4D8PA

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
184
structure length
184
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DQA1 protein
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pA01
1A7BA 3RJQB 4X83A 1DBAH 1T1YB 5ICZA 2FECL 2HN7B 3KXFA 1I3UA 43CAA 4EUPA 5DR5L 3O8XD 1U6AL 1MCBA 3VW3L 1FN4A 5E8NB 3PQYA 3QUXB 1TJIL 3RZCB 3AU1B 3LIZH 1UM6L 4H25B 5L7XL 1MCOL 1N6QL 2LABA 4F7EB 1H3TA 4MS8C 5DVLA 1RK1A 4FQCL 3DPBA 1A6AA 2VLLA 4LDOB 1U8PB 3GBMH 3UTPE 4RGMB 3HA0A 4ENED 5D4QA 4EUPG 1A7RH 1VADA 5EZIH 4UQ2A 2N4IA 2HG5A 5D1QA 4UINH 1BZ7B 3VGDA 1EFXB 2AJUH 3O6LL 3FONA 3GSOA 4APQC 4R3SA 2WUBH 4M3KB 5J6GA 2VDNL 4J3OC 2VQ1A 2V9QA 2PYED 4JO1L 4MAUH 2EDTA 3HC3H 3KGRA 2O93L 3S5LB 2AEPL 4F9LA 1ZANH 4GRLA 1A21A 4YFDB 3RUGF 5DQDH 1VFAA 4BYHA 1E4XI 3DHJA 1LDPL 4L8SB 4MJ2A 4LNVA 4QNPF 4PJDF 2ED9A 5A2FA 2AERT 4FQQB 1GC1L 3T1FA 3VRLE 2X4OB 4PGEA 1RZGA 3ECBB 4WUUB 3KS0J 5BRZE 4Z7OF 1PAMA 5IB1B 1FZMA 4XWOC 2ZUVA 2F54E 4GKNA 3U0WH 4U1KA 3BSZL 5I71C 1EIBA 4HX1A 5CMAB 4TSBL 3F58L 1TJGL 3DBXB 4XMLL 1KJ3H 1GZQB 2HJLA 4RFEB 5DZLA 5GS1C 1UVQB 3TO2B 3QFJD 1CFNA 2R9HC 3RU8H 4A6YL 4QHMA 4H0IA 4M9PA 3QQ4B 2MNUA 2V17H 5D7JD 4LBEB 1MCNA 2FBJL 3GIZH 4MXVE 5JHLH 3WN5C 4OCWH 2DWEA 2IPUK 4DKDC 5KS9E 3WUWB 2P48B 5GIRB 1FO0H 1U3HA 5IG7B 5DD6A 1AKJA 4HUXB 2FEDD 4NRYA 4LNRB 4XPFH 4ELME 3WLBB 3RNQA 4O4YH 3I85A 3QI9A 4CU6A 3T8XB 1FZOA 1Q0XL 3WFCH 1J0JA 2PR4H 3RPIB 3V6FA 2NY7H 4OD3L 2QTEA 3O2VL 3QXVA 3ARPA 4P2QE 4PIRF 5E2UH 4YFLF 1A6WH 1A5FL 3GFUA 2GTWB 3I02A 1QLFA 4PRNA 2A38A 4ISVA 1VFOA 5I8KH 3VXQA 1F3DJ 3ZDYE 3K8MA 1JYWA 2MOVA 1YQVL 4HAGA 1PZUB 2PW2B 2NY2D 4LSSH 2W9EH 4UAOB 1A14H 1HINH 2HRPH 4U6VL 4M6MH 1IE5A 5CJQL 1AJ7L 3QEGH 5E00B 3JV4A 1XCTA 1ZHKA 4HJJH 3VFNA 5EU5A 1JPSL 4GBXD 4S0TD 3WFBH 4E41D 1TXKA 1OPGH 5IVXF 5DC9B 2DQFA 4PV8B 1T04A 2DL2A 3H3PH 1TCMA 3CZFA 4P3CL 35C8L 5EWIL 2YD6A 5A1AA 4MB3A 5CBAB 1BPVA 2VWEE 5I73C 4AM0B 1UC6A 4OUOA 4G9DB 4QWWD 3MV9B 2BNQB 1NCCH 3QDJD 4PR5B 1Y0LB 4Z78A 2D3VA 2VISB 1E27B 3BPCB 1A0QL 1I1AD 1RAMA 4AEIL 3D5OF 4XNQB 5HVWA 2NY4C 3VFRB 3OMZA 5K33A 1KCVH 4HS8H 1QA9B 4Y5YC 4IRSD 4LK4A 1RZ8B 3ZT5A 3QIWC 1DLHA 2VXQL 1KIRA 2O5XH 1EMTL 2R1YA 4N8VG 1BFVH 1ZXQA 3HZKA 3JVGC 4RISL 1ZGLA 5JUEL 5DJXB 3SKOB 1KBGL 2DM3A 3L3DB 4P59L 5F1NA 1WICA 3CMGA 1J8HB 2X1OA 1QPPA 2VITA 2BRRH 1HNGA 5MEND 1YECH 2DLEA 3GNMH 2OI9B 1YNTB 5LVEA 4JVWA 4P46D 3U6RB 1I8MB 1BMGA 1L6XA 1HN1A 4Q6YA 3B83A 4QF1A 1EHXA 3MYJB 4YXHL 2AXHA 25C8L 3MQIA 4U6HB 3MRIA 2OXGA 5D7LE 1AXTL 5ADPL 2XY1A 1Z6JT 4WW1A 4RDQG 4F7CB 4HKJB 5JXEC 3SKNB 3FHAA 1IARB 2R1WA 4YDLC 3ULUD 4QRRA 4KQ3L 1Q72H 3SE3C 1XGYL 5I1HH 1S5IH 3PWLA 4OZGF 4B7LA 1UH4A 4XP4H 2YPLE 5SV4A 1KGCE 3Q6GL 5B3NA 4WU7B 2R1XA 3MBED 1S3KL 3HB3C 4PLJD 3BN9D 4MHHG 4MXWH 2OTWA 3NIGE 4YDIL 4EQ2A 5C0DA 1BAFH 3Q5TA 4F80A 2IALA 1K3IA 1UCBH 2VN7A 4JFQB 4LLAA 1J05A 4AEHL 5BVPH 3T2NH 4L8DB 2ARWA 3DNKA 2VLJE 1KLUA 3ARFA 4HBCL 2BHYA 1I7UA 4Q9RH 3P4NA 1MHHB 4ODVH 1S9WB 3S35X 4YJZL 3WHE0 4UBDD 3P4OA 1QVOA 1FFPA 1XR8A 3C9NB 4M7LL 2NMSA 3D3VA 4NO0B 1HHIB 1NKRA 5TGBA 4JDTL 2MMXA 3I2CH 3MLXH 1K4CA 4RSVA 3VCLA 3EDFA 2C26A 5L2KD 1N6UA 3VGAC 2OQJA 2IWGA 4OZFH 1DBBL 5LAXA 5CFHA 4CKVX 3M45A 4HFUL 1MH5B 2X4PA 5I8EB 3H9SE 2G60H 5LGHL 4N0FA 4RWYH 4BKLA 5FO9B 4TNVF 1YN7B 4JRXE 3T0BA 5JPNA 2YSSA 4ZSOB 4XXCC 4FA8A 3NH7L 2R2BA 4OF6A 3O6FB 2P8PA 3VWJA 2HKHL 4I18C 1KJMA 2JTDA 4J4PA 3NBNA 2HVKB 2IH3A 5E2JA 4NO5A 1IEBB 5BS0E 5GRZA 3JXAA 4JANB 3PDGA 2NPLX 2OXHA 3DROB 3MODL 4IMLB 5IEHA 3NAAH 2EKJA 5GRUH 3ARBC 1ZVHA 3VWKD 1BLNB 3U7WH 1BD2E 3ULVL 4OLEA 5J13B 1T2QL 5EUOB 1DVFA 5HJ3B 4N1HB 1J1XH 3FAXA 5ANMB 4PRAA 3MRDB 3OKDB 1K5NA 4CVXA 4WUUE 2DI7A 1A9EA 3GHEH 5DTFA 1U9KA 5IHUH 4U3CA 3P0YH 2Y1VA 4LVOC 3OR7A 4C4KT 1RZFL 2NW2A 5FCUL 1NJ9A 3R06B 4WNQB 3WE6A 4XPTH 4AG4H 1OWRM 1J0IA 1INQA 2AJXL 4Y16D 4P5KB 1OAKH 7FABH 5DUBB 3TBYB 5KSVB 3MBXL 4PP2A 3D2UD 4BFIB 3G6DH 4MCYA 3HHRB 1MJ8H 4E5XA 4G8FA 4PLKC 1IC1A 1RUKL 4IOIA 4RGND 2F8XC 1OTSD 1A6VH 2AEQL 3WNOA 3GSQB 4GW5B 1LMKA 2BSRA 1QO3B 3RTQA 3TBTB 2NQCA 1XIWB 2IBZY 3NCYP 1INEH 1UKTA 4JREC 1LD9B 5DJDB 1BVLB 1IGML 1NEUA 5B8CB 1T0PB 1YEJL 3RX7A 1OQXA 3QH3B 3ULSB 4Y5VA 4C57C 3QXUA 3WHXA 1DQDL 4P2OC 3THMH 4G9FD 4Q2ZA 2J8OA 5J7CC 3G5XB 4OM1H 3LKQB 2NY3B 4PRBA 4N8PA 3UROR 4XBEH 4NQXB 1DE4B 1R5VA 2VDRH 2WWKT 1X44A 3F6LA 1UGNA 3ZKMC 2X1PA 3WDHA 1FO0A 1FGVL 1CVRA 4PREA 2R56H 3O2DL 3MO1A 1NANH 3IDIB 4NRXA 4YIQA 2VZUA 4KJPC 4S1SL 1Z3GL 1NCAH 3HCVB 1GOFA 4JPKH 5GS0D 1KTKE 4POZD 3UTSE 3FFCE 3SDYH 5I19H 1N59B 3NPSC 2W0KA 4WEUD 2CRMA 1UJ3B 3RVUC 2IPTH 5JQHC 1AO7E 3AXLB 4PB9H 5F7KC 4D9QE 4NQSA 5D7IA 2DTML 4DGIH 1KIUA 3TVMA 3C5JA 1LP9F 4AT6B 5FHBL 4POUB 4HAFA 4ONOA 4MNQA 3U36A 1S7UB 4KMTH 3VXMD 4WFFE 2HRLA 3NA4A 2X9YA 2OS7A 2E7LC 5IK3B 3IJHA 3JUZA 1KB5H 5ID1A 2N56A 4R8WL 3QIUB 4X7DC 3BKYH 5CD5D 4R7DA 4KJQD 4OZHB 2VB5A 3EO1B 2CMRH 4LVHC 1N8ZB 1ORQB 4LRNH 1VGKA 1RURL 4JFOA 4YFEA 3SKMB 4Z7VB 1JGEB 1NDMB 3MV01 5F88B 4GS7B 2CRYA 1GGBH 1U8OA 4V1DE 3MLUL 3HI1A 4QTIL 4QRUA 4XRCB 1YPZF 3Q3GB 2Q8BH 3KXFB 3CDGA 4Q9QL 1T1WA 1ZLUH 3HUJA 3WJLA 2FHFA 3PIQB 5EO1B 3ORJA 1XF1A 3PHQA 4MAYD 4N90D 5KSUA 1RU9L 3WLWD 3CH1A 1K85A 4FQXD 1RK1B 1OF2B 3FTGA 5A2JH 3TF7C 1V3JA 4UT9L 1B6UA 1VADB 1KJ2H 3QEQA 5CBEA 4UQ2B 5AYUH 5CILL 2HG5B 1J0YA 1ED3A 5C08D 1NC2A 3FONB 3UMTA 4JJ5A 2F53D 2NNAA 5SWQA 3PP4H 4QRQA 5J6GB 2DWDA 1IGIH 4DFIA 4FFYH 3QG7H 4KRNA 2IEPA 3GSUA 5JW4N 1AH1A 4D9RE 3BPNB 4FQ1H 3MUHL 4NQVB 4J12A 4G43A 1PKQE 4XC1L 1X6LA 1EO5A 2DQIL 4KRPC 2FATH 5HHOB 4UILH 2PO6B 1VFAB 1N0XL 2MQ3A 2YD4A 3BW9A 1B4RA 3BKMH 2J7LA 3ARQA 1CF8H 1MHCA 4JFFD 2A6IA 1J86A 5FYLL 4H88L 3JTTA 3LQAL 4PJEE 1MREL 1RZGB 4XPBL 3RL1A 3BAEH 1IM3A 1FZMB 1A6ZA 1QLRA 2DBLL 2R0LL 2VR4A 2XWTA 2FO4B 4GKNB 3FB5A 4L3CA 4U1KB 3CX2A 3E1F1 3GUTA 1D9KC 4BH8A 2FLBT 1PQZA 3FQTA 2XKNB 4QO1A 1JL8A 1MCRA 4GRWF 1KNOA 2EEDA 2YUXA 5IMMA 5JOFA 3EJYC 4N8CL 4DAGH 4Z9KB 1CFNB 4JO2L 4NQED 3DV6A 1XF3A 4OF8A 3P73A 3MXVL 1JPFA 2VDPL 3JWOH 1OW0A 2DWEB 4JY6B 5T5NG 4OZFA 3V5HA 1C8PA 1NGYA 5BV7H 1BQLL 1MHEB 5FYKL 3WCYA 4C56D 3QIBC 5BOZG 5TDNB 5DD6B 4LEOA 4NRYB 4PJ7E 1H5BB 2XQYK 3NZ8A 5CEZH 1TNMA 3OL2A 1OGTB 4PRHB 4WWKA 3RNQB 3TJEH 3TFKC 2BFVH 2IANE 3SHSA 4GXVH 4I9WD 1JBJA 2I26N 1D6EA 4FFVC 4JZJA 1U8QB 4Y2OA 3IS1X 5HDBF 5DRXA 4IDJL 4JFDA 3DURA 4OZIA 3CXHJ 4PRNB 2M1KA 2Z93B 3VXQB 3MMEA 2JJUA 4MS8D 4OZFG 2I07A 2PCPA 1G7PA 3QPQC 3GIVB 2UWEE 3N0PB 1REIA 4Z7UB 4PP1C 3QJFB 4K8RC 1G7LA 1RJLA 4G8GA 1QSEB 2K7PA 3B5TA 3W82A 3AMLA 3DYOA 1F4HA 5IVOA 8CGTA 3HZYB 4APQD 3C6LB 1E4KA 2NCMA 4G8EA 3VXUD 3B8SA 1ZHKB 4KUCD 3U9UA 1JI1A 4ZAKB 5HGBA 1MJ7L 1FE8H 12E8L 4JGUA 4Q0XH 1T04B 3QXDA 5F97E 2AAVA 3RVVD 5KSAA 3BIAX 1NLBH 3JV6B 4X7EC 5DI8A 1V3MA 4L4VB 3RWCA 4J8RB 1FG2A 3JV5A 4OCXL 3AAZB 1LK2B 3K80A 4Z78B 5L2JA 2WUCH 1CR9L 3MCKA 1FL6A 1OAQL 2E9IA 4ODBD 3V0WL 3C5ZA 2V5TA 3B5GA 5E08L 4XC3L 3IVKA 1ZEAL 4XWOD 2DQUL 2E27L 2V5SA 1MAKA 3SE4A 2VMFA 1A7QH 2VH5L 5IEKA 5I74B 1UACH 1ITBB 2EICA 5EDXA 5HGGS 3ET9F 2R1YB 4I3GA 4OLXL 1WEJL 5E5UB 3H9HA 1BQHG 3HZKB 3R8BB 1ZGLB 1H3PL 1W8NA 4K9EL 1Q9OA 4NJAH 4MD4A 5F1NB 1TETL 1BZQK 2VITB 2BVUA 5TDPB 2JELL 3HNTH 2J3SA 2O5YH 4XXDB 1Q94A 1U58A 4XGZA 4MZ2A 2XQBH 1QQDA 2PW1A 2CO7B 5LWYH 2EE9A 4L4TD 4OLWL 2ZUUA 4QF1B 5AD0A 1NCBH 4UV4L 4OTXL 3MRIB 4NBXB 4JVUA 4CAGA 4XCNA 1V3LA 5LGJA 4M1CC 4Q6IA 4PY7A 2PN5A 2R1WB 3RGVD 3QCVL 5KSBE 5I8CA 4QRRB 3W2DH 4Z7WF 4X99A 3MRNB 1KLFA 3CIQA 3PWLB 4AMKH 1OP9A 3VFWB 3GKWH 1C1EH 1HHKB 1AD0B 5LCVH 5F9WC 5EC1B 4K3JH 4UUJB 2P45B 2OTWB 4D8PA 1XZ0B 1T20A 3K74B 3BN3B 1KB5A 3BD3A 5C0DB 3D9AL 5DD5L 3K3QA 4ZUUA 3VRLF 2IALB 2LVCA 1CN4A 1J05B 3MZGB 1G7IA 2YMXL 4Y1AE 4R4BA 1G6RH 5IBUG 4I3RH 1KLUB 5ITFA 4K7PX 1F02I 1U91A 3TO4B 3EGSA 2YRZA 1I7UB 1BX2A 2OMBA 5GSRB 3PQYE 5CSBA 2GJ6D 1N2RA 4JM2A 4R4NC 5D2NA 3P4OB 3AREC 4C59B 2DLFL 1FFPB 1XR8B 3OWEA 4CVZB 3D3VB 4I48A 3RDTC 5TGBB 1K4CB 3BOVA 2CO6B 5HVHC 3HNSH 5C0BE 4FFZH 2VUOA 3V0VA 5JDJA 3GO1H 1K8DA 1FLRL 1WWCA 2OQJB 5C6PB 5HYSG 2DTSA 2NY4D 4XNUH 4YDKH 1EUUA 4RIRB 4YHZL 5C9JA 3IFLH 4N0FB 4HG4K 2XWJA 3BRDA 1I1YA 4DUWA 2YSSB 2FEEI 3LKSA 1WTLA 3VFOA 2R2BB 5AG8A 5EU6B 5JR1L 2EH8H 5F93C 3WFHA 4NNYB 1DQLL 2C5DC 3S37H 2IPKA 3VWJB 3RIFK 3V52L 3QULB 1KJ2A 3GI9L 2GAZA 3LHPH 4PTUA 1NL0H 4NO5B 5CJ8A 4KTYA 2RHEA 1FZJB 4UNTA 4AIZA 1J5OH 4DW2L 3LS4H 5F70A 4U1GB 4K3DL 4U1MA 1KEGH 3VGBA 4KVCH 2X4SB 2FGWL 1NMAH 5MERA 4X5WB 5JW4Q 3MA9H 5IBTH 1BFSA 4NN6C 1A9EB 2BRQA 4PS4L 4D0BB 1QKZL 1MHPL 3QWOA 4PJBA 2NW2B 1T21A 4JFED 4ZS7L 5JXED 2CRZA 4WTXA 1C16B 1DL7L 1KENH 5CAYB 1DUYB 4NO2A 2R23A 4NN5B 4B53A 4N0UA 3K8KA 2FHCA 1LQSR 2GITA 4WI9A 3NPZB 2R2HA 4X80L 4EVNB 1R3HB 5FXCH 1BJMA 3HB3D 2YPKA 5D1XC 4EI5A 2BSRB 4XPGL 4L3AA 3KPLA 5I6XB 4YGAB 4JO3H 2BCKA 2ESVD 4HZLA 3TZVB 3SGKC 2WNGA 4JCLA 3GJEB 3MLPA 5I18H 1IM9A 2VZ3A 5EIVA 4Y5VB 3N1FC 3WHXB 2FJHA 4Q2ZB 1AP2A 4PRBB 1G9NL 3N1MC 3NCBB 4JFHE 1NEZB 1R5VB 4X9IA 3MJ9H 2J5LC 4HK3N 1OL0A 2VLKA 4Y0GA 4PREB 4QXTA 1ZT1A 3MO1B 5H2BB 4NRXB 3EOAB 2UUDH 4S0SD 3GBLA 2JCCF 1IT9H 2QSCH 3DXAD 1MFBL 2EDHA 1P84J 4RBPK 2LQRA 4G3YL 4YHOL 3O81A 1DQML 1IAOB 1FBIL 1YYMH 3TBWA 1JHLH 2HA1A 4H1LG 1MCSA 3LEVH 1LEGA 2B8OT 3HE7A 5A40E 3QR2A 2C4FU 3DV4A 5D7IB 4HHAA 1S9YA 3IXAA 2VDKL 5DF0A 3TVMB 3C5JB 5HHQB 1MIEH 3GI8H 4HGWB 4NQDD 4AQ1B 2FYYB 3ARBD 4K94H 1R0AL 5IQ7L 3S3SA 4HK0A 4NOBA 3IJHB 4Y19D 3C09B 2JKXA 4WO4A 2BHZA 3IDGB 4OIBA 4PJ9C 5IHLB 4R7DB 2EDNA 3NFNA 4AQOA 2Q76B 1CE6B 3Q6FA 4ZS6C 5J06A 3QXAA 3AGVA 4JFOB 4DN4L 4M6OH 5EOTA 3HG1A 4YLQT 1X5AA 3A6CH 1RZKH 5DXWA 5IB5A 3PL6B 3OB0K 4MD0A 5F89A 3LN5B 5I1GL 1KIQA 3S7GA 3HI1B 5BO1L 2C1OA 5HDQH 3TJHC 5DJ2B 3LD8C 5DMYA 2XACC 4MMXC 3UCRA 2R39A 1KIPB 2DIAA 3HC0A 4GAYB 3FQUA 1RUQH 4P2CG 3HUJB 2EDDA 3QUYD 2VKWA 4R2GC 1LO4H 4ZOCA 1AQDA 3W0WD 2PTTA 4HCRL 5D96B 1WIPA 2I27N 3QDGE 3BZEA 5IW1B 3RA7H 3EYVB 3VG0H 4M5YL 3VG9C 1ZKAA 5BMFH 4KHXL 1DBMH 1TZHB 2ORBL 4P2OD 3UBXA 4PY8I 3QEQB 4KWUA 2YEZA 4LKXA 1U3JA 5D8JH 3ULVF 4LLVA 2A0LC 3UPAA 1ED3B 4LPVA 5HYQB 5I1JH 4JJ5B 2NNAB 3ZKMD 4JLRA 1TPXB 4IHOA 5KG9A 3MLSH 4C55A 4AEEA 2DWDB 1R24A 3QP3A 3L5IA 4P9HL 1FNSL 1F2XK 2E9JA 3QUMH 4KJPD 3SO3B 1J9CT 4LP4A 3UTOA 2EXWC 1P7QB 2P8MA 1BJ1J 3CDYA 3UBXG 3UZQA 1XR9B 1A7NL 5CINH 3WJJA 3WMSA 1LO3H 3B43A 2HT4C 1YNKL 3BW9B 2PXYA 4Z5RA 4UTAL 4KAQH 1KXVC 1RZJH 3L3HB 3MJGX 3RVUD 1NUNB 3JTTB 1T4KA 1MNUL 2IH1A 4EN3A 1IM3B 4W68A 1A6ZB 1CLYH 3BMVA 4HJ0C 4LDEB 1FRGH 4I0PC 3GUTB 1WFTA 1AFVH 4BH8B 3SE9L 1D3CA 1G6RA 3QZWG 3NZHH 3ZTNL 3FQTB 4XTRC 4FQIL 4GFTB 4GSDH 1KNOB 5IMMB 5JOFB 1ZK9A 1S7TA 2ILLA 3DV6B 1JGUH 4OLYH 1W2KT 3P73B 1RFDL 1XFPA 2WQ8A 1G84A 5T5FH 1IVLA 5IOPA 5F8RC 3V5HB 1NGYB 4ZUWB 5IESH 4LEOB 1HQ4A 2EDLA 2MWCA 2ZCHH 3TYFA 4K55A 4KROB 4CMHC 3VXPB 1OTTC 1D6EB 3U0TA 4P23B 3F65A 4NZJA 3QQ3B 4E9LA 3I6KA 4JFDB 1FNEB 3MMEB 3MRPA 1OSPH 1TVHA 4U1NA 3PWVA 4LHUA 3GBML 2VWEC 5I1DA 5EZIL 3HE6B 1G7LB 1KLGB 3AM8C 4G8GB 4KTEH 4YHLL 3DX9A 4UINL 4BQ6A 4YE4H 1Y18A 2AJUL 3DUUB 1Q1JL 2DKUA 2KH2B 5AWNH 3TIEA 4HIEB 2WUBL 1KG0A 3L7EA 3IFPA 4QOKA 2NTSP 3WFEH 5HGBB 3BHBB 4NQCA 3GSRB 3KPSB 3O4LA 3EOTH 5E6ZA 1MI5B 3ZZ1A 2BOBA 3D69B 3LEXB 4KRPD 5GGRY 2CJUH 5DQDL 3KPOB 1TQCB 4H0GA 1CBVH 4G7VH 3GSXB 4FXKB 1NBZA 3K8LA 1OCWH 2E9WA 1EZVY 1FCGA 3ABZA 2P5WE 3BESR 2G75B 2PYFB 5L2JB 1S9KC 3MCKB 5HHNA 1FL6B 2NLJB 1K9TA 3VXRD 5GXBB 2IAMC 2VDLH 2DYPD 3ZDXE 5C0EB 1CQKA 2YA2A 4HUWA 3U0WL 4DWHA 3UTTA 4Q97A 4KDVA 1D9KD 2ATPA 4RMVA 2FX8L 2LU3A 1HOCB 4CW1A 3IKCA 1A9BB 4TUKH 3U4EA 3V0AC 3EJYD 1Q9OB 1HHHA 4MD4B 1YN6A 1OSZA 3RU8L 2M8XA 1IGTB 3DYMA 3IDNA 1S7QB 3MJ9A 4DGYL 2JIXD 4N0RA 1NBVH 3MROA 5BW7C 1FL5A 1IAIM 3PF2A 1S8DB 2VXSH 5E7BA 1I4FA 5D1ZA 3SBWA 3MJ7A 4C4KO 3U0PA 3JWDL 3QIBD 4B5EA 5AD0B 5GGSY 5IFHH 2VKXA 3TFKD 4N9GB 4Y4HB 3IAQA 5CCKH 4XCNB 2NY7L 4FFVD 1RUPH 4Q6IB 5HTSA 3U30B 4MNQE 3T0ED 3QDME 4HGKC 1QOKA 5T1LD 3SGEH 3EYUL 4ZFGL 3QHFH 5I8KL 1P5VA 1EXUA 4WW2A 3D25A 3RIFF 4TTDC 1C5DB 3QPQD 3G5VA 3K0WA 5ADOH 4PP1D 4K8RD 3SGJA 1BFTA 4LSSL 5EC2A 3W81A 1HINL 4MJID 1T20B 5IM7A 2OR9H 4M6ML 2DD8L 5CZXD 3QEGL 4ZUUB 3C60C 1FYTB 3MRGB 4OGXH 1G7IB 4R4BB 3ZLQC 1HIMH 2WWKO 1G0YR 5ITFB 3GK8H 5C0FB 4KXZH 1BX2B 1ZT4A 1DSFL 4RMWA 4Y2DC 2GTZB 1N2RB 3LMJH 5D2NB 3QEHA 1A22B 3HR6A 4P9MH 5I0ZA 1QLEH 1T1ZA 3CFJB 1TITA 4U4BA 4LF3A 5CP3H 4CNIA 2R8SL 1NCCL 4P4KD 3BO8A 4GLRI 6FABL 1UWGH 5EG6C 3NGBC 3QEQE 4ETYA 5C9JB 1RJZA 3IDXL 4TOYH 1CFQB 3U4AA 3OJVC 4IOFC 1P2CB 4NFDA 3WO4B 4PGBA 3VFOB 5K9QG 2O5XL 3SDCB 1UEYA 1BFVL 3WFHB 4IS6B 3L7FA 4HWZB 2QSTA 2IPKB 2ATKA 1MFAL 4NCC2 3L95A 4PJHA 2EIZA 2GAZB 1RQ5A 4PTUB 3NIFF 4J3TA 4WFHE 2ITCB 5B3JF 1G7HB 1UM4H 3H8NA 1G1CA 5JA9A 3BQUC 2BRRL 2Y5EA 3GMPA 3KPRE 5F9AC 1A3RH 5J1TC 4Q74A 1P4IH 1LE5B 3G5YB 1AD9B 3GNML 4LLYA 5TJWK 3T2QA 4GH7B 4DGVH 4F57H 2D2OA 5EUOF 2F74B 1AXSB 4U1MB 3SCMB 2FDBP 3KJ6H 5MERB 2D9QB 5DMKB 3QUMA 2I25N 5IW6A 1BM3L 3RVWC 4JZOA 4X7TA 1KN4H 4W6XB 4QTHB 1CICA 4NSKA 2GJZA 1VFMA 4U6TA 5DURD 4WRLA 3QWOB 2OLDA 5F3HA 4M1CD 1T21B 4I0KA 4QRPA 4ZO9A 4HZAA 2EH7L 2EKSA 2GJJA 1H3GA 4OCYL 1CZ8H 4RWHA 3ALXA 1VEMA 4LASH 2PTVA 3O4OB 3VDCA 3WSQL 2R23B 3U4BL 2PYEE 4N0UB 1S5IL 5FM5M 4UT6L 1CVSC 1MFDH 1L9MA 3H2WA 4KDTA 4Y4FB 5ESQA 2VABA 3ZE2E 5HYJD 2K1MA 1CDIA 4K71C 5C09A 5F7EH 1L9NA 1A1MA 2NX5D 3BZ4A 2VNCA 1PYWA 4MQ7A 3OAYK 5FECA 5JW5B 3DX8B 5FOJA 1UCBL 3H42H 2OTUA 2Z91A 5LBSL 1WGOA 3T2NL 4ALAL 4XVTL 3W39B 1PZ5A 4X6EA 2DKSA 1FAIL 4DOHE 2XICA 2FSEB 4X8JB 5TF0A 3ARED 2IBGA 4DFHA 1ZVYA 2LU4A 5BV7B 3RDTD 2A74B 4OZIE 1HXYA 2UYLB 3MLXL 1ZT1B 1IAIH 2OSLB 1X4YA 4JG0H 5FM5O 3SGDI 2BNRD 3P77A 3ZSTA 4EI6A 5DQ9A 3V6BR 4RWYL 4DK6A 3DMMA 3NIDE 4ODSL 3FT2A 3IF1B 2ERJC 1ZS8B 4M7ZC 5FO7A 4HT1H 3TBVA 5SWSD 1BIIA 2X4NA 5IHZA 3TN0C 1A64A 3HE7B 3U9PH 3SOBL 32C2B 5J11C 2LV4A 3X11A 1S9YB 2YRPA 2Q1EA 5I1CH 2D03H 1WFUA 4GG6B 5E6IC 1JF1B 5GRUL 3B2UC 4OQTH 3U7WL 5D9SB 2AJYL 1UH3A 1YA5A 1J1XL 1SMOA 3ARGB 2AJ3A 4WI7A 5SWZB 3W9EA 4OBRA 4OZHF 4PJDA 5A2KH 1TZGH 4JFYA 1JFQH 5K9JH 2HAZA 4PV9A 3GHEL 3Q6FB 1SJEA 4X6DB 3QXAB 2XA3A 3MV7B 4Z7VF 1IKFH 3HG1B 1ZLWH 3NFPA 5LXGL 4MD0B 2AQ2A 3BT2L 2DQDL 4AG4L 4PJXE 1TENA 2C1OB 3ARZA 1OAKL 2XN9E 3HI6L 3TC9A 2E8ZA 2QQQA 3R0MA 3OHXA 4D0DA 3RFZC 4L3EE 2VZSA 3FQUB 5D1XD 1XT5A 2BVPB 3B9EA 1CT8B 1QG3A 3SQOH 5JDSA 1AQDB 1WLHA 5F44A 1INEL 1U0QA 3DVNB 1MCDA 2HJKB 2JB6B 4FQLL 3C8DA 1O7VA 4XBGB 3UDWC 1QSFA 3P30H 3TA3C 3THML 5D7KE 1D5MA 2I9LB 3TBSB 4LLVB 1RZ7H 1SYVA 1T7WA 1SY6A 4TSAL 5J9PA 4JN2A 5T3ZE 2VDRL 1VB9A 4M02A 4PRPA 5B22A 3B6SA 3CFKA 3L5JA 1FH5H 2L7JA 1R24B 2R56L 5CEXA 3D0LA 5TQ0L 4IOSD 4JCMA 4PJIE 1NCAL 3GMRA 3UX9B 4BA8A 5FF6A 1XF4A 4JPKL 1K6QL 4R96A 2BSTA 5DJZA 4LSTH 5KVFH 3BMWA 2QADC 5I19L 1DFBH 1KN2L 1LWRA 4Z8FH 2PXYB 3QUZA 2Y36H 5E5MB 2BJML 2DM4A 1EERB 1TQBC 3QXTA 4PGDA 5D2LA 1GGUA 3LSOB 2IPTL 4XT1C 4HFWA 3TEUA 1H15A 4PB9L 2K9UA 4ZUTB 1I8LC 2IH1B 4EN3B 4DGIL 1MUJA 1GH7A 3TT1H 4DVRL 5A2LH 4OGZA 3T2OA 1WK0A 5IVXA 4KMTL 4YDJA 2Y23A 4JKPH 5CJOH 4ONFH 2Q7YB 4UDUB 1JZ7A 4PJ9D 3WNKA 1YJDC 2G5BA 1S7TB 4ZS6D 4LRNL 1RHHA 4JRWA 4F2MA 3UTPD 5TFSL 1Z5LA 5CP3A 4PRDA 2RGSA 4TVPE 3TJHD 4H8WH 2Q8BL 4JGMA 5DJAA 2X7LB 4PJCE 3EO0A 1HQ4B 4Y4KD 3ZKXC 1D7FA 1MCWW 3INUL 2XT1B 4U7SA 3TYFB 1G7QB 2X4QA 4G8IA 5CKAA 4F7MB 4JO4H 3U0TB 4ELKB 1FVCA 4R2GD 5C0CB 3BP4B 3I6KB 1JYNA 1SVZA 1YMMD 2AK1L 4XWGL 2B4CC 2WM0A 5TPWL 1ONQB 4M8QB 3MRPB 4IIQA 1ERNA 1TVHB 3JSSA 4XMKH 1EX0A 4U1NB 3PWVB 1RV6X 4Z7UF 5I1DB 2XWBB 5DSCB 4HPOL 4OD1H 2A0LD 3DX9B 3FOMA 5FYJL 1Y18B 4PJBE 3HPJA 3O41B 5BRZD 2C9AA 4TUJA 3PWNB 1E28B 3TIEB 3D0VA 1Y6NR 4M9OA 3L7EB 1F58H 3OKLA 2ZOKB 3AS2A 3IFPB 3TLRA 4F7PB 2NY5H 4FFYL 4I5BA 1QP1A 2F54D 4NQCB 5MP6L 3O4LB 5FM8A 2EXWD 4FQ1L 2P44B 3VFVB 5I1EL 1Q9WB 3WFDH 4XVUC 5IUSA 2A9NH 3O2WH 2FATL 2HT4D 1J1OH 1V5JA 5IGXH 3X3GL 1U8HA 3DJ9A 3MREA 1NBZB 4GMSH 4NPYA 4HBQA 4M8VA 4ZUVA 2CDGA 4F8TA 3A6OA 2BC4B 3RHWK 2WBJA 2V2TB 3BAEL 5JMOC 1FSKB 5KTEH 2ZSVB 1DBKL 5EBWA 4HKZB 4HJ0D 3VMNA 2PF6A 3MRBA 4IRJA 4R9HA 2VLRA 1JGDA 4LIQH 3R1GH 2EDQA 5EU3A 4KKAD 2VLKE 4XTRD 3SE8L 1LEIA 4P2QD 3VH8B 3IKCB 2Q20A 4LCYB 1MIML 2AKRB 2A73B 3FQXA 5TQ2H 1WWBX 4N5UA 1C7SA 4MA7H 5D5MB 4IBLT 4DAGL 1OSZB 4EQ3A 1C12A 1NCUA 1U8IA 2AK4B 3TYGH 3B3IA 2NXYC 2Y6SC 3X13A 2BZDA 1WIOA 2XPGA 3D85D 4ZFOA 1KELH 5BV7L 4M7JL 5IWLA 1JPTH 1GSMA 4U1LA 1UA6H 2Z31A 5CEZL 4KVNL 4PJ8C 1PG7X 1W72H 3O3AA 3TJEL 4JDZA 4Z7NF 1F4YH 3GRWH 3MUZ1 4GXVL 1HCVA 5DRWA 1OTTD 2GUOA 5I0DA 1NQBA 4NN7B 4D0CA 4JY4A 4OAWA 1X5KA 3RY4A 1FFNB 5TF1H 3SDDB 1I9JH 3EJZC 3WL9A 4UU9A 1ETZA 4YHYC 1EXUB 3ZE1E 5DJYA 1BJ8A 1R3IL 4ETQA 1UM5L 4OQ1A 1WJ3A 3FFDA 1ZA3A 3B9KC 5F7MC 4OQTA 3I75A 3HG1E 4FMFA 5DD0L 3DVIA 4U6XA 1ZE3C 2R15A 4PRIA 2I9TB 3G9VA 1B4JH 2GKIA 4BSVB 3SEPA 5D1QC 3QEUB 5KVGL 5K9KB 4W6YB 4PY8J 1OP5H 1FE8L 1BVKA 4RX4D 4Q0XL 5DR5H 4LCWB 5C3TA 5E9DA 1U6AH 1OP3K 3QEHB 5M7QA 4OCNC 3A0OA 3KDMA 4F9LC 3VD3A 4CNIB 4GRLC 5JNYA 4NKOB 1SJHB 5L7XH 2WUCL 1MCOH 2MJWA 5ID0A 5K9OA 5FGCB 1N6QH 4XPHL 3FQNA 3IDUA 3DARA 3MOAL 4PBXA 1CGSL 3PV6A 5EZJA 4JKMA 1A47A 3KPNA 3PHOA 1A7QL 2GYSA 5D7LD 1T1XA 5I17A 3P3YA 2ATKB 1FVEA 3EFFB 3O0RH 3OX8A 3L95B 5INDA 2VDNH 3OJMB 4LARL 2BDNL 4JO1H 1JHKH 4P5MB 4HEPG 5INCA 1BVZA 2YPLD 2AEPH 1KGCD 4HW6A 4LLYB 3V7AE 2BSSA 3IDMA 1I7RA 1CIUA 3QUMB 1RJCA 5FK9B 4FN0A 5IW6B 1LDPH 4GBXA 4X7TB 4LOUC 1NCBL 3KLDA 3IJYA 3KLAA 4U1JB 4Y89A 5C0ND 2GJZB 1N7ML 1M71A 1WV7T 5HHMB 5JIIA 3JWNC 1U3HC 3DIFA 4QRPB 3S3JA 2YPVH 4TUOA 2WV3A 2EKSB 2VLJD 7CGTA 3I6LE 4HKBB 2D0HA 1UB6A 4N9OB 3QA3B 3QI9C 3UZEA 3VXSB 1J7VR 4IJ3B 1WAAA 1AY1L 5GRXG 1CGVA 3C8KA 4M1DL 3BSZH 3RZCD 4TSBH 1ZLUK 3F58H 4TTDD 1TVBB 5CP7A 1TJGH 4XMLH 4ZYKB 2EYSA 3C2SA 1JTOA 4P5TC 4XZUA 5ESQB 2VABB 1F2QA 4MCZB 1S7SA 2IMNA 1A1MB 1QEWB 4A6YH 1JCKA 4UOW0 5FKAB 3H9SD 2YBRA 4G6FB 3P4MB 3C60D 4HV8B 4M6AA 2OTUB 2FBJH 3CSGA 4AL8H 4JRXD 1QFUH 5DJCA 5EOCH 4HC1H 3MA7A 3KYOB 1NMCB 3HPLB 4Y2DD 5MENA 1BF2A 1VESA 2ZUSA 3T0AA 3CMOH 5ENWA 4ZOBA 3Q2CA 4JHWH 2NY0C 5BS0D 3LN4A 1TDQA 3RWFA 4OF5A 5E94A 1RK0A 5IP4A 4UV7H 4FFZL 4DKEL 4M93C 1TZIB 2QBWA 3AY4C 4EI6B 4XNUL 4IOFD 1BF8A 4WUUD 4ZXBC 3TBVB 3AROA 2V7NA 4KRLB 3GEWB 2EH8L 1GVIA 2KQNA 1X5JA 2X4NB 3LKOA 4QOKE 4J3XA 4XVSL 1QACA 5CJQH 1AJ7H 2ICWA 4QLRA 5D7IF 4KHTL 4NQCE 3U1SH 1QFOA 3ILPA 3X14A 3LHPL 3MBEA 1NL0L 1L0YA 4CADA 1JPSH 2RB8A 3BQUD 2ZSWA 4KK5C 3DVGA 1RIVL 1BWMA 3V6ZB 2N1KA 3S4SA 1EVTC 3G6AB 5HYEA 4M4PA 3ROLA 2GCYB 5EWIH 3V6OA 3DRQA 1NMAL 3N50A 1RVFL 3MA9L 5IBTL 3RVWD 2AJ3B 1F4WH 4RMRA 1ZLSL 4YR6A 4RAUB 4ODUB 3LS5L 4JFYB 2CIKA 2YD7A 4PV9B 1SJEB 1SM3H 2IPUG 1YEGH 4FXLA 1U3ZA 3EO9L 4P3DB 1QZ1A 2XKUA 3UTTE 1KENL 1WCBA 3LY6A 3VJ6B 3GHBH 5L2KA 2XG4A 3ARSA 2IJ0C 2VOTA 2X09A 4E0RB 4RISH 5D7SH 1WCQA 3OHXB 1NFDE 4Y8DC 3HUJF 1KBGH 3MGTA 5ILTH 2P1YA 4CMMA 4KQ4H 1OARL 3BGMB 5JDSB 4JO3L 1JIBA 1F4XL 3FFCD 3UTSD 3PJSA 2JJVA 2QQLL 1QSFB 1M6OA 4LKCB 3KLSA 4MA8H 5CUSH 4NM4L 3QQ9C 3HI5H 1AO7D 4D9QD 1AXTH 4UT7H 5C07A 1VERA 3MJ9L 3ZT6A 3ARFC 3VDAA 4PRPB 3B6SB 3CFKB 5JLZB 3LZFH 4CBPA 1S7XB 4YC2C 2MPAL 3L6FA 4JZNB 5CEXB 4WFFD 4AENB 3GRWA 1N3NA 3L5HA 3F5WB 4GUPA 4KQ3H 1XGYH 1Y6MR 5FF6B 1PVHA 2DF3A 5IIEA 3MV9D 2BSTB 1IT9L 2QSCL 4JGJA 5DJZB 4YHML 3NCJH 5DRZA 3ZT7A 2EC8A 1S3KH 2XTJE 2W0FA 3QUZB 1YYML 3CZJA 5HY9A 5C0AA 5D2LB 1JPGA 1QRNB 1JMZA 3UXFA 3TN0D 3FL7A 4UNVA 1H15B 4OD2B 2AVGA 4V1DD 4XP1L 3HRZB 1MUJB 3LH2L 5E6ID 1MIEL 2FJGA 1HQRA 3MV8E 1T0MA 4MA1B 5IT2L 4J4PC 4U6YB 1B0WA 1JF5A 4FNLL 1S9VB 4XP9L 4LLWA 2B2XH 3X12A 4JDTH 3BUTA 4G9FA 3ZE2F 4MGXA 2R4SH 4O58L 1TCRA 2Y5TB 2HJFA 1DVFC 4M6OL 4X6CB 3L3GB 1RZKL 4F2MB 5MEOA 5LGHH 2PNDA 1CLOL 4YNYA 1HH6B 3EDEA 4F58L 5MEPB 1KCRL 5IQ9B 2GEEA 1D5XB 5HDQL 2YR3A 4LVNC 4JRYE 2IFGA 3EO0B 3NH7H 3RHWF 4PJHE 4XCFH 2Q8AH 1JK8A 1RUQL 5C0RL 4M4RA 2Z0BA 4D9RD 5JOPE 2H2SC 1LO4L 9CGTA 4D9LH 3MV11 4WDIB 3MODH 2DQCH 4PJGE 4YGVB 3VFMA 4P57A 4IIQB 2XZAH 3JZ7A 3RA7L 3VG0L 2YXFA 1T3FA 1T2QH 1MCLA 3RTQC 3TA3D 1D5IL 3DI3B 1P5UA 3T4YB 1DR9A 2FX9L 5D8JL 3FOMB 2Z35B 1TNNA 5I1JL 3HPJB 1A3LH 2H26A 5E4EC 3D0VB 1NC4D 3MLSL 2E6QA 3X3FL 1P4BL 5F6HJ 3UPCA 1BQUA 3MLZH 4NCC1 4E42B 3ZDZE 3QUML 3EDDA 4Z7WA 3GZKA 3MBXH 2CDEA 4NO0D 3D39B 2KZWA 1ULVA 3DSFL 1R6VA 4XCEA 5C09E 4Z0XB 4J3WA 1U8HB 3MREB 2GW5A 5DD3L 2AEQH 4ZUSB 2CDGB 1AI1L 3MRCB 4MA1C 3RWJA 5J8OA 3O8XB 4WI4A 1XF2B 5IROC 2FZ3B 3MRKB 1YEJH 3KPMA 1AHWB 1AIFB 4EDXA 5IMKA 4MLSA 5EBWB 1AGFA 1J0HA 3O6KH 4JFEE 3S35H 3FT4B 5BQ7A 5JXAH 1S9XB 4A6YA 1EGJH 1DQDH 1FRGL 4MAYA 4IRJB 5F8QC 4LLQA 1ODAA 5E1AB 3U7YH 4HC1A 3V9FA 3OTTA 1JHTA 3VA2C 1IC5H 1DANT 1OGAA 3FCTB 4HUNB 1Z3GH 2VSDA 3CCHB 2XNAA 5HHPB 3OGOE 2F53A 4ACPA 4LCCC 3B3IB 5B39A 1V7NH 4ZFOB 1TIUA 3MCLL 1ZWIA 4JE4B 4U1LB 3EYOA 1UXSB 5BOPA 3O11A 3CU7A 1L6ZA 4YHNB 2ZCHL 4MJ5A 1G7JA 3T4AA 4NKMB 5I1AA 2BSED 3HZMA 2DTMH 4JY4B 4OAWB 5CIPH 4MQXC 4UZGA 4U0RC 4YHIA 4HXBL 5FHBH 1FFOA 4RRPA 3BDBA 3WL9B 4K3EL 3RUGE 1ETZB 2VN4A 4F7TA 5FDWB 5BXFA 4W4NA 1OSPL 5DJYB 1T22B 4QNPE 4PJDE 2W0LA 3FFDB 3OF6D 5JO5A 1ZA3B 2Q3ZA 3I75B 4U6XB 2APFA 2W91A 5EUKB 4Z7OE 1C5BL 2RIKA 4X4ZA 1QUNA 5FYKU 4G42A 1CXKA 1FORL 3MACH 3WIIH 3WFEL 4WWID 4XBPA 4ZPVB 1R3LA 3VRJA 1BVKB 5JPMA 3QFJB 2A9ML 2X40A 3PXJA 4C83A 4M5ZL 4NQEA 4XVUD 1BOYA 5I76B 5F1IB 4Q9QH 2D4FA 2CJUL 4OB5H 5D7JB 1P7KA 4PJFB 1CBVL 4G7VL 3O3UN 1ITCA 2LAGB 2UUDK 3KDMB 5KW9L 5J12B 5JNYB 3MRLA 1RU9H 1UWXK 5ID0B 2A6DA 3FQNB 2YD2A 1X9QA 2R2CA 4UQ3A 1ZHBA 5T3XE 3PV6B 4ENEC 4O2CB 3EYSH 3CSBA 3WO3B 3PHOB 5EULV 5CILH 2OR7A 4MHHI 2FRGP 4MSWA 1T1XB 5IFJA 5I17B 1BQHB 1FVEB 2AJSL 4ZPTB 1YYLH 3ZL4L 5INDB 4F33A 2NY2B 3HLAA 3HS0A 4H5SA 1NH6A 3BUYA 4GW4A 2CLZA 5INCB 3H9YA 4FFWC 3IDMB 2DQIH 2H3NA 2Y6SD 1A1NA 3VXUA 3RBSA 5D71L 1N0XH 2VXSL 3AB0B 3KPPA 5MEQB 5HPMA 4GBXB 2WINA 4E41B 4ORGA 4PJ8D 1X6NA 4GG8A 1M71B 1MREH 2FWOA 2CDFA 5E24E 5DHYA 3UTQB 4GOSA 5DFWH 5SX5H 1R5WA 2DL9A 3DIFB 1RUPL 2H45A 2R0LH 4FXGA 1BHGA 1CGTA 1F6AA 3KPTA 3FB6A 5IVXE 3B9AA 1SYSB 1UB6B 1CL7L 1W0VA 3EJZD 3PQYD 3QHFL 3LQMA 4QHKJ 1I1AB 4JZJC 1XGQA 2DMCA 3H9ZA 1AR1C 5AYQA 2P49B 1HDMA 2HKFH 4JHAH 5DK0A 3B9KD 3WNMA 2BY3A 5DJ6A 3QNYA 3SJVA 4NWUL 4IRSB 2X5PA 2J12B 4JO2H 1KTLA 4R7NB 4M48L 2C1PB 3MRJA 4HMCA 4OGXL 4YK4B 5D1QD 1ZLVH 5GS3A 1KCSL 1Y6KR 5GS1A 1T1YA 1BQLH 3M8OH 5FYKH 3OKEB 4EJ1C 1CXLA 3GK8L 5HDLA 5MENB 1U95B 5ISZA 3ZO0A 5JORA 4OF7A 5ENWB 4P46B 3WN5A 4OSUL 3RWEB 3QUXA 4P9ML 3KR3L 2P8LA 3IDYB 1QLEL 3VXNB 3F7VA 4GRLD 5E94B 2XZCH 4H25A 1MCQA 1MCFA 4QRSA 5KSAC 4X8XA 4F7EA 5F96H 4ZOEA 5HYSB 4UIKL 2YWZA 2CXGA 4YWGH 4TOYL 4WI6A 4Y7MA 1TFHA 3UJJL 4QHUB 5IF0B 3ZTJG 2Q87A 3C5ZC 4AH2B 2L4OA 2BXZA 2E7MA 2CXKA 1EFXA 1ZT7A 3LKOB 4Y5XC 4L9LB 4ONHB 1RMFL 3D18A 2XFXA 3ILPB 1FNGB 3I50H 4HS6B 1IGJA 3MBEB 5HHVL 4CADB 1MJ7H 1UM4L 4GG6F 4OZGE 4P4RB 1L7IL 2R2EA 2YD5A 1A3RL 3S5LA 3SDXB 2VYRE 4F57L 3ROLB 3M1BB 4LSRL 2CK0H 3IAGC 4DCQB 1NBYB 5F7HA 1A6TA 1KN4L 4LOUD 4RBPH 5DWUH 5FHAL 1INDL 4OCXH 4FQQA 2RAMA 1LNUA 1CR9H 1OAQH 1I1AC 3V0WH 1U3HD 1AKJD 5IB1A 3MJ6A 3S5LG 5E08H 4ODWB 2XQYG 5ESAB 1CZ8L 2Q86A 1WCBB 3QI9D 2VLRE 2E27H 4LASL 5L2KB 1CL7I 2VH5H 4OFIA 3W11C 2ZCKH 2F19L 4JFHD 2XI9A 3NABH 3FZUC 2QJDA 1U8JB 3KJ4C 1CTOA 3STZB 3DBXA 1GZQA 1EGJA 3BXNB 4RFEA 1AGDB 3VD7A 5FOBB 4JPIB 2D7MA 3LB6C 3MGTB 1UVQA 5F7EL 3QIWA 3TO2A 4CMMB 2JELH 1NDGB 1TMCB 2B5IC 5CEYA 1MY5A 1MQKL 1ZVSB 2EYRB 1H3XA 3H42L 4LBEA 5JW4M 2X44D 3CDFA 3ZYJA 2VJXA 1M6OB 4A2MA 3RNKA 4TRPH 3OB0H 5GIRA 5IG7A 4BFEA 4LNRA 3HAEB 4NIKB 4OLUH 5F7YC 5ALCH 3T8XA 4DKAA 3VWKB 2H1PL 3RPIA 2E5EA 1HI6A 2NY0D 4HDIB 5FUOH 1TVDA 2GFBA 4JQVA 2CK2A 3G04B 3L6FB 1W72B 4JM2C 4HJGB 2KPNA 4JG0L 3LDBB 4GUPB 4ZFOL 4CL7A 1ZMYA 4PYGA 5AAMA 3VFSB 4HF5L 3WUWG 4FQ2H 3GM8A 5CIPA 1J12A 2W9LA 5F7LB 5JXEA 5DRZB 4ZXBD 4PLJC 3CFBA 4Y16B 1I1FB 2HTKD 4PRIE 5HY9B 3JV0A 4WJ5A 3D2UB 3TNNB 5EN2A 4H1LB 3TT3H 5T33H 5DD5H 1GIGL 4BQ8A 4MMZC 2EEAA 4RGNB 2H32B 1KF9B 4KK5D 3KLHC 4NDMA 1J18A 1Q9KA 2D03L 5HI4C 5E9DE 5EORL 1M1SA 4PV8A 4ZNCD 1IEAA 4HXAL 2DLFH 4UBDC 5F6IC 4LLWB 4AM0A 1F00I 3X12B 4HG4J 4G9DA 4OLZH 2BNQA 4G9FB 5K9JL 4PR5A 3LOWA 4JHBA 2VISA 1DEEB 1E27A 3QDGD 3Q0HA 4LAQH 1FLRH 1IKFL 2WAHA 2CGRL 4XNQA 5GQBA 3VFRA 1VKXB 2APWA 2W07A 4MWFB 3GM0A 1QBBA 4KI5F 1SHMA 4YAQA 4JN1H 1HYSC 1LVEA 4X6FB 2YUVA 4OIAA 5JHDE 3NCFB 5JR1H 2LFGA 3VXOA 3MPCA 3C08H 4HIJA 1S7RB 3G08B 4PG2A 4TN9A 2AI0L 3GI9H 1JK8B 5DJXA 1WWAX 4MD5B 3CFCH 1J8HA 1G9MC 2Q6WA 4XXCA 2ICES 3SQOL 5SX4H 2DM2A 1XF5A 4DW2H 2FO1A 5E6YA 2UZIH 4P57B 1YNTA 3U6RA 1T3FB 4EI5C 2VXVH 3CFEB 2FGWH 3H0TA 3P30L 2R0KH 4MNGE 4CN4A 1IZKA 1PX4A 4DN3H 1RZ7L 5E2TL 3VXMB 1H8NA 3ARBA 3E2HC 4PS4H 2IBZX 2H26B 1BFOB 1QKZH 3ARFD 2PTUA 4F7CA 4R0LB 1FH5L 1LP9E 5DFTA 3SKNA 4HKXA 3JWOC 2VO5A 2GT9B 4M1GL 2W0PA 4LSTL 5C0JB 4WU7A 1DFBL 4RGNC 2OL3B 3DVFA 2Y36L 1H8OA 5DMIL 4XPGH 5HGDB 3UTZB 2DJSA 4JFQA 3K2MC 5IMKB 4ZFZB 1AGFB 4L8DA 4R97B 4NYLA 5BQ7B 1JYXA 4ZNEA 2CSPA 2D7NA 4MAYB 1MHHA 4J4PD 1UQSA 1G9NH 3AFLA 2AV1B 5I16B 4JKPL 4FQXB 4N0YL 5CJOL 4KMLB 4UDTB 2JJTA 4O2FB 1Z9LA 1JHTB 2KDGA 5CD3B 5HVFB 1DVFD 1FFQA 5GJSL 5GSVA 2DLHA 5C08B 1IQWL 4WO4C 3U82B 1MH5A 2F53B 3CLEH 5I8EA 1OD7A 2EIBA 1CG9B 5B39B 2DQJL 4G3YH 4YHOH 5FO9A 3V4PL 1GCFA 4OCRL 4JFPA 5KVMC 1IZJA 1YUHB 4H8WL 4ZSOA 1FBIH 2BNUB 3EYOB 4ODHL 3O11B 1M05B 4U7KA 3VDBA 4MJ5B 5DJ8A 1G7JB 3T04D 2HFEB 2HVKA 1YNLH 4BH7A 2H2SD 4S1RL 4ONGH 4QEGA 2NY1C 4JFFB 5DHXB 3RJDA 2GI7A 4IMLA 5GS2H 5E99L 2FHBA 3ULUL 4F7TB 1KTDB 1BLNA 2BNRE 5E2VL 1JV5A 4M62H 3RTQD 1ZTXL 5EUOA 2AXJA 5HJ3A 1MJJB 1R5IB 5ANMA 5JO5B 2P5WD 5EZOL 4OD1L 5J1AA 5SWSE 4DN4H 2E7LA 4NUJA 4G42B 1F58L 5I1GH 4WNQA 3R06A 3RY6A 4XB8A 5FV2A 5BO1H 4XBPB 3VRJB 4NHUB 4WTZG 5DUBA 2UZYB 3TBYA 1XGTA 5KSVA 3HTLX 1KPRB 2JB5L 1DDHB 4C83B 5T1MA 3T08A 4NQEB 4KZDH 3WFDL 3MYZA 4GRWE 1P7KB 4LIQE 4X98B 1J1OL 4OUUB 4GMSL 3N85H 1QO3A 5CZKA 4C56B 4LHQB 5B38B 5IB2A 3WJJC 4ODXB 1XIWA 4NT6A 2A6DB 1VA9A 4WV1C 1BVLA 4YDVA 4M5YH 4NJ9L 5KTEL 4UQ3B 1NANI 1ZHBB 3VI4F 3QH3A 3ULSA 3AS3A 4KHXH 2ORBH 5JW4R 5FUCE 3G5XA 4FABL 2HWZH 5C07E 4NQXA 5IFJB 3ZHKA 1JGLL 4U2ZA 5FIEA 2IC2A 3MNVB 4HH9B 4MNQD 1BGXH 5HDBE 1NGPH 4MA7L 4P9HH 2DQHH 4RAVB 2DAVA 3HS0B 3HLAB 3IDIA 4H5SB 2OK0H 3PDOB 5D72L 3BUYB 5H37H 4OBSA 3HCVA 2YWYA 3IDJA 1A7NH 4APQB 2H3NB 3VXUB 1E4XL 1N59A 1UT9A 5C0AE 1KELL 2WINB 1ZLWK 2WWMC 2E7BA 4OFVA 1SVCP 1UJ3A 3Q48A 4WCYL 5C86A 4PJ5A 1W72L 1WQVT 5DZOA 2FWOB 2CDFB 3GRWL 3H7BA 3AXLA 4JFXB 1MNUH 4HWEL 1R5WB 2L7UA 3E6HA 1AXIB 3NVQA 4N68A 3PV7A 4MQXD 1F6AB 3FB6B 3VFTB 2AS5M 4AT6A 3NN8A 2XXCB 1CK0H 1I9JL 3MX0A 4YEEA 1D5ZB 3SPVA 1FVDB 2ADIA 3UYOD 2NR6C 1HSAB 1XGQB 4K3GA 3SE9H 3ZTNH 3OZ9H 5IBLD 4XPAL 1KXTB 5DK0B 1CWVA 3BRGC 3NACH 2LTQC 3VFUB 3QNYB 4WI3A 4X4MA 1VACB 1ORQA 5I71B 1KTLB 2Y06H 1D9KA 3KVQA 3RWIB 3QEQD 3ES6B 3QYCA 1JGEA 3C5SA 3UAJC 1RFDH 1A8JH 4J1UA 5F88A 4LRIC 4Q9BA 4OIIL 1NC2D 4NWTL 5GS1B 4XRCA 3T09A 3Q3GA 2VSCA 1U41A 3H3BC 4UIMA 2JIXA 3GJFB 5ISZB 5JORB 4XHJC 4WFHD 3WN5B 2XA8H 4TTGA 2P8LB 1JTTA 4L4TB 5CKGA 1NAMB 3KPRD 3F7VB 3PIQA 5EO1A 2NYYC 1GGIH 2VXTL 4QRSB 3BPOC 2QEJA 4HUVB 3WFZA 1OF2A 3OAYH 1KFAH 4JPVL 4M7KL 5GS0L 1HHGA 4OCSH 3MRMB 5KZCD 4YHLH 3BX7C 1ZT7B 3C8HA 4P2RE 1Q1JH 2J88L 3QNXA 3D18B 1WFNA 3O0RL 2XFXB 1F8TH 1IGJB 1RUAH 4EDWL 5IB4A 4Z7WE 5HVGB 2A77H 2R2EB 5E4IA 1JHKL 3IXTA 1CD8A 4NQVA 1YMME 4OI9A 4FFWD 5BZWB 2MKLC 5HHOA 2PO6A 3ROOB 3RVVC 5BZDA 1A6TB 3LKRB 1U92B 2F9BT 2KKQA 1LNUB 3WIFB 5MHSD 4GLRH 5D1ZC 4DTGL 2GJ6B 4ZTPL 1WWWX 5EH1A 2YPVL 3BEWA 3O3DA 5I73B 2Q86B 4WWKD 2FO4A 2YUZA 4ZO6A 2OL3L 2EC9T 2NY6C 2M2DA 3KWWB 4LLUB 1BECA 4P0DA 2DI9A 4NZUL 2FX8H 1AR1D 5FUZL 4KFZC 2NY4B 5FB8B 2XKNA 4YXKL 1NSNH 4JFDD 3BD4A 4UOJA 4HUKB 2Z8VC 4GW1A 4H0HB 2KUTA 1OGAE 4Y5YB 4NZTH 1EFQA 4WW2C 3QIWB 3OAZK 1QRKA 3PWPA 2GY7B 3N1QC 4WHYG 4DGYH 1AR2A 5CEYB 1XGRB 3LKPB 4QKXB 4G8GD 4K94C 1KXQE 4AL8L 3EAKA 2XTJC 4JY6A 1QFUL 2YA1A 5EOCL 4LPYA 4HMDA 4HC1L 4NGHL 4GKZA 4GKSA 3RNKB 1UADC 3JWDH 1MHEA 2D7PA 2YZ1A 3BWAB 4OV5A 5TDNA 1H5BA 3DX7B 5ALBL 1OGTA 4PRHA 3CMOL 2MHAA 2HMIC 5F7FA 1HI6B 4JHWL 2R69H 4CU8A 2GFBB 2ICEA 1U8QA 5JA8B 1H9VA 3RGVC 2YZ8A 2VZTA 4UV7L 5KSAD 3EYUH 3IFNH 4ZFGH 1W8OA 3Q5OA 2Z93A 4O2EB 1EPFA 2EZ0C 1FC2D 3BP5B 5CIPB 3GIVA 1PD6A 5ITBL 4YDLB 3PP3H 4Z7UA 1WISA 4GXUM 3QJFA 3C5ZD 5T1DH 3CFBB 2BXYA 5D2LF 4CUCA 1QSEA 4WJ5B 5EN2B 2DD8H 3HZYA 4G5ZL 3C6LA 3U1SL 2YRLA 4XMPL 4ZAKA 3S9DB 2XN9D 4LEXH 1H8SA 4NDMB 1Q9KB 2NX5A 2ZUYA 2ZUXA 4LPTA 1DSFH 5F9JB 3GMNA 2ESVB 5GRJL 1IEAB 3IGAB 4L3ED 3JV6A 1CGUA 4LFHD 1F4WL 2K3TA 4L4VA 3KYMB 4QYOB 4HGMA 4J8RA 4LSUH 2R8SH 3E0GA 3AAZA 1LK2A 3SGDH 1SM3L 2QQKH 3OXRB 1YEGL 4MQSB 4X6CF 3V5DB 6FABH 4FTVE 1CICC 3IDXH 3UBXI 5D7KD 1D6VH 5ICXB 4O00A 4YAQB 3GHBL 2KBGA 4HCRA 3VGAB 2DJ4A 4BSJA 6CGTA 1U8NB 3W11D 1EAPA 1QNZH 3FZUD 5T3ZD 4LDLB 5IJKC 3VXOB 1IGYA 4HIJB 3TH3T 1RZJC 5D7SL 1MFAH 3DXAB 5IMLB 1KCUH 3LB6D 3EHBD 5ILTL 3DSNA 2Q6WB 1I85A 4H20H 4KQ4L 5TDPA 3U79A 4KDTC 2JCCE 1XF5B 2CLVA 4XXDA 3MLYH 5B21A 4I18B 4MA3A 2CUIA 4KKNA 3H0TB 3B9DA 3DO7A 2ZOLB 1BM3H 1MCCA 1UZ8A 1S7WB 1IGCL 4MA8L 3PWUB 3RWHA 5CUSL 1VGEL 3HI5L 3ARBB 4UT7L 4MQTB 5EO9B 4OJFL 1JRHI 3FN9A 4Y19B 1OP5K 2MQ0A 3LZFL 2EH7H 4OCYH 4HKXB 5MI0C 1P1ZB 4WFEE 4JM2D 3QFDB 3WSQH 3U4BH 2ZG3A 3MRNA 4AIXA 4UT6H 4LVOB 3HN3A 4N1EA 1OM3L 3VFWA 1Z0NA 1HHKA 1AD0A 1VSCA 3NCJL 3SJVE 5EC1A 4PJAB 3G6JB 4UUJA 5GGVH 1X5FA 1NCNA 2W60A 4W6WB 3BP7A 4I2XB 1XZ0A 4RMSA 3MLRL 3DMMC 3SDAC 1RUML 4CN6A 3CVIL 4JJHA 4TVPD 5LBSH 1HXMB 4ZFFA 4KRMB 3MJ8B 3KLHD 4ALAH 4XVTH 3MGAA 4NYLB 5HI4D 3KPQA 3DRTB 2AGJL 2HVJA 4KGLA 5B4MC 1IC4L 2ADFH 3TO4A 1ACYH 2H9GB 1FAIH 5GSRA 4JREB 1UQSB 4X9FA 3W0WB 3PABB 1FNAA 3QG6B 3SGKA 2F8VA 4HLZH 4CVZA 3ARRA 3I3DA 2B2XL 5F9OL 1MSPA 4P2OB 2BY1A 3BZFB 2R4SL 5DT1L 5GSVB 1YEDA 4RIRA 4HUMB 1JNNL 4KU1A 3UYRL 2P42B 4JFPB 2E3VA 3ULVE 4ODSH 1HYSD 1XEDA 1CI5A 1E6JL 1NAML 2WP3T 5EU6A 2VQUA 4Z18A 4NNYA 5ETUB 5DJ8B 4LSDA 5I9QC 4DEPC 4LPCA 4XCFL 2Q8AL 4KK6C 2C3GA 3QULA 3SOBH 3JTSA 3O9WC 4BH7B 3NPSB 2FH8A 2JJWA 1JWSA 4D9LL 2ZNXA 1FZJA 1NFKA 4PPTA 2DQCL 2DQGH 1T66C 5DK3A 2XZAL 4EI5D 1JV5B 2AJYH 3X17A 2X4SA 4NNPL 4X5WA 1EEYB 2V2WA 5J1AB 1IM9D 3BPLC 5HGHB 4D0BA 1A3LL 4S11A 5HI3C 1F3JA 5LXGH 4NUJB 1DQJB 1C16A 3BT2H 2DQDH 2IFFH 1T83A 1X5LA 4PJ9A 3MLZL 4U49A 5KVDL 1DUYA 2EDBA 3HI6H 4LVHB 5HPOA 1XGTB 3CFIC 5T1MB 2VLKD 1MELA 4GAJL 5D93B 5GGSB 4EVNA 5HI5C 4PJFF 1R3HA 3RL2B 2XZQL 5L88H 3QUYC 5IB2B 3VD4A 4NT6B 1MVUA 1YEIL 3TZVA 3T0VA 3GB7B 4YDVB 1M7IB 3GJEA 4FQLH 5FYJU 1RZIA 5JXAL 1EHAA 3O6KL 3S35L 2NXZC 2VZOA 1EGJL 1O7SA 3HE7D 1FYHB 2YXMA 3V8CA 4TSAH 1NEZA 1FZKB 2BHUA 3U7YL 1AGBB 4HK3J 1PEZA 4U1IB 4OF3A 2LU7A 2JK5B 3ISWA 1OP3H 5TQ0H 5H2BA 1IC5L 2B0SH 3EOAA 2Y72A 4WO4D 3HFMH 5BRZA 3IDJB 1K6QH 3TH4T 4YUEH 2WIIA 1V7NL 5CJ5A 1KN2H 1MEXL 1L4IA 3HG1D 3ELAT 1IAOA 3MLVL 1NEZG 2BJMH 5E1HB 5C7XH 4PJ5B 3ILQD 4KRPB 1HILA 3H7BB 1X5GA 2C4XA 3E6HB 3MOQA 2EXYC 3HC4H 1BP3B 2NY1D 1N26A 4S10A 4K23H 4DVRH 5HHQA 1WAAF 1MJUH 1NAKL 3NN8B 4M6NL 2MCPH 4HGWA 5IHBA 2FYYA 3SPVB 2ADIB 4EIZC 1YEHL 3WNPA 3VXRB 5K9QI 1UWEH 1M7DB 3A6BH 4KUZH 3MV9E 2BNQE 3VGHA 5JZ7C 3MNWB 3IDGA 2JF1A 3LPFA 1JE6A 4ELMA 4JQIH 15C8L 2Q76A 1CE6A 4I0PA 2VL5A 5KOVC 1D9KB 1U2CA 5CSZA 4PTTA 5D93C 3C5SB 4MJ6A 1UKSA 3PL6A 4J1UB 3MACL 3LN5A 4P2QA 5TFSH 5K93A 3WIIL 4MDJA 4OLVL 5DJ2A 3R4DA 2EIEA 2V2XB 4PGZA 3P2TA 3INUH 4PUBH 4UIMB 2JIXB 3LKNA 3NCCB 1KIPA 4OB5L 4GAYA 1J8HE 4AJ0A 4YBLC 4NFCA 1G9EA 3D85A 1CFTA 3QIBB 2AK1H 2EDFA 4XWGH 5TPWH 5IW1A 3EYVA 1LILA 3ARDC 1OAXH 1TZHA 4XNMB 4YPGB 2UZXB 1HHGB 3EYSL 3T0EB 1MLBB 2WBJC 1E4WH 3ULUF 3NCMA 4HPOH 3MRFB 3T77B 5KAQF 5EBMA 1EZVX 3Q5YA 1BEYH 5FYJH 1LEKB 5HYQA 3CUPA 2QL1A 3QNXB 5FYLE 2VLME 1CS6A 3T0WA 1IGFH 1YYLL 1JI2A 3I6LD 5IB4B 3AM8A 2OZ4L 5MP6H 3SDXF 3L3OB 3IXTB 4L29B 4MJIB 1P7QA 4LLMB 5I1EH 4NKQB 4NKDB 1XR9A 3VI3F 3TP4A 2MTPA 5KANG 3SKUD 3QAZC 3X3GH 5BZDB 1GPOL 2EDXA 2WWMD 3BGFC 3EDJA 4RX4A 4WHTB 3L3HA 3CFDB 3KYNB 5LQBH 2DICA 5IWLC 4FG6D 3ARYA 1YDPB 2Z31C 3BEWB 1DBKH 3O3DB 4ZNEE 5C6TH 3IKKA 1LO5B 5EIIA 3CU1A 3F12B 3U83A 2NR6D 4LSVL 5EPMA 5IKCA 5FYKE 4KGJA 1CDCA 5FGBC 2IAMA 2IQAB 2FB4H 3SE8H 1VFUA 3DGCR 2HKFL 4JHAL 1MIMH 3QWRA 4GW1B 3A67H 4LHUD 1KJVB 5D7LA 3PWPB 1UH2A 1I8KB 3UAJD 4ZSOE 1CD0A 5DHVB 4QHNA 4GKZB 4GKSB 3M8OL 2VDQL 4M7JH 1QBLL 4ZUWA 4OV5B 3S34H 4QOKD 4KVNH 1BOGB 3RRQA 4XHJD 4NQCD 5BW7A 1JF6A 3NIFE 2MHAB 4XAWH 4CDGC 5B3JE 4CU7A 3CPLB 3VXPA 4P23A 3ARUA 2ICEB 3VRIA 4HLZG 1I9RH 2NYYD 3QQ3A 3MUGB 3T0EC 2XZCL 4HIIB 1GJIA 3CSYA 2QR0A 5EUOE 1FNEA 5F96L 2AABH 2ZG1A 3OG4B 5DURB 3F6IA 5ANME 3VE0B 3QCTL 1R3IH 4YWGL 5IB3B 1UM5H 1YPZB 1EEZA 1VDGA 1U42A 3HE6A 1KLGA 3OV6A 5DD0H 1QSZA 5T1KD 3UO1H 4W4OC 3DUUA 3QJHA 4NBZB 5CZXC 4HIEA 3UTTD 4X0KA 5F9WB 3I50L 5KVGH 3OR6B 3BHBA 5HYJB 3GSRA 4NRZB 3QQNA 3KPSA 1MI5A 2NX5B 3GGWA 3BKJH 3D69A 2PKDA 3LEXA 3GMNB 5L0QC 1UYWH 5IV2B 2CK0L 3KPOA 3WNLA 4Z76A 3GSXA 4FXKA 5DWUL 4DZ8B 1P6FA 1T6VN 4P4KC 2G75A 2PYFA 4Y2DA 1YJDH 5D1ZD 4XPHH 2NLJA 4G6ML 3AREB 1URLA 3T65B 3MOAH 1NCWH 3RDTB 1CGSH 5C0EA 5BS0A 3T3PF 3BGAA 2FEEL 5HVHB 2VZVA 4JFZH 2NY6D 1FAKT 1EAPB 1E0OB 2ZCKL 3NABL 1BD2A 3W9DB 1IGYB 4EBQH 1HOCA 1L0QA 2WZPD 5DEGA 1A9BA 4YFLI 4LARH 2BDNH 2OMNA 3BDXA 3REVB 2FD6H 4XP5L 1IGTA 2G2RB 1S7QA 1HCFX 2CLVB 1HWHB 1RIUH 4JM4H 1CE1H 2XTJD 4MA3B 3QHTC 1MCHA 1ORSB 2XIDA 1S8DA 1PG7H 3DO7B 4TRPL 1WBYB 4PJ5E 1UZ8B 2OBGA 3RWHB 4NP4L 2DQEH 4OLUL 3P9MB 1N7MH 5ALCL 4N9GA 4Y4HA 2HMID 3QWQB 1E6OH 4B0MM 5FUOL 4RMTA 4LFHG 5F1KC 3MV8D 1KB9K 4NN6B 1AY1H 2IADA 4M1DH 2IQ9L 2EZ0D 1EH9A 3S36X 5EU7E 3ZKND 1OT1A 4FQ2L 1C5DA 3L3KB 3EUUA 1SEQL 4OZHE 2WQRA 4KXZI 4X4ME 4HS3B 3J8F7 2W60B 4ZD3H 3BP7B 4JEGB 4CGTA 4Z7VE 4KY1L 3MUJA 4NCDA 3TT3L 4X7CC 5T33L 2EDWA 5JQ6H 1FYTA 3MRGA 4O02H 4ZFFB 3KXFE 4JRYD 5D1XB 2AQ1A 2VDMH 3KPQB 2HVJB 1W0WA 3DETD 5C0FA 1OOAA 3FO2B 2GTZA 8FABB 3UTSA 5I75C 1FDLL 4LU5L 4HULB 4BM7A 5JOPD 3CFJA 5EFIB 4OLZL 4JDVA 1P9MA 2NY5C 1EBPA 4DKEH 3ALPA 4PGCB 5GGUA 4LAQL 2BK8A 1YEDB 1OLLA 1N5YH 4M61B 1CICD 2J5LB 1MQ8A 2BMKA 1HKLH 1CFQA 4JB9L 2ID5A 1P2CA 2YD8A 4JN1L 1QBMH 2CPCA 2VIRA 5SX5K 3I6GB 3SDCA 3TCLB 4IS6A 1JNJA 4HWZA 3C08L 1IC7L 4XVSH 4KHTH 1NBQA 1MCKA 3JTSB 2ITCA 3CFCL 1G7HA 2XY2A 1RIVH 1JWSB 4PLOB 1CLZH 4EUPH 2QSVA 2ZP0T 1LE5A 5DLML 3ARTA 3G5YA 5HHOE 1AD9A 3VMPA 2UZIL 1CGWA 2Y7QB 1T7ZA 2F74A 1AXSA 2VXVL 5C09D 3SCMA 5KJRH 1OT2A 3VFGL 5DMKA 2R0KL 1RVFH 1ZLSH 5E6IA 3LS5H 4QTHA 2V2WB 4DN3L 4K8RL 1ZLVK 4F3FA 4NC1E 1F3JB 3WBDA 3EO9H 2J8UA 4UB0L 2CR6A 3GSNB 5E8DH 5E2WH 3T2PA 3S36L 4PJ9B 4AK1A 5FUCC 1VEPA 5CLTA 4Y4FA 2MCG1 4IRZH 2H6PA 2FR4A 2X89D 2X4UB 3LD8B 3GKZA 5M94B 4OGYH 1G7MA 1OARH 2VR5A 1FJ1B 1T7XA 1ZA6A 3DMMD 5HGAB 4Y4KB 4RFNC 3SDAD 5JW5A 1MVUB 3DX8A 1F4XH 4K7PL 1I7ZA 4V2CB 5FAAA 3B2VH 1K8IA 3QO1A 1IAII 2QQLH 1RZIB 3W39A 5F1SA 1QTYT 4ERSL 5B4MD 4R2GB 4PRHE 1LDSA 1PKQA 4NM4H 5J4MA 2FSEA 2A83B 4X8JA 3ZHLA 1M7XA 3P9LA 3PDDA 5H94A 4YPJA 3UDWA 3VG9B 2A74A 5L6YH 3GMLA 1PG7W 3TA3A 1Q9LA 4OKVB 1WBXB 4O9HH 5CZVH 4U2YA 2MPAH 2UYLA 5TE4H 3CVHB 4R26L 2OSLA 1NMBH 2H8PA 3F7QA 1DQTA 5F72S 2HT2C 5BRZB 3CLEL 3CX5K 4Z7UE 1UWXH 4KUCF 4F15B 2WIIB 4YHMH 1QSEE 2F54B 2I24N 2ZPKH 3IF1A 1ZS8A 2M26A 1KYOJ 3TNMA 3QBTB 4IEFB 5HYIA 4KK6D 1HILB 2VAJA 32C2A 1QFWI 1F90H 3O9WD 1YNLL 4XP1H 3C2AL 3P0VL 3LH2H 1GAFL 4ONGL 3FN0H 1G6VK 1IQDB 4GG6A 1T66D 1JF1A 2X70B 2DBJA 3TIDB 5J89A 5IT2H 3QXWA 1WBZA 5I1IH 5J1SC 1IAKB 2ZUQC 5D9SA 4M62L 1I8LA 4L4VE 1EDQA 4WY7L 4FNLH 5KS9B 4M00A 3ARGA 4XP9H 5SWZA 1EVUA 2W59A 4ELMB 4ODTL 4PJ7A 1I8IB 2CD0A 4O58H 4I0PB 4X6DA 1CFVL 2YA0A 3ZE0F 2VL5B 5HI3D 2IANA 3MV7A 3KS0H 5CSZB 4PTTB 5T3XD 4MJ6B 1Z2KA 1FNFA 2Q7NA 4P2QB 1XGPA 1CLOH 4MDJB 4F58H 1KCRH 3ARXA 4KZDL 4Y4KC 4RQQA 3LKNB 5HI5D 2GQHA 3BIBX 1GC1C 2UWEA 2HH0H 3OKKB 2P47B 2BVPA 5C0RH 1CT8A 3N85L 3D85B 2DRUA 1OLZA 1CFTB 3W5MA 1PLGL 4DZBB 1NLDH 3RWDB 1A7OH 3DVNA 1CXEA 2HJKA 2JB6A 4WI8A 4CMHB 4BFGA 4XBGA 5EBGA 1D5IH 2NXZD 4BQCA 4WHCA 3F7PC 5KBNC 1AE6L 1ZHNB 2I9LA 2CUMA 2FX9H 3TBSA 1WIUA 5EBMB 2HWZL 4Z7NE 3WXVH 1JNLL 2OR8A 3CUPB 3WS3A 2GHWB 4F15C 1CQYA 4QRRE 3X3FH 1BGXL 1P4BH 1NGPL 5DYOB 2BVQB 3K1KC 4RZCB 2DQHL 4HWBH 2NZ9D 3PXHA 2OK0L 1F3DH 4FHBD 2ZUTA 2OP4L 4D3CL 1CDBA 3DSFH 2O5ZL 2X41A 2ARJB 3L9RA 3L1OH 5DD3H 2APBA 3GMQB 4M43L 5E5MA 3Q1SL 3IU3A 1T03H 1AI1H 4FP8L 3FOLB 3LSOA 2HFGL 4H26B 1T7YA 4ZUTA 3V5KA 1SEBB 2EXYD 3UJTL 3MLTA 1CFSA 4IM8A 5EIIB 1PDKA 1CK0L 4GXUN 4I13B 1XGUA 3V7AG 1WZKA 5EPMB 5IKCB 3D3VE 2V9RA 4XNYL 1EO8L 2IAMB 4KKAC 1MAML 2Q7YA 5C0IB 3OZ9L 4UDUA 5ECJE 5JZ7D 3MRQA 1RIHL 1V7ML 2CIIB 3NACL 1EHNA 5IMOB 2DJUA 5HHXL 2Y06L 5D7LB 2UY6A 3EIFA 1I3RB 3HZVB 5IR1B 4MB5A 1F6FB 4ZO7A 3DUSA 5KSBA 4I77L 4QHNB 4X4XB 5EU6E 3MCLH 5DFVC 3IJSB 2FX7H 2X7LA 3N1PC 2H41A 4ZQKB 1V3KA 2YPLB 4P99A 4PD4J 5LKNA 1G7QA 1LGVA 2I60L 2XA8L 5CHNB 4F7MA 4ELKA 3VRIB 5FKPA 5C0CA 1CFBA 3BP4A 1GGIL 4HXBH 3CSYB 3GSVB 2QR0B 1CD1A 4K3EH 4FQPA 1ONQA 3BP6B 4M8QA 3F7YA 3ARDD 4Y1AA 1KFAL 2CKNA 1EEZB 2EYTB 2WBJD 4OCSL 2VLJB 3BYYA 2XWBA 5DSCA 4X9GA 2ZKHL 2W9DL 3CNKA 1JUFB 4BSWB 3O41A 1C5BH 3QB7C 3QJHB 2VE6B 3PWNA 1E28A 3WKML 1EJOH 1F6LL 2ZOKA 4X0KB 1FORH 1F8TL 4IRJD 4F7PA 2VLRD 1RUAL 1IEHA 3B9KA 5C0BA 2A77L 3RY5A 4YHPA 4LHUG 3GGWB 2A9MH 3TWCH 3VFVA 4M5ZH 1Q9WA 4BFBD 3H9SB 1JJUA 3CD4A 3C60B 4HD9A 1U3YA 4GKOA 2GSIA 4XCCL 1MFCL 4JRXB 4Z76B 3GSNL 3L5WA 3D6GA 5H8DA 2R0WL 2D4DA 4XCYA 3CSPA 5KW9H 5EU4A 5GJTH 2BC4A 1DUZB 4FS0A 4Y2DB 4ZODA 4ZG1A 4OM0H 2V2TA 3KYKL 1TTFA 1MRCH 1IKNC 2WP3O 1CLCA 2ZSVA 2Z31D 1DN2A 4JHZA 2YK1H 4HKZA 5BS0B 3FO0L 1T5WB 3OJ2C 3QUKB 1BD2B 4XNZC 1UZ6F 2HLAB 3O6ML 3NGBB 5TE7H 1NSNL 3VH8A 1NGWB 4LCYA 5DEGB 2AJSH 4QRTA 3ZL4H 3UPRB 2C4FT 3IETB 2AKRA 2A73A 2IF7A 2OYPA 3V4VL 5IVZB 5D5MA 4NZTL 1OD9A 2AK4A 1J88A 2VQTA 4J6RL 5D71H 1U8MB 2EE3A 4KV5F 3B8YA 3VFPA 1MCWM 4PRID 3BQUB 1B0RB 1OQOA 1WZLA 4K3HA 4BQBA 1P4LB 3RWGA 3VH8G 1YEEL 4OI8A 2FJFA 5D7IE 4RCAA 5J3HD 5C0NC 4LVEA 3CVHL 1ZV5A 3CAFA 4S1QL 4TULH 1HEZB 1B88A 2R69L 1OAYH 5E9DD 5DQJB 1OAUL 3QO0B 4O5LH 1CL7H 1FFNA 4L5FL 1I1CA 3IFNL 3SDDA 2IADB 2XG5A 2DLTA 3QUXC 3RZCC 3MRRB 2B20A 2ZNWA 3BH9B 1CGYA 2FECI 4PJAF 3G6JF 1VPOH 5JOEA 5T1DL 1NCDH 4NWUH 1MWAB 4HIHA 4RGMC 3LPGA 4M48H 3IB4A 5E8EB 2I9TA 4KH2A 4OKDA 3PUCA 4P5TA 4BSVA 1CIDA 3QEUA 1WC7B 3ULVC 1JMXA 4K71B 4LEXL 4QXGL 5K9KA 1KCSH 1MLCA 5L8LB 1GOGA 1W0WB 5JHDD 2VAAA 3IAPA 3CK0H 1NPUA 4LCWA 4G80B 2YKLL 3HUJE 1R3JA 3FFCB 3UTSB 2RBLA 2ARJQ 4OSUH 3KR3H 5H35B 5BVJA 4JDVB 4YO0A 2EO1A 4LSUL 4NKOA 1SJHA 5GGUB 2QQKL 3O45A 2F8OA 3L3JA 1AO7B 3HNVH 3PGDB 5EZLA 1A1OB 3BEVB 4L8SC 3HMWH 2UVEA 4UIKH 4KK8C 4QT5B 1A02N 2BMKB 1D6VL 4LCUB 3LRSA 3UJJH 2OJZH 4JPWH 1QNZL 2VIRB 3AY4A 4N8VA 1EHLL 2ADGA 5A43C 1RMFH 3EFFA 3IFOB 1KCUL 4FQHA 5HD8D 5HHVH 1CDGA 4ZXBA 2ERJB 4H20L 4M7ZB 4U7MA 1WVZA 1U93A 4S2SB 1L7IH 1ADQH 4P5MA 1UKQA 4N5EC 3UYPA 3TN0B 2V5YA 3MLYL 5E0QA 1HH9B 1RULH 1YY8B 2B1HL 4LSRH 4V1DB 5J11B 4HWBA 4JQXC 1IJ9A 4X6BA 5FK9A 3OXSA 1FC1A 3CXDH 4JY5L 5E6IB 3RQ3A 5FHAH 4PLNC 1INDH 4U1JA 2J2ZA 3TV3H 4F3FB 1S78C 2J8UB 5C70A 5DEFB 3LCYA 4HKBA 3VXSA 3QA3A 1HHJB 5HSFA 4CJ1A 1K2DB 3QDGA 2F19H 4YBQC 5E5RB 1TVBA 2P43B 4JQVC 4ZYKA 1JWUA 2CLRB 2H6PB 2FR4B 4MCZA 4YHKH 1UG9A 5GGVL 1WF5A 2X6MA 5ABDE 1G7MB 1QEWA 1ZA6B 5FKAA 3RPKA 3P4MA 4NFBA 1CXFA 4HV8A 5MHSE 1MQKH 1I7ZB 2QHLA 1K8IB 3QO1B 4UAOC 5F6HI 4Z7QF 3KYOA 2ADFL 3HPLA 1ACYL 2D7TH 3D1MC 3FO1B 1FGNH 1PKQB 2C3VA 3WS6C 2H1PH 3P9LB 5H94B 5KVEH 3GMLB 4IMKA 3TA3B 1Q9LB 4JFDE 1FQ9C 4WFGD 1TZIA 2H8PB 4PJEB 2V6HA 3QISA 4HF5H 3WXWH 2FIKA 4WEMB 4OFYA 1NC4B 1KC5L 2RJMA 1K3ZA 4G8GE 5I2IA 3PGCA 2ZJSL 2P4AB 3P11H 3TNMB 2KL6A 3BJLA 5BCAA 3LV3B 5DGRA 3FO9A 5DD1L 1GIGH 2QADB 3WEXB 3KPSE 4I0CC 1MI5E 3F7RA 1TQBB 2Z9TA 3WNNA 5EORH 2QKIA 4NM8H 4PG2C 3V6ZA 2DQGL 1KTRL 2SEBB 3G6AA 1WBZB 5K59F 2GCYA 4HXAH 5DK2B 2ENSA 4I4WB 2YD1A 3V4UH 1BZ9B 2OI9C 4RAUA 4ODUA 4PJ7B 5E8OA 1I1RA 3T1WA 1FL3A 2IANB 5AZ2L 3MR9A 2CGRH 4P3DA 4JG1H 1J1PH 1XGPB 3NMEA 2IFFL 2XRAH 3VJ6A 3GMMB 3LEYH 1YEFH 2IG2L 2YUWA 5C07D 1U8KA 3NCEB 1VHPA 2NTFA 3TPKA 4Q7DA 1J10A 4RQQB 4E0RA 2UWEB 2AI0H 3LQAC 3QDHA 2ADJB 5L88L 1SBSL 3E6FA 2UVFA 3BGMA 1XCQA 3ZKXB 5I15H 1MFEL 3DWTA 5FDYA 3PP3K 3MXWL 1DLFH 5C0AD 1GGCL 4OGAC 2FBOJ 4LKCA 2FGZA 3QPXL 4RAHA 1IBGL 1AQKH 5E2TH 3HMXL 3WS3B 1JN6A 5D6DA 4HMEA 1KCKA 2AV7A 3BZDA 3U46A 5JLZA 3TM6A 5ICYB 1S7XA 2X05A 2P5WA 4JZNA 2I5YL 2B0SL 4AENA 4HIXL 3F5WA 3EYFB 2QLVB 2HT2D 3HFML 2JJTC 1QYGL 4M1GH 5F1OB 4MDIB 4YUEL 2FH6A 4DK3A 2E9BA 3L9RB 5FGRA 5TDOA 5DMIH 1RD6A 1DTUA 1KV3A 3IU3B 5C7XL 1O0VA 1E4JA 1QRNA 1FYTE 3VMOA 1GHFH 3DYPA 4OD2A 4YXLL 2BOCB 3T3MF 3V5KB 4LMQE 1MVFA 3HRZA 3HC4L 3MLTB 4WI2A 1CFSB 4K23L 4JR9L 3O6FC 1MJUL 4DQOH 4XNXH 3DHMA 4JAMB 2MCPL 5D2NE 4LSPL 4Y88A 3RAJL 1XGUB 4QHLB 4U6YA