2CUMA

The solution structure of the 33rd fibronectin type iii domain of human tenascin-x
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
105
structure length
105
Chain Sequence
b'GSSGSSGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tenascin-X
publication title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 6
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cumA00
2MQ0A 4C83A 2XKUA 4JHZA 1QSVA 5EO0B 1YC7A 1YEIH 4U6VL 4N1CA 2LU3A 1CT8A 4QRUA 3NAAH 1QQDB 3PIQA 4HD9A 3GHEH 4OUUB 1KCUL 3C8HA 4KPHH 1U8MA 3QDJE 5DK0B 2WSKA 4E41E 2VLLA 2Y36H 1T1WB 3OX8B 5DWUH 4UV4L 5E94B 4PP2B 1C1EL 1S7QA 4XBGA 4ZO8A 3ZL4H 5KVDH 3INUL 1A1OB 4M93B 3S37H 2CGRL 4QOKE 2O61A 1LK2B 3CSYA 3GKZA 1M05B 1WCQA 4OD1H 3KLHD 1E0OB 4KDTA 6FABL 4DOHE 4PRPA 3ULUL 1ZSDA 1ACYH 1OAQL 5KANG 5C0GB 1NFIA 4F8QA 1I9JH 4L4VD 2XZQH 1GOFA 2D7PA 2AP2A 3G9VA 4Z77A 2AEQL 2BSSB 2DJSA 1KPVB 3STZB 4NP4L 1FZKA 3DARA 1NDMB 1O5DT 4OCSH 4AEFA 3QIBC 1QYGH 4IOFD 4BFGA 3WN5B 1R5VA 4LLUB 1MLBA 4PRIB 1LE5B 2GSGB 2OZ4L 3MA9L 3HE7D 4JREB 1MFBH 4NQVA 3IVKA 5JQ6L 2UZIH 1DFBH 2E27L 2YN3A 3G5ZB 4ZAKB 4PJ9A 1A6UL 5FA3B 1MI5A 2DQGL 4RFOH 5ICZB 1A6WL 5C0CE 4IMLB 1XZ0B 3QG7L 3O4LB 1LK3H 2UUDH 1A2YB 4JO2H 3WFEH 4GW1B 4E5XA 1NJ9B 4GO6B 2HP4A 4ZUWA 5IROA 3FB8A 1QSEE 1MIEL 4XPGL 4A6YA 3DO3A 3KDMB 2F8VA 1EO5A 3IFNH 4ONOA 4PJIB 1OP5K 3PGDA 5JO5A 3X11A 5E8NB 1UWXH 3NA9H 2D7QA 4LF3B 4RQQA 5HPOA 4NN6C 5HGDB 3CPLB 2P24A 4IHOA 5J11C 5DJDB 1C5BL 4CVWA 4IM8A 4M93C 4AIOA 2DI8A 2R0ZH 1XIWA 4XP6H 4YNYA 4G9FD 2IGFL 4HEPG 1A7NH 3H9YA 4UIMB 5GPRA 1MCQA 2PO6C 3VXNB 1OGAE 3DIFB 5I8OL 3TBWB 5B38B 3BKCL 4Q9RL 2Z0BA 3JWDC 5DMYA 4HPYL 3N50A 3WS6A 1WSST 3VH8B 3X12B 5L8JB 3NH7L 1SVZA 1ZK9A 1Q9LA 2DJ4A 1I7UA 4BFBD 2JCCA 4JLRA 4TQEL 4P5KA 4HCRH 4KVCH 5H35B 2AW2A 4LIQH 2XFXB 4WVRA 2WUBH 4J3TA 3EDFA 1Y18B 3ARRA 1F4YL 2Y25A 1U42A 5TF0A 3PWLA 2CSPA 3QH3B 3MLSL 1KGCD 4G7VL 2AXFB 3TPKA 2P5WD 3GJFK 4YGVB 5EO1A 4NQDE 4G6ML 2EDLA 2YZ8A 3CVIL 3OKDA 3CD4A 2BCKA 5IW6B 1NAMH 1A64A 2W59A 3L3HB 3ULVD 1MFAH 3ZZ1A 1WIUA 3BEWB 1E27B 1GZPA 5T1DH 3ILPB 2HTKD 5TDOB 5AYUL 5EOCJ 3BPLB 3JV6A 4HF5L 5C71A 2V7HB 3SJVE 2VLJE 2FO4B 4V1DE 1QFHA 1JYXA 1OY3B 1S8DB 1J0KA 2Y07L 3U7WH 4QWWC 3GNML 4X8JA 5B3NA 5C3TA 1I1RA 4NC0B 2GY5A 4NPYA 3KPMA 3NCEB 4MA7L 4OCYH 5DO2D 4LLVA 4RISL 5DHVB 5AWNL 4U1NB 3NCFB 5CD5D 1TZGL 4Y2DB 1UENA 3REWA 1I7RA 5I75B 5D1ZD 4ZQKA 1KIPA 4Y5XC 2EYTA 3A6BH 3VGGA 1I9RL 3QA3A 4FFWC 4BQ8A 3G04A 1B90A 3D39D 4KQ4L 2O5YL 4JFPB 1UJ3A 1T7VA 1Q9WB 3IF1B 3EGSA 4ETQA 5IV2A 4DZBA 4UINH 1KIRB 4HIIB 4J4PC 1FYTA 1DVFA 4PJEA 1H3GA 1MHCB 1VGKA 4LHQB 1ZHBA 3C9NA 3WIFA 2GJ6B 4XWGH 4NBXB 3SCMA 3KYOA 3RUGA 4KY1L 4NZTH 3AAZB 4FQIL 2H2SC 4F80A 4JFXB 3VWKD 1ZV5A 3GBML 3LRGA 5BOPA 2BVQB 4EXPX 1BQLH 1RZJH 4EIGB 1YEJH 4XVUD 3CFEA 3L5HA 4G8FA 1E4WH 3QULB 1UM6L 4JPVL 4RBPH 4O2EB 4NO2B 2AJ3B 1OW0C 2CJUL 3ULVH 5DD6A 1EDQA 1PQZB 3ZO0A 1WFTA 5HD8D 2GCYA 2AEPH 1DL7L 2NLJA 3PHSA 2CR3A 1ZMYA 2XWJB 5EU6D 2VZTA 2YA1A 1NCCL 3BQUC 3CVHB 2BHUA 4M7JH 4OGXH 3CSGA 1ZHKA 1G6VK 4XI5D 4BFIB 3RVWC 1A6VL 5SWZA 1EFXD 5HVFB 2J7LA 1LEKA 2DQJH 1CD1A 3MLTB 3MXVL 4NRZB 4D0BB 3G08A 4ENED 2V5SA 5CEZD 3BP5A 4URTB 1ED3A 1T83C 5I1KH 4GBXA 5I75C 4X7FC 2VLKE 3QUMH 5FO9A 1HH6A 2Y06L 3IDMA 3TM6A 3RU8H 4DW2H 4OLWH 1DLFH 1KPUB 5E8OB 2ZCLL 3QJFB 1D5BA 4EI5A 3P4OB 1A9EB 4ETYA 5GS1A 2PXYB 2JELH 2R29H 3RDTD 1V3LA 1UKQA 2IQAB 4JRXE 3MMEA 4YHML 4HXBL 3CUPA 3QISA 4J6RH 4M3KB 4W68A 1OP9A 2FSEB 1F02I 1JRHH 2V2TB 3FO1A 3WXWL 3VFMB 2X40A 4QRPD 2B5IB 2OXGA 1WTGT 2NY0D 3C5ZA 3AS1A 1U8HA 4H88H 2JK5B 3OR6B 5BJTB 4LHUB 4GUPB 3NFSL 4Z7VB 1JNHA 5E70A 3ZT7A 3G5VB 1I1AC 4PGDA 4PD4K 3QFJB 3VA2C 1CFBA 1L4IA 5C07D 1V5JA 3E2HB 3EZJB 3MV9D 1AGFA 2Y7QB 2W91A 4G43A 2Q76A 5ALCL 1IFHL 2HWZH 4PRPE 4XCEB 3QUYB 1YUHB 1YQVH 2ICWJ 1OP3K 4U0RB 4KKBC 3OHXB 1BD2B 1FGNH 3D9AH 4H25A 1IGCH 3DHJA 4Y4FA 3V0AC 1MJJB 2OTWB 3BPCA 5CP7A 4PV9B 4NO0B 4P23A 3GO1H 2Z31C 1INDL 4Y16D 4U1HB 4EI6A 5BV7C 5CEZH 4DAGH 4JVWA 2VAJA 1ZLSL 2D7OA 4U1LA 4Z7OF 2X4NA 2XTJD 4HDIB 1UT9A 3U6RB 3BGAA 5IMKA 4LU5H 2AI0H 2RCSH 3K0WA 3DRQB 3VMOA 5F70A 4XVSH 3N1PC 2VLME 1KCSL 1MI5E 1JPGA 4QY8A 3TV3H 4DKFH 2HKFL 1OAZH 4QGYA 3WKML 3FQUA 4MNQB 4R9HA 3SE8L 1A5FL 2NYYD 2R23A 4YO0B 1T5XA 2P46B 1TMCB 4YHZH 3TNNA 5MI0B 43C9B 2AGJL 4WNQB 4HIJA 1CFTB 1R5IB 2CDGA 2O26U 3SDCB 3GMPA 1PZ5A 4H26B 3UCRA 4KJYA 3VXUA 4GKOA 4G7YH 3P11H 5F1OB 4FTVD 3CC5A 4JZJB 2NXZC 3SO5A 2IPKA 1S9KC 4S1RL 3I75B 4ONGL 3P9LA 4AIZB 1I3RA 4WFED 1E4XL 2AQ3A 1BOYA 5CP3A 4MNGA 3ECBA 5KSAA 1NBVH 1TTFA 2NY5H 3VW3H 2EC9T 2EDJA 5EULV 3ALWA 2FDBP 4ELKB 4Z7OE 5JOPE 4L4TD 2A9ML 4LAQL 3RJQB 2GI7A 1FQ9C 2YD6A 2ADIB 2DWDB 3LKPA 1JP5A 1UWXK 3MBEB 5E4EC 4DVRL 3H7LA 4Q0XH 4GW5A 5IF0B 4UQ2A 4UB0H 3AS0A 3FFCB 1YY9C 5DI8B 2WBJD 3U36B 1DBBH 1TVHB 2HJLB 3KHOA 1JK8A 1KJMB 2ICEB 4MLIA 2Z92B 1WWCA 3ARZA 1B4JH 1A4KB 1LMKA 4HZLB 1H3PH 4U6XB 1A8JH 4LLMA 1U3HB 2EZ0D 5C0FB 4LSVL 3QDJB 3DX7A 3HHRB 1WC7B 3EBAA 1B0GB 3FTGA 1OTUC 4OCLC 4OCXH 1WITA 4E41B 5KVFL 4P5TB 3ARUA 1EEYB 2UYLB 4HUUB 4Z0BH 2LV4A 4I48B 4LDLB 2YEZB 1JHKH 5E0QA 4YXLL 2HH0L 4PJEF 3SQBA 1IAKB 2IPUG 3LPFA 2G5RA 4CNIA 1IVLA 2J8HA 4AEEA 2HVJB 1FSKC 4DOHB 3BYTA 4JE4B 2C26A 4WHYG 4P2RA 3RP1A 5LAXB 1EMTH 3QEQD 5DD1L 2IBGA 3GMOB 3RY6C 3VI4F 1A22B 1K6QH 1FBIH 1YNLH 3V2AR 1MCKA 1IM9D 3O6LH 2WV3A 4L3EE 4Z7UA 3UX9B 5GGVL 3GFUA 4ZPVB 2BOBA 3UDWC 4NCDA 1EHNA 4JFDE 3RL2A 3RWJB 1JF1A 3MBEC 3TO4D 3SDAD 3C5SB 4XWOD 3C5JA 3SKMB 4PJ8B 1XGQA 2VWEE 4ZD3L 3QQ4A 3VD3A 4X9BA 3IXAB 1B0WA 1DBML 1S9XA 4ODWA 5EC2B 2W0LA 3HPLB 5C0CB 3JV0A 4XAWL 4X5WB 3HI6H 3OKOA 4L5FH 3EO0A 1HDMA 4IJ3B 5HGAB 1ERNA 4NC1E 3RZCC 5JXEA 1S9WB 1A4JB 3QRGL 4PJEE 1QSEB 2NX5E 4NQCD 5EWIH 5JOFB 4KK9D 5C9KA 2XY1A 3PWJB 1K85A 2H26A 4HC1A 1WBYA 5T1LD 5IFHH 4X8XA 3GMMA 4TUKL 3VXTB 4WI7A 2VL4A 4OZ4A 3VI4E 1FVCA 4GQ9H 3DX8B 2DM7A 3IFOA 5FKAB 4XHQA 1LO0L 2WWMC 5ID1B 1MLCA 3IJYA 4ZUSB 5D7LB 4R7DB 2W92A 1YY8A 3MNWA 1HYSC 5KG9B 3HC4L 1OGAB 4GAJH 1BM3L 4GS7C 5DRZA 8FABB 4JHWH 1H5BC 3ZSTA 4DGVL 5MERA 1I3GH 1CIDA 3HLAB 3LKQA 5FECA 1YNTA 3RL1A 3MOAH 4P5MB 1F4HA 3UZQA 4FMFA 1NAKL 3Q6FB 1T5WA 2FBJH 3HB3C 1JBJA 3VFGH 4RGOL 3V52L 5F7YC 3VG0H 2A77H 5DQ9B 2VKWA 3S96B 3ULUF 4HK0A 1K9TA 4YAQA 1FNGA 4OLXL 3VXRD 3MO1B 3T08A 3KPOA 4GQPH 5D70H 3HA0A 4DN3H 5F1NB 1MCFA 3JV4A 5IG7B 1I9EA 1VEMA 1N4XH 4NQDB 4WUUB 5JA9A 1VENA 5FIEA 2X4PB 5D7KE 1GIGL 3LV3A 4KI5D 4NBZB 4LSTL 2QBWA 4CADB 5C0ND 3UTSB 5T1KA 2NY1D 3QIUC 2XKNA 4MJ5A 5J6HA 4K3HA 4QHNB 5D6CA 5EIVA 4ODHH 5B39A 2DWEB 1MHEB 4OF5A 5DJZA 1FZJA 1FLRH 4JFQA 3RWCA 2JIXB 3SJVB 2VLJB 4M6OH 3BH8A 4NNXA 1U8PB 4G5ZL 2RJMA 3WIIL 4R0LB 1P7QA 5GRYA 3FRUB 3MV7E 5E6IB 2DKSA 4XNZC 3ZKSD 5GQBA 2BP3A 4JN2A 4LVOB 1HNGA 3T3PF 1UYWL 4I18A 4JCMA 3ULUE 4UAOB 5H37G 4DZ8B 3HAEA 1NGPL 4OTXL 2M8XA 1UB6A 4CUCA 4NGHH 3OJ2C 1FLTX 2ARJB 1OHQA 2W9DH 1SJHA 3D0VA 4F33A 5JNYB 2GTWB 1IGTA 2D0HA 1KXVC 3QDHA 3ARWA 4ACPA 2QSQA 1NCWL 2DBJA 2KKQA 4L1HA 5D1QA 4XP9H 5BVJA 4HZAA 5E8PA 3O4OC 5JW3H 4PJXA 1CXEA 4MAYD 3I6LE 3WUWA 2AV1B 3KPQB 3SKJH 1MFEL 3DBXB 4WJ5A 4CVZB 3GSVB 4D0CB 3DV4A 3O2VL 4UT6L 3L9RA 2ZSWA 2FX7L 5FGSA 3REVB 5I8EB 1X5LA 3DNKA 1DLHA 1BJMA 5IVXA 1P4LB 2JJTA 4OLEA 1AGCA 3HR6A 3VD7A 3ZE0E 3QQ3A 2BY1A 1G7HA 3I2CL 3DO7B 3DVGA 3HZKB 3QG6B 1JUFB 3T65A 1B0RA 3MR9A 5F88A 4AENB 4PJ7A 3ZYIA 3T3PE 2EIBA 5DJXA 1RZFL 2Q8BL 2AKRB 4M02A 3BSZL 2WINB 3X13A 5FYLD 2EKSB 1LE9B 5D71H 5D7IA 4MSWA 3KAAA 1HSBB 3ME0A 1MJ7H 5D7SL 5E6IC 1X5FA 2CMRL 2E7BA 3H42L 4JM2A 3IFLH 4MQSB 4NRXB 4BELD 2EDOA 2APVA 4R4NC 4DEPB 5EZLB 3FOMA 4ZOCA 2DQCL 3GK8L 1T22B 1EUTA 1JPTL 1NLBH 4M43H 1HWHB 2X7LB 3FN3A 3GSRB 2LAGB 5TH2A 4MNGE 5F6HJ 4X4ME 4RRPA 5I8KL 1OB1B 3LRSA 5F6IC 1OT1A 1V7ML 1HHGB 2BDNL 4RX4D 2X4RB 3FQRB 2MHAB 3VFSB 3MFGB 2J8UF 2XNAA 4MXVF 2VXUH 3PHQA 5BOZG 2VH5H 5IMLB 4Z7UF 2DLHA 5EU7C 4KZDL 1VPOL 3O3DA 1UWEL 1U95B 3IDGB 2ZUXA 3TVMA 4C83B 4NQXA 2ZPKH 4JRXB 4DCQA 1JJUA 3ZDZF 1CT8B 5KVEH 4OQ1A 4P0DA 1H3TA 4QRUB 2NY6C 2HRPH 5CEYA 4AG4H 3PIQB 4X80H 3BGFB 4GFTB 1U8MB 3GIVA 1YC8A 4D3CH 2VLLB 1S3KL 4OM0L 2ZUQB 1S7QB 5JA8B 3CIQA 5F89A 4WEBL 3FO0H 2O61B 3CSYB 4CAGA 2D7TH 1J7VR 2P49B 4EVNA 1RUPL 1KEGH 3BMWA 4PRPB 3LIZH 1ZSDB 1NUFA 1IKNA 2QADC 1NFIB 2JJVA 4GSDL 3KPTA 4Z77B 1RHFA 4MXVE 3MNVA 1NLDL 3BKJL 2CR6A 4Z7UE 1FZKB 1NFDF 4ZUVA 1S5IL 3O8XC 3OAZK 3OG6B 3QIBD 3CDFA 1R5VB 3SE4A 1MLBB 4WFGD 3ZDZE 3KYAA 3ILQC 1KCKA 4NQVB 3IVKB 3GJFA 4HBCH 4LSUH 4L4JA 4PJ9B 5DSCA 1MI5B 1YMMA 4Z76A 1V05A 3QUKB 3Q6GH 4S1DD 1NFKA 4LSQH 4E5XB 4TPRL 1DBAH 4ODVL 3S3SA 3FB8B 5HDBF 2YOCA 1I7ZA 3BGFC 1CD9B 4A6YB 2X70A 2HRLA 4TVPH 3PGDB 5JO5B 4PYGA 3VMPA 3X11B 4RQQB 4PUBH 1LO3H 3LOWA 2PCPA 4M1DL 1QVOA 2P24B 2W65A 2I60L 4IHOB 5IHUL 1IEBA 2ATPA 3VDBA 4RGNE 1KFAL 3HPJA 3GSQA 2FIKA 4I5BA 5GRJH 5JMRA 1XIWB 1LHZA 4YNYB 5I1LA 5EIIA 1RUQH 2QSVA 1MNUH 1NFDE 4YX2H 4FABL 2HTLC 1CICA 5ALBH 2E7LC 2EDTA 1N0XL 2XOTA 1T0PB 5M94B 4I9WD 4O9HH 2QQLL 3S34L 2X4OA 4HS8L 5I6XB 4CKVX 1WWBX 5DJYA 4PBWD 4HLZH 1Q9LB 4P2QE 3EKCA 1FO0L 3DETD 2NZ9D 1I7UB 2JCCB 4JLRB 4AEIL 4P5KB 5T3XH 3CFCH 2BY2A 3NTCH 4OLUH 4XC3L 3C60A 1UJTA 4OZFA 5CGMA 4AL8L 1MCJA 4ZAKD 5HDBE 4NNPH 4WO4A 4IIQC 4KWUA 4K7PL 3MJ9A 3PWLB 3L3KA 1A3QA 5F7LB 4FQQB 4PJBA 1AD9A 4X5XA 2PF6A 4JO4H 1QKZL 1HIML 3O4LD 5EO1B 3D87B 1DUYA 1KG0B 3OKDB 1RIHL 2AXJA 4TNWK 2BCKB 4FZEH 2XG4A 1KBGL 2WLZA 2JLLA 4LSSH 1KB5A 2VB5A 1I9IH 4YDIL 5E00A 3S36X 1C7TA 1RU9H 5K9OA 4M48L 3KR3L 1QZ1A 1GZPB 5EORL 3IAGC 1AE6L 5E7BA 3ARFC 3IB4A 2X1QA 1OAXL 1MRFH 5ECJE 3HE6A 5BO1L 3WIHH 5FYJL 3QCVH 4KHXH 2I25N 5ILTL 3GI9H 2BVOA 3EOTH 3QWOA 2C9AA 2VXSL 4X8JB 2ZWLT 4U7KA 2R69H 1OAKL 4NPYB 4JFDB 4PJ7F 5DURB 5CZVH 4NOFA 3V6FA 4LLVB 2CUHA 1A3RH 1R24A 4HJJL 4I3RL 4G6AC 3WS6C 5D7IF 3REWB 1JV5A 1I7RB 3FAXA 4ZQKB 4JM2F 2R1WA 1KIPB 2E3VA 1U6AL 2R1YA 2EYTB 4KRPC 4OFIA 3QA3B 1BBDL 3MV01 3G04B 3V4VH 3MLVH 2LU4A 3WLWD 1UJ3B 3LZFL 1B3JA 5HYFA 4HQQL 3EGSB 1WV7T 4ETQB 4DZBB 5IV2B 3M1BA 4KJQC 1FYTB 5CJOH 1DVFB 4J4PD 4PJEB 5MP6H 2NX5B 4R26L 1VGKB 2BXZA 1ZHBB 3C9NB 3MRQA 5TPWH 4YR6A 3WIFB 1FFQA 2E6PA 3U82B 3V7AG 3SCMB 3KJ4C 5B22A 4J7RA 3FQNA 2DL9A 1C5CL 3KYOB 4LOUD 3RUGB 3T8XA 3WFCL 1HZHH 5BVPL 3NIFF 4K3GA 3HNVL 4QHUA 3NOIA 1TVDA 1NEZA 2N4IA 4NQSA 3G9AB 1Y6MR 1YEHH 3GBNL 3CFEB 4G8FB 2B2XL 3P0VL 3P30L 3SGDI 3U30B 2QHLA 4NN7B 1R6VA 2AABL 4PJ7E 2IPUK 4U3XA 5DD6B 4LGSB 3ROOA 5EUOF 2GCYB 2NLJB 1FFOA 3BT2H 3B83A 1CDBA 2YA0A 2IFFH 3BQUD 5D7IE 1ZHKB 1F8TL 3S98A 5SWZB 3EO1A 4NZRH 3HKFA 15C8L 1LEKB 2IFGA 3QDAA 1CD1B 2IQ9H 3NFNA 1DQJA 3G08B 1F11A 4Z7WA 3WBDA 3WD5H 3UC0H 1J1XH 3MXWL 4HS3A 3BP5B 2ZG3A 1ED3B 1EO8L 2EDFA 3VXME 4GBXB 1Z9LA 1QFWH 4XNXL 1FNAA 2OXHA 1MFDL 5FO9B 1HH6B 1MEXL 3IDMB 3C8DA 3AFLA 3N0PB 2R4RL 2CKNA 1D5BB 1MF2H 5FYKL 4L8SC 1IGFL 3NIFE 4EI5B 4UTAH 1RURL 5E2VL 4PS4H 3H6JA 5DT1L 4XC1H 5GS1B 2XWTA 3S4SA 2GJ6D 1VA9A 1CGSH 1GGIL 1C16A 3MMEB 5FUCC 3WUZA 5I0ZA 4ODSH 3CUPB 4TULH 3GRWH 4R4FH 1ZS8A 4FXLA 3MROA 4MA3A 5I30H 1T3FA 3FO1B 5EUOE 4BFEA 1MH5A 3C5ZB 4HKXA 1S7UA 1U8HB 3BKMH 5I1AB 1MCPH 3UZEA 4L8DA 4KXZH 4YE4H 1IGIH 3EHBD 2OBGA 3Q1SH 1JNHB 1AQKH 3PGCA 1UM5L 2NR6D 4PGDB 4LLWB 1JGVH 3ARGB 4CBPA 3EYUH 5HVGB 1RJCA 1AGFB 1YJDH 1TJGH 4G43B 1VFBA 2Q76B 4D94A 4GRWH 4PBVC 1J86A 2YKLH 3DMMC 1OTSD 3KWWA 1QOKA 4MXWL 5C92A 1FAIH 3NVQA 3VFNA 3ZYJA 1QHPA 2R0KL 2FX8H 4JY4A 5L8KB 4H25B 2VITA 4YWGH 5D7JC 1U2HA 4Y4FB 5CKAA 3BPCB 5CP7B 1DDHB 3TWCH 4P23B 3MLZH 2UVFA 3ARSA 3LN9A 2VIRA 5DYOA 3CU1A 5DHVH 4EI6B 1QA9A 3BO8A 4JFFE 1BAFH 4TN9A 3BW9B 4U1LB 2X4NB 3LS5H 5IMKB 5HXMA 1SJEA 3L3DA 5DDHA 2Q7NA 3OPZH 5KSBA 3RPIA 4W81A 2CDFA 3P3YA 4Z78B 1JPGB 4QY8B 2PXYD 2VQ1A 3TCLB 3FHQA 1MJUL 3FQUB 5EPMA 1Q38A 5D8JL 1G7QA 3QBTB 1SBSL 4Y1AE 2R23B 1WVZA 1T5XB 2VZSA 3TNNB 1NMCC 1T80A 4HIJB 5ESAA 1GGBL 43CAA 3C09B 5IVZA 1K8IA 2CDGB 3IKCA 2APFA 3GMPB 1PZ5B 4PJBF 1CXLA 4KJYB 4HT1H 4Y0GA 5EU4A 3R8BB 1AIFA 3ZT6A 5I18L 1TJIL 3CC5B 4UNVA 1TZIA 3QFJD 1TTGA 2IPKB 4K2UL 5DD0H 5D6DA 1I3RB 1KLFA 5B8CA 3D1MC 4M6AA 4MNGB 1DJSA 5KSAB 3QUYD 4LLQA 5IB2A 5IJKA 4LSPH 4JG1L 1G9EA 1GL4B 1BD2D 4M1CD 3RGHA 4JANA 5I1HL 3CVHH 3EOBA 7FABL 2YRZA 3RBGA 3LKPB 1FO0A 2VDLL 4NUGH 5A3IC 4ELMA 2HT4C 4NO0D 4OM1H 3VGFA 4M7KL 1EV2E 4GW5B 3KS0J 2ZCKL 4UQ2B 5EU5A 12E8H 2P5EA 3I84A 1N5AB 5F9OH 1KB9K 4HULB 1JGLL 4W70A 1YY9D 2O5ZL 1OTTD 1JK8B 4HSQA 5IT2L 4M00A 5FCSH 5CILL 4LLMB 3TBTA 1J5OH 4KFZC 1FCCA 5J0BA 4J3XA 5TDNA 3DX7B 1U92A 4PJBE 3W11C 3FTGB 1BF8A 3F7QA 1FYHB 3P0GB 1OTUD 1JNJA 1QO3A 4MNQD 4I8DA 3QCUL 4KGJA 3PABA 3PDOA 3CLFH 4WHTA 3QPXL 1M7IA 4EUPH 3N9GL 1PBYA 3BUYA 1CU4H 5J13B 4JGMA 3SDCD 4PJDF 5GZOD 3HCVA 5CJQL 4PRHD 2YR3A 3QIWC 1BWWA 5GHWL 2QSTA 5E4IA 5FGBA 4P2RB 3RVVC 5TQ0L 3LN4A 3M8OL 3BVNA 1FFNA 1GYAA 2WIMA 2L7UA 1A7RL 2R0LL 3RNQA 4IBLT 2ARWA 4Z7UB 4K8RL 2BOBB 3QNYA 2Y6SC 2D3VA 4KJPC 1RVFH 3RL2B 1UA6L 2BJML 4JDTH 3UJJL 4JFEA 4S11A 4XTRC 3FONA 1EGJH 3MBED 3C5JB 1HI6A 1XGQB 4K3DH 4MHHI 3OB0H 4OI9A 3QQ4B 3QAZC 2RFXA 1S9XB 4ODWB 3BDYL 3FFCD 4NFDA 5LCVL 5HGBA 1PEWA 2ORBL 4WEUD 4IRZH 4Z7WF 2YPLA 3OKMB 4PJGF 3OKOB 1QLEL 3EO0B 1HDMB 4WCYH 2B1AH 4C59B 4B41A 4QYOA 4HKBA 3QDJD 4X83A 4PJDE 3W9DA 3QUMA 4ZSOA 2H26B 3CH8A 1WBYB 4OCWL 4E41D 4P5TD 1TQBC 2OCFD 2J6EH 4NJ9H 4P46A 4ZTOL 3GMMB 2XACC 1TZHA 3IU4H 1D5IL 1ORSA 1HWGB 4OZ4B 4RGNB 1FVCB 5IR1A 3Q5OA 4YHNA 2ZUVA 5J13C 3IFOB 2A1WL 5IGXH 3L5WA 1OPGL 2WWMD 1MLCB 2EDQA 3IJYB 1PX3A 4P9ML 1YY8B 3MNWB 4MA8L 4P4KC 3VFUA 1CDCA 1RUKL 1XR8A 5DRZB 5MERB 3QEGL 4WTWA 3LKQB 5FECB 1L0XA 1YNTB 4LEXH 4O5LL 3RL1B 1S5HA 4KMLB 4L9LA 4K8RC 2NTFA 3WHXA 2HLAA 2VLRA 1F2QA 3PWNA 2AK4A 1MJ8H 3BPNB 1T5WB 4QRRA 2FH6A 2E9JA 4HXAL 3HB3D 2A6JA 4Z7WE 4DN4L 1MAKA 1MVUA 4PJGE 5ANMA 1EUUA 4OFYA 2J88L 2ENYA 4YAQB 1FNGB 5I19L 5DUPH 4M7LT 4PJ8D 1UWGL 5DXWA 4Y2OA 5DUBA 5A43C 1YA5A 1NC4D 3KPOB 4TSBH 4DQOL 5I1JH 1N6VA 2VJXA 3IYLW 3ZTNL 4EXKA 3RGVA 5C0CD 2DTSA 1J11A 3JV4B 4POZD 2W38A 4JHAH 1AQDA 1KCVL 4PG2C 4F7CA 1K3IA 4OKVA 5JXEC 3ZHLA 4M03A 2HMID 3A6CH 3CZFA 5IHZA 1KELH 1QSED 2BNRA 3O45A 4C58B 1CLYH 4NKDA 1PJ9A 4KUCF 5F7EH 4KRNA 4JVUA 3W81A 5T1KB 2XKNB 4MJ5B 5J6HB 1UVQA 3QIUD 5D6CB 5B39B 3UJIL 4EKXA 5KSBF 5DJZB 1FZJB 2QLVB 4JKWA 1LP9F 1UFUA 4JFQB 3RWCB 3BN9D 3BH8B 4NNXB 1HXYA 4QHLA 4GT7A 5D7LD 5C2BL 2P45B 1DBJH 2N1KA 4N8CL 4UQ3A 5H8DA 2IAMA 1FNSL 3FN0H 4XVTL 4JN2B 5C0IA 1OGAD 3O2DH 3RHWK 4I18B 5JW5A 3TT1L 3MV8D 2FD6L 3HAEB 3OGCA 5HDQH 4KKAD 1UB6B 3C6LB 3H9SD 3S7GA 1SJHB 3BPNC 3D0VB 1J1OL 4F33B 2R0WH 5JW4N 1IGTB 4HV8A 2XICA 4NKOA 4HWEH 3I02A 3LKNA 4QLRA 4FRWA 3QEUA 5D1QB 4R2GB 5E8PB 4OZHA 4X9GA 1CDYA 4PJXB 3WUWB 2DYPB 3VRLF 1KEMH 4WJ5B 4TUJA 3AREA 3TA3A 4YXKH 3DV4B 2CK0H 2KQMA 4HH8A 4P2YA 1W72H 2ZCHH 5KSBE 4WUUD 3L9RB 2ZSWB 2X9YA 1AI1H 1DEEA 4TOYL 1DLHB 4NBYB 1KJVA 3PGFL 5L0QB 1AGCB 1SMOA 3QQ3B 4M5ZL 1G7HB 3UTSD 3DVGB 5I66A 5IB4A 3T65B 1B0RB 5CJ8A 2ZUTA 3MR9B 1JE6A 3MGTA 2C7UA 5F88B 2DMCA 4PJ7B 1T1XA 1F5WA 5DJXB 1WUNT 4P49A 3IJHA 4GMSH 2JIXD 3TCXA 2FNBA 4XCCH 4XNMA 3X13B 3RIFK 3VXOA 1WZMA 5D7IB 2M1KA 4MSWB 3LMJL 4DFIA 4JM2B 5E6ID 1ZLUK 3FFDA 5JHLH 4LVNC 4FZ8L 2CLZA 3FOMB 2EKJA 4R4ND 4BYHA 2E9WA 5LQBH 3TT3H 4I0PC 1SYVA 1U93A 1SVCP 1WLHA 1ZVHA 4HIHA 1A7PH 1OSZA 4KUZH 4MVBC 5TH2B 4RFNC 2XZAH 3ZYOA 3LRSB 4Z5RA 3QDMD 3UTOA 3VRLE 1INEH 3N85L 5GS0H 4L8CA 4RAHA 2GIYA 2YPVL 2XNAB 4K3JH 5GGRA 3GUTA 1T21A 2QL1A 3PHQB 4LMQI 4X4ZA 4JPWL 4EOWL 2OL3A 2P5EE 3S36H 3NABH 4PP1D 4LQFH 4ZXBC 3QO0B 2Q3ZA 2DQHH 3TVMB 5C7XL 5FDWA 1HINL 1NMAL 2APXA 4NQXB 1QRKA 1YYML 4Y5YA 3ZKMD 4DCQB 3LB6D 4M9OA 3UBXG 1U8NA 1I1FA 3U48A 4JEGB 5F3BA 4LCWA 1PY9A 5CEYB 2NY6D 1F3DJ 4U2ZA 1CXFA 5GGRY 3GIVB 4YHLH 5DD3L 1RZ7H 3LDBB 1E28A 1ZVSA 4S1SL 3GMNA 1QFWI 5F89B 1ZT4A 1JWUA 4JO1H 4J1UA 3F62A 5CLTA 4ZUUA 4EVNB 2A0LC 4F15C 3ARBA 3DXAA 4NM4H 2RIKA 2C4XA 4O51A 3X3FL 4O2FA 1FNEA 3TYGH 3D69A 3OMZA 2DI7A 4OLVL 3VFOA 3BZ4A 3MNVB 3BZEA 2OP4H 4DGYL 2A74A 2GAZB 2NY4B 5AG8A 4ZUVB 4TNVK 1J1PL 3GKWH 1UM4H 4KMTL 3ILQD 1MRCH 3GJFB 2VDOH 1RFDL 4LDEB 5DSCB 2OLDA 4XP5L 2DB8A 1YMMB 1JFQH 4E9LA 4Z76B 1E4KA 2YPLE 4O58H 3D2UA 4Y1AB 4BSJA 3TBVA 5HHOA 4HWUA 4GRLA 5JR1L 1I7ZB 5C0BD 1OVZA 2X70B 4ZO9A 4WIQA 4ZSOE 5BZDB 4U6TA 1MCOH 4HEME 5SX4H 3VWJC 2PCPB 4PJFF 3AU1B 2IPTH 2W65B 1IEBB 2ATPB 4UUJA 4QHKI 4OB5H 3HPJB 3GSQB 5INDA 4NRYA 2FIKB 3WSQH 1ETZA 4I5BB 2EDEA 1QFUH 4WY7L 3K8KA 2J4WL 1HKLH 2ESVE 5T3ZL 5I1LB 5EIIB 5K9JH 3K8LA 4WDIA 4PRPD 1CICB 2K7PA 2HT3D 2HTLD 3IT8D 3GIZH 4IOSD 2DLFH 1FPTL 2V9TA 5I15H 5BW7A 4YK4B 4FQJL 2X4OB 4FQCL 5F9WC 3NZHL 2AJVL 4KKLD 1ZEAL 4MHHG 4KZEH 4CGTA 2VLRE 3KJ6L 3MPCA 2NY3C 5DJYB 3V4PH 2AK4E 4X5LA 4QRRE 4RNRA 4WV1A 1HSAA 4YBLC 1HE7A 2LU7A 5ANME 5CHNA 4Z0XA 4N5UA 1F3RB 1LGVA 2VXQH 3C60B 4HGKC 1GC1L 4OZFB 4WO4B 2P7TA 2AEIT 5D2LA 2HFTA 5FYKE 1M4KA 2FEDC 2VDPL 1B6UA 1U3ZA 1MI5D 1PYWA 1U0QA 3L3KB 5CAYB 3GSNL 4RIRA 4PJBB 1SYSA 1AD9B 4X5XB 4XH2A 2XQYK 3BP4A 4EZMA 5IVNA 1DUYB 4OZHF 1G7MA 5L6YL 1RZKC 4LLDA 3TN0C 1T6WA 2BNRE 1KB5B 3TF7C 4MX7A 4P9HH 3OXSA 5E00B 3RBSA 2NQCA 5KAQG 4Q6YA 4PJAA 3QXWA 1EERB 5ABDE 3QB7C 3HE6B 1DCLA 4KQ3H 1JPSH 1A6PA 1XIWD 1HILA 4UOW1 2UV3A 2H8PB 3LQMA 1CLCA 3RX7A 2BVOB 4GAFB 3QWOB 3LKSB 4I2XE 1P53A 3PWVA 1E6JL 2F58L 1J9CT 2PETA 3PJSA 3H3BC 3V6FB 2MCPL 3N1MC 5JOPD 1DE4A 1R24B 5D72H 1JV5B 2NZIA 1A7OL 2R1WB 3HFML 2R1YB 1YEKH 2NXYC 1K4CA 1X5GA 2D31A 4XPTL 4QRQA 1W8NA 3BUTA 4KRPD 5E7FA 3C60C 4WWKC 4JHBA 4OZHE 4LVHB 3LPWA 1I4FB 3T2NH 3M1BB 1JNLL 2UZYB 1LO4L 3MRQB 2XZCH 4YR6B 4ZS6D 3TYFB 1KENL 3U9UA 2C3GA 2CDEA 5C2UB 4PJDB 3TJEH 2MPAH 2F15A 1MAMH 2YK1H 4OKDA 4ZS7L 4O02H 4X6DF 2WK2A 3G6AA 3T8XB 1CL7L 4OJFL 3UAJC 5CSZA 1CTNA 3VRIA 4QHUB 2BNUA 3DURA 3TIEA 1NEZB 4H20H 4O4YH 2LE9A 2G60L 4NKIL 5TF1L 2ERJB 2F8XC 3QHFH 4A6YH 4OV6F 3O0RH 1D9KC 5DC9B 1OAYH 4U3HA 3HE6C 4M5YH 2KZWA 3ROOB 3RX5A 2HJKA 1FFOB 4HWNA 3PWPD 3ZE1F 3P77A 3SE9L 1GJIA 5C0AA 4KPHL 1Q0XH 3MNZA 1P7KA 32C2A 3EO1B 1V7NH 2R4SL 3NFNB 5DURD 1DQJB 1ZLWH 1F11B 4Z7WB 4LRNH 2FHBA 4HS3B 1IAIH 2VR4A 1Z3GL 3ZL4L 3SE3C 5KVDL 2OK0H 5C6TL 1ONQA 4DKDC 3I6GA 4XB8A 4PTTA 3QUXA 1CGYA 4HJ0C 4X6DE 3EJZC 3Q5YA 1BWMA 1I9JL 3KYNA 2XZQL 1TVBA 4Q58C 1FYTD 2WW8A 2VDNL 3CLEL 1R3HA 1WEJH 2XWTB 3S4SB 3DPBA 5EBLA 2R56L 3L5JA 1C16B 2AJSL 2VNCA 3SCMD 5FUZH 3S5LA 5IJVA 1Z6JT 5F6HI 4OCSL 3RZWA 4YQXH 5GGSY 1AJ7L 1QNZH 4LCWE 1ZS8B 4S0SD 3MROB 4MA3B 2FBOJ 1T3FB 2YD1A 1MH5B 1CBVH 4TNWF 4M62H 4HKXB 1S7UB 3ZE1E 3C8KA 3MCLL 4IRJA 4DTGH 5EC1B 4L8DB 4UT7H 2Y4SA 1NMBL 5L2KA 3PGCB 2ENSA 1LK3L 5FYJU 3AUVA 4TYUA 5J56B 3CDGA 3O3BA 5JUEL 1VFBB 4CRPA 3CMGA 2HFGH 5IFJA 3WV0A 3KWWB 5CBAA 3DMMD 5SWZD 3VFNB 1CFVH 2JB5H 3SKOA 1TTUA 4Y4HC 3KPRA 3B2VH 2AQ2A 2VDRL 4JY4B 2VITB 1P9MA 2XV6B 3WJLC 5CBEB 2IH1A 5C0JA 4B53A 2VIRB 1BZQK 1TPXC 4XP6L 5I1GH 3MA7A 1QA9B 3BO8B 4HGWA 3B5GA 5ID0A 1A7NL 4AZ8A 1JZ3A 1A1MA 1DQDH 3ZMRA 1SJEB 3L3DB 5KSBB 2YD2A 4EI5D 1TNMA 4WTXA 3RPIB 5K59F 5J06A 3UO1H 1BF2A 2CDFB 5D7KD 1XGRB 3PP4L 2BOCA 2YHGA 5BRZD 3WHE0 2VQ1B 4JQXA 2OI9B 5EPMB 1G7QB 2F5AL 4ERSH 4HCRL 5B38G 5I74C 4KK8C 5D2LF 5JXAL 43CAB 5IVZB 4QCIA 4LIQL 1K8IB 3C5ZD 3IKCB 4GAYA 4J3UA 3C08H 4QKXB 4IDLA 4NWTH 2WUBL 4QXUH 4DFHA 5IFAL 4XCYA 5IWLA 3VH8G 1BIIA 5EU4B 2B4CL 1AIFB 2BSTA 3I3DA 1TZIB 2BX5A 1PY4A 4X9HA 2OJZH 4M6NL 4FQXC 1CCZA 3STBA 5B8CB 2VDML 5IB2B 4LLQB 4PJAF 4YHYB 2YWYA 5EUKA 5DC4B 2B20A 3ZTJG 5F1KC 4JANB 5T1DL 5BS0D 3EOBB 3V6OA 2YUXA 4BH7A 2MJWA 4Y4FD 1B88A 1FO0B 3T09A 1RULH 5K59E 3OX8A 3WIHA 4P23D 1G1CA 2HT4D 2P5EB 4S10A 1D6EA 3LN5A 4OLZH 3RWGA 5FGCE 3MLUH 3B3IA 4XPBL 3U7WL 5KOVC 3LD8C 1M05A 4AMKH 4M8VA 3TZVA 4LPXA 2WBWB 4NO5A 5DVMA 5D2LE 3TBTB 1WT5C 3OAYH 4G9DA 2FYYB 5C0GA 3T0EE 5TDNB 2VQTA 4ODXB 1U92B 1ZTXH 3W11D 4LKXA 1QO3B 2J8OA 4D9QE 3PABB 3PDOB 2HG5A 3A6BL 4U6VH 4WHTB 2W9EH 1M7IB 5HHME 3SDXA 5JHDD 2EDDA 1FH5H 3BUYB 5HTSA 3K2UL 4IOFC 1KCUH 2X1WL 3ORJA 3UPCA 4F2MA 3HCVB 3VXUD 3HE7C 4PJAE 1IGMH 1JMZA 3BKYL 3JVGA 5C08A 4MAUL 4UV4H 3RVVD 1JIBA 1JWSA 3LN4B 5ACMA 3BVNB 1FFNB 1RD6A 3INUH 4TSAL 2XYCA 1BJ1H 3LSOA 4UNUA 4WTZG 4ZUTA 3RNQB 5IJKC 5KSAD 6FABH 1B9ZA 2XZZA 2FGZA 5EZIH 5GGUA 3D3VA 3QNYB 1YEJL 3ULUH 2Y6SD 5DMIL 5DD5L 4KJPD 4QT5A 1E4WL 3OJVC 2HVKA 5I76A 4JFEB 4XPFL 2E8ZA 3FONB 4XTRD 1F58L 2Q7YA 3ULVL 1HI6B 3SKNA 2BERA 4P48A 2AEPL 2F8OA 1BBJA 2RFXB 5HGBB 4OGXL 4NNYA 3NACL 2YPLB 1G6RL 3BD5A 4HBQA 5HI5D 4Y4KC 4DWHA 1FNHA 3MA9H 5JQ6H 2E27H 4L3CA 1T1ZA 2VZ3A 5F7NC 3EDKA 3ZDXF 4QYOB 3V6BR 1A6UH 2QTEA 3W9DB 3QUMB 4ZSOB 1A6WH 3ABZA 1KJ2A 2DIAA 5EU3A 1P1ZA 4P46B 4JKPH 1TZHB 4DGIL 1ORSB 3B9KC 5IR1B 3DJ9A 4YHNB 1MIEH 1IM3A 2F9BT 3L5WB 2FJGA 2R29L 3LEVL 5F3HA 4O00A 5F96L 4WW2C 3P4LA 3VFUB 4L1DA 1XR8B 4P2RD 1C5BH 3GRWA 1P6FA 3QWRA 4OBSA 1GHFH 4M7ZB 5KVMC 4EDXA 4L9LB 1GGCH 2NTFB 3WHXB 5ADPL 1XFPA 1RZJC 2HLAB 4QTIH 2VLRB 3A6OA 5D2NA 3PWNB 2AK4B 4QRRB 1IAMA 4HWBL 3IETB 3LHPL 2A6JB 5TQ2L 8CGTA 5CP3H 1LDSA 1MVUB 3BIKB 5ANMB 5L88L 3ULVC 3BKCH 5SX4I 1TXKA 2PW2A 4HPYH 1NBZA 2BZDA 5DUBB 2HTKC 5E8EA 3ZDXE 2Z93A 1U36A 2W60A 4F9LC 3QUZA 3RGVB 1YQVL 2WP3T 4V2CB 4TQEH 3QNZA 1AQDB 1YNKL 4F7CB 1FGNL 4OKVB 1G0DA 4OFDA 5JXED 1IGCL 3CZFB 5IHZB 1L7TL 2BNRB 3ETBF 3F6LA 3O45B 1VCAA 2GUOA 5EA0L 5A40E 4NKDB 2MFNA 4XGZA 3MLSH 4N0FA 4IDJL 4G7VH 1UVQB 3MUY1 5CD5C 5CEZL 1ZKAA 4P46C 3EJJX 4J3SA 3BJ91 3CVIH 3CMOH 5FHAH 2BY3A 3SDYL 3FRPG 3MQIA 2YS4A 2AI0L 2RCSL 3KLDA 4JPIA 2W0FA 4YHKL 1HXYB 4QHLB 2EEBA 5CINH 4XVSL 2HYMA 5I73C 3HMXL 1P5VA 4UQ3B 3SGJC 5C0IB 1IARB 3UYPA 2Z8VC 4HF5H 5JW5B 4YHZL 4BQ9A 3OGCB 5IB3A 2M2DA 4L9LC 2QR0A 1AGEA 1QD0A 1ADQL 3GNMH 3VWKC 5J4MA 4HV8B 1OF2A 4NKOB 3I02B 2VSDA 4MA7H 1VFAA 3QEUB 1T0MA 4XVUC 5AWNH 4B5EA 4OZHB 3AMKA 1TZGH 5ICYA 3MLPA 5KTEL 3BRDA 4G6KL 4TUJB 2OR9H 3AREB 3MC0A 5GS2D 5HD8C 3TA3B 1I9RH 2NY5L 3VW3L 2Q20A 4KQ4H 2O5YH 2R2BA 1B2WL 4CMHB 2MMXA 4EN3A 5JQHC 1KJVB 5ISZE 3OAUL 4Q0XL 1L7IL 4ENEC 4KVNL 5HI3D 5T1KD 4GW4A 1FL5A 3KYKL 1X5JA 3DRTA 3P0YL 5DEGA 5F9JA 5GJTL 5I66B 4N9GA 2D03L 1NUDA 2C7UB 4KY1H 1T1XB 5HGGS 4J2XA 1H9VA 3BI9X 2XI9A 4FQIH 3RVXC 3IJHB 3GBMH 3E3QC 4XNMB 3VXOB 5SV3A 3UJTL 1P7QD 4LRIC 1FIEA 1EEZA 2IAMC 3FFDB 4OCXL 3SDXF 4P3CL 3MRIA 1IGJA 2CLZB 4HMCA 1UM6H 4JPVH 5T3ZE 1BVLA 2CJUH 2IBZX 3RDTC 4EUPA 1SYVB 1U93B 4PYHA 4HIHB 1DL7H 4UILL 2IQAA 1OSZB 3H0TA 1NCCH 4PY7A 1WWWX 5IW1A 4LASL 4Z5RB 2FSEA 1CGXA 4AK1A 1A6VH 3MOQA 2FB4L 3MXVH 1RIVL 5GGRB 3GUTB 5DZLA 1T21B 1EMTL 5D1QD 4JR9L 5BJTA 1FBIL 4EDWH 2OL3B 3MLRL 3GM8A 3LQAL 2VABA 3O6LL 4NZUH 2OYPA 3F5WA 2NY5C 5FDWB 5E2UL 4DKAA 1K2DA 5DUMH 4Y5YB 4MA1B 2OX5A 2ZCLH 5E5UB 3ARDA 3GMLA 3F7VA 4MJ6A 3UP1A 5F3BB 2CKBL 4JO3H 4LCWB 4XCEA 1MCNA 1EGJA 5GS2H 3SOBL 3LPGA 5I9QC 3EO9H 2PKDA 1FE8L 4Z9KB 5AUMA 2YUVA 1GAFL 1FORL 1IAII 1TQCB 4G6JL 1E28B 4YHMH 2KBGA 4HXBH 1ZVSB 1U58A 3GMNB 3SDXE 3BE1H 4NFCA 4PREA 5JPNA 4Y16C 1ZT4B 1JWUB 2YC1A 5FM8A 2H3NA 4J1UB 3WXWH 3ARVA 3ARBB 2XTJC 3DXAB 4LCCA 2A0LD 1RSFA 5DC0A 4K7PX 2BHYA 1QP1A 4JM2D 4O51B 2E7HA 1T04A 4O2FB 5C08E 3NFSH 1FNEB 1RPQA 4FFYL 1P69B 5IFHL 3D69B 3IS1X 1YEEL 2P5WA 4K23L 3VFOB 3BZ4B 3T0BA 1INQA 3RHWF 2X4TA 3ZSSA 1BLNB 2NYYC 5ALCH 2A74B 4CDHA 1OLZA 3D3VE 3UPAA 1UACL 1FVDB 1S7XA 5CEXA 3VDCA 3X3GL 3HAEH 4LPCA 3F65A 5FOJA 1TJHL 1DZBA 1I3GL 3LQAC 2CLVA 3CU7A 4NUJA 4K55A 4F9PA 5DVOA 1C8PA 1UEYA 3MOAL 2DLEA 1INDH 4CW1A 3TVMD 1PG7L 1NCDH 2ZUUA 1RZ8A 1ZLSH 3CK0H 3D2UB 3AROA 1SM3H 3TBVB 4PB9L 3VG0L 5HHOB 4GRLB 4Z6AT 1ORQA 1MRDL 2YMXH 1CXKA 4GRWF 5BXFA 3GMRB 3G5XA 1QPPA 1KCSH 2ITCA 3L7FA 2HKFH 3WKMH 4Y19D 1MCWM 1MREL 5D1ZA 3VWJD 4LNRA 4X4XA 1N6UA 5HJ3A 3SE8H 4DN3L 3C87A 5DJ2A 1ITBB 4UUJB 3QXUA 5INDB 4NRYB 2AGJH 1ETZB 1N4XL 2RGSA 2YSSA 1JCKA 2BC4A 2X44D 4BM7A 4X7EC 2HJLA 1BZ7A 1LEGA 4WDIB 3RIFF 3O6KH 1U3HA 1I8MA 5F7KC 2V2WA 1KXTB 2GSIA 4ODHL 3AM8A 4ONGH 1FLRL 4QXTA 1E4XH 2YA2A 2KH2B 2NY4D 4M6OL 4GKNA 5D2NE 4Q9CA 4RNRB 2XN9E 4WV1B 1WBZA 2JJUA 4X6EA 3S35X 2YEZA 2NY7L 5FGCB 4XZUA 1HSAB 4QOKA 3PHOA 2E8YA 5CHNB 2J12B 4Z0XB 5HHXL 3O2DA 1U8IA 2A9MH 2ZJSL 2J5LB 4LAQH 2Y5EA 1GH7A 5KSUA 5TE7L 2P7TB 4K71B 5D2LB 3FQWA 4WI9A 4GRWE 2FEDD 1PYWB 1YMMD 3CNKA 4RIRB 1GGUA 3D0LA 5GRVK 5IBTL 1SYSB 3S3PA 4PRDA 3U0TA 5DTFA 4QEGA 4XH2B 4JFZH 1R3KA 1YEDA 3BP4B 3HG1A 3F7RA 4FXKA 5HHMB 3TIDA 1G7MB 4HK3N 5JLZA 4LLDB 3TN0D 3RVTC 4JM4L 4OSUH 4MX7B 1QR4A 5JW3L 3AGVA 3OXSB 3TO4C 3SDAC 3PP3K 4XWOC 4PJAB 3O6FB 2F19L 3SEPA 5LGHL 1HQRA 1W72A 2C3WA 3DGCR 1RAMA 3HMXA 4QXGL 4YXLH 1TENA 1PFCA 3VGEA 1BMGA 1HILB 3DUSA 3NPSB 3V4UL 2CH8A 3U1SL 4PIRF 3FB6A 3HI1B 4XVJH 3PWVB 1MHPH 4G8EA 3U4EA 4ZO6A 3PJSB 5BW7C 4KK9C 3UROR 1MCIA 5JTWA 1DE4B 2ARJQ 4RWYL 1QUNA 3BDBA 3VGAB 4MD0A 1Q72L 5C9JB 5ITFA 2XA8L 3NN8A 5DA0B 5GGVH 3WL9A 1CFQA 1K4CB 2D31B 5D71L 2Q8AH 4QRQB 4TNVF 1MJ7L 4U1JA 2EO1A 2VE6A 3IFLL 3R4DA 3VGBA 1O7SA 4LBEA 3C60D 1IJ9A 2A9NH 5ID1A 5KS9A 4WO4D 1EJOL 5L9DL 5LGJA 2EYRA 4JFOA 1QLFA 3SDDA 1IC4L 4ZD3H 2YXFA 1DBMH 3U9UB 2CDEB 3IDYB 3V7AE 3GSXA 2D7MA 4N8PA 3LEYH 3WEXA 3GJFH 5E9DA 3JBG7 2ADGA 3G6AB 1IQWH 1CGWA 1BX2A 1QRNA 4XAWH 4Z18A 1S7TA 5CSZB 3UAJD 4KTDL 3VRIB 2E7CA 4D9LL 4MCYA 3DURB 3QRGH 3TIEB 4HWZA 4KHTH 3DVNA 2ZKHL 5CJXC 3D48R 4I4WA 5SWSA 3UZVB 2WMPA 2IJ0C 1RK0A 5TGBA 4TUKH 2V5YA 3HE6D 2HJKB 5E2TL 4J3WA 3ZT5A 3P77B 4AG4L 4F7MA 3DX6A 3M17B 4X80L 5C0AB 1LO0H 3MNZB 4U1IA 1P7KB 4PJ5A 32C2B 4N1EA 4WI3A 4QRSA 2X4PA 1G1YA 1AC6A 4YC2B 1CWVA 2AJYH 3HC4H 4KI5C 1BM3H 4DGVH 3L5XL 1S7SA 4M1GH 2NY1C 2I9TA 3FO0L 4U1MA 1ONQB 3K46A 1T89A 2H9GA 1N3NA 3HUJF 3K1KC 4RDQF 4G8GA 1NAKH 3I6GB 2HKHL 3V52H 4PTTB 3QUXB 2VLJA 4HJ0D 2BXYA 3KYNB 4V1DA 5IIEA 3O41A 1TVBB 5FYLL 1TNNA 3MZTA 3PV7A 1VFUA 3OJDA 1R3HB 1CF8H 2H2PD 1UC6A 5EBLB 4XHJD 3S88L 2PW1A 3S5LB 5C8JA 5IJVB 3VG9C 2GKIA 3MJ9H 4ESKA 1X4YA 2EC9U 3UYRL 4L4TA 2AJUL 1URLA 5JNYA 1GIGH 5AZEL 1H15A 1SY6A 3TPUA 5ADOH 5I1CH 4IRJB 4LSTH 5JMOC 5L2KB 4LL9A 4AIXA 2WBJA 3QP3A 5DGQA 4MAYC 5D96C 1WK0A 3N1FC 4M7LL 3KPQA 1P5UA 2ZNWA 3CDGB 3O3BB 1ZE3C 4N8VA 4PFEA 3MLXL 2AXGA 4G5ZH 5IFJB 3WIIH 3HUJE 4HG4J 5CKGA 3H3PL 5CBAB 1YECL 4Y5VC 3SKOB 4Q6IC 5J1AA 4F57H 3DWTA 4ZOEA 3KPRB 3NCYS 3VE0A 1VERA 2P5WE 3HZYA 4MMZC 4H0IA 1UYWH 3DYPA 2IH1B 4YDLC 2AJXH 5C0JB 4OTXH 5SV4A 4PGEA 3O9WA 2VZVA 3MA7B 5F7HA 4HGWB 5ID0B 4KK5D 2CO6B 4YX2L 3I3EA 4UIKL 4HX1A 1A1MB 3JXAA 1NCWH 4JJHA 4Q7DA 2I24N 1JNNL 5E56A 1HSBA 5EIQA 3I6KA 3RA7L 1HH9A 2BOCB 1XEDA 5FM4A 1F42A 2LAAA 5TE4L 1IM9A 1UKTA 2H1PH 1QBLL 4HLJA 4UT6H 3CFCL 3RWDA 3T04D 2FX7H 1BQUA 2K7QA 4OLUL 2VLKA 4QCIB 3FQRA 4GAYB 2CXGA 3MRCA 4XCYB 3VFSA 5E5RB 4I13B 1BIIB 4UV7L 3I2CH 3X14A 2BSTB 3V5DA 5SX5H 2VC2L 5TFSL 4I3GA 1PVHA 4G6FD 3WCYA 4WUKL 4JRXA 4HMEA 3P9MB 1OP3H 3B9VA 3OZ9L 5EUKB 3PL6A 5D7SH 1F4XL 1RU9L 3H42H 1XGPA 3QT2A 4GOSA 2DQCH 1SJVA 4NN5C 1JI2A 4TUOA 5HGHA 4BH7B 4F7PA 1JPTH 5ACZA 2O5XH 5J12C 5ETUA 1BFTA 3FQTA 3CAFA 5I8KH 3QXDB 4FQ2L 1KLUA 2GT9A 1D6EB 3LN5B 2Q1EA 2GFBA 1V7MH 3RWGB 3OXRA 2BDNH 3B3IB 3GI9L 4KUCD 4RZCA 5IHLB 3TZVB 4NO5B 3AC0A 5CZVL 1T2QL 4YEFA 1WZLA 4Y8AA 4G9DB 2VZOA 4BZ1L 4G80A 4JQXC 1VPOH 5F44A 1AHWA 4LKXB 5HSFA 2BSED 1JGEA 2HG5B 3HG1E 3NPZB 3SDXB 3JWDL 4KAQL 4S1QL 5KS9F 4OZGF 1VEOA 4ZFOA 4XB7A 3EFFA 5CJOL 1IEHA 4F2MB 2AV7A 4HKZA 4LPYA 4OM0H 3W2DL 5C08B 1F4AA 2D0GA 1I8LC 1JWSB 4WEBH 3KPSA 3LSOB 4XNUL 5C0RL 4ZUTB 4S1DC 4MYWB 3QUKA 3E6HA 1ZVYA 3DOSA 4NHUA 1RUPH 5GGUB 1KJ3L 3D3VB 3QHZL 1YYLL 5KZCB 5FAAA 4QT5B 25C8L 2HVKB 5I76B 3V6OC 1WZKA 1HKFA 4GSDH 3ZHDA 2Q7YB 1KOAA 1BEYL 3SKNB 4PBXA 3SBWC 1NLDH 1T2XA 3V0WL 3BKJH 5J9PA 1BBJB 5GRVL 2P5ED 1E6OL 4NNYB 1DN2A 4NZRL 1U3YA 2EIZB 1FL6B 2APTA 4Y4KD 5KS9E 3BD3A 1ODAA 5C07E 2I5YL 3NZ8A 4L3CB 4OZGE 1T1ZB 4JQVA 1MOEA 5HYSA 1QFWL 3OWEA 1D7FA 5E9DE 4WGVB 1MPAL 1KJ2B 1QRNE 5EU3B 1P1ZB 4TPRH 4ODVH 5DJ6A 3B9KD 1VB9A 1F13A 1KC5L 3DETC 2NZ9C 1IM3B 4GJTB 3WN5C 3PWUB 2G75A 5SWSE 2FJGB 4JREC 5E08L 2DKMA 5F3HB 4ZAKC 4ODSL 4M1DH 4POUB 5IHUH 4TULL 3VXQA 1KFAH 4YZFF 3QZWG 4R4FL 4MQXD 1RQ5A 3O3AA 4FQQA 4XMKH 3BPOB 3MBXL 4EDXB 3MRJA 5A2JH 2EE3A 3BKML 4PJ5E 5D2NB 4FABH 1KG0A 4YE4L 1IGIL 3QI9A 3T0VA 1N0XH 5IVOA 3VMNA 1AQKL 4KJWD 4JFED 5CIPA 2QQLH 1JGVL 3S34H 2PW2B 5JPMA 2BRRL 3EYUL 4CVXA 5FF6A 1NBZB 5E8EB 4G8GE 4OLYL 3NBNA 4GRWB 2Z93B 4KU1A 2W60B 3JUYA 4JDVA 3QUZB 5HYIA 1QEWA 1FO0H 2YPLD 1FAIL 3QNZB 1U91A 1S78D 4M6ML 2XA3A 4XC3H 4L3EA 4NM8L 4AL8H 3HI5H 4K7PH 4NQEA 4WFEE 2GUOB 3MLZL 4JG0L 4JFDA 5ITBL 4XGZB 1MWAL 1YEFL 4N0FB 3CFBA 2FR4A 1U8QB 1QKZH 1BAFL 2HFEA 4P46D 1E4XI 3LS5L 5K9QG 3ARQA 4L4TE 2P8LA 1RIHH 2CRIA 4YZFE 4LDOB 1KBGH 1CDJA 4JPIB 2W0FB 3P40A 3WLWC 1SEBA 4YDIH 4M48H 3KR3H 2WAHA 1DEDA 3B5TA 3X17A 4UI2A 5EORH 1KLGA 1JI1A 1FZMA 1OAXH 2NX5A 5L7XL 5GJSL 3VFWA 2F54D 5BO1H 5MHSD 5IB3B 4OFVA 2QR0B 1YN7A 4LOUC 1NPUA 2VLRD 1AGEB 4HAGA 3IDXH 5ILTH 2VXSH 5CJ5A 4QRRD 4XBEL 4LK4A 1P84J 4HT1L 1OF2B 3C2AL 2G9HA 4R3SA 1VFAB 4OFYD 3ROLA 1T0MB 5IEHA 5DMJB 5E6ZA 4HJJH 3DVIA 4I3RH 5DD0L 3MGOA 5ICYB 3BAEH 1ZGLP 3BPLC 1KB9J 1BQSA 3RGVD 2FLRT 4KC3B 3MUJA 4I77H 3ESUF 2R2BB 2EH7L 2B39A 1XT5A 3QEQE 4HQQH 1KCLA 1MQKL 4EN3B 4YH6A 2BNRD 4Y88A 1UZ8A 4R26H 2VXTH 5DK3A 2EDHA 3O6MH 4GW4B 1FL5B 5DEGB 3MRGA 3DRTB 5F9JB 4Y2DC 4N9GB 1C5CH 3Q3GA 3QIBA 4PJCA 4JY5L 5BVPH 1PKQA 3HNVH 3RVXD 4PRBA 2VTFA 5BV7L 3MACL 3KPPA 3S35H 1MAJA 1V3MA 3GBNH 1EEZB 1U8LA 3L5IA 4CN6A 3P0VH 2IAMD 3MRIB 1IGJB 1BVLB 2AABH 4XMPL 4EUPB 1HOCA 3WDJA 3A67L 3WJJA 3H0TB 4LNVA 4PY7B 5DK2A 5IW1B 3IAPA 3KLAA 1W0YT 5EBMA 4PLNC 3CFKA 4L9DA 3QDGA 5I1AA 2ICWA 3MXWH 1QFWM 1EJ6A 1AGBA 1EO8H 3EHBC 5A1AA 2NR6C 3MV7A 2VABB 1GOGA 4XNXH 1X5KA 2B7DT 1MEXH 4LLWA 4XX1G 3F5WB 3ARGA 3ARED 4DKEL 3O2WL 4OGZA 1K2DB 4ZFZA 5SX5K 3B5HA 1IBGL 3ARDB 3GMLB 3F7VB 4ODBD 2R4RH 1C12A 4MJ6B 5FYKH 2PO6A 1BZ9A 1JN6A 4LSDA 1IGFH 3CDCA 4JDTL 4U4BA 1OTSC 1RURH 5DT1H 4LARL 1R5WA 3VCLA 5AUMB 2EO9A 3E6FB 1GGIH 2A6DA 5HDLA 1FVEA 1DDHA 4YUEL 1U58B 4IRZL 3BGMB 3PV6A 1QSFA 4PREB 4EBQL 5JPNB 2KUTA 2YC1B 2H3NB 2OZ4A 4FNLL 4AYFA 2B1AL 3BW9A 4LCCB 5HHQA 4U49A 1I3UA 3TH3T 1IL1A 3HUJB 1IMHC 1T04B 3AXLA 4NO3A 1Q94A 1DUZA 3DI2B 4EQ2A 1UM5H 2D9CA 2PXYC 4Z78A 3RIAK 2C3HA 2P5WB 4P3WA 4NJ9L 3KPSE 1V3KA 3IU4L 1INQB 3TCLA 2X4TB 4MZ2A 1XGTB 3FKUS 3S9DB 2ADFL 4RFEA 4LGPB 1UH4A 1S7XB 5CEXB 4WU5A 2F53A 4ZOAA 2R0KH 2B5IC 1AR1D 1WISA 4GG8A 2YWZA 2DI9A 2CLVB 4NUJB 1OAUL 4TRPH 1G6RB 4LEXL 3WO4B 4CW1B 1CIUA 2Z35A 3E2HC 1FG9C 2FHFA 1A6ZA 1RZ8B 1MJ8L 3T4YB 3OR7A 2C1PA 1CN4A 1EZVX 4LCWD 3QUYC 4X4MA 1YPZF 2QHRL 1ORQB 4YHPA 4U0RC 3ARTA 4HFWA 1KN2H 4QTHA 4M1CC 5BXFB 3G5XB 2ITCB 1N64L 4Z7NF 3L7FB 2DQUL 1MJUH 5D1ZB 2BFVL 5I1JL 4LNRB 4X4XB 5D8JH 5HJ3B 4Y5XA 1SBSH 1AO7A 1WTLA 1Y6NR 5DJ2B 1A9BB 2ZUWA 2FZ3A 1N5AA 5E99L 1GXEA 2YSSB 2BC4B 5FK9A 1GGBH 5H94A 3TP4A 1OTTC 2C3VB 5AD0A 5FO7A 4P2CG 3DXAD 3JWNC 4AEHH 1BZ7B 5KAQF 1LEGB 5A16A 3P9WB 3MLWL 1UH2A 1JGUH 3U0WL 5I18H 1NANH 1WZ1L 3FT4A 1TJIH 1I8MB 2V2WB 2W07A 2GSIB 2RR3A 2P43B 4JPKH 1ZOXA 4D2NA 5DFTA 1IC7L 5C0DA 1R3IL 4HAFA 1DQML 5CZXC 4QXTB 4WFFE 3I50H 1FIGL 4MQ7A 3VFRA 4GKNB 3OAZH 5MI0C 1WBZB 4X6EB 1MCLA 1NCUA 1XF5A 2BVEA 4JG1H 5DEZA 4XZUB 4XXCC 1DBJL 3FQXA 1KTKE 1SEQH 2JJSA 3MODL 4QOKB 3PHOB 4ZFGL 5I1HH 3SDCC 5B39G 5GZOC 2DIBA 1U8IB 4KH2A 5KSUB 4ODUB 1YPZE 1OW0A 5TJWK 4M7KH 3FQWB 3QXVA 1F6LL 1K4DA 2ZCKH 3HZMA 4NHCH 3OKEA 4JZJC 2JKXA 3D0LB 4Z7NE 5FYLE 1JGLH 2J8UA 4PRDB 1RMFL 3U0TB 5DTFB 5D5MA 2VN7A 1R3KB 1YEDB 2OL3H 3HG1B 3D2UD 4FXKB 4P59L 1MCEA 3TIDB 3V0VA 5JLZB 5HHOD 1MWAA 5CILH 2XRAH 1OL0A 5ICXA 4NQEE 3RVTD 3HAEG 1T83A 1ZGLA 5B4MD 3H9HA 4FQLL 3DHMA 1BQHA 1L9NA 2ZUSA 1YN6A 1AH1A 3QCUH 3MUZ1 3NIGF 3T3MF 1HQRB 1F4WH 3QPXH 2CK0L 1W72B 3N9GH 4XPHH 4QHKJ 2A2QT 2XKSA 4H8WL 3DUSB 1AFVL 4JGJA 1U9KA 3OKMA 1CVRA 4KGLA 3FB6B 4G8EB 3U4EB 5CJQH 4OCRL 2ED7A 1U3HC 4PJCF 5GHWH 1O7VA 4X6BA 4N90E 1ZT7A 1Q9KB 5TQ0H 3AM8C 3M8OH 4U1SA 4P5TC 5KW9H 4UOJA 4U1GB 4MD0B 2R0LH 1A7RH 5FHBL 5ITFB 4XCCL 2NY0B 3NN8B 4PPTA 3WL9B 5F7FA 5KBNC 1CFQB 1MHHB 1YDPA 3LH2L 4U1JB 4LVEA 2VE6B 1UA6H 2BJMH 5F7DA 4LBEB 3FAWA 2PYFA 5LQBL 1I1AA 5KS9B 1NFDA 5DR5L 1S7WB 5IOPA 5LGJB 2EYRB 4JFOB 1QLFB 3SDDB 3WNKA 1REIA 4NYLA 3ET9F 3GSXB 3WEXB 3HNTL 5E9DB 1FN4A 1INEL 2ADGB 3NIGE 1BX2B 1QRNB 3T3ME 1FDLL 1QLEH 4BSWA 1S7TB 5HHMD 4D8PA 5BMFH 1MUJA 4MCYB 1G0XA 2LFGA 4P2QA 4HKJA 4HWZB 3DVNB 3LRHA 4I4WB 1ZANH 4JFHD 1KUMA 4R97B 5SWSB 3AY4C 2Z31A 4OCWH 4KTEL 2DQHL 5B3JF 4PJ8C 4OF6A 4PJCE 1RK0B 4ZTOH 3S97C 1PKQE 5TGBB 5B21A 1R0AL 1D5IH 1J10A 5CCKL 4OT1L 4H8WC 3CXDL 1UKSA 2NY2B 4F7MB 3DX6B 4POZC 5FB8A 3U7YL 4IJ3C 1OPGH 4U1IB 4PJ5B 2IADA 2HMIC 4YHLL 4QRSB 3B8YA 4C4KT 1TLKA 3QEGH 5J89A 3MZGB 1S7SB 4U1GC 2I9TB 5MEPA 1FFPA 2EDWA 4RAVB 4U1MB 2P44B 2H9GB 3GSOA 1N3NB 4G8GB 1RJLA 4FA8A 4HUVA 1RUML 1QHOA 3QNXA 5GGQH 1Q1JL 4HXAH 3BN9C 4HMDA 3QDGE 4YPGA 4V1DB 2J88H 5IIEB 3O41B 4W6YB 4BK4A 3MRFA 3OJDB 5I19H 1UWGH 4PJIF 5LWYH 3ARYA 5AZ2L 2PW1B 3ZTNH 5GS0C 2VN4A 5C8JB 3NCBB 1CK0L 4KKAC 5B3JE 4A2LA 1U8KA 1YEGH 2XQBL 4RGMB 2FHCA 1KCVH 3C6LA 2DIJA 4ZYKA 1UM4L 4L4TB 4DVBA 1MRCL 2VXVL 3R1GL 2DMKA 1H15B 3TPUB 1CE6A 4P2OA 5HYJD 5DZNA 4YHOH 5I1DA 5J3HD 1KULA 2X42A 2WBJB 1QSFE 5JDSA 3UJIH 1FFRA 1XGUA 2EDYA 1DQLL 2DYPA 1P4BL 2NY2C 2HA1A 3NGBB 4YFEA 2W0PA 4N8VB 2ILLA 2AXGB 3D85A 4JRYA 5C0AD 2D4FA 3IRPX 2UWEA 4N8CH 2FH8A 2W0KA 5J1AB 1FNSH 3VE0B 5DJCA 5F1IA 3HZYB 5GIRA 1IC5L 4H1LA 1T89C 4PGEB 4KROB 3IDNA 4PJIE 4PRAB 4Q97A 3O9WB 1CXHA 3IDJA 2F53E 4MD4A 5K9JL 3OF6A 1FJ1A 2V9QA 3QUXD 3GIZL 5I1IL 3PXJA 3L3JA 4HX1B 4PRHA 3V5HA 3CGTA 4JRWA 5I15L 1QG3A 3EYSL 4R0LC 3RJDA 2DLGA 4TTGA 3BISA 4U1KA 3RY6A 3I6KB 1EA9C 1HH9B 2OTUA 3QEHA 4LVOC 1IM9B 2ZSVA 4K7FA 3FJTA 4UAOC 3V4PL 2NTSP 3VXMA 4Q9QH 3RWDB 5FO8A 2VLKB 1QTYT 1CZ8L 5HVHB 3MRCB 1NGQL 3GDBA 3MOBL 5D5MF 4M5ZH 2X05A 3X14B 3U9PL 1AO7E 1F00I 5L2KD 2G2RA 2WWKT 4PP1C 3BZDA 3V5DB 2CXKA 1AXTH 3QO0A 3NGBC 1I7TA 4OZFG 4JKKA 3ZKMC 3RZCA 2QKIA 3LS4L 3LB6C 4KDWA 4TVPD 2RBLA 3L3OA 3PL6B 4P9HL 2R9HC 3T0DA 1XGPB 5EUOA 3KPRD 4FZ8H 4TUOB 4ZNEE 3VI3F 5HGHB 3B8SA 1JZ6A 3R0NA 5EOTA 4F7PB 4JQIL 5ACZB 1KN4L 1ULVA 1U8JB 5ETUB 2BNQA 3FQTB 3AS2A 3HC3L 3V9FA 1JPSL 1KLUB 2GT9B 2GFBB 3OXRB 5DJAA 4CJ0A 4RZCB 2PR4L 2YPVH 5LXGL 1A21A 4KRMB 5BZWA 1WQVT 1H5BA 4JPWH 4DEPC 4EOWH 5KJRL 4G80B 2DQTL 2GITA 4NZDA 1N5YL 2J8UE 4NWUH 5C7XH 1AHWB 5D5ME 5IHBA 1F6AA 1HINH 1JGEB 2FEEI 1YEKL 1YYMH 3MSPA 4OQTL 4MWFA 2FJHA 5T3XD 4F7TB 2GAZA 1Q0YL 2Q3AA 5I71B 4ZFOB 1P2CA 1JRHI 3EFFB 4JFFA 2DLTA 2QSCH 3WXVL 4DK3A 2AV7B 1J0IA 4HKZB 1NC4A 1CGVA 2X4SA 5I17A 2HFFA 2B8OT 3PNWA 2VRAA 4WU7B 3E1F1 4S1SH 1NL0L 2X9XA 2DD8L 4O02L 5GGVY 1DR9A 3VI3E 3KPSB 1S9VA 1C08A 3K4DA 1DSFL 5HI4D 4J3OC 2IH3A 5HYEA 3E6HB 4NKMA 4P9HC 2W9LA 4NHUB 4Y1AA 2GJ6E 1K3ZA 4UU9A 3X3FH 4JAMA 4ZG1A 3QIUA 4A6YL 3EYFA 3H7BA 3MRHA 4GXUM 4RA3A 4OIIL 4OLVH 1OAYL 3FN9A 5BZDA 1CDHA 4IOIA 1X5HA 2X1XR 5J9PB 2ZUQC 4DGYH 1WICA 2CUIA 3AU1A 1NEZG 1J1PH 1Q0XL 1QBAA 4R90H 4ZTPL 4C54A 1I1CA 3KYMA 5FOBA 1WAAF 4KDTC 2DOCA 5JIHA 4KMTH 2HT3C 5IMOA 5CUSL 3NZ8B 3MV8A 1RFDH 2YZ1A 5HYSB 3EJYD 3DGGA 4XP5H 1AHWC 4HFUH 4ZDHA 5IBUG 3H9SA 5LGKA 1X6LA 2MSPA 4PRNA 4KKLC 5CSGA 1IRAY 2ZG1A 1PZUB 3QPQC 1NCBL 2LTQB 5DJ6B 3JV5A 1OCWL 3J8F7 2DBLL 1MQ8A 1CDUA 5JR1H 5EZOL 2ZNXA 3QXAA 3FMGL 2G75B 1WEJL 1Z9SA 4PRID 1CLZH 4PJ9C 5C08D 3FO2A 1P4IL 4ONFL 1OSPL 4FN0A 3VXQB 1QNZL 4BKLA 3AB0B 3O3AB 3JWOL 3DUUA 2J4WH 3MRJB 1N59A 4M62L 5T3ZH 2F5BH 4OGYL 3D3VD 5IROC 1G7LA 2LVCA 3QI9B 3HMWH 1FPTH 4FP8H 3T1FA 1UEMA 1WAAE 5CIPB 4FQJH 4JGUA 5F9AC 5JPMB 4FQCH 2BK8A 3BH9A 4CVXB 3BP6A 5FF6B 2AJVH 1G9NL 4MZ3A 3KJ6H 2UWEF 2HN7A 4JDVB 1QEWB 5DQDH 3UTQA 3ZE2F 4N0RA 1QACA 1A7QL 1FRGH 3PQYA 1XIWC 3LQZA 3DLQR 1U91B 2H8PA 3D6GA 4L3EB 1GC1H 4DK6A 3R0MA 3LKSA 2JJWA 1CQKA 4JQVC 4NQEB 1NANI 2VDPH 4RMSA 3WFDH 4IS6A 5EZJA 1HCVA 3CFBB 2FR4B 4UT9L 1H3WM 1UH3A 3QDMA 5I6XC 2HFEB 2VR9A 2FWOA 5EOQH 2YD7A 3H2WA 4LCIH 3SO3B 2P8LB 3EDJA 4YDKL 3NCCB 3VXPA 5A2LH 3VGHA 2J3SA 4UTBL 1SEBB 3R8QA 4X4YA 4LP5A 4UOW0 2B0SL 4PLOB 1I4FA 1KLGB 1FZMB 5SWQA 1J0JA 4ZS6C 3QWRD 3TYFA 3JWOC 3VFWB 5CWSA 4PJDA 4JRYE 2DQFA 4OGAD 1YN7B 4C57C 5DGRA 1NGZA 2UWEE 3MGAA 1MY5A 1E6JH 4HIEA 4MNQE 3ZE2E 2G9HB 4R3SB 3ZKND 1IT9H 2MCPH 4NT6A 3ROLB 5IEHB 3NCYP 1G9NC 1DBKH 3MGOB 5F8QC 5JIPA 4WW1A 2P8MA 2A73A 1A7OH 3K2MC 3HFMH 3QUZD 4XPTH 1Q9OA 4YEEA 1NC2A 4PRHE 1WWAX 4JDZA 1ZLVK 2VYRE 3BWAA 3I3BA 1WBXA 4LEOA 1JNLH 3BEVA 4UBDC 1LO4H 5DA4A 1RULL 5T33L 3OKLA 1UZ8B 5DRXA 3QXTA 1KENH 4G3YH 1UADC 4PJGA 1HNFA 3MRGB 3CXHK 3MLUL 3O8XA 4XNQA 4XMLL 4ZS7H 1H8NA 4Y2DD 3Q3GB 3QIBB 4PJCB 4XP4H 2VWEC 2MQCA 1CL7H 4LLYA 3SO3C 1PKQB 3OKYA 4AMKL 4MD5B 4PRBB 1KJ2H 3KPPB 2HT2D 1UJ3C 2G60H 4MXQC 1U8LB 4NC1C 3MRMA 3KXFA 1BREA 1DVFC 3W0WA 1PG7X 2ITDA 5LBSH 1CFNA 2W9EL 1HOCB 1H3UA 1G9ML 3SCMC 1X3DA 1FH5L 3SE9H 5DK2B 5C0BA 5E2WL 4HIXL 1S7VA 2R8SL 1J88A 5DS8B 1IAIM 3KLAB 3ZKXB 1IGML 5EBMB 2R4SH 4O2CA 4NN6B 3CFKB 3QDGB 2ICWB 3DUHA 1PW3A 1AGBB 1Z3GH 2BNQE 2EEDA 2ZG2A 5EC1A 5J11B 3U30C 1DTUA 5C6TH 3MV7B 3I9GL 4L3AA 4NN7C 3GB7A 1AKJA 1QLRA 1FAKT 4U05A 5EZIL 4ZFZB 3OV6A 1C12B 2PO6B 1BZ9B 1JN6B 2E7LA 4G8IA 5AAMA 3WS3B 4OQTA 4EN3D 3MRPA 1R5WB 2VDNH 3CLEH 3VCLB 1G84A 2Q86A 2R56H 4YBQD 4KDVA 2A6DB 2AJSH 4JB9L 4Z95H 3V79C 5IQ9A 1FVEB 3OB8A 4GBXC 5CBEA 3IXTA 3TC9A 1AJ7H 3PV6B 1QSFB 2OMBA 2DDQL 2YRLA 2ZOKA 1XH3A 5HHQB 4QRTA 3RI5F 3MCLH 4IIQA 1IL1B 1ZLUH 4EI5C 3AXLB 5DHYA 5GRXG 1NMBH 4NO3B 1Q94B 1DUZB 4HK3J 5GS1C 3QQ9D 1LP9A 1G9MC 1XGRA 4JKPL 5FXCH 1GSMA 3WJJC 5JUEH 2Z8RA 4LFHD 3TH4T 3BN3B 4RFEB 5CLWA 4U31A 4GXVL 4WU5B 2F53B 3ZKXC 4RMWA 2YPKA 5IESL 3C5ZC 4NJAL 2JTDA 3KPLA 2VDRH 2XPGA 5FM5O 4GG8B 3ARFA 4WRLA 5JIKA 1KSRA 2IBZY 1OARH 4LHUD 3N1QC 1AD0A 1GHFL 4JN1L 4FQ1L 3ARGC 1GGCL 4QTIL 2AAVA 3ULUC 5D7LE 2Z35B 1A6ZB 4P4RA 3OR7B 3ARDD 2C1PB 4CVUA 3THML 2WUCL 4YHPB 2NCMA 3MV8E 3Q48A 3HZVA 5IQ7L 4HFWB 3UYOD 4QTHB 1CQYA 3PP4H 3H9SE 4Y4FC 3F58L 2CUMA 3SGKA 5CGYD 2EH8L 5DVNA 4P23C 4Y5XB 1AO7B 1KIQB 2F5AH 4OCNC 3BRFA 2FZ3B 5MENA 1BGXL 3CFIC 4ODTL 5JXAH 5FK9B 5H94B 2Q6WA 3VD4A 5AD0B 2D9QB 5FO7B 5IFAH 1KF9B 5A16B 5GZND 2B4CH 1AGDA 3FT4B 4TSCL 3UTTA 2FYYA 4WUUE 4ODXA 4M6NH 5C0DB 3CMOL 5FHAL 5AG9A 1CGUA 1AY1H 5CZXD 4MQ7B 3VFRB 2VDMH 3HRPA 5CINL 3IKKA 5E8DL 1XF5B 1DANT 3UTSE 3C09C 3FQXB 1A1NA 4K7PY 1NBQA 2OM5A 5BCAA 1N26A 2BSRA 5I1EL 4GKSA 4AT6A 1K4DB 3HZMB 5KOMC 3OKEB 3PWPA 1JZ8A 3BQUB 3CX5J 1NKRA 1AXIB 2J8UB 3HR5A 4XPBH 3PQYE 5D5MB 4DJMA 1J18A 4XRCA 4ORZC 5A2IH 3KHQA 3V0VB 5KSAC 1MWAB 1T4KA 2EC8A 5ICXB 1NGWA 4K3EH 5FCUL 4AQOA 1ZGLB 4LSRL 3H9HB 4A2MA 1BQHB 3BZFA 3QDME 1YN6B 2YD8A 4ZO7A 2OR9L 2EIEA 4XNYL 4CU6A 3HRZA 1A3LL 4L8SA 1DQTA 3K2UH 3KPNB 1LEIA 1RZGA 4AH2A 5HI5C 5EU7E 4HUXA 5E03A 3UEZA 5L2JA 4PR5B 2D0FA 4PY8I 4KRLB 1U3HD 3BKYH 4MAUH 5E5MA 4X6BB 1N7ML 1ZT7B 5D9SA 1EXUA 1BFSA 4HJGA 5IBLD 4U1SB 4KI1A 3RIAF 4TSAH 4HC1L 4QGTA 3HNSH 1UXWA 5GISL 5AAWA 1VFOA 3KLSA 3SY0B 1YDPB 2P42B 2JJSC 1T66D 5T5NF 2DTML 5DMIH 5DD5H 4QOKD 5F7DB 4XPFH 2ESVA 4K07A 2PYFB 1F58H 1I1AB 4J8RA 1NFDB 5IOPB 3HN3A 4NYLB 4LPUA 5EBGA 5DMGD 5HHNA 1L6XA 1FN4B 3NACH 3DMMA 4I3SL 3HG1D 1G6RH 4BSWB 4D8PB 1MUJB 4X7SL 5D7JA 4P2QB 4HKJB 4PB0H 5KVGH 3IETA 4MJIA 4EDWL 3BIKA 4NZUL 2Z31B 2FX9L 3V8OA 2I9LA 5BV7B 5DUML 3EYQD 3MUGA 4DGIH 3FZUC 1MFCL 3QZWA 3BJLA 1RK1A 3CSBA 4JO3L 2WP3O 3VA6A 3EW3B 5FB8B 3EO9L 4PJFA 4BZ2L 5BRZA 2IADB 3LEVH 3KXFE 5F96H 3W0WE 1CFSA 2IANA 2B1HL 4GAGL 4D9RE 2Y1VA 3WNLA 3BE1L 1Z2KA 2YUZA 1IZKA 5MEPB 1FFPB 5C0BE 2FJFA 4I0CC 3GSOB 1RJLB 5ADPH 4HUVB 4MMXC 4RGNC 3B4NA 3T77A 3QNXB 3O81A 2AK1L 1UQSA 2IEPA 4HWBH 3VDAA 5IK3B 3LHPH 5TQ2H 4YPGB 4Z8FH 5DRNA 5L88H 1GPOL 2NXZB 3MRFB 3QCTH 4I2XA 2DQIL 1LDPL 3RWHA 3SDDD 1X4ZA 1T03H 1J0YA 2KQNA 3JSSA 5E9DD 2OS7A 1D5XA 5GS0D 3GHBH 4CDGC 4R8WL 4RMQA 1U8KB 1QRND 1BJ1J 3DSFL 1YNKH 1U8OA 5BS0A 4ZYKB 4DVBB 1L7TH 1FGVL 1I8KA 1CE6B 1MELA 1A6TA 5E4EB 4P2OB 5EA0H 5SWSD 4ZPTA 5I1DB 4IDJH 2R2EB 2QQKH 1NCDL 5JDSB 1L6ZA 1XGUB 3JTTA 3CK0L 1SM3L 3B6SA 3UXFA 3SDYH 3EFDH 2DM2A 2NY2D 4MDIA 4YHKH 4N0YL 2YMXL 4X6CA 3D85B 4JRYB 4K94H 1IGYA 2EICA 3B2UC 2WM0A 4GG6A 4NQDD 4PJ5D 2V6HA 3HMXH 2UWEB 4FXGA 5HDOA 4XCFH 1F90L 2JCCF 4XPAH 1LP9E 5DJCB 4DUXA 5F1IB 2EE6A 3GBLA 3GI8H 5GIRB 4XXDA 2A38A 5JHDA 5HI3C 2VKXA 3OG4B 3WFBL 4NSKA 4H1LB 1CXIA 4HPOL 3IDNB 2LQRA 4G8GD 5LVEA 3IDJB 1FG2A 2PTTA 4MD4B 1ADQH 3NA4A 1CGTA 1N8ZA 1KV3A 3MRBA 1FJ1B 1LO2L 1FSKB 3SJVD 3L3JB 4PRHB 2VLJD 3O6KL 3V5HB 3QIWA 4V1DD 3EYOA 5CD3A 1ZGLM 4RCAA 4U1KB 4PGBA 2OTUB 2EDNA 3QEHB 2AXHA 5KTEH 4NQTA 2ZSVB 1HEZB 4I18C 4K7FB 4G6KH 4ZOBA 4N0CD 2UUDK 5AYQA 5GSVA 3G5YB 5TDPA 3C6LC 3VXMB 2FGWL 4BUHA 4JZOA 1B2WH 5FO8B 3IDUA 3OAUH 2MNUA 4P2OC 1L7IH 4LCYA 1JWMA 4KVNH 5D1QC 5DLML 4X6DA 4R2GC 4OF3A 3KYKH 5GJTH 2G2RB 3P0YH 2D03H 2JCCE 3MYJA 4JFZL 5MENE 2R2CA 1X5AA 5T5FL 1I7TB 1PLGH 5GRUH 3RZCB 5HBBA 1BIHA 2QKIB 5DMKA 3UJTH 1NCAH 4OSUL 3L3OB 5F9DC 4F58L 3V6ZA 1I75A 2R9HD 2GHWB 4P3CH 5EUOB 2JJTC 3PUCA 1RJZA 3UTTE 5L0QC 1UCBL 1LD9A 1W0VA 5EOTB 4I0KA 35C8L 1LVEA 1H8OA 1CLOH 2BNQB 4UILH 2APBA 2YD3A 4KROD 5TE6L 3O9WD 4LASH 2FATL 3HTLX 5D1XA 1QSZA 1CL7I 1CE1H 1QPXA 1QR1A 1MCRA 4XVJL 2PTVA 5DJAB 1T6VN 2FB4H 1MHPL