4D8PA

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
184
structure length
184
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA-DQA1 protein
total genus 35
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pA01
3VMNA 1XGTA 2Y07L 4ZS6C 1S7SB 1CT8B 4HJJH 3GRWL 3NFNB 5IM7B 3BUYA 2YOCA 3S36H 3S4SB 3VGDA 1MVUA 4M93B 5BXFA 4R8WL 1ZLVH 3LEVH 3GB7A 2Q7YB 4G9FB 5ETUB 3GNML 5FUCC 3L1OL 2BHZA 2LU4A 4OCYH 3RDTA 1MCBA 2RR3A 1FAKT 3FN3A 4ZNEE 5KANI 3FFDA 4H1LG 1KSRA 2OTUB 3MRQB 2V2XB 3QEQA 3R06A 2CGRL 4CUCA 4P23B 3VRJB 2CMRL 4TTGA 4GG6E 4HSQA 1ORSB 2Q6WB 3ARGB 4RQQB 3KYKL 4LLUA 2KBGA 4ZAKC 5HJ3B 5KSBA 1ZGLA 1G7IB 4LVHC 4X6FA 3GRWA 4ZFZB 1EHAA 4WFHD 3BESR 5KZCB 2VH5H 1AE6H 3VI4E 1DBAL 1L7TH 3T0WA 2X70A 4MX7B 2NXYB 5IBUB 3ZE2E 4C56A 1F4XH 5CJQL 3DROB 4V1DB 1GOGA 4UV7H 4DUXA 2DQFA 1P4BL 3H9HA 3H0TA 3OG6B 1NMBL 1HYSC 1HH6A 1I3GH 5B22A 3ULVE 4GRLB 3MV9A 5DO2C 4M43L 2D9QB 2ATPB 1BGXL 1T2XA 3TVMA 1LEIB 1QSED 2QSQA 1DQJA 4HEPG 3MV8B 5IW1A 1CICD 3HE7B 3IU3A 1VDGA 2ADIB 2CKBH 3H3KA 5E2UH 4PV8A 3IU4H 2P24A 4HC1L 1T22A 3KXFE 3DYOA 2NR6C 1YMMB 5BOPA 3SDDC 4TULL 1MFDL 4NCC2 1A14L 1QP1A 5E7FA 2EDYA 2APFA 3EUUA 4J3TA 1XCTB 1T3FB 3QO1B 2QQNL 4XMPL 3RVVD 5I71B 4C58B 4OM1L 1CIDA 4I8DA 4LSVL 4LCWA 2YK1H 5FK9B 4H25B 3ZKQD 5D8JL 5FGBA 1MLCA 3EOTL 2FATH 5B3JF 5J6HB 3WHXA 2L0DA 4LAQL 4M7LT 1CDBA 5C2BL 1AY1L 1U3HB 3QG6A 4KV5E 3DIFB 1AJ7H 2F5BL 4CRPA 3IGAA 4UILH 3TV3L 1QHOA 4IRSC 4RWHA 1CT8A 5I71C 3HMWL 2P8MB 1PW3A 5KOMC 1JZ4A 3BUYB 1W8NA 3BPCA 4NKDB 5DDHB 2D2OA 2DI8A 1XIWD 5IKCA 3CZFA 2ICCA 1HHKA 3DO7B 1MJ8L 2ZCHL 2XXMB 1AO7A 3R0NA 1F5WA 3QO0B 3CLEL 3T04D 1RULL 3LKPB 5IBUG 1FNEB 3X12B 1QSEA 4JPIB 1LP9B 2HJFA 2VH5L 4R90L 3R4DA 3OKDA 3MRMA 8FABA 3BXNB 1R24A 1GZQA 1I3UA 5FECB 5C0BD 1A7PL 2GW5A 4XP4L 1NQBA 4U6HB 1BX2B 1ZT1A 3MXWL 1UM6L 3BRDA 1SY6H 4QRUA 5DQJB 4FQIL 1YEFH 4U6YA 4JFQA 1E27B 1XFPA 4GAYA 3OAUL 2ARJB 3EDEA 2MQ0A 5C92A 4HH9B 2XQBL 3GSNA 3CH8A 3F8UB 4KI5E 1BZ7A 1DLHA 2GT9B 3P0VL 4OF0A 3H9HB 3HZYB 4WTZA 1AGEA 3ES6B 1ONQA 3Q6GL 1MUJA 1OD7A 1GAFL 1UWEL 5DMIH 3WFHB 4Y2DA 1YA5A 3HUJA 4K7PY 4LLWA 4MXVE 4XC3H 4C83A 1LNUA 2HVJB 4PV8B 2JK5B 1BF8A 1Y0LB 2R4SL 2BCKB 4PRNB 3SGEI 3WDJA 2X4UB 4AEIL 3D69B 1JBJA 3SE8H 4P9ML 3BZEB 1KB5A 5IJKC 3KS0H 2E9IA 4CDHA 5HGHB 3TEUA 2XY1A 4PJ9C 2YZ8A 3G9AB 4D0DB 1F58H 4NKMB 1DBJL 2HRLA 4EN3C 5KBNC 1I1FB 4HG4J 3MRHA 1Q9WA 3OZ9H 5ID0B 1U8MB 2ERJC 4FZEH 4JANA 2IADB 5IIEA 2FCBA 1J7VR 1RZIA 2NXYC 1U58B 5F7DA 3L3HA 5D1QC 5HYFA 1SEQH 2RJMA 4Y1AD 3HTLX 3LSOA 5F7NC 3QXWA 3AS3A 2QADC 4AM0B 5EZIH 4OQTH 1U41A 3ULSA 4N5EC 3QDJB 1A7BA 4N0YL 5CBAA 5IV2A 1YYMH 3STLB 5GISH 3WFDH 1HSBB 3O3EA 1JYWA 3DHJA 2GFBA 1GZPA 4WWKA 1MCNA 2X4TB 2GIYA 4HCRA 4WUUA 3MA9L 1MJ7H 3VWKA 1I8LA 5IEKB 1NL0L 1LWRA 5FUOH 4RIRB 1NCNA 1KIRB 4S1DC 5E5MB 1CS6A 1F6LL 1HKLH 3C9NA 3DURB 4PJFB 3MRMB 1D6VH 3V6BR 1IC1A 1IM9A 1XGPA 2R2CA 5JOPE 1C1EL 5IHZB 2O5ZL 1YMHA 3PL6C 2ICWB 3BDXA 4V2CB 3T2PA 5FCSH 1WTGT 2H32A 4JFDE 1DQTA 1EHLL 1G7MB 2BNUA 3PNWA 4Z7OF 1MHPH 4P4KA 4IDJH 4M1DL 1UCTA 4ZO8A 4M6AA 5E8OA 1SJVA 4GAYB 2ARJA 4EDXA 3KDMB 1PKQB 4FXGB 3PABB 5J1AA 2NLJB 2VQUA 1KB5H 1ZGLP 1U42A 1OTTC 3SKMB 3D3VD 2C4XA 5BO1H 2WZPD 4H0IA 5T5FL 5BVJB 5BV7B 3B83A 5TFSL 2GCYA 3U9PL 2PKDA 3TNNA 4YHYB 1KEGL 2ZOKA 1CVSC 2WWMD 4LLWB 1JZ6A 1SM3H 1UXWB 4X7EC 3T8XB 2VZVA 5FO8B 4LFHG 3T3PE 4M02A 3REVA 4XP6L 1ZLUH 4GG6A 4NSKA 3U0PB 4K3EH 1FNSH 1B4JH 3N50A 5SV4A 5KZCD 3UTSD 1BEYL 2Z92A 5JQHC 1AGFB 4M5ZL 1Q9OB 2MMXA 4TSAL 1F42A 1PLGH 4PJIB 2ADFL 3Q6GH 5C0CA 2CK0H 4PRHB 4PRID 3K0WA 5F8QC 3X3FL 3RU8L 3PWVA 1HHIA 5KVEL 4Z7QE 4HKXA 3GHBL 4OUOA 3QEUA 5ABDE 2D7MA 5JW4N 2BFVH 2C3WA 1ZLWK 1FLTX 3C60C 4JAMA 2IAMB 3GUTB 1A4KA 3ARDD 1CL7H 1K9TA 3JTTB 4XMKL 2XZCH 3QDGB 4PJBF 4HUUB 3V4UL 3Q48A 1JE6A 3ARXA 3HE7C 3ULUH 1IAIL 4KRLB 5D70L 3KPRD 1E4KC 5DJ6B 3VGAB 1KCVL 2A6JA 3MBXH 1NGYB 2GAZA 3Q5YA 1ZLUK 4OCNC 1DDHB 2H26B 2X4SB 5DRXA 3BW9B 5IVZA 4DZ8A 4S1QL 4WTZG 1AR1C 1YEEH 2FSEB 1CXHA 3RX8A 3V8OA 4K8RD 3MJ9H 4F8TA 5DMGC 3DGGA 3VXPA 4U1LB 4NN5C 5DQ9A 4LLDB 1S7XB 2NY0B 4LHUD 2ZKHL 3DPBA 3WN5B 3HC4H 4KJQD 4WI9A 3PDGA 2BP3A 1HHHA 1QVOA 4DVRL 1NUNB 1BQHB 2EDWA 2WMPA 2W0LA 4HEME 4X5WB 4YHLH 3B9AA 1YJDH 2GJ6A 3N9GH 1C08A 4HGWB 2AK1L 4KK9D 4GLRH 4NWUH 2GCYB 4NKQB 3LIZH 5CEXA 4OB5L 1G7JB 1DVFC 2L4OA 3ECBB 1E6JL 1A1NA 4Y5XA 4Z7WE 5DRNB 2YPKA 3L9RB 3IJSB 3ET9F 4LCCA 3VGFA 3WKNA 1UXWA 5DMYA 4OIIL 5EO9B 32C2B 3LRHA 1G9NH 4HIEA 1RZKC 1JPTL 3QDGE 4P5TB 1HI6A 1F11B 2AVGA 4JN1H 3W0WE 3ZKMD 3EGSA 5J3HD 4LASH 1NMAL 2PR4L 5JPNA 1NFIA 1JHTA 4GBXD 5FYLL 3VXTB 3PV6A 2Y6SD 4QRPB 4KXZH 4CW1B 4PY7B 4PLNC 4WEMB 1TZHA 1DLFL 3FZUC 3BP5A 1JL8A 4PJDF 4PGBB 3RVVC 3MRGA 1V7ML 4Z5RA 5C9JA 4JO4L 4PJAB 3ARFD 4QF1B 3BN9D 2GJZA 3H9ZA 1QLEH 3QFJB 2FJHB 1I4FA 1NKOA 1FJ1B 2JB6A 1IQWH 1CDGA 4Z8FH 1T89A 3MJ9A 4WW2F 1T83A 3HI5L 3FO2A 2I07B 4ZQKB 1ZHBA 4HUUA 1JMZA 4ELKA 3VFOA 4EZMA 2HVKB 2W59A 1CDUA 1LO4L 3KPSA 5BRZB 1RU9L 3VXSD 5JDSA 4N1EA 1CGSL 4L9DA 5GRZA 4XPFL 3AY4A 5ECJE 4MDJA 2XFXB 5KW9L 1TLKA 3BW9A 4QTIL 1SYVA 3T3ME 4S1DD 1AH1A 4LMQE 4CAGA 1FO0A 1YEHH 4JLRA 4NO0D 1GGIH 1Z3GL 1KIQB 1AQKL 1PG7X 3T1FA 1RIHH 2OXHA 1URLA 2EYRB 5JHDE 3VDAA 5JW3L 1A14H 5B38B 2C1PA 1N5AB 5I18H 3SKOB 4RFOH 2OK0H 5E70A 1IAIH 2FWOB 1JTPA 5LWYL 4HS3A 2UVEA 1BVKB 3WFCL 5DVOA 4K9EH 1MLBA 2AXFB 3BH9A 3C5JB 1A6UL 3C8DA 4P2YA 2MPAL 1QVOB 1DQDL 4WW2B 2V6HA 2VLJB 1BJ1H 1A2YA 4MQXD 3ZZ1A 1QFWL 4OZ4B 1U8PB 4K55A 1GH7A 2E6JA 3SCMB 3QDHA 5IMMA 1MCJA 2HLAB 2WANA 1E6OL 3GMMB 2EE9A 1BZ9A 1LEGA 1OTSD 2AJVL 3PGDA 5FO9B 4FHBD 2ZUWA 3H9SD 1EHNA 3RGVA 2V7HB 4LKCA 1ZMYA 4NRXA 3MLWH 4JDZA 4NO5B 3MREB 2DQGL 5B4MD 4N68A 1FYHB 3QI9B 32C2A 5TDOB 1CE1L 1G7LB 3B9EA 1BQSA 5J13B 4U1HB 2AQ2A 5ILTH 3DMMA 1IGMH 2G75B 4CL7A 4NZRL 1XF4B 4JO4H 1IGIL 1JHTB 2VDRH 2NX5A 4Z7NF 5L0QB 3KNBA 1IQWL 1KCRH 1KPVA 2XZAL 1PG7L 2VISB 5I75C 2CH8A 4Q2ZA 2BVQA 5GQBA 4XXCA 3GSRB 2PXYD 5CWSA 1U91B 4TVPH 1UB6B 2GTWB 3UTQA 4JDVB 5F9AC 3D39D 4OV5A 4ODVL 5ANMA 1NC4B 4NM8L 2WIMA 1J1PL 1DBMH 1XIWA 5FB8B 4YZFF 4JFDD 1E28A 1R6VA 3JV5A 4MLIA 1V3KA 4CU7A 4MA7H 1XH3B 1WUNT 1AQKH 3QRGL 2DQEH 3D48R 1TQCB 2AV1B 1P2CA 3OPZH 1UWXH 5DHYA 4X0KB 5IOPA 1TJGH 4JFXB 3DX6A 4R6UA 2OJZH 5F7WC 1KV3A 3QUML 1SYVB 5I1KH 5D1ZC 3CMOH 3ZTJH 3IKCA 5F6IC 3VFGH 3VW3L 1JNHB 5EG6C 4RWYL 1T20B 4LRIA 4JJHA 3MCLL 4E41B 1B0RA 1T1ZA 4LQFH 2V17H 4HKZA 5DUBA 3IDMA 4OTXL 1N2RA 1MFEH 3MPCA 5JO5B 5E6ID 1A4JB 3KPRE 5HBBA 4E0RA 5DF0A 4PJEB 3LQMA 2HKFL 5D1XC 2IALB 2NY6B 4LOUD 1P1ZA 3MACH 1DQJB 3EFDL 3NIFE 3WKMH 5CFHA 5CEYB 4O2FB 1ZANL 4U31A 1UKSA 2H6PB 3X11B 3VXRE 4DVRH 2VXTH 3GMQA 4UAOC 1KIPB 3LEYH 4KWUA 4XWGL 3QO1A 3FB8B 4PB9H 3SPVA 1P4LA 3L3GB 4R2GD 3S35H 2XWJB 3SN6N 1X5KA 2VZOA 4K2UH 4C54A 2EDRA 4PV9B 3T4YA 5I66B 1INDH 3MA9H 3WHXB 1A6VL 3C60B 2YN3A 4LBEA 3D3VB 4PJ7F 1UB5A 4TTDC 1WAAE 1CICC 5EZOH 3TWCL 4MJIB 4X4XB 3U1SL 4LHJB 1VFAA 2Q8BH 5DSCB 3R1GH 4LASL 4GQ9H 4I0PA 1J1PH 4K71C 2D0GA 3CDFA 3FFCE 5AEAA 5IR1B 3LD8C 4C57C 1Z9SA 1KPUB 1CQKA 3RDTD 1SBSL 3RBGA 2DB8A 2OS7A 4ZFOL 4P4KC 1D9KD 5E2TL 1JF5A 4DGIH 3WUWG 5D2NE 1Q94B 4PTUB 5ICYB 1CVRA 4U1MA 3T0XA 3O2VL 1IEAA 2BXZA 2OL3A 3FQWA 4G6JH 4M6MH 3VWJC 3S4SA 3PWPE 5JHLH 3O41B 5FEBA 3KWWA 2E3VA 5T1LB 4ZUWB 2PO6C 3THML 3C5ZC 3MLTB 1XH3A 1NGXB 4Z95L 1A7PH 4P5MB 4RGND 5EU6D 3U9PH 4ZAKD 4JPKL 5HYJE 2YMXH 5ESVB 1LO2H 4MNGE 5FV2A 1LO4H 3HAEB 4WUKH 4QHNA 1EGJH 2R8SH 4U33A 4JGUA 4JN1L 1JNHA 5HHMB 2Z93A 2DKSA 4G3YH 4Z9KB 3U36A 4HH9A 5C3LD 2PYEA 1KG0A 1NBYB 3VFVB 1OPGH 4NQTA 5EORL 5A16B 2RIKA 3H9SB 4WI7A 5GS1B 3MBEA 4L4TD 3G5XA 1JGUH 3TIEB 5JQ6H 3RP1A 1RMFL 5DFWH 3MOAL 2IALA 1XF3B 3EO1A 1AI1L 4S1SH 4M1GL 1GGYA 2VE6A 2DJ4A 2PXYC 2X70B 4W6YB 3V2AR 3WD5L 3REWB 2ZUVA 3HUJB 4RDQG 3VFMB 4EI6B 4XAKE 5H8DA 4P2RA 3JWOH 2J8UF 4YO0B 1IC5H 1DUYB 5DEZA 3UEZA 4O2FA 3GBML 3MXWH 1MY5A 3MLXH 1QPXA 1HIML 1I9IL 4NQXB 5JIPA 1HH6B 2V17L 4NN7B 4P99A 3EKCA 3TYFB 4U1JB 1C16A 1IL1B 1KB5B 2VDOH 3BI9X 5A3ID 1IGCL 4NRZA 2YPLB 4LDOB 3HE7A 3IU3B 5GGSB 2VWEE 4PJ5D 3RVUC 4POYA 1XGUA 1SEBB 3NA4A 4XRCB 4YHKH 1U8MA 3P0VH 1H3XA 4MHHI 3MLRL 1T66C 3QCTH 1U8HB 5DR5H 3LQZB 3D3VA 2R0WH 5DK3A 1I1CA 4H8WC 3TT1L 4XH2A 2XZZA 4U05A 3GBNL 5I8EA 2IFFL 1HDMB 1U92B 4MDIB 1NGZB 4U3CA 2JJTA 5L2KD 2EKSA 3RVTC 4BQCA 3QDJA 4Q6IB 1I7UA 1DVFB 4L8CA 4MCYA 2QV2A 3LRSB 5IK3B 1R3JB 1OAZL 1K8IA 1U6AL 4PTUA 1C7TA 1EJOH 1XF5B 2VDKH 4FQCH 1X7QA 4P2QD 4OFVA 4JFPA 2PO6D 5I15H 2F5AL 4KUCD 3QHFL 1NGWA 4ZFFB 2V2TB 4LVNB 3V0VB 4NQDB 1IM9B 1XGPB 3U46A 1G1YA 5LAXB 3KVQA 2XN9A 4FTVD 1QSEE 1UQSA 4UDTA 4RMRA 5D7JD 1L0YA 3VGHA 2A73A 3GGWB 4BUHA 4TSBL 1FNEA 4XC1L 4DGIL 1GRWA 3IDIA 4HIIB 1RK1A 2R2BA 4QXTA 3MOAH 5H37H 4YBQC 5J12C 4ZTPH 3BXNA 1QKZH 3PGFH 2Z31D 5CJOH 5C08E 2VIRB 4JFED 5KVFH 4LARL 2YPVL 1CDHA 2FD6H 1RUKL 2X1OA 3TBSA 1CLOL 1I9RH 1GJIA 4IIQB 4ODBD 5FO7A 2HMIC 2EH7H 5DJYA 2VLME 1PX4A 3NTCL 3UJTL 3VFMA 4EI6A 2IJ0C 1CFBA 3OJDA 4ODVH 4Z7UB 3U7AA 3WSQL 1J05B 3HC3H 1X4XA 4M48L 3RNQA 4GSDL 3WDHA 2N56A 4C59B 2OTWB 2GSGA 3U4EB 3WIHL 2PXYB 4EVNB 3ISWA 4HGKC 5J3HC 3ZKMC 5I1GH 2BNQE 3IYLW 4GQPH 4M5YH 2OZ4A 5MHSE 1KTRL 2FIKB 1FQ9C 4FFVC 5JQ6L 4IOIB 5EU5A 4AEHL 4YAQB 2DYPD 3UDWC 4XNYH 2DLEA 5T33L 4Y2DD 5B8CC 4K3GA 1MHCA 3QH3A 5D5MF 4PIRF 5FGSA 2APWA 2IH1A 3U0WH 5IGXH 3IRPX 2HRPH 1AD0B 2BX5A 1DEEA 3OX8A 4BQ8A 5TFSH 1CBVH 4NKIL 4FABH 3QEUB 5ISZD 2MJWA 3NOIA 3ZE0E 3D18B 4M1CC 5C0CD 3MRHB 1Q9WB 3T65B 2VLJE 4XPHL 1D9KA 4G9FE 4HXAH 3W0WD 5FFLA 1X44A 4AY0A 1EUTA 3SO3B 4F80A 5D1ZD 3GDBA 4YBHA 4JZNA 1JZ8A 1MRDH 1U58A 1KJVA 5I1LB 4Z76B 2J5LC 1J11A 3DXAA 1K8IB 4QEGA 3RKDC 3SGKC 3QI9C 4OAWA 2IBGA 1MEXH 3OHXB 2H26A 1LGVA 5B39B 3FO0L 4I5BA 3NA9L 2P4AB 1WCBA 5GZNC 3ZO0A 4XP5L 3HE6A 5AAMA 1I3VA 3QEQE 5LAXA 4DKFH 2XN9B 5EO0B 1CDYA 5CJOL 1AO7D 3WJLC 5CKAA 3ARBC 3T4AB 1GGCL 4U1LA 4HPYH 5IB1B 1WITA 1EJOL 4PJFA 3WN5A 4R9HA 5EOTA 1B0GA 1QR4A 1HHHB 4TVPD 3SKJL 2AEQL 3QEGL 2VIRA 2A9NL 4HF5L 2W9EH 3BGAA 5ITFB 3W82A 4BH8A 3JV6A 5C0FA 2KZWA 1VA9A 5IFJB 1G7MA 4PJAF 3OXSB 3VFWA 1IZJA 3PWLA 3W2DL 2F54E 1FIGL 1JHKL 4XI5C 4EUPG 1Z2KA 4XNZB 4TSBH 2M1KA 4HMEA 1VADB 2X10A 2Y5EA 1AHWB 4NJ9L 5GJSH 2HAZA 1TETH 4NKOA 3STBA 3P4NA 4IBLT 1DE4B 4R26H 1FCGA 4DW2H 4WHCA 4NC1E 4TSCH 1JYXA 2GSGB 3U4EA 5F1KC 5DFVD 3TNNB 1HI6B 2HWZL 1HXMB 3QUZA 2XPGB 5KVDL 1CQYA 3RY4A 5DC9B 3GIVB 3MV7B 1MFCH 4DFIA 4F9PC 3L3JB 3V52L 4XNXH 3MV9D 1BFSA 3ULUE 1XGRB 4XCNB 2IH3B 2OI9C 5F93C 3WS3B 1AGFA 1IGTA 4OZIA 2ESVE 2CGRH 1UZ8A 3HC0A 5DURD 3RKDD 4PRHD 4FQ1H 1XGYL 3SE9L 5EZLA 1FYTB 3JZ7A 3MNZB 1N8ZB 4U1IA 3FT4A 2NZ9D 2FJHA 1I4FB 2C7UB 4WHYH 5IEHA 3HI5H 4OZGA 2HKHH 3TM6A 2IANE 5BS0E 1BD2D 5HI5C 4ZQKA 3A0OA 2EDLA 1JRHH 2LAAA 3ME0A 1LILA 9CGTA 4JVWA 4LEXL 4M4RA 1YN6A 1BFOA 4QNPE 3KPOB 4KK5D 3FB6A 1IAOA 4JAMB 2XA3A 3MACL 4MAUL 1QSFB 2VLKA 5E9DB 2ZPKL 5C0GA 3MLVL 2N1KA 1AY1H 2B4CC 5FUOL 3KYOB 1JGDA 3GO1H 1CFTA 2WLYA 2DM7A 1CL7I 3WFEL 2NY7L 3NCMA 4L9LB 4FFVD 1TXKA 3QUMA 4JHAH 1N5AA 2JB5H 5K59F 5DFTA 5IB1A 1CGTA 3R0MA 3WO4C 2X6MA 2E7HA 1IGYA 3CFBA 4LSTH 1A3QA 2R0WL 4XTRD 3MLUH 1H0DA 4ONOA 3GIZH 3TESA 3X3FH 3VXPB 4Q74A 3QB7C 4N9GB 4DW2L 2VC2H 3CH1B 5HY9A 3LB6D 4ODTL 3PL6B 2FDBP 4I9WD 5BS0D 5DD1L 5HYQA 3MUGB 1LEGB 5E2JA 1K8DA 4Y19D 4BSVB 4D94A 4I77L 4XHQA 4QRRB 5ENWB 5A2KH 2A6DA 4EDWH 4NKOB 2ATKB 5EC1A 3HG1B 2F53B 3VRLF 5I1DB 4NRYA 3IVKA 5BZWB 4ELMA 3BP6B 1G7HA 3MRRA 4YFDB 4FP8H 3DV6B 4IMKA 2OK0L 3D2UA 1OSPL 4HF5H 1E4XI 3VU2A 4OZIE 2B4CH 4LDEB 2XPGA 3A6OA 4OCXH 3MNWB 3TNMA 1MF2H 3BT2L 4NBXB 1Y18A 3RIFK 5KANG 4AG4H 4UBDD 1OAXH 2NX5E 3BO8B 4Y8DC 4KK8C 1X3DA 5IQ9B 5F7LB 4Q2ZB 3KPLA 4TVPL 2X1PA 3RBSA 2VR9A 3FOMA 3GSXB 4WFGE 1S8DA 1MFBH 2NY1D 4OZIB 2Y7QA 3O6LL 1Q0XH 5D2NC 1YYLH 5JMOC 4KAQL 1FL5A 1KOAA 5DJAA 4WO4A 3CDGB 5DD0L 1GPOL 4OZGB 2PW1A 1D5IL 2FD6L 3KYAA 1S7SA 5GIRA 4M7KH 2GJJA 4KQ4L 3VXQA 2Q3AA 3WJJC 2DQHH 3MRGB 3TGXA 4POUB 4HS6B 1Z9MA 3GB7B 5E4EB 5JXEA 3DX9A 1RD6A 1TTGA 3QFJA 2AV1A 1P2CB 2Q3ZA 4HWBL 4ZG1A 4W68A 4PJHE 3OR6B 1EAPB 5C0ND 1ROWA 3TYGL 1ZHBB 3MJGX 5E1HB 3BKCH 4NCDA 3ZE1F 1JGDB 2AI0H 5F9JB 1YEIL 1CFTB 5I1JH 3NFPA 4RAHA 2DLFH 4LQFL 5FYKU 2Q6WA 1CFSB 4HK3J 2D0FA 5B8CA 1K2DB 2JELH 1T04A 5HYJB 2YD7A 1JFQH 3RA7L 4NM8H 2EIBA 2JIXA 1C12B 3OF6A 3FTGB 5EOCH 1A9EB 1EFXD 1H8SA 2B0SH 1OWWA 1P1ZB 2VDLL 4PJCB 4MB3A 3QRGH 4MQSB 3S5LA 2E6PA 5T3ZD 3BWUC 3DROA 3RHWF 3UPCA 5E00B 1HK6A 1OM3H 4IHOB 3X11A 2J8UE 3X3GL 1MI5D 3OZ9L 4F7CA 4HV8A 5CMAB 5GGRA 4GKSB 3MV9B 5CP7B 5FGCB 5HHNB 1X5FA 3SGKA 3BT2H 3NH7H 4P2QA 4XMLL 5I1AB 1EJ6A 5DD5L 4OZ4A 4XHJC 3V5KA 5DEGA 1H9VA 2ADIA 4NT6A 2XKSA 1OAZH 4Y16B 4JPVL 4ONHA 5TF1L 1BZ9B 1AIFA 1BQHG 1VFUA 1Z5LB 4FQJH 2APBA 2AKRB 2LVEA 3HPLA 4Y4KC 3E3QE 4JDZB 4F7TB 2D4FA 1MLCB 5HDBF 2YA1A 4YJZL 1LE9A 2FX9L 1G7PB 2Y7QB 4Y16C 3FCTA 2AEQH 1HYSD 5I8OL 5JIIA 3ZYJA 4V1DE 3FO1B 3ARRA 2YS4A 2PW1B 2R0ZL 4M6ML 2HN7A 3TA3B 3GMLA 2NW3B 3DETD 4NP4L 3UZEA 3GRWH 3D9AL 3L3OB 1AQDA 5KSBF 1HQRB 3D25A 3NMEA 4UT7H 1QFWI 1ZHLA 4ZUWA 3PQYE 1DBBL 1R3KA 1VEOA 2J4WL 3MV8D 5KJRL 3OR6A 1IM3B 4QRSA 1JFQL 3GMOB 3F5WA 5SWZD 5HPOA 3J7HA 5FB8A 3OKEA 3F7VB 4N8CL 4X7DC 2V7NA 2DQTH 3O4LE 3G6JA 2VXVH 5DK0B 1NDMA 2R69H 4YHNA 3BPOB 2VJXA 3OKDB 3D85A 3SDYL 5FDWB 1G9NC 2PYEB 4QXGL 5ACZB 5D71H 2BNRE 1N0XL 4HWEL 4JRXD 4U6HA 5JOEA 2YD1A 4H5SB 5CHNB 2EXYC 4ZYKB 4QRUB 4RGOL 3G5XB 5JZ7D 4HC1A 3SDXB 5IFAL 4JFQB 2JIXB 1G6VK 1LO5A 1KPRB 3SQBA 1QTYT 2E5EA 5T5NF 2WQRA 3L3DA 5KVGL 5DRWB 1DANT 1EO8H 4Z0BH 4O00A 3G5YB 4HKZB 4PJ9D 3QCVH 5I8KH 3KJ4B 3GBMH 4E5XB 3OG4B 3V0WH 1FC2D 4D0CA 3U4BL 1JCKA 1E0OB 3PQYB 3NIFF 1DBKL 4KTEL 3QIUC 1A4JA 5JO5A 4F7CB 2V5TA 3O0RL 3MRJA 4H8WL 4JG0L 4M43H 3RL2A 1HILA 4NRZB 3SOBH 3QDJE 4KKAD 1LNUB 2E8YA 1RZ7L 3DARA 3LEXB 5E2UL 4BQ6A 3BVNB 2H6PA 2VDLH 4XRCA 3UTSA 2W65A 3BH8A 4BZYA 1IVLA 1Z5LA 2J6EH 3D69A 1JN6B 1ED3B 1KC5H 1INQA 3VD5A 1BLNB 4NGHL 1A7NH 5C0IB 2ZG2A 5C0CE 3LIZL 3BKYH 1DFBL 2WM0A 3HZVB 4OZHA 5EH1A 3WIIH 2MCPL 3VG9B 3CSYA 5IIEB 3VXRB 4Q97A 5FCUH 3QDME 5BMFH 5A40E 4G8EB 4MJIA 4OBSA 5GRWA 4HULB 5D7IE 2VC2L 2YD9A 3TBWA 2F53E 1SJHB 3RAJH 2CPCA 3L3OA 4UIKL 2O93L 4U1NA 3RWJB 3GKWH 5J6GB 5IV2B 3STLA 1II4E 3D25B 3SDXE 4LSUH 1HSBA 1R3LB 4L3CA 3TZVB 1JPSL 2DQUH 1TQBC 4CMHC 4YH6A 1F97A 3WKML 1QHPA 1CICB 1H3TA 5EBMB 4JRYB 3S37L 3MUY1 5T3ZE 4IRSA 4YDIH 1VFBB 1IEAB 3GGWA 2DAVA 4RBPH 4OT1L 1K4CB 1TJGL 3P11H 1UA6L 2P8LB 3B5TA 4D0BA 2AJ3A 4FNLL 4NN5B 1GC1L 2V5SA 2EDQA 1X5HA 1YMHB 4BSJA 4S0SD 4H5SA 5CHNA 3SDCD 5DVLA 5I1EH 4X8JA 2W0KA 4YWGH 3QXTA 1C5DB 4TQEH 2VO5A 1G9NL 2UZYB 2XWTB 1LO5B 3JV0A 1K85A 5SWSE 1NDGA 4AH2A 2C3HA 2BDNL 4YGVA 4QLRA 4AMKL 4F7PB 2BHUA 5E8EB 1NLDH 4HK3N 2D3VA 4FXGA 4H1LB 2CRZA 3RZCC 2E7LA 4GXVH 3MX0A 2X4PB 1LEKA 4NQCE 5CKGA 3OXRB 3IB4A 1MAML 3JVGC 3TZVD 2VAAA 1B6DA 4ZUTA 2GTZB 4GO6B 2R39A 5EFIB 1XCQA 2HFEA 1FIEA 3REWA 2CLRA 2IAMD 4QRPD 1HH9B 2HJLA 4HS8H 4L8SC 2YUWA 4YC2B 3T2OA 4HDIA 1FNSL 2J5LB 2HRPL 2IC2A 5I0ZA 4FFYH 4LMQI 3BH8B 3CFJA 1DN0A 1HHJA 3QUXB 2C5DC 5EA0H 3MLVH 2AW2A 1YY9D 5LJYH 5EBLA 1U8NB 4XI5D 1QRND 3I50H 4JQXA 3B5HA 2NPLX 1XGUB 3X13B 2L7JA 3S98A 3T65A 4PS4L 3HAEH 4LKXA 5KOVC 2F8VA 4ZDHB 2F8XC 4HXBL 1L7IL 2UWEA 1FN4A 3TN0C 3Q1SL 4LVOC 5IHLB 1JI2A 1UH4A 4XVSL 3F7YB 1U8HA 2GQHA 3FN0H 3ARBA 2ZG1A 4G8EA 3TFKD 2V5RA 4UNVA 5C0BE 2J6EL 5K9QG 3G9VA 1B4RA 2CXGA 4WEBH 3N85L 1S78D 4TUJA 1WJ3A 1SJHA 3MRKB 4PJXE 2Z4QB 1KN2H 5F1IB 4HUWA 2NY0D 1WCBB 4LHUB 5IBLC 1S5IH 3SE4C 2X9YA 4DKFL 3BPLC 2ZWLT 3NCFB 3WUZA 3HE6B 4JFFB 3QZWA 5DD6A 3NH7L 3SGEH 2CDFA 2ADGA 5EBMA 4G8GB 1F4XL 3NGBB 1BBJB 4KROC 1X7QB 1G7QB 3RX5A 3L5HA 1FFNA 5C07A 2ZSVB 3PJSB 2G5BA 1KCSH 3QUYA 1NGWB 4LLAA 2V9QA 1X5AA 1OSPH 1IC7H 1D5ZB 3U46B 4J2XA 3OV6A 5TH2A 1YEGH 3MV7E 4X8XA 4UNUA 2EDTA 2B1AH 3PHQA 1XZ0A 2A73B 3AAZB 5DQ9B 3VWKC 4KHTH 2FGWH 2ITDA 5D7IF 4IDJL 4KK9C 4OUUB 3K46A 4HKJB 4TRPH 2XKUA 2JTDA 3OKKA 1FFPB 4LVNC 1RULH 2I24N 4YBLC 1T7WA 2DDQH 5ISZE 2AK1H 1HINH 3CU1A 4R7DA 4HJ0D 3P30H 5FYJL 4NP4H 1JGLH 5EU6B 4DQOL 4XZUB 3GMRA 1Q0YL 2AABL 4LP4A 5CEXB 1E4WL 5EU7C 1JUFA 1HXMA 3QUZB 1YEDA 2B7DT 3WJJA 3ZL4L 3PV7A 5DRNA 1HQ4B 2BVOA 4KKCD 1N3NA 3R8QA 4X98A 3GSVB 5CUSH 3RNQB 1NCWH 4XNUH 4RFEA 2DLIA 5CZKA 1H3UA 5IB5A 1EFXB 5EIVA 5J06A 1CN4A 3PHOB 3C5ZA 1PX3A 4XCNA 2YA2A 4DVBB 5L2KB 3OJMB 3HNVL 3UAJC 2FL5B 3VXSE 5E1AB 4PJ7E 4IDLA 1RK0B 3QCTL 5IVXE 1BZQK 4I0CC 3MNZA 3TT3L 4PJ9B 2AJUL 2C7UA 5KSAC 5IEHB 4K94C 4YLQT 5I2IB 3UPRA 4X4ME 4JKMA 1W0YT 5GSRB 1P5UA 5H35A 3BRFA 4WFHE 1A7NL 1E4KA 3C60D 1H3PH 5JHDD 1I1AC 5FA4B 4U3XA 1WFOA 1T03L 3D39A 3MBEC 4X4YB 4HIXH 2W9DH 4FQIH 3C6LC 3L3IB 4FTVB 3GSOA 3QUZD 4WRLA 3QXAA 3GSNL 1D5MB 2QQQA 1NAMA 1QNZL 4WCYL 1B88A 4MNGB 4PJ8C 1WIOA 4WFFE 5DD6B 5BRZA 5I73B 5JDSB 1OGTB 1CLZL 4D9LL 4J23A 1S7RA 2A9ML 2XTJD 1FFNB 1JPSH 2DQUL 3QJFB 3MRIB 2FGWL 3M07A 2WIIA 3CPLB 4AQOA 1W72H 1FNAA 3DMMD 5E2TH 1MFAH 3U7YH 5IJVA 3RI5K 1HZHH 1H0DB 2P46B 2DDQL 4YX2L 5DJ8A 4JM4H 2CR3A 5GISL 2ORBH 1XZ0B 3PHQB 1T7ZA 3TN0A 5F89A 3GBLA 5KSBE 3BP4B 2R4SH 3RZWA 4AEFA 2ZPKH 4XNZC 1E4WH 5EOTB 3U79A 5D7IA 3LDBC 2CO7B 5ENWA 4JY6A 5SWZB 4BH8B 4JO2L 5I1DA 4QOKA 2VLLA 5ITFA 3IVKB 2DLTA 4G8IA 1G7HB 5C0BB 4IRZL 3MBXL 3RVUD 2IMMA 3PWLB 4JFZL 4LLQA 5AZEL 3H7BA 3K74B 1MCOL 2FBJH 2BXYA 2XACC 3RWIB 2B1AL 2Y36H 3FT2B 3I84A 3ALPA 3MLWL 4XPGL 1FFRA 3MRCB 3MUHL 2CUHA 4P9HL 2CRMA 3P4NB 3QAZB 3TA3D 1MHEB 4M1DH 2VZSA 4MD0B 2FECL 4X98B 3DXAD 2B2XL 3HAEG 4WVRA 1KYOK 4QGYA 4XP5H 5HI5D 3FFDB 3MJ9L 3CC5A 2V2XA 3QEQB 3RVWC 1MCFA 4P57B 3W39B 3ROLB 1XF4A 4HBCL 1GGCH 1ETZB 4XNQA 3U7WL 3A6CH 4DKAA 5HJ3A 1JNNH 2B8OT 1A6WH 2ZJSH 4OLEA 1FV1B 4UOJA 3VXQB 5T1LD 3LZFH 4N5ED 3SDAB 4FA8A 2DD8H 3ESUF 2F58L 5IBLD 3LN4A 2PTUA 5ESAB 1JHKH 1BPVA 1S78C 5HHOB 3ULUD 1KT2B 1P7KA 3E8UL 2CIKA 5KG9B 4Z77B 3UBXI 5DR5L 4F37F 1ZHKB 2WBJC 4P46D 3LMJL 3CXHJ 4O4YH 3B43A 4Z7UF 3AS0A 5DZLA 1RSFA 1RU9H 4XVJL 4AIXA 1QFHA 2EC9U 1BD2E 2ADJA 3LHPL 4MD4B 1T22B 1JK8A 4OGYL 4Q9RH 3OKMA 5LCVL 2W92A 4NBYB 3IKCB 1RZGB 1XF1A 4KDWA 5C9KA 4TNVK 4TUOA 2YKLH 3HCVB 1S3KL 4DCQA 4PGCB 2FZ3A 5IG7B 3B3IB 2PTTA 2DRUA 3QQ4A 4K3JL 4WI4A 3T3MF 2XG4A 1N2RB 3QISA 1VKXB 1GCFA 4E0RB 3RL1A 3DUSB 3QWRA 5C71A 1UVQA 4U1KA 1ZA3A 4OF8A 1A7OL 1GC1C 1AGDB 2V9RA 2CK0L 2D03L 3BPCB 1KN2L 3Q5TA 4NKDA 4Y16A 2KZ1B 3MRNA 5IKCB 1M71A 3NFSL 1YC7A 2XA8L 4XP9H 1CLYH 5E6IB 2R2EA 3MRBB 2EDFA 3F6IA 3TCLB 4J3OC 4ODSH 3HB3D 1JVKA 2CR6A 2FJFA 2XWJA 4PJDE 3LKPA 1SY6L 1I8KA 2Q87A 1FYTD 3RUGA 1QSEB 3X12A 4U0RB 5BVPL 4WI3A 4RBPK 4MLSA 1CG9B 4YHLL 4P23D 4CADB 1UENA 5C0AA 1FAIH 2PW2A 4NZRH 1GZQB 3FCTB 4DGYH 1F4WL 1FSKC 2C1OA 1E4XH 1FL6B 3O11B 4YPGA 1NANI 2DTSA 3NZHL 3TA3A 3T77B 1XIWC 4YBLB 1SBSH 3QXVA 3EOAA 1AGBB 4PGEB 1B2WL 5FYLE 4GW1A 3VWJB 4E42A 1KGCD 5TDPA 4JY4A 2L7UA 5CP3A 3MMEA 1FL5B 3KLDA 5TE6L 1NMCC 5ICYA 3IJYB 1NLBL 4YDJB 4Z7VE 3HB3C 1IKNA 1P84J 3F5WB 4NO0B 1LK2A 1UWXK 3D85D 5JPMA 4L3ED 5T1LA 5DK0A 1NDMB 4X83A 4YHNB 3BZDA 3WFHA 5FDWA 2UYLA 4FFWD 3M45A 5FKPA 2Y9RT 2I60H 2O5XL 4JJ5B 1NAMH 4NUJB 1EAPA 4LLMB 4PRNA 2YRPA 1IGJA 4MJ6B 1MF2L 4LVHB 4NZJA 43C9B 3DSFH 1T0NB 4BK5A 1UM5L 4G42A 1A7OH 1DQMH 3SCMD 2P7TA 3P77B 1KG0B 1NBYA 3VFVA 1UJ3C 4WHTB 5ITBH 5JW5A 4YBQD 1PZUB 1KELL 3CVHL 4WI6A 4A6YB 4UAOB 4WTXA 4NN7C 4K23L 3RL1B 3KR3L 1CGSH 3DUSA 4HG4K 4FTVE 3VDCA 3K2MC 3EW3B 1A9EA 4M9PA 4PJCA 3RL2B 3JWOL 1VGEL 5IHUH 5IB3B 5D7LA 4AT6B 4PJBE 1W0WB 1FZOB 4KJYB 3CK0L 1P4BH 1RUQL 3LEXA 3QWQB 3UTSB 5D1XB 2Y06H 2R0KH 1MCHA 2WQ8A 1R0AH 1ED3A 1MOEA 3QUMH 1GZPB 1FFOB 1G0XA 4ZD3L 3KYMB 4YDKL 2QL1A 3LY6A 5CJ8A 2W60A 4NT6B 4FQPA 5J1SC 1TPXC 5MP6L 1IM9D 1YEIH 2QSTA 3VJ6A 5HPMA 4HIJB 3RVTD 5CAYB 3CSYB 4YPJA 3C6LB 4RNRA 3DI2B 5DUML 5CZVL 3TPUA 5F3HA 2QSVA 1FL6A 1KEML 2OL3H 5F9OH 1IILE 4YDLC 3NCCB 2X4QA 2R4RL 2OMNA 1EA9C 5D7SL 3EJZC 3EOAB 4M93C 1T7XA 2Z31B 3JV4A 4MCYB 4DGVL 2DQHL 4JEGB 3WBDA 4DOHB 3I9GH 4FQCL 4CN4A 5EDXA 4ODHH 5HHPB 1MCLA 2NW2A 1YEFL 4XWOD 3WIHA 1SM3L 4NZDA 1OTUC 3SGDH 1XF5A 2OR8A 3QAZC 4WY7L 5DT1L 4NQCD 4X6CE 5TQ0L 4ZS7H 3RTQC 4E41E 4F7EA 1LK2B 4JZJB 1O5DT 3FQNB 1YECH 1IEBA 2P8LA 1MHHA 4X9GA 4YFLF 5D2LF 3TYGH 5HHVL 4OCLC 1N4XH 4HMDA 3G6AA 3IFPA 4G9DB 3CX5J 4HT1H 4GMTL 4KJWD 5F8RC 4XVUC 4JJ5A 3MLPA 4JM2F 4H0HB 4QRSB 3GMOA 2DM4A 1OB1A 4U6XA 5DJZA 3TF7C 4ODUB 3BIKA 3QJHA 3BN9C 4NWTL 4NZUH 3RA7H 5K9JL 3ZT7A 4PJXA 1Q9OA 5IESL 1NBZB 5E4EC 4JZJC 4F7PA 4JG1H 4ODWB 4I2XA 1QA9B 3ZKNC 1U36A 4WHTA 5JA8B 3QNXB 2DQGH 2CRYA 4Y4FB 4ZYKA 2FEDC 4Y4HA 1SYSB 4JO3H 4YDIL 5A2JH 2O5XH 4J4PA 3D6GA 4HCRH 5EFIA 4RMSA 2OR7A 3GSUA 4N8VG 5EU7E 3TBYA 1SJEA 2EDDA 4E5XA 4LVEA 4JFEB 1XR8A 4X6DA 2EC8A 2FIRT 1DN0B 4WJ5A 4FQQA 3O6KH 2EYSA 1A64A 3N0PB 3QUXA 4GXUN 5D1ZB 5EZIL 1MFEL 2R56L 1NSNL 1U8IA 2EIZA 4YHOL 4IOIA 1IAIM 2RGSA 4XP1H 1OAKL 3VH8G 4OGYH 4NDMA 5INDB 2BVYA 1B6UA 5IHUL 4PJHF 5LGKA 4OFDA 1I1AD 4M7ZB 4DZ8B 2DJUA 4KI5C 5ALCH 2EYTB 3QUYD 2UV3A 5KN5B 1MCKA 3TPUB 1MELA 5D2LA 3N1GC 3P9MB 3HMXA 3FMGL 4MA1B 1A7RL 2DYPB 3MRPA 4FQ2H 5T1DH 1D9KB 1XR9A 5SWSA 1J0KA 1OOAA 3NCYS 35C8H 5K33A 4DWHA 5A2IH 3C09C 3HRPA 4Z76A 5HHPA 2J1KA 3UZVB 1AJ7L 3S36X 3LN9A 3FQNA 1AXSA 1LDPH 2HYMA 2Q8BL 1SVZA 1X5ZA 4BELD 1EPFA 3DX7A 1QLRA 4PJ5B 3ZYZA 4M7KL 1OGAD 4IRSB 4IOFD 2EXWC 3C8HA 2KQNA 4X9HA 5C0DB 1CF8H 3GHEL 1XF2A 4TRPL 4ORZC 4UBDC 3S6CA 2QQLH 3BIKB 4GAGL 5I74B 3QRFM 2B2XH 2QADB 3L5IA 5CCKL 1A1MA 3UYRH 4DN3H 1U8QB 3RWFA 2QSCL 2E7MA 4NWUL 3MLYL 5SX4H 4UV4L 5HDQL 2ZOLB 3IAGC 1TCRA 2AERT 1GHFH 5I6XC 2BERA 3GJEA 4PY7A 2C3GA 3WNLA 1ITCA 3SJVE 3FQRA 1MRCL 4EJ1C 3WUWA 4OLWL 2CJUH 2VDQH 3OXSA 5GGSY 3VFWB 3BZ4A 2ICWJ 2ADFH 2NY5H 2YMXL 1F4AA 1BJ1J 4M7JH 5E94B 1KFAL 1QBML 2N4IA 4R7NA 3RIAK 5F88A 3TBYB 4H1LA 3TO4C 1IT9H 4Q0XH 3FKUS 4WI5A 2JB6B 1RZ8A 4ZSOA 4MYWB 4P3CL 5FIEA 4F58L 2WNGA 4KROD 2GITA 5ID1A 1AD9A 1FSKB 2YEZA 4X6DB 1PZ5A 2JJSC 4TOYL 4NHUA 5L8LB 2P8PA 5I9QC 4KHTL 5K59E 3AS2A 1X6LA 3TH3T 3SDAC 3W9EA 5ADPL 4DVBA 3IFOA 1UM4L 3NBNA 3SDCA 1J86A 4PJ5E 1U3YA 4ZO7A 5IVNA 2GJ6D 2EE3A 5KSBB 2BNQA 1ZGLB 1OTTD 1G7IA 4FQ2L 1EFQA 4PYHA 4X6FB 4NNYA 4Q9CA 4ONFL 2D9CA 3RFZC 5KN5A 2F19L 4AEEA 3X14B 5HYIA 2VMFA 1IGTB 3OTTA 3NCYP 4U3HA 2PF6A 4MX7A 5EZLB 3CMGA 5FGRA 1IKFL 4W6WB 4P9MH 4MS8D 2M26A 3MLSL 4R2GB 1FG9C 1NFKA 4L1DA 2OMBA 5SWSB 2M8XA 4LEXH 4IM8A 4OGXL 1W2KT 4EIZC 3HE6C 4ETQA 2AJXL 4GSDH 4QT5A 1QRNE 5TDNA 3L7FA 4LNRB 2NY4B 1YN6B 4I0KA 3HNVH 5JOPD 4KROB 5BS0B 5F1NA 4H1LH 1D6EB 2BSRB 4QO1A 1IAOB 3H3PL 1MAMH 4MJID 4LLYA 5IJKA 2VQTA 1QSFA 2VLKB 5D4QA 5E9DA 3QFDA 5C0GB 2P24B 1F02I 2P49B 1FYTE 3MRIA 1WZ1H 4LSQH 3ULVD 3ZE2F 3N9GL 2OZ4H 5DC4B 5HGAA 2ADGB 4PP2A 5E03A 3IXTB 4BH7A 3QUKA 4U1SB 4YXKH 5DYOB 5IWLC 1EZVY 4UTAL 4PLJC 1MCCA 1KNOB 3QZWG 4JKLA 2G9HA 4GRMA 5J6HA 2ENSA 4HIXL 3S3SA 4RCAA 4YDLB 3BIBX 3VFPA 1P84K 4ZPTA 1IGYB 3BOVA 2F5BH 4WHYG 3QYCA 1U3HA 1QBMH 3IDJA 5E8NA 2A6KA 4GG6F 2UWEF 5SWZA 2B39A 3QEGH 5IUSA 2VLLB 4NZUL 5K9JH 3TLRA 4PJ8D 1N64L 3DECA 4G8GE 4D9LH 3EDKA 2DTML 2A38A 3QWRD 3D0LA 1WK0A 1Q72H 4JQVA 4BQ9A 3RWIA 5DA0B 4JQIL 3QUZC 3C6LD 1D3CA 2FX9H 3MBED 15C8L 1TVHA 3EYFB 4R7DB 4ELMB 1RZ8B 4ZSOB 1CE6B 1XGTB 2GITB 1T0MB 4ZS7L 4P2OC 4HH8A 2EH8H 1ZAGA 5GJTH 5IMLA 5AYUH 5GRUH 2JF1A 3W9EB 4LU5H 4KUZH 3NACL 1UG9A 2BC4A 4OJFL 1JIBA 3ROLA 2QHRH 2BSED 4N5UA 3LD8B 4GMTH 3FB7A 1NKRA 4JN2B 2ZCLL 1N3NB 4X0KA 3QA3B 5IOPB 2UY6A 3ARFC 4PJIE 1T4KB 3RWCA 5F7KC 4P4RB 5IB5B 2W0FA 1UWGL 2W9EL 5CBEA 4P23A 3MOBL 3VRJA 3X14A 1MAJA 4PRIA 1RK0A 25C8H 1JWMA 5E2VL 4KKCC 4KKLC 1HOCA 4HPOH 4Y4HC 1TIUA 1ZXQA 4DKDC 4WFED 5EU3A 2F74A 3WEXA 5KG9A 2GSIA 1FH5L 1NFDA 1TJIH 3F12A 3P0GB 3N85H 3UTTA 3LOWA 4HCRL 3L7FB 3WXVL 5C0EA 4I3SH 5J57B 3ARGC 5C7XL 1WZKA 1D5BB 2PYEE 1H3VA 5F1NB 4DQOH 3LHPH 1A6UH 4C83B 4OBRA 3JWOC 4OLYH 3U7WH 4F57L 2QHLA 4KKAC 3QFDB 3FRUA 4FTVA 2XN9D 3L3IA 1NUDA 1UM6H 3GSOB 4FABL 2P5EB 3I75B 1D5MA 5ELIA 1MIEH 3ZT6A 43CAB 3O3UN 2AK4D 1ZKAA 3GNMH 5MI0B 1YZZA 1Z0MA 5E4IA 3TIDA 3OB0H 3HCVA 3NTCH 4NC0B 3FB8A 4O9HL 3UJTH 2AS5M 5IW1B 5B8CB 1V7NH 4LHUG 5C8JA 3IETA 1T89C 4ZUVB 5I19L 5T3ZL 4LSUL 3VFPB 3C60A 2DQJH 3HR6A 1ZEAL 5EZJA 1BM3H 3FTGA 1H5BC 1ZA3B 2EEDA 2X1WL 2NNAB 5F96H 4M8QB 1TPXB 5FK9A 2D7TL 3LSOB 4H25A 1MRFL 4F15C 4JRYE 3WO4B 1W0VA 2GK2A 4XXDB 2DQDH 3CIQA 4XB7A 5JLZB 5JW4M 5SX4I 4M61B 5MENA 1EERB 4Z7NE 3VFTB 3T2NL 5E8DL 3QG6B 1LO3L 1INDL 4U7MA 4R8WH 3O4OB 1QFOA 4JZOA 5E8PB 1CE6A 1S3KH 3DWTA 5ACLA 2ZUQC 3HUJF 2VLRE 4LLQB 3H7BB 4OQ1A 4NQEE 4N90D 3HKFA 1WZMA 2BC4B 3S35X 1N64H 2B4CL 2EC9T 1HHKB 3R1GL 4HWZB 3N1FC 2AGJL 2PW2B 2R1YB 4ZNCD 1NFDF 3RY6C 3CAFA 1MPAH 4G7YL 3WFBL 4EQ3A 2FR4A 3EYQD 1KLFA 4Y4FC 5FGCE 3HAEA 3T77A 3PP3K 2W0FB 4BZ2L 4AZ8A 5E8OB 3FT3B 3ZKXB 3O2VH 2IPUG 4JM2A 2H9GA 4X6EB 3U36B 3WXVH 3CSBA 1ETZA 4XNQB 4KAQH 3C2AH 4RMQA 3NACH 3FO1A 3I3DA 1A0QH 5GS1A 4MA3B 1PKQE 4UT7L 3FL7A 3BD4A 1OD9A 2OSLA 3G08B 5BVJA 3UZQA 3V79C 1HIMH 3TZVC 4BFBD 1XEDA 4M7LH 4HWUA 4WUKL 5DD3L 1O7VA 1DQQB 3GSWA 3LN4B 5IMKB 2NX5D 3QP3A 5EBGA 3T8XA 4JPWH 4DKEH 4XHJD 1QSZA 4ISVA 5JXAH 1EHLH 5HHME 3OKYA 4ORGA 3A67H 4X9BA 4XXCC 1MUJB 3G6JB 3KLAB 3SDCC 2NY3D 3IDYC 4OKDA 5JW5B 4HUKB 1YYLL 1I9JL 3S34L 1J18A 1I3RB 3VFRB 2H3NB 1BQUA 4G6KL 5EZJB 4I4WB 4JRWA 2RCSL 2V5YA 4OLUH 2DIJA 5E8DH 4KQ4H 2VLRA 4MS8C 5DRWA 3V5DA 1RHHB 3PDDA 1RHFA 4NKMA 1WFNA 3B9DA 1QRNA 4QHLB 3GUTA 3M1BB 1Q9KB 5HDOA 4EXPX 4Y5YC 3H8NA 1IGFL 5BRZD 5TE7H 4JKWA 3B9KA 1RIUH 1ND0A 3RKPA 5AZ2L 1I1AA 3HFML 4PP1C 3ARSA 5H2BB 1BEYH 1M6OB 5FM4A 2EIEA 1AGDA 4XCYA 3OAZH 2GAZB 5CSZA 1EDQA 5TQ2L 2Z8SA 1J8HB 4JFPB 4K8RL 3VXUA 5CBAB 5DRXB 2CUMA 3NGBC 3E2HC 4O2EA 3V0VA 1OGAA 3MRBA 3GHBH 1JP5A 2QKIA 2WP3O 2MCPH 5F7MC 3IFNH 1IC4H 4YHMH 1OQOA 3HZVA 1A6WL 1EX0A 4R4FL 1J88A 1F58L 4F9LC 5C0AB 1OM3L 3EIFA 4GKZA 4W4OA 1GGBH 3WNKA 2R8SL 4XVTH 5GS0L 4YPGB 2QQKL 1WVZA 4MQ7A 4NQSA 4OCXL 4AL8L 3G04B 5BQ7B 2OSLB 1CK0L 3G08A 3WL9B 4P4KB 3H2WA 4N8VA 5CIPA 3T0AA 3QIUD 3ZMRA 4PJEE 3SJVA 4UT9H 1PKQA 1A1NB 4IOFC 4JY4B 4M5YL 1WAAF 3T0EA 3GSWB 2QEJA 5J1AB 1CICA 2O26U 2Y23A 4XT1C 4D3CH 3Q5OA 5KJRH 1KLUB 3EAKA 1J5OH 5DJ2A 1QYGH 1A5FL 3BAEH 1EEYA 1NMAH 2AEPH 4ODSL 4OJFH 4PY8J 3PWPD 5GGVH 4RMTA 2AJ3B 2HTKD 5ADPH 2JJVA 4LCYA 1QA9A 2YPLD 1P7QD 3ZDZE 4X99B 3QH3B 1AHWC 4PREA 3O2DL 4Y4HB 1CD8A 1P7QB 3UTOA 1I3RA 4LCUB 3RWHB 3U0PA 3ALXA 3NN8A 4O9HH 5I9QB 3G5ZB 5EN2A 4J7RA 1X5XA 2O5ZH 3FAWA 5I0DA 3ARZA 1IQDB 3V5DB 2CK2A 1PGRB 4IRJC 3O3DA 1ZE3C 1SJEB 5GGQL 2PCPA 4Z7QF 3TT3H 4AIZA 2AI0L 4PJBB 4QHLA 3NIGE 3MNVB 3QEQD 2H2PD 2XT1B 5D9SB 4JZNB 3WNOA 3SQOL 3HNSH 5DMKA 1ES0A 5MEOA 3GI9H 4UU9A 1NJ9A 1UACH 1HH9A 2HJLB 3BHBA 3ZTNH 3PDOA 4F7MB 2Y1VA 1FFQA 3CUPA 2XFXA 1A4KB 3F6LA 2P45B 3EFDH 2W9DL 3QDGA 3KPMB 3RGVD 1I9EA 1RUPL 1KJ2H 5HVWA 1MNUH 1OGAB 4IRSD 1MI5E 1S9WA 1TCMA 3O8XB 4LSQL 1KXQE 1FPTL 1FNHA 4U7KA 3T4AA 1FGNH 4K3DL 1I1YB 2X4SA 3RIAF 3IU4L 2DQJL 1EIBA 2BOCB 3OJ2C 3QIBA 2FSEA 4GKZB 1JPST 3M17B 5J4MA 3CLEH 4JPVH 5TF1H 1MRFH 3TH4T 3UROR 3S3PA 1AFVL 3ZHKA 4X7TB 1S7XA 1T1XB 1S5IL 2VDNL 1INEL 3MC0A 1AR2A 4QHUA 3VGEA 3ARVA 1TTUA 3SJVB 4JHBA 3I6GB 2HH0L 3QZWB 4JQIH 2DKMA 1BQHA 4X6DF 5EUOE 4KJWC 4L5FL 1QLRB 2YD2A 4NUGH 5M94B 1G7QA 1KLUA 4Y1AE 4L4TE 1A3LL 4J3XA 1UH2A 3DVGB 5JORA 2XTJE 4OZFA 5GRYA 5KS9B 1PSKH 3W81A 2YRZA 4Y5XB 4PRBA 5M95B 1D5ZA 1CTOA 4XNMA 3IJSA 4FNLH 4LCCB 1KUMA 3CFDA 1LO0L 3L3JA 4XPGH 3C6SB 3LN5A 3RZCA 2E7LC 2IBZX 1LD9B 1KPVB 2VDPH 4LCUA 5LGHL 2BVQB 2FO4A 3QIWA 3T2QA 3ARFA 4ZXBB 1JRHL 4O4YL 2Z91A 1NCCL 3EGSB 1UB6A 4H0GA 1K6QH 2YXMA 1NFIB 3IDUA 3FT4B 1P4IL 5DUPH 1TZHB 4MAUH 1J1OL 3BP5B 3K7UA 1F00I 3GMRB 5DURB 1I85C 3SE8L 4MQXC 1E28B 1WT5A 1CL7L 4UU9B 1NJ9B 2ZUYA 5HHOE 1PEZA 1N6QL 4QF1A 2IWGA 3UDWA 3O3AA 4G6AD 4YE4L 2R0ZH 4JFXA 4JFEA 4OFYA 3UMTA 3ARUA 1IKNC 3GSVA 3NCJL 4H20H 5FYKD 5DJ0B 3AB0C 4KZEH 1U8OB 2OR9H 4NNYB 3ZYIA 4CN1A 5IBTL 1IRAY 3E0GA 3SE3C 4DK6A 4FQQB 3I85A 3MRQA 5CILH 3ULVH 1S5HB 1RVFL 4A2MA 1U8IB 2EIZB 2VRAA 1TNMA 3GM8A 4LLUB 1MCWM 4WWKD 3IDMB 2MQCA 4HZLA 1I1YA 1NLDL 1DSFL 1UACL 4G9FD 5I17B 3VXSB 4XCFH 4UMGA 3D5OF 4PJEA 3DRTA 1KIQA 4KI5F 4LNRA 2KH2B 2Y72A 1T0PB 1ZSDA 1OARH 3SCMC 4HS3B 4KRPB 1PFCA 1R3IH 3E3QC 5CZXD 2DQFB 4MAYA 4XBGA 2HG5A 1FL3B 3GMQB 4Y88A 3U30C 3UTPE 3WV0A 4MNGA 4HFUL 1R5VA 2ATKA 5DWUL 1G9ML 3HG1A 3OQ3B 5EC1B 2A9MH 3TVMB 4P49A 3L3GA 2BMKB 3FZUD 4XCCL 3E6FA 1FLRH 5IMMB 3AXLB 3STZB 4PGJA 3OAYH 4TNWF 1OGAE 4ERSH 1YMMA 1NSNH 1TZIA 1UZ6E 4DEPC 1ADQL 1YYML 4XNMB 4WUUE 3RAJL 1J5OL 3O9WC 3SOBL 2JCCA 2DQIH 1MFNA 4PJ5A 5DJXA 3QI9A 5GXBB 1J12A 5F89B 4HPYL 1YEHL 4XBPB 2BSSA 3CFEB 2HH0H 4X80H 3GJFB 1XMWA 2GY5A 1A6ZB 4HMCA 4PJIF 3V6OA 2AXGA 2E9JA 1CFNB 5D7IB 3LKNB 3DIFA 4KV5F 3TO4B 4KK5C 1TCRB 1TMCB 3GSQB 1UA6H 4LSPH 2EO9A 1DP0A 5D7JC 4KC3B 4ZOBA 3GI8L 1C5CL 5GIRB 3W11C 2I9LA 4LU5L 3MCKB 2Z8WC 5B3JE 3BZ4B 4Z8FL 3PE9A 4L8BA 3P4OB 1RUKH 5TGBB 3ZHLA 3VFNA 5HYEA 4N1HB 2GTWA 2OYPA 4YDVA 5HD8C 5F88B 2A1WL 1OQXA 4LSDA 3NAAH 4PJEF 3RPIA 3QDMA 2DQCL 3CVHA 1HCVA 2D7OA 1SHMA 3KPTA 4MHHG 3VRIB 3GI9L 5DMGD 4ZFGH 3LS4H 4I18B 4K8RC 5FYJD 1Q72L 3LVEA 3NFPB 3HZMB 2BOBB 4R4NC 5SX5K 3MO1A 5A16A 4JRXE 1QFUH 5ILTL 1RAMA 3T0EE 4K94L 5EU3B 4DN3L 3OBAA 3TIEA 3JSSA 3UTSE 1W72A 3SGJA 3DV4B 5EUKB 5ICZA 5HI3C 1MWAL 5E95B 5C7XH 1ZVYA 1KCUH 4LF3B 4NKIH 3VI4F 4CJ0A 1MJUH 3ESVF 2YUZA 5IF0B 5I1JL 5GRJH 1I9IH 3HZYA 4IHOA 2P47B 4Z77A 4XBGB 4ETYA 3IDGB 1YEKH 2HG5B 2F54B 1C5BL 5DRZB 3TIDB 4Y2DB 5I1AA 3WIFA 2YD5A 1OT2A 3E6FB 1WFTA 5IQ7H 4WUUD 3FHAA 4QHMB 2CDGA 4QYOA 5D72H 2BCKA 1RUML 3T3PF 4PG9B 2ICES 4MXWH 2AKRA 1RZGA 5FM5M 1CXEA 4JKPH 3T0DA 4KJPC 2NNAA 5E6ZA 4DCQB 1MCPL 5C6TL 1P4LB 3WD5H 1MIMH 1RQ5A 5I8EB 3BGMA 4OFIA 2PTTB 1UCBH 1U92A 4MDIA 3MJ7A 2ORBL 4QY8A 4BYHA 1I1FA 4U1GC 3WCYA 2G9HB 1W0VB 2NXZD 4GRMB 4WW1A 4Q6IA 5BOZG 2AXGB 4QWWC 2X7LA 3L6FB 1I7RA 4PJHB 1RZIB 5MENE 1DBBH 1EBPA 5B39G 2OX5A 3GIZL 5IT2L 3GSQA 4X4XA 2COQA 2F5AH 1NCCH 5D7LE 4JFHD 3VD7A 2NW3A 2CDEA 4JFFE 4JM2C 3TFKC 3MCKA 1AQDB 4W70A 4JFZH 4L8BB 1M71B 3P4OA 5TGBA 2J6EA 5IESH 3IS0X 3C5ZD 4ZFFA 1ZHLB 5E6IA 4P46B 3ARDB 4HWZA 5FUZH 5GS2H 2HA1A 1Q94A 2K7QA 2BNRB 4AENA 5AWNL 4DZBA 1Q9LB 4M8VA 2OP4L 1D6VL 3WE6A 3ZHDA 4CVXA 3O9WA 3O41A 3KWWB 4EXKA 1F4WH 3FT3A 2YUXA 4YXKL 3D85B 4NOBA 2BOBA 5SWQB 3HA0A 3MO1B 1ZWIB 3O11A 1YDPB 1T4KA 3MV9E 3RWCB 3CLFH 5J12B 2VDPL 5LGHH 3QIWC 3EYVB 5I1CH 5CGTA 2P5WA 4G80A 4PJGF 1BFVH 5HHXH 4IIQA 3QXDB 3BPNC 5E5UB 3B9VA 1NFDE 4KTDL 4BSWA 1IEHA 3LKOB 1YEGL 4XCFL 5JHDA 1OL0A 5TPWH 1N0LA 4D0CB 2F74B 5L9DL 5D6DA 4YNYB 3IT8D 4EVNA 5D1QD 3D0VB 1QRKA 4XPAL 2ZOKB 1ULVA 4F2MB 4MZ2A 5GGVY 4Y5VC 3MROB 5IFAH 4L8DA 4LPWA 4X7CC 2WBJB 4OD1H 5F7FA 5GJTL 5C08B 2FYYB 3OR7A 3KPSE 1DBAH 1L7TL 3BVNA 2IH1B 2OJEB 2OCFD 2ZCLH 3DX8B 1QPPA 1U3JA 4YK4B 4TVPE 3EHBD 1INQB 1ZLVK 1FVEA 4G42B 1FDLL 4KDTC 3MGTA 3PXHA 2C4FT 3BQUD 4P59L 2DD8L 4W81A 4W4NA 5GS2D 2B5IC 2DF3A 2GEEA 4B53A 5CINH 3TBTA 4M48H 4K3DH 4KHXL 4TYUA 2NY1B 5F72S 1ND0B 4NJAH 1OPGL 3U82B 2CO6B 3A6BH 1OAYH 2FX8H 5D72L 1WWWX 3LV3A 3DXAB 1YNKH 1GGTA 5F7YC 5FF6A 1RMFH 1MREH 4XXDA 2CDEB 4JKPL 4X9IA 5JNYA 1I7UB 1R0AL 2C3XA 3DUUB 4HKBB 1M05B 3RI5F 4FMFA 3N1PC 1R3LA 3K8MA 4X4MA 3BMWA 1YQVH 3DSNA 3KYMA 4JE4B 2W9LA 1DDHA 3KG5A 1CFVL 4PBWD 4FQHB 4LLVB 1VFBA 2JCCF 4I48A 1J87A 3O9WB 4KH2A 5CZXC 1DBJH 1XAUA 2KL6A 4RFNC 2AJVH 5D7KD 1LP9E 3K8LA 4MAYD 4RRPG 4HJ0C 4YHKL 2ITCB 5JOFB 4B7LA 2E8ZA 3RGHA 3QULB 1KTLA 3IDIB 4HIIA 1U8JA 1CF8L 3GHEH 3IAQA 3UTTE 1AKJD 5DTFA 5HVGB 4YGVB 2PETA 3DBXA 2H9GB 4X6EA 3PG2A 4BSWB 4N0FA 1AHWA 1HZHL 2WK2A 3TCXA 3U9UB 4LSPL 4ONGL 5DZOA 2D7PA 1I8MA 4JZJA 4P5TC 3CCHA 3K1KC 3KLHD 1G7JA 3C08L 1VGKB 2HFEB 2XV6B 1WBXA 3ZSTA 5C08D 3G6AB 3MROA 3QCUH 3MV7A 1OT1A 4KTEH 5HYJD 4HDIB 4G6ML 2I60L 3B2UC 3MODL 1OP5H 1PD6A 2X89D 4X99A 3L5WA 4TPRL 4F58H 4CU8A 3OKNA 2R23A 1H15B 3G5ZA 3HMXL 5EN2B 5T3ZH 1M1SA 4FN0A 4ODWA 3MGTB 5I8CB 2FRGP 4NJ9H 5GJSL 3ULVF 4QRPA 4GS7C 7CGTA 1KJ3L 2IPTH 4CW1A 4RX4A 2BY3A 4PJGA 1SYSA 3TBTB 3UXFA 1AD0A 3OX8B 4RMVA 3VD9A 2UWEB 4YHZH 1ZT4B 3UJIL 4LP5A 3IFLL 2FHCA 1BAFH 5D9SA 1KF9B 5DMJB 3O6MH 2YPVH 3GSUB 1FZJB 3IS1X 4WNQB 4LIQE 2GJZB 1FJ1A 1IKFH 1QRNB 4KU1A 3K4AA 1U6AH 4MD5B 4HX1A 4RZCA 4XCEA 1VB9A 1PAMA 3O4LD 4M6NH 3KPMA 3RWGB 3UPAA 4PRPA 2EDKA 4JHAL 5D1ZA 4L8SB 1AXTH 4KHXH 5FOBA 4YDKH 2IAMC 1G9MC 4GQ9L 4OLZH 4R96B 1G9MH 4XMLH 3QXUA 5B39A 4I48B 1DUZA 3OKLA 1KCLA 1NC2D 4MSWB 4JB9H 3LS5H 2FLRT 4JLRB 4OQTA 3KXFB 1QR1B 1JRHI 2ID5A 1UKTA 5HGDB 5DK2B 5T1KD 3WLWC 4NZTL 3ZDYE 2ZSWA 5B38A 3I02A 2QKIB 3LKQB 2X4RB 3S35L 2DYPA 1IJ9A 2F9BT 3CH1A 5HY9B 1XR9B 4GBXC 3C5JA 2VL5B 4X80L 3DBXB 1KJMB 4BSVA 4N0FB 5BMFL 1NEZB 3HI1B 2YBRA 3MV7D 2CXKA 3D39E 1EO7A 3EYUH 1TENA 5E5RB 1DL7L 2Y4SA 5D93C 2VQ1A 2NY2D 1I8MB 1FGNL 4RAUA 5CGYD 4BQBA 3GMMA 1QQDB 3WS6A 4OZFB 5E6IC 2IQ9H 3SY0B 5HVHC 1F3JB 1JTOA 3B2VL 5K93A 1WBXB 3TNMB 3UCRA 2V7HA 4LKCB 4X5XB 1NCTA 1IAMA 4NRXB 3P9WB 1KJ3H 4X5LA 3BO8A 1QD0A 2YD6A 4JFFD 1RZKH 3UTPD 3QIWB 3QPQD 3C5ZB 3ARGD 3S8WA 2Z91B 3QPXH 3RY6A 4PRPD 3PHSA 4P3DB 4IRJD 1L4IA 5DUPL 3AS1A 1ADQA 1H3GA 4MMXC 4OLWH 5C09B 1J1OH 1JWSB 4TVSa 4FQLH 1MCRA 1BFTA 5AG8A 5KSAB 1KEGH 4QXGH 1T1WB 5EPMB 2NY6D 4UV7L 1FORH 5ICXA 3QG7L 4KKLD 1SJXA 6FABH 1P6FA 4BK4A 1UWGH 1TJHH 1X5JA 5CJXC 4PLOB 3F7RA 2R2HB 3K2UH 1L9MA 2MNUA 4XP6H 5FUCE 4R7NB 4NQEB 1LE5B 4YFEA 1JNJA 5CJBA 1DBML 2PCPB 3DOSA 2WAHA 1LO0H 5L0QC 3MNVA 1HHGB 3QSKB 3CXHK 5IW6B 5EOQL 4J4PC 2XOTA 2ESVD 1MFBL 1M7DA 1S5HA 3HZKB 4O58L 5E99H 4BA8A 1OGTA 4QOKD 4NWTH 4N0UA 4Q6YA 3PGCA 1K2DA 5I1KL 3PIQB 4QRPE 3AY4C 1BREA 2VNCA 1NEZG 4PTTB 1F6AB 5KW9H 5D1QB 2UZXB 1OAQL 4J1UA 1S9WB 5E7BA 3ALWA 3CFKA 4MCZB 5IJVB 4E41A 3GSNH 5L7XL 4MXWL 4NNXB 3S5LB 3DVFA 1U95B 1AXTL 1JI1A 4U6VL 4A6YL 5GS0H 1B4JL 3AMLA 1A7QL 2VABB 2FBJL 3OF6D 5GZOD 1P7HL 2LV4A 5IBTH 5IFHH 4ETQB 1KJMA 4YXHL 4GKSA 3EYOA 4MGXA 2FECI 4K7FB 3UC0H 1UGNA 5EUOB 1U93B 4N9GA 5DEGB 4P2RD 2J8HA 4LLYB 1T1XA 4Y5YA 5KS9F 1YEEL 3AU1B 5CEYA 1E6OH 3RU8H 4R26L 3HNSL 4F3FA 4KVCH 2NY5C 3PGFL 3MRCA 2VXUL 3O6FA 2K1MA 4K2UL 4ZFOB 3CFCL 1MHEA 2P1YA 3LPFA 4LGSB 3BP6A 3G6DL 1P6AB 1KNOA 1L0QA 4X7SL 5JW3H 3VXRD 5LWYH 2OLDA 4MQTB 3DETC 1KYOJ 3MODH 1S7VA 2WWKO 1CFNA 1ZTXH 4X6DE 4LBEB 5D96B 3LKNA 2MHAA 4OZFG 4MB4A 1JWSA 1YNTA 1T2JA 3WLBA 4WIQA 3RHWK 5ESQB 1JNLH 1FV1A 2FO4B 1SY6A 3ZKXC 1KXVC 1GVIA 4LSSH 1S8DB 4PRPE 1FC1A 1T7YA 3O4OC 5GS3A 4NQCB 1JZ2A 2BNQD 3EFFA 1V8HA 4LCWE 2EE2A 5JR1H 1QKZL 1PEWA 1CXKA 1HNGA 5AYUL 1K3ZA 2P44B 3SGJC 1H3PL 1P7KB 4E9LA 4X6CF 2VUOA 4XB8A 3VRIA 1HCFX 1YNLL 4MA8L 3WXWL 1OSZB 2V2WB 1N5YL 4AJ0A 1NGXA 5D71L 3SDAD 3LPGA 6FABL 2Y6SC 3BZFB 5ACZA 5K9QI 1V7MH 4HXAL 4MD4A 2DBJA 5DJ0A 3BPOC 3MXVH 1JK8B 3GI8H 4UIMB 2GK0B 4R3SB 4WU7B 5CBEB 5C07E 5EUKA 1F45A 5F9JA 1KCKA 4TUOB 1NCBH 4PR5A 4LRIC 1CFSA 2Z0BA 1JWMB 1T21A 5GSVB 3MA7B 1FH5H 4O51B 4HZLB 1A1OA 4N0UE 1MFAL 1EAJA 4KDTA 2I5YL 1NBVL 5MERB 3F12B 4RAVA 4GRWH 1AE6L 3EO1B 4G6FD 3DVNB 4L4VE 3H9SE 3EOTH 3TBVB 3KLSA 4ESKA 3KYNA 4WO4D 4Z7VB 5EUOA 1U93A 1IC4L 2IG2L 3I3BA 1MWAB 4GKOA 4UZGA 5DJCB 2IEPA 4Y2OA 4QHMA 1VCAA 4MAYB 1Q1JH 3I75A 4F3FB 5C0AE 3KPRB 4HV8B 5CMAA 5GGRB 1ZA6A 1HKLL 3VXNA 4WWID 1NC2B 5J9PB 5KSAD 5TE7L 3TYFA 1K3IA 1R5VB 1FAIL 1IL1A 1BOGA 1BLNA 3U48A 2OR9L 3V5KB 3WDIA 4Q58C 1YQVL 3MJ6A 3AXLA 4GOSA 2ARJQ 3VFUA 1JYNA 4JQVC 1JPGA 4JKKA 1PQZB 3D2UD 4RISH 5D6CB 5LGJB 2GY7B 4PJHA 5C0JA 1YEJH 4WV1A 1J8KA 4F7TA 3O8XC 3NFSH 2YK1L 3P3YA 2LU3A 2ZUQB 1WBYB 5MEQB 5K9KA 1TZGL 2VXSL 3GJFA 2NYYC 4BZ1H 3V6ZA 3VFTA 1QLFB 1Z6JT 3FQTA 1YPZB 3QPQC 1Q38A 3VXUE 4UDUA 5I18L 1RZJH 1T7VA 3IJYA 1EVUA 3OAUH 3MSPA 1Q9LA 4R4BB 1F8TL 4F15B 2I9LB 4Z7VF 1I7TA 1MCOH 5BJTB 1IBGL 2V2WA 2XKNB 5BXFB 3VFNB 3C5SB 3UBXB 1N59A 3WIIL 4NQDA 3CX5K 2LTQB 3BZFA 2FR4B 4AK1A 1UZ6F 2NY5L 3ZL4H 4NUJA 1T5WA 3TO2A 3OGOE 2G60L 5LXGH 1C5DA 1J0ZA 1YY8A 2V7NB 4XVJH 1RK1B 2R2BB 3QPXL 4QXTB 3VXME 5L88H 1SQ2N 2ZNXA 3UTTD 4LNVA 4PR5B 3BSZL 2VWEC 4GXVL 4OF3A 3L5XH 5HI4C 2C3VB 2P43B 1RJLA 4N1CA 3BPNB 3V52H 5FHBL 1LHZA 4GUPB 5AD0A 3OXRA 3SDXA 4BM7A 3GZKA 5DVMA 1DR9A 2R0KL 5FO7B 2GYSA 3D0VA 4M1GH 1HWGB 5DJYB 1FZMA 2CLRB 3TJEH 3CFIC 1U0QA 5GPRA 5IF0A 1WCQA 4ISVB 4NQVA 5GGTH 3KPRA 1HHJB 4NC2B 2P5WE 3DX8A 2Q76B 5CIPH 4ZUSA 4JFDB 2V5MA 4KTDH 3EJJX 2W60B 1LMKA 4G7VL 1QEWA 1INEH 3TVMC 1A47A 5EORH 3C6LA 4EDWL 3CZJA 1HEZB 1YQ2A 3DO3A 4WENB 4WV1B 2YD8A 3EJZD 2PUQT 4O2CA 3D18A 3T09A 3MJ7B 4QY8B 4JHWL 4QOKE 2X4QB 4Z0XA 2NY4D 4TUJB 4WW1B 3ZT5A 4H88H 1A7QH 4OZHB 2Z31A 3JV4B 4K9EC 4KMTH 1M05A 1A21A 2GHWB 2HT2D 2QADD 2J8UA 4JFFA 4RGNE 3B5GA 1EEZB 3O45B 5DHVH 3LCYA 5CSZB 4HAFA 4OAWB 3MRLB 4OQTL 2ESVA 2NXYD 4LLVA 5DFVC 5BJTA 5F9WB 2X4NA 3PP3H 5J6GA 3QUYB 2G5BB 1L6XA 1QFPA 3EBAA 3HMWH 1CLYL 4R0LC 2R4RH 3KLHC 2ERJB 4FRWA 2Q1EA 4EN3D 3UJJH 4HAGA 4PJFF 5D7LD 2BNRA 4AENB 4JRYA 2H8PA 1U2CA 3H3PH 1JGEB 2ITCA 1HE7A 3AAZA 4WEBL 2ITDB 3GBNH 4FXKA 1S9VB 5IB2B 1LP9A 2HJFB 4NQDE 3GMNA 5DS8A 5GRXG 2EDBA 4JDTL 1YMME 3LEYL 1KTDB 2HJKA 4PRDB 5KTEH 2ED9A 5FECA 4LEOA 2IPKA 1ZWIA 3WFZA 3V9FA 1ZV5A 4Y4FA 2PTVA 4GUPA 3VD3A 3WL9A 5AD0B 1CD1A 5CILL 1NAKH 5F70A 3ARWA 4GW5A 1E27A 2X09A 1GXEA 3QXDA 3HLAA 1HKFA 2E9BA 2OQJB 4WHDA 3FONB 4JFYB 2G60H 1EGJA 4JGMA 4XPFH 4MVBD 1A5FH 2PR4H 4OLVL 2X4PA 4RFEB 4NQVB 4Y5XC 4JGJA 1EFXA 3HMXH 1RZ7H 2WINA 1YC8A 4PBVC 2EYSB 1PKOA 5E08L 2NTSP 3AB0B 4ZUSB 1AKJA 3QIUB 4HK0A 1Z3GH 1F6FB 2FL5A 3RNKA 3QI9D 1ACYL 8CGTA 3BYTA 2VR4A 2A83B 2FX7L 5FA3A 3RWHA 2X4UA 2OJEA 5IGXL 4KMTL 1XGRA 3O6ML 3THMH 1DFBH 3BKCL 3N06B 1NCBL 4Q9RL 4G6FB 2PNDA 1U8NA 2XRAH 4M1CD 1OF2B 4D0DA 4PD4K 3D39B 2KPNA 4AIZB 4HWNA 3BQUC 1P9MC 2FH6A 2BK8A 3NIGF 4XCEB 2DWDB 4FQJL 1D9KC 4WU5B 5BZDB 2HT4D 2ZCKL 3EZ8A 4HUNB 1MQKL 1NAMB 3KPPB 1EEZA 3O45A 2NMSA 3WHE0 1ORQB 5FOBB 3HNTL 1K4DB 4F7MA 2EZ0D 4NN6C 1CIUA 3CUPB 1JWUA 5I16A 2Z4QA 4O5LH 3P73B 3HS0A 4RGMC 1AXSB 4D2NA 3ZDZF 2EXYD 4MSWA 3U7YL 5DGQA 1AP2B 1S7QA 5HGDA 3MQIA 2MQ3A 3L7EA 3U2SB 1R5WB 2ZSWB 4OD2A 2MWCA 4LAQH 3EO9L 2XZAH 3AROA 3SDDD 1EXUA 2NR6D 3U4AA 3FQUB 2HTKC 5J11C 1I8LC 1A1MB 3CFBB 4PLKC 1RUAH 4PRDA 1CCZA 3NAAL 1QNZH 1WBZB 1AC6A 5IHZA 3ELAT 3SKJH 3I6KB 4Q0XL 2O61B 1CFQB 1MRDL 4IMLA 5F6HI 5C0BA 3MFGB 2WWKT 2CKBL 3QULA 4NJAL 4LL9A 3PL6A 1U8JB 2FJGB 3MUGA 3MRFB 1G6RA 5J0BA 4QHUB 2OQJA 2UWEE 3I6GA 4M62H 1N0XH 4JO3L 4HWEH 4UOW1 3RY5A 2NLJA 3U9UA 3UTZB 2D0HA 4Z78B 2BNRD 5L8JB 4MD0A 1GIGL 4NQED 1CDCA 1Y6NR 5EU6A 3MLYH 1KJ2B 4GAJL 4L1HA 1JZ3A 1NLBH 3BUTA 3MZTA 4RDQF 4LARH 1YEDB 3VW3H 4JVPA 4MA8H 4HK0B 5EB9A 1FGVL 2VDQL 4P46C 3BDYH 5EWIH 3GM0A 3PWUA 5HGGS 3V8CA 2FBOJ 4F9PA 4CN6A 4OTXH 4PYGA 5JUEL 3DHMA 2R23B 4XVTL 12E8H 1TQCC 1HNFA 5I30H 2XICA 3HC3L 4JR9L 4BJLA 4PJIA 1JTTA 1V5JA 3HHRB 4KDVA 4LCWD 5GGQH 5I2IA 3UPRB 5C09D 1CXFA 5HHOA 3BJ91 2QR0A 3MYZA 4CNIA 4IIQC 4P5TD 4KJPD 3BJLA 1WZ1L 4H26A 1VENA 2VKWA 3IDNB 4D9RD 3KPPA 1M7DB 5FA4A 2QBWA 1ZLWH 3RVWD 3HZKA 4TNWK 1D6EA 1E4JA 2BSRA 3K4ZA 1JWUB 5I16B 3JTTA 4PTTA 4KI1A 4PJXF 3M8OL 1UJ3A 3RWGA 4NPYA 1DBKH 4HHAB 3QIBC 5DXWA 3U0TA 3EYSL 5HGBA 4J1UB 1NUFA 5HGAB 2BY2A 3X17A 3CFKB 4MCZA 3IXTA 3QUKB 4U1SA 4PGCA 4NNXA 1IGFH 4MAYC 1S7RB 3U1SH 5DA4A 1TTFA 3JTSA 1J9CT 3KXFD 1DUZB 3WJLA 1N7ML 4ZPTB 3UO1H 4YXHH 4ZXBD 1D5XB 5ALCL 4JHZA 5HI3D 5E2WH 3KJ4C 3L3KA 2J88L 1OTSC 2DS4A 1GAFH 2PYFA 4YEEA 3LQAL 1CFQA 3SQOH 1A7RH 1PDKA 1I9JH 2XNAA 2OBGA 4H88L 2GUOA 4Y5YB 3AU1A 2YHGA 4R4ND 4M6OL 2YN5A 3JWDL 1G6RB 2QTEA 3QT2A 1EV2E 1KENH 2HT2C 1FL3A 3QBTB 2C26A 2IGFH 2D7NA 5CP7A 3BD5A 1OAQH 3O6FB 3H6JA 3EYFA 4P2QB 3DRQB 1MJ7L 3K80A 4QOKB 4Z78A 1CGWA 3Q3GB 1T0MA 3EOBA 1CXIA 3E2HB 1RIUL 4PGDB 4R0LA 1TZIB 4NFCA 3ECBA 5LQBL 3FB7B 4JN2A 1JPFB 3KJ6H 2JCCB 4RA0C 4OZHF 4YEFA 2C1OB 3TVMD 5C2UB 5DJXB 3V5HA 5BW7A 1YNTB 3WLBB 3MRDB 4HT1L 4P9HC 5INCA 1RFDH 1FG2A 3MJ8A 4J8RA 4UB0H 1X4ZA 1TETL 5GHWH 3B6SA 4PGEA 4G43A 3BE1H 4LK4A 4QRTA 5JPNB 4NQCA 2HFFA 4PRIB 2BRRL 1FBIL 3TO4A 3ROOB 4NO3B 5D2NA 3VG0H 1M7IB 5FYLH 1FGVH 1T1WA 5EPMA 5ICXB 4APQD 3GMLB 3WEXB 1S9XA 1JV5B 3HG1E 1FVCA 3LB6C 7FABL 5EA0L 5EIIB 3SDAA 2J7LA 4K3HA 3VRLE 5C0EB 3O2DH 1N6QH 1BP3B 2IQAB 1NAML 1BGXH 3CVHB 3FRUB 1QLEL 1HHGA 4TOYH 3B2VH 5MEND 4XVSH 1XGYH 3OWEA 1IGJB 4FQ1L 2OTUA 5A2LH 4I18A 4OZFH 3QHZH 1VPOH 2HVKA 1FZKB 1YUHA 1B3JA 3KPSB 4GFTB 3RWDB 2APXA 1HWHB 2DLFL 2X1QA 4O5LL 3CJJA 3P77A 3PIQA 4HS8L 2BVPA 4OCSL 2R56H 3O3BB 1C7SA 4LOUC 5T1MB 2KKQA 3OKMB 4KZDH 1KCUL 1FO0B 3IXAB 1GPOH 4M6OH 4J3WA 3SE3A 1W72B 3DV4A 4ZOEA 2LABA 4U2ZA 3T1FB 3TBVA 5EU4A 3MYJB 3CK0H 3PWJB 4YHIA 3SKOA 4AT6A 2H2SD 3QQ4B 3DXAE 3LZFL 1MWAA 4V1DA 1Q1JL 1OVZA 4RGNB 5F97E 3GO1L 3OL2A 5D1XA 3CSGA 4ACPA 3O6FD 4QNPF 2XQBH 3MRJB 4KJQC 5CEZL 3HI6H 3Q1SH 3W9DA 2NZ9C 4HFUH 3VH8B 1NCDH 4M5ZH 4DK3A 2XWBA 2FX8L 3SBWC 1U8PA 3U30B 3SCMA 1MJ8H 4Q9QL 3O8XD 15C8H 3KPSD 4QWWD 3BPLB 4I1NB 5FO9A 1SVCP 3RUGF 1JN6A 4XC3L