2CUMA

The solution structure of the 33rd fibronectin type iii domain of human tenascin-x
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
105
structure length
105
Chain Sequence
GSSGSSGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Tenascin-X
total genus 6
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cumA00
3VWKD 1LO0H 5DRNB 3PE9A 3MNVB 1T89C 1T3FB 1A1MB 3DI2B 4NKOA 3VG0L 1Q1JL 1H5BB 1NMAH 5IB4B 5D2LA 2H45A 4HBCL 1L7IH 2CR6A 4DJMA 2VB5A 3K4AA 2OTWB 5BOPA 3I50L 3LQZA 2ZSVA 5SWSA 3AC0A 4ZO9A 1I3RB 4NRYA 1P9MA 2WBWB 3KPRD 5BVJB 4HJJL 4OBRA 5JXEA 3R1GL 5EBLB 1DUZA 3IU4L 3P9LA 2Z35A 2A6DB 2NY1C 2XTJB 3MMEA 3RAJH 3O6FA 4YXHL 2QADC 4KAQL 4NFDA 5T1LA 2E9IA 4HWZA 1GZQB 4PJAF 4S0SD 3MLYH 1BJ1H 1OW0C 3OHXA 1KJ3L 3VFOB 1OHQA 4PPTA 5ICXB 4D0CB 3KDMA 3MRCB 3QEUA 2GFBA 4YK4B 5ICXA 4BUGA 5I0ZA 3EYUH 2R1WA 3FT4A 2IGFL 4GQPH 3NIGF 4LIQE 4P2OD 1CICA 1CT8B 3ARFC 1WBXA 4Q58C 4Y2OA 5BS0A 1JTTA 5DK3A 2ED7A 4WHYH 2AJZB 2ZUQC 2NXYC 4YHPA 1JVKA 4PJ5E 3RA7H 3EZJB 3O6FB 3FKUS 3ROLA 2P42B 4BQ8A 4U1SB 3RJQB 4RISH 3RI5K 3VGDA 4ZYKA 3U9UB 3F6LA 4OZ4B 5I1AB 5E0QA 1KPVB 1JPGB 1ES0B 4ONGL 1T20A 4ELKA 4HGKC 3QNZB 5ID1B 3ZDYF 1GH7A 3DGGA 3R1GH 5GGTH 1B0RA 5I9QB 4NNYA 4PBXA 1ZLSH 3RQ3A 2JIXD 4O51B 5A2LH 5EIIA 1JMZA 5D93C 2WIIB 1WBZB 5TPWL 4ODUA 3B8YA 5TDOA 4TSBL 1I9JH 3DV6B 1TFHA 4O2FA 2C3XA 5ALBH 2I9TB 4XAKD 3OG4B 2FWOA 1OGAA 1II4E 4YAQB 1CVSC 2F53E 4MDIA 2RFXA 4PBVC 4BZYA 1AHWA 3CPLA 3ISWA 1A2YB 3B9KC 2KBGA 1N6QH 4G7YL 4AEIL 1B2WH 5E95B 4P5MA 4JGUA 2YSSB 5B38A 1CD9B 1OTSD 4DGVL 3O8XB 5D1XA 5GGQH 3ARFB 1FE8L 1BFOB 1MJ7H 4MNQE 3IU3A 1BD2B 2L7JA 3AXLA 2J5LB 3V79C 1UZ8B 1FH5H 2IBZY 5DD1L 4LLUB 2IPKB 3BP7B 2YMXL 1BFSA 1AY1L 1X5JA 1I1AA 1FFOA 3MRJA 3DX8B 2B4CH 3RL1A 2FDBP 2C3WA 2GYSA 4F9PC 3DLQR 1QSEE 3NOIA 2Q6WA 2PKDA 4AEFA 4D9RE 5I1GH 2OR9L 1U8MA 3H3PH 2EH7L 1W0VB 2J8UB 1KCVH 1YJDH 4UUJB 5C6TL 1RMFH 2XRAH 4M1DH 4OGAC 1F6FB 4KK9D 4KROC 1YMHB 4DKDC 3RWIB 2DWDB 1U93A 4QCIB 4QTIH 4BK5A 1DQJB 5DXWA 1WK0A 4ZOCA 1RVFH 2AJUH 5IROC 1LO2L 4I0PC 5FO7A 4L4TA 3S36L 2BP3A 4IOFD 3PDOA 8FABA 2CRMA 3FB6B 4JREB 4YNYB 1VFAB 4H1LA 3FHAA 2WUCL 2OI9C 1F6AA 3PG2A 1JYNA 3EOBB 4O4YH 2JCCF 1TJGH 2P46B 2DL2A 4RFEA 1IGIH 3S6CA 1JHLL 4DGIH 2X2YA 4GBXA 4UOW1 5DZNA 4MCYB 1X4YA 3FQNB 4UT7H 5IVOA 2Q8AL 1BBDL 3OKOA 1QUNA 4ODWB 5ADOL 4Q9BA 3JXAA 5KG9B 4S1RL 5DD6B 1N8ZA 5I0DA 5IJKC 1F90L 1SBSH 1FN4B 5EBWB 2WMPA 2F54A 4PJFF 5IMLA 4OD1L 2Q3AA 4JZNA 2P8PA 1AP2A 4WUUA 3TA3A 4JFPB 3OXSA 1LVEA 2DTSA 5DJAB 5HGBA 3W0WB 1MOEA 4X7SL 3WUWG 2CKBH 1KACB 4IS6A 1CR9H 1MJ8L 5EPMA 3A6CL 3DYOA 1FNSH 1PZ5A 2IBGA 3BKCL 4Y5YB 4HKBA 2EIZA 5E5UB 3IYLW 3MLSH 3IDUA 3NIFE 3A6BL 2X4UA 4X5WA 2AJSL 1JZ4A 4GMTL 1U8JB 4ZQKA 1ZT1B 5DFVC 4FZ8H 5F6HJ 4JREC 4ODWA 5BRZD 1XF1A 5FDYA 4PJ5D 4GH7B 2LQRA 1AIFA 1LO5A 3QQ9D 1MUJA 4XMKL 2NY6C 4XP1L 1FLRL 2UVEA 4LMQE 2XIDA 2VLMD 1XIWA 2X9WA 1I7UB 3EOAB 5EUOB 3I3DA 3GK8L 4XNQB 1FVEA 4PG2A 5HHPB 4JVWA 4NZDA 2EEAA 3MRNA 1I8KA 1CGXA 2CLRA 3EYOA 4XNYH 3KPOB 3EYFB 4P59H 1BAFL 4YQXH 4GXUN 4M5ZH 3RWIA 3VRIA 4LARH 1GC1L 1GRWA 3FFCE 5A2JH 1YEIH 5FYLE 5IW3A 5JHDA 4YE4L 2NY6D 4W6XB 4XPAH 5I1DA 4RMTA 3B9KA 5ILTH 4C59B 1TMCB 5EBGA 1R3KB 3ARYA 4HPYL 3UTPD 3I6LD 4QNPE 3V5HA 4PJBA 3QPXL 4P23D 4BFIA 4PJEB 2KH2B 2JCCB 5SWQA 4GAJH 1IGJA 2Y07L 4U3CA 1GGBL 4YHOL 2W9LA 2GK0B 1A6UH 5CZXD 5C0AE 5TDNB 2CMRH 1QNZH 1SYVA 3UTQB 3QDJD 1FFPA 1RZFL 4PR5A 2QADD 3LN4A 3QWQB 3QXDB 1DQLL 2I24N 5IR1A 4OQTA 4I8DA 1H8OA 1NUGA 1EGJL 1D6VL 4DW2L 3A67L 2VXVH 1B6UA 3ARZA 5CEZD 3EJZD 35C8H 3LB6D 3WJLA 5IW6B 2L7UA 3MYJA 4M02A 4U1GC 4AL8L 3ZYZA 5BXFB 2HFEA 1Q9OB 4P2OB 2FJGB 4K71C 1ND0B 3X3FL 4A2LA 1JUFB 3W39B 4F2MA 3EFFB 1HHKB 5DTFB 3VFSB 1YNLH 1PG7W 4IDJH 1FYTD 2ZNWA 1HSBB 5ETUA 2VISB 5JIPA 3ARBD 2VR9A 4KY1H 4OCNC 3IF1B 3PWLA 4BFEA 4HC1L 3OAYK 5CZKA 3IFOA 4PB0L 5ID0B 3TIEB 1CE6A 4L8DA 4RCAA 5J57B 1BF8A 4M1GH 2Q8BL 3RL1B 1G7JB 2EDTA 3GI8L 1EXUA 2BNRD 2VYRE 5FOBB 4XMLH 4OIIH 3PGFL 4CAGA 4HUNB 3DMMB 4GBXC 4YXKH 3TESA 4FQIL 3DHMA 2Y1VA 3GSQA 4BZ2H 5K9KA 1YEDB 4IRJB 4KKLD 4TRPH 5IKCB 5L6YL 2FJGA 3C87A 4V1DD 5ALCH 2DWDA 4HWBH 3A0OA 5KVGL 4M3JA 4EXPX 3EHBC 5D7JD 5F7EL 4KQ4L 5J13B 5DJDA 4HLZG 2AK1H 1DN0A 2P5EE 4MB5A 4QHLB 1JRHL 5JPNA 2Q7NA 1UEMA 4P5TB 5DMYA 5TQ0H 2QBWA 4QHLA 2ADIB 5D1QC 1WIOA 5D2NE 3TA3C 2EECA 4WTZA 3QT2A 4OZIB 4W6WB 3TIDB 2EKSB 2VLJA 4ELMF 4YLQT 4MNQB 4G43B 4HWZB 5B39G 4ZNEE 5I19H 1BD2E 3UBXI 4F9LA 3ILPB 2JKXA 1BQLL 4BSWB 5GS0D 1S8DA 3X14A 4FQXD 4P2RE 1WZKA 2X7LB 4M93C 5T1MA 3RU8L 1A64A 4RX4A 1NL0L 3G9AB 1T7ZA 4KTDL 4BFBD 4H8WH 1EH9A 3HC3L 2J8UE 3L1OH 1U8OB 3RBSA 3QXAB 1IAIH 3GKWL 4JEGB 3LOWA 4MD4B 4D0BA 2VOTA 1P7QA 2CO6B 2QQLL 4LLDB 4QOKE 5JOFA 1N6VA 5E94B 1KJMB 3H3KA 4UTAL 3QBTB 4PJIE 4NN6C 3O9WD 3VFGH 5DRNA 1TZIA 5GXBB 4HQQH 4JFEB 5E8NB 1H3UA 1CTOA 3U9UA 1HNFA 1J0ZA 3JV6A 3W2DL 1LO3L 3ME0A 2B1AH 3MV8E 3VFWA 5GS2D 1BQUA 3HC0A 4H88L 3HE6D 4I2XE 4UQ3A 3RVWD 8CGTA 5E08L 1CI5A 3TGXA 3VXPB 2H2PC 1UZ6E 3IDXL 2V5SA 1RPQA 4WFHD 4HULB 2DLGA 3FAXA 3FB5A 5F70A 5HHOE 4N0YL 3FONA 6FABL 5IBUB 1CE6B 3OKLB 4Y8DC 3U0TB 4HH9A 3WHXA 5HBBA 1L7TL 4Z77B 3RI5F 4GUPA 3C5ZD 4PGCB 4NKMB 1MAMH 4IOIA 5J4MA 3W0WA 4MJ2A 1H3GA 3TBWB 3LKPA 5IVXE 1NQBA 1V7ML 4JFOB 5F93C 2GK2A 3BKMH 4HG4K 2P24B 5IB2B 4NQCE 1G6RB 4FQJH 5IKCA 5DR5L 4H0IA 2VH5H 2QSCH 2F8VA 3RIFK 4R90L 4DQOL 5E1AB 3QCTH 4KTEL 2EIEA 3V4VH 5CEXA 4HKJA 4TULL 4Z95H 3N85H 1J8HE 5DJAA 5AWNL 5DK2B 5DURD 1I3RA 4W4NA 1WC7A 5SWQB 2HLFC 3ARGC 3OJDB 1KJ2L 3QUZD 1Q9WA 5HYSG 2EIDA 3MBEA 3TIEA 4EVNA 1S78D 3B9KB 2E9JA 3PHOA 4D9LL 1VEPA 1H9VA 1MRCH 3IDMA 3U1SL 2EYRA 5DD0L 4P57A 1A3QA 2EXWC 4PR5B 2CXGA 5MEOA 5D96B 4YR6B 5CBAA 4YX2H 1EEQA 4JFFE 5E99L 1F4YL 3RVXD 2EH8L 3BISA 4PUBL 1UVQA 5TDPA 1I7UA 4NQDD 5D2NC 3MYZA 3TYFA 1U93B 1PKQE 3ARRA 5E4EB 5GGUB 5KANI 3G6JA 4L8CA 4CADB 3OKEA 1ZVSA 2GSGB 1BWWA 2XPGB 1BJ8A 2HH0L 1KJMA 1CD8A 4MA8H 4EBQL 4G6KH 1I3VA 5E00B 4Y2DB 4YBQC 4NP4H 1W72L 4KJPD 4G9FE 3BKJH 4EXKA 4XXCC 4MYWB 4E42A 1OAQL 4BQCA 3NZ8B 4RGND 5INDB 4NNPL 4KI5D 4FMKA 4K8RH 2WM0A 4ZAKD 4W68A 4LHJB 2X44D 2NY3D 1BVLB 3UTQA 2X1QA 2X41A 1J88A 2JCCE 4X0KB 5LXGH 4OI7A 5EO1A 1S9WB 1CBVL 4S1SH 5E70A 2Y36H 1FJ1B 4ZUSA 3LKQB 5C2BH 1U8OA 1IC4H 5GGUA 3C60D 3U0PB 4P46D 1BD2D 1B0GA 1B88A 3EYSL 4XVUC 3RNQB 3FTGB 4DVBA 2Y25A 3RZCD 4U1NA 4G6AD 5DC4B 1O7SA 12E8H 3LS4L 5BRZA 4YHZH 3EOTH 4RRPA 2Z4QA 3TT3H 3MLXH 5D70H 2X1OA 3SJVA 1W8OA 2D0GA 2NY2C 2ILLA 4TPRL 3QFJA 4JFED 3AREB 2YEZB 2A0LD 4OCRH 2JB6A 1J1PH 4L3EE 4MQXD 3AGVA 4JM2B 3D39A 5GGRY 5GJTL 1H8NA 2A9NH 5M95B 3N0PB 1K4DB 3BGAA 4D9QD 4Q2ZA 2K3TA 3ZYOA 3SOBH 3PV6B 1CDHA 1LEKA 5TF0A 1B0GB 3FOMB 1UQSB 5HVGB 1EVUA 5IK3A 3R8QA 5JR1H 3CXHJ 1OLZA 4P9ML 2CRYA 2ZUTA 5KW9H 1KB5H 2FO1A 3EUUA 4M43L 4XXDB 5E1HB 4WV1A 3BP5B 2P5ED 5MEOB 4HMEA 3PP3K 2F19H 43CAB 1DANT 4Y4KA 1MPAH 2H3NA 4YIQA 3KPQA 3KPRA 4KROD 4X4MA 4H20L 1KB5B 1EAPB 5C0RH 5KJRH 3KYMA 3VI4F 2GSGA 4QRTA 2F58L 3OJDA 5GHWH 5IK3B 4IMKA 1QLRA 1S9XB 3IFNH 4NQCD 3RVUC 5DURB 3R0MA 4XCCL 2FEDC 5J1SC 3FO9B 3QNXA 4GRLD 4CU6A 5C71A 4FG6D 2VLKD 5FGBC 1CTNA 3U0WL 3H0TA 2R56L 1HH9A 3MJ8B 4EQ2A 1G7LB 3NFPA 3GGWB 1FG9C 4LKCB 3RVTC 4U05A 2HFEB 3WE6A 5E8NA 5BJTA 5T3XE 5LKNA 1XGTA 5HHOD 4IRZL 2W0FB 4N8CH 5E6IA 3GIVA 3O81A 2GJ6D 5JDSA 1OL0A 3MV7B 1BQSA 3MNZA 3ZDZF 2BFVL 3FQNA 1U8MB 1S7XB 5J0BA 1DQMH 4GKSA 3QXDA 4U33A 3MC0A 3V4UL 1KULA 5F96L 3C6SB 3IXAB 4L29A 3C5SB 1DUYB 5FYJE 3SJVB 1G9ML 1HZHL 3U79A 3G9VA 3O3UN 1U3HC 3I6GB 4JHAL 5BRZB 2O5XL 1HILB 2VQ1B 3NCMA 4O2FB 3B3IB 2D0FA 1Z9OA 5CP7A 2VLJD 5EOCH 2JE8A 5FK9A 2VN7A 4HIIA 1KLFA 2B8OT 2O5ZH 3EYOB 4GSDH 1GYAA 4LSTH 1PX3A 4K7FA 4FFVD 1BVZA 3L5XL 3O8XA 3NA9H 5C0EB 2ADGA 2BY3A 2Z8VC 3GSXA 1T7YA 5IT2H 5GGRB 4QXGL 1OPGL 3SE4C 3KPLA 4L9DA 3LEVH 3VD9A 1LDPL 3GO1L 5D7LD 3HUJE 1MRDH 3TBSB 4PJBF 1X5FA 5IUSA 5IVNA 1MCLA 1Q8MA 4DN4H 3U30B 2AGJL 5HYJD 1B0WA 2FH6A 1FG2B 4G6JL 3TJEH 1QPXA 2BFVH 3QP3A 3O2WH 4KMTL 3HRPA 4RAVA 4M9OA 2Z93B 3BZDA 5CSGA 3PHSA 2X4QB 2XKNA 3QXWA 4MX7A 5DQJB 4R97B 3IJHA 5CLWA 4FTVB 4FQCH 1BOGB 4CVXA 5FDWB 1UKQA 5EULV 1OY3B 1PEWA 3D48R 4XVJL 4F7EA 4HLZH 4ELMB 4R2GB 3SE8L 2VITB 3WO4B 4M7LH 3PL6B 4JVUA 3RUGF 1J05B 3PWPD 3IFNL 2NXZB 3SN6N 3WL9B 5E8OB 1Q9OA 1FVCB 1MLBA 3LQAL 2BHUA 3BQUC 5L7XL 3WMSA 1IAIM 3M45A 1UXSA 1DQQB 4KROB 3VXRD 1XF5B 2D03L 4RWHA 1MPAL 3LKSA 1NMCC 3DRTA 2F19L 4O00A 5HVWA 2BVPB 4I0PD 1OQXA 4OF7A 4E0RB 1KB5L 1MREL 1VENA 2AEPH 3EDFA 3MROA 1SEQL 1J5OH 1HE7A 1M7DA 5EZOH 3T2NH 2EEDA 3WS6C 1W0YT 3GGWA 2B2XL 3K8LA 5C0GA 3DBXB 3WIIL 3ROLB 2E7HA 2GTZB 3PDOB 1QOKA 5JA8B 4JR9H 1OARL 1BHGA 1H8SA 4KMLB 1I1AC 1XF2A 1SM3L 4PJEA 1DQTA 1TZIB 5EC1B 5J6GB 1IM9A 3MACH 3NMEA 1ACYH 4RQQA 3NABH 5IB3B 1MJJA 4EZMA 4JO2H 4HC1A 3CFBA 3MA9H 5HGDB 1A6VL 1RIUL 2E6QA 1LK3H 3KPSD 1ZS8B 3RY5A 1YC7A 4QRSA 3SDDD 1P4IH 5KSVA 4OCWH 4TTDC 5DEFA 3MLXL 1WEJL 3BWAA 4N5ED 4CJ0A 1CFSB 3DSFL 3SY0A 3CLFH 3EO0B 4LGPB 4LBEB 4LAQL 5F9AC 3EYSH 2PF6A 4NQUA 2VE6B 3MMEB 1IKNA 2A6DA 3FQRA 1FHGA 5F71A 3I75A 3HMXL 3QQNA 3NIFF 2Y36L 1ZEAL 2ITDB 3MRMB 4NRYB 1GXEA 4DK3A 2R29H 4Q2ZB 5CSZB 4NWTH 3LRHA 1S7RA 4PJAE 2C3VB 43C9A 1MFCL 4F3FA 2EDXA 3QQ4B 3BDYH 3SDCC 1Z6JT 1RIHL 2XKNB 4MJ4A 4UILH 4JM2A 4ZUVB 2GAZA 2X09A 4ODXB 4OZFG 4P46A 1OAQH 3BO8A 4CW1A 5C6WH 4YHLL 4Q6IA 5LGJA 4MNQD 3OR6B 3ZKND 5D9SB 4OF8A 2XXCB 3CUPB 1MJUH 1P5VA 4M6NL 4ZNCD 2DN7A 5DUBA 5HGDA 2ICEB 2WWMC 3H0TB 5C0IB 4KRPC 5JPNB 3C5JB 4K3GA 1Q0XH 3IJYA 1F3DH 2R0LL 4GG8B 1S3KL 3MRRA 3O4LB 5TE6L 1TTUA 4XNZB 1M7IA 1IGJB 2EH8H 1G7PB 4PJBB 4LIQH 1IKFL 1FO0H 3L3IA 5I76A 3L5HA 2YS4A 2HMID 1I3UA 2R69H 4QLRA 4PJ5B 2WBJB 2XY2A 2M2DA 3KPRB 1M7DB 2R8SH 5F89B 4XB7A 1KLUB 1CK0L 2CPCA 3QDJE 2IBBA 1JN6B 2BRQA 3BRDA 4J23A 5KG9A 3AROA 3O41A 4JZJA 3C60B 4JY4A 5DJYA 4YXLL 5CUSL 2AI0L 5EO0B 3I6GA 2X4SB 4LCWE 4HT1L 4D0DB 4KRNA 4O9HH 4X99B 3IAQA 2NLJB 3MLUL 1IM9B 4X6DE 1IM3B 15C8H 4C4KO 5BXFA 1HXMB 2CUMA 2V2TA 4HCRH 1V3JA 2VDML 4NZTL 4BJLA 4DQOH 4N0FA 3W11D 4N8VB 1MQ8A 1INQA 2GUOB 2ERJC 1AO7E 1PBYA 4HBQA 4PRHB 3F7VA 2OP4H 2Z8SA 1INDL 1DR9A 2ZPKL 2FHFA 3F7VB 3TT1L 5DQDL 2FATH 3CSGA 3WNNA 4ZOAA 1IC5L 3D18B 3IXTB 3L6FA 3MLVL 4NO5A 1R5WB 4K2UL 3IKCB 3NGBB 5CEYA 4OSUL 4EDWL 5B8CA 3PXHA 3S37L 5I1CL 4LRNH 2XZZA 3IDXH 1C5BH 3SDXB 1YNKL 1FG2A 4G80A 2EEBA 3GSNL 3S35H 5L88L 4FFZH 2YRPA 3WYRA 4XX1G 4NO0D 1JL8A 3ZKQD 1JGLL 1AP2B 1YEGL 3P4OA 4G42A 3MREA 2HMIC 4TSAL 4X99A 3DXAB 5JXAL 1I1CA 3HFML 2YD4A 5D71H 4KK6C 4U0QB 4X5XA 5FUCC 4OLUL 1JHKL 1IRAY 3IDYC 1AFVH 1JNNL 4KK5D 5FO7B 2WINB 2VDLL 4AIOA 1JPTL 5SWSB 3BRGC 2EDKA 4POUB 3EYFA 5A16B 4DFIA 4WCYL 4ZO8A 4M7KH 1ERNA 3FO1A 3C5ZB 4OT1L 5D72H 3VXSA 3O45B 2J8UA 3L1OL 4UUJA 1WITA 4Z7UB 4JY5H 2LV4A 3LD8C 2HLAB 2PW2A 3FMGL 5F7NC 1EFQA 3HPJB 5F3BB 3NACL 1FLTX 3OX8B 3REWA 3RU8H 2UZIL 3K7UA 1M7IB 4DN3L 4MXWL 1YMMD 1A1OB 1P2CA 4H25A 3TBSA 3CSPA 5DZLA 3TNNA 3SCMC 5F1NB 1SJHB 2D31A 3ARWA 3I6KA 3IFPB 4PJFE 3QIWB 4QXTB 1IMHC 4JRXD 3MJ7B 3QHZL 3KLHD 1FDLL 3UJJH 2VNCA 5FV2A 2QQNL 3RFZC 1BFOA 2VIRB 4QHKJ 1HHHB 5A2IH 4JFDE 4RFOH 1EHXA 4WTZG 2A0LC 5KS9F 2YPVH 4MD4A 3WFEH 4YDJA 2Q86A 4K9EH 2IPUG 5C7XH 4HIIB 4OGZA 1RUAL 5I73B 4BZ2L 1R3HB 4IRSB 3BSZL 1TJIH 4ESKA 2VZVA 3BZ4A 1DBKH 3QZWB 3BIBX 2VLRD 3Q2CA 2NTFA 2DQGH 4X0KA 2XQYG 4ELME 3BYTA 3MX0A 4LKXA 1KIRA 4LSDA 5TF1L 2VDKH 5KVDH 4GS7C 3B2UC 3QI9B 3K3QA 3HI6H 3ULUH 2DM7A 3UTSA 3MZTA 1A9BB 5EOTA 1FGVL 2WW8A 4PJCB 2XA3A 4FXLA 2RR3A 5E6ZA 1U3JA 3UO1H 3H9ZA 4JO4L 4QRRB 3LSOB 4JRWA 4PIRF 2ESVE 1RV6X 2FX8L 5I1AA 1C5CH 4JFHD 4NUGL 3UTPE 3ZE2E 4TVPE 4M8VA 3GSUA 3C8KA 1CZ8H 3FRUA 3KWWB 4U2ZA 4Q6YA 1SVCP 1XR8A 3DARA 1OGAE 3QFDB 3X3FH 5F7DB 1F11B 4M3KB 1KUMA 5C08D 5EBLA 1XR8B 5KAQF 4L4TB 2FD6H 4PRPD 2H9GA 3S88L 3NH7L 4MA1B 1ITCA 3KYKH 2DB8A 1J18A 4M6OH 3A67H 1FGNH 1KIQA 2N7AA 5EUOE 2J2ZA 4R2GD 3STLA 4K3HA 4D0CA 1FORL 2H26B 2IFFL 4XCEA 4Y4KB 3LV3A 2H6PB 2N1KA 1M71B 3ULUF 3ZO0A 3DX8A 1QNZL 3VU2A 1CL7H 2ADJB 5FUZL 1N26A 1OAKH 3HAEG 3LDBC 1AJ7H 3L3IB 4O5LL 4J4PC 5DWUL 2Y07H 2XI9A 5IF0B 2D7MA 4NQSB 3M17A 1E27A 1QSVA 4RMWA 1OTTD 4PRBA 5FYKE 1XGPA 4JM4L 1F3JB 1FFNA 3O11B 1TDQA 4JN1L 1QHPA 4XPGH 4HFUH 4X8JA 3IFLH 4LF3B 3MCKB 1B6DA 4G6FB 5SWZB 5DJDB 5EA0H 1JWSB 3GMQA 3QG6B 2DM3A 3PP4H 1KPUA 1IJ9A 1QD0A 1MI5A 1T0PB 4E5XA 1D9KB 2DD8L 5B3JF 2XKSA 5I66B 1A7OH 1PGRB 5GRJH 3RNQA 3MPCA 5EUOA 4XNMB 3U0PA 4LPYA 1K6QH 2R0KH 3TO4A 3BP4A 3GMRA 1BX2A 3F5WB 5HGHA 4YAQA 2AJXL 2FWOB 3AS3A 3OBAA 4JKLA 4GMTH 4M4PA 2D9QB 5IFJB 1RJLB 2ICWB 3SKOB 5L2KB 1MQKH 3W9EA 3PP3H 3KPSE 5IQ7L 2VMFA 3G6DH 1A6ZA 1CFNA 2XA8L 1U95B 3H7BA 3TF7C 5I1LA 1HSBA 5EUKA 4ZXBC 4HG4J 3OXRA 3G6AB 2WUBL 3SHSA 3P9MB 3MRHA 3QDJB 3UJTH 2P5WB 2DQUL 1NBZB 4YFLF 1JUFA 4NRXA 4HUWA 3Q5OA 4ELKB 5CMAA 1CICD 4NN7C 5HDBE 4GFTB 4KHTL 1J0YA 3DVNB 5D7KD 4LASL 1IBGL 4N0CC 1YEJH 3KPPB 1XGYL 3GSOA 4N68A 3HAEA 1XMWA 2BDNL 4JQVC 2DQCL 4LPCA 3E6FB 3V7AE 2M1KA 4N0UE 1S7TB 4OB5L 3BZFB 3KPTA 4RZCA 2R39A 1IC1A 4Y16D 3O4LD 4PJCF 5L8LB 2IEPA 4K3EH 5J9PA 4GW1B 4HKBB 1A7QL 1QP1A 5D8JH 1TJGL 2VXQL 1X6NA 1C1EH 2ZKHH 3GSNB 2MNUA 3PNWB 4LDLB 2DYPA 4M6ML 3RIAF 4RAUA 3OZ9L 4OIAA 5IJKA 1MHEB 3UAJC 1X5XA 3AU1A 1C7SA 4OZIE 4HUWB 2VLME 2QQKL 4FQHA 4OFPA 3QEQB 3IFOB 3IVKA 3H7LA 2X4RA 1KC5L 2P5WA 5SX5K 2QHRL 1NFKA 4H0HB 1TITA 5FCUH 4PRDA 3JV5A 5EU4A 4JO4H 1CFTA 4M1DL 1U3ZA 3RBGA 5EZJA 1PSKL 4HIXH 5DHYB 3VJ6A 4FMFA 2FBJL 4OD2A 3C08H 5I76B 2JK5B 3B5HA 1B90A 4E41B 3FO2B 5CGTA 5ESVB 4G8GA 3HZMA 4B5EA 5DJCA 4ODVH 1U91A 4S1QH 4P2QA 4PJHB 4Q0XL 3ZE0E 1UA6H 5DRXA 5DJ6A 1JTOA 4XPTL 4YNYA 1EO8H 4LEXH 3P4LA 3ET9F 2R9HC 3BPNC 4Z7QE 4XXCA 4MD5A 5GSVA 5D5MB 3THMH 4YEFA 4TVPL 4WW2B 2VWEE 1MCWM 1BF2A 1UJ3B 3WFEL 4Z7WA 2O93L 2R1YA 4S11A 1QBBA 5IB1A 3MRKB 5TGBA 5A43C 3RWDB 1Z0NA 4R7NB 4C83A 2V17L 2K7PA 5D2NA 1BM3L 4M7LT 5SX4I 2QQNH 3HE7A 1NFIA 4DGVH 3ARFA 2CRZA 1GGCH 1MCOH 3B6SB 3EJJX 2UVFA 4TQEL 1DN0B 4R0LC 1I85A 4ZUUB 5FHBL 2EYSB 1TPXB 1N6QL 1NGWB 5DJ2A 1R24B 4BH7A 5CEZE 2L4OA 3K1KC 4Y7MA 5MP6H 4JZNB 1CGUA 4HKZA 4PRPA 3THML 3ULUC 5KTEH 3UYRH 4JFYA 3VA2C 2I9TA 4Y4KC 4ZSOE 4HGMA 2CXKA 3OF6A 3O4OB 1XAUA 3ZHLA 1F13A 4FABL 1JGEB 4O2EA 3OKKA 2VUOA 4ZPTA 4XNUL 5EZIH 4QRRE 4M7KL 4Y5VB 4AQOA 2J3SA 3VFUB 4QYOB 1J10A 5IB3A 4FQLL 2EDFA 5JO5B 2X89A 2PETA 4PJ7A 2BMKB 1DEEB 4NZRH 4OFKA 1OLLA 4PYHA 5F8RC 5E8PB 3QXUA 1R5IB 1DVFB 1ZHKB 3CVHA 4KJWC 5TDPB 3BPCA 4RBPK 4U31A 4HD9A 1S78C 4TSAH 3CDFA 2FJHB 3HZYB 3N50A 4J3SA 3S35L 4DK6A 3GSNH 5L88H 4EIGB 3KXFA 3DUUA 5IVZB 2Y5TB 3ZKMC 4JFFB 2IGFH 3CFJA 4OSUH 4EDWH 3OZ9H 2HJFA 4JANB 1CXIA 1NMBL 2HG5B 3BH8A 4HUMB 1R0AL 1B0RB 2A73B 1EAPA 2KPNA 3JWOC 1QFWH 3O2DH 3MRCA 5FB8B 2JTDA 2CR3A 1RZGB 1M71A 3SGJC 1MI5D 5DK2A 2BC4A 3LN4B 4TNVK 4YHNA 1Y0LA 4JY6A 4Y4HC 3C5ZC 1F3DJ 2B4CC 5TJWK 1OM3H 5KS9B 2ADFH 7FABL 4OGXH 1MCBA 4OB5H 4ISVB 4L4JA 4JPVL 5FHAH 2DQCH 2IJ0C 4PYGA 4U0RC 1JNLH 4JJ5A 3WUWA 4WUUD 2R2HB 1YEJL 5CJQH 5ADPH 2CIIB 2YRZA 4JDZA 4LASH 1L7IL 4LCWA 1FSKC 4EUPH 2AI0H 3I02B 4YXLH 2OTWA 1QFUH 1LO0L 2GT9B 3QDHA 2OZ4L 3B83A 5IR1B 3UJTL 4I0PA 2CDFA 2ESVD 2WUBH 2A6JB 4QRPB 4OLVL 4U1LA 4LFHG 1G0YR 3GM8A 2IF7A 3I6KB 1A6TA 4U3HA 5EU6B 4NJAL 1MQKL 3D3VE 4LIQL 3SPVB 5IB5A 2DQDH 4Z0XA 3JWDL 1A7NH 3OAUL 4O2EB 1OQOA 1OSZB 5TE4H 5KSBB 3PUCA 3T4AA 4HHAA 4FRWA 5TE6H 3SQBA 1S9YB 4KDTA 3U7YH 1HCVA 3U4AA 2VDOH 4QGTA 1F97A 4M6NH 1QBLH 4CDHA 1NSNL 1H5BC 4FQ2L 4P2CG 4N8VG 1BQHG 1YYMH 2BCKA 5C0AD 1MAKA 2OQJA 2W0LA 2GJ6E 3OV6A 1NCBH 3EGSB 3IDYB 3U6RA 4FQQA 1RZKH 4JN2B 4UILL 5L2KD 3V5DB 4NSKA 5DJXB 4OV6F 1DBJL 2YN3A 3S4SG 5EORL 2BVEA 3FZUD 2YK1H 4OF0A 1IAOA 3RDTB 4FQXC 4ORGB 3VD3A 4KJYB 2RCSL 1GAFL 3G5YA 3S98A 3JSSA 3LMJH 2LU7A 2GY5A 2Y06H 4KKAC 4GG6E 1MUJB 3LIZH 4LAQH 1I7RB 4JG1H 3D85B 1MH5B 3DSFH 3OSKA 4U6VH 2IC2A 4LOUD 4OUUB 3QEUB 2H32A 4HXAL 4PB9L 5DWUH 1PFCA 5CBAB 5JDSB 2M8XA 1Y18A 1WWAX 4HH8A 1P7HL 1PAMA 1P4BH 2B1HL 1RIUH 4AM0B 1KOAA 1R3JA 5E2VL 1FPTH 1R3IL 2FBOJ 4KRPB 4XTRD 3H8NA 3T8XA 1WCQA 3QIWC 1A2YA 4Y4HA 1G7LA 4HS3B 3OKDB 1BEYH 2CUIA 5EU6D 2PO6D 1J8KA 4WFGE 1A7PL 3ABZA 4JR9L 4HZAA 2HT2C 1MLCB 4KI5C 4OCMC 5JHDD 4OM0L 5AAWA 4YPGA 3S88H 4NNYB 1I9EA 2DWEB 3BT2H 1MREH 3B9EA 3QEHB 1ADQL 2CSPA 2C4FT 3C09C 4HJGA 4J6RL 3JVGC 1N8ZB 1VACB 4WI7A 3OGOE 4NUGH 4QF1B 1C5CL 1YMHA 4E41E 4PGCA 5I6XB 2I25N 3IKCA 3ARDC 4XP6L 4MDJB 3S7GA 5JXED 2I5YH 2DLFL 2MPAH 4KZEL 4JHWL 5LCVL 2Q6WB 1MHPL 4G7VL 4LCUA 2HN7A 3HI6L 3MJ9L 1I9IH 3MYJB 3FFCA 5KVDL 5TF1H 4Y5YC 3U48A 5D7IA 1HSAA 1UJTA 2I60L 4KI1A 2EKJA 4N8VA 5IQ9A 1T0NB 3NAAL 4JLRA 3SGKC 4LLUA 1RZJH 4WI8A 4WNQB 3GFUA 3VXOB 4NQVA 3GI9L 4Y8AA 4M5YH 3DX6A 2PTUA 5HGGS 3C8HA 1R5IA 2KQNA 4GAGH 1QFHA 5DT1H 5F3HB 4H5SA 1GZQA 4Z7NF 3V7MA 2GAZB 1X5HA 4CW1B 2ZG1A 5C7XL 1XIWC 4K9EL 2FNBA 3MLRL 5D7JB 1A6AA 2Z31A 1U3HB 4HWEH 1T1ZA 3HNSL 3O0RL 1DJSA 3T0ED 1T1WA 4KV5F 4PP2A 3MRMA 1FDLH 1OD9A 1NFDB 2OTPA 3SKOA 4WGVB 2ENYA 5GISL 4WU5A 5BVPH 5IMMB 1UB5A 5IOPA 1ORSB 3Q1SH 4NO2B 3QISA 3ZE1F 2OCFD 3LEVL 3P73A 2BVOA 2A83A 3CU1A 3MUY1 4GXUM 5GS2H 4EKXA 2XQBH 2ICCA 1OWRM 1LP9F 5F21B 1FYTB 5TE7L 3AAZA 2HA1A 5GS1B 5C6PB 3PQYD 5IMKB 3CXDH 1KEGH 4GSDL 2PYFB 3GIZL 1QYGL 2O5ZL 4NC1C 1DBAH 1YEEH 4UI2A 3QWOA 1PLGH 5T3XH 2ZUSA 3FQUB 4X9BA 1ZWIA 1JPGA 2DQFA 1FVDB 1U8HB 1F58L 5E2JA 3QG6A 3RVTD 5T3ZH 2MTPA 5LG1A 1ZLWH 3DX6B 1XGUB 2O5XH 3QZWG 1VPOH 4NJ9L 4U7SA 2C7UB 4NHCL 3U7WH 3FT2B 1AFVL 3DBXA 3QUXA 5DRXB 4LCYB 3HG1B 4QXUH 5K9QG 2YXMA 1O7VA 3NFSL 1JGLH 1ZE3C 1YPZE 1KLGB 3F7RA 3S9DB 4E9LA 4RMVA 1CD0A 4FFZL 4QGYA 1NC4A 1WV7T 2QLVB 1ZGLB 3PWPB 3JWOL 1YNKH 1NGXA 1Z0MA 3WFCH 1REIA 3CU7A 3TN0D 4JQXA 4EQ3A 5EPMB 5LQBH 3UJIL 1EJOL 1S7QB 2FATL 5ACZB 3G5ZB 1XZ0A 3RP1A 3DIFB 5GRWA 5F1IB 1INDH 3P30L 2OP4L 4UNVA 1NGQH 3EO9L 4O02H 5J56B 4MJIB 4NQDE 4F9PA 1HSAB 3F58H 1EK3A 3MUGA 5KS9E 2LVEA 1NMCB 3UDWC 5EC2B 3RGVA 1JK8A 3T04D 4BSJA 3X17A 1AGEB 1T7XA 3BEVA 2C4XA 4PJGE 3L95A 2IBZX 4AENB 4NZUL 3MLUH 3HCVA 1EO7A 4IOFC 1UXWA 5I8OL 3AY4C 4MVBD 4JFZH 1UJ3C 2VC2L 4PJAB 3WHXB 5A3ID 5CUSH 3O3EA 1D5ZA 5KN5A 1XGRB 5E5RB 5KN5B 5DC0A 3ULVD 2PN5A 5JNYA 1U8IA 3LPGA 4LHUD 4DAGL 3TBYB 4P9MH 2JIXB 5ISZA 4ZS6C 3KYNB 2RB8A 2Z35B 1U8LA 3MR9A 5A1AA 4WFFD 4UV7L 3KYOB 3TYGL 1BP3B 2JF1A 2SEBB 3VGBA 1JF1B 1ULVA 1IKFH 1VDGA 3RGVB 3MGAA 5CEZL 1WAAE 3MRQA 1S7VA 3IDJA 3WFDL 3RDTA 1J05A 5DVMA 3K0WA 1S3KH 3KR3H 5JOFB 2FH8A 3IJSB 1BLNB 5I1DB 4M7ZB 1PY9A 3TFKD 4MZ3A 2P8MB 3LHPH 4WY7H 5LGKA 4M7JH 4OI8A 1Q0YL 2FB4L 3K2MC 3NIDF 5SV3A 5B4MC 2VSCA 2VDPL 2X4OA 2Z0BA 2YUZA 4U6HB 2AK4B 5EOCJ 4DVRL 1KJVB 3LS4H 1HHJB 3TO4D 3PJSA 4J3XA 3GSVB 1EX0A 1CGWA 1YMME 2C1PA 4XNQA 3EJYD 3MA7A 3SGKA 3BX7C 4NC1E 4LNRB 4OZHA 1LP9A 1SJEB 5EFIB 5EB9A 2NY4B 5I8CB 1YEFL 1JYVA 2DF3A 4WO4D 1BIHA 5FV1L 3FJTA 4GKSB 5EFIA 4NCC1 3RZWA 4F37K 2W59A 3HMXH 5FAAA 1C16B 2Z31C 3VD5A 4JDVB 2A6IB 1JE6A 4HIJB 3ALWA 4N90D 3BD4A 2OMBA 1T66C 4MQ7A 2OR7A 3GMNA 1WEJH 4DVRH 1OB1A 2ADGB 3L7FB 1E0OB 3DX7A 4JHZA 3GSRA 1RZ7L 3REVA 3CZJA 1H0DA 4FXGA 5D7LB 3TBVB 4U7KA 3WHE1 2D4DA 4PJIF 2Y9RT 3NABL 3P4MB 4W4OC 1AQDA 2V2WB 5D1ZC 3V0VB 5TDOB 5D7SL 1CXEA 5D7JC 1OARH 2CDEA 4IMLB 4NC0B 4N1EA 5DFTA 4ZFGH 4I9WD 1FN4A 3TYGH 5EU6A 4PJFA 2OBGA 4HDIB 4OZFB 3DXAE 1A14H 1NCWL 4W6YB 3RPIB 1JPFA 1T1YA 4G80B 4MD0B 5IG7B 1C5DA 3VXNB 5GS0L 4LVOC 1ROWA 3D5OF 5FEBA 3SDAA 1G7MA 3AUVA 2FO4A 2GJ6A 2PXYD 4PG9A 5HYSA 3KG5A 1X5AA 3V5KB 4NM4H 3C2SA 2DLHA 4XI5C 4Z18A 4GRWF 5I8OH 2IADA 5I17A 3P77B 1MCPH 3BN3B 1IFHH 3DO3A 1JK8B 1JI2A 4QOKB 4Z95L 5FGRA 3CDCA 4AMKH 5J11C 2ATKA 1F02I 2IMNA 2FLBT 3FOMA 5DRWA 3QCTL 5E2WH 2AXJA 3VXOA 2HVJA 2NY4D 3OGCA 2GUOA 4NDMA 4LDOB 2DS4A 3VRLE 1HCFX 3WDIA 3UPAA 3N1QC 3NGBC 4KMQA 5JDJA 1U8QB 1NPUA 3G5YB 4XVJH 3P30H 3UTZA 4JHBA 3O9WC 5BZDB 3FT3A 4YHIB 4PY7B 4PJFB 4OFIA 4MNHA 4HWNA 1W0VA 5BMFH 4ACPA 4ZFZB 4DZ8A 4XVSH 1ACZA 3WFCL 3RWHA 1CLZH 3D2UD 2AERT 3JWOH 1TQCC 1N0LA 4G6JH 3BUTA 4I2XA 1CS6A 2AGJH 3QA3B 4X4XA 5HY9B 2B1AL 4PD4J 25C8L 3CMOL 2NTFB 4K9EC 4CMMB 5HYJA 1TCRA 1XGUA 4LPWA 1KN4H 5CHNB 3T0EC 5DSCB 4Z8FL 5JHLH 4UTAH 2J8OA 4DGYH 2Z8RA 1JV5A 5T3ZL 5IT2L 3TNMB 4LSUH 3X13B 1FYTE 4PJIA 1E4KC 3G5VA 4QRRD 1NFIB 5HDQH 3GKWH 4EUPG 5MI0C 2E7BA 4F7MA 1YEEL 4MZ2A 5BZDA 3DURA 3O8XD 1GCFA 2NY4C 2HFFB 1G6VK 5TE7H 1BQLH 2OS7A 4JFQA 3HG1E 4KRLB 1CGSL 4M4RA 1L6ZA 1ODAA 1EEZB 4POZC 3W5MA 1H15B 2X9YA 1F6LL 4WTXA 1MF2H 2OX5A 3FB8A 4L4TE 3WLBB 3JWNC 5F96H 3M8OH 5IEHA 5IF0A 2IADB 2Z8WC 3AB0B 3HE7D 3HNSH 4Y5YA 4HWEL 3GHEH 4D8PA 1WUNT 3VXME 3O3BB 3VH8G 4KDVA 2R1XB 4HGWA 2VXUL 1JV5B 2XWBB 3CX5K 5F44A 1WC7B 2WBJC 4R2GC 4N8CL 5C0DA 2EDNA 1IGCL 1OT2A 4GAGL 2ZCLH 5DDHA 1YY8A 1A6PA 1A0QL 4M5YL 4YDLC 5B39A 2DQHL 2YD7A 3GI8H 1QQDA 2I60H 3DO7A 3U46A 4RIRB 5FYJH 1K8IB 1NKRA 5C0CE 4E41A 4GRLC 1JZ3A 1Q94B 2F58H 4G7VH 1EVTC 3D25B 4XC3L 4PD4K 2EZ0C 1JGVH 1HXYB 3KDMB 5IFHL 1FZMA 5HDOA 5DHXB 2VZ1A 4H20H 5D1ZA 3HUJF 1YNLL 3D0LA 3SDDA 4KVNH 1R5VA 3BPLB 3AM8C 3QUZA 4J6RH 1ONQA 5AZEH 1MFEL 4FQHB 1C16A 1CDGA 5EU3A 4AYFA 3JV4B 1OAYL 2VR4A 3BT2L 5CIPB 3D9AH 2EO9A 4JDZB 3G5ZA 4ONFL 5T3ZE 4EDXA 2EC9T 4JRYA 1INEH 5T1KA 3TO2A 1A7PH 5B22A 4N0UA 3WNLA 2NMSA 3E3QC 1KJVA 3HZVB 1EUTA 1GC1C 2VZSA 2A9NL 4IDLA 1VCAA 4ODBD 4X6BB 1EPFA 1TPXC 4MAYC 1LWRA 1I3GH 3QIUD 3KPSB 5I75B 3MV8D 4GUPB 5SWZD 5IBLC 4YHOH 5IW1A 1F4AA 4U4BA 1NGXB 5D70L 3MBED 3TO4B 3VH8A 3FONB 2BOCA 3DNKA 1I8IA 4OGAD 4WFHE 4NKIL 4G8EB 1S9YA 3CK0L 3T3MF 3DETC 4HPYH 4NRZA 4XMPH 1GOFA 1ZWIB 2Y06L 3TJHC 3IU3B 4G6AC 5CP3H 3GMMA 4XPAL 1MRFL 3HE7C 4ODHH 5C2BL 3ZSTA 5C3TA 1FAKT 5IJVB 1LDSA 2F5BL 5GRXG 5D1XB 1CE1L 3CFCL 3GB7B 4HK0A 2D2OA 1SHMA 4JO3H 1CIDA 2HFFA 5CBEA 3L3DB 2Y6SC 5AUMB 3OR6A 3UBXG 4Y1AA 4I0PB 1JGUH 4CBPA 4NNPH 4Z7UA 3IDNA 3HCVB 4QRUB 5DGRA 5DHYA 3VJ6B 1UB6A 1NSNH 1CDYA 3RZCC 5JW3L 1IAKB 4WFGD 2EYTA 1TVBB 2AV7B 5GZOC 5JOPD 3T4AB 5C08E 5EU7E 2R2CA 4QRPD 1IAKA 4P4KC 4XH2B 1D5MA 3TVMB 2VXSL 2A1WH 1FAIL 4H26B 4PUBH 5HYQA 4XWOC 4UDUB 2BK8A 3QDMB 3W82A 1A7NL 1F4YH 2G75B 1T2JA 1R5VB 3DV4B 4K55A 3MV11 5LAXB 2BVYA 3A6BH 3DGCR 4WJ5B 2OL3A 1OAZH 3O3DA 1WFTA 5ICZB 3MRIB 3HPLA 2GKIA 4FQXB 5MERB 4F2MB 3FQTA 4L3ED 2ZZUT 1BLNA 4ALAH 2D3VA 2V7HB 2DI9A 1ZK9A 3MRKA 3V52H 4OZFH 1QFUL 4EDXB 2WLYA 3BPOB 3ECBB 3DETD 4UT9H 4XRCB 5C0JA 1NLBH 4G3YL 1OTUD 4RZCB 4XCFL 5CKGA 1CWVA 1A4JB 4WW2A 2XN9D 4JB9L 4F8TA 3T65A 3PWUB 5ADPL 3OTTA 4DUXA 1NAKH 3E6FA 1VFBA 4XCYB 5EBMB 2R1WB 1SBSL 1U8NA 3TLRA 1KBGH 4ZTPH 1DP0A 4Q9QL 2YBRB 3ZLQC 2CKBA 4KJQD 3DI3B 3DRQA 1IZJA 1VACA 3A6OA 7FABH 4FQJL 3S35X 1CD1A 4EJ1C 5ADOH 4QRTB 2ZG2A 4ZS7L 1JIBA 4QRRA 4G8GB 4IIQA 4UT7L 2G75A 2J88L 1QEWB 5LWYL 5INCA 2D9CA 1WWBX 1JHLH 1NC2A 4DGIL 1FFQA 4JY4B 1CGVA 2NZIA 4PJ7E 2PYFA 4U1HB 4F7TB 1QFWL 1IEHA 4JPIA 5MENB 3MRIA 4IJ3B 1UWGL 2HTLC 2P5EA 3BGMA 5LAXA 4IM8A 3UC0H 2H9GB 5IV2B 3BZEA 2VJXA 2ZJSL 4P3CH 1SYSB 1G7HA 3D2UB 5JLZA 3L3HB 4NQEE 3BEWA 4EI5A 2X4RB 3W39A 2AJ3B 3LKNA 3REVB 1ND0A 1X5ZA 3KLDA 5I1IL 2Z31D 5DEGA 2NYYC 4HS6B 3DMMD 1PYWB 1GGTA 5GRZA 5C0DB 4KI5F 1UGNA 3L3DA 2BMKA 1J1OH 5D6CA 1T1WB 3P2TA 3P4MA 1OP3H 4X9FA 5H2BA 5T3XD 2NY5H 1E6JH 4XVUD 4Y89A 3C60C 5HTSA 3X3GH 4D9QE 2FR4B 3D3VD 2Y4SA 4YH6A 1IGMH 3WNOA 4I48B 3AS2A 5EZIL 5F1SA 3DVIA 2BHYA 4XNUH 3F8UB 3IFPA 5HPOA 4H8WL 5I30L 3S3SA 4DKFL 1Y18B 2VLRA 1WQVT 4M1CC 1FH5L 4L8SC 3RNKB 3BP6B 5GRVK 5FA4A 4U1MA 1WIUA 2DI8A 3EGSA 4HWBA 3M17B 2J6EH 4JKPH 5I19L 4PJ9D 4I18C 4R4NC 4HGWB 2OQJB 3L7EA 1RIVH 3P3YA 1R3KA 2GJJA 3B6SA 1D5BB 2NR6C 5FHBH 3RUGB 3Q48A 4I0CC 3SGDH 2DLTA 1WZ1H 2QQQA 3SDCD 3TM6A 3RWDA 2XNAA 4X7TB 5B38G 1GGCL 1MCOL 1JYWA 1YA5A 4KPHH 1JHTB 1BM3H 3HZKA 2B0SL 5F7EH 4E42B 5E5MA 3VWKB 3MXWH 1WFNA 4HWBL 4DZBB 4XAKE 5EWIL 3VDCA 1U6AL 4LVEA 5I1KH 4K7PX 1Y6NR 5JNYB 1A1OA 4WRLA 3BP4B 5GRYA 3BXNB 1I9RH 4YXKL 1UM6L 4G9DB 1UKTA 3AFLA 1ZVYA 1Z9LA 4NBZB 4U1IA 4RMRA 4PRAB 4OZGA 5DUMH 3TBTB 1K5NB 4ODVL 4IIQC 4U6YA 1TQBC 4LQFL 4HS8H 3C08L 2CIKA 2CGRH 4GRWE 4LHQB 1K8DB 3T0EA 5GGSA 2CDFB 3WE6B 5BJTB 3ZL4H 1WTLA 1PSKH 4YFDB 3OL2A 3MODH 1V7NL 5SWZA 2DKMA 1YN7A 2VAAB 3KLAA 1I75A 1E28A 1TETH 1X5LA 3O8XC 3CCHA 2QHRH 3F62A 1KC5H 2MHAB 5JUEH 1IT9L 1YN6B 1UADC 1TVHB 3P0GB 2YUWA 4M03A 2QQKH 1TQCB 4ZFFB 1JZ8A 1D5XA 2IG2H 4OLYH 4OQ1A 1HKLH 3SGEI 1JPSH 2Y7QA 4K07A 4OLEA 5IESL 4XWGL 4UBDC 4C56D 3KXFE 1SY6A 3FZUC 2MFNA 3WFBH 3NN8A 3IXTA 1RHFA 3C60A 2D7PA 4KKBC 4B7IA 5CCKH 1NCDH 4ZO7A 3FN9A 5EUKB 3VWKC 4JFOA 4K3EL 4N0CD 5AYQA 3BDXA 3BGFC 2H6PA 2X5PA 4Y5XC 4MX7B 1XF4A 3RDTD 4PJ5A 2F53A 1LK2A 4ZFOL 1D5IH 1VHPA 1FV1A 3QDMA 1VFMA 1XR9A 3ZTJH 2ZOKA 5E8EB 2D7TL 2X42A 3P0VL 4YBLB 3CVHB 3QUXC 1GGBH 4S2SB 1AQDB 2V2WA 4NRXB 2APTA 5DJZB 4GAJL 3QO0A 1T80A 1X5GA 1WJ3A 2FR4A 1DBMH 4MLIA 2Y23A 3FQTB 3SPVA 4MJID 1HHJA 4JZOB 5DJXA 3CVIL 1GZPA 2Q87A 1QA9A 4K8RD 2NNAB 1CXKA 4UB0L 2J7LA 3V6BR 3NTCL 3OX8A 3REWB 1J8HA 1YEIL 3PQYE 5F7FA 3SO3B 3VXUA 3GBNL 4LARL 1FC1A 4PRHE 1LQSR 1V8HA 4JRYD 4EI5C 3U4BL 1YEHH 4P23B 1QACA 4NCC2 4NO2A 3QRFM 1ZLVK 1NCCL 2PYED 2EXWD 4U1NB 1D9KD 2DJUA 1IGTA 4PG2C 1HEZB 4D2NA 1X44A 4AH2A 1I8LA 4P4RA 1MIEL 5EU5A 3LN9A 2VQ1A 2ZOKB 3EHBD 4XP1H 2VERN 5DUBB 3GSRB 1DUYA 4C83B 3C2AH 2BNRB 2PXYC 3QNZA 2W07A 1RUQL 4P2QD 3PL6C 4J8RB 3TIDA 1QO3B 2DD8H 3VXUB 1AE6H 3TH3T 3MOBH 1JWSA 1UJ3A 3GMQB 1I4FA 3NPSC 4J4PA 3CFBB 2V5YA 1RJZB 5DD3H 3MV7A 1E4WH 3HE7B 2A2QT 3BKCH 1N7ML 3ARDD 1AD9A 1W0WA 2CKBL 5I15H 3TYFB 4LCUB 1D5XB 4NOBA 4OM1L 1CICB 4Q6IC 4HIHA 3RGHA 4ISVA 4PGBB 2ZOLA 2JJSC 4FXKA 1MFDL 4CN1A 1PD6A 2HJKA 5HHXH 3SDAB 3HR5A 3MRPB 1S7QA 3O2VH 4QOKA 1FFRA 1WWCA 3DSNA 4KGJA 4PJ7B 3RVWC 1D5ZB 1T03L 4RGNB 4KZDL 4F7CA 1ZKAA 3GM0A 3HLAA 3OKNB 1BBDH 1CU4H 1MNUL 3BN9C 4W70A 2XICA 4A6YB 2MQ0A 1KCSH 4ERSL 4M93B 2W65A 1RUKH 5EC2A 4BQ6A 4PRDB 3F7PC 3ZDXF 3K46A 4OV5A 4BA8A 2FD6L 4PJ8C 4PJDB 2F8XC 4ZDHB 2Q1EA 4MA3B 1LO2H 5KVEL 2ZCKL 1OP3K 4OF6A 4QTIL 4N9GA 1RZGA 3JBG7 1VB9A 4ETQA 3UDWA 3KGRA 5ESAB 5FB8A 2BSED 4DKAA 4PTTA 3MCLH 1HXYA 2YWYA 1N7MH 4CMHB 3D25A 1K5NA 2V6HA 4I3RH 2HT2D 4X9IA 4WI4A 1E4WL 4U1KB 4QXTA 2PR4L 5FIEA 3S4SA 2EE9A 3BO8B 4CL7A 3ULVC 5HI3C 4TTGA 4U1MB 2YD2A 1QRNE 4JPWH 3F12B 5F1NA 2VDKL 4EN3D 2G60H 2W91A 3RJDA 1NDMA 3MV8B 4ZS6D 1YY8B 4WUKL 4P5KA 4PJXB 5E5MB 1HYSC 3V6FA 4KVCH 4YDKL 5B8CC 2EYSA 5F9DC 1AHWC 1PY4A 1J11A 1EZVX 3BSZH 4Y16B 4YHYC 2NLJA 1RUAH 4I1NB 2R4SL 3SDAD 4APQC 2NY3C 2X40A 5DQ9B 4KJQC 1NBZA 2R2BA 5C0BE 2FHCA 4KK8D 4MB3A 5GRUL 2YPVL 3QIBC 4P48A 5FKPB 2I9LB 5DEFB 3RVVC 5C92A 3HC4H 4JM2F 5FYKH 5BS0D 4PRHD 5TQ2H 5I2IA 1KLUA 4DKEH 3O6FC 3NTCH 3DPBA 1D6EB 1HQ4B 1CQKA 3D39E 1B2WL 3TWCL 3ZT7A 4CU8A 5D5MF 3QCVH 1BFVL 4XP4L 1ONQB 4EOWH 2JJTC 1G7HB 3MV9B 4HK3N 3RL2A 3U9PL 4R3SB 5ALBL 1N59A 1U8HA 4HHAB 1IGFL 3QDGE 4DN3H 3HS0A 3H9HA 5TPWH 5JORA 4K7FB 3EYQC 3P0VH 2D7TH 5IJVA 3T0BA 3TN0C 2VUYA 1P7QD 4K94C 4NGHL 4F15C 1U8IB 4NQTA 1YEKH 3CUPA 1ETZA 2DBLH 3TH2T 2K9UA 1B4JL 4YDVA 4LKCA 4HXBL 3BQUD 1ZTXL 4LF3A 1A02N 3QEQA 1U92B 1EEYA 5B39B 4NN6B 4UIKL 4N1HB 4BH8B 3MBEB 2EO1A 4TNWF 4IHOB 2LU3A 2ZSWB 3BVNA 3VGEA 4CJ1A 3HFMH 1NFDA 2OMNA 3BMVA 2VLKE 1SJXA 2GIYA 4APQB 2ITDA 3SDXA 3LV3B 1JPSL 4RGOH 2AEQH 2FGWL 5KBNC 3DROA 3PDDA 5FGCB 2GI7A 3UTTB 1UWEH 4HPOH 4HKXA 3K4ZA 4N5UA 3NCCB 1MI5E 1TETL 5ERWB 4H8WC 1G7MB 3Q6GL 5JW4Q 1KJ3H 5IHZA 5I18H 1A7RL 4RMUA 3IJHB 3GJEA 3MFGB 3JWDC 5EO9B 3NFPB 1UT9A 2GCYB 4NM8H 4HS8L 5HVHB 3WLWD 4AIXA 2YA2A 3TEUA 1MELA 1PW3A 4MA7L 5CILH 4K3JH 5DUML 4WI5A 3ARUA 2YR3A 4LVHC 2E3VA 4HJJH 2H8PB 2EYTB 2F53D 5TH2B 5DA0B 4HX1A 2I27N 1VFAA 4H1LB 2IANB 3INUH 4OCYH 3PWVB 5C09E 2YD5A 2C7UA 2PO6A 1HIML 1AGCB 2GEEA 1YY9D 2ED8A 4QF1A 4X9HA 3VG0H 4LLVB 3MXWL 1IL1A 1VA9A 3GMNB 4MSWA 1A3RL 5J3HD 5F6IB 4YFEA 2B0SH 1WCBB 2XZCH 4Z7NE 1C7TA 2AP2A 5GSRB 4L3EB 4MNGB 1S7TA 3JV0A 3CFEB 5BO1L 2EE2A 3T1WA 5T1KD 1FFNB 1WZ1L 3HC4L 1MWAB 1J8HD 3BRFA 5D7LE 1RIVL 4MCZB 4TUKL 5GRUH 1A9EA 3FN0H 3S5LA 1FCGA 3G08B 1N5AB 5C0IA 4HAGA 2XACC 1SQ2N 1D9KA 5D2NB 1ZANL 3QSKB 3QFJD 3NCJL 1ZS8A 2UYLB 4AQ1B 4WUKH 4NN7B 1YUHB 3NFNA 4Z76B 5CGYD 1MEXL 4BKLB 3O6FD 1FO0B 1S7SB 1EUUA 4YHLH 1QKZL 3GUTA 3T77B 4JPWL 4YUEL 3TCXA 5GGVH 3P4NB 1I7RA 4NDMB 2V5TA 5DJ6B 4CVZA 1E6JL 5HHMB 4NKDB 4NWTL 1P84K 1IC7H 3MCLL 3E8UL 3G6JE 4G8IB 1T0NA 4R4BB 3SE9H 1F45A 3VFRA 2RIKA 1FV1B 4M6AA 1SEBA 4JE4B 1CF8L 2F53B 3FO9A 2ADJA 3GRWA 3NIDE 4POZD 3VXQA 3FFDA 3V5DA 3CLFL 4CN6A 4RGNE 3QEGL 7CGTA 1KEML 1AC6A 3SKUD 5D5ME 1T1XB 1BPVA 1TNNA 4QY8B 1N64L 5I74B 3IVKB 1LK3L 4PY8J 4Y2DA 3VXSB 3WFZA 2W60B 5F7YC 4XPHL 5D4QA 1NLDL 4KUZL 3AREC 4UT6L 3VG9B 1KCSL 4X6FA 4ERSH 1DDHB 3QUYC 2HFGL 5C8JB 1FNLA 1PQZA 1ACYL 3U46B 5IGXH 3EYVA 3MACL 4L3CB 3DUUB 5H37G 4HJGB 2IAMB 4OFDA 1CFBA 5AG9A 1QQDB 4XNXL 3U2SB 1T03H 4TUOA 5KSAB 5DMIL 5H35A 3WS3B 2V9QA 4ZPVA 4MNHB 3O2VL 3RWEB 4NQEA 2WSKA 3N9GL 5T3ZD 4PJHF 5FF6A 3RTQA 1MFDH 1SEQH 2BVPA 2DYPB 1Z2KA 4KWUA 4ZTOL 4Z77A 3M07A 3HI1B 4UQ2B 3C9NA 5I15L 2ZUVA 4Y19B 5DS8B 3SO5A 3JTSA 3HMWH 4JQVA 4XC1H 3MGTB 3QH3B 2DICA 4JJ5B 1H15A 1WFUA 2NY2B 5BV7L 5DD3L 1CDJA 5DHVH 1W2KT 3SCMD 4MMZC 1CL7I 3MJGX 4J3VA 3HAEB 1SY6H 5HD8C 1RJZA 2E8YA 3MOAL 3FTGA 3CAFA 4MQSB 4R8WH 3S34L 3BPCB 1R24A 4JN2A 3SE8H 2VXSH 4OBSA 2HVKB 2UYLA 1UWXK 1FZKA 3DURB 5GZND 2CUHA 2KQMA 5IP4A 3ORJA 5K9QI 1FQ9C 3LH2L 1MIEH 2ZUYA 1JF6A 3F5WA 5ENWA 3R06B 4LLYB 3UTSB 5FO9B 1KTRL 1CLOL 1DVFD 3WLBA 3E6HB 3ZKMD 1JF1A 3TJEL 2J8HA 2FYYA 2CLRB 1I8KB 4X5XB 4G9FB 3CFCH 1CE1H 3MFFB 1T2QH 3GBNH 2YKLL 2F5BH 3TBYA 3DYMA 4OCSL 1A5FH 1HHGB 5F9JB 4CMHC 4Z0BL 1N0XL 1FP5A 5TFSL 4UV4L 3KPNA 3EDDA 4OKDA 1R3HA 4IRSA 4Y1AB 1EAJA 1EJ6A 3EO1A 1BZ9B 4ODXA 4P46B 3ES6A 3MV9E 4KQ3L 3WKMH 1U3HA 1KGCE 1UXWB 5E2UL 1JF5A 4WWKB 5A2FA 1NC2D 3QRGH 1F3JA 5I1HL 1QFWI 3L3GA 3RX8A 1PKQA 3VCLB 1ADQA 4WEBL 4KUCF 2UWEE 1DE4A 4P4KA 2HT4C 1GIGL 2XTJE 1JI1A 4LNRA 5JIHA 1S8DB 5EOCL 2VLKB 4YHKL 1ORSA 3CIQA 5JW4M 5JW4N 4JHAH 4BSVB 3KPSA 4HUXB 4M48L 4I13B 2BC4B 5CCKL 1NUFA 4ZOEA 2YPLD 2FEEI 5D2LE 2X4PA 1B3JA 3RY6C 5ESVA 4LRIC 1DQML 4HKXB 4XBGA 4MJ6B 4ONHA 5AD0A 3VI4E 1HKLL 3WNKA 3QUXD 5DD5L 2VRAA 3MRDA 4MWFA 4KXZI 2OL3L 3UTTE 3V0WL 3FRPG 5M94B 2Y5TA 4IRZH 1CN4A 1WIPA 3LY6A 4ZUTA 5DTFA 1HHKA 2MHAA 1G6RH 2H2PD 3VRJA 3WNPA 3CCHB 4OLWH 3WHE0 4KFZC 5LGHL 3B8SA 3ZL4L 3OKLA 3U0TA 4HX1B 1EFXA 3BN9D 4XC3H 3T65B 1VADB 3PXJA 4G8FA 5M7QA 1KV3A 4WFFE 2QJDA 3B2VH 1BGXH 4JPKL 1U91B 2R0WL 5IW6A 1KB9K 5ID0A 2UUDH 3B2VL 5DHVB 2X4SA 2LU4A 1AGDB 4X7CC 3QDJA 4U6YB 1MSPA 1XF3A 2DQHH 5C0RL 5KJRL 4P2YA 1RURL 1I1YB 2R9HD 1SJVA 1MCFA 2ZCLL 1A6ZB 3VXNA 5IG7A 4N8PA 4OFYD 2HT3C 2ICWA 1QRNA 1U6AH 4MGXA 4M61A 1AQKL 1O0VA 3LN5A 3JUZA 4F3FB 4MJIA 4H26A 4X4ZA 5DD5H 2YD3A 3C8DA 3UXFA 4Z5RB 5KW9L 3FO0L 1FIGL 1QSFB 2E7LC 1J1XL 1UQSA 5KOVC 2P47B 1NGWA 1LEKB 1ZT4B 3PV6A 4JKMA 3ZYIA 2N56A 4YDJB 4ZUSB 2ZSWA 4G6MH 5JR1L 4TOYH 4KK9C 1IM9D 1U2HA 1ZA3A 1EEYB 2EXYD 5MHSD 5ACMA 5FO8A 1N3NA 3BWAB 4MNQA 2LE9A 2Z9TA 2IFGA 1QLEL 2DM4A 3OKMA 1W72A 3O6ML 3WEXB 5C3LD 3GRWL 3OB0H 1OOAA 3K80A 5I1HH 1KCRL 3ULUE 2Z93A 2YHGA 2DTML 3GMPB 3TT3L 3QULA 3EOTL 2WANA 12E8L 1NANH 3L5IA 3G6JB 4L8CB 1PG7L 2BNQE 1OAUH 3SKNB 1HQRA 2JCCA 2UV3A 4DGYL 1KF9B 1I8IB 3HZMB 2J4WL 1ZHBB 5IHUH 1M4KA 2AABH 4S1SL 5EDXA 3RRQA 2DAVA 3X13A 3CMOH 4LHUB 25C8H 4U6HA 4JRXE 3CXHK 5DI8B 5CD5D 2YPKB 2R23A 4UIMA 5ESQA 4L8SA 5I1IH 3X12A 5DSCA 4K23H 3VXSE 3VD4A 3FQXA 1CGTA 3UPRA 3RHWK 2Q20A 4JQIL 4GQ9L 1N3NB 5DGQA 5E2TH 4QO1A 5IBTL 2XYCA 3ARVA 4JM2C 4L4VA 1YZZA 4XVSL 2AJ3A 5BMFL 1F4HA 1W72H 2L0DA 4I5BA 5E4EC 3ARBA 3UROR 4WUUE 2D7NA 1NAMH 4L3AA 4OJFH 5C0NC 2ICES 1OWWA 1T6VN 4P9HH 3RWHB 4ZD3H 3K81A 4ZS7H 3T3PF 4NO5B 2RBLA 4LGSB 2ZUWA 4F7CB 4PGJA 3FB7A 2HWZL 4P2OC 4PTUA 4YC2C 2AQ3A 2AW2A 1MCJA 5BV7H 4Q9QH 3LSOA 1KBGL 4N0RA 5CWSB 4AMKL 5SWSE 2HJKB 5IVXF 3HMWL 1IFHL 3WN5C 3VD7A 1MRCL 3UTTD 1MJJB 4ODSL 2FJFB 4HH9B 4RFNC 5CJ8A 5E7BA 3WSQH 4U49A 3I2CL 3QI9A 3V52L 5T1LB 1GJIA 1IKNC 2NY1B 1I8LC 2XTJC 5C0JB 5CEXB 5GS0H 4U3XA 1UH4A 3AM8A 4PFEA 3UMTA 4P2RA 3V4VL 4Q9CA 1OAZL 4IRSD 4ZFGL 5KZCB 5DMIH 1KGCD 4NBXB 2QSCL 5DR5H 1CFNB 3H7BB 4BM7A 1U3HD 5JIKA 5D7SH 3BKML 1R6VA 4KC3B 2FECI 4J1UA 4ZD3L 2Q7YA 3RWGA 3CFKB 1L7TH 4Z7WE 3T1FA 1NAML 3RUGE 3B4NA 1IQDA 4X6DA 3KPOA 4JGMA 3WL9A 5IBTH 4LLMB 5FGBA 1DTUA 3QUKA 4YBHA 5DVNA 1ZHBA 3PL6A 5IROA 1RK1B 2ICEA 1JGUL 3O3AB 3E2HB 1ZA6A 1H3TA 1CF8H 4LPTA 1RQ5A 1FNEB 2GJZB 1J8HB 3ALPA 3IJYB 4GG8A 5ITFB 3VCLA 2X1XR 4UDTA 3VI3F 1YEFH 3TZVA 5IHUL 1T21B 2HKFL 1MFBL 5I66A 4GRWH 4XPBL 4XMPL 4WEMB 1NCNA 4O58H 1RK0B 1QSEA 4PJGB 2R2EA 4PLJC 4WDIB 3DUSB 3EOYG 3SQOH 2VDPH 5LJYH 1KCRH 3HG1D 3VWJA 5T1MB 3HC3H 4WFEE 1Q0YH 2FB4H 5HYJB 4GRWB 1T5XA 4HZLA 4M7JL 4AJ0A 2EE3A 1OGAB 5IW1B 3O6MH 5F72S 4ODTL 1ZANH 1NGZA 1BVLA 5ICYA 3EJYC 2C3HA 4J7RA 2UZYB 3TA3B 3UTSD 4TUKH 1FJ1A 3GSXB 4IEFB 5HPMA 1S9VB 1HWGB 2F54D 4TOYL 4H1LG 3LDBB 4R7NA 1BJMA 2FEEL 3O4LE 5TQ0L 1J1XH 4H5SB 4HUUA 1DSFL 4CNIA 3WLWC 5DVLA 3CFDA 4ZAKA 2HVKA 1FNEA 2W92A 1DLHA 1JFQL 1GZPB 2QHLA 4WNQA 5KVGH 1OVZA 3OKOB 2R15A 2B5IC 2ICWJ 1F2XK 5ALCL 2I07B 4PY8I 3GMOA 4KXZH 3QO0B 5KSBF 4KVNL 2AK4E 4NO3B 4ZUWA 2N7BA 4CRPA 4JCLA 1MCCA 4X83A 5D7KE 3I9GH 4GXVH 4OCYL 1G7JA 3ZDZE 2HT3D 4LU5L 3T0EB 4Y19A 5DS8A 3O4OC 1MIMH 2VQTA 1I1FB 4FZEL 2FJFA 3CH1B 2M26A 4J1UB 2ZWLT 5FYJL 2R0WH 5J9PB 4BYHA 5C86A 3KPQB 4PB0H 3ARPA 3FRUB 3QJFB 1ZGLP 5MI0B 1BGXL 3ARGB 4I0KA 4O02L 3GKZA 5GPRA 1NGQL 1R3LA 5DMJB 5FCSH 1NCAH 1MHCB 3SKMA 4A6YL 1V3KA 5E8OA 4KK5C 1A0QH 3HRZB 1AKJD 4ONHB 4Z7OF 1DEDA 3VMPA 5HJ3A 3QHFL 5HPMB 3D85A 1DUZB 2P43B 3P9LB 1C8PA 5JPMB 4LCCA 3UYPA 4R96A 3WS6A 3EYVB 4L3CA 1U58B 2OL3H 3TBWA 3MRRB 4YHML 4ZG1A 1TVHA 5EH1A 4R6UA 1I1AB 3FT4B 4G6FD 3WN5A 1YC8A 5BOZG 2E6JA 4L4VB 35C8L 1URLA 5AEAA 1MF2L 2VXVL 1OGTA 2QKIB 4M48H 1MHCA 1ZTXH 1D6VH 4AM0A 5C9KA 2EDWA 4FTVA 3W9EB 2BX5A 3OAZH 4IOIB 5HGAB 1ZLWK 3IGAB 2DL9A 3P9WB 1YEKL 2VDQL 4RDQG 4KK6D 1GIGH 2VIRA 4OZGB 5HGHB 3CH1A 1DBAL 2YD8A 4EUPA 3SE3A 2XPGA 3ZHDA 5BS0E 4WEBH 1BJ1J 3CGTA 3CXDL 1ZSDB 1FVDA 3QRGL 2DQFB 3AY4A 3J8F7 3MV9A 1DEEA 1IGFH 4PRNA 1CVRA 5HI5D 3QG7L 2BVQA 4LSUL 3RWFA 3SBWC 3VMOA 4EOWL 4DTGL 4PJIB 3BFOA 3JV6B 4NSKB 5HI5C 4L8SB 2BXYA 4Z0BH 4CNIB 1A5FL 4LSSL 4OCSH 3OQ3B 4DKEL 2YKLH 4JRXB 4XHQA 3IDMB 4MA1C 3K2UL 3CC5B 3O45A 3VE0A 3IAGC 5E00A 3W5NA 3CD4A 4Y4FD 3STBA 4HKZB 2BZDA 1S7RB 3P4OB 4G42B 1RSFA 1NAMB 4AT6B 1JGDB 3BZEB 5HHOB 1N2RB 1QFWM 3PNWA 2Q3ZA 4WUUB 4KVCL 1Y6MR 5E1AA 5L2JA 5B21A 5MEQA 2VLRB 3PWNB 4GW1A 4X6DF 3V2AR 2YUVA 4ZQKB 1SVZA 3F7QA 2AJZA 5D9SA 3S34H 4WI9A 4I77H 3ILQD 1NBVH 2A6JA 4P9HC 4QRPA 4U1LB 3BIKB 1R3LB 3MJ9H 4LPUA 2AV1B 3VWJC 1JTPA 2WWMD 5IWLC 5BZWB 3SDXF 4WO4A 4UAOB 5JXEC 2ADIA 1G7IB 1ZA3B 1H3PL 3ULUD 1KIQB 1JJUA 3BPNB 4XP6H 2G5BB 1CR9L 1MJ8H 1LE9A 1L9NA 4EI6A 3ZT6A 1JBJA 4R96B 5T33L 2FX9H 4NM4L 1G7QA 4LAJH 5JZ7D 1P7KB 2E27L 4PV8B 5KVEH 2XN9A 3PDGA 2W38A 4TUOB 3U83A 4P2RD 1QRNB 5FOBA 4LSQL 3MROB 1A14L 1NCWH 4TN9A 4OFVA 2W65B 5HHMD 2EDBA 3HI5H 4DEPC 3LQZB 3T1FB 3ZKSD 5ERWA 5DQJA 4KKBD 1V5JA 1A3LL 5EIVA 4G5ZL 5AD0B 1KXVC 1NC2B 1TENA 3PHOB 2FEDD 3CFIC 4U1GB 3EDJA 1CGYA 3RIFF 2OR8A 3AU1B 5GRVL 1Z9MA 1LHZA 3EDKA 5I8EA 3CFJB 4KZDH 1F6AB 1IGIL 4KUZH 4NQED 3V0AC 4XPHH 5JA9A 5MEND 2B1HH 1LNUA 1P4BL 4LMQI 3X14B 3FT2A 5EBMA 2PO6C 2VO5A 3I85A 4HXAH 4RDQF 5HHNB 3KAAA 3AB0C 3SBWA 3QEGH 2AJVL 3B2UD 2HYMA 3HHRB 4JG1L 4N5EC 3VWJB 4F9LC 2KKQA 2BJMH 1MWAH 3CFDB 4ZAKB 3SDYH 4MAUL 1RVFL 2AJUL 2XZQL 5DJ2B 3C6LB 4HV8B 3LMJL 4J3WA 1K9TA 1FFPB 1GHFH 3DRTB 2I26N 3GHBH 3GMLB 3WJLC 1A9BA 5EORH 1KCVL 4LPVA 3RWJB 3MOQA 2APVA 1NGPH 2NZ9C 3AREA 3EFDL 1WICA 2DM2A 2OR9H 4Z6AT 2P45B 4AIZB 1RZKL 4NYLA 2BVOB 1NCBL 4PREA 3U36A 1FIEA 1X5IA 1AHWB 3CPLB 4Y16C 4YHYB 4UQ3B 5F7KC 2NX5B 3C2AL 5L2JB 3T2OA 1MEXH 1U8PA 1CFSA 2XV6B 1QBLL 4I18B 3HB3D 3NCJH 2VDOL 3HR6A 1QSFA 4Z7VA 1K4CA 3JTTA 1V3LA 3LB6C 3RTQD 1WISA 4PJ9A 1IEBA 2GW5A 4PS4H 2DIAA 5D7JA 4WWKA 3WFDH 1QR1A 4UINH 4WO4C 4LBEA 4ZXBD 3EO0A 1TZHA 2DQDL 2W0FA 1P5UA 3VGFA 3RGVD 3AS0A 1QPPA 5A16A 2BSSB 1IVLA 4KHXL 4UNUA 3U4BH 3VG9C 2FZ3A 1AKJA 2YPLA 3PF2A 5FK9B 3BE1L 3L3JA 5HYIA 4WU7B 1SJHA 2D31B 3H9SD 1UM5L 2RJMA 1TNMA 2D7QA 5F9OH 4J2XA 1RJCA 3IDGB 5BO1H 5K33A 2OZ4H 5FA3A 4AEIH 1G9EA 2XTJD 2XZCL 4B41A 3V4PL 3MNWB 4M8QA 4F15B 1FNGB 4NYLB 1GOGA 3OKEB 5I71B 1HQRB 4PJEE 4J3TA 4P2QB 4PJ7F 3VW3H 4FS0A 5BCAA 4U1KA 4P3WA 3VWJD 4Y4FC 3MLWH 1FZMB 3INUL 4WI2A 3E1F1 4L9LA 1MY5A 2HTLD 4XT1C 4C56E 4RMSA 4X8JB 4K3DH 3LD8B 4G9FD 4RWYL 3O11A 4JPVH 5FHAL 3I02A 3K4DA 1F4XH 1TVDA 4OLZL 3VFOA 5C09B 1D5IL 43CAA 2R2HA 2UUDK 1LILA 4LCCB 3MRDB 1MCIA 3QEHA 2WBKA 5DJ0A 3LZFL 1NCDL 1XF5A 4N0UB 5KSAA 1RZ8A 3O2DL 1A7RH 5DLMH 2DI7A 1JZ5A 1EJOH 1I1RA 3BZ4B 5FM5O 5IIEB 4NQXB 5LQBL 3Q6GH 4XWGH 1CT8A 4J4PD 4L4VE 1IM3A 1KN2L 1UWEL 1T5WB 5CEYB 1U9KA 3VE0B 3WBDA 1IT9H 3QUZB 2QSQA 1E4XI 5HHQB 2CIKB 3MRPA 1V7NH 2EDEA 4HCRA 2YPKA 3VFTB 5I9QC 4UIKH 4X6CF 4DCQA 4NJ9H 3NCYP 5MEQB 4FQLH 4R4BA 3GSWA 4KAQH 3VFWB 2PYEA 4LQFH 3ES6B 1CDUA 1FNAA 2WWKO 1T22A 2DMBA 4I3SH 4DUWA 5CJOH 1DFBL 2G5BA 4NGHH 3GIZH 5EO1B 5CJXA 5DVOA 3CSYB 3S97C 1DVFC 2E9WA 3PWJB 2F15A 3RY6A 1UM6H 1P1ZA 3PGDB 2I07A 1I9RL 2H1PL 1KB9J 1A6WL 1FO0A 1S7SA 5FECA 4HJ0C 5I1KL 3T08A 3Q5TA 5BW7C 5ANMA 3U9PH 3OKMB 4CVUA 5MP6L 1Q1JH 1N5YH 1AR1D 5DMGC 3BAEH 5J06A 4Q9RL 5L2KA 4LLYA 2BXZA 1KTLA 1DANU 3QCVL 4GW4A 1CIUA 4X6CE 1SEBB 1T83A 3SKJH 4BSWA 3TC9A 4TQEH 4TVPD 2NY3B 1UC6A 3DVFA 2E6PA 2X4PB 3EOAA 3JTTB 3Q0HA 1FZOA 2ESVA 1N2RA 1EBPA 4LRIA 5K93A 4AH2B 1DQDL 3SDXE 3IRZA 2O5YL 3V6OC 3AXLB 1KG0B 1BD2A 1P9MC 1FZOB 2VLRE 4HUXA 3MLRH 5JPMA 5JQHC 3ZMRA 3BESR 5EN2A 3LN5B 4Y4FA 1A6AB 5HJ3B 2YRLA 2APWA 4XCNA 3DOSA 4DCQB 2IPKA 3BP7A 3CX2A 5E6IB 2ZNXA 4PGEA 1YUHA 3NFNB 4Z76A 1UA6L 2JELH 5EZLB 3QYCA 3NAAH 4DKFH 4KKAD 4OZIA 5I30H 1OGTB 4IJ3C 3OAZK 4S1QL 3MCKA 2PO6B 1XCQB 4TUJA 4FQ1H 3VGGA 4F33B 1KIPA 3KJ6L 3PWJA 3TNMA 4XP5H 2NY2D 5D6CB 4AEHH 3DV6A 2WAHA 1YECH 3C6LC 4KZEH 3TA3D 2ZUXA 4HIXL 2AJYL 4NQXA 4I3RL 4NQSA 3RWEA 1UVQB 1J1OL 3TCLA 5JMRA 4WWKC 5DJ8A 1WAAF 5KOMC 4POYA 3FOLA 3LPWA 5EO0A 4L3EA 2CH8A 1SYSA 3D2UA 3H42H 5A3IC 4I2XB 2FYYB 3O41B 2FO4B 5T5NG 3GSUB 3QI9D 3ZE1E 1Q9KA 3LPFA 2ZJSH 4QEGA 1QFPA 3FRPA 3UC0L 5MEPB 4U1HA 4OM0H 1KCUH 2Q76B 1JZ2A 2EIZB 1OTUC 3ULSA 2G9HA 3IF1A 5D8JL 1RUKL 1VGEH 2NY0D 1ES0A 2NXYB 5LWYH 2PUQT 2VISA 2EZ0D 1X4ZA 1T22B 2UY7A 1MCWW 5LBSH 3D39D 4NC2B 3GMOB 1HN1A 2BRRH 2FJHA 4YWGH 1XGQA 1U92A 4EEEA 5C1MB 1FPTL 1HK6A 5E2VH 4YC2B 4HZLB 3HNTH 3ZTNH 3U4EA 3ZZ1A 3KVQA 2VN4A 3H2WA 3ARDA 1XGYH 5CIPH 4HEME 4JB9H 5E6ID 1J7VR 4LLWA 4XCFH 4HJ0D 5CINL 1OT1A 3V5KA 1FBIH 3NPSB 2R4RL 4Y5VA 1ZV5A 3UTTA 1INQB 1ZMYA 2X4QA 3B9KD 5CSZA 4ALAL 5J3HC 2VZTA 2RCSH 1QSZA 3O3DB 4JO1H 5BVJA 4Z7OE 4PJGF 3MRGA 2YK1L 3HNVL 2ESVB 1VEMA 4BFIB 2GQHA 2IMMA 3V6OA 1GGUA 4TSCL 4IHOA 3O2DA 5BQ7B 3GDBA 3IAPA 5EN2B 3QDGD 2VITA 4W81A 1MVUB 4OTXH 1UZ8A 3UPRB 1QVOA 3RKPA 3K1DA 3E6HA 2DQJL 4IBLT 1YNTB 5JW5B 1PKQB 2JB5L 4FP8H 4O51A 2XNAB 3OAYH 3WV0A 3B9VA 2XWJB 5F7UA 5JW3H 2IPTL 5D2LB 3WO3B 1FVEB 5GGVY 2OZ4A 5ITFA 1UH3A 1ZVSB 4K8RC 3R4DA 2WP3T 4OTXL 2A77H 4LLVA 4XAWL 1FNGA 1IZKA 5CP7B 3GMPA 2NXYD 2W1NA 5GGTA 1WBYA 4MJ5A 2OK0L 5EA0L 4U7MA 3E3QE 1WBYB 4MJ5B 2W0PA 4HFUL 1UACL 4XPGL 4JO1L 1S5HA 1IQDB 2OM5A 1MRFH 4LLAA 4ODHL 5HHQA 4K7PY 3HE6C 4Z9KB 3TN0B 3STZB 4QKXB 4HUVA 4O2CA 4XGZA 3DVGB 4MHHG 1Z9SA 1P6AB 3WN5B 3V8OA 3DJ9A 3MRBB 1JNLL 5SWZE 4X6BA 5CZVH 4GG6B 1CL7L 5FUZH 3HNTL 1I3GL 4GAFB 2W9DL 5DEGB 4OGXL 1K3ZA 2IFFH 5IEKA 3U4EB 5L8JB 4FNLL 1HILA 3MLTA 1Q72H 1OM3L 3NN8B 2MCPH 5E9DD 5D1QA 2RFXB 5EBWA 3MLTB 4Z7WF 3SY0B 2YA0A 4LDEB 2BNQA 4NFCA 3BKYL 1PJ9A 4GAYA 1EXUB 1XT5A 1INEL 4APQA 4NKQB 3D69B 4OCXH 4ONFH 3WFBL 3CX5J 3CFKA 1KCUL 2V5RA 3S3JA 3H9SB 3TZVC 5IESH 4R0LB 3DGGB 4OLYL 4QY8A 4OCLC 2HRLA 4YDVB 2H2SD 3PWLB 3TN0A 4OQTH 3QFJE 5AZEL 2DQTL 2DDQL 2EDYA 4AZ8A 3H42L 4LNVA 5JUEL 5I1JH 1FYHB 5IVZA 3HB3C 5D7IE 4ZYKB 3UP1A 3UYOD 4KK8C 1OP9A 2C3GA 4KGLA 2EXYC 5GS1C 3HZYA 3AVEA 4P2RB 3UO1L 3MODL 1WT5C 3DYPA 4HIHB 1EBAA 4YZFF 2Y6SD 2CGRL 5FUOH 1FC2D 4RIRA 4XP5L 1KXTB 4RX4D 2FZ3B 5C8JA 4EI6B 2BSSA 2CJUL 2CO7B 1RUMH 3MNWA 4M8QB 1B4RA 3KYMB 1J9CT 5HYFA 1SMOA 4OZHF 1AO7D 4R0LA 2DIJA 2XWJA 1KB5A 4HWUA 2KUTA 4WHDA 1NBQA 4LP4A 2CKNA 2JELL 2YA1A 3L9RA 2H2SC 1UYWH 2RGSA 2VLLB 2VZUA 2OL3B 3QCUL 2R23B 4UIMB 5ESQB 2UWEA 3TPUB 1QR4A 2BSTB 1IGCH 3TV3H 4I18A 3QHTC 3FB7B 5IFJA 4FXKB 5JW4R 5IBLD 3GEWB 4TNVF 4R4ND 2BVQB 2O5YH 3QPQD 3G04A 1BZ7A 4ELMA 5EU5B 4AIZA 1MHHB 2LTQC 4KPHL 1MHHA 2ZG3A 2DLEA 2Q86B 4EUPB 1T1ZB 3D6GA 3SJVE 4QRUA 3KHOA 1AI1H 4LP5A 3DVGA 2R0ZL 3HMXA 4P23A 1N5YL 4E5XB 4UDTB 1I4FB 2VZ3A 3QUMB 2YZ1A 3VRLF 3ARDB 2K7QA 2UZIH 2GTWA 1QSEB 1SYVB 4XPTH 4MAYB 1S7WA 4P3DA 4NZJA 1NEZG 1XGQB 2Z4QB 1OP5K 3GMLA 1HKFA 2FSEA 4FA8A 5H2BB 4NUJA 5CSBA 1RHHB 2VDRL 5B38B 4PJ8B 4LCCC 1N59B 1ZSDA 4XVTL 1OW0A 3X3GL 2FBJH 4X8XA 3F7YA 1HHGA 2G9HB 5F9JA 5DMKB 1M05B 2QV2A 3LKNB 4LSRL 2AXGB 3PV7A 5EUOF 4PBWD 3G5XA 2XZAL 5D1XC 5IHZB 1Q9KB 3ZHKA 1NCTA 1KTDB 2KZ1B 4FFVC 3SEPA 5DO2C 5FECB 4WV1B 4BFGA 4W4OA 4JZOA 3WUZA 1C5BL