4D8PA

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
184
structure length
184
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DQA1 protein
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pA01
3WXWH 2FCBA 1AGEA 4RIRA 3GSNH 1KV3A 1MRCL 1RZJC 5GS1A 1KACB 4LGSB 3LRSB 1JBJA 1T83A 3TH2T 1BM3H 4K3EH 2YHGA 5EPMB 1JWSB 4P57B 4YLQT 5JORB 4Z7OE 3O3AA 1A21A 5KANI 3CIQA 4BH8B 5IV2B 1IMHC 5D9SA 4RA0C 1VFAA 2GTWB 2FX9H 1ZT1A 1V3JA 3FO9B 1S7RA 1K3IA 1OSZA 4MDJA 3S5LA 3T0AA 2BNRB 3KLAA 1I9RH 1I85A 5I8EB 1CS6A 3MRDB 3UPAA 2R2HA 1I7UB 1NANI 1NBVH 3WFBL 4ZXBB 2BZDA 3IJSB 4Y19B 2NX5B 5ENWB 3RVTD 3SKJL 3O2VL 5D70H 4GAJH 2NY5H 4QNPE 4Y5XB 2QBWA 2NTFA 1AXTL 3G6JF 3MLWH 4JFYA 4YHOL 4LLYB 5J12C 2ZSWB 5TDPA 4LCYB 4MA8H 4RSVA 1OT1A 2X4QB 4KVNL 1K8IA 1CD0A 3MXVH 4LOUC 1U3ZA 1RHHB 2C1PA 1OB1B 5TF0A 2ZNWA 4M00A 5D7IA 1U3JA 5J06A 3LEVL 1E4JA 5JW3L 1RJLB 3BEVA 2FH6A 4N0CC 3TN0C 4ZSOE 3F12A 4TUOA 2I24N 4FQLL 4R7DB 1C1EL 2NZ9D 2G2RA 1TTGA 1Z6JT 4UOW1 4X5XB 5ESAB 5EZJA 4LPTA 1MFAH 1VEOA 1D6VH 4UQ2A 4RNRA 3NTCH 1CT8B 4N0UB 4KROB 2E27H 2NXZC 2HH0L 2PYFA 4L8CB 4PP2A 1KJVB 3CMOL 2X41A 4O00A 3PGFH 3Q5TA 4V1DE 4JEGB 2P48B 2D0FA 1WWAX 3MLUH 4DVBA 2H6PA 3JTTA 2CK0H 4JVPA 3VXUB 3WLWC 1BIIB 4S2SA 4UOJA 5C0JB 3BWAB 1NCAH 4K71B 1U8NB 1M6OA 1YEJH 5FEBA 1JGDA 1MH5A 3WS3A 4PJ5D 1UB6A 3VDAA 4HJJH 1FLRL 2KH2B 2VWEE 5D1QC 3SJVE 2JB5H 5DA0B 4M7LT 1MSPA 3EUUA 4OT1H 4MMZC 2BNQA 5FYLL 3TJEL 5AWNL 2HN7A 2EEDA 1VGKA 4PLJC 4AENA 5I1HH 5T1MB 5D93B 3SE9L 2X7LA 1JGUH 4PRIE 4L4TB 2AXFB 4JPVL 4PP1D 5ERWA 3SE8L 4NN7B 3EYOB 4NUGL 1ORSB 2H41A 3BN3B 1XH3A 1LP9F 5E2UL 1UENA 4HC1H 2VDKH 3MGTA 2Q7NA 5FFLA 3LB6D 3UTPD 4R3SB 5HGDA 3O11A 2NY0D 2XA3A 2Z4QB 4IOIB 5DLML 2R4RH 1QVOB 1X5FA 1JHKL 4QOKA 4X99B 3DGCR 1FAIH 5D2LA 5K9JH 4MXVF 4WUKH 1UJ3B 4I2XA 5IFJB 2K7QA 2YD3A 3QFDB 3DVFA 4Z8FH 43CAB 3IU3B 4XMKL 1LK2B 1UGNA 1CU4H 4EBQH 3RVVD 3CFDA 1MNUL 3T2NH 2P4AB 1F6LL 1G7JB 1INDH 4MJ2A 4F58H 3H2WA 3MRHA 2W59A 1NGZB 5E6YA 4WU5B 2X4NB 4XP1H 4FQQB 3VGEA 2CDGB 5FF6A 5SWZE 3R1GH 1E6JH 2FJGA 4R4ND 5IQ9A 4EQ2A 5I16B 3D0VB 5BVPL 4KY1L 3TVMD 3C5SA 4MJIA 4LHQB 3DECA 2FX7L 4QXUL 3GI9L 9CGTA 3D0LB 3QDMA 4ZS7L 3RY4A 2XWTA 2AEQL 3MRMB 1GIGH 1QQDA 4NO0A 3FB6A 4V2CB 3UDWA 4N0FB 2XQYG 3O6FB 3TT1L 3MV7A 3OKMB 1RU9H 2R29H 4HS8L 5I19L 4LHUD 5JR1L 1NUDA 2DBLH 4JY4A 5HHOA 4DGYH 4NIKB 3EDFA 1JPTH 4HGWB 1N7MH 5JZ7C 2LQRA 5D6DA 3DJ9A 4N1EA 4MA1B 2H1PH 4ZFOB 3L3JA 5JUEL 4KJWC 4AY0A 4FQIH 3JWOL 4M5YH 1PZ5B 3TBTB 4PY8I 1RZGB 2Y9RT 1BBJA 1DFBH 2BSTB 4YHYC 3HFML 5IIEA 3RTQC 3EYFA 3HPJB 4O02L 1G7QB 2OLDA 3EOBA 2DD8H 2GFBA 3S34L 3QNZA 1U58A 4JZNB 1LD9B 2J6EL 2RHEA 4PJ9D 1MF2L 4IEFB 4IOFD 4H8WH 2KQNA 1DDHA 1V3LA 2RCSH 2VWEC 3HE6D 3HZKB 3RIAK 3C87A 2FEDD 3DIFB 3QULA 1VENA 1LMKA 1UT9A 5D72L 5DQDH 3CFCH 3GRWH 4LNRB 5E6IA 5CWSB 5IWLC 5L2KA 2AJ3A 4NZDA 5TE4L 3EO9H 3PE9A 4NQEE 4I18B 1KELH 3QSKB 4JG0L 4PJIB 4JAMA 1CXLA 5F3HA 2LFGA 3ARGA 3FN0L 2EECA 3JWDC 3RI5F 4X5WA 2OTUA 2P5EB 1PVHA 4GLRI 1GGTA 2C3VB 3BKCL 3ES6B 3NFPA 4J3TA 5D71L 5DC9B 4CN1A 2D2OA 4M7ZB 5HHMB 5TGBB 3DUHA 3V0AC 1GPOL 5CHNB 3SHSA 3C9NA 2DDQL 4BZYA 5HY9B 3QXDB 2D7PA 3QFJA 3S7GA 2VLKE 1FBIH 3HC4L 1GGCH 3C6LC 1CGTA 1RK0A 5SV3A 3C5JA 3R4DA 1GZQA 1MLCB 4I3SL 1M7DA 3CC5B 1MRCH 1OF2B 1P7QB 1TJGL 3BH8B 4ISVB 4J3WA 1R24A 5BRZA 4Z7UB 5C92A 5LKNA 4LLQA 3VXQA 4GKZB 3EZ8A 4FFWC 2FZ3A 4DZ8A 1MPAH 3VXRA 1QO3B 3RWEB 1F3JA 3PGDB 2UY7A 2GITB 2OZ4A 3FQRA 3HRZA 3UC0L 4LCWB 3ESVF 4JM2F 2A73B 3NCBB 4CGTA 4PJGA 4BFIB 1ULVA 3O4LB 1A02N 1LO5B 4L3EA 1LEIA 3OR6A 4YK4B 4B41A 4WIQA 3O2VH 4M6ML 2APVA 5J6HB 1X5YA 3SE4A 5DFWH 1ZLSL 5KAQG 3LKRB 1JHLH 4Y4HA 1RQ5A 3CNKA 2H3NA 1JZ6A 1EO8L 4YHOH 1ZGLB 2FNBA 3TJHD 4ZS6D 2BVUA 1AO7B 3TA3D 5I6XB 5DUMH 4K94C 4U1JA 3PP4L 3BO8A 3L9RB 1N5AB 3I02A 1AI1H 3MSPA 3PNWB 1OAZL 2R0ZH 2PTTA 4F33A 3HRPA 1W72H 1RZ7L 3GMRB 5E8NA 2H9GB 3LEVH 5CIPB 5JW3H 3ULVE 1LQSR 5IEKB 2MWCA 1NEZB 1HDMA 4FQLH 5E99L 4ZAKD 4GRWH 2FBJH 2QTEA 1C1EH 2CMRL 1I8MA 4K3HA 2ZZUT 3PWUB 5C07D 3BPNC 3RQ3A 1AXSA 3TBSB 3VXNB 5C86A 1Q0XL 4NC0B 4RFOL 5JHDA 4BQ8A 5J13C 3BQUA 2BK8A 5EBMA 1CFTB 3W39B 3FB7A 5E5UB 3UTTB 1F97A 3C2SA 1S7SA 1P6FA 3CMOH 5EC2A 4Z7NE 4JHAH 3J7HA 4PLOB 1U9KA 2J8OA 3O6KH 1I1CA 3LEYH 4YXKL 1QBLL 2JCCA 4DAGL 4RGOL 5J1AA 3QDJB 1DBKL 4OLZL 1RFDL 5FO9B 3BGMA 2LVCA 1GGIH 1CE1H 1FLRH 1JYVA 1AHWB 5KVEH 1KB9J 1LWRA 4FQXD 4XMLL 2CXGA 3X13B 2QLVB 2Z31C 3ULUD 2JIXA 5FYLH 3TJEH 3BGAA 3IDJA 3OB8A 3OKLA 3DX8B 1FVEA 4LLUA 1U8OA 3BZEB 5E4EB 4U2YA 1AGDA 2F53A 1UG9A 4JPVH 3NPSB 2XWJA 3BVNB 4OFDA 3L7EA 2IQAB 1UVQA 5DJDB 4GKSA 4MMXC 5BJTB 1XEDA 4ZO7A 1WV7T 5D6CB 4L4VD 3VU2A 1CICB 1KTLA 5ISZE 4UIKH 3OPZL 2VXUL 3MA7A 2GT9B 3G5VB 4HUKB 1G7IA 3L95A 3DUUB 4RISL 5INDB 3ARBA 4X4ZA 1QEWA 2AXJA 1KB5H 1RUQH 2E6PA 5C3LD 4TSCL 1NFIA 2DI8A 3OR7A 1QRNE 5CGTA 4DFIA 1FZOA 3K74B 1YEFH 3RUGE 1EGJH 1J1XH 3KPLA 4G7YH 5MHSE 2Q20A 3MRLA 1BD2A 5D96B 1JHKH 5IB1B 3MV8D 4G3YL 5CSBA 3FB5A 4Y16D 1KFAH 3BDBA 5C0BA 3BIBX 1EBAA 3MREB 4QHKI 5H2BB 3U9UA 3B9VA 3GSRB 1MNUH 2ZCHL 3NIFF 2DF3A 3BPCB 4Z77B 4KKNA 1IZJA 5T3ZL 1DP0A 4EDWL 5I1LA 4IMKA 3D85D 1LEKA 4QKXB 2IAND 1JJUA 2QV2A 4M9PA 5FGBA 4NZJA 4NHCH 3BKJL 1JIBA 4OUUA 2BMKB 1K85A 1XGRB 1VKXA 5BVPH 4KY1H 1KPRA 3LH2L 5I1DB 1CD8A 2ENSA 1IAIM 2FX7H 4JCMA 4ZFZB 4QXUH 5DRXA 3WHXB 4MNGA 3U48A 1HHIB 3OKOB 2YD6A 3TIDB 2AEQH 3NMEA 1YMMD 3ULVC 2I27N 3HZYA 4KJYA 1XCTA 1F45A 4GRLA 4LMQI 2OBGA 3AROA 2XZAL 2XFXA 1T1WA 4P2OC 4D0CB 1I8IB 3CFEB 5JR1H 4ORZC 3RZCA 3RAJL 2V17L 1J8HE 4UT9L 1H3XA 3D2UA 32C2A 3MRGA 4HWZA 2ZOLB 4GUPA 1J11A 5HD8D 1OWRM 3OKKB 5HYJA 4NO2B 2HKHL 4G6AD 1MVUB 2Y06L 3M8OL 3O3DB 4PJ8A 2VZUA 4V1DD 4Y4FD 4WEUD 4P23D 3S5LG 3HFMH 3B8YA 4NNYA 4UI2A 4F3FB 2FGZA 3AFLA 2ADJA 1WIOA 5DUPL 3S34H 2J6EH 2YN3A 4L4JA 4J12A 2ESVA 3FRPG 2XICA 2OL3B 1G6RH 1LO0H 1J10A 1FJ1A 2ZUWA 3GO1L 1OGAB 5IJVA 4OGAC 4ZTPL 1F42A 1OTSC 4OM1L 1D5XA 5E9DE 4PLKC 1J1OL 2Z35A 1PDKA 1E4XL 1XGPA 1HEZA 2EDJA 5D72H 4P4RB 1KNOA 4J1UB 5DRZA 1PJ9A 5TE4H 2UYLB 1ZA6A 4GXVL 1A6TB 4JG0H 4YDIL 3V8CA 3MJGX 4IDLA 5C0AB 1U8QA 3NCJH 3MJ8A 1U3HB 3KPMA 1X5ZA 1TJIH 3IDIA 5DK2A 1KCLA 3BKCH 3WS6A 2LTQB 5KW9L 1I8LA 1PQZA 5JIIA 1AR1D 2YPVL 3L3HB 2DDQH 2EH8L 3DROB 3WJLC 3Q5YA 3AM8C 4APQB 4DGVL 3HC4H 4YFLI 1HQRB 3KXFA 1GGYA 1YY8A 2NY3D 2PXYB 3QT2A 4AIZA 4GT7A 5EOQL 3ULSB 4QEGA 3H0TB 2WK2A 1CIUA 1Z0NA 3VFMA 3PV7A 3MCKB 4Y1AB 3IU4L 3RGVB 2P5WB 4GQ9L 1W0WB 5D5ME 3EGSB 3FT3A 2EDOA 1CFNB 1Q9WA 3OXRA 5EN2A 4JY6B 2N1KA 3BHBB 1UZ8A 1JZ8A 2FO4B 3FO1B 2UV3A 4U1SB 3UX9B 2IH3A 5AAMA 4PJIF 2P8LA 3OB0K 1IFHL 3WNPA 5BW7A 4ETQA 5B8CB 2J5LC 5ALBL 1I1AC 3M17B 3P0VL 1QPXA 4IIQC 4ZFGL 4HIHA 4M6MH 4ORGB 1QSZA 4WO4B 3OG4B 1AKJB 3HLAA 2BY1A 1P7KA 3GMLB 3LQZB 3NFSL 1ZLSH 3VWKC 5K9KB 2VLJE 1H3WM 4HXAL 5C08E 5DMJB 1Y6KR 4DGIL 3HUJE 4F7TA 4KKCD 1ZWIB 1F4WL 1CI5A 3U30C 5GGRA 3KYKL 1ZHKB 2PW2A 5KVFH 5F7LB 3AB0B 4R8WL 5F7YC 1A6AA 3G5YB 5E5MA 3MGOA 4ACPA 4B7LA 1RV6X 2O5XL 3TCXA 4Z7UF 4YDVA 3VGBA 1NMBL 3X11B 4PY7A 5JDSA 3IXAB 3EJZD 1NBYB 5JA8B 3KR3L 2XTJE 1CGSH 3GSVB 1EX0A 1QSFA 2OX5A 4UNVA 5FGCB 4XMPL 3RP1A 3R06B 3U36B 2BSRA 4HX1B 2BOCA 3L1OL 3VWJB 5FA4B 1V3MA 4P5TB 4PRBA 4ZG1A 5HHNA 5DVNA 4Z0BL 1LO3L 3BW9B 2XWBA 3HG1E 3LIZL 3IGAB 3TWCL 2WBJB 4YXKH 1AQDB 1EAPA 2WWKT 4HUNB 4POZC 3SDCD 4DAGH 4RGOH 4BUGA 4HKJA 4OLZH 1RFDH 3SDDA 3VFUB 3SCMA 4XNZB 3TIEB 1VFUA 5GJTL 4P2QB 4UTBH 2VNCA 4HV8A 4FMKA 3MYZA 1FL5B 4XMLH 1HINH 4Y8DC 2VN7A 3HR6A 3TFKC 4HUWA 4OAWB 4LBEA 1SYSA 1EFXD 5FK9A 2DRUA 3ARDA 3RL1B 3G6DL 3KPPB 3D18A 3PF2A 5F6IC 1YEIL 3TBWB 1RZKH 2GTZB 3R8QA 3VXOA 5FECA 2IBZY 1B0GB 5DRWB 4NYLA 1KB9K 3NIDF 5DC4B 1H8NA 4M43L 3MV9B 1CFQA 2P43B 4BKLA 1GAFL 4WFGD 1B4JH 3Q1SH 2YPLA 3QNXB 2EIBA 4RGNB 2Z91B 1UC6A 4D0DB 5E4IA 4RRPA 12E8L 4TSCH 4E41D 4Z7VA 2VISA 3CDYA 4GKNB 5IFHL 5KSAA 5JQ6L 3AY4A 4GW5B 4NNXA 4OJFH 5T1KB 5F3BB 2IAMC 3QUYA 4G3YH 4U49A 3T4YA 5F7UA 4TULH 2CLRB 1K9TA 4IM8A 5JXED 3S98A 2HRPL 2AJSL 1ZHNB 2Y6SD 4PJAB 4H26B 4CAGA 2UWEA 1KJ2H 1OVZA 2EYTA 3B9DA 5M95B 2W60A 1AGEB 4RIRB 2E7CA 5FKPA 5GGUB 4EQ3A 2YD2A 1X5HA 3LPWA 5T3ZH 1QBAA 1X3DA 3Q6FA 2WM0A 2JKXA 2OM5A 2B4CC 3O3AB 4GW1A 1CXIA 3BKJH 2DLFL 3CFIC 3WYRA 5DTFA 4OIAA 3W82A 5DJYA 1ZT1B 1S7RB 1NDMA 1OSZB 4MDJB 3S5LB 3KLAB 2OZ4L 3IDUA 3B2VH 3QUZA 2R2HB 5M7QA 3C08L 1PG7W 4UV7H 2DIJA 4XVJL 2W9DL 4NUJA 2DQCL 3G6JE 2XZAH 3BZ4B 1VFBA 3GMNA 2XTJC 4U0RB 3C5ZC 3N50A 3RAJH 1R5VA 4AZ8A 3S9DB 1WC7A 4NT6A 3MTRA 4WI7A 2NTFB 1T1ZA 3KS0J 4JFYB 1KIRB 3O9WC 5CBAB 5BS0D 5TDPB 5DRNB 2HKHH 2CGRL 2VMFA 1KIPA 3MBED 4UINL 2YBRB 1K8IB 2G5RA 1MFBL 3H9SD 3FTGA 2C1PB 1UFUA 4QTHA 5D7IB 1K8DA 5C09D 3OB0H 4DN4H 3AUVA 3OBAA 3QQNA 2FDBP 1R3HA 1WFTA 4JFPB 4TUOB 1FNGA 3QIUA 3RVXD 2ARJA 4X80L 1PEWA 1QACA 4HIJA 4KHTH 3CFKA 3DRQA 5C0DA 4XC3H 3WL9A 3F7QA 5JDJA 4Y88A 2G2RB 3BUYB 3GO1H 3L3GA 1YYLL 1L9NA 4OCRH 1J1OH 5C2BH 1E4XH 4HHAA 1V3KA 4PLNC 1FORH 3EDKA 3P30L 1T7ZA 3AVEA 3K8MA 3K4DA 1A7RL 2PYFB 4QF1A 4PP2B 4I3RL 3F5WA 3OF6A 4GXVH 3O81A 2PO6A 2QQLL 4AEIL 1KCRL 3LN9A 1WITA 1KCUL 4DVBB 5JW5A 2H6PB 3JTTB 5A2LH 4CADA 4S2SB 4UNUA 5FUOH 4N1HB 1M6OB 4MNQE 2D7MA 1JGDB 1MH5B 1XGUA 1A7PL 3MUY1 1UB6B 1GXEA 2EDKA 3KPRA 2L4OA 5D2NE 4ZUVA 2YPVH 3FMGL 1S7UA 2EH8H 4S1DD 1A9EB 3LD8B 4DGVH 5BO1L 4WHTA 4JPKL 2BNQB 2LU7A 4AYFA 4YHML 2HN7B 4AENB 4XCFL 1BHGA 4ODVL 2GEEA 2DM3A 5EOQH 3CCHA 1FFRA 1N3NB 3C6SB 3JV4B 4RQQA 1LP9E 5C1MB 5ERWB 4RAVA 4NN6C 4JKPL 2OXHA 4YHZH 2QEJA 1RZ8A 1XH3B 1V7MH 1GZPA 1F4HA 5DD1L 3MGTB 4OKVA 1IGYA 4LLAA 4Y5YB 1MCLA 2DYPB 3KHQA 3V5DA 3K4ZA 1JRHL 2FSEA 4Y4KA 1AFVL 4NFCA 3O11B 1MCWM 4YWGL 4RDQF 3GMPA 4FRWA 4AK1A 4MXVE 3N0PB 4QHNB 2J8UB 3ZKMC 5EIIA 3V6FA 4P4KB 4QOKB 5DO2C 1R3KB 4KRPD 5D2LB 5ALBH 4JRXE 4PJXE 2Q76B 4ZFGH 4WI5A 2BJML 4OCYH 4WHDA 2PETA 4WV1A 4A6YL 2R1XA 3HKFA 1Q9LB 4ODSL 3SEPA 5FYLD 1JNNL 5TE6L 2ZCLL 3U4EA 1VCAA 5FYKE 4HXAH 5CLWA 1ZHLA 3EDJA 3LKPA 3CFDB 3RWCA 4MQSB 1FVDA 3ORJA 1GCFA 1FAKT 4DGIH 1YMHA 5MENE 1VERA 4TUKL 4H25B 1K4DA 3MODL 4HIEA 5E8OA 4P2RA 4S10A 4MLIA 1MHPL 2I9TA 4R8WH 5EO9A 5FF6B 1ZA3A 5E8DH 4NKMA 5T33H 1OTUD 2FJGB 5IQ9B 4N9GA 1S9XA 5KAQF 3C5SB 4MJIB 2W0KA 3KR3H 5EULV 3ZKNC 1SQ2N 4M1GH 4OBRA 4XRCA 4OLVH 4ERSH 3QDMB 1PBYA 3SOBL 1G9ML 2H32A 1B4RA 1KCVL 4AM0A 4F7EB 3NGBC 2XWTB 3N1FC 3HNSH 4P2YA 3BDYL 1QQDB 4NO0B 3FB6B 3OKDB 5BV7L 1NC4D 2XNAA 4LARH 4OF7A 2VXQL 4XCYA 3L1OH 4LLDA 3DMMA 1MWAH 4F7PA 4JY4B 3GGWA 5HHOB 4Z0BH 4PREA 4WGVB 5CP3H 1QOKA 1G6VK 3T3MF 2NXYD 3CXDH 3QEQD 3L3JB 2Q86A 1DLFL 1EO7A 4PJ7A 4AT6A 2NLJB 3TZVB 4LLMA 1BBJB 1OAYL 5GJTH 2YD8A 2BFVH 3EYFB 4IRZL 5IB3A 3T0WA 3EOBB 3RY6A 1YQVH 1PSKL 3M07A 2GFBB 4U6HB 4AG4L 1TCRA 4NZUH 4ELME 5IESH 4MB3A 2DLEA 4Y2DB 3G6DH 4LIQL 5C9KA 3PWPE 3BP4A 3LRHA 1GHFL 3WKML 4O5LL 3FFCA 1YEIH 4NC1E 1IZKA 2BHYA 3QULB 5T1LD 2YZ1A 5HVGB 4OLWL 2VRAA 4OD2A 2APBA 2VZ1A 4WRLA 3QUXC 4OIIH 5E6IB 5L2KB 5TDOA 1FL6B 2AJ3B 5DMIH 1IAII 2ILLA 5GGSY 5IJKC 4JFDB 1EMTL 5F3HB 2QQNH 3ARGB 4O2CA 2XN9B 4X5WB 1WTLA 3RNQA 5IFHH 5JQ6H 5KBNC 1A7NL 3NCYS 5H37G 5EUOA 3NFPB 1R0AL 2FD6H 2ADIA 3HE7A 1SJXA 3TF7C 1DBBL 4OD3L 4R2GB 4BFBD 4TVPL 2AJSH 3QFJB 4FG6C 1T3FA 2CPCA 5B3NA 4B53A 3DPBA 2I5YL 3CU7A 4XBPA 3W9DA 3GEWB 3L3OB 5HJ3A 1RK0B 3C5JB 3V95A 1GZQB 2NY4B 3TO4A 1M7DB 1A6ZA 3K80A 2IEPA 4I77H 1JGEB 1OAXL 1FNSL 1NMCC 4WEMB 4YDLC 3MLYL 5BRZB 4U1KA 5ESQA 1R5IA 4QRPE 4EN3D 4LLQB 4NOBA 3VXQB 2CDFA 3TA3C 3VD4A 2DLFH 4DZ8B 2Y07L 4QWWC 2RFXB 4NP4L 1G9EA 1C12A 1UM5L 2BERA 2IALA 3FQRB 4JZOA 4JY5H 3HRZB 4RMTA 1U3HD 1CLOL 4L8SC 2VABB 5FCUH 4XVJH 5EU6A 1IT9L 4WJ5A 1T1XB 1LEIB 2D4FA 3MJ9H 3OR6B 1BJ1J 3X12A 4MCYA 2AGJL 1T04A 2XQBL 3V0WL 4CKVX 3PHSA 3QO1A 2OR8A 4Y4HB 2H3NB 4PRAA 5K59E 1IC4L 4PJAF 4QRUB 1YNLL 2CGRH 3S36H 3D3VA 4U1JB 4UINH 2EDLA 2X89D 3BO8B 3I02B 5EWIL 2DJ4A 1EEYA 2PTTB 2HT2C 4F33B 3AS3A 4UILH 2APXA 2DQIL 5MI0C 5JNYA 4X6CB 1FNFA 1IM3B 4LSQL 2OCFD 2NNAA 3IFPA 1INQA 4PGBA 3VGFA 1XF2A 1I8MB 1AE6L 1NGQH 4HSQA 2BNRE 2VLRD 1DL7H 3P0YH 4UV4L 4KZDL 4TPRL 3INUL 2Y7QA 2C7UA 3CX2A 5JHDB 4Y19E 5L0QB 2NX5E 3BQUB 5EBMB 5FA3A 4MJ4A 5SWQA 4UTAL 2VXSL 3QB7C 3P30H 2AQ2A 3BAEL 5DWUH 4AEIH 5EC2B 2QQLH 4NC1C 1WBZA 3Q0HA 4EDXA 1BVLB 1KCUH 2EEBA 4I5BB 1S8DB 2JCCB 4X9BA 1BZQK 3IDNA 3O4OB 4FOMA 4U1MA 5F21B 3KPQA 1M05A 5DD0L 4R4FL 4N5EC 3FMGH 2XA8L 2YZ8A 3V7AG 4D3CL 2VO5A 4CN4A 4LLVB 1WJ3A 4JPKH 2JIXB 3MLZL 2BY0A 4M6AA 1IGFL 1U2CA 1FVEB 5JW4M 4LLUB 5D7IF 2HT3C 4JFQA 5LGHL 1AGDB 2F53B 3BN9D 2AI0H 2R4SL 1S78C 1KENH 5D1XC 1UVQB 1D5BA 1DCLA 4GKSB 4MNHA 2YPKA 4JKPH 1LGVA 1K2DA 3QDGA 4AIOA 4N0UE 5IROC 5CEZE 5INCA 1I4FA 2DKMA 1AGCA 5DHVA 3MA7B 4GBXC 4HPOH 3L95B 3SKUD 3F8UB 1QEWB 5T1DL 1ZLWH 3KPTA 2X4SA 4P5TD 1NFIB 5LXGL 1UKSA 2EIEA 4I0PC 2Y5TA 5ALCH 2H2PC 4M8QA 3KPLB 4YR6A 3MRLB 1HILA 2FATL 3L3KA 5FGRA 2P24A 1A1NA 4JM2C 4XI5C 5CGMA 3MLRL 5C0BB 1TQBC 4ZTOL 2BJMH 3U0PB 1Q1JL 3NIFE 2CIKA 3T0ED 4MWFA 4A6YH 1JNNH 2ZCLH 3PQYD 4XX1G 4KPHL 3MLXL 4XAWL 3ZHDA 5HXMA 4L4TE 2LE9A 3A6OA 4RRPG 2VDRL 2MJWA 1I1FA 3WFDL 4TUKH 1WISA 1KN2L 3MODH 5I1LB 1LEKB 2X5PA 4HXBL 3W11D 1JNLH 2VQ1A 4J4PD 2CO7B 1MLBA 1R3JB 4M6NH 4XXCC 4DUVA 1RHFA 2R0WH 1VKXB 4BSWA 5JIHA 1G9NL 1X5GA 5DRXB 5D7LA 1G9MH 3OKEB 3DX9A 1KCVH 3LOWA 5F6HJ 4OD1L 4JFFD 3DETC 3BDYH 1TTFA 5BV7H 3HZYB 4KJYB 5L88L 1XCTB 4GRLB 2VXQH 3DVIA 4OB5L 3D39B 1JPSL 1NAML 4MXWH 3RZCB 3HCVA 5D2LF 4WENB 4C54A 3D2UB 4HMCA 32C2B 3MRGB 4HWZB 3DV6A 1FO0A 1OAUH 4GUPB 4ZXBC 1Y6MR 5F8RC 5CD5D 2AJZA 1QSEA 2DQHH 3OGCA 3MRFA 3BE1L 1PKOA 3L5WA 1OGTA 5HYJB 1P69B 5D1ZD 4PJ8B 5CLTA 3VXSB 2NY5C 4JQXC 4LVNB 4OZGA 4TNWF 5T3ZD 4Y5XC 3PV6A 4NNYB 2VR9A 3JVGC 5LQBL 4XBEL 4IRZH 4PRHB 4UT7H 4C56D 2B2XH 2PKDA 4LQFL 5GQBA 1EVUA 4NQSA 4AG4H 5EA0L 2YWZA 1D6EB 1CL7L 3T3PE 2VXTH 5H37H 2ESVB 3GJFB 4H88L 3WKMH 1YEEL 3CPLA 4O5LH 2X6MA 2CK2A 5IHUL 1QHOA 1CTNA 2OTWA 1D5XB 2Z35B 1JZ2A 2N7BA 1JTOA 1HEZB 2ZUQB 2G9HA 3ZSTA 1KNOB 1IQWL 4PBXA 2PYEE 2ZG2A 4YHIA 5DRZB 3LRGA 5LJYH 1T2JA 1U8QB 5E70A 1MCDA 3GB7A 3K1DA 4UUJA 5AAWA 5IK3A 4KROC 1A7NH 1D5ZA 1V5JA 4NQXA 5GSRA 3IDIB 5DK2B 5C0FA 4B0MM 3S88H 2CKBA 1MHEB 2WW8A 1R0AH 1IEBB 2FLRT 2BC4A 5D7KD 1PQZB 4U2ZA 4BK5A 1CVSC 1WK0A 2AV1A 5AD0A 2ED8A 4OD3H 4OZHA 1NFDB 4K23L 1X5AA 4K71C 3KXFB 2X42A 1YY8B 2E8ZA 2VUOA 2A9NL 4WFHD 4AIZB 1IQDB 4Q9CA 1ZGLM 3KWWA 2W9EH 2EDDA 4JANB 4QYOA 1FNSH 1CLYL 2XKNA 1H8SA 2GJ6A 4IBLT 3VFMB 3MLYH 4H1LA 1CXKA 4Z7WA 4EOWL 4BZ1H 3VH8G 1LE9B 3K46A 2E9JA 5D93C 3FT3B 1XIWA 3MNZA 4KKCC 1Q9WB 1VB9A 2HG5A 4BH7B 1CLZL 1KPVA 5EN2B 4GRMB 4PJIE 4N8VA 4NN7C 4NP4H 5DURB 4DJMA 5EU5B 2VL5A 1UM5H 4JZJA 2P5EE 5IW1B 4EIGB 2MHAA 2P8LB 4AEFA 5FUZL 1CLOH 5IFAH 3L3DA 5D4QA 1RAMA 2VH5L 2PW1A 5HHME 1EDQA 4ETQB 4OCWH 3EYSL 1AJ7L 3AMLA 3RWHA 4HIHB 2AGJH 4IHOA 2FR4B 3U4BH 2D3VA 3FHQA 2XQBH 1ZHBA 2VLME 3V0WH 1KBGL 3HLAB 3QI9D 3P11L 4M1CC 5MERA 3TNNA 2WV3A 3P4MB 3SKOA 3PWNB 1FSKB 1UJ3C 2W65A 5EWIH 4F7TB 1LILA 4Z7UE 2F54B 5GGRB 5HYSA 3EYQD 2E6QA 1BFVL 4PRDB 4XNQA 2DQIH 5E5MB 3ZT7A 4YNYA 4POYA 4YDVB 3VJ6A 3VRLF 2DQUL 3RA7L 2ARJQ 1AE6H 5ILTH 5I8CA 4UV4H 3MCLL 5EZIH 4LCWE 1HKFA 1QSFB 2C4FT 1NCNA 3EFDL 3T04D 4KZDH 5F97E 3INUH 3PWLA 3O4LE 1H5BA 2OXGA 4QCIB 1A5FH 1MCPL 3BD4A 2BSRB 4P46B 5J3HD 2IMMA 2BOCB 4PRBB 3STBA 2AXHA 5E2WL 1QFWL 4W6YB 1JP5A 1EAPB 5JOPE 3GI8L 1G84A 3ARFA 3OGOE 4L9LA 2EKSA 1A6VL 3OX8A 3O6FC 3DX6A 1WTGT 5MEPA 1AO7E 2IMNA 4HKJB 1BFSA 3SDDB 5DD0H 4AMKH 5IP4A 4R4FH 1MCBA 3SCMB 2W0LA 4LRNL 5ID1A 2GW5A 4YHPA 5ID0A 4JGUA 5CZVL 2XA8H 5IVNA 4HV8B 1MCEA 5KS9A 1HHHB 4MA1C 3OXSA 2ORBL 4LBEB 1SYSB 5FK9B 4NKIH 1IGFH 1HHJB 1SBBA 1RIHL 3ARDB 5T3XE 4KK8C 5JIPA 5CMAA 4HKBA 4HMEA 3NIDE 2DWEB 2YK1H 3D18B 4K3JH 4X6CF 5LGHH 3TVMA 2VR4A 3HB3D 4XWGL 1ORQB 5F9JB 4CVXA 5GS0L 4TOYL 5J6GB 1CFQB 4Y89A 4BKLB 3UTTE 3OWEA 4GS7B 1UA6L 3MV7D 1T89A 5LXGH 3QIWB 2OSLA 4LHUA 4GG6A 4TTGA 5KSAB 1YDPA 5E00A 3O8XB 3QDJE 1DVFB 4NNXB 4NZTL 3RVUD 2PCPA 3KDMB 4ZUSA 1EEUA 3QXVA 1TETL 1HK6A 4I18C 3QUYB 2JCCF 3T4YB 2YXMA 1NDGB 5F1SA 4ZTOH 2MNUA 2F58H 4G8GD 4I13B 2IG2L 1JN6A 2UWEB 4M7ZC 1S5HA 3MRNB 5IVZB 3MLXH 3P73A 4XAWH 3IJYA 3L7FA 2O5YH 4PJ9A 5FKPB 4JFZL 4DUWA 2VDRH 3QCTL 3RDTD 5AZEL 4ESKA 2ZUUA 1IARB 3HE6A 1JV5B 3I6KA 2AABH 3OG6B 2D7TL 4GW1B 3IDGA 3PL6A 3NIGF 2WZPD 1CDIA 5DTFB 4M7JL 1BVKA 4N0YL 1EJOH 2WMPA 4LLWB 1C8PA 1NDMB 4H5SA 4W4OA 4X0KA 1HHGA 3MJ7A 2AKRB 2FECL 3QUZB 4F9PA 4OD1H 5FO8A 4MQXD 2A74A 4DK3A 4NUJB 1RZIA 3S4SA 1J1PL 4K8RC 1JPSH 3O45A 1Y18A 2CIIB 1FE8H 1NAMH 3GMNB 2GCYA 3X3GH 2DKUA 4O9HH 4C4KO 1LE5A 5EZLA 1FL3A 1T1ZB 5IVXB 3VXME 3BE1H 4YK4C 3NA9L 4NBZB 3LKQB 4X83A 4HJ0C 3FTGB 1T5XA 4XBEH 5LQBH 5IEHA 4LQFH 5CCKL 3HI5L 1K8DB 3WIFA 5CSZA 4K07A 5EA0H 1XF4A 2EO9A 4MDIA 5I6XC 1R3HB 3PXJA 3ZTJG 1FNGB 5B21A 3QIUB 4K3DH 2ARJB 4HIJB 3VXRD 5TQ0H 3CFKB 3DRQB 5C0DB 2AK4B 3WL9B 4H88H 1YEEH 3ECBA 5FM8A 3ZT6A 3L3GB 3O3EA 3MRPA 3DGGA 5DSCA 5IB5A 4O58L 1D5MA 1HKLL 2XPGA 5SWSD 4HHAB 2IADA 2VZSA 1IQWH 4WUUB 4L3ED 1YPZA 3F5WB 4Y7MA 2PO6B 5E2VL 4JPWL 4EI6A 1KPUA 1BJ1H 1HWHB 2J3SA 3LY6A 1SJVA 4XHJC 5JW5B 4CADB 1C7TA 4IOSD 4XHQA 1WFNA 2BCKB 35C8H 3MPCA 1XGUB 3P4OA 5F9OL 3TV3L 3GBNL 2IPTL 3N1GC 4XNMA 4ZUVB 1VDGA 1S7UB 4WY7L 2DJUA 4HKZA 5EZOL 4PRPA 4TYUA 1WCBA 3SGDI 4S1QL 4WTZA 1GC1L 2A9NH 3CCHB 2F74A 3MUGA 3MYJA 1VEPA 1AHWC 1Q38A 4NPYA 5ECJE 2A83A 4CNIA 4RQQB 1N6QL 2FWOA 2NY1D 1OGAE 4RAVB 2NY6B 5C07A 5DMGD 3QUKA 1PAMA 4P9MH 4WFEE 3MROA 1H9VA 5E4EC 1JGLH 4OKVB 1IGYB 4P9HC 5JHLL 4JFHD 1C5BL 1CLZH 3NPSC 3V5DB 5B38A 2CUMA 5IMOA 5C0IA 2AEWA 4Y4KB 3GSUA 3P4NA 1A6WH 4J3VA 4NQVA 3ZYJA 4LSSL 1CICC 3GMPB 2IPKA 1KXTB 3H3KA 4Q6IA 2VH5H 4KV5F 5EIIB 1RIVL 3V6FB 1T0NA 2VDOH 1CR9L 1JTTA 3EYSH 1AJ7H 4DK6A 3QG6A 2Q3ZA 2X4OA 3RX8A 1KBGH 1L6ZA 4N1CA 3I75A 1UH3A 2R1XB 4FQXA 5H94A 3CVIL 2OP4H 4HWNA 3WJJC 5D96C 2Y36L 1IM9D 1JWUA 1YC7A 1ZHLB 2HWZL 3F7VB 3LKPB 3RWCB 1FVDB 4YBQC 1OTTD 1A4JA 4CVUA 4Y1AE 1E28A 1FZJB 5F8QC 4HIEB 2P5WE 2H45A 4P2RB 5E8OB 3RJQB 5IMMA 4L9DA 1H8OA 4BSVA 1BFVH 5EO9B 4XB7A 1ZA3B 3M45A 4NKMB 4S0SD 4MSWA 2E7HA 4ALAL 5ICZA 2VE6B 4N9GB 2V2XB 1S9XB 3KLSA 4M3KB 1CVRA 4AQOA 3RA7H 5F1OB 2GK0A 4NM4L 3ARBD 3H42H 1U8JA 2B20A 2Z9TA 1VEMA 2ICWA 2YEZA 4PGCB 4XRCB 3B2UD 4XAKD 5CZXC 2H32B 3WFHA 3UXFA 1FCGA 1WEJL 1MCPH 1MQKL 2IPUK 4KDWA 4IJ3B 2XNAB 4XCYB 1BD2D 4LLDB 3T3ME 2EH7L 2VDLH 3FZUC 3MV8A 3DMMB 5E2WH 3V5HA 1QFWH 4F7PB 4NHUA 5IB2B 3GGWB 4Y16A 1EVTC 4PREB 4PY8J 3V4VL 1L6XA 8CGTA 3GI8H 2PYED 1FO0L 3TT3L 1A6VH 2Q86B 4JFED 5ETUA 1MCIA 4PJ7B 4FTVD 4AT6B 4HZAA 2DLTA 3C60B 4LLMB 2D7NA 4HUXB 4NQDD 3VRJA 4B50A 1UXSB 5C6PB 5CZVH 1DQML 3KYAA 3JWOC 4JO4L 3ARUA 2ORBH 1N64H 4KKLC 3D85A 5CFHA 1BF8A 2ZWLT 4GMSH 1TCRB 1RIHH 3Q6GL 2NY2D 2GJZA 3L5IA 3FFCB 3V4UL 5HHVL 5FGCE 3C8KA 2OQJA 4XWGH 4XTRD 1UJTA 4OD2B 5JPMB 1X6NA 1WUNT 3UJIL 3WFEL 1YMMA 1DZBA 3CVHA 5TDOB 4MA7H 4MXQC 5KANG 3A0OA 4KQ4L 1N6VA 4O2CB 3I6LD 3RNQB 3BDXA 4HUMB 2AEIT 4NZTH 4J23A 3IYLW 4BA8A 1TETH 3K2MC 2HJLA 2CKBL 4G6MH 4P2QE 3GSNA 2ADIB 3HE7B 1EUTA 4V1DA 4ZNCD 3C09B 4Y4FA 5HDLA 3RTQA 4FXKA 1F5WA 4P23A 1U3HC 3ZDZF 1T3FB 3CH8A 3U2SA 4PS4L 3W9DB 4G6FD 2IG2H 5HJ3B 3MX0A 2LTQC 5LBSH 1A6ZB 1HSAA 4I8DA 1JE6A 5FO7B 3SJVA 3K8LA 3QCTH 4APQC 1U8KA 5AZEH 1BZ9B 2EE3A 4U1KB 5ESQB 1IGTA 4PRNB 2PXYC 3N9GL 3MV9E 4LPYA 2RAMA 4RGNE 2CDFB 4K7PL 2AQ3A 2D7TH 3ARZA 2JK5B 3B5HA 4BSJA 4M7JH 5EBGA 3BEWA 1MAKA 3U4AA 3RGVC 1C12B 2C4FU 3RWFA 4KXZH 3AS0A 4HBQA 2IALB 3CDCA 4JZOB 4Q97A 3ABZA 2DTML 1MHHA 4X8XA 2DI9A 4Z7VF 4QGYA 1WICA 2HVKB 5EU6B 3E2HB 3T1FA 3V0VB 4S11A 1J1PH 4H1LG 1MRDH 3X12B 4K2UL 3HNVL 4PJAE 4U3HA 2MFNA 1T04B 4DN3L 4HLZG 1QBBA 5AYQA 5AG8A 5C0RL 3QO1B 1FZMB 2X2YA 4PRAB 4KTYA 4FFYH 5B8CC 1QA9A 1YEHL 1U8PA 3D3VB 4N8VG 1F6AA 2UWEF 4WO4C 1MY5A 5B3JF 3DNKA 5DS8A 1J05A 1DQDL 4NN5B 3K7UA 5CCKH 1ITCA 5IG7A 5IF0A 5JNYB 4L1DA 2NNAB 3IFPB 1J86A 1INQB 4PGBB 1GGBH 3LQMA 4LSPL 1XF2B 5SX4I 4DVRL 3AB0C 2C9AA 4NKDA 2WUCL 2ZOKA 3MLVH 5D7SH 3RPKA 4I3GA 1HKLH 2GSGA 3REWA 5IKCB 4OSUL 1SM3L 5SWQB 1WQVT 1NKRA 5IUSA 3F65A 4M7KL 3SPVA 5HYSG 1DBAH 2F15A 4EJ1C 5L7XL 1CGUA 5E2VH 1WBZB 4EDXB 3NN8B 4OLXL 3IDNB 4U1MB 5JLZB 3VWJC 3AAZA 3KPQB 1M05B 3MRKB 4P5TC 5F9OH 1DUZA 3WBDA 3TV3H 2M26A 3GBNH 1FFQA 2IPTH 3U7AA 2Y1VA 2WBJC 2XZZA 5D7IE 5GZOD 4WFFE 1UKTA 4PR5A 3P4LA 5DGQA 1BQHB 1B6DA 2YMXL 4N8CH 4IDJL 1R5WA 4XNZC 4ZNEA 4HC1A 2KKQA 1MI5D 3LQAC 1NJ9A 4JFQB 1T4KA 4WWID 3LHPL 1F2QA 2P44B 4U05A 2AJUL 1D5BB 4MNHB 4Q9QL 2YPKB 2R8SL 1K2DB 4MAYD 5DHVB 2P8MA 2EIDA 5JHLH 3VWKB 4GOSA 5LWYL 4RA3A 4J4PC 3FB8A 4MB5A 5HDBF 4F57L 3TO2A 3MOBL 1J87A 1I3GL 4RGNC 1N5YL 4U1LA 3SDCA 2LVEA 1HILB 1RIVH 3UAJD 2P24B 1S9YA 4BQBA 5CKAA 2WP3T 2UUDH 4QHKJ 5L6YL 1KT2A 2JJVA 2Z31A 2BNQE 2CIKB 4MWFB 1JNJA 1I75A 3AS1A 1EHNA 4OTXL 2Y36H 5HPMA 1EFXA 1WCQA 1JPST 2HWZH 2V5YA 1UADC 4NKQB 1MIEH 1I1FB 5BQ7A 5DJ2A 4U4BA 1MJUL 3PJSA 2KL6A 1UWXH 4JLRA 2HMID 3WUWA 1AGBB 1C5DB 4KJPD 2HTLC 1DANT 2D03H 4ALAH 4AIXA 3JTSA 5FYJE 1T83C 2YPLD 4NM4H 2IBBA 4OBSA 1BVZA 4BSWB 3ILQC 4ENEC 5JPNA 5FDWA 4JREB 2YWYA 5D7LB 4MYWB 4E41A 4HDIA 3ZE1E 3VG9B 1WEJH 2J8UE 3DX9B 4KUCF 4G5ZL 1SYVB 4JDTL 4QOKE 3ARED 5D2LE 5ACZB 4P3DA 3UTSD 5DQJA 2EH7H 4U7SA 2HT4D 4PGDA 1I85C 3HCVB 1AQKH 5LGJB 3IKKA 3RZWA 2A0LC 5JXEA 5A2IH 2MKLC 3NFNA 4MD5A 1FO0B 3DV6B 3V4VH 2AJZB 2F19H 3OGCB 2VZ3A 1N4XL 3TT3H 4P48A 3L5WB 3E6FA 1OGTB 1Q94A 2P8PA 3WO3B 1RZJL 1MIML 5E2JA 4U0RC 2R0LL 5DJ6A 3PHOA 4Z76A 4OZGB 3WDHA 1EHLL 3PV6B 1SBSH 3EKCA 3W9EA 2DMKA 3A67L 3DO7A 5C70A 5GJSL 1HNFA 3L3IA 1IC7L 2CUIA 3CU1A 4KDVA 3QRGH 1BQUA 1Z9OA 4DTGH 2XV6B 3NAAH 3QDME 3CPLB 3V4UH 3FOMA 3AXLA 3WUZA 5BMFH 4D9RE 2HTKD 1NANH 2OTWB 2WINA 4W6WB 1UEYA 3NACH 1EHAA 2WWMD 5TFSL 3C2AH 4N90D 2G9HB 3RY5A 3ZDXE 4F2MB 3OJ2C 1REIA 4YHIB 5HHOE 1F58H 1MFEH 4U3CA 3GB7B 4UUJB 5ADPH 1I1YA 5B4MC 1I9IL 3CLEH 5IK3B 1D5ZB 4NQXB 1CZ8L 5GSRB 5C0FB 3B4NA 4NZRL 2CKBB 1NC2A 3FRUA 4TRPL 2BC4B 1UZ6F 3FHAA 2ADGA 5AD0B 5HYFA 2BP3A 4PJ7F 5GRWA 3WN5B 4PS4H 3X3FL 3OKNA 3MLSH 2CLZA 3WE6B 1MCKA 2EEAA 3GJFK 3WFZA 3IKCA 1BREA 4HS3A 4QYOB 3LD8C 2AJVL 4WI8A 5JIKA 4H1LB 4OV5A 1HOCB 4Z7WB 3QPQD 1A3RL 5KG9A 2J7LA 1KGCD 2G5BB 1P4LA 1PZUB 4L3CA 1SJEB 4HLZH 3MNZB 4K7PH 5L2KE 2R9HD 3NCYP 2HG5B 4KRMB 1S7XB 4JRYD 4MHHG 4JFDE 2FIRT 5KZCD 4N8VB 2D0HA 1NCBL 2VL5B 2XN9E 3ALPA 3RRQA 2FJFA 4WTZG 5ISZA 4X6EB 2MHAB 5F7WC 5IR1B 5EORL 1ZV5A 5MEOA 4Y5YC 1Q0YL 2PW1B 4IRJD 3BSZH 1QRNA 3VXPB 2FHCA 5C0GA 4PJ5B 3WJLA 3RWHB 3QFJE 4K2UH 1NCUA 3KPRD 4QRQA 1ZHBB 4ZO6A 3BKYL 4WW1B 1QLFB 5C0RH 3BI9X 2V5SA 1W72A 4W81A 1DUYA 3KYMA 4P4KC 5TH2A 1CBVH 2A6DA 1CFVL 3SKOB 3ULUL 1SEBB 5B38G 2C1OA 3GSQA 4YBLB 3C8HA 4U33A 2W65B 5BCAA 2C26A 4M93B 1E6OL 1TZIA 4NJ9L 5HYSB 1LO2L 1ZT4B 3RWGA 1W0YT 1A8JH 4YNYB 3VJ6B 1GOGA 4XNUH 4LSPH 4HS6B 1YEGH 3MJ6A 1MCRA 1G7LB 4KUCD 2RB8A 1TZHA 2WUCH 2NY0B 3PWLB 4KWUA 1H5BB 5IB4B 4G7VH 1L7IL 3PDOA 1N0XL 4TNVF 4OSUH 1I1AA 2VITB 4XPTH 2MKWA 5ICXA 3EYUH 4M7KH 2R23A 1JUFA 3QQ9D 1QLEH 1QNZL 4LRIA 1CF8H 2WQ8A 3ALWA 5FHBH 4OLXH 4L9LB 3UDWC 4CRPA 4YFEA 3OX8B 3DX6B 5MEPB 1E4WH 1Q9KA 1A7QH 5CJBA 1DN0A 1ZVSB 4LAJH 3CFJA 2E7BA 3MUHL 5ID1B 4YHPB 2YA0A 4OZFG 5C6TL 1SY6A 4X6CE 5A3IC 3OXSB 3D6GA 2C3GA 5B39B 3LKNA 3TZVC 4U1HA 3MRQB 4K7FB 5CMAB 4HKBB 4KDTA 4XH2A 4PJCE 1D7FA 1KB5A 2EZ0D 3LHPH 3TVMB 2AJUH 2EDRA 1GOHA 4NGHH 5JHDE 4Q9QH 2V5MA 5FHAL 4CVXB 1DEEA 1EGJA 4Y2DC 3UBXA 5HYEA 1J0YA 2RR3A 4ZOBA 3GHBH 4ODXA 3STZA 2ZUVA 1MAMH 3K3QA 1IEAA 3CVHL 5I76A 3VW3L 2OSLB 4LHUB 4GG6B 1UWEH 4F57H 4LEXL 1YDPB 2PUQT 3MOBH 4X6FA 5E00B 3VDBA 1IEHA 3LN4B 1I3GH 4NOFA 1N5YH 2QADB 2PCPB 3BZDA 5E6IC 4ZUUA 2AS5M 1WFOA 2G60H 1ZTXL 1IKNA 1K5NA 3TM6A 2DB8A 3GSOB 5C3TA 3ARGC 5C0CD 5L6YH 1BX2A 4F37F 1T22A 4X4ME 2J8HA 1BM3L 1T0PB 2VB5A 5GGSB 5I8KH 1JN6B 1S5HB 3IJYB 1F11A 3TPKA 2XACC 2F53E 3IT8D 4ODBD 2EYRA 4PJ9B 3NCEB 4R2GC 3WCYA 1JHTA 4KUZH 3NIGE 4KK9C 3HE6B 1MJUH 3DXAD 3G6AB 3SO5A 2NY4C 2I25N 3RU8H 2ED7A 5T1LA 3IDGB 2E7LC 5KN5A 5HVHB 1BVKB 3CDGA 5D5MA 4H5SB 5D70L 3JWDL 1HHGB 1CCZA 5FO8B 4MJ6A 4C59B 2APTA 4G5ZH 2ICEB 2A74B 3B9KD 3FT2A 3MLWL 3S3JA 1HSBA 1RZIB 3MOAL 3S4SB 5C0BE 1Y18B 1O5DT 2BOBA 1FIGL 4MA8L 1B2WH 4LAQH 3DYMA 2E9BA 3K8KA 4D8PA 3SQBA 5DD6A 4G9FD 4K9EC 4N0RA 1LE5B 5EZLB 5E8EA 4WNQA 5ESVA 1FL3B 2I26N 4LP4A 3TO4D 4F80A 4Q0XL 1CTOA 2J6EA 2I07A 4YH6A 1P1ZA 1RZJH 4RCAA 5J8OA 2PF6A 1EHLH 1QHPA 2MQCA 4Y4HC 4O2FA 1G6RA 4X7DC 1PKQB 1A3QA 2VDPH 4XCCH 5CSZB 4ELKA 1Z2KA 4EN3A 3F6LA 1XF4B 1D6VL 1IC7H 1YY9D 1JZ5A 3C8DA 4G80B 3DHJA 1A64A 5EU4A 2E27L 1WT5C 3NCCB 3RWJB 4HWUA 3ECBB 1HH6A 2EE2A 4HUVA 2JE8A 4WEBH 5CP7A 3O3EB 1XMWA 3MRPB 3DGGB 3PGFL 4NDMA 5IB5B 4P59L 1D5MB 3QQ4A 2XPGB 2Y4SA 3PWVA 1ZKAA 4P5KA 4HIXL 3RKDD 2CK0L 2IADB 3D39E 2RGSA 4UNTA 2OI9B 3QIBD 5DMKA 3LV3B 5HI4D 4KI5D 1BGXH 1YEJL 1YPZB 3RIFF 5BVJB 4EI6B 4KKAC 3QZWG 4HJJL 3B8SA 4FFZL 1NCTA 3MNVA 5L0QC 1I9IH 3BQUC 3O9WA 3UP1A 1NMCB 4OT1L 5HYJE 4MQTB 5DFVD 1U8IA 1CZ8H 3EOYG 4NZRH 3VXSE 1NGPL 2PTUA 4LSRL 3P4OB 4TRPH 4LDOB 4I9WD 4K94L 4LVHB 2V6HA 4R97B 2X89A 4LEOA 1F13A 4PRHE 4HKZB 3WXVH 4WWKD 3O4OC 1WCBB 4LIQE 3X3FH 2YC1A 4OZGF 3P9LA 1CE6B 1JI2A 3GZKA 3EDEA 4GW4A 4H0IA 2WIMA 3BH9A 2F74B 3FONA 2VDMH 2ESVE 3MYJB 4ODWA 4HC1L 4X6DA 1EZVX 3HNTH 4P2CG 3WKNA 4F9LA 4ZAKB 2AJVH 3EOAA 2FWOB 4BJLA 3T0DA 3B5GA 2VLRA 3PHQB 4MA3B 5C07B 5HDQL 1MFDL 1A3RH 4WI6A 1WZ1H 5I30L 1IILE 2KUTA 1F2XK 1XF5A 1D9KD 3MROB 1U8HB 4L8DA 4X8JA 1RK1A 2DQFA 2R4RL 3SGKA 3ZE0F 5B38B 5IMOB 5C0IB 1FAIL 1K3ZA 4X98A 1JGVL 3GSUB 3P4NB 4NQVB 1I7TB 1KEGL 4FABL 4LCCA 4YIQA 5J89A 1O7SA 2CD0A 2NW3A 2IQ9L 2GHWB 5HI5C 4Q6IB 4YPGB 4G6KL 4KJQC 4TVPE 5E7BA 1NFDE 4EBQL 3T2NL 3QG6B 2X4OB 3KXFE 1OW0A 1CK0H 4PV8B 1INDL 3TYFB 2YD5A 3I75B 4HKXB 2I9LA 4PBVC 1H3VA 4FQXB 3H3PH 5H94B 4M8VA 4W70A 4XP1L 1JWUB 4FFVD 5D7JD 1CFVH 4Q9BA 3R1GL 4PTUA 4UDTA 1E28B 4KI1A 1KXVC 3SE3A 1LO2H 2BRQA 1TITA 3BPLB 4BSVB 4Y0GA 4XGZA 3QDGD 5F93C 4U1NA 1ERNA 1VGEH 3FQUA 4L4VB 4Z7WF 5A43C 1M71A 2GK0B 1KOAA 1U8JB 2ICWB 4YJZL 1ZGLP 2BSSA 1RU9L 2YXFA 1J5OH 2DBLL 3WFHB 5FGBC 2YS4A 4OZFH 2Z92B 4Y2OA 5C9JA 1X7QA 1L7IH 3E3QE 1EPFA 1H0DB 1CDGA 3HAEG 5K9OA 3GSXA 3G9AB 3RVWC 3Q2CA 3O2WH 3ROOA 1XGTA 5GISH 3MV8B 1S7QA 4NHUB 1QNZH 4Y16B 1DFBL 4JN1H 4J7RA 2D7QA 4M9OA 1TTUA 4J3XA 3T0EA 3WSQL 1NH6A 4GRLC 2EO1A 2WIIB 3VFTB 3PQYA 3DURA 4G43A 2DD8L 2F54E 2CUHA 4NSKA 3RZCC 1OL0A 4BM7A 4H8WL 3OHXA 1ITBB 5GRXG 3D85B 1U92A 4PJ8C 4ZPTA 5GRYA 1FZKA 1ZT7B 1T6VN 4LVNC 4LKCA 1S7VA 5DQDL 3CFCL 3IVKA 2GJZB 4F7MA 4X5LA 1QSFE 5EDXA 4D9QE 3LKSA 3N06B 3C8KB 1OHQA 1KELL 1ZLUH 1MFCL 2OQJB 4OLYH 2GKIA 1BF2A 5GGVH 3B3IA 2CJUL 3ULVL 4XP5L 5DJ0B 1YMMB 3CVHB 3V7MA 4XPAH 1Z5LA 1EA9C 2FIKA 1N26A 4IS6A 2CXKA 2YUXA 3UYOD 2ZUQC 4CMMA 4M4PA 1KJ2A 3ZDZE 1QSED 2YD1A 2HJLB 3ILPA 4FMFA 3K1KC 5D1ZA 1QLRA 1FYTD 3GSNB 4V1DB 4Y4FB 1CG9A 4FXKB 4P23B 3BIKA 1HYSC 2V2WA 2Z93A 2Q1EA 3U2SB 3KGRA 4LK4A 4C56A 3T2QA 3WS6C 3F62A 1EXUA 1I8LC 1KLUA 3BKMH 1HSAB 2A1WL 1BQLL 5D2NA 1JF1A 4LQ1A 5I71B 1MPAL 1WIUA 3GJEA 4XP4H 4F7CB 5KSUB 2C3WA 1XCQA 4FS0A 3QPXL 3QUXA 1FFPB 4N9OB 5BOZG 3QG7H 2Z0BA 4XXDB 3NBNA 2APFA 2BVPA 3WDIA 1Y0LA 5M94B 3RWFB 3DV4B 1A14L 3JWDH 3CX5J 3LS5H 2E5EA 3FRPA 1L0QA 5GRZA 3ZYOA 4GG6F 1JHLL 1TNNA 4RWHA 4O4YH 2NCMA 3T1FB 3MOAH 4HEME 3IDXL 1FP5A 3TESA 1FIGH 5DUML 1J0KA 4TSBL 4NKOB 1AI1L 2UWEE 4OF5A 2R0ZL 3WD5H 1SEQH 3E3QC 5BW7C 1QA9B 4FQJL 1W72L 2NY3B 3D69A 4Q0XH 4PJXA 4LMQE 1RUMH 3QJFB 4YQXH 5DS8B 1J05B 3D25A 5FV1L 3S96A 2GJ6D 1MEXL 2FBJL 3BYYA 1Z9LA 1JZ4A 1RJYA 3QH3B 4FP8L 1AP2B 5C8JB 3Q3GA 5IG7B 3PP3K 5CGYD 5IF0B 2WLYA 3S36X 1FSKC 4U3XA 1XIWD 2NYYC 4LASH 2BVQB 4TNVK 5GZOC 4YPJA 5GPRA 4X9FA 3U9PL 2JELL 1CD1B 4CUCA 2OMBA 2XY1A 4JG1H 2ZOKB 3P9WB 3K4AA 1NCDH 4JHAL 4P59H 3O6KL 4GXUN 3U7YH 3LEYL 1F00I 4HIXH 4ZFFA 4QRTB 1F4XH 4YGVA 1T03H 2EDBA 1YJDC 3SPVB 4XPHL 4R4BA 3V6ZA 4PJDA 4HD9A 1GGIL 1CE1L 1QBML 5KVEL 3OSKA 4FFZH 5IVXE 3QI9A 4P46C 4I0CC 4M5ZL 2BRRH 1JYNA 1S3KL 1MREL 1NGPH 4LSRH 2CRMA 4K94H 1UQSA 2XRAH 1DTUA 5JXAH 1V7NL 4LSTL 2ERJB 1RURH 4Z78A 4PR5B 1SY6L 2D9CA 5MEQA 2H2SC 3SDDC 25C8L 3SCMC 1R5WB 1RJZA 1YECH 4UIKL 5E56A 2AK4E 2OK0H 5GRVK 4EXKA 1NJ9B 3LDBB 1T4KB 3VA6A 5CUSL 2X70A 1KB5L 1RUQL 3CGTA 3QAZC 3ROLA 5HDQH 4QXWA 1MFDH 1H3UA 4NRYB 4KK5D 5I30H 4KZEH 4ELMA 5HI3C 3ARDC 3OJVC 1YEFL 1EGJL 1J1XL 4G7YL 5HDBE 2EDNA 4WUUE 1TQCB 3BP7B 1TVBB 4JRWA 4NQCD 5BZWA 5I15L 5GGRY 4LKXA 1JGVH 1GL4B 3FB8B 1A1MB 1BAFL 5E5RB 3WO4B 1KFAL 4JJHA 1KEGH 4FABH 5E08H 3TO2B 1YPZF 1P5VA 1FV1A 4J3OC 5HGAA 3ARFD 4U1LB 2IQ9H 3SDCB 4G6KH 4GS7C 1JRHI 1FN4B 1MJJA 1S9YB 2VDNH 2NPLX 3QIWC 1HXMA 1GJIA 1VADA 2P7TA 1SVZA 5KSAC 3O8XC 1DVFC 3UBXG 2EYSA 5L2JB 1JK8B 1KF9B 3QUYC 1EFXB 4G42A 3OTTA 1NAKL 3UJJH 4NHCL 1JWMB 4NNPH 3HAEH 4KKBC 3UPRB 3U7WL 3PJSB 4JLRB 5IROA 3WUWB 3BYTA 2K7PA 4HT1L 3GK8L 3W2DH 2DAVA 3LPFA 3T0BA 4MS8D 2J4WH 3P2TA 1IAIL 1VSCA 1E27B 3QNYA 5IBLC 4QRPA 4UBDC 1MWAA 3EOTL 5JPNB 1EUUA 5FDWB 2RJMA 4WI2A 4E41B 1QG3A 1WBXA 1AY1H 5CP3A 3CLFH 1JVKA 4OF3A 2GQHA 4HZLB 1S5IL 2QADD 3CZFA 1G9NC 4QRRE 3P9MA 1G1YA 5DQJB 2V7HA 3T1WA 4BQ9A 5JO5A 3LSOA 7FABH 4PGDB 5I75B 4GAYB 3QUZC 4R9HA 4OM0L 3NFNB 4MD5B 3SDAD 4G8GA 3P77A 3WSQH 5J1SC 2D31B 3E6FB 1Q9OA 2ITDA 3QEUB 1Q94B 2P8PB 4KU1A 3PG2A 3RHWF 1X5XA 2GUOA 4R0LA 1UYWH 4XPFH 1H15B 3O41A 4NO3A 5DJ6B 3ULUF 4Z76B 4P2RE 4HCRL 1TNMA 1U0QA 2JLLA 4XPGL 3RDTA 3REVB 3W9EB 1G6RL 1LO0L 1ND0A 1VACA 4M1DH 4UAOB 2B4CL 4XXCA 3L3IB 3FO2B 1W2KT 5EPMA 1X4ZA 3PL6D 3EHBC 5E8PA 2QL1A 1ZS8B 4IRSD 5A1AA 2XYCA 3ZZ1A 4EVNA 3FOMB 3AXLB 1MFCH 2JJSA 3ZKQD 3KJ6L 2FYYA 3NCJL 4FQ1L 2GTWA 5CJOL 3QIUC 4FXLA 3ULVH 2CJUH 1QTYT 4XP5H 1TJIL 2BNRA 4RFNB 3MRDA 3BPOB 15C8L 2FO1A 1I7UA 4ZXBA 4HW6A 1CGYA 2K3TA 1UZ6E 3IJSA 1I1YB 3PP3H 5GRUL 5ENWA 1DEDA 2WBKA 4PJ7E 3FRUB 5BS0B 2PO6C 4RAHA 5GGQH 4GAGL 2CDEA 3MBEB 1MOEA 2ADGB 3DLQR 3IAQA 3GMMB 3H9SB 1BZ7A 3ELAT 1CDYA 2OS7A 4DKAA 2CLZB 5C09B 3WIIL 4J3SA 2QKIA 1E0OB 2XZQL 2XG4A 2A1WH 2CKNA 1BQLH 1RHHA 1OB1A 3FFCE 4MD0B 1B0WA 3HI6H 4OV5B 1RJLA 5CEXB 4GH7B 4DFHA 5KG9B 3BESR 1YA5A 3I84A 4JHBA 1P4LB 3QPXH 3EJJX 4Z7QF 5SWSA 4S1SL 4X5XA 5ESAA 3MJ9A 2NY6C 2EDTA 5IMKA 5J9PA 3E0GA 3E8UL 1A14H 1FNEB 5HGHA 4KRNA 3FQNB 3I3BA 1OAQH 5MEOB 1KJVA 2NR6D 4Y4KC 1QRNB 1S9WB 5C0GB 3IDXH 4LOUD 1IAKA 5C0JA 1O0VA 4TSBH 1U8NA 5IGXL 4NCC1 4PRPD 1OD9A 5DHXB 2YUVA 1W72B 4B5EA 5KVFL 1DUYB 4UIMB 4XC1L 4N0CD 4FQJH 3TN0D 2A6DB 1DQTA 1BP3B 3CX5K 4KH2A 2C1OB 3GSQB 4Q9RH 8FABA 4AQ1B 3IDMB 3PABB 4MVBC 4QY8A 3L5XL 4GRWB 5DF0A 1MEXH 3W0WE 3WEXA 4FP8H 3VFVA 3QUML 1CGSL 4W4NA 2M2DA 3F7PC 4L4TA 2DQGL 2AXFA 2NXZD 4URTB 2NZIA 2JJWA 3VFWA 2MOVA 1ORSA 2R1WB 3U9PH 2JELH 1RSFA 3WLWD 2ZCKL 3KPSD 5EU6E 2AJYL 2JTDA 2SEBB 3GIZH 3HZMA 4R3SA 5ICXB 1S9KC 4KRPB 5JOEA 4IOIA 2ED9A 4LHJB 5D1QD 4XPHH 1JUFB 2MTPA 1U36A 3SDXA 4Q2ZB 4XZUA 1QBMH 1KCSL 4UTBL 4PLJD 4M5ZH 1HINL 4IJ3C 1S3KH 3ESUF 3UROR 3QP3A 4TTDC 1MREH 5CSGA 1IM9A 5IFJA 1DN0B 3DMMC 3CFJB 3QFDA 4O2EA 4JFXA 4U0QB 4WW2B 3IU3A 3FJTA 1LK2A 1V7NH 3LMJL 3QQ3A 4LSTH 1F8TH 1SY6H 1RZKL 1MELA 4OGYH 1G7JA 25C8H 2HAZA 3LKNB 4U1HB 3C60C 4WU5A 4KTDL 2X4NA 4FQQA 4XH2B 1B4JL 3Q1SL 1KB5B 1YYMH 2CDGA 2PN5A 5CUSH 4JVUA 3RY6C 4GFTB 3UMTA 3EJYC 4OCLC 1TCMA 4OJFL 4OLEA 3KHOA 4ODXB 3STZB 1WZKA 1NC4B 3D0LA 2P46B 1IEAB 4O51A 5I76B 1MCFA 5GS0C 5I15H 3ARSA 1BAFH 4TULL 1SVCP 4N0FA 4A6YA 4X6FB 4P3WA 4ZUUB 3QBTB 5J11B 2NXYB 2PYEA 1AC6A 3QEQB 1KJ2L 4RFEA 3ZSSA 1K5NB 3E6HA 4JFEA 1WBYA 1XF1A 2E9IA 4X4YB 3KLHC 4FTVA 4OGZA 2N7AA 3OV6A 1BX2B 4NQDA 1T22B 1TFHA 3X17A 2G75A 3IRZA 2OJEA 3FAXA 3HMWH 2EXYC 4M3JA 1TXKA 5IBTH 3GIVA 2BSTA 2UVFA 4QHUA 3HE7C 2V9TA 3C09C 1HCVA 1NAKH 2EYRB 1LDPL 5IW3A 1G7QA 4G8FA 3NOIA 4PTTB 3F7YA 3U7WH 4OFPA 2P45B 4JZNA 5EU7E 3GNML 4HT1H 3GK8H 1WZMA 5T1LB 3B2VL 1IAIH 4UV7L 5J7CC 1XFPA 5KN5B 2EKJA 3G5ZB 5GHWL 2CRIA 5D5MB 3EOTH 5GIRA 1T66C 3MMEA 1LK3L 4C57C 2EC9T 5JZ7D 4XWOC 4LNRA 5DUBB 5EBWA 4MJ6B 4KJWD 4L5FL 3ISWA 2BDNL 1S5IH 4JO1H 3JV0A 1K4CA 2X09A 1X9QA 2P5EA 2BOBB 3RTQD 5E95B 3ZTNL 4Q58C 3VFGL 4D8PB 4OM0H 1OM3H 5E8EB 4WNQB 2A6KA 4G9DB 5ESVB 1MUJB 4LDLB 5HI4C 3E2HC 5CHNA 1BLNB 2YUZA 3CSYB 4DN4L 2I07B 3QHZL 4JFOA 1B0RA 5E94A 3SJVD 4HCRH 1JF6A 3ZMRA 4KHTL 4XPGH 2CSPA 4BK4A 2VJXA 3GFUA 1G6RB 1MLCA 4O2FB 4XC3L 4PV9A 3WNKA 5ITFA 4GJTB 3WFCH 2B4CH 2X1WL 3RL2A 4ELKB 3H9YA 5F89A 4EN3B 4HF5H 1P7QA 4OCRL 3BH8A 5EBLA 4PRID 1U3YA 5C2BL 2X4TA 4NFBA 1ADQA 3PIQA 3H3BC 5EU4B 3VG0H 1FORL 4NN5C 5D7LE 1BJ8A 5E2TH 5IT2L 5JQHC 5F7NC 4LCIH 1PW3A 5CP7B 4NDMB 5DVMA 3KJ6H 3U0WH 2J88H 4FQ1H 5CJOH 4P5KB 3RWEA 1CL7I 5DMKB 5FUOL 2DQEL 3PWJA 4ZMAT 2V9QA 4LCWA 1C5CL 15C8H 1T7VA 3O4LA 2KPNA 3C6LD 3MNVB 4X4XA 3UTZA 4CU6A 5GRUH 4JKKA 3O6LH 1U8IB 1QR1A 5L9DH 1KEML 2EIZB 4MAUH 3U0TB 3GHEH 4KMQA 4OZGE 1K6QL 4GAGH 1OLLA 4LEOB 4DQOL 5C7XL 5TF1H 2UVEA 3LN5B 2YC1B 2VDQL 3P9LB 1MJ7H 2VSCA 2ZKHL 1II4E 3L9RA 4OI9A 1ROWA 1M1SA 3WIIH 4YHZL 5I1KH 4FFWD 1BQSA 4GW4B 1ZLVK 2XZQH 3BH9B 1T80A 4QT5B 3ZYZA 3FONB 1V7ML 4ODWB 5L8JB 4LPXA 4X6DB 3FCTA 3EOAB 3GMRA 2H9GA 5CIPA 1GC1C 3MO1A 4KMTH 2VLRB 1E4KA 3ZE2E 2YRPA 5SWZD 1NEZA 1XF5B 1T21A 3IAPA 1ZAGA 4XVTL 4L8DB 4S1SH 3I3EA 1RK1B 1TLKA 2DQFB 3TBSA 3U46A 3ULVF 2NQCA 4X98B 4PG9A 3T65A 1CFSB 4LGRB 4X7SH 3E8UH 5EU7C 4LCCB 3W39A 4OCYL 3QEHA 3FQWA 3UTTA 4HULB 1F6FB 2NW3B 2YN5A 4W6XB 2Q3AA 4TQEH 3LAFA 4EUPG 1S7TB 5IGXH 2I9LB 2YRLA 2D7OA 2DL2A 5FO9A 4QRRD 4MLSA 4XC1H 1VPOL 5E8DL 4A2MA 5T33L 4TSAL 5KOMC 4QHMA 3L5XH 4UDTB 1MI5A 4Z7WE 5EC1A 4M1GL 2EXWC 5LAXA 4OLVL 1U8MA 2E7MA 3QUMH 4ERSL 4U1NB 2DQGH 3FQUB 4MAYA 3BVNA 1X5LA 3HNSL 1M71B 5AYUL 5DJDA 1GH7A 5ITBL 4OLUL 4LARL 1JNHA 2BSSB 1YN6B 1MWAL 2ZCKH 3ZDYE 5C9JB 2AJYH 2DM2A 5J1TC 5K9OB 4PG2A 4POUB 3GSXB 3CXDL 4PJ5E 3RNKB 4NQED 2V2TB 2F5AH 3ROOB 4JREC 1S7QB 3W5MA 4UB0L 1P84J 2C3HA 3VFOA 3VG9C 1PG7X 4DOHB 2Z31D 3WJJA 1KCSH 2BFVL 3T0EB 1FFNA 3PQYB 4G43B 1YQVL 4NZUL 2EICA 4JKWA 5IESL 1QFWI 3P3YA 5TDNB 2VLKD 4UT6H 3D9AH 4Z6AT 3HC3L 3LMJH 3QWQB 4HQQL 4HUUB 3VXMA 4GRWF 1UCBL 1U92B 5C0NC 1FGVH 1FZKB 4TN9A 2EE6A 3VFSB 2JJTA 1I3RB 3RI5K 4KTDH 4LKCB 3H7LA 1S7VB 3IVKB 4OIIL 2Q8BL 3UTPE 1ZE3C 4HFWA 5DMIL 5SV4A 1F3DJ 2BMKA 3G5XA 2QQNL 1WSST 4JFFB 4ZFZA 3B3IB 3AREA 1XF3A 3WHXA 2F5BL 1UACL 2FD6L 1HHIA 3UTSA 3TIDA 4EXPX 3UYRL 4IS6B 2R69H 4CMMB 1WAAA 1KJ2B 3CFEA 3OZ9L 2GJJA 3RVTC 5D1ZB 2Z8VC 5IMLA 4I77L 2I60H 1H3PH 5GS1B 5TQ2L 3OKKA 2V2WB 2Z93B 1VFMA 4DW2L 5A16A 5MP6L 1MVUA 3UZVB 5DHYA 4HG4J 4C56B 5EOCJ 4MX7A 4WW2F 2BY3A 1EXUB 1KLUB 4NRZA 1KLFA 2HP4A 3BFOA 5D2NB 2WAHA 1LDPH 4L8BA 1JF1B 4XP6H 3GJEB 5TJWK 3WN5C 1N59A 5D9SB 1VFAB 3IFLL 3GNMH 3LCYA 3H8NA 4JY5L 3ULVD 2OL3A 2ICES 3W0WD 4P2OD 5FCUL 3BUTA 4GG6E 5GHWH 2NZ9C 2CRYA 1Y0LB 3MJ9L 1NAMA 1FNAA 1LK3H 5CEZL 3RIAF 4L5FH 1ZLVH 1A6TA 2BDNH 1DBMH 1MAJA 2W1NA 1NC2D 3LS4L 3ARYA 2YKLH 3S36L 4HGMA 2O61A 4KXZI 3ZTNH 3VFGH 4WHYG 2FECI 4YC2B 3WIHH 4UILL 3QJHA 3D69B 4PJXB 3QHZH 4APQA 3BEVB 2PTVA 3VMPA 3F12B 3LEXA 3S96B 4J6RH 1RJYB 4OGAD 1NGQL 1OTSD 3P0YL 1DL7L 4PLKD 5E1HB 3T4AA 2LU3A 4TUJA 5J4MA 5EZJB 3SKNA 4YBLC 4NFDA 5FYKH 2ENYA 3VI4F 4M93C 4UQ2B 4RNRB 2W91A 1SJHA 2P5WA 4JRYA 1W0WA 3GKZA 4UU9A 4PP1C 3EGSA 5DWUL 3CK0H 4Z9KB 5IT2H 1CFNA 5ISZD 4JY6A 4JO3H 5FM4A 3BT2L 5D5MF 4NC2B 4ZFFB 4ZUTA 2BSED 1OCWH 2A9MH 4YGVB 3VH8A 4IRJA 3R8BB 3T8XA 2DQEH 3LB6C 1QRND 2M8XA 4R4BB 3WS3B 3V6ZB 1C5CH 1T1YA 2NY0C 4PJDB 1H5BC 2V9RA 5MHSD 3QI9B 1WFUA 1FQ9C 4K7PY 3M17A 1MY7A 1JYWA 1HE7A 2YOCA 1KEMH 4ORGA 1BPVA 4WVRA 4HAFA 1VGKB 4GSDH 1AKJA 1K6QH 1UQSB 3GMLA 5K9KA 2HRLA 2X7LB 4ZD3L 4DQOH 1PKQE 3DUSA 5C7XH 2AI0L 4L9LC 4DCQA 4U7MA 4Z78B 1T20A 1EO5A 1KENL 5MEQB 2VDQH 2ZKHH 4FNLL 1ZWIA 2D9QB 4I0KA 1PX3A 3RVVC 1RJZB 2B1HL 1HCFX 3J8F7 2KZWA 4HPOL 4EIZC 1A3LH 1AH1A 3OAUL 1SMOA 3ROLB 4YEEA 4RGMB 5HGDB 3L5JA 3IXAA 1NBYA 5ALCL 4EUPH 3BP5A 4R4NC 4Z18A 3TLRA 1EERB 5K9QG 4XVTH 1I1AD 3TVMC 1YPZE 5DZLA 4FQHA 3DX7A 2PR4H 1R6VA 1UM6H 5BZWB 3RWDA 4LKXB 3WDJA 2EC9U 3O3UN 4I2XB 1IGML 4MGXA 4KHXL 3VWJA 1FV1B 1P9MC 5HGAB 5HVWA 4XNYH 3TGXA 1T89C 5C2UB 1MJJB 3IGAA 5I1EH 1NUNB 3DSFL 1VADB 2AK1H 4I4WA 2VKXA 1NL0L 1UKQA 1J8HD 2P7TB 1GYAA 3MRHB 1YZZA 3DBXA 3T2OA 2QADC 1MQ8A 1DLHA 4LFHG 5I1GL 1JNLL 1VPOH 4G42B 4TSAH 1RIUH 4M6NL 3MZTA 2VERN 4OAWA 1GVIA 4P49A 5C07E 2R0WL 4D94A 2IGFL 2DQJL 2BHUA 2BXYA 3CFBA 5DR5L 2IFFH 4X6DF 3VFPA 4OI7A 2C4XA 3S35X 1INEL 5EIVA 4PJ9C 4CMHB 3CXHJ 3F58L 4YXHH 5GGTA 5AYUH 4IOFC 4KGJA 1J9CT 5ITBH 1T7WA 4OLUH 3HE6C 5DRWA 1ZXQA 3MV7B 1MWAB 2FEDC 1MCJA 1BFTA 4KQ3H 5E9DD 4ZDHA 1DR9A 4POZD 4MXWL 2Z91A 4M4RA 3PL6C 1OAUL 3CZFB 5HVHC 4LSUL 2DQHL 2DMCA 3P9MB 2K1MA 3HC0A 3K0WA 4GKNA 5JO5B 3LSOB 4W4OC 2IWGA 4GW5A 4QGTA 2COQA 4UB0H 4EI5D 3TFKD 4P3CL 5C0CA 4PJHA 1GOFA 4F9PC 5F3BA 1NUFA 3ULUE 1MCWW 4G8GB 5IIEB 3P77B 1MVFA 2X9WA 1EIBA 3NCFB 2B2XL 4UT7L 1NBQA 3GBLA 1Q9OB 1YNKL 2GUOB 4R0LB 3QNZB 1U58B 4PJAA 4NO3B 3O41B 1RULL 5GRJL 5IHLB 2VXTL 1Z0MA 3RDTB 4DKEH 2VLLA 1DDHB 3HC3H 5JW4Q 4HQQH 1VACB 1ND0B 4L4VE 1P84K 1UCBH 3DXAA 5GGUA 1EJ6A 3UJTL 4YAQA 4MD4A 2XZCL 5E8PB 2HFEA 3DVGA 1ADQL 2Q8BH 2MCPH 1WGOA 3PGCA 4EVNB 4JAMB 2FYYB 3MXWL 3LKOA 4U6YA 3UYPA 1YUHA 2OTUB 2IAMD 5F88A 3B9KA 5EO0A 3MV8E 2HFGH 2F5BH 4K8RL 3S88L 1UACH 3D5OF 1HHKA 3UYRH 5FB8A 3C9NB 3FFDA 4JQVA 4G9FA 4ZPVA 2OI9C 4GO6B 1ZSDA 3BZ4A 3OZ9H 4MJ5A 4PYHA 3S8WA 3D87B 2W9EL 2CDEB 3SDYL 5DJZA 5I74B 3UCRA 4OCSL 5FDYA 3CUPA 5HDOA 5TQ2H 1RVFL 1BZ7B 1KIRA 5CBAA 4JO2L 4DW2H 1R24B 2NR6C 5DRNA 5MP6H 4F15B 2IANE 2VLJD 2YBRA 4BZ1L 5C08D 3TJHC 2QKIB 4LVHC 4R97C 3IF1A 4ZS6C 5I66A 2WP3O 3MC0A 3A6BL 1J0JA 4Z7QE 2FZ3B 3VXRB 1IRAY 1F3JB 3IFLH 3EZJB 4RX4D 4JFPA 5IBUG 3EYVA 2W0FA 1YMME 4WHYH 5T3XL 5SWSB 5IFAL 5D8JL 3BUYA 4HG4K 4ZAKC 1T2XA 4PJGB 3BGFB 3QIBA 2XTJD 4LPUA 5IMKB 3C5ZD 2VXVL 4L3EB 4OCWL 5J9PB 2RQ8A 3U4BL 5HGHB 3GBMH 4K7PX 5CEZH 3O9WD 4PB9H 1JZ7A 3G9VA 1X6LA 3HMXH 2UZXB 2LV4A 1V05A 3LS4H 2YD4A 4KGLA 3I6GA 1IAKB 1RJCA 3HG1D 4HWBL 3SGDH 1NEZG 1LHZA 3D48R 2DIBA 4JGMA 1ODAA 4NO5A 4Q6IC 1QFUH 1P6AB 4WWKA 3CDFA 1AD0A 1T5WA 2HA1A 5E8NB 4OQTH 4AEEA 1A9EA 8FABB 2HKFL 4QY8B 1ZK9A 2F8VA 1HDMB 3O6ML 4FQXC 3O2DH 3WEXB 2NY1B 2BNUA 5ILTL 4PJBA 3VFVB 2WLZA 1KC5H 3ULUC 5EZIL 1N3NA 1AXSB 3C6SA 3JV4A 3A6CL 5CJ8A 1KN4H 1D9KA 2FB4H 4P9HL 3VFWB 4CVZA 1A5FL 5I1CL 5KSBA 1M4KA 1XT5A 3FB7B 4S0TD 5DQ9A 5JA9A 3BPLC 2MCG1 1S7SB 4OF8A 4UZGA 1YC8A 4Y5YA 2DYPA 1QPPA 2OYPA 3BT2H 3HZMB 4G8IA 1TVHA 5KJRL 2DKSA 5J1AB 1P2CA 4AMKL 2FJHA 3BGMB 3SDXB 3MQIA 4QHNA 2J8UA 3JSSA 4JE4B 4XZUB 3F7RA 4P4KA 1R3KA 2X1OA 3FQTA 1LVEA 2Q76A 2DLGA 1IM9B 1JFQH 3B9AA 5D7JA 4NKIL 3IDJB 3OKLB 4Y16C 1Q9LA 4O2EB 4JFXB 1U8OB 4ZD3H 5DD3L 2YK1L 4K3JL 4PJXF 1TPXB 2XWJB 3QQ3B 3KYNA 3L7EB 1CGXA 4FNLH 4FZEL 1CWVA 4R6UA 4H25A 2B1HH 1KTLB 5I1JL 3EO1A 3WV0A 1G7IB 3OAUH 3ARBB 3L6FA 2X4UA 3OR7B 5IQ7L 4S1RL 1FZOB 3VI3F 3VXUE 3ZKMD 4HPYL 1CGWA 5ANMA 5DO2D 4J8RA 2AAVA 1LO4L 1Z3GL 1G0DA 1BD2B 4O51B 2A6IA 4F7EA 5I18L 3FB5B 1DQQA 1A6PA 3OKDA 2QSTA 1IGMH 4A6YB 4KHXH 2F58L 4ONFH 1B3JA 4PJDF 4ZO8A 2PYEB 4RFEB 1U95A 3QISA 3E6HB 4JFEB 3U9UB 1WBYB 3DSFH 3T77A 4FTVB 1TJHL 5LCVL 5KVGL 2O5YL 1NL0H 4NQDB 4JDVA 5TE7L 1YEDA 2G75B 2OJEB 5HD8C 5I1GH 5KSVA 2NLJA 1A7OL 3TZVA 4ZNEE 3GIVB 4JPIA 4M02A 3HA0A 2AABL 4G6AC 4QHUB 4Y4FC 5FCSH 4P23C 4PJFA 3ZKND 4OUUB 4G8FB 2NY2B 1ED3A 1OSPH 3JV6A 5AUMA 4U6HA 2IGFH 1KPRB 2DQJH 1T2QH 3F7YB 4RZCA 5HHQA 1EJOL 5DR5H 4Y2DA 4MNGB 2B0SL 1F3DH 3EAKA 1INEH 2M1KA 3SN6N 3BD5A 4CJ1A 1CXFA 5T5FL 3F58H 5BV7B 4DWHA 5I71C 4ELMF 2OL3L 4HK3J 2FX8L 3K81A 4YHKH 5CKGA 4YE4H 1NGXA 2XFXB 1T1WB 3MMEB 5GIRB 1FE8L 1IAOA 3KPNA 4JQIL 5E03A 3X3GL 3QR2A 1FL6A 5EBWB 4O9HL 4N68A 3LVEA 1B90A 4JFDA 2XQYK 4LSUH 1K4CB 5LVEA 2XN9A 4FQCL 1FYTA 3CXHK 1HIMH 4P3CH 1U6AL 5GGVY 1QKZL 3HPLA 4ODTH 5I9QB 3S97C 4R26H 5GSVA 1H3GA 5F71A 4OZIA 4WU7A 1AXIB 2A6KB 4G6FB 4MNQD 2ADJB 1IL1A 1YNKH 4X6BA 1C08A 5EOCH 1IAMA 2K9UA 4JFOB 1NSNL 4TVSa 1B0RB 1AR1C 1RULH 5E94B 3L3OA 1ACZA 1CYGA 4K3DL 5GRJH 5TQ0L 5TPWL 4RDQG 4PV9B 5ICYA 5ITFB 1FJ1B 1JGEA 2E3VA 2NY3C 3OQ3B 3RL2B 5IJVB 5F89B 2E7LA 3QUXD 5EBLB 4WFGE 3UJTH 2X4TB 3V8OA 2XZCH 1XGPB 3PIQB 5DGRA 3P40A 1ADQH 4E41E 2YR3A 1ZA6B 4B7IA 3MXWH 3GM8A 1NLBL 3MJ8B 2RFXA 3KPMB 4Q7DA 3W81A 35C8L 1LNUA 3FL7A 4K8RH 4X7TA 3PWJB 3KNBA 3KS0H 5FAAA 3ZL4L 4FG6D 3WFBH 1KYOJ 3BMWA 2VABA 4LPCA 4R96A 4X4XB 3SGEI 3UTZB 1T1XA 5FOBA 2DN7A 2EDFA 5IBUB 2C3XA 3SKJH 1QR1B 4HEPG 2LAAA 4JRXD 4NRXA 5DT1L 1IBGL 3MLTA 3SDYH 4OCSH 1AXTH 2J2ZA 1RVFH 4JO2H 4QRUA 4YBHA 5A2KH 4KVNH 5FYKD 4P9ML 5SX4H 4QWWD 1WT5A 3A6BH 5MEND 5K59F 4Z5RA 1JGLL 3FCTB 2GSIA 3OXRB 1HQ4A 4MHHI 1UZ8B 2ERJC 4X6CA 3VXTA 3MO1B 2AJXL 1IM3A 5CIPH 5F7MC 3HI1A 1A6WL 1AIFA 1T21B 2IH3B 5T3XH 3LDBC 1KUMA 4PJCA 2CO6B 2FHFA 3HTLX 3EJZC 5D8JH 3U46B 2VDOL 4D2NA 2VXVH 4PG9B 3T65B 3GKWL 2HH0H 3DYOA 5EUKA 3OJMB 3QEHB 3FQWB 1P7KB