3A 3FCTA 1TG8A 3NJHA 5DLLA 1Z9OA 2EECA 3JV6A 2HLAA 3B4NA 2F74B 3NIFB 3Q43A 1HHHB 1J1OH 2QR0A 3SDCC 3GEWB 2CHNA 1CDYA 4C4UA 4IGBA 1UVQB 5KAQG 3OKMA 1FNGA 2G0KA 1ZS2A 4DFIA 4OJEH 5JW3H 1NFAA 2WXIA 3GKZA 2VSCA 4DVBA 2YR3A 3GLAA 3VCLA 3TLRA 4FJZA 4B9KC 1FVCA 4BZ2H 2IXQA 3SDCB 4IRZH 5EEYA 3CZFA 2OXHA 4X8GA 2YD2A 2P24B 4Y4HD 3BVNB 1ADWA 1B0IA 3VXRE 4GRMB 3L5WB 4FXTA 3H8NA 2EC9T 3CD4A 3SQOH 5AW6B 5TFSL 1QNIA 2ZOLA 4I0KA 2DB8A 1AJ7L 1GKEA 1KEMH 1Z9PA 5EU5B 4BUGA 3C9NB 3L17A 3UYOD 3F84A 3NQIA 4RAUA 1LE5B 2E7LC 4MDIA 5EIIG 2DLFH 4LNRA 1G87A 1NIFA 1RUQL 4JN2A 1NLBH 3WE1A 5C0JB 3QH3A 1EFXA 5I8EA 1E9OB 4M7LH 3MLXH 1FAIL 3OF6A 1YEEL 3HZVA 5CXPA 1MNUL 4JY4A 4B3VA 4G5ZL 1KACB 2EIEA 2X6VA 4AQ1C 5C0EB 4U0RC 4X5PA 1K72A 3NPZB 3T77A 2BIQA 2XY1A 4M7KL 1EVTC 1IKNC 1OLLA 3AXLB 2AJUL 1FFQA 2OJ1A 1CFMA 1GMEA 3WGVB 2R1XA 4HSCX 4KI5C 5BZWA 3RHWF 4CJ1A 5JW4N 1T22A 2EO1A 3MJ9A 1CXFA 5FF6A 1M56B 2BNQA 2ZOKA 1C9SA 1WITA 4OLWH 1Z3GL 2D7QA 3X3FH 4ETYA 1AR1B 3AQZA 3DRQA 1LK3L 1KJMA 4JE0A 1E5YA 3AQYA 2R0LH 4KH9A 4OTXH 2HPTA 5D1QD 4C83B 3VQ1C 3RX7A 5C08E 1PCSA 1XGUA 4BKLB 1KB5L 5IB5A 4Z76B 1MJ7L 2P8MA 3QCUL 2DPKA 2QELA 2OMVB 4M3HA 5J6SA 4EMZA 4CU6A 1AR1C 1A6WH 1GS6X 2LTQB 5D7SL 5E8NA 2MPAH 4AJYV 3D85A 1D5MA 4PJHF 5LAXA 3DPBA 3ARXA 4RIRA 5E2UH 3GKWH 1TYJA 4ZX6A 3DWTA 3ILEA 5JW4Q 1D6EA 5C9JA 4IBQA 4C59B 1MRCL 4YLCA 4U1HB 4F7CB 1J0HA 5F7WC 4LHQB 4DW2L 2LTQC 4G3YH 2VL5B 5E2WH 4PRPA 4PJCB 1I3GL 4BFIA 3BIBX 3EJTA 4HFWA 4J3OC 5I1IL 1RZFL 4HMCA 2WJ7A 5DA4A 3OZ9H 5CD5D 2E9BA 3Q8EA 2R8SL 5JDSB 4XBGA 2XWJA 5IBUB 2MKWA 4HJEA 4JAMA 1ZWIA 3UG5A 1X5AA 4CKQA 4LE8A 1SEBA 2F7OA 4HBCL 4ZK8A 4HHWA 2W0PA 3ULVE 1WGVA 1XGTA 3SE3C 5LWYH 5T1LD 4K7PX 4MKTA 4WEUD 4X4ZA 5HI3D 3FRUB 4HBCH 4M1DL 2WJ5A 1ZE3C 4FTVA 1UURA 5SWSE 2F7IA 4FN0A 1T0OA 3MRHA 1KN2H 3L9RA 3QJXA 1YEEH 1QFUH 1MQKL 3NIDB 1Z0MA 3CUPA 3WFCL 3T4AB 1NBYB 2GY7B 4NSKB 4WI8A 1HNYA 3SE8L 1XCQB 1SQMA 3DX6B 5EPMA 3BYYA 4OV5A 4A7SA 43CAA 2BS71 4UDUA 3MBXH 1T4KB 3FCSA 3LKRB 1CDCA 1E2WA 3NZHL 2VLME 3C2AL 4PY7B 3FT1A 4JHZA 1P5UC 4G6MH 1KXQA 4POZC 1DQIA 4TVPL 2HG0A 3SQOL 4HD9A 3IVKB 1BJ1H 4PP1C 3FCUB 5FHAL 1E9PB 3VI3E 3C08L 4G42A 5DWUL 4HUWB 1MCOL 3QEHB 1DBMH 4PJ7A 4B5EA 5I8KH 4KHTH 3N1GC 1U91A 3VRIB 1RIVL 1AZNA 1KIPB 5J9PB 4HC1H 2J8UE 2C1PA 3QB7C 1AKJD 4LVOB 2XN9E 5KSBA 3JVGC 3WFEL 1B9KA 4ZXBA 2ZX6A 4NERA 1OZUA 5IEKA 1JMZA 3FU3A 4JHBA 2I5YL 2WUCL 4Y4FB 1MUJB 2D03H 4HJTA 4M00A 3BAEL 5HYJA 4Z95L 2IADB 2R9HC 4TLSA 1AFVH 1R5WA 3FZUC 3KWUA 4Z0XA 3N5AA 3FO1A 4DGVL 3NZ8A 5B8CA 5D6DA 1F3DJ 4HZLB 2HWZL 1DQMH 3D33A 3GK8L 2ICWA 2IPKA 4CVWA 2NCMA 3ARBB 5KVDL 4B9IA 4K7FA 1KYFA 3CG8A 3C5JA 2PO6B 3OX8A 3DVGA 1YUHB 3W38A 3PAZA 3FO2B 3NTCL 2DWSA 3T4YB 3SJVA 4GRLC 1KG0A 4DKAA 2DYPA 2O5YL 4WKZA 3SDXF 1J9TA 1WLHA 1G5GA 5KN5A 2H32B 3FB7B 3D4ZA 3VWKD 3IDMB 3O6LL 4G83A 5KS9A 3BKML 3S5LB 1BM7A 1KEML 5D6CB 1RIHH 3WEMA 1OD9A 1MH5A 5E7BA 4W6XB 5C92A 2YPVA 3QPQD 5FECB 3APMA 1BZ8A 4CSPA 4YDJB 4WTZG 12E8H 4JFDB 2VXUL 3QXDB 1BXVA 4BSJA 4BZ2L 1NCCH 1G0DA 4IOFD 4XE5B 5KOVC 5GGTH 3C8KA 3MLRL 3BT0A 4Z6AT 2NQCA 4LEEA 1E8YA 2ZWKA 2BSRB 3GXUB 5D6DC 5I75C 1ZA3A 4GRWB 3ZRSA 4BELD 2MSPA 4Y2LA 4FXKC 4QHNB 5CGYC 1U8IA 4NC1C 4F27A 2WVSA 1MZZA 3E9UA 4N0UA 3ECQA 2JI2A 3BXNB 4D9RD 4B27A 4I0PB 3U79A 5E6ID 5EBWB 2GFBA 4QXGL 5EZIL 4LCIL 3KHQA 3MJ7B 1R46A 3LKOA 2KYIA 1S7XB 1Z2KA 5LAPA 4DK6A 4FLSA 1PPIA 1KTDB 2JI3A 3ATEA 2XQYG 4PS7A 4U7MA 1UH2A 3ULVC 1E2ZA 3T6XA 4N90D 1UD8A 4A1RA 4AYFB 7CGTA 5A2JH 4FFYL 2DJSA 3L54A 4QAMB 2NSXA 4P9HH 4JPKH 3TFKC 1ECZA 1DBJH 3OR6A 2I9TB 3V0VA 1N8ZB 4WUUA 2CLVB 3L81A 5E9NA 4DSYA 1MIML 1Y07A 2DQIH 4Q89A 3ARGA 2EIZB 4OY9A 4ONFL 2K3HA 3E6FA 1JFQL 1ZAGA 2BHUA 4Y89A 2X6BA 1MOEA 5I18L 4Z78A 5FHBH 5L7XL 5MHSD 2ETWA 4P5TA 4TLTA 2IH8A 3D12B 3T0EB 4AGQA 2UXFA 3W9EA 3SPVB 1KXVC 3S37H 4G7YH 1WZMA 3MCKB 2JK5B 3P9MB 3CSPA 2BW5A 1R3HA 1A1OA 3ZYIA 1LE9B 2NY7H 4A6YH 5F7LB 1F2QA 3GB7A 3NPSC 1IM9D 1BIIB 1OGAD 1OVZA 4KJYA 4Y5VC 4XNAA 1AHWA 4G8FA 4ZAKC 2GI7A 4P57A 1G43A 1XL4A 1U3HC 1IKFH 2B0SL 3OB0K 1MHPL 4NO3A 3QSKB 4JFYA 5HI5D 4NWUH 3NCFB 1UFUA 1TMQA 1JN6A 2DL2A 2F6AA 4OLEA 1XL6A 3T0DA 1CXEA 5IROD 5DRNA 4EI5B 3D52A 5EIIB 5CP7B 3H6JA 3NCYP 2SEBB 3MQIA 4Y2OB 1HCVA 4P3WA 5EO0B 3MRGB 3VFGH 5TDPA 4ZMVA 4H2AA 3BN3B 5DJ6A 5I6PA 1BF8A 1XVSA 2EDOA 5DFVD 4KY2A 3O6FD 4P48A 5EZIH 1CXIA 2EVJA 1W0WA 2ADJB 2OMYB 4UANA 3ULAB 3AGWA 3KPSE 3CIQA 3ARSA 3SYQA 3NP4A 3PAVA 4JMNA 3JV5A 4JFEA 1CF1A 2NY3B 2O6DA 5F3BA 2BIIA 3H42L 2ICEA 1L7IH 4ODHH 2H8PB 5CJOH 5JIMA 3M1OA 3UO1L 1S9YB 3NOIA 4ABVA 1TEFA 2I27N 3D08A 5FYKE 4MCZB 2DWEA 4QRTA 4ANKA 4GAYB 4IOIA 1FBIL 4GNKB 3TU6A 2HLFD 2CO7B 1M6OA 1JYNA 4L5FL 3RNKA 4EN2A 3RIFK 1OK8A 2IDTA 1O9VA 2DEXX 3P0VL 2FB4H 5B39B 3VFUA 4PJAB 2E47A 5EZOH 5F2FA 5BVJA 1QMUA 4I3RL 2FJFB 5J06A 3EFOA 4XR8C 4H5SB 2FUQA 4X5LA 3WIFA 3P3SA 2Q3XA 3FU0A 3L1OL 1KLGB 4NFDA 3LN4B 1BHGA 1QHPA 2C7UA 2ZKHL 4G8GA 2B39A 2AP2A 3U4AA 4G7QB 1NIEA 2DMCA 2UWEF 4GS7C 1HCYA 4JB9L 4N22A 1RJYB 1O7DC 4R0LB 5LGJA 3LHPL 3Q2NA 4NLAA 4U33A 1L9SA 2G4EA 2YD6A 1VA9A 3QFJE 4KTEL 5L2KB 4EI0A 3BGMA 2VSMB 3BMVA 3HNSH 3HUJA 2HUHA 4YSEA 1YMME 2JKTM 3KCPB 5B1CA 1X3DA 2YD4A 2D0GA 3VMNA 3O0RL 3D6GA 2GY5A 1OTUD 4FLQA 4ZS6D 1QX1A 4DFHA 1XEDA 2VE6A 1M05B 3BPCA 3PWPE 4GSDH 3QQNA 4FCHA 2DMGA 1WD9A 4TQ8A 4Y5VA 1PG7W 2N59A 1MCQA 3NCJH 5SX4I 4NEHB 4UQBA 2OMWB 15C8H 4PYGA 1HDMB 3FO0H 1IC0A 4KJQD 4Z95H 1KPRA 2YSSA 1WZAA 1XF2B 3CX2A 4DAGH 1W6LA 3VO0A 5EV7A 4YXKH 2W9EL 1D2PA 1MLBB 2I5YH 2WUCH 2G2PA 3MRMA 3TBTB 3PS6A 3AUVA 1I8MB 2YUVA 3FQWB 2YXVA 3B7YA 3TV8A 1UTDA 5FM4A 4NNPH 1U3NA 1FO0H 2C3HA 1ZANH 2BY0A 4LSRH 3DX3A 3LIZH 4N2GA 2MMXA 3BLKA 5IVNA 3G6AB 3NZUA 1A7NH 2F54A 3O4LE 4DGUA 4JBSA 3DUSB 4D94A 5EOCH 3CFQA 1RPKA 1YY8A 1IGCH 3GHEH 5FYJH 5ESQA 5B8CC 1A2YB 2K8MA 3E2HC 3J8F7 1UUNA 3AROA 3F12A 5E70A 2O61A 3NZHH 5HJ3A 1A5FH 4KZDL 1WFMA 4ZTOH 4KHXL 4F33B 4YNYB 2X05A 2VLKD 2X2HA 3EUUA 3QWRD 1HCZA 1UCBH 4NN5C 5F88B 4ENEC 5KJRL 4F15C 4R4BB 1CDUA 5EC2A 2VN4A 3OAYK 3MRPA 3WFCH 2XU9A 3QUML 2GSIB 3SBWC 3L95B 4K15A 1NCAL 2X9WA 5BO1L 1KN2L 1RSFA 3MLSL 4QRRE 4FA7B 2WO4A 4UU9B 4MZIA 5KYWA 3GMNA 1LHZA 4P59L 5DHXB 2O72A 2X4QA 4NQEB 3Q6GH 4HK3N 3LZPA 4OZGB 4PJ9D 5HP5A 3ABMB 2FAUA 5C0DA 3NESA 3UMNA 4OGZA 3N43B 4D2NA 4KK8D 2BINA 1MAMH 3O11A 1RV6X 4PMEA 4WFFE 4JFPA 3DXAA 3MV9D 3Q8BA 3B6SB 3WS3B 1VKXB 1GYAA 4U7SA 5HYSG 3HFML 4ZUWB 2OCFD 4GG6B 4Q52A 1HAUA 3D4YA 4L9LB 4HAFA 2Z6FA 3W37A 1BD2E 5GJTL 2A9AA 3WAJA 2AK4D 2CKBB 1LWRA 4X4XB 4XHJD 4LLWA 2L0DA 5FC9A 2WBJA 2X4NA 4PTUA 2ZG1A 3IXAB 4IMLA 1NM9A 3T1FA 3QORC 3UJIL 2XN2A 4L1BA 3R7RA 3SPCA 1KCUH 3WLBA 4ELKB 2XHNA 3ZRFC 2GKIA 3EO0A 3GRGA 2JF1A 4YHNA 4Z77A 1ZGLB 4GRLA 3ZE1B 1ZLSL 4OI7A 1L7TH 2CLRB 1JZ5A 5DHMC 1ZGLP 3INUL 5D7HA 5D2LE 1A7OL 2Y3AA 4EZJA 1AD9A 1MJ7H 2UXGA 3D87B 5KSUA 3DGDA 1THAA 1IBYA 2CCVA 1V7NH 3PDGA 2EILB 4JDVB 4YHZL 1DVFC 3KL3A 2G2RB 3H3PL 4O2FA 4FP8H 4UV4H 1PFCA 2GJPA 3HRZA 3RU8L 3KPRB 3K8LA 5CJ5A 1EERB 4YWGH 2V6HA 4PLNC 2R4SH 4PWGA 2KPNA 4RAHA 2IWKA 3GHBH 4JM2C 1EH9A 4CADB 1KB5A 4OCXH 4JX0A 2WNGA 6PCYA 2B8OT 1HOCA 1DN2A 3QFGA 3KVDD 4GFXA 4JY6B 1A4KA 3I2CH 4WHDA 3TM6A 4JM2B 4RQQB 4HHAB 1LQBC 3UX9B 2XFXA 4AH2B 4TXVB 3B3IB 4P4KD 4Z7VA 3P3UA 3C6SA 3S36H 4PG9B 1OP4A 2XWTB 1AGFB 4HLJA 1IL1B 1E3XA 2BNQE 5F7EH 2IDQA 4Y5XB 1DTUA 2AJ3B 4EUPH 1N0XH 4OJYA 1LD9A 2GCYB 2ERJB 5F3HA 4X4YB 1D2OA 2Y36H 4J3OD 2P8PB 4PS8A 1TMCB 4LL4A 3OB8A 3KPNB 4N8PA 1IMHC 4I77H 5DTFB 2IG2L 4MX7A 3WTVA 1OB0A 4RZCA 1F4YH 3V0WH 3ZBMA 3NGBC 3L3OA 4Z1PA 1UZGA 2GUYA 5L0QC 1HTYA 3VFMB 3VD7A 2ZXQA 1ZT1B 4FQLL 1BGXL 3QDMA 4XWOD 1B4RA 3V79C 1OWWA 2Y06L 5FB8B 4K7PL 5E08H 1Y0LB 2O1AA 3RVVC 2YMOA 3HI5L 1FVEA 1U8JB 4YO0A 4PJDA 1FYTE 4M5YH 3RVXD 2R4RL 1FFOA 3HPLB 2V7HA 3CC1A 4Q9CA 2BM3A 5A3ID 5I0WA 3A6CH 1RZJC 5C07D 1HOEA 2XV0A 4F92B 1S5IL 1WC7B 1QAWA 1OSYA 4Y7MA 2CHDA 3L7EB 2ICES 3HRZC 3QRBA 2VZUA 2XQBH 1RIUH 3SQBB 3M88A 4OT1L 2QPEB 2B59A 3SZ6A 4ETQA 3K6FA 4DIXA 1QG3A 2XN9D 3ME0A 4DN3H 3VG9C 3WJLA 3ZTJH 2IFGA 3WE6A 3PGFH 3W2DL 3PWPB 1EHLL 25C8L 3GSRA 4X5XB 5BV7H 3QJRB 1CGVA 2BOLA 4P2RA 4RNRA 3SO3C 1FF5A 2CNZA 4YFLI 4FQQB 3VSVA 3QZPA 3QQ4B 5A3IC 3P4MB 4JFUA 2ZF8A 4NCDA 4KX8A 4QF1A 1WPCA 3AJ7A 2XWBA 2CDGA 1OSZA 4J4PA 5L8LB 3KWTA 3VACA 4P2RD 3STZA 1T03H 1YEJH 4NUJA 1MCJA 1FN4A 3FU7B 4ODSH 5LBGA 3FUFA 2GPZA 4MDJA 1NDGA 3B5HA 4PCSA 3GJEB 3MGAA 1XXFC 1X6LA 2JKIS 1LWHA 5CLXA 1Q9LA 1L9OA 2K8QA 4JCWA 4TSBH 1TJHH 1TJIL 1SJHA 5K69A 4FD0A 3L4VA 1IZKA 5H8DA 4BFBD 4IIQC 1P6WA 1UT1A 4HWEH 2QMJA 5HJBA 5CBAA 2P4AB 2CK0H 4FJYA 1FV1B 2Q7YA 3MBEA 5KSBE 4V1DB 3ZKQD 1R75A 2NY1B 1A7QL 5IK3B 3QP3A 3MZGB 5DMJB 5KBNC 1FIEA 1CXKA 1NGZB 3P4OB 2Z31A 3V0WL 1F4YL 1DL7L 3HW7A 3QAZC 3BDYH 5I1LB 3IMUA 5E94B 2IMMA 4JMXA 3WXVH 3FB5A 2MNWA 4JRXE 4PJXE 3E38A 2CM5A 4TQIA 2ISDA 4GSXA 4WW2A 1YO4A 1NL0L 4Z23A 1VFAB 2DL9A 4JY5H 4LBAA 2VQ1A 4U4BA 4ZNEA 4QOKD 1IEAB 1NGXB 2VT0A 5HHOB 4F7TB 3S36L 2IANB 5CU5A 5EBMB 5AW4B 1KJ2A 5DSCB 4XMUA 1M3IA 3N06B 1A3RH 3EFFA 2FX9H 4PREB 1ES0B 4FYTA 3F5WB 2IAMA 3QJUB 1L9MA 3QO1A 1CBJA 4JHAH 2P9RA 4HIIA 5CGYD 4ICXA 3NJVA 5DD6A 4JL1A 1JZGA 3KLHD 3Q1EA 4PJIA 2R27A 5K9JL 2OFQA 2WP3T 4PRIB 3VG0H 3W9DA 2VXSH 5T3XH 3K6DA 1UA6H 3QULA 3RU8H 3INOA 4DZBA 1J8HD 3IJSA 4FP8L 1CR9H 1WUNT 2LVCA 1XF5A 1JGVH 1ODUA 4TNWF 1ED3B 1ZMYA 5HGAA 3BP4A 2NY0B 5J1AA 4E5XB 3CFUA 3FH5A 4CMMB 4JHWL 1GZHA 3TBSA 2W59A 4GBXA 1U8CB 3PQYB 3MPCA 4ZMZA 3NSXA 3V6OC 2N56A 1U0QA 4EIGB 4NCC1 3GC3A 1MVYA 3BOVA 1V3JA 4YL9A 2CCWA 3FONB 2X87A 2YGQA 1IGYA 3NSYA 5JHAA 4BFFA 4QHUB 4XODA 5I74C 4LFHG 1DUYB 4YDZA 2BPBA 3BZDA 4NJAH 3FTYA 3PWVB 4KRPC 2COVD 3SPJA 1RPUA 3ORJA 4KKRA 4QJ4B 3BSHA 3B2UC 5DK0B 4KRLB 4NGHL 3EJRA 4IBLT 5FW7A 2AXGB 1J1XH 3M8OH 4IEFA 4WWID 5AL0A 2ED7A 4WI7A 5FA4B 3SQRA 1HL5A 2BC4B 3RUGF 2YC1B 1K4CB 2IVFC 3UBXA 3OTTA 2DEYX 1BZEA 1RQ5A 2WZ5A 3IJHA 3OBAA 4TUJB 3VMPA 5AWNL 1OCZB 3OJDB 2Q6WA 5D7JC 5AW7B 2OS7A 5I19H 4AOFA 2WY3B 5HI5C 3D39B 1Q9KB 1XIWB 1N68A 1GPOL 2J2ZB 2XG5A 2B14A 2BSCA 2Y6TE 4HGWA 5BZZA 3N40P 3KNBA 4H88H 2BCKA 2C5DC 1OCWH 5GGUA 2PR4H 1MCKA 5T3ZE 1QPKA 3JTSA 1ZDSA 2X6UA 4AEHH 1F1AA 2VWEC 5IW6B 1V3KA 4UAHA 3X14A 4NO5B 2LE9A 1OL0A 4NQCE 4ATTA 4JFVA 3BP6B 2WSKA 3BVDB 1N59A 5FAAA 1IAKB 1X9RA 2VGLM 3VFVA 2F19L 3W81A 1PF3A 3WFZA 5AB9A 2CIIB 5K93A 1A7NL 3ZX1A 2EH8H 5KYYA 3NAAH 1S7UB 3TF7C 5J5EA 4N0FA 1F97A 2AV7A 4L5FE 2KZKA 1AXSA 5DHYA 5GGQL 3STBA 3UIYA 1ETA1 5EUOB 2QKIA 1BLIA 4JG0L 1FCGA 5T3ZL 4FQXC 3GF8A 2ODHA 2IBGA 2VUYA 4HXAH 1IM9B 1JI1A 1OGAB 2C7FA 1M57B 2YAEA 3CFBB 4NI6A 7FABL 4AW4A 3UTSD 3UZQB 3HS8A 5KTEL 4P2OD 4U1SB 2CHZA 4N8CH 4PJGA 4XP6H 3V4UL 5B3JF 1IEBA 3O3AB 1E5CA 4R8WL 2R1WA 4UUJA 2ZWLT 4FQIH 1P9MA 4ZYKB 4BK8A 2AEQL 2LHAA 2MCG1 3ZTCC 3CFJB 4X0NA 4OM0L 3MRIA 4BZ1L 4GIOA 2R2HB 4JFZL 1UXWB 2YEQA 3F58L 4PJEE 1K8DA 2KH2B 4LLYB 4K5LA 4ZFZB 3KPMB 3HNSL 1TVHA 5M7QA 3GSNB 2OKMA 3L5JA 3S34H 2PO6C 5MI0C 1RXLA 1CB4A 1WSST 2DM7A 5DUBA 5KVEL 2PWDA 4GFTB 3DGGB 5SX4H 1JGVL 1WTGT 3G9AB 3QDJE 3ZW3A 2XICA 1B4TA 4LL1A 2RCSH 4YHLL 5IJVA 1SXZA 4AVHA 3PUUA 4O2CB 2VC2H 3M45A 4TUOA 1TPXB 4D0CA 3DO7A 1EAPB 1DEEA 1OV8A 2RFXB 1BAWA 3IDNB 4JQIL 1UWYA 4HKZA 5AWNH 5J6GB 4Y4HA 1G7QB 1MCWW 4ZG1A 2YRZA 1IQWH 2V9QA 2F7PA 2CRZA 4QLWA 1K8IA 5KANI 3LNIA 1AG0A 4JKPL 5KVFL 3SDYL 4Z3HA 1NBZA 2BHFA 5TE7H 3ELAT 1JCKA 2ZKYA 1G0XA 3BGAA 4H25B 5I0YA 2NYZA 4TUUA 5L4MA 3CFDA 4D9LH 1KGCD 1HL9A 5J1TC 2OCJA 1KV3A 3BUPA 4PLKD 3ZDZE 1KPUA 2VM4A 3IFNL 1EJFA 5DRWA 1WD8A 2A9DA 3ZE2E 4BQ8A 4BQ9A 1M4KA 4A37A 1BMGA 3FH7A 4F7MA 2JLLA 1WH0A 3MLZH 1EMTL 2UUDK 5HI3C 4HIEA 2CO2A 4ABWA 3FSAA 3GRWL 2BNQD 5A16A 1YMMB 2J6EH 5I76A 3ESVF 4Q2ZA 4NRXB 1MHPH 3HG4A 5CUSH 5GZNC 1UWEH 3B2PA 1IKFL 4H0IA 3FTSA 1N9PA 2HVBA 2LLLA 5AZ2H 2G5BA 4P46B 3WL9B 1UZ8A 2G75B 3QQ3A 1FHNA 1E5BA 1A7RL 5E5LA 1BIHA 2NY7L 1SVCP 4H13C 3DVNB 4Y5YB 3EYVA 3S3BB 4ZSOB 4PI2A 3IRZA 3NVQA 4Y8AA 5HYSB 1ZOXA 4U7KA 3QZBA 4U3XA 3FFDA 5BUGA 5EOTB 4AQZA 4QHKI 1YY9C 1OXYA 2ADIB 2CJUL 1TKWA 3HHMA 4PGJA 3W39A 2UWEB 2X4PA 3T0EC 3GJFK 1OGSA 2FEEL 1IVLA 5I6MA 2YQGA 1H3UA 4L23A 1MIMH 2DQIL 1KIRA 2IOIA 5EO9B 4LIQL 4PW4A 3ZOAA 3D18B 1EHLH 3U36A 2X3BA 4JPKL 2WVTA 1CLOH 1IAOB 4WI0B 4PJEF 2PTTA 3LEVL 3IMVA 2WGNB 4GG8B 3WXVL 2R9HD 1P7KA 1L6PA 2D9CA 3BLPX 3OZKA 4H1LH 3PABB 4JRYE 4NYLB 5HDRA 3TBYB 3TURA 2NNAB 1IAII 4X7FC 5CWSB 1BMWA 4MNQE 3FU8A 5FK9A 2VR4A 1IFRA 4M61A 3VB9A 3G6JF 4WGWB 3SODB 2SODB 5I66B 5IHWA 1D5RA 3EOTH 1J8HB 4HMDA 2IALA 5I82A 4JRWA 4K3DL 5GZNA 2AZUA 1KCKA 1ET5A 4YN3A 2X42A 3A6CL 2YN5A 4M8VA 1H5BB 1BFOA 2W07B 4NKOA 4JJ5A 4GYBA 4M5YL 2QPDB 4QT5A 4WU5A 2B2XH 1K4DB 3IAPA 4N8VG 1WCBB 5ICXA 1VIWA 5KSAA 3FO9A 1PEZA 4LF3A 4MB5A 5DUJA 1CS6A 4ZT1A 1Y6KR 4X6BA 3RWEA 4GS7B 3CFCH 3QI9D 4R0LC 4J3OF 4JM4L 4RVBA 5IIEA 5IUCA 4X9GA 2YMXH 3EZJB 3NN8B 3AXIA 4MXVE 1G7IA 1U33A 1P7BA 3SE4A 3VFWB 2IOOA 2FL5A 1DVFD 1CJYA 2VH5H 1IGMH 4NQVB 4TVPD 4PS4H 1C1EL 3KM2A 2QTVA 3EGSB 4Y4HC 3VFSB 3L7FA 2ID5A 2PCFA 3EGDA 4Z7AA 2X10A 1YN7A 4K5NA 3HJ0A 3NIDF 3PWPD 3BW9B 3MGOA 5ERWB 4BSWB 2XJKA 3RA7L 5JW3L 3E6HA 1KDIA 2OL3B 4UQAA 2BVQB 1FVDB 2E9JA 3L16A 4C56A 4DN3L 2DQDL 3EOAB 5I73C 3OR7A 1BVLA 4TRPL 3MGOB 5A7BA 5C0IA 4ALAL 4GKNB 4UILL 3QEQA 1GZQA 1CZ8L 2CIKB 3I9GL 4L29B 3MV8A 5DJ2B 4N1EA 4YOKA 4XOBA 3CMGA 5J13B 4PJ7F 5LKNA 3RB5A 4G7SB 4MCYA 3DA0A 1HQRB 1ZVYA 4P4KC 4EIUA 2VDNB 3ARBD 3KR3L 3D3VE 4XNMB 8PAZA 5ADOH 5T1LA 2FUTA 3LV3A 1YEFH 1MI5E 2LQRA 4G9FB 4TL5A 4W1TA 3ULVD 3BEVA 4A6YA 4FULA 2D03L 1A9BB 3QPXL 2B9AA 2IAMD 3PP3K 2UVFA 4H26A 5E4IA 1G9MH 4ZUSB 1WAEA 3QZWB 5ADPL 1X5XA 5IR1B 4EJ1C 4YHZH 4RMUA 1BLNA 1EAJA 2Y07L 5AVYB 5GS3A 4NKOB 3LD8B 5AQ0A 5GSRA 2GBUA 4OZ4B 5LNEA 1ECYA 3FZUD 4Y16B 2DLEA 4CJ0A 4KQ3H 1FQ9C 4KWUA 4KHTL 3SDDC 2APXA 4BRJA 4X6DE 1OTSD 4HPOL 4I77L 1MKFA 3C08H 3VM7A 4WI5A 5EFIA 3BN9C 3CN4A 1GOFA 3V0EA 2E7LA 1XH0A 3R1GH 1BOYA 2NLJB 2GIMA 5IW1A 1J8HE 1LK2B 4ABQA 3D0VB 3ATFA 1HHGB 1LQSR 4Z8FL 4HG4J 2QKIC 4FG6D 1ACYL 1P53A 2AITA 1IAOA 1G4MA 4RFNC 2Q86B 5GJTH 2GJJA 2EEDA 3E7JA 4ABUA 4D9QE 4ANWA 2G30A 4G7VH 4YGVB 5E2VH 2EDWA 4TL4A 5EO9A 5F7YC 3SPIA 3P54A 3V0AC 4G8EB 1I8LA 3KAAA 3PYCA 2O5XL 3JTTB 4LAQL 1WUZA 3RKDD 2WD0A 1CFQA 1JG9A 3FUKA 3V5HB 1VHPA 3O4LB 2JKXA 4BQCA 2JJWA 3DO3A 1F8TL 4FQHB 2F08A 1LTXA 1SBSL 1ZHLB 3K80A 4XNZB 3UYPB 4LOUC 3L3GA 1R5VA 4HT1L 1DQQB 2XX0A 4XNXL 1OAQH 3TT3H 5C0AB 5FYJU 4XGZB 5CEXB 5IB2A 5MEPB 2ESVE 3H7BB 3QORB 3DMMA 3TCLB 4J3BA 1NMBH 4GW1B 5DEGA 4KUZL 3WY1A 1ZXQA 3VU2A 3HIZA 5H2BB 4DETA 3EH4B 4QI3A 1PG7H 5I1IH 1CBVL 1PKOA 4BD4A 4NPYB 3VXNA 4APQD 4ZTOL 4G3YL 3NRQA 3LQZB 1TQCC 2E8YA 1JZ2A 3OHMB 2KDYA 3UPCA 4FXGC 3MOBL 3VW3L 1TQTA 4AQEA 1OB1A 1O7VA 1Q1PA 4JDTL 3UJIH 1PSKH 4PJBF 4IRSB 2XN1A 2PYEA 2GBVA 3AT8A 4F7MB 4LOUD 4FZ8H 1JMXA 1T0MA 3D7PA 1KCSL 1IGIL 2MQ0A 3V52H 5L2KE 4G6FB 4ERSL 2VIRA 1ZHBB 2X1XR 4KOBA 5D7JD 1G0YR 1R6VA 3KLHC 1SPDA 1UWXH 4IBUA 5ALCH 3LRGA 2J1WA 3Q2WA 1R17A 1ZVNA 2BIMA 4DT2A 4G1EA 5L8JB 3R0MA 3QJOA 3FQNB 3PP4H 5IWLC 5IROA 4LLQA 1V3MA 2E9IA 3F65A 3AS2A 2BRRH 1DANT 2IGLA 3KPRD 2FSEB 4JFXB 4P59H 4GBXC 2VDPL 4LK4A 2VABB 4Y4KB 3O8XD 5C0BE 2FO4A 1CICD 3IGKA 4DTGH 1HESA 4HG4K 5BO1H 1OAQL 3TT3L 2HTLD 3IDNA 4JO5A 4ZZFA 4MMZB 4QWWC 1J1PH 3QXUA 1AGCB 2NX5A 3FMGL 1FCCA 2ZUYA 4PJCF 4E41B 3FQRB 5KBKA 2DLFL 3BUTA 3GMLA 5DJYB 3X1FA 2A4EA 1L5GA 5DCCA 3UAJC 2VLJD 4X0KA 1I4FB 3BFOA 4P5SA 1XGRB 3HPJB 3EYSH 4HUNB 2I69A 4MMZC 1O0VA 4QTFA 4I3SL 4U3SB 4XBEH 4QRBA 5D96B 4OCYH 5ICUA 1LP9A 3GHEL 3PNWA 5G5DA 3QUHA 3ZMEA 3KPMA 5IF0A 3GBLA 2AEOA 3QZNA 1EHNA 4Y5XC 4BQBA 4UB0L 5D1ZA 5E0FA 3KXFA 4TTDC 5D72L 1S7WB 2FB4L 3Q48A 4HWBH 1WFJA 2Z35B 4UNIA 3V55A 4ZMOA 4N0YL 3OWRA 4L3CA 2JQMA 3MRQB 5D96C 2RQEA 1FLRL 3V8OA 3V7MA 2X3AA 1O5PA 3EADA 3UZQA 1AMYA 1E6JH 4Y19E 2EDRA 3O6FC 1P4BL 1MFDL 5EMYA 2V5RA 3D9AL 1MJJA 4L8SC 4NAMA 3G6JB 4B7LA 4NQDB 4AQ8C 2NUPB 3FTVA 2XLLA 1A4JA 3QIBA 2RACA 4YEEA 1F4HA 4UOQA 1URIA 1IC7L 3ESOA 4EQ3A 1KBGH 5DHYB 5LDUA 2W0KA 4Q7DA 2H2SD 2CMRL 2I9LB 5F0MB 5DLML 2WLLB 1KN4H 1E7UA 1GVIA 3VFPA 3N44F 2YEZB 3GXFA 5BZDA 4N0FB 2JKLA 3H9ZA 3G08A 1NKRA 3QZOA 4PI0A 5DFAA 2CJ3A 1YEFL 2Y24A 3UOAB 5E6IA 1IAKA 5CLTA 5CAYB 3J2PA 5DRZA 3ZDXB 4LHUG 1C12A 4E68A 2KQNA 3H0TA 4WU7B 2Q3AA 3N40F 4MA8L 1TDQA 1MW0A 3BFQG 3VXUA 1FI8C 2CBPA 1ZLUK 3VG9B 3VXSE 4KXCA 2J8UF 5LGYA 4NJ9L 3QNYB 3K8KA 3PGCB 4OZFB 5JNYA 1HXMA 5I1EL 3KNBB 3QT2A 5D2NA 1P4IL 4EIBA 3R19A 2A9NH 1N7MH 1ORQA 4KO7A 4IIQB 5FWRA 1WYJA 3D4CA 4ZO6A 5DD3H 5FO9A 2V5SA 1F90L 3GJFB 5EF2A 1TQUA 3FCGA 1PZBA 2QPUA 1Q9WB 3WJLC 3WXWL 4N0RA 1X4XA 5CKAA 3UZEA 4BINA 4D0BB 1TO4A 2XPZA 3FF8A 1HINH 3PPSA 4WU7A 3H0TB 2WB1A 4PGCB 1RK7A 3WELA 2UV3A 3H42H 4ODHL 4PJBA 3QAZB 2OPCA 5ITBL 1HILB 3CFCL 1G9EA 4RCAA 1F11A 2QSCH 5HPMB 1L3WA 4QXTB 4NRYA 4MXQC 5CJXA 5JLZA 4BH7A 1H8NA 4H8WC 4FNTA 5E9DB 1PGRB 5ISZE 2B20A 1TENA 1I9RH 4XN1A 3ILPB 4HIXH 4KNTA 1DUYA 4HJIA 1VFBB 2VXTH 3MNMA 5FX3A 4WI4A 5DEFB 1RZIB 3VFGL 4XMPL 4HIPA 4GXUM 5TE4H 1EFQA 4PIRF 1A14H 5GS0D 5HDOA 2EP6A 1I9RL 4FG0A 5B7FA 3EOTL 3OAUL 4JQIA 4XP5H 1JZ8A 3G6JA 1A22B 4OIAA 3QHFH 4MAYC 1X5ZA 1JGEB 1O9WA 4IDJL 4JPVH 1E27A 4U6VH 2F8VA 1A25A 5FYLD 1MFCL 1GTNA 1OAKH 4PJEA 1ACXA 4R7NA 3ZDXE 4CMMA 5I9QC 3SGDI 2ZJSH 3DX0A 4C4BA 4MYWB 1NFKA 4U1LA 2ED8A 1SXSA 4HOZA 1JHTA 1AGBB 3QULB 4LIQH 5C0AD 2VSKB 4JFDE 1TZAA 1MJ8L 2XIBA 1EXUA 2APWA 4XCFL 3S3JA 1MEXH 2VQTA 3JWNE 3OPZH 3N0PB 1XGQA 5DZJA 4FQJL 4Z7WA 3U6RA 2W88A 1OALA 1MRFH 2X40A 1S5HB 5FUCE 4U0RB 5EOQL 4HU8A 5DJYA 2XC8A 5E6UB 2R51A 4ZUVA 3IN0A 3F5WA 4KK9C 4XVJL 4NQDE 2IH1A 3ABGA 2DQGH 4G6KH 1RIHL 2AABH 2EDKA 4GQRA 4MVBD 3WTTA 4N2DA 4MMZA 1RAMA 1MLCA 1LNUB 1KJ2B 4RGND 2EO7A 2QV2A 1T4WA 3WTUA 3A22A 1QRNB 2OMXA 1XB6A 2YFOA 3D5OF 3N1QC 4J12A 4XAWL 3V0IA 4FDWA 3LKPB 1D5IH 1NGXA 1AYRA 1SLWA 1E27B 5CIPH 1AXTL 5FM5M 1DVXA 3II3A 1HEZB 4XOCA 5E24E 1GC1H 4KK6C 3ZT5A 2LAAA 1I1CA 2A9CA 4X7SH 2IDUA 3NCXA 2DWDB 3TF4A 1T1YA 4WY7H 2G0LA 2JKWA 2Z4TA 3FUIA 4NZFA 3GK8H 3QC6X 5C9KA 5IM7A 3Q2VA 1KTLA 2YPLE 3TA3C 3FDWA 4APXA 2YBGA 4ZNCD 3BD3A 3GGWB 2YIHA 2IGFL 1LP9F 3LS5H 3VDCA 4YPJA 1ZHBA 3WUWG 3QEQD 4BH7B 5JLZB 3BAEH 2Z92B 2K45A 4GB9A 4QXTA 4XMTA 2ZUQB 3X12B 1M2VB 3V4VB 2JTDA 1U6AH 1I1YA 5C0CD 2Y7LA 2P5EE 3DHPA 4IIZA 4AJVA 5JO5A 4XVSL 4KRPB 1VEPA 3WFDL 2ZKMX 3QHZH 1OB1B 2NY4C 5C6PB 4Y1AE 4PHXA 1IJNA 4O5LL 3ARDA 3RVVD 3WIHH 4AQEB 1WZ1H 4KZEH 3VX1A 1OF2B 1QASA 4WENB 4MAUH 1Q9LB 3GLEA 4UQEA 1J9RA 1T6WA 4XBPA 1GSKA 3VXNB 5JHMA 4NPYA 1SXCA 1J5HA 1ZSDB 1FN4B 3BCFA 3TJPA 5C3IA 4IIQA 1IQWL 3SD2A 5FPIA 4I3SH 2X4OA 4KJPC 1J87A 1KC5H 3RGHA 1R24B 5KYNA 4RISL 1DBKH 4GIPD 3C2AH 4Z7UF 1MSPA 2VLKE 4HS6A 2XZCL 2UY7B 2AGJL 4N2BA 4MASA 1JIBA 4P4RA 4A38A 5J8OA 4PRHD 4PB0H 4PW9A 4HCRH 4N9OB 2H3NB 1ZHLA 4MDRA 1J1PL 1G7JA 1P5VA 2VMDA 2ZXDA 3S8GB 4FQHA 3RY5A 3HN3A 2F58H 4J6RL 2NY4D 4AKOA 2EZ0D 1QR1A 5KVDH 3JTTA 1DQML 2WXRA 2H2PD 2P45B 3WD5H 4B41A 1V55B 2BRRL 4PCYA 1ML0A 4XZUA 4YLQT 1URLA 5BZDB 1CD8A 2GTWA 1ID5I 5CCHE 2F9BT 1TOXA 3HE7B 3U2IA 4DKTA 3KH4A 4OLXH 1U8MA 2QGBA 4BM7A 1JV2B 3JWOC 3ZKSD 3HS0A 2ZSVB 1WC7A 4HA1A 4UM9D 1CK0H 1A4JB 1M7XA 2XN0A 1RU9L 4HCRA 4K3EH 5KTEH 4TS6A 4ERSH 3V9FA 4XI5D 5I5JA 2EINB 4EBQL 1I3GH 1U8JA 1IAMA 1FVEB 3MXWH 4YO0B 4UNTA 4KI1A 2P44B 3MV7A 1Y0LA 2R29H 1NDMB 4AKPA 3LYRA 1NGQL 5MI0B 3ZL4H 1XH1A 5FYLL 3IDUA 1ZLVH 3VGAB 2Z35A 2E8ZA 4MA1C 3GKWL 2X89D 1KENL 1EEZB 4LMQI 4D7PA 5IR1A 5BNXD 5B1KA 2DD8L 2CXGA 5G5DB 2KZ1B 4OCSL 3QNFA 4L2YA 1TLKA 3DARA 4RGNE 5MEQA 3UADA 2NUTA 4IRJC 1BP3B 3AG1B 1XGRA 2AJZB 2GEQA 2BNRB 1KGUA 1JZ7A 1EWHA 3QDGA 5JIIA 4ZX4A 2XA3A 2OSWA 5D71L 1PAZA 3BPNB 2OMTB 1LK3H 1IL1A 2Z91A 1AGFA 5KYUB 4E41A 2KERA 1QBLH 2AEIT 3HZKA 4MCYB 4KVNL 4E9YA 3FJTA 3GUFA 2XFXB 1EANA 2XT1B 3V95A 1UB6A 1OCWL 1J86A 2Z65C 3EOAA 1XGPB 2R56H 3TBBA 2D31B 1FIGL 4AG4H 4TF4A 3GDCA 3MKKA 2VZ1A 4MS8D 3WKPA 3QEQE 4M4RB 4Q6IC 2QDWA 4YIQA 2Y1VA 4NCC2 3BUBA 1JNNH 4JW3A 3HC4L 4N2NA 3KGRA 4NC2B 1G6RL 2AMUA 4CADA 3MRDB 1UA7A 2WVVA 2IH9A 5BRZA 3LPFA 3K91A 3BDBA 4PTTA 4O2FB 3BQUA 2G2RA 1SVZA 5A2BA 1AE6L 4B96A 4TPRH 5CLZA 1AZVA 1QHQA 1VJSA 2W91A 2X4TB 5KSUB 1OAUL 1DQVA 1W6WA 2FYYB 1T0MB 4ORGA 1J9SA 1FG9C 1I3RB 3CX5K 4FNLH 4KXBA 4E9QA 2BSSB 3T0AA 2MPAL 3AMKA 1CDHA 2NYYC 3NFNA 2XZAH 4QT5B 1KCRH 3K81A 2WWNA 4X6DA 2HX8A 2CZNA 1R3JA 4ONHB 1HWHB 2DJMA 1DN0A 1AI1H 4YMPA 3RHWK 2IALB 4TOYH 1J8HA 3ET9F 5A6IA 4LCWE 4LLWB 5JTWA 3BJLA 2XZZA 3NIFE 4RBPK 5E5RB 4Z7NE 3VXMD 4AMKH 3I85A 2O6CA 5DEGB 2X0WA 3ABKB 3ZE0E 5HVFB 4QWWD 3QORA 2NW3B 1VDGA 1G9NC 3PGDA 4OLYH 4Y7OC 2DBJA 3EOBA 1BX2B 1ZLWH 3SYCA 2LR4A 3TJEL 4M7KH 1DQQA 1Z5LB 4U6TA 3UYPA 4LCWB 4UI2A 5D2LB 2WAQA 5CEYA 3LZQA 5C0FB 1CZ8H 3I9GH 5T3XL 1D7CA 4PS3A 2ITDA 1AOZA 2FWSA 1CFQB 2VLLB 3MTRA 5F3FA 2IGTA 2HVJA 4P5MA 3BIKA 1MCBA 3BIKB 4P5MB 1S9XB 2A6JB 4ZAKA 3O2VL 3KYMB 2C9PA 3Q8CA 1D5BB 2ICWI 2FECI 1N19A 4W9JC 3TZVB 4J23A 4LKCA 4KMQA 5FGBA 2DIJA 5LCVA 1G7LA 5I1HL 1X6NA 5CEYB 4JJHA 1OCOB 4WEMB 4NWTH 1RUML 2EYRA 3EYUL 4M6NL 2PWHA 3QEGL 3EOBB 4FZEL 1JVKA 4PBDA 5G4OA 4ELME 1KXVA 4UIKL 4NKIL 4BZ1A 2NW3A 3PHOA 4MNQB 3MROA 3OPUA 2HCZX 5HJ3B 2K0RA 4XC3L 3M07A 4I7ZC 1WT5A 1WIUA 1H3PH 3QQ3B 1JPFA 5HDLA 4YAQA 4JO4H 3DUSA 1PNDA 1FORH 1UM6H 2PW2A 3US1A 3LPOA 4UNUA 3VXSD 2XXCB 4OZ4A 5GSRB 2XKSA 1IM3D 4P5RA 1DL7H 3QWQB 5EEWA 1ZVSB 3QZWA 1DO5A 1VERA 5JHDE 3FQWA 3P0YL 2BHZA 3O9WA 4KAQH 4LGRB 1OP9A 4UIMA 2ZOWA 4HK0B 1AKPA 2E74C 3CX5J 5C6TL 4XCNB 4G9FA 4HWEL 1QLEB 1IC4H 3UAEA 3G5YA 4R97B 4QYOA 3TXAA 5JMRA 1D3CA 4Y5VB 5TH2A 4I5BA 4CVZB 1ZHKB 2RQ8A 3LXAA 1OM3L 4C56D 1I1AA 1I53A 2WWKO 4GKNA 4NB7A 4FFZA 4WFGE 5C0IB 2YJLA 4DPBX 4YIQB 4QOKE 4ZFOB 1T03L 1ZLEA 4BWUA 2E6PA 2ZZUT 3HUJB 3V6OA 4FRWA 4PJ5D 4PGEB 3W0WD 3Q06A 1F1GA 1AYOA 2D31A 1MCPL 1DO6A 4Y4HB 3P3RA 1JXFA 2DW5A 1YN7B 1IX2A 3QEGH 2R69H 3MCG1 2PCFB 1EAPA 2V3DA 4V2BA 4ZOAA 5DQJB 4O2CA 5AALA 3RBSA 2OYPA 2I07A 4YZFF 5T5NF 2PXYA 1GGYA 3NJMA 2H9GA 1OT1A 4X6BB 3RWEB 2EXTA 3IJ7A 2Y1YA 3QPKA 4UM8B 2P8LB 3ZKXB 5MEQB 2ZICA 4BQ6A 2OULB 1IC4L 3EGXB 3HVNA 1WCBA 1RIUL 1K4DA 4BJLA 3UGXA 2V17H 2DWEB 1UWEL 1CVRA 1CIUA 3MRIB 1MFEH 3GBNH 1UWGL 3KS0H 5IV2A 1H5BA 3G04A 3V4PB 4JUTA 2ICEB 3VD4A 2QQNH 1OAZH 1EMTH 4HCGA 4NZTH 4IU2A 4B97A 4RGOL 1X7SA 2J88L 3I84A 2YRBA 3NIFF 4GAGH 4UYPA 2GJ6D 4G80A 2GABA 3KBFA 3OJ2C 4YHOL 1PIGA 1IM9A 1OGAA 3CFBA 1KJ3H 4UZSA 4A2MA 1UM6L 1P7QA 2NNAA 3CC5A 5DJ6B 4G72B 2N7AA 3II1A 2VRQA 3GFUA 4U6YB 3WYRA 2YK1H 3N0AA 3HN8A 4EI5A 3P77A 2ZAHA 1CYGA 2HT2D 3BH4A 3CMOH 3HE7A 5TE7L 1OHQA 2AV7B 5FV2A 4XNZC 5I1GL 3SDYH 4NO3B 5D7LD 1IBHA 3RPIB 1KIRB 3U48A 5B7EA 5JOEA 1M6UA 1XF1A 3HI6H 3ARWA 3VFVB 4XTRC 4QRPE 4KNSA 4QXUH 1QR1B 4NN5B 2X4PB 3QRFM 4GP5B 3CSGA 3W39B 4P2RE 3GB7B 4JKWA 3GLZA 1YQVH 4PJ8A 1P5VB 4HH8A 3TVMA 2Z7ZA 5LNDA 5DZVA 3NACL 5FYKU 3CHOA 1E0OB 2YUZA 4UT7L 1GGBH 1JNNL 3WUWA 5HDBF 4Y5YA 1ETB1 1R5IA 3MKGA 2DQEL 4AM0B 3OSVA 3TIEB 4FKKA 1R24A 5D7LB 6FABH 3EZ8A 1FIGH 5FCSH 2WHVA 3MA9L 1TJGH 3KLLA 3WL9A 4P46A 4LL9A 5K39B 1CLCA 4LU5H 4OCXL 3QJFB 4XBPB 1T1XB 2BNRD 3D39A 1T2QL 1JGDA 1FWXA 4YWGL 5JORB 4WUUB 2XETA 5F8RC 2GW5A 2GBTA 3CXHJ 4BZ1H 1U21A 3OJDA 3CQFA 2WWKT 4ZBJA 5HTSA 3V5DA 1NANH 3IJHB 4TUJA 2H1LM 3QDJD 2FO8A 4GUCA 1XX9C 2JQZA 2A0LD 1I1YB 2DDQL 4N8CL 3LDBC 5DZAA 1S7QA 3O6KH 3O4OB 4IEFB 4DESA 1ZD6A 2FWUA 4KZCA 1KPUB 1NPUA 4YHPA 3LKOB 1EXGA 1KENH 2R23B 2BVYA 5EBWA 3ENEA 3BQUC 3IGLA 4P06A 4I0PA 5AW0B 6PAZA 1RHFA 4PJXA 3WIAA 1OCCB 3N3EA 5IM7B 3P0GB 3ZL4L 1YMMD 4YDLB 3HZMA 3MMEB 1NBZB 1YEGL 2K7QA 1HK6A 4LT7A 2Q2LA 4QHNA 2VWEE 4TM9A 2VR8A 3SBRA 1KMGA 4HZAA 4EBQH 3JXAA 4XRCA 3T6WA 4TQHA 5GGSY 4JVPA 5LJYH 1RKRA 3LKPA 1U8NA 3V7AG 3S6CA 3VRJB 1QRNA 4MJHA 4YX2L 1E28A 3HFMH 3NJJA 1W72B 2LGNA 4M93C 4PJ9B 1DFXA 2C4FT 4OLXL 2FHFA 1C5CL 3EDKA 4GW5A 4R5VA 2PNDA 2ZG3A 2IH1B 4WUUD 4JFSA 4A55A 1YNLH 2E4TA 1Z9SA 5FECA 2NPLX 4B9YA 1U8QB 5IJVB 2VITB 3O45B 5D6CA 4M4PA 5IMKB 2CG9X 3FB7A 5IOPB 4MB4A 4PVBA 2KZWA 3I6GA 4AGOA 4BSVA 4HIIB 2PWEA 5M94B 5D71H 5GPRA 3K4ZA 4WKZB 1DLHB 2DYPB 3L2MA 3JSSA 2WQWA 2GC4C 5MP6H 1K8DB 4ONGH 1KG0B 5KAQF 1A65A 5B22A 3EFFB 4L8SB 2AGJH 3UZVA 5I15L 2XZCH 3CFJA 1OCRB 2RAMA 1F4WL 2OW7A 2A9ML 4NX0A 1YVLA 1R3IH 3FRPA 3EO1B 4F7TA 1R3LB 3UBFA 1JBJA 3B9AA 3QRGH 3MUHL 4ZFQA 3PP3H 1CUOA 2CA3A 5KVFE 2WZPA 2JJTC 2WTOA 4GQ9H 5GGRB 4AZ8B 4UT9H 4LSUL 4YC2C 3P9WB 1CTNA 5DD1L 3GMRB 2H0FA 4R90L 3MRRA 4POYA 3FB5B 3FYIB 4F91B 4IOSD 4Y2DD 5J57B 1LJMA 1CYWA 3WIHL 4JFEE 4FX5A 5CR1A 4XO8A 1AXSB 4HF5H 5I0DA 2NXYB 1QFHA 2QKSA 3VRLE 3BE1H 3TX4A 1IU1A 4NO0D 4K9EC 4WW2C 4MZRA 5C8JB 5IJDC 3AG3B 2YRLA 3L2LA 5CM1A 4OGQC 1AZZC 1TNMA 1P1VA 3F7VA 3O3EB 1FV1A 2HSIA 3GSVB 2ARWA 1N59B 2WXKA 4M1GH 1E9PA 1GAFL 4HXBL 1LDSA 1YJDH 1CG9A 1EGJH 1FGVL 4ACTA 5IW6A 3FUDA 1EJOL 3CSBA 4AV5A 1QD0A 1CGXA 1RFDL 2WNKA 3BT2L 4OV5B 3B9VA 1AXTH 3TNNB 1PVHA 1QTYT 4HCRL 4RZKA 2VLKA 1MN4A 1FP5A 2K9UA 5IMLB 1YZZA 3KG5A 1TFHA 2FE0A 2Z93A 4U6XA 4HWUA 3OG4B 4AQAB 1YAIA 3QIWA 3IMRA 4G6AC 5ICZB 4FTVB 3DIVA 3Q5OA 5EU6A 2V8MA 4UTCA 3HZ3A 4PBVC 3GZOA 1AD0B 4X5XA 1J48A 1M7IA 3ULUC 4TVSa 4YPGA 4FFVC 3PWPA 5EOQH 3U25A 2ROYA 3ZN6A 4R4FH 3VXME 2YC1A 2OSXA 4OZHB 1MWOA 5PCYA 3MLVH 4V33A 5C09D 4P04A 3OQ3B 1MREL 3UYRH 1BQHA 4O5LH 4XCFH 2AXGA 4OFVA 3GM8A 2Q8AH 2Y1AA 1LILA 2B1HH 3EFDH 5DR5H 2VJ8A 5LGKA 3DVFA 3VFPB 5F7HA 1O7DE 1AZCA 3R06B 3QCVH 4HFWB 1QSFB 3X3GH 2VMFA 2DWYA 3CLWA 3VU1A 1KCLA 1ACZA 3IF1A 1JXJA 4X5RA 5GRVK 3KYAA 1FH5H 4GP4B 3TCXA 4PEEA 3MV7E 3RTQD 2DV6A 4MD4B 1JHKL 5TE6H 4DCQB 4PJDB 1PZDA 4MS6A 3DPBB 1S7VA 1NC4D 4L4VD 3JWNC 2CK0L 4PUBL 4GAJL 4L3CB 5CN3A 1O6SB 3WKQA 2AV1B 5IB5B 3KXFB 1J7VR 3GMQB 1WIPA 5B1BB 2YJQA 1CLYH 2PCXA 4H1LG 3IJSB 5C0ND 3RGBA 4ADJA 5KS9E 3W82A 4L3AA 1RULL 3G5VB 5KSVB 3RDTC 1PD0A 1UEYA 4LCYB 5GRXG 2AK1L 2FGZA 4H7VA 4HJJH 1YYLH 2F53D 2ILLA 1UXMA 4KV5F 5LQBL 2ZX8A 2R0KH 2EDXA 3JZ7A 2D7MA 4R83A 1L5GB 4A6YL 2H5UA 2KUTA 1HT6A 4CAGA 4PH8A 2WXMA 4FNPA 4HZ1A 4M3KB 1GJWA 1C8PA 1AGCA 4QCIB 1MEXL 4WO4A 2WOYA 1DFBH 4I18C 3AB0B 1N70A 1FDLH 5I6OA 2ZQKA 25C8H 2D3NA 5EORH 5A7EA 4JY6A 2A6DB 2BWIA 2GEEA 5A40E 3FFCD 3L08A 1RUAL 1SHSA 4LNRB 1RZJH 1JFQH 4B5ZA 4LLQB 4PY8I 5BRQA 2OI9C 1M7DB 2EKJA 2OMUA 3FQ2A 5JIDA 2XCMC 1DBBL 4KVPA 1CI5A 4H40A 4PB9H 4QTHA 1LO2L 1QR4A 4AYBA 1C08B 3KPRA 4GRMA 1F56A 1NCBH 1PZ5A 1U58B 1RHHA 1UD3A 1ZT7A 2WVUA 4U1NA 5CP3H 3QVAA 1XMWA 1AC0A 5GGVH 1A14L 2C9SA 3UBHA 4O58H 4DVRH 5IK3A 5B7MA 1FVCB 5LB1A 1A4BA 5CZRA 2FSDA 1OOAA 3BP5A 5E5MB 3SKNA 2B7DT 4AQ1B 3EO9H 2PYEB 4EOWH 2CLRA 3P2BA 5DS8B 3CVIH 3MVSA 2E59A 4A39A 5I30H 3OKMB 3B8YA 1PNCA 4XO3A 3N43F 2VXQH 1RL1A 3L4YA 4GEIA 3S3CB 3WLBB 2FEJA 4Q6KA 1HHHA 3IRPX 3PL6A 3TO4A 5I28A 3D2TA 2WBJB 3Q44A 4PTUB 5DVKA 3FU7A 1FYTD 2XWZA 4QKXB 3FL7A 3CDGB 4AC2A 1CO1A 2NY4B 4PGDB 4ZUTB 5E23A 2NY1D 3HBGA 1CICC 1LMIA 4FNUA 1ZLWK 2QDVA 4U1KB 4JG5A 1NCCL 1OO2A 1SY6H 2ATPA 1CXLA 4ZUWA 2QADD 4I3GA 4KV5E 4J3WA 5CEXA 1BSIA 3QZWG 4Z7WF 1FL5A 4KFMA 5HDQL 4F8OA 3GTVA 5KBPA 3E8UL 5GIRA 4BK5A 1T20B 2GJ6E 3E0GA 2JB6B 3OV6A 4PPTA 3K8MA 5HHQA 2ZWNA 5F0PB 3EYSL 2DLGA 4LKXA 2BWDA 3OLDA 3BD4A 2PPFA 4UU9A 4Y9EA 3AM8A 2OMZA 5DS1A 4G43A 5EEXA 4WI6A 1AIZA 1BVZA 4G6JH 1PY9A 2Z4QB 3SYOA 4DP2X 2GSIA 3T6VA 3VD5A 4DGYH 1KY7A 2A1WL 2Z1PA 3DECA 2DJ4A 3SQBA 4M5TA 2FBJL 5T1DH 2GQHA 2IAND 4J2QA 2X41A 1JK9B 1DEDA 3L7EA 4BGDA 2LLGA 3AQDA 4F33A 3SHSA 4DOHB 5DMIL 2R7EA 4UCFA 4TTDD 4XAKD 4WTQA 4CSSA 3QIBC 2AEPL 3CXDL 2AI0L 4JZNA 3HG2A 1LK2A 4MLSA 4L2LA 1A2YA 2D4DA 2K6WA 2VDQH 3BDXA 4C54A 1RZPA 2ENJA 1MCFA 2VDOH 5I1JH 2GC7C 1ZT4A 4NNXA 4MQXD 4IRJB 4NO0B 1OWRM 1KBKA 4Y2NA 2HT2C 5BRPA 5KVGE 3IDYB 3IMSA 2FH6A 4H8PA 3T4AC 1WTLA 4H0GA 3PJNA 3NFSL 4LQFH 4PSRA 2OJZL 4N0YH 1ERNA 2R15A 1MCWM 1A6VH 4K8RD 2J43A 4FZ8L 2H3KA 5DVNA 4HQQH 2ZCKH 4B50A 2MOQA 4Z7NB 5AFAA 5F3HB 2H1PL 4URKA 2HFFB 1PSKL 1EBAA 4G8GE 3IDYC 3L9EA 4S1DD 2MCPL 1NGPL 4LVNB 2RIKA 2OMWA 2EDJA 2VLRB 2XWTA 3PU7A 5DD5L 4Q6IB 1ZEAL 4LSTH 4NUPA 3ATAA 5LGHH 4ODXB 4LPXA 3MV8B 5DJ2A 2X1WL 1AHMA 3QBTB 1F4XL 1P6AB 3HBZA 3V6OE 4RQQA 1RK0A 4LLVA 3OR7B 1S78C 3P11H 3WNOA