2EUZA

Structure of a ndt80-dna complex (mse mutant mc5t)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*TP*AP*AP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 84
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euzA00
2EVIA 2EVGA 1M6UA 2EUXA 2EUVA 1MN4A 2EVJA 1MNNA 2ETWA 1M7UA 2EVHA 2EUZA 2EVFA 2EUWA
chains in the Genus database with same CATH superfamily
3QXAB 5G4MA 5LN4A 1YHPA 1L3WA 4JDEB 3AUWB 2HTKC 1P69B 1WD9A 2BSRB 1E42A 1FZKA 5I0YA 1LJMA 1YSOA 1JUFB 3FPYA 4U1JA 4WWID 2EC9U 4XBGB 4GP4B 4R7NA 4BSWA 2EDWA 3HAEB 2IWFA 3OTTA 5F7WC 3O4LB 3KPOB 1UCBL 3ETBJ 3LKOB 1HE8A 4ZUUA 5ISZA 3RWJB 1D3CA 4UWQB 1YEJL 1YUKB 2A4CA 4NIYE 4BCXA 4PJXB 3MRNA 5JXAL 2VW4A 2WTPA 2AW2A 2AK4A 4RCAA 3D07A 2IQ9H 3VO0A 3S97C 2I07B 3U0TA 2Y07H 3RY6C 5KJ7E 1CFMA 5GS0L 3L4WA 1A7RH 1I7UA 2MTAA 1QFOA 4O02A 3ZRFC 4IRZA 1G0XA 3T77B 2R1WB 1GJWA 5D71H 1FA4A 4PJ9C 2YBGA 2ZKXA 3KNBA 4J6RL 5F3HA 1EMTL 1NCCH 5A1AA 3IB4A 3BE1L 3QDJB 1B90A 4ZSOA 3LNIA 3MR9B 4YHYB 3Q7JA 4HIXH 4JQVA 1D5ZB 3IFNL 1JYNA 3TO4A 3VD4A 1QSEE 2DQCH 3K1KC 4KXAA 1QBML 1T0MB 4H2AA 2C1OB 1R3JB 3L3KB 4D7BA 1SHMA 1KGCE 4IU2A 3HZMB 4KVCL 3UG5A 5I1KL 1EHAA 2K8QA 1BZ7B 1U2CA 3D39E 4XZ4A 3B9VA 2V7HA 4L8BB 3M1OA 5EOCH 3GKWL 4EAEA 5ABDE 4GXVL 2HAZA 3LQAC 1J05B 1QW8A 3AUVA 1BJ1J 5BRZA 1U58B 5EO1B 2DEYX 1FH2A 2BHZA 3W1ZA 4JR9H 2G0LA 2HX7A 2WTRA 3MJ9H 4XP4H 3TBYA 4BCYA 4YK4C 5HDBF 2JFCA 4X9GA 4IBWA 2QADB 1JFHA 3OZKA 3QIWC 1JJUA 1OM9A 4IBLT 3PJSA 4NPYB 1EEZB 3S8FB 1X7TA 1CI3M 5JPNB 2ADIB 5EUOF 3A4AA 1BD2E 1M9SA 3VFOA 1FGNH 2MPAH 3IDIB 5DHXB 5HHMB 4WU7B 1A7PL 3E0GA 4G8EA 2B4CC 2Z92B 3VXUE 4OCXL 3VFTA 4ONOA 2BERA 3K2UL 3QJOA 4K3JL 4AE1A 4X0NA 4AW7A 5CCGE 2N56A 4LEEA 3TBSB 3GHBH 3PNWB 4PS4H 1A21A 1SBSH 3K0WA 4JE0A 2XWCA 5HI4C 4BHUI 3DIVA 5J56B 2WKGA 1CR9H 5HVWA 4PJ9D 3FDWA 5T1MA 5I18H 1VKXA 3SCMB 3DYPA 2HX8A 3LKNA 4WJKB 4OCWL 1LMIA 4TNVF 3T09A 5DEGB 3KWTA 4NCC2 4NAJA 5J6HA 4Y9FA 1DVYA 2AGJH 1WZMA 4I4WB 5IY5B 4RAUB 5LB1A 3EBAA 4ZTPL 1Q72H 5CJQL 2ZXGA 1RP8A 5GS1C 4WI4A 3WBDA 3SKJH 1ACCA 2WUCH 4RGOH 4H26A 2VDOH 3T0EC 3B1TA 4QHNB 3KE0A 4ZX4A 5IW1A 5EEYA 4YZFE 1BWMA 1FNGB 2A9ML 3UTPE 5GRVK 1E4KC 3F8UB 3L5XL 3DVNB 4FQXC 1OOWA 3QNYA 4KRLB 1O7SA 1HJBC 3AG3B 1AQKL 5E8OA 4AQ1B 4N2HA 3CFDA 3RWFB 1R24B 3I6KA 3G6AA 4G8IA 1GTFA 2ZWLT 3N42B 1A7NL 3QIWD 1RZFH 2LTQB 1IC7L 2HG5A 2QT6A 3ARPA 3QUKA 2VZVA 1F4YH 1LWJA 3ALWA 4AKPA 3EDJA 4HOMA 3ARDB 3LIZL 1M7UA 1W6WA 3V5KA 3NYKA 1JV5B 4YFLF 3FQTA 5A2CA 3HKZA 4M56A 4DP2X 5C0DB 4DGIH 1JZIA 3V6ZB 2H6PB 1RU9H 2CH8A 3P3UA 3K5SA 1FH5L 3P4LA 3UJIH 4YBQC 4NQDD 1MVFA 1E4XH 2X1WL 3F7QA 3FB5A 3S37H 3V2AR 3TT1L 3TEYA 1RJLB 4UUJB 1U8JA 1F90H 2BIOA 1WEJL 1L6ZA 1KCUH 3G6DH 5DRNA 3B6SA 4XCFL 5H37A 3ULVL 3EXLA 3SN6N 3CPUA 3GBML 1HHIA 1HOCA 2K7QA 1L5GB 2BVUA 2KDGA 3GBEA 2C3XA 4P9HH 5KSBA 2W9EH 3IJEB 1J5OH 2OXGA 2OI9B 5C0FB 2D7OA 3CN4A 3T0ED 1G9HA 1GCYA 4JY4A 5D7EA 1V7MH 3EOAB 3SO3B 3VXRA 2MQ0A 3II3A 3WXVL 1CVSC 3KR3L 4W9FC 3FSVA 4IHOA 4Z3EA 1IEAB 5KYWA 3MLYH 4FQXD 3CIAA 5CCKH 2HN7A 5TQ2L 2XY2A 2LU7A 3QISA 4MJ2A 1GZQB 1UACL 2YXMA 2BNQD 4KXCA 4N0CD 1AGCB 3GTVA 4POZC 5FV1L 2CLVB 3MU3A 1FVCA 1YRKA 3BZDA 2CHZA 3SGKA 2V9QA 5CS7A 4IRSD 1T7XA 1IBDA 4WWKB 1H9DA 1UWXH 4N2OA 1MHHB 4DQOH 1T2QH 2NNXA 5F7EH 5BV7B 1U8MA 3HB3C 1TKWA 4G1MB 2Q9OA 3MA9H 4LNRB 5CEYB 1GZHA 1P9MA 2CO6A 4L1BA 5D1ZA 5DO2C 2H1XA 4NQVA 5BXFA 4MXQC 3BMWA 3FO0H 5BQDA 2A77L 2OMNA 1UM6L 5GZOC 3WIHL 1N10A 4G6FD 4PCKA 4XPAH 3ZDZF 3EHBB 4TM9A 4EUPH 1NCWL 3WKML 4CNIA 2IALB 5FUCE 3LN5A 5IB1A 5ADPL 4YBQD 5E2VL 4ADIA 5JW4M 3BKCL 4W9HC 3BJ91 2V33A 2AEWA 2ZD0A 2QVIA 3F5WA 3QRFM 3BKMH 1NUNB 4LKXA 5HHNA 2AQNA 2NYKA 3KG5A 3GSNL 4Y5YB 5FO7B 3DBXA 4AJWA 4M6ML 1GSKA 4AJVA 4XP6L 2HRGA 1AHWC 2WB1A 2H5UA 4QEGA 5DZNA 32C2A 2X09A 3WLWC 1AC0A 1PZDA 2FECL 3EFDL 4KDTC 2VC2B 4M48H 4XVJH 4UQ3A 4R83A 2UZYA 1MCCA 1FL3A 2GUYA 4Y9GA 1BF8A 3H9HB 4CADB 1YO4A 3CMOH 4PWIA 3CHPA 1L9QA 1XXFC 1XR8B 1AQMA 3C5ZC 3O2DH 2ICEC 3VGGA 4JO1H 2C7FA 1NBZB 1I9RL 4FFVD 4WTXA 4POZD 2NLJB 1PLGL 3FU7B 4L8SB 5DSCA 1TCMA 3PWLA 5TE6L 4PRID 4KKLC 3RUGB 2X2UA 4HJEA 2AEIT 4WJ5B 5F9JA 4BKTC 3HHSB 2X1QA 3HB3D 3X3FH 2O1AA 3ZDYF 3FB6A 4M4RB 3GI9L 5DO2D 4HJGA 4MXQD 4O58H 3QQXA 5LGHH 3FUMA 4HOZA 3OF6A 5EB9A 1LWRA 1VFBA 4HH9B 1IAOA 4LHUB 4P5RA 2OMXB 4GP8B 2XNAB 3MKGA 2F53E 3LAFA 2DZEA 3OKMA 1AHMA 2DM4A 3LXAA 4HF5H 1EEYA 1YNTB 2AJVL 1AQDB 4YHNA 4ZD3H 2HJFB 3GQFA 4BZ2H 4N26A 1MHCB 2WUBH 3U6XS 3LB6C 3N50A 2ZSWA 5IHWA 3AC0A 3CVHB 3K7UA 1YEWA 5SX4I 5ADOL 4BH7A 1WWAX 3KH3A 4MLSA 5INCB 4KKCD 3FS9A 4JVPA 2IMNA 4DERA 2BP5M 2J1ZA 3PHOB 3NEEA 4FXGB 1XBDA 4Q6IC 5JXEA 3MJ8B 5EA0H 2W65B 5IJCC 5K1NA 5IHBA 1GS7A 3ZHFA 5DJYA 4X4YB 4M9OA 3PWPA 5BS0D 1T3FA 4Z7QB 4KK6C 1FCCA 4A37A 1P6FA 4R90L 3E8UH 4LARL 1YMMD 3RTQB 1HJCA 1OAXH 2HJLA 1YEFH 2IV8A 3P9WB 4NUJB 4DK3A 2AHIA 1SFHA 2UXTA 5J9PB 3C5ZD 1TTUA 2G5RA 4PJGF 2WSPA 3FJTA 5E9DD 3VTTA 1GAFL 3VAEA 3P11H 4XOBA 5I1AA 1RMFL 2R0WH 3SDDC 4KZEH 3HC3H 5FYKH 1A6PA 4JN2A 5EV7A 1NBCA 4GAGH 3MRJA 1UZ6F 4A7GF 4NQDE 3AQDA 1CBVH 4KKLD 4P8QA 5KAQF 4BQ9A 2UVEA 4FADA 1F86A 1ZHKB 2F7RA 2R51A 4FQCL 4ACTA 2HJKB 2KZBA 4G9FD 1NCIA 4HIHB 5ALCL 1Z6JT 4OV5A 1NGWB 3WO4C 1JYWA 4P2YA 5A7BA 5F7AA 1R34A 2NY5H 2X1OA 3TYFB 2R0KL 1N5AA 4LPCA 4F9LA 1VDGA 2AABH 4PTUB 3KPSA 3SBRA 2LU5A 2ICCA 4Z0XB 5DJZB 2N7AA 5F8QC 4FMFA 1EVUA 3T0EE 2OTWA 2WP3O 2ENQA 3LB6D 3EBHA 4ODWB 4PJBE 2XZZA 2EXYC 2XWJA 3ZGHA 1FN4B 1HC1A 1KC5L 5CD3A 4XNMA 4DGYL 1MEXL 3G6JA 4TSCL 1NDMA 2Y7MA 3QPQD 4CGTA 5LWYL 3MLWL 4FGMA 4NN6C 1P1ZA 1SJHB 2QSTA 4MVBC 5FO9A 3SYPA 4ELMB 2LR4A 4X6EB 3VYOA 2VSKB 3N3EA 2HRPL 3REVB 1GH7A 3IXAB 4CSZA 1KWGA 1TQBB 2C9PA 1FNHA 3CGTA 1R3IL 3CZJA 4R5TA 1U3HC 4GO6B 4KK6D 2OX5B 4O2CB 4M43L 1TYEB 2R1YA 1EZVX 3CSFA 4KY1H 4KNTA 4UT6A 3P0VL 2L4OA 1NGXB 2XCMC 4KNSA 2WMPA 2PF6A 2ZAGA 4JUSA 1IGMH 2WWNA 3GINA 1G0DA 4CDGC 1MJ8H 1O9VA 3MBXH 3ULVF 3FC8A 1QWUA 2NNAA 2VDPH 3ULAB 5AVRB 4U1NA 2PW2A 5HGAB 3B7YA 3U30C 4W93A 5FDWB 2WN2A 5D4JA 3BEVB 3PGDA 2BC4A 3MLXH 4GRLC 3KH4A 1SEBB 1F97A 1D6VL 3GMPB 2P8LB 5EHFA 5FYKU 4DQAA 4LE8A 3FYEB 4PGZA 1BBJA 1OLZA 4L4TE 3MREA 4XMKH 1FG9C 1OWRM 3QCVL 4JRLA 1D5MA 4WSKA 5DK2A 1QRNE 3HNVH 3DJTA 3H55A 4ILDA 2VLJA 3IMBA 1E27A 1ZPUA 4TSBH 3VGEA 2NZIA 2YD1A 1BFOA 2BNRD 3DVGB 4MAUL 4OFQA 1QMUA 5I8OL 1QKZL 4Y5VB 1WVZA 4G8AC 1XGZA 4AV5A 4YSQA 5L88H 3A67H 5JQ6H 4YPJA 1A6AA 4FABL 5MEOA 1U91B 2V5YA 2W59A 2NX5A 4ZXBB 1U8OA 2X53A 4Y2OB 2AJZA 2MQ3A 4XNYH 3GB7A 1HCFX 2CBQA 4QHMB 4Z18A 4YHOL 2YSSA 3BX7C 1YN6A 3BDYL 4NNXA 3PDDA 3IS1X 4GXUN 5TE7H 1U3HD 1T0NB 2A2QT 3N43B 3UL4A 2IXQB 1UZ8A 2FQDA 2ZOTA 3MV7A 3D6GA 4G71B 2X4UA 4PRIE 5LN8A 2KZWA 1M7DA 4P46C 4HOXA 3WGUB 2ZUUA 1AGFB 4WO4A 5L2KB 1BX2B 4FTDA 4DOHB 1F3JB 5FO8B 3CZGA 3NSJA 4OGXH 4RMUA 1AZNA 2CA4A 2FL5A 4U1GB 3QT2A 5KYXA 1ZLWK 3C6LB 4BWWA 4FNUA 2E6QA 2FD6H 3L5IA 1G6RA 2EKSA 3SDCA 1FSKB 3FQWA 1EX0A 4ZO6A 1C8PA 1E4XI 2XZCH 4GRLD 5HJ3B 4OCRL 3D2UD 2QSCH 3EDFA 1AO7A 2Q20A 4WW2F 2F74A 4FP8H 4BIKA 3EBGA 3D0VA 3OXRB 1MJUH 3TONA 3FSOA 2G2RA 4NUGL 4P2OC 1KB5B 1URIA 1PNCA 2OMVB 2VKWA 1RZPA 3OQRA 4QUOA 1EUTA 4DO6A 3G5YA 1QA9A 5GGSY 4TUUA 3WNJA 4R7DA 2Z7YA 2ZCKL 1HQ4B 1NTDA 1SM3H 1XCWA 1IKNC 1B0GA 2GFBA 4UV4H 2F5BH 4Y9BA 2APSA 1YMME 3MAWA 2ATAA 3V0IA 4OCYH 3WYRA 1U95B 3PDOB 5EIIG 5EN2B 4F7PA 1PX3A 1W0VB 3RDJA 3F58L 1X9UA 3NMEA 1QLEH 3D5OF 2BCKB 4WI0A 4XB3A 5E9DE 3X3GL 1BAFH 5E99H 3WNNA 1RULL 4F8TA 4ZX3A 5GGTA 5I19L 5ID0A 1FZOA 1MAKA 3EZJB 5K69A 5IIEA 4GG8B 2H1LM 2PUQT 3FFCA 3MCLH 5EU5B 3ZR5A 3W56A 4QF1A 1FL6A 4S1RL 4XNXH 5HDLA 4F37F 4EN3A 2NW2B 2VLKA 4P46D 3DHUA 5F7UA 3QRGL 4AMKL 3B5GA 3IDJB 2NY0C 5IJVB 5J12C 1UH3A 4DKAA 4G9FE 1ZEAL 3UTOA 4OIAA 4JDEA 2MCG1 5AB2A 3BIAX 4Q4EA 2CNYA 3QYCA 4XO4A 5B7MA 1F18A 3AY4C 1S7WA 2BSRA 4RBPH 2AEOA 2V8LA 3ZTNL 4NN7C 1JUFA 4L9LB 4XBGA 2ZKMX 2VDLB 2UUDK 3HAEA 3IU4L 5IUSA 1YEJH 4XMZA 4H13C 2IG2H 3O4LA 3KPOA 4WI2A 4TUOB 3LKOA 5BO1L 4A6YH 5JXAH 2OJZL 2OMZB 4K9EC 1RIVH 4P2OD 5TK2A 4PJXA 3IJ9A 3A22A 5GS0H 2FAUA 3BWUC 4MWFB 5KBMA 1CE6A 1T7VA 4K71C 2I07A 4XB8A 1M4KA 1H19A 1Q8MA 3DPBB 1ECZA 4FTVE 4J6RH 1EMTH 3RNQB 1XF5B 2Z3FA 1TSRA 1GYUA 2PMZA 3GUFA 3BE1H 4PD4K 1AZVA 4PJDE 3J7HA 3T77A 2R1WA 4QRBA 1NMCB 3IFNH 4R97B 3B4NA 2E7CA 3QDJA 4C54A 3INUL 3MR9A 2EYRB 2J20A 1D5ZA 5E7FA 1ID2A 4ONHB 1U2HA 4H1LG 4R26L 2HT4C 3DJRA 4JBSA 1T0MA 3KLLA 4KVCH 3T8VA 4ODUB 1F41A 2C1OA 1R3JA 1UXMA 3L3KA 5FYJL 5JMOC 1OB0A 2R29L 4AYFB 3HZMA 3L2NA 3MOAH 5D96C 2YLHA 1SY6L 2V2WB 4BA8A 5HHVL 3DJSA 4GXVH 4E0RB 1F3DH 4J2XA 1BZ7A 2EC8A 1SPDA 4L8BA 4IKJA 3HR6A 1J05A 2BO0A 5T3XD 2V9TA 4N68A 1KN4L 2JQMA 1U58A 2E6JA 1AKJB 3HFMH 4JZJA 4ZYKB 3M88A 3IXTA 2G60L 3PL6C 4ENEC 2ROYA 3PQYD 2BNRE 2APBA 2W0FA 3ILPB 3NT0A 3HE6B 1SLUA 1N6UA 4FFWC 1R5VB 3QDGD 3V9FA 4NPYA 1EEZA 1OW0C 3RVUC 3OAZH 5T33H 5JPNA 2ADIA 1WUNT 1SUJA 1UVQB 4AVKA 4AQZA 1E8WA 1MIEL 2ADGA 4HJTA 4UZUA 4DF9A 4UTBA 4RFNC 3NIDB 3IDIA 4FJ6A 1FP5A 5ESQB 1H8NA 2EQDA 3ESVF 3L3OC 4WU7A 2QVFB 4JPIB 2Z92A 4F8PA 1MRDH 2DQGL 1XH3B 2AQ3A 1WZAA 4JK0D 3S36X 4UQ2B 2XC8A 2HMID 3TBSA 1XEUA 3PNWA 1KYDA 1W0WA 4JAMB 4FFYA 4OV6F 4OCWH 3ZUCA 3BD4A 2AZAA 1Z5YD 5ACLA 3KHQA 2XHNA 5FGBA 3H4HA 1N8ZA 1WAPA 3SCMA 2ICWI 3LZRA 1QZNA 3FQXB 2BIPA 2JQAA 4ZTPH 5DEGA 1HHHB 5FO2A 2AKRB 4QHPA 5CJQH 2ZQKA 3R7RA 3UTQB 4I4WA 4K15A 4PJCB 4RAUA 5FM8A 1NFIB 1U21A 3WJLC 4MZ3A 2IOOA 4XPHL 2FJGB 1IRAY 1OT1A 3S3SA 1MFBH 3QUYB 2A9MH 3VWJC 2R59A 4NFBA 1RKRA 4OF3A 4QHNA 5DYOB 5G2NA 3ZE2B 3WNKA 4NFCA 4PJFF 1FNGA 1AQKH 3GLDA 2FT6A 5HHPB 3VX0A 2YBRB 3DVNA 1UWFA 2J55A 3DYOA 4LPXA 5I2IB 3D3VD 5D2LB 4AQ1A 4ZAKC 3N2JA 1A7NH 1R24A 3RWFA 1OE2A 4ENED 4ZNCD 1I1YB 2IIJA 3QCUL 3WMSA 4FFWD 1XX9C 1B4RA 2EIEA 3LIZH 5FFGA 2R83A 1XH1A 3RVUD 4I18C 2CUIA 2DMGA 4S10A 4XC3H 4JRYD 3QWRD 2NYZA 4LVHC 3DWTA 3ARDA 2P4AB 4XBEL 2D9CA 5DMJB 2NW3B 1JV5A 4F9PA 1QFUL 1CICB 2VRAA 4JN1H 5F89B 3VXSB 1CXLA 5C0DA 3UJTL 1KBPA 3V6ZA 4AIEA 3TT1H 4MMZC 2IAND 4M8QB 2LW3A 1GL4B 2N0MA 3HUJF 1HZKA 4N1EA 4XCFH 1JNLL 4UOW0 1RJLA 4UUJA 1G4MA 3F7KA 4QAMB 4EIUA 1PKQB 1RCYA 4Z3TA 3CXHJ 3W5MA 2F54D 3ULUC 3ZJAA 5K59F 2XTJC 3N9GL 1L5GA 5HP5A 1YPZF 3GJFH 3WXVH 3V0HA 3IJEA 2QVMA 3ASWA 3VWJD 5C0FA 3AG2B 5IFJB 1GW0A 3EOAA 5DEFB 5TQ2H 1NLBL 4PB0L 5TE4H 4IBUA 1USQA 5L2JB 4QXTB 5D7JC 1JG9A 1UACH 3ABGA 5F6HJ 1B0RB 3O6FC 3EOTL 3QS3A 4V2CB 1T83A 4ZAKD 3TURA 1GZQA 1AGCA 1DUYB 4P4KC 4J2QA 2CLVA 2D8KA 1NKRA 5T1LD 3VRLE 4FLHA 1RUML 3T2LA 4WWKA 1FG2B 4X2UA 1MHHA 5IVXE 3TTSA 1AJ7L 1GKEA 5CD5D 1I3RB 2CBTA 4NDMA 4G1MA 1FQ9C 2GQHA 4LNRA 4NQEB 5CEYA 3WIHH 2VCOA 4DUXA 3LN4A 1FHGA 4HK0B 1NCWH 1GKOA 2FYYB 3ZMEA 2VW6A 2QKSA 2NY3C 3HN8A 2GPZA 4L3CB 3P0GB 1MCNA 1TJGL 5E2VH 1CE1L 3BKCH 3WMQA 4LT7A 1CURA 1O7DC 3WHE0 2IALA 4HV8B 2MPVA 1TXKA 3V4PL 2O4EA 3NCJH 2CIIB 4C8XA 2F9BT 2WXGA 4YFLI 2P24B 3GSNH 3Q6GH 1KY7A 2XN0A 4R5XA 3ULUD 2J56A 4OW6A 4HXAL 4XP6H 5GZNA 3KWVA 5FO7A 4Y5YA 2XTJD 1WA2X 3MXWH 4YDLC 5JIKA 5JIHA 5T3XE 5LGJB 2DQEH 2XIDA 3G08A 1E8YA 1YC8A 3BCFA 4RZKA 1EFQA 3QIBB 3US9A 4IDJH 3STZB 4DK6A 2A9CA 5DVLA 3PQYE 1GA2A 2CDGB 3DSFL 4YFDB 1AXIB 3K74B 3QDGE 5HJBA 2EILB 3H8NA 1UH2A 4PJ7F 1IO4C 4NKMB 4LP8A 2YK1H 2XWRA 4CADA 5D7JD 1JZ2A 4KMTH 1XR8A 3HHMA 5I6NA 3O6FD 1SOKA 5DUBB 3RWIA 1G5GA 2CKBB 3CFIC 3OKOB 4IBZA 2CLRB 4PR5B 3TH4T 4ZNEA 1PLGH 3EJTA 5I30H 1NBZA 1V05A 3OKDB 4K7FB 4X98B 2NLJA 3FU7A 4L8SA 1KTJA 2D73A 3LSOB 1N2RB 3VG0L 3RUGA 1CL7L 1TG8A 2DPKA 4WJ5A 4EXPX 2DWXA 3HHSA 4B0MB 3D85B 1S9VA 4M4RA 4HX1B 1IZJA 1UB6B 4I0KA 4ANKA 5AL0A 5HY9B 3FU3A 1WUZA 2NY3D 3WE1A 5ICYB 3OV6A 4YE4L 4HH9A 1GOFA 4LHUA 3FBKA 2WD0A 2AJVH 2OMXA 4UAOC 1CS6A 2XNAA 3U1SL 3US1A 4M9PA 3QJVB 1JGLH 1WTLA 3ZIYA 3MA7B 5ADOH 1YNTA 1TZHB 1AQDA 2HJFA 1MHCA 3ETTA 5F71A 4E9SA 4CVUA 3Q8EA 3BYTA 4GG6E 1J1XL 1P4LA 5INCA 3BVWA 3KGUA 3QGVA 4YK4B 5E4IA 3PHOA 3D3VE 4FXGA 3TCXA 5E8PB 3MJ8A 5I6LA 2W65A 3H7BB 1BECA 3QIWB 4RA3A 4R90H 5F97E 1WGVA 4KKAC 4LARH 3BP4B 3RDTC 4X4YA 1J0IA 1L9TA 1X5FA 3W0WD 1F45A 3WOVA 3RKPA 3VWKC 4A38A 1R17A 3RTQA 4GUPB 4ELDA 5KJ4A 1GAFH 4JRYE 4NUJA 1A64A 1L9PA 2WLYA 1RMFH 5J9PA 2EKJA 1Z5LB 3L6FB 5IMMA 2KZKA 2GB2A 3EGSB 2UWEB 1NGQL 4NQDB 1A4JB 2Z34A 4WI9A 5JOPD 1XSIA 1GC1C 2IANE 3BYYA 3N0AA 1CFSB 3JWOC 3K81A 3RIKA 3SDAC 3LPFA 5ALCH 3ZYJA 1ZHKA 2JI2A 2N7SA 2VH5L 3MQIA 4MSWB 5TFSL 3MROB 3TJEL 1PNDA 3JT0A 4PBWD 2HJKA 2R0KH 4OR1A 5CEZL 2F54E 5DQJB 4GSXA 4HIHA 4KZ0A 3LPPA 1NGWA 2FX8H 5GS1B 4RX4D 1AXTL 4RGMC 2FUQA 3OPZH 3TYFA 3V4VL 5ANMB 4OCMC 3T0EB 2FH8A 4PTUA 5IVOA 2F5AL 1ZCRA 5BZDB 5I6PA 4Z0XA 4GLRI 5DJZA 3F05A 4FG4A 1NIFA 2YKKA 1KC5H 1Y0LB 4FQXB 1NWOA 3MTXA 4ODWA 4PI0A 4B96A 4DGYH 1KENL 1Z32X 3KCWA 5LWYH 3PAZA 4OQTA 1K5NB 1KJ3L 2BNQB 1HI6B 2HRPH 4Y8AA 3UROR 3I6GB 4D9RD 2VDNL 3II2A 1R3IH 1SJHA 3HBPA 2J6EH 4X6EA 4KKAD 5GJTL 4M43H 4AIZB 4R4BB 1T5WB 1JPTH 4MS8C 3BUQA 1TQCC 5LG1A 4EQ2A 4I1PA 1B0IA 1LO4H 1CLZL 3VWKD 2OX5A 4O2CA 1IBGH 1J87A 3HBQA 4HC1H 4PS3A 2XZAH 4BFEA 2LAAA 1FORH 1NGXA 5FYLD 4BK5C 4KDVA 4NSKB 5I15H 4TPRL 3GSUB 2C3GA 3QARA 3VE0B 4HZ1A 5HGAA 1G43A 3RZCD 2OKMA 3CDGB 1KGWA 5IVNA 1D6VH 2BIHA 1PFCA 3SDAD 3Q3GB 3BEVA 3N1PC 1MCDA 3BKJL 3GMPA 1BP3B 1RZKC 2P8LA 3QCVH 2YRBA 3MN8A 2RJMA 2YOAA 3U9WA 4F93B 2CG9X 3Q8AA 1PSKL 1JPST 2NPLX 2XTJE 3IPBA 3OKNB 4TNGA 3BSZH 5AB0A 4LL9A 1I1RA 3GPEA 1MXDA 4MAUH 3SPJA 4L8CB 5I8OH 2N7BA 1B2WH 3DTXB 1K2DB 1DUZA 3MV9B 4FABH 3DVGA 4JREC 4LIQL 1UD5A 4Y5VA 4JRXD 1OAQL 2B0SL 4LVEA 1N6QL 3GXMA 1EAJA 4BHUA 5JA9A 1U91A 3QXTA 4YHOH 1CIDA 2HH0L 4ZXBA 1MCLA 3BDYH 4Y2OA 5HBBA 2V3DA 2PCYA 3CXFA 2YPKB 2XA8H 3QC6X 4PWFA 4QHMA 3BAWA 1BM7A 3CH8A 2ENPA 3LS4L 1WCBB 2J8UE 2P43B 4MS8D 1J5IA 3O6KL 4EF3A 2V3EA 2O26U 3MRIB 5F7FA 3HB3B 1T0NA 3CXDH 2IXQA 3E1F1 1WBYB 4PI2A 2KPNA 3K4DA 1C5DB 5GQBA 1JPSL 3BUPA 2TRHA 4FL4B 1AGFA 1A6WL 1BX2A 5L2KA 1F3JA 5FO8A 3LH8A 4QT5B 4DP0X 1M42A 3PABB 3MOBL 2I69A 5FA3B 2HYMA 4HLZG 1HINL 1T7ZA 2C4FU 2XWDA 4BQBA 5JW4N 3C6LA 2KT6A 3JV4B 3QXVA 1UB5B 4IOFD 3EF4A 4LCWD 1AI1L 2X6UA 4WUUB 4OCRH 4BCZA 4M62L 2LU3A 4QRFA 5HJ3A 5EH1A 2A7BA 3MTRA 5CZXC 4BDVA 2GW5A 2VZTA 3UTSB 1T80A 3OXRA 4LOVA 4GI8A 1G9ML 4ZUVB 3T2OA 1AHWB 1OCOB 4Q58C 3H53A 2CO7A 1KB5A 4UT9A 4XCCL 4ATWA 4WTZG 2AMUA 1F42A 3WXWL 5BS0B 5DJ8B 3LXBA 2VUOA 5DJ0B 3FTXA 3W0WE 1HQ4A 5TPWH 4DEWA 1TDQA 3A6CL 3C5XA 3DIFB 1CQKA 3C5ZB 5I8CB 2JCWA 2ICEB 3X3GH 2P48B 4DUWA 2K7PA 1U95A 5EN2A 4KTDL 5EZLB 5I19H 1W0VA 5F7LB 1OE3A 3EYOB 4H7VA 1FO0B 2BCKA 4BSJA 4MMXC 1VHPA 4G7SB 4D3CL 4DP4X 4LDLB 3JVGA 4GG8A 1FIEA 4S1RH 1Q94B 2WZ6A 3QHFH 4EIBA 5JOPE 1PG7W 3BO8B 5EU6A 4CU7A 3QRGH 4N2KA 5DS8B 4MKTA 3MRFB 4NZUH 5EU5A 4AMKH 4RWHA 2YRLA 4TN9A 4WWNA 2HKHH 4JFQB 1KT2B 4EPSA 1EJOL 1ZEAH 2NW2A 2JV6A 3LD8C 4KO9A 4YVUA 3DECA 4KQ4H 5BQ7B 5KJRL 3IDJA 5IJVA 1OTUC 1A7QL 2LV4A 5GGVL 1CGUA 4NS0A 4Y16A 3VFSB 4AENB 3CFBB 3TLRA 4RFOL 4L23A 4BV1A 3L5WB 3LZNA 1XAUA 3VYPA 3IU4H 4XI5C 1A9EA 4PV9B 5SWSD 4L9LA 3EO1A 4GKOA 3WCYA 2OJZH 4P59L 4WK2B 4Z7WF 3CLEL 4OLUL 4TUOA 5CZXD 3U82B 3S2AA 4HSCX 2P47B 1FNFA 2OMZA 1ZSHA 5I66B 2X4QB 3T3MB 4W6XB 2B20A 4D9RE 4MWFA 3GRWA 5C07D 3VD3A 2FECI 3K80A 4AC4A 3KYKH 4IKKA 4OJFL 1GYVA 5AZEL 4U31A 5HJGA 4GT0A 3DPBA 1YNLH 2J12B 1DEEB 1XF5A 1NDGB 4EI0A 1WIPA 1PVHA 3INUH 2UV3A 3M46A 3NG5A 4GQ9L 3PWNB 4J3OF 5FYLE 4FF9A 3SDDB 1QUNB 4UQBA 2G2PA 2FNWA 2EYRA 3P4OB 4D9QD 2BM3A 3BFOA 3VD5A 1HWGB 3KS0H 5FYJH 4ZPVB 4ONHA 2R29H 1NIDA 5AKTA 2Q2LA 3LPWA 4LCCC 4X50A 3SGEI 4AUJA 3OWRA 1SY6H 1PZ3A 2HLAA 3HPLB 2R23B 4FNRA 4GAJL 4ODUA 1MF2H 1C8QA 2DM7A 5C08E 4AYFA 2E47A 4KMLB 4MMYB 2ITFA 2CWRA 1M53A 2V2WA 4K7PL 4E0RA 4KHXL 3WO4B 2FEDC 1OTUD 5AG8A 1KN4H 1XL6A 5HYEA 1S7RB 1QATA 2QVKA 2J8HA 3IJHB 4WGVB 1A02N 4HCRA 3TJHD 5K93A 1BZDA 4Q9BA 4HOWA 1AKJA 3WS6C 4JKNA 4XI5D 4P23C 1B4TA 2ICES 4MZRA 4ZYKA 2CM6A 1XF3B 4E9YA 1NIEA 4RGNC 4YBLB 3ILPA 3HE6A 4ZOAA 1HXMB 4F7KA 3L1EA 4JRXE 1R5VA 2JCCF 4I87A 2QDWA 2MCPH 3GBNL 1UVQA 4NN6B 1P7QB 2BFVL 4N86A 5KUMA 1HNFA 4QWWD 2A9DA 2X44D 3L1FA 4JPIA 1XH3A 3IPFA 1D5XB 4KX9A 3CQQA 5CGMA 4MJID 4P5SA 2DI8A 4WTWA 3QJSB 2QR0B 3NJLA 4UU9B 4JAMA 2JE8A 2J5WA 3ESUF 1EGJH 3KMDA 1OSZB 4M6AA 2P1YA 3Q8BA 2DEWX 2NY7L 4OCSH 1M1XB 4OD1L 1BAWA 3JT2A 3FQXA 1IFHL 3LV3B 5B3JE 3WDIA 3QORC 1A8ZA 1HHHA 1IGFL 4XPHH 1Q1PA 2AKRA 3U30B 2XVGA 4BQ8A 3BWSA 6CGTA 3UTQA 2ZCZA 4LCWE 4PJCA 4ZW7A 1NFIA 3H9YA 5JR1L 4GRLB 1C08B 4P9HC 1A8JH 4HLJA 4LSTL 3B2XA 1MCFA 3NJJA 4EI6B 4X6CE 3QUYA 1KGXA 4JVUA 1FFQA 5FYJU 5DZ9A 3IFPA 5DYOA 2FEDD 5T1KB 4GQQA 2ZPKH 1I8UA 1KTCA 2YWZA 5HHPA 1EEUA 4NENB 5LAXB 1NCGA 4WUKL 3TC9A 2R7EB 1CU4L 3QCUH 5I2IA 3BN9C 4P23D 1OP5K 5KOVC 1KYFA 1LK2B 1EJ6A 3QA3B 1T0OA 4BFNA 1RJCA 1Z9SB 4RGND 1I1YA 5DVOA 2G4GA 4UM9B 5EFIB 4ETYA 4X7FC 4XBEH 1SDAB 5D4HA 3T9WA 5BPPA 4OZHF 1RL1A 4FQQB 2WK2A 1J0JA 5BUAA 4GW4B 1JMZA 1JMXA 1QFUH 2TRYA 3DETC 5CGTA 5HHQB 3UJTH 4JO3H 4OZGF 5E6YA 5T3ZL 1OK0A 1FL5B 4D9LL 2NW3A 1IKFL 2DRUA 1CICA 5F89A 1NCOA 4OGAC 3VXSA 5EDSA 3WEBA 4XB7A 5D72L 3H9SE 1JNLH 4P46B 2XVKA 4BFRA 1CD1B 1TFPA 2QHLA 3C2AL 4M8QA 4PIRF 3ZDYB 5E8EB 1RI8A 1SLVA 2O5YH 3L95B 3MGOB 2R27A 4W9JC 3E6HB 5G4OA 4QGTA 2JI3A 2PETA 4XPBH 4OZIE 2G3ZA 2PKDA 2OS7A 4NO0D 3CCHB 2WZ0A 5CMAB 2EE0A 1PKQA 1SJVA 3N9GH 3QORD 4GO8A 3IN2A 3CUPB 4J6IA 3NZHL 3GSWB 3ARBD 1MOEA 4Q74A 4DT2A 4WTZA 4I88A 5SWSE 1JGEB 1NLBH 4KHTL 4PB0H 1ZIAA 2PPEA 2VDKL 4XMVA 3E38A 5IFJA 4HS3B 1C7SA 2YUWA 1FWXA 2J5LC 2L3BA 3EOTH 2ZYHA 1HL5A 1UD6A 2DTSA 5L2JA 5HGHB 4QXTA 2XOTA 2XYBA 1BOYA 3FN9A 3HMWL 4RMWA 4CC0A 1N3NB 1RJYB 3ETBF 3EYSL 1B0RA 3LVTA 4PRHD 1M2VB 5C07E 3P4MA 2PPCA 3NH7L 3FZUD 4RIRB 1RUMH 3IPEA 4NRYB 1AGEB 1ES0B 2VISA 3D51A 3FK3A 5SWZB 3BH8B 3ZO0A 1QYGL 4G8FB 1FG2A 5CZRA 3TN0D 1I3RA 2X10A 1D6EB 2DLIA 3L5JA 3N5AA 3CZNA 1I3UA 5KSAC 3FULA 4NQEA 5B38B 1XVSA 1N0XL 1I3GL 1CE1H 1KACB 4L3FA 4D9QE 1W9XA 2X70B 4HK0A 3VXME 4RDQF 1BDYA 4L3CA 3K91A 1QLRA 1UKQA 4X8JB 5A6LA 2EIDA 4XVTH 3DLQR 4HV8A 5D7IE 3CN1A 5HDRA 2X9ZA 3UIYA 2NY0B 3T3PE 1MELA 1C16B 3HG1B 1F11B 4KTEL 2CIIA 4NB7A 3EH4B 4HXAH 3EIFA 3ZE1E 4BGLA 2P24A 3IFLL 4YSCA 4W9KC 3JTTB 5A7EA 3UJJL 4YMPA 5AD0B 5AOZA 1U30A 2IOMA 5I0WA 2NZ1A 4NN7B 3FT9A 2H9GA 5LGJA 4FG2A 3A24A 3ZUNC 4RISL 3DSFH 3TT3L 3BT2H 5ETUB 3QIBA 3STZA 1ACYL 1JD9A 1J1OL 5KW9L 1KGYE 1ZGLM 1SN2A 2Z93A 4PJIE 1WCQA 4O2FA 3EGDB 4NKMA 4HCFA 2O6FA 2XRAL 4KI5C 3TU6A 1OIOA 3QQNA 4JFXB 4K71B 5DUBA 4YWGH 3U0PB 3PWVB 5FECB 1DJSA 2CKBA 5A2AA 3OKOA 2HPTA 1IGIL 2CLRA 3FUFA 4K2UL 4JFFB 4Y9CA 1ZXQA 3OKDA 4K7FA 2P42B 3EBIA 4X98A 2CKNA 3OGOE 2WJ7A 1SOQA 5EORH 1CL7H 4MJIE 1MXGA 3QAQA 5CJ8A 5E2UL 5B1BB 3VI4B 3B8YA 4FKKA 3LSOA 2HZHA 3SO5A 3EH3B 2VOTA 5DQ9B 1AACA 4NN5C 4YX2H 1BVNP 4ZTEA 2R0LH 3EF7A 1YEKL 3D85A 4PLOB 1JIBA 3UYRL 3V6OC 1L0QA 4F2MB 4YE4H 1TU2B 4PYGA 3U1SH 4HX1A 3I84A 1M6OB 4Q2ZB 5JDSB 3INOA 2R69L 1E5YA 5CP7B 3VMNA 3T4AC 1A3LL 3ZTDC 1AS6A 3N04A 5EMYA 2NZ9C 3A5VA 3GLZA 4I3SL 2ZICA 3MRHB 3MA7A 2QGBA 1TZHA 1XF4A 1QFWM 1EDYA 4QOKD 2EUXA 1N7ML 2ODHA 5C3TA 1FLRH 2HKFH 4ZFFB 1LO0L 1U33A 2EADA 4XT1C 2J25A 1PAMA 3PL6B 3WNOA 2I5YL 4DPAX 4PBVC 2WQAA 3WI9A 3DSNB 2XPZA 1FZMB 4AYSA 5E8PA 4KQ3L 4RGNE 2R15A 2XFXB 3BP4A 1NC4B 5CN2A 1IM3D 4DO4A 2V6HA 1NFDE 4K5LA 4JRYB 4HJIA 4NFDA 4KX8A 5GISL 1ZHLB 3LX9A 4GUPA 4KI5D 4X8XA 1NGQH 4IOSD 4JGUA 4HMDA 1G94A 1J9RA 3MPCA 4WEEA 3EJPA 5I1CL 4JQXC 1NCJA 2IANB 3EGSA 5FYKD 2UWEA 1P0SE 1WSST 1S7VB 4PD4J 4PJ5D 4M5SA 1IGTB 1DQML 1CFSA 1QUPA 2VH5H 3NCCB 4S11A 5TFSH 4QRPB 3CHOA 3KYOB 3RAJH 2H32H 5CEZH 4JDVB 4AJYV 4YL9A 1PDKB 2XPGB 3Q2LA 3S3CB 1X9LA 4NGHL 4MSWA 4UM8B 3MROA 1JK8A 2QGDA 3UXFA 1EXGA 1SNRA 3V4VH 4M93C 4XVUC 1BF5A 4Y5XB 2F5AH 4LCYA 5GS1A 4IBTA 2Y2TA 5ANMA 3VWJB 2I27N 1DQDL 2NZ9D 5DF0A 4QPEA 6FABL 5BZDA 4N0YL 1KENH 1MFAL 4PUBL 2AVGA 1Y0LA 2QGEA 1KEMH 2EE9A 3FQNB 3HNSL 1KJ3H 3WNIA 1WH0A 2Z91B 1FC2D 1X5IA 2HT2C 2AJSL 3DI2B 2PPFA 4JCMA 2VDNH 4OZFH 2D3LA 1QLFA 1UASA 1K5NA 2BNQA 1DZ0A 1HI6A 1ZLSL 3I6GA 5KYUB 2XQBL 5CWSB 4QTHB 5EWIH 5T1LB 3UGXA 3VFMB 1CLZH 1YZZA 4AIZA 4G70B 4R4BA 2AXHA 4I18B 2X0VA 4HMCA 4X6FB 4Y19B 4CMMB 4LVHB 3BC9A 3QXDB 3FN0L 2RQEA 2Y4SA 5L6YL 4QJ4B 5AUMB 2EECA 3MBEC 5DD1L 1PY9A 4I3GA 3GSUA 5DMIL 1K8IB 1SN0A 4MMZB 2PYED 3VE0A 2WXPA 5J0BA 4ONFH 3CDGA 3BKJH 2QFRA 1AR1C 4PY8I 4Y4HC 4JZNB 1UT9A 3Q3GA 4LOUC 5TTRA 3EGXB 4NNYB 1RZ8B 2YQ2A 4S1QL 3ARZA 3CU7A 5C7XH 3UZEA 5L8JB 4DN4L 3TA3C 1GGYA 4AIOA 1J9CT 5F72S 4LHJB 4U49A 2WQRA 4FX5A 3OKNA 4NKIL 5C09D 3M7FB 2RB8A 4L1SA 4TULH 4L8CA 2FHCA 1R4XA 4QR7A 1T1XB 1OAQH 2B0SH 3DTXA 1K2DA 1SF3A 3G5XB 4ZMAT 1NBVL 2YOCA 2Q0ZX 4JDZA 3MV9A 4NM4L 1XCTB 3U36B 3APNA 5D1QC 1S78C 2HH0H 4P04A 3ILQC 3RTLA 3O6FB 1YNKH 2HT2D 2QHRL 2W9LA 1C9SA 1LQBC 4UZSA 2W1NA 3LS4H 1ZKAA 4P4KB 4KUCF 2J8UB 5L4FA 1TLMA 4KNQA 2JJSC 3NAAL 3LEXB 4HEME 4XNZB 5ILTH 1H6UA 4N2FA 1CDIA 2C9UA 1WCBA 1IE4A 1QABA 4UF7C 3ZYOA 3MRIA 1P84K 1A6WH 4PV1C 4WY7L 5HHOA 1WBYA 3U7AA 4AC2A 1HOEA 3FXIC 3SDXE 2WVUA 1C5DA 4JCWA 5LDSA 3MOBH 4MAYB 5EEUA 1HINH 5AW0B 2NY3B 2YD2A 5GZOA 2B15A 3SE8H 1AI1H 2PPDA 3CFMA 4LSQL 3PABA 3B8SA 5FA3A 3F12B 5FW8A 1QTYT 3S7GA 1DBBL 2PR9A 4M62H 5DMGC 4WVRA 4Z77B 5HYJB 3JV4A 1UB5A 3VFUB 5EZIL 1LO3H 4UTAL 4WUUA 3O8XC 4Y4HD 1AR1D 3AWGA 2AQPA 2AMGA 2VRQA 4CC4A 4EE2A 4HD5A 4LOUD 1K3ZA 1BLIA 2MNUA 2VDRL 4QOKE 4XCCH 3KVQA 4YDLB 1G7PB 1E9PB 3UTSA 4QRSB 3WXWH 4ZUVA 3MCYA 4L1LA 3JYBA 5E1IA 1USZA 2QV4A 3G5WA 3WEOA 5B1JC 4UOQA 4W9ZA 4R8WH 5BS0A 4QRQB 1WS8A 5DJ8A 3S4SG 3ZSSA 5DJ0A 5C0IA 3M1BB 2AANA 1ILUA 2DDQL 4ICWA 1GVIA 3SBPA 3WTXA 3H2WA 4KTDH 5D1QD 3W11C 1S78D 4Z3JA 3DIFA 3C5ZA 3ILQD 4QI3A 4X4ME 5I8CA 4U3CA 1ZVNA 6PAZA 2ICEA 5EZLA 2RACA 1IAIL 4IBSA 1O5PA 3Q9QA 1CQYA 3EYOA 4BFIA 5MP6L 1FO0A 5IBUG 3LY6A 3WG7B 1GGUA 5FYKE 1UM4H 2EVHA 1ND0B 4Q9RL 1EJOH 4PJ5E 1G9NL 4G7YL 4IJ3B 3CN2A 4HHGA 5DS8A 2TAAA 3MRFA 3VW3L 4GY4A 5KJRH 1A7QH 4JFQA 5GGVH 1IBYA 1RP9A 2Y0SA 3K6DA 5MERB 1QSFB 5JUEL 3V6OE 4F15C 5HVHB 3IWUA 4XMPL 5B38G 2DYSB 5BQ7A 2W0KA 1EAPB 1PJWA 3FTZA 4OF0A 5CHNB 2A74B 3OG4B 3VQLA 4HDIB 4KQ0A 1KCWA 3VFSA 4M7LL 2AJUL 1M05B 3OC8A 3CFBA 4AENA 3MKKA 3GXFA 4UCFA 1OPGH 5KAQG 2D7PA 4FHBD 4A1RA 3O8XD 4P59H 4K3HA 1AP2B 3CLEH 2CIKB 2BXZA 2R9HC 4PV9A 5C71A 4UNTA 4UIMB 4F8LA 2Q1EA 2JWYA 1GGCL 4JL2A 1TJXA 1BZEA 4XMLH 4XPTL 3QDMD 5E23A 5HDBE 4P2QD 4WHTB 5I66A 2AERT 1BJ1H 2DQ6A 2FQFA 4OJFH 2PPAA 4G9DA 3RDTB 2GJ6D 1L9SA 1MJ7L 4LLQB 3UPRA 1HXKA 4HQQL 4NKQB 4KTYA 3VWKB 1N9PA 3R06B 5EUOE 2OK0L 1WAAA 2ZKYA 5GGRB 4ZG1A 3W11D 4GQ9H 4YSPA 2BVTA 3HVNA 1R5WB 1NDGA 2BS71 5CJXC 3UDWC 4F1ZA 2BMKB 4NBYB 2C7UB 3PNRB 2IC2A 3BUIA 1E7UA 2B3IA 3PWNA 4J27A 2CUAA 3SDDA 4N20A 2VZUA 3MRCB 3LNGA 3S5LB 4KVNH 3P4OA 1BHGA 3F7PC 2PP7A 2XV6B 4GAJH 2PYEE 1FFPB 1U8QB 3S88L 1QEWB 3BI9X 1IAIM 3T6ZA 1CL7I 3HPLA 2R23A 4MA8H 1KELH 5BZXA 3I6LD 1LEGB 2ZKWA 4KHXH 3GDCA 3IF1B 3DTUB 1A25A 1T04B 1WFIA 5GGTL 4MMYA 1CFNB 3RFZC 4HFWB 2EVGA 3QUZB 4YHKL 2CAKA 4RGMB 4BQ6A 4MCYB 5I76B 1S7RA 2RH0A 3L3JA 3IJHA 1DQJB 4F24A 1GJIA 3PREA 1OLLA 5C09E 1JZ8A 3GFUA 3NK3A 5I0XA 1QAWA 1FIGL 2J4WL 3V10A 4YBHA 2R9HD 4H40A 1XF3A 3D87B 5C0EA 1WK0A 4A63A 4LPVA 1B4JH 1UT2A 1B3JA 1NWPA 2WY3B 2R0ZL 2UY6B 3GBNH 4LMQE 2UXVA 3ZX1A 4S1SH 1HXMA 1P5UA 1CDHA 3K4AA 1BFVH 3KYNB 4JPKH 4UILL 4MKMA 3AWEA 3VD7A 4XNUH 1P7QA 3DVIA 5KS9B 2QMJA 1V10A 2MIZA 3LVEA 2NSQA 1NCDL 1N8OE 3B9EA 2VZSA 5M7QA 1R1CA 4J3XA 2ZUQC 1D5XA 2MSPA 3QFGA 5JLZB 2N59A 3WFDH 2QR0A 4PS7A 1V5JA 2CHNA 2NY7H 3CBJB 4UU9A 4OD1H 1MSPA 4PS8A 1IFHH 4R2GC 4O02H 3ZT6A 4IRZH 1OSZA 2FNBA 1Q0XH 5FUOL 4JKWA 3GSXB 4EZMA 1M1XA 4PV8B 4XTRC 1MCOH 3ZY7A 3LV3A 5LHDA 3U6RB 1RPUA 3QI9C 5JR1H 2X4SB 2I25N 2ZSVA 5DZPA 2JELL 4LSTH 4L4VD 1HYSC 2B1AH 5DEJA 3KD4A 4GRLA 5A43C 1C08A 2XQ0A 5G4NA 4EI6A 3UZVB 5BCAA 1VERA 3VXOB 4Y7OC 4GNKB 4PG2C 4ADJA 3S34L 2Y3NA 3I9PA 4WUKH 2F8VA 4HZLB 1WIUA 1CU4H 1WC7B 1V3JA 4DESA 3IS0X 1HSAB 2Q87A 4JPWH 4NENA 1H15A 5LAXA 1DZBA 2R7EA 4XO5A 3VQMA 1UD3A 1MKFA 1LK2A 2SEBB 4M7JL 3QA3A 4NWUL 4MB3A 5F1NB 1SDDA 1Z9SA 4KVPA 4UM9A 5D1QE 2BSTB 5EFIA 4LBEB 3RVWC 5LQBL 2O6CA 2J2ZA 3G6JF 3OJDA 2FO4B 3SBWC 5T3ZH 1DFXA 2KC0A 4D9LH 5IB4B 4YNYB 1H3XA 2AJ3B 2K4AA 3UTTD 5HHQA 2RTTA 1RZQA 1FL5A 3G9AB 1DFBL 3FT0A 1F0LA 5E5LA 1KYOK 3MV8B 1E2ZA 5B39B 1PIFA 1S3KL 1JPEA 3GJEA 1GGIH 3M86A 4UTBL 5KVFL 2ZP0T 1CD1A 1JNJA 1IC1A 4TNWF 5J4MA 4OZIB 5DTFA 2E0PA 5E8EA 3L95A 4R2GD 1H5BB 1QFPA 3H2PA 3MGOA 3FSZA 3C09C 3EAKA 2PNDA 1E3ZA 3NZHH 5HGGS 2XWBB 4JZOB 4XTRD 3CCHA 1S5IL 5CMAA 3MUUA 3QI9D 3HZYB 4HULB 3CUPA 4PG9B 1OWWA 3Q01A 5SWSB 1HYSD 5KVGL 3GSWA 2IBZX 3GUTB 4Z7VF 4N6RB 3H42H 1MI5A 2PABA 3N85L 4KBPA 3WJJC 1JGEA 4E9TA 3BLBA 1OQXA 3BVXA 2XXMB 2ZT9C 3S4SA 4OTXL 5DMKA 5EBLB 1ZV2A 5F1SA 4HA1A 1CGSL 1U8CB 1Z3GH 3N44F 4YUEL 3HMWH 4N9GB 4JDTL 3NEOA 1XH2A 2DI9A 2G5BB 3EYSH 4JPVH 4AYGA 2N1KA 2OA9A 3V9CA 3S37X 3GHPA 5HGHA 1EA9C 2RQ8A 3NH7H 4P2QE 5HGBB 2WLHA 3R8BB 1N3NA 1RJYA 3J07A 4HIEB 2GJ6E 1M2VA 1RVFH 2XG5B 4QXVA 4X99B 4FQLL 5DK0B 4Y89A 4RIRA 1IKNA 1QYGH 1MRCL 2YGVA 4NRYA 3UP1A 4DKEL 3X17A 1AGEA 2RGSA 1XZWA 1ES0A 1ZLDA 5SWZA 3RVWD 2B59B 3AT0A 3BH8A 3X13B 1CGXA 4G8FA 5FOBA 5EDXA 1N0XH 1I3GH 1PG7L 1RD6A 3EOBB 2A9NL 1AS7A 2E7BA 4JMXA 4P99A 1D6EA 1E43A 2EVIA 1QEXA 1OM3L 3ZKMD 5B38A 1K4DB 2X70A 3UEZA 1JZ3A 3KW8A 4X8JA 2CNZA 4KTEH 2GK2A 5SX5K 3LD8B 1AD9B 2I32A 2WXRA 3I6LE 1XD0A 2W9DL 3IFLH 4M5ZL 4YDNA 4BRVA 1T5XB 2ZZUT 3M6DA 4MB5A 1C16A 3HG1A 1F11A 5DCCA 3BVNB 4IBYA 1PZAA 4UQDA 2Q6WB 1S7UB 2OW7A 5IOPB 4M29A 3AY4A 3JTTA 2O5NA 1Z0MA 5AD0A 3L81A 5I1GL 5HDQL 3RVTC 1GW6A 1ACYH 2BJML 3NACL 5H37H 2FBJL 3I6SA 4B5ZA 2DYPD 5EPMB 5ETUA 3CVCA 5FK9B 1BV8A 3F00A 4X6BA 5A2KH 2XRAH 1VENA 4Z3FA 3IDYC 1OARL 3T0AA 3AU1B 4PMEA 4NCC1 3QDAA 3EGDA 5JORB 4D2NA 4CVXA 5JOFB 4LOEA 4K2UH 1U9KA 3QAZB 3EKCA 3LRKA 5L7XL 4JFXA 1KBBA 3PWVA 5FECA 2ZXQA 3MJ6A 5E2UH 1HHKB 4HKXB 4JFFA 3LRGA 1NICA 1DJZA 1TTGA 3FHAA 3VI4A 3OB0H 3W9EB 4PJGE 5I1HL 3UYRH 4YOKA 3CPLB 4MJ4A 5DQ9A 1WZ1L 4CSSA 1P7KB 5D55A 1OGAE 1ZTMA 3IDGB 1G1OA 3BP6B 3ASNB 2R69H 2A6KB 4F2MA 1UGKA 1AG6A 1MJJB 4OKDA 1A3LH 4L4JA 2WXNA 4LCCB 1QTPA 2UZIL 1M6OA 2EIZB 2Z64C 5AZ2L 2IFGA 4X5LA 1VZIA 1QWHA 5BV7L 2XWZA 1PEZA 2MTPA 2O5XH 5DHMC 3RY4A 4HIPA 1N7MH 2CE6A 3MRHA 2G9KA 5EZPA 1JDDA 1LO0H 3APCA 3IJ8A 3HC4L 1AIFA 2I5YH 1HNGA 1JNNL 5CR1A 1NJ9B 5IB2B 4ZFQA 4ZFFA 4UNUA 3G5ZB 4KQ3H 3PL6A 5GRWA 3LMJL 3QUXB 3ASOB 5H35B 1P6WA 3DSNA 1FZMA 3FUEA 4IEFB 1U92A 1NFDB 1SEQH 2E9IA 5HDWA 2XFXA 5FKPB 1OW0A 2WQXA 1NC4A 4H2CA 1SXBA 3VVWA 4UI2A 4PCSA 1ZHLA 5LDUA 1QI3A 5MHSD 1EBPA 1FUNA 3GSQB 1DQKA 3QK0A 1XIWC 4Q7DA 3UTTE 2HXAA 4HK3J 2VC2L 3L4YA 3TXAA 2GIYA 4OI9A 3EXJA 4IKNA 1IT9L 1JRHH 3NRQA 1P2CB 1SGKA 3CZEA 1Q4NX 1S7VA 2JB5L 3BH9A 4J5VA 5JHDA 1IGTA 5DWPA 1WF5A 3S0PA 4QRPA 3KYOA 4JUTA 3WFBL 4JDVA 3CZSA 1PDKA 2XPGA 3QORB 5D6CB 5ITFB 3HI1B 5EOQL 4UM8A 3UAAA 4B6ZA 4CW1B 2QJDA 5C0GB 3WJLA 2GYSA 4O5LL 1DQDH 1NDTA 3CVBA 4Y5XA 1JF6A 1Z3RA 2GABA 5FGCE 1T1YB 4N0YH 4QXWA 4NXSA 2IGTA 1MFAH 1MNUL 2GJRA 4N3UA 4PJ8C 1KGIA 3HNSH 4PW9A 4LHQB 2NR6A 1G7LB 2FWOB 4OKVB 3E2HC 3ML9A 3TBVB 3BRDA 4LCVA 1E4WH 3ARWA 1YVLA 2RBLA 3CV5A 3FQNA 4OF8A 2X4TB 3KBEA 4PRHB 1E6OL 1I31A 3P2TA 5EUKB 2XQBH 4Z78B 2H3KA 5DZVA 4GIPD 2OP4L 1NMAL 1JHTB 5EZOH 4AUUA 3NA9L 5J7CC 5AW9B 2L8AA 1T89A 2E27L 5CWSA 5KYUA 4QTHA 5T1LA 3CVHL 5AQ0A 3VFMA 1UEMA 5EU3B 3FN0H 4JM2C 4I18A 3TEZA 1FZJB 1P7HL 5L6YH 4GUCA 5EEZA 3B9DA 4X6FA 4Y19A 4CMMA 3QXDA 3KEHA 1UENA 4L2YA 4N0UB 1AYOA 1XIWD 1W16A 5AUMA 5GRVL 2E8ZA 4V1DB 4J3SA 4NP4L 3ARUA 2CA3A 1C12B 1F56A 4LCUB 2X12A 12E8L 1QASA 4FAAB 1K8IA 4MMZA 5B8CC 1RK1B 2FX7L 3JUYA 2XIBA 4S1QH 1TOXA 4JZNA 3HN3A 1OY3B 2AXWA 2DMCA 3H3BC 4DN4H 4FZEL 1KJVA 3EGXA 4NNYA 3LNDA 3ISWA 1RZ8A 3ABMB 3ESPA 1YJDC 4YLQT 4Q8BA 4IRJB 2DJUA 4E9LA 2Z1PA 5HHXL 4C55A 4E68A 5FHAL 5DD3L 2ED9A 1FFOB 1D7CA 2YAFA 4LLMB 1NBVH 4PJ8D 5EF1A 2OZNA 2HB0A 3L9RB 4ZMYA 2BCMA 2OR7A 1T1XA 2J5LB 4LZKA 3G5XA 2QHRH 2X28A 4Y4FC 2O93L 1XCTA 3U36A 5EEWA 3UG4A 4HBQA 4HYTB 5K39B 1DL7L 3DOSB 3MRRB 3GSVB 3NAAH 4ZQTA 4RSYA 3T6WA 3IBOA 1RURL 1MCQA 4MNGE 3N42F 2ZCLL 4P4KA 3VD0A 1OP9A 5FFLA 4JM2D 2QKIA 4OQTL 2BSSB 1YG9A 1U3YA 2WO2B 3PJNA 4AEHL 5KSAB 5F7KC 3UCRA 1QNZL 1X5ZA 2HFFB 2J57A 1KN2L 4MAYA 4ZW6A 1DBBH 1BXXA 4UT6H 3NFSH 4ABQA 1PFOA 4NYLB 2AJYL 1SXSA 3F12A 3ERXA 5HYJA 2J21A 4Z77A 4P2RD 2LU4A 5J89A 1N0LB 2OFQA 4XVSL 3UERA 3VFUA 3VYNA 4MXVF 4QGYA 2VDRH 1RIHL 1Y6NR 4NUPA 3ROOB 3G04B 4MS6A 1JNHB 1Z0NA 2WWKT 4K55A 5F44A 5DJCB 4E9XA 4R4NC 1E9PA 4QRSA 3BAIA 3IDXH 3UPAA 2J88L 3IVKB 2PO6B 3WTUA 1A3QA 1HHGB 2DDQH 5KVEL 1THAA 1IC4L 4QRQA 3FSWA 4YHZL 1W6LA 3KGRA 3M1BA 2I26N 2A6IB 2JCCB 3RRQA 3V0WH 2C4XA 1IAIH 2E8YA 5MP6H 1EZVY 3MHZA 4HWBA 4W70A 5MHSE 3KL0A 3MYJB 1CWVA 1RK0A 3U48A 3VFVB 5KG9A 1BG1A 4AQAB 3D4GA 4RAHA 2FX9L 1VZHA 3BQUC 3NFPB 2BZ7A 4GSDH 3RWDB 4DVRH 4NQXB 4G7YH 4TLSA 2CU9A 2VUKA 2IDFA 3VW3H 4C83B 1ND0A 4YXLL 4NN5B 5TQ0L 4ZK8A 2UXFA 2JSFA 4ZI8A 5JUEH 3KPMB 4J4PC 4UTCA 3PHSA 2EAEA 4M7KL 4GRWB 3K6IA 1J0HA 3WNLA 4M7LH 1QSFA 2AJUH 2VXSL 3FPXA 5MERA 4J3UA 2VR5A 2NY6C 3QCTL 1D7DA 1EAPA 3QQ9C 5CHNA 5IQ7L 2A74A 3T4AB 4HDIA 3ECQA 3FUJA 2EDXA 3F7YA 4M00A 1A2YB 1M05A 3O3DB 5GRJH 3O6LL 1DE4B 5LCVA 4WFED 3US0A 5AFAA 2BNUB 4YEEA 1ED3A 1GGCH 1AP2A 3EYQC 3QRBA 1VEOA 1JZ6A 1AE6H 4LDCA 2DBJA 4UIMA 1INEL 2WQWA 2YAPA 4FXTA 4XPFL 1G6RH 3JWNC 4XPTH 5CUSL 4KV5F 4P3WA 1BVNT 5CKAA 1XZ0B 3IBEA 4R4ND 4GKZB 2QQKL 1MJ7H 2YAEA 2XN2A 4WHTA 1J9TA 2DF3A 1ZOXA 4HQQH 5D70L 2X1PA 1OZUA 4XH2B 5D7SL 2OLDA 3E9TA 3RDTA 2OK0H 5KZCD 4LLQA 4PRNB 1UOLA 2X2JA 2P28B 3VI3B 3R06A 4NWTH 4UT9L 5GGRA 5CILH 1P6AB 1R5WA 5IFHH 1CDJA 2BMKA 2EIJB 2JH2A 2C7UA 2MEJB 4AKOA 5K9JH 4HWNA 1L0XA 1R0AL 2EP6A 3BQUD 4G6AC 3LXUX 3QHTC 5EU7E 5DD5H 4AQEB 4OLXH 4AZ8B 3MRCA 1G7QB 4H4NA 3S5LA 1RXLA 3B5HA 4AUYA 4YHIB 5FYJD 3T0WA 3V4UL 4G8GB 1KEGL 1FFPA 1U8QA 4EDXB 1QEWA 5F9WC 1UM5L 5GGTH 1B9KA 5IUCA 4J4PD 5E2TH 1TETL 1NFKA 4FERA 1LEGA 2I7OA 4OBRA 3IF1A 4R0LC 4YHKH 1CDBA 4F7MB 1OAZH 1T04A 1NEZB 1CFNA 4HFWA 3QUZA 1OAYH 1MPAH 2NY6D 3QQ9D 4ZPTB 5CGYC 3BD3A 5C09B 4AM0Q 4MCYA 5I76A 1FIGH 4L3ED 5E8DL 1DQJA 2J4WH 4ABUA 4H0LC 2H1PL 1YPZA 5D1ZI 4R96B 1OALA 5LNDA 1LXMA 1YNTF 1XGRB 1JI1A 2R0ZH 2MNWA 2YD6A 5F9AC 4PJFE 4GB9A 2IGLA 1KOAA 3BP7A 2P9RA 1NPUA 1YY8B 5CF3A 3UAJC 1CTOA 1HESA 3ZHDA 4UILH 3QBTB 2UY6A 1X5AA 3SD2A 3HAEH 3QG6B 3KYNA 3T5WA 1YEIL 2R4SL 3V0EA 1NCDH 3Q6FA 1QI4A 2VDLL 4Z8FH 1V55B 4ODTL 5C2BL 5KS9A 3K46A 1OSPL 3WTVA 3TH2T 3PJLA 4NHCH 4Z7QF 2X89D 3TX4A 1XAKA 3KDMB 1W8EA 4FHKA 2E9WA 5JLZA 5FUOH 4Y0GA 5C92A 3MBEB 1SJXA 4BK5A 4JFHD 4FA8A 4TXVB 5K1JA 4G6AD 1HKFA 2XZQL 4J3TA 3NIFB 4WKZB 2JELH 3GSXA 1EHLL 2FJUB 4PV8A 5E6IC 1WA0X 2X4SA 3CSGA 5JTWA 2RFXB 2YSTA 2IWKA 2YN3A 3FCUB 1YLBB 3HUJE 2WIIA 1AR1B 1IE5A 2FGWL 3JVFC 4Z95H 2G30A 3S34H 3TA3B 2CRYA 3VXOA 1IAMA 4YAQB 4I9XA 4Y1AA 5IF0B 5I6KA 1X5KA 1X7SA 3MACL 4FNSA 43CAB 5CGYD 1I8IB 3OGCB 3Q43A 1YPZE 2X9XA 1JYVA 4HZLA 1WS7A 4GQRA 4AX3A 2WZPD 1WC7A 1OP3H 4M7JH 1HSAA 1RUQL 3HNTL 4NWUH 2H2SC 2M1KA 4UAHA 4WEMB 5KYNA 2SEBA 5LQBH 1UWGL 2LOEA 2XWEA 3GIVB 4JB9H 4NQQA 4ZMXA 4PJ7A 5F1NA 2VXUL 3SYQA 4UT7L 5ICUA 4HCRL 4WAFA 2BSTA 1BFSA 4LBEA 5E1QA 3ZDXF 4AGOA 5H94B 2FO4A 3CH1A 4Z3IA 5IB4A 4YNYA 3LRSA 1EAQA 4B9KC 1Q0EA 1DFBH 2NUPB 2AJ3A 4ELMF 1IC5H 4PP2A 5B3NA 4IU3B 2V2XB 4ALAH 1Q38A 5LNGA 4UTBH 3NUKA 3OX8B 4ZMTA 1VJSA 3OJVC 1WHPA 1X6NA 3MV8A 5B39A 1CXEA 2R29A 4F7CB 3OZLA 3Q2NA 2WPGA 5JW4Q 1PL3A 1YYML 1S5IH 5C0CD 1H5BA 1TMCB 4FFYH 2OR8A 4OM0L 1OOAA 5KVGH 2XWBA 2K45A 4JZOA 5E6ID 4AEIH 1IB5A 3DIDA 5LXVA 3HZYA 1JDCA 3O8XB 2MOVA 4N2MA 3N85H 4X80H 4WFEE 4PG9A 1KDJA 3E7JA 3ZZ1A 4IMKC 3GUTA 4OTXH 1FNSH 4N6RA 5ABAA 1RIUH 2XIIA 1VA9A 1YC7A 1YEEH 3QUGA 1L0PA 1PEWA 5EBLA 1ZTXL 4U7SA 1U8CA 3QDMB 4N9GA 4P2QB 2G5BA 3GTNA 3DX0A 1RZJL 3I75A 2OMYB 3P2DA 15C8H 1EWHA 3DX7B 5HGBA 2DH3A 5E0FA 1NUDA 2APFA 4EQ3A 2H2SD 1TT6A 2D7TL 4HIEA 4YVNA 4DKEH 2MJWA 2XG5A 4X99A 5DK0A 1H8LA 5EF2A 4AITA 5KANG 2J71A 3DHJA 1PG7H 2A9NH 2YD5A 3AS3A 3VNYA 3MUY1 5TD4A 3X13A 2XFGB 4AGQA 3H4FA 1OM3H 3EOBA 1C5CL 1WBXB 1YYLL 4M8VA 2EIKB 4AM0B 1RUAH 1R46A 2EJ1A 2XKNB 4M5YL 1K4DA 4WZ9A 5FYJE 1EXUB 1TENA 3N43F 3OMIB 3PLYA 4NAMA 1KCSL 4M5ZH 5IROC 3QVAA 3RGVD 1P84J 2EDYA 3OSKA 2H0JA 2FGZA 5LNEA 1HKLL 4J3OG 1AD9A 1JE6A 4JG1H 5BVJB 3GO1L 2EDDA 1REIA 1T5XA 3BVNA 2G3NA 1VRSA 3K8MA 4JFTA 1S7UA 5HDQH 2Q6WA 4AVJA 5IOPA 1PYWB 2BJMH 3NACH 2FBJH 4LESA 4R9HA 5ACZB 2APTA 2ZKHL 1IAKB 4L3EE 3P2BA 3FNKA 4LF3B 1X7QB 3D50A 2BY2A 4AV0A 1TVBB 3WL9B 4B7IA 4LEXH 4A2MA 5G5DB 3NJVA 1Y18B 5EPMA 1DBML 5FK9A 4Q0XL 1WFTA 3IDNB 1JWSB 3AU1A 3OD3A 5L7XH 3KAAA 3MUHL 1OVZA 5JORA 4PWGA 1JBJA 2PCXA 4O00A 3CTTA 4OZFG 1BEYL 5JHLA 3U79A 1KTLB 5ITBH 5CLXA 1XGQA 5I1HH 1HHKA 4UMSA 2IWGA 3ME0B 4HKXA 1M6UA 4LSUL 5JPMA 1WZ1H 3W37A 5C0AD 3NBNA 3W9EA 2WVVB 3F85A 3HI6L 4HJJH 4C4UA 1IAII 4JFHE 3CPLA 1ODAA 5AZUA 2Q86B 1CG9B 4A7SA 3ZT7A 2CK0L 3EDEA 3RB5A 5AYQA 1PW3A 2UZIH 1DCLA 3IDGA 5IHUH 2XVBA 5MEND 4S0TD 2A6KA 3A0OA 2W88A 4L4VB 1MJJA 5BV7H 1OAKL 4LCCA 1TQVA 2FQGA 4JG0L 5C7ZA 4JM0A 2EIZA 2WB7A 5LBGA 5JW5B 2ADYA 2V5RA 2Z6FA 3AXLB 1GS8A 4N87A 4XHQA 2X40A 3AREC 3LEYL 2VDKB 3HC4H 3GSOB 1T4KB 2Z7UA 3QZBA 5CBAB 4P5KB 3GZQA 3BUTA 3D34A 2COQA 3CSPA 3LMJH 3L1OH 4EEEA 3N1FC 3ATDA 4JHUA 4Z7AA 1NJ9A 4K8RL 4U1IB 3WS6A 5IB2A 1F00I 3JV6B 2FRGP 3G5ZA 3HN5A 3QUXA 1MG2C 3NRFA 5H35A 5TDNB 1T22B 5IREA 4IEFA 3M1CA 1RZIB 2O6EA 2V7NB 2FH6A 5FKPA 3L9EA 4DCQB 2X6VA 3TIDB 5BVPH 4LL4A 3U9PL 5KTEH 3QQ4B 1WWWX 4A2LA 2VC2H 4AL8C 3GSQA 3CLWA 3DARA 3DRQB 3BT0A 4PY8J 3NRPA 3NOIA 2LLGA 1IT9H 2QPFA 2MKWA 2ZUQB 3NSDA 3ARTA 2JB5H 1Q0YL 3HG2A 4ELKB 3RJQB 4AW4A 4RH4A 2NUTB 2P7TB 2UYLB 1Q1JL 3WN5C 2YJQA 3OKKB 4R2GB 3WFBH 1I1FB 3V4PA 4YHPB 4S0HA 2CKBL 5EOQH 2CUHA 1RPQA 1UG9A 5TH2B 1EH9A 1MCHA 4PGCA 5C0CE 4A67A 4CU6A 5CEZD 3WGVB 5E08H 3QI9B 5D6CA 3QORA 4XCYB 5ITFA 4MRCA 3HI1A 4CBZA 4F8NA 1DSWA 1KZQA 4HJSA 4CW1A 1MNUH 5D7LB 2P5EB 5C0GA 1BJ8A 3PU7A 2Y23A 1T1YA 2WNKA 1ET8A 1XGTB 2QQQA 3DURA 1L7IH 3MXVL 1V3LA 5KWYC 3DXAE 3APDA 3ARED 4UDUB 4F58L 1SUHA 5I1LB 4X6DE 4DEUA 2EYTB 1HCZA 3FUNA 3QW9A 4PP1C 1G7LA 2FWOA 1E6OH 5C0ND 4XO3A 3TBVA 4Z6AT 5IQ9B 1FBIL 2OP4H 4GBXC 3AJ7A 5E51A 1TNNA 3NA9H 4PRHA 1IL1B 2APXA 2HTLD 3TEWA 1S9YB 4I2XB 4Z78A 4YPGB 3BZ5A 2GJZB 3CVHH 4FQIL 5FUZL 1R3HB 2NTSP 3QIUC 4G42B 1JHTA 5CJ5A 3VH8B 3LQAL 4ZMZA 3UG3A 2ZWZA 3QFJB 2YEVB 1FZJA 3KWUA 4B60A 1E9QB 1W80A 1QR1B 3SKMB 1FJ1B 4KMQA 1OTSC 1IIIA 2HA1A 2IPKB 5ERWB 4ZX6A 2CUMA 2NXZD 4N0UA 2VR6A 4GAAA 1BLNB 4NQCB 4R7XA 3CG8A 4V1DA 1RUPH 2FX7H 1C12A 5HXMA 1WQVT 3BFWA 3NJMA 3GRGA 5BRQA 1RK1A 4H8WH 1ZVSB 2ZYRA 2B4CL 2O6DA 3C09B 3MNZB 2VQ1B 4FMVA 4KROC 5IMLA 5AOMA 4XWGH 5DRWB 4RDQG 5FHAH 4IRJA 4ZMNA 1NANI 4FQJL 4PMFA 3WD5L 1WWBX 3WEAA 1VF5C 2KLSA 4NO3B 3GBDA 1ORSB 1SDYA 1TEGA 1FFOA 4YZFF 4LLMA 4U05A 3L9RA 4M1CC 4ZDHB 1DVTA 1CXFA 4NCDA 2Z7ZA 5T5FL 1DL7H 5D1XC 5DRZB 1NINA 4GBXD 1TMQA 1PGRB 3L7EB 4R5VA 1RURH 5K39A 2ZCLH 3PXJA 3VFGL 1JERA 3DOSA 1MQKH 5D2LF 3MRRA 1LDSA 4HIIB 4JY5L 4DGVL 2GEEA 5C0JA 4C56B 3QIUD 4PRPD 4CVWA 2KMWA 2OR9L 4OQTH 2WVSA 3W9DA 1ZLUK 4AEHH 1ILSA 3SPVB 4OF5A 3PAUA 3QR0A 5C0AE 1I85A 1QNZH 2BSSA 2KI6A 2YXFA 1KN2H 3KXFD 4ZW3A 5KSAA 3AMKA 2IH1B 2A3TA 4JVWA 1FCGA 2HFFA 2AJYH 3UADA 2ZG3A 5MENE 5E5RB 5F6IC 2KLRA 3NGBB 1IBFA 2FEEI 4XVSH 1KB9K 1GXEA 4GAYB 2NCEA 2Q3ZA 3AB0C 4I0PC 4NYLA 1RIHH 3IJSA 4G72B 4F80A 1N0LA 1QBLL 5JMRA 3H85A 4KROD 4P5TB 2BVEA 4M02A 2DW5A 3D52A 1M71B 4N9OB 5E2WH 5I5JA 3ROOA 1IU1A 3G04A 1JNHA 4JFDB 2DEXX 3TZVB 1JV2B 2BSBA 2GAZA 2J88H 5I82A 4YSAA 3IMUA 1FYTB 3W38A 1ZXKA 1X4YA 1D9KC 1JVKA 3RYMA 3B3IB 1P4IL 3LNHA 3NESA 1E9OB 3AACA 4CILA 3IVKA 2PO6A 4YHZH 4Z7WE 4YHML 4FQPA 2B16A 1HHGA 4CSPA 5IB3B 4WCYH 3GM0A 3IDYB 3GIZL 4H25B 2YPLD 1A4KB 5GIRA 1UC6A 2JCCA 2A6IA 4IM8A 4W68A 5I8KL 4N22A 4X9BA 2FX9H 1WICA 3NSYA 1OCZB 1GGBL 2XTSA 3MYJA 3VFVA 4AQAA 2LQRA 2D31A 4XE5B 4Y88A 4YXLH 4ESKA 3NFPA 4NO5B 3ZYIA 4UQAA 3RWDA 1DBJL 4NQXA 1IM9B 4BFBD 4M7KH 2DWDB 1WO2A 3RIFK 1LP9E 3KPMA 3QCTH 2DN7A 3K0YA 5IQ7H 5CEZE 2EO9A 4YC2B 2WINB 4W9DC 1HH9B 1IKOP 2LAGB 3C60D 2CDFB 5FEBA 3QEGL 2DLFL 5EC1B 3D9AL 3PXHA 4I0PD 1A2YA 1DE4A 5CCJA 2R1XB 1ZK5A 1I8LA 2BNUA 3M8OL 1HWWA 1INEH 4D94A 3SPCA 5IV2B 4YSSA 2J8OA 4XPFH 4EIZC 1UFGA 2PLTA 5CUSH 1TQSA 2X4PB 4HWUA 4ZS6C 3GK8L 4JG9A 3KM1A 2QQKH 3VQ1C 2G9HB 3KCPA 5D70H 5D7SH 1NKOA 1XZ0A 3WKYA 1D9KD 4GKZA 5DHEA 1CT8B 2A9AA 3PPEA 4XN9A 4OI8A 2CPUA 1J8HB 1YEHL 4XH2A 1W72L 5GHWL 4UT9H 1ANUA 1KB5H 2Q7YB 3EFOB 4PVNA 3TL5A 4PRNA 3GMMB 4LFHG 4GP5B 3LKQB 3VI3A 2YD8A 4P05A 3O3AB 3TCLB 2P3YA 3MJ7B 4AKQA 3VVVA 2I9LB 5KSUB 2IAMD 4ZFOB 4ODXB 1AY1L 3V4UH 5IKCB 5ABZA 3HFFA 4AQEA 2ARJQ 4AZ8A 3Q0HA 1G7QA 5FLUA 2GC7C 4OLVL 5IQMA 4YHIA 3ZKNC 1TETH 2VRKA 3CDFA 2WAQA 4G8GA 4KRPC 3F01A 4EDXA 5IFAL 1MW1A 2JK5B 3ECBB 5IMKB 2A4EA 5IQNA 1AGDB 5AW5B 5DGQA 3U7YH 3PP4H 2VT0A 2QQNL 5E00B 3A47A 4F7MA 3HEIB 1MWOA 1NEZA 5E8DH 3NTCL 2KZ1B 2H1PH 4YXKL 2F1AA 2YD4A 4ZPTA 5MI0C 4PLJC 2Y5QA 4PJ8B 4WI7A 4W4OA 4OIFA 4Z7VB 1AIZA 3HW7A 4XZUB 4CAGA 4R96A 1XBRA 2Q76B 4LSRL 3E2HB 1XGRA 1JXKA 4D0BB 4NQTA 1YY8A 2W0LA 4ZS6D 1CUOA 1YEIH 4MQXD 1E65A 4WSJA 2MHAB 2VDLH 4HPHA 2H45A 2WVTA 4ODTH 3WU1A 2G75A 3LZPA 3QG6A 4MNQB 3JXAA 2QVTA 5ISZD 3SZKC 3S5ZA 1CGTA 3H6AA 3DK0A 1YECL 4PRPE 4EBQL 2EABA 3A3YB 3Q5YA 4WHCA 4KXZH 4JM2B 4QHKJ 1JGUL 1LK3L 2AK4D 3MBWB 3NSXA 4OZHE 3KDMA 3KLKA 4G5AA 3GRWH 1ZT7B 4OZGE 3KXFE 2CJ3A 3MBEA 3PFUA 4X42A 1EHLH 2CR3A 5D2NB 2YIHA 5J6GB 4Z0BL 2UWEF 4WKZA 5BUGA 3UAEA 5B8CB 4P2RB 3ELAT 3VGAC 2FGWH 2DWYA 3VFWB 3ZKND 4CL7A 2RFXA 4JHVA 2VERN 4KRPD 3ZRSA 4L29A 4NRZB 1LD9B 1GMIA 1JXGA 3MACH 5AAWC 1KPVB 3SJVB 3AXIA 3TA3A 2OCJA 2P5WE 3WLBA 1UUNA 3NJHA 4XX5A 5CN1A 1HEZB 4YAQA 5IF0A 1BVLB 1O5DT 1L6PA 1RUQH 43CAA 3ARSA 1I8IA 4R7LA 1CTMA 3IWVA 1RAMA 4CU8A 3FB7B 2YO3A 1UWGH 3KPRE 2VXUH 4UT7H 4EI5B 2NXYD 4HCRH 4Y4FB 4GKSB 5H37G 4UMGA 2OM5A 4JGJA 5BRZD 4YHLL 1FNLA 1R75A 2VYRE 3GIVA 4LU5L 2WOBA 5L0QC 2B1HH 2Z65C 4PRBA 2YUZA 4UV7L 1KPRB 5DZJA 3RQ3A 3OHMB 5H94A 1KBKA 2Y06L 1UOVA 3TEXA 2PWEA 5L9DL 4TQHA 2ALAA 1RJZB 2NUPA 1F1GA 4GI9A 3FCTB 4IU3A 2V2XA 3QNZB 4HKJB 2ZE0A 3K72B 1SOSA 3EO0B 2K6WA 3DJZA 3DUUB 4L3AA 4XN7A 4PGEA 5CSBA 2WW8A 2R2BB 4F7CA 4OM0H 5CIPB 5ALBL 3Q8FA 3G3LA 4LRIA 2PXYB 5DHYB 2FIKA 2LVCA 3VFPB 2Y22A 1HN1A 1HAWA 5TGBB 3O41B 3KVDD 2FCBA 2FSEB 2Y7QB 3O8XA 1ADQA 1UYWH 1ZLEA 4RZCA 1OSYA 2DQJL 1SVCP 1ZTXH 5E7BA 2NT0A 1IFGA 1GCFA 4GI6A 3R4RA 3QQ3B 1RZJH 3MCKB 2LABA 2NCMA 3BEWB 3QDMA 3WENA 4A7QA 1PZ2A 1Q9LB 4GRMB 2CCLA 1PLCA 2ERJC 1RPKA 3HC2A 1ZLWH 4LBAA 5B1JA 2OMYA 3I9IA 1ZT1A 2YGPA 4LASL 4WV1A 5KZCB 4XCEB 2RHEA 3DX7A 3T8XB 3OVUB 3QPXL 1YCSA 2QV2A 3WEMA 4S2SB 4XN5A 3B2VH 5LJYH 2ZONA 1JGVL 1HL8A 2ADFL 1MDTA 1C5CH 4TSAH 4FZ8H 3BQUB 4TLUA 3SGKC 4YR6B 4FLSA 1DR9A 5AYUL 4M5YH 4CGUB 2IADB 3IFOB 3CSTA 5HDOA 1KCSH 2ZJSL 3ZL2A 1IGCL 1MRFL 5CLZA 2NY2C 2XA3A 4PJEB 2O5ZL 2XKNA 4BSVB 4MDJB 1GZHC 1P9MC 3RI5K 1EXUA 2YD0A 2H0EA 2DMBA 5I16B 3GO1H 4JO5A 4N3TA 1BGXL 1VACB 4HLZH 5EEVA 1NIBA 3UMTA 1NFAA 4W81A 4PREB 2NY6B 5BVJA 2CSPA 1MDAA 3CDZB 1KJ2L 3AT8A 1TJHH 3VXPB 3CDCA 3WY2A 4YXHL 2I9TB 1PYWA 4TNFA 1HVXA 5ACZA 3O2VL 1V3KA 2W8CA 1IAKA 4LF3A 4DKFL 1X7QA 2UY7B 1DBMH 2C3HA 4Q0XH 3OB8A 3POHA 1DQQB 3HVDA 1I7TB 5E1HB 4Z7UB 3WL9A 3P9MB 5G5DA 4AYID 1Y18A 1OZTG 2C34A 3BZ4A 3IDNA 2B2XL 3WHE1 1MCPL 2P44B 3HHRB 4NT6B 1JWSA 4FFTA 3AS2A 4HWZB 5I17B 4BE5A 1J0KA 5LKNA 4KXDA 1BEYH 3VXRD 5I1IL 4WKXA 5ISZE 5DJ2B 2V3FA 1I7ZA 4LSUH 4AY0A 5BRPA 5CM1A 1KTLA 4H5SA 4FLQA 4MNHB 2EUZA 2UUDH 2AK4E 4MB4A 4WNJA 3AG4B 3HI6H 2IJ0C 3UDWA 2PWGA 5HYSB 2WVVA 3GMRB 3ZQ9A 2ESVB 4BZ1A 4Q97A 4JKLA 2Q86A 1CG9A 1OAKH 1EO8L 4DTGL 4JG0H 3WNPA 1RSFA 4A7TA 5F9WB 5L4MA 2NY2D 4L4VA 3FUKA 1UOWA 4U2ZA 1J5DA 4FA7B 5IR1A 1FDLH 4ZSOE 3LEYH 1A4CA 4LDOB 5DJ6B 4R0LB 3HS0B 2WIMA 5JW5A 1S7QB 1IUZA 4QO1B 2X42A 2W38A 2JTDA 3HC0B 1KCVL 1T4KA 3D69B 5GSVA 4K8RH 5CBAA 4P5KA 2GIMA 4KK5D 2F53D 2CJSA 4DPBX 2H2PC 4ODBD 3BRFA 2M8XA 3FHQA 3FSAA 2BHYA 2XU9A 4ERSL 4U1IA 5I75C 4G7VL 2WN3A 1GTNA 4HUMB 5BRZE 4QRRB 1EHKB 1T22A 3BCDA 5TDNA 1DANU 2ZWKA 2CLZB 5T3XL 1RZIA 1I7RB 4X5XB 2WXHA 4DCQA 5K33A 3TIDA 2VSMB 4PBDA 2MMXA 4J1UB 5T1DL 1LO5B 5T3ZE 4N0CC 3T3MF 1Y1DA 1R9FA 1J0ZA 1Q0YH 3CN0A 2WBJA 3DRQA 3NDYE 4Z7OB 2QSVA 4IRSC 1D2PA 1Q1JH 4K9EL 2DQTL 4PJDF 3QJTB 1WAAF 1S9XA 3MLPA 1ZV9A 2DAVA 3L3DA 4ELKA 2CKBH 2Y7LA 2P7TA 2UYLA 3FONB 3GSRB 4L0ZA 3BPNC 4R84A 1KTRL 1UXWB 3OKKA 1X4ZA 5F0PB 1I1FA 4AJ0A 4JKPH 1MWAL 4YHPA 4ZT1A 3HZKA 4G2AA 5TH2A 5D5MB 4B3EA 3QI9A 4XCYA 3ATEA 2WBKA 5D7LA 2P5EA 4LNVA 1VPOL 1ROCA 4F58H 4N4YB 3T6QC 1T6BX 1KBWA 1OF2B 1XGTA 3NJFA 2X9YA 3VXNB 3GXPA 2B39A 4DK5A 2C9RA 6PCYA 1KYAA 3OF6D 2A1WH 2P52A 4MZIA 3K6SB 1FBIH 2CBOA 1IMHC 2ZUXA 1TR7A 2EYTA 4KK9D 2H3NB 3QPKA 1FNEB 4BD4A 2OTUA 5IQ9A 4FQIH 1PMYA 2H2PD 5FUZH 8PAZA 3A6OA 3QHZL 2BS8A 4IK6A 1IL1A 4Y4KA 5I8EB 3JQOB 4I2XA 3W81A