2CUMA

The solution structure of the 33rd fibronectin type iii domain of human tenascin-x
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
105
structure length
105
Chain Sequence
GSSGSSGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tenascin-X
publication title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 6
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cumA00
2GQHA 1A7OH 1KT2A 5E7BA 5IBUG 3LB6D 3BKYH 3BIKA 3L7FB 4OTXH 4Q2ZB 3B9VA 4ODHH 1NAMB 3ARGC 3SKUD 5ADPH 2Q7YA 4ODUB 4QNPF 1UCTA 3PGFL 2KPNA 1I3RA 1QSEE 4P2OD 3TT1H 5LXGL 3EJYD 3LN5B 4YK4C 5HI4D 5EBMA 3MNWB 1EO8L 3RY6A 3QJHA 5D7LA 3LRHA 5LXGH 4FQXA 1HH6B 1MCKA 4EQ2A 1OAZH 2YRLA 3JV4A 4ERSL 3GEWB 2A74B 1EO8H 2CD0A 3HG1B 4YQXH 1HXMB 4LP4A 3GIVB 4U1MB 1K8IA 5DSCA 3OR6A 1BQHA 1UB5A 2GFBA 4ODBD 1U8OA 3GSQB 3S5LB 3UJJL 3BOVA 3VDCA 1DE4A 1EPFA 1J0IA 4PIRF 1I9IL 4JEGB 1WCBA 3WN5A 32C2B 2DM3A 3T1FA 1I9IH 3MBED 2RHEA 3F62A 3RY6C 4PPTA 2BVOB 1JK8B 4NN5C 1NGPL 4FQIL 4XWGL 2AP2A 1DBMH 3PWPE 4ELME 2VABA 3VFOB 1CXFA 3KPSE 4NZTL 3P9MA 4U6XB 1TPXC 4FFVC 4XWGH 5IQ7L 4PV9B 2ED7A 2CO7B 2Z4QA 5SWZD 2ZNXA 2GSGA 5FF6A 3VWJB 5IQ7H 2XACC 1K5NA 2YUXA 1A6TB 5DHVH 5DJYA 1IKNC 3VFMB 5C86A 5D5ME 4FZEL 5CZXD 4ZUTB 2V5MA 2AK1L 4QY8A 3ZYJA 2WBKA 1UH3A 5E94A 4TUOB 2AV7A 5EU7C 1IGMH 4FZEH 4Y88A 5I1IH 4U2ZA 1K4DA 2OMNA 5EIIA 1KLUB 4DGVL 2ZUUA 2ZUSA 3QB7C 3WV0A 5IVXA 1O7VA 3BN9C 2NY6B 2MKLC 4FNLH 4LAJH 3PWPB 1XF2B 2BSTA 4DGVH 1BLNB 4JFPB 4I0PD 3U9PH 4R4FL 4J2XA 3F7PC 2YSSB 5EUKA 3QQ4B 5CLTA 1MAML 4X7CC 4RISL 4F8QA 1FORL 3WD5L 5K59F 2PW1A 1SM3L 2PXYA 1U9KA 2FLBT 4NM8H 2V9RA 4R4FH 5FYJE 2MHAA 4PUBH 5TE4H 1CXLA 1MAMH 1NCDH 4N8VA 2F53B 4AQOA 1T0MB 2CUIA 3GGWA 4WFFE 1M1SA 1FORH 1SM3H 5HHXH 5C08A 3TGXA 3ULUH 3QFJA 1MCIA 4LPCA 5IKCA 4UBDC 2R0LH 2NY7H 5BOPA 3CSBA 1R5IA 2CMRL 4NRZA 4QRQA 3O4LA 1YPZE 4X83A 4OD3L 25C8H 1F6LL 3M17A 2CMRH 4KY1L 2MQCA 2DLEA 3CZFA 4XWOD 3KVQA 1U3JA 2Q3ZA 4OCWL 4KY1H 3BPNC 4YZFF 5AG8A 4P48A 2PXYC 4WUUB 3EO9H 2BXZA 2GJJA 3CZJA 4C56D 3WDHA 4OCWH 2HKFH 4XVTL 3H3PL 3HPJA 4KI5E 3PNWA 1INQB 4XCNA 3H3PH 5I6XB 3H7LA 4FXKA 1LEGA 1NDMA 3PHOA 2A0LD 1JWUA 1J8HB 2LVEA 5DTFA 3MRQA 3CK0L 1YPZB 5IB5B 4WFGD 1JYNA 4I3GA 3RVVC 1T21B 3IB4A 2X4TB 1XZ0A 1QYGH 4LOUD 4O58H 2MQ0A 4Z7OF 1TVHB 4LPXA 1K6QH 3MV7E 5C0CE 1LO2L 1YNLL 2X4QA 3SKNA 1EJ6A 4P57A 4IJ3B 1YNLH 5MERB 1AGDA 2C7UB 2FL5A 2LTQC 2X1OA 2X4PB 5I73C 5DA4A 1LE5A 3QDGE 4ALAH 4N9OB 4HK0B 3H7BA 1URLA 4DFHA 2VDKL 3QI9B 1FG2A 3V5KA 1QR1A 4RFNC 2YRPA 4BZ2L 5EZOH 4M43L 3NIFE 4TULL 3GNML 2OTUB 2VDKH 3H8NA 4JANA 2QEJA 5FK9A 1E28A 4BZ2H 5F9OH 3L3KB 2PW2A 3LV3B 1A4KA 4P3CH 3MRFA 3NGBC 2CK0H 3MV7B 4XC3L 5C0CB 4CVZB 4RA0C 3I2CL 1PX4A 3OKOB 1A9EA 5DF0A 4HF5H 4XC3H 4NQVB 2J5LB 3I3DA 3CDGA 2IPUK 1UACL 3NACL 1NEZA 2XRAL 3BP6A 5JORB 3I6LD 4LHUA 4LF3B 1CFVL 3SDXF 1YYLH 3NACH 2AEPH 2J12B 1S7QB 2OLDA 4PR5B 3REWA 2VSDA 3DV6B 1OGAD 5DUML 1OM3L 43CAB 5K9KA 2P5WA 4PJBB 4GAGH 4MDJB 5ISZB 2GY5A 3TT3L 1OM3H 4XPAH 1A7PL 5I16B 4L4TE 5FA4B 3TVMB 5E8OA 3BH8A 2EDEA 1A7PH 3DTXA 1GZQA 3JZ7A 3QHTC 1HK6A 1R5WB 4Z7VF 5KTEL 3GMNA 4ENED 1MH5A 2AV1B 5F88A 5H35A 4JFFB 1JZ4A 3D39A 3Q1SH 4U1IB 4LARL 3KYOB 2VDQH 2R1XB 2X4NB 5AZEL 5CHNA 4MX7A 2V7NB 3QPQC 3HB3C 3QISA 4WRLA 4P2OA 4RGMC 2NR6C 5KN5A 1GGUA 1J1XL 4HCRL 1EMTL 2X1PA 5FYLD 1INEH 1IAIL 1T5XB 1PW3A 4FTVB 5JIKA 1FZMA 5JHDD 1VGKA 1C7TA 2XZCL 4NFBA 1MJJB 1IAIH 2FECL 5IHLB 3SBWC 1T3FB 1EUTA 5D7SL 3S88L 1HDMA 4R0LB 2BY1A 1ROWA 1UJ3A 4G7VL 3KPMA 2QL1A 4AMKL 4UINH 5D7SH 3S88H 1ZVHA 4P5MA 2ERJC 5D1QD 4XPHL 5IBTH 4NQSB 1EFXD 3DRTB 3DROA 4KUCD 1A6AA 1YEDB 2B5IB 1NGWA 4P2OC 1KTKE 4UT6H 5I8EB 3EJYC 4XP6L 4YHYC 1PBYA 5FV2A 2FIKA 3M1BB 1MCRA 5D7IE 5CJ8A 3QDMA 1CD0A 1UXWB 3RPIB 1FNEA 1YMHA 2ZSWA 2FHBA 2B20A 2VAAA 1E4WL 4HS3B 1A9BA 4OQ1A 1MOEA 1UJ3C 2KZWA 5BRZE 5F9JB 5SWZA 1E4WH 2CDGB 1ORQA 4UIKH 5CSZB 4U6VL 2Q20A 3WKNA 3CLFL 2YN5A 4HH9B 5HHOA 2BFVL 5BS0D 4TTGA 4OKVB 1AIFB 3D9AH 3AU1A 4G6JL 4U6VH 1P1ZA 1TTFA 4J3OC 3TBSB 4A2MA 3VFWA 4HPOL 2BFVH 4ZAKD 4Z7NF 4NQED 2VLJD 4XBEH 2I60L 3CDCA 5E95B 1WK0A 3T0XA 4JGUA 5D7IB 4QRUB 1B3JA 1OB1B 3MLUL 1GRWA 3MMEB 4PP2B 4CW1A 4HUNB 3ZE0F 5BZDA 4S1SL 1LWRA 4WFED 1FNSL 4LLQB 4NN6B 1JTOA 2IFGA 5BRZB 3UTPE 2P4AB 1XF3B 3JWNC 3WHXB 4KXZI 2Y5EA 2A9ML 2PYEE 2Q6WA 1J1OL 4Z7QE 5I18H 1KC5L 4GG6E 1BFOB 1J0HA 1KIUA 1BZ7B 4HIXH 3B5TA 2JF1A 2R69L 4FS0A 4Y5VA 2YA0A 1KC5H 1OT2A 3TH3T 3BUTA 4KI1A 2YUWA 4MSWB 4X6DF 5CKAA 4P0DA 1S9YA 2R69H 2VXUL 4KUCF 1FFRA 4TQEL 5DUBB 3ZMRA 4JDVA 5IMMB 4WHDA 4H0HB 2JB6B 4NQCE 2VXUH 4TQEH 3GB7B 2I07A 2IWGA 3SDXA 4KV5E 4LEXL 1DQJA 4QXUL 5HHPB 4FXLA 2QLVB 4LLMA 3Q0HA 5HDBF 2Q76A 2XZZA 4QXUH 3RWDA 1AQKL 1SBBA 3F7VB 3CFDA 2NY1C 4JO3L 3RVXC 3BHBB 3MCKA 5KVFL 2BHUA 5HD8D 1WISA 2A6IB 1I9JL 1AQKH 1IT9H 3F7RA 3HUJE 3U82B 4JO3H 5KVFH 2CLZA 4LAQL 4LCCB 5T5NF 4PP1C 4XVUD 1MNUH 5CWSA 5IROC 2FEDD 5FO9A 4LAQH 5DUPL 1KIPA 1P5UA 4W4NA 5C9JB 1SYSA 1FRGH 2YA2A 4HIJB 3B6SA 3OGCA 3F12A 1QQDA 2H8PA 4LFHD 3KPNA 5E2JA 4JRYD 2OJEB 5E5MB 4GS7B 5FXCH 1LO0H 1T1ZA 1MHEA 4DVBA 2WLZA 2Y5TA 4EDXA 4EXKA 4IRJB 1V3LA 4YWGL 3KS0J 4GRLD 4CJ0A 1F58H 5DS8B 4F57L 4LNVA 4PJ5E 5J56B 2B4CC 4YWGH 1JN6A 4C4KO 1W0WA 2B39A 1HHJA 4F57H 1JNNL 1KEGL 2IPKB 4RWYH 3FOLA 4FN0A 5JNYA 3OZ9L 1HQ4B 5KS9A 2VNCA 1JNNH 1T20B 4KMTL 4YDJA 1T0NB 4HJGA 4LNRA 1KPVB 3PP3H 5LQBH 4WEUD 4UMGA 1JZ8A 3MGOA 4NCC2 1LEKB 4Z7UE 3MRGA 5DVNA 2CLVA 3K2UH 4PB9L 1NSNH 2YEZB 1J11A 1JPSL 2R0ZL 4BH8B 3U83A 3HNVL 2EDFA 5HVHB 5J12B 1ZT1A 5C70A 4RFEA 3VE0A 4YLQT 3T3PE 5GRUL 2R0ZH 5TQ0H 2ZOKA 4ISVB 1OGAA 4MNQB 1HWHB 2VZ3A 2DKUA 5GRUH 4FQQB 4YDLB 4KK8C 1BP3B 2BSRB 5EUOE 4ZOEA 3EYVB 3EDFA 1QFWM 5HHQA 4NC0B 2ZZUT 4EUPG 5B3JE 1U8KB 4PRHE 4NQTA 4PGBA 5I1JL 1EEUA 4LSVL 3G6JE 8CGTA 4HIIB 2XTLA 3W11D 4Q9RL 5I1JH 4LSVH 1LO5B 2P46B 7FABL 4NRYA 4Q9RH 2NX5A 3TPUA 2I9TA 3TM6A 5D1XB 2UZIL 3ARTA 3LRGA 2HVJA 4Z0XA 3TCLA 4YPJA 3S34L 4NKOB 2APWA 4ZUVB 3QXAA 1EBPA 1EJOL 1S7SB 1UM4H 4X99B 3S34H 5EUOB 2CIKA 1HHHA 1V3KA 1EJOH 4LSSL 4Q97A 5MI0C 4F7PA 5I8KH 3DNKA 1NUDA 2YOCA 1RK1B 3RGVD 4Y2DC 2WAHA 5I66B 1ZHNA 4Z0BH 1PD6A 2I24N 2LVCA 3MZGB 1S5HB 2B2XL 1KENL 3DI3B 5DRXB 3S3PA 4X6DA 4ELKB 1IQWL 4AJ0A 3ZKMC 4M7JL 1KENH 1KIRB 4XMLH 5KBNC 1FH5H 2YR3A 3OKNA 3TV3L 3D48R 1NGXA 1NCBL 4NUJB 3WKML 2NW3B 4M7JH 5GSVA 2DWDB 3TV3H 1NCBH 2I5YH 3VXMA 2F54E 4HUWB 2BZDA 4BK4A 3VJ6B 5C0FA 3MUY1 1TFHA 4YC2B 1AH1A 3QRGL 1CFQA 4FQ1H 1NBYB 4G8FB 3UMTA 1U58B 2BVQA 1VACB 3QRGH 4MAYD 3BZ4A 4KTDH 5BS0A 1IARB 1RZFL 5F7DA 3P73B 5HBBA 1NC4A 3DRQB 2EECA 4WTZG 1WFNA 5ADOL 4ZAKA 5IM7B 1RZFH 4LRIC 4MA1B 3D18A 4JZOA 1C08A 4NQEA 2OR7A 3MLRL 3RHWF 2DBLH 1IQDA 2DYPD 5DHYB 1J9CT 3I75B 4OLWL 4EN3B 5ADOH 4CMMB 3PWLA 3P30L 5D7KE 2F54B 3U48A 4YNYA 1L6ZA 1A7QL 5B38B 1XGUB 2R9HD 1UWXH 2NMSA 4UB0L 5B4MD 5DVMA 1YQ2A 1A7QH 2FBJL 3H9SA 2C26A 4OLYH 2HVKA 3C9NB 4R6UA 4PRBA 4DN4H 3DX7B 4ZUWB 1D5XB 2GJ6B 3O3AB 2FBJH 4FFWC 4AEFA 3QHFL 2EDOA 3WS6C 3MRPB 3QDJB 5FB8B 2Z91B 4MCYA 1IM3B 5EU4B 3G9VA 2DKSA 3OKKB 3SY0B 5IW6A 4K3JL 1RSFA 4E5XB 4QCIB 4ZTPL 2BNQD 5ICZA 1UA6L 4AEEA 1ZLVH 4WVRA 4JAMB 2FO4B 2NXZC 4ZTPH 4JRXD 1NFDF 4POZC 2KDGA 4HDIA 3VXOA 4P49A 2FSEB 4P4RA 5EC1A 1F4WL 2OR9L 1SYVB 3QUML 5I15H 2DQDH 1X4XA 4GQPH 1VKXA 1A14H 1KN2L 4PRID 2EE9A 5IVOA 3QUMH 2O5XH 3VI3F 1HOCA 4ORGB 5D7JD 4CBPA 5C07E 2W9EL 1CGYA 5JXAH 4Q9BA 4CUCA 3MJ6A 3VGAC 1AY1L 2ATKB 4CADB 4PJ9B 4ZOBA 1QG3A 3PJSB 4OGAD 3QIUB 2PTTA 3GSOA 5EO0B 3SDDB 2X1WL 4FABH 1AY1H 1IC5H 2AJVH 4DTGL 4UV7L 1F42A 3WFZA 5C6WH 1PQZA 1WZLA 2XWBA 2HG5B 4U1LA 4ACPA 4AT6A 4QHLB 1F11B 3JV6B 4NQDE 1U8JA 4XNZB 4UV7H 4EUPH 2W38A 3C6SA 1MRCL 4HIEB 1MWAH 5IMOA 1CVSC 3MLTA 2FATH 3SJVB 3U4AA 4HZLB 1JBJA 4MQ7B 2Z93A 4H8WC 4L4VD 4QRTB 4LCUB 4W6XB 1XGYH 3PL6C 5E00B 2BSSA 1G9NC 2EYSA 5JUEH 1U8PA 5AUMB 2GTWA 2YC1B 5HGGS 2Y06H 3VXSB 4PLKD 3DX6B 3V52L 4MD5A 5JOFB 4TVSa 3D85D 5HTSA 2P8PA 2N56A 4K7PH 5DJZB 1OAXL 1QRND 4FFYL 2ICWB 2CQVA 2OQJA 5GGTL 2NLJB 2HN7A 3TPKA 1OAXH 3IETB 2NXYB 5AWNL 5GGTH 3X3FL 4DWHA 1ETZB 4L5FL 2CO6B 4JY4A 1KTRL 5DVKA 1JGVL 1MLCA 1YY8B 5FM5M 8FABA 1F6FB 3C60B 4PJFF 5AWNH 1DEEA 2Q87A 5JOPD 4G6KL 4JPWL 1JGVH 1KJ3H 1DLHB 1ONQB 3SKMB 1P4LB 2IH3B 4G6KH 3SDCB 3ECBB 3TIDA 3NABL 3RVUD 3UP1A 3BD4A 3LKSB 1A02N 3HNSH 1G7IA 1GGBL 4BFIA 4UIMA 4K9EH 3MRMB 1GGBH 1AD0A 3Q2CA 1BOGA 3HE7D 2DLIA 1JZ2A 3IDMA 1SEQL 4G8GD 4Y16B 1UVQA 1OW0A 3RVTC 1BJ8A 1YUHB 3HZYB 4XNMB 5D2LF 5E2TL 3VXUB 4NSKB 1SEQH 4J8RB 2PKDA 1JHLL 4I3RL 1Y0LB 4JQVA 3O3EB 2ADIB 1OTUD 2X89D 1OP3H 4ODVL 4PGDA 4M3KB 1JHLH 1I4FA 5GSRB 3VXRA 3INUL 3PQYB 2FJHB 4NHUB 5E99H 3KHOA 4ODVH 3PWUB 3RGVA 1ZHKA 5MEPA 1KF9B 5FYJH 4U3HA 1ZLWH 4UDTA 1MUJB 2D0HA 5CS7A 2E6PA 2BOCA 3QUKA 3FO2A 1CDCA 1MI5B 4PGZA 3TBTA 3PDOA 1BZ9B 4KJWD 3L5XL 3WFDH 5E8DH 2RGSA 4RDQF 1AP2A 1QNZL 3GSXA 4AM0B 3UDWA 3DVFA 3HMWH 3CSPA 3L5XH 3DMMB 4JQVC 4Z77A 1HKLL 3LIZL 4JKMA 4DAGL 2DQJH 1PSKL 2QSCH 1JRHL 2H2PD 3MV9D 5E9DE 3MV01 4DAGH 2YD5A 4JB9L 3RGVC 3OKEB 3FB8A 3DLQR 1AXTH 3T4YA 1JRHH 1KOAA 4JB9H 5FCSH 1XR8B 3BXNA 1UFUA 5C8JA 1X7QB 4MXVE 3WO4B 3CDFA 4H5SB 3X3GL 5H2BA 5FDWA 1JUFB 5C0IA 3QT2A 4HKXB 4B5EA 4MAYA 3NA4A 2PUQT 3QCTH 1U8HA 1UM5L 1UB6B 5J89A 3JWDC 1UM5H 4PJGB 4WHTA 4L9LA 2OSLA 5L2KA 2DYPA 1WFUA 1YEEH 3WHE1 2WUBH 1FVEB 3EOBA 1KCRL 3A0OA 1E0OB 4JJ5B 1JNHA 1L6XA 2D9QB 3SDAD 1YY9D 4XMPL 4JFED 5HYJA 4JFDA 2EH7L 3R0MA 1ZV5A 3AXLA 1NQBA 2DMKA 5JLZB 2EIZB 1G0DA 4MAYC 3DV4B 3QUYD 5F96H 1YMMB 3J8F7 1IAKA 2UWEF 1BVKA 2ZUXA 4XCCL 1IM9D 4OV5B 4KZDH 2OL3B 5MP6L 1L0XA 4C58B 5CUSH 1BIHA 2AK4E 1FFOA 4XCCH 4JREC 3P4OB 2PYFB 1NL0L 2XYCA 1JPFA 1B6DA 2DI8A 2BNQA 3PWNB 1CS6A 4D0CB 2R9HC 4M5YH 4QTHB 4BFGA 5FKAA 1AGCA 2COQA 3HAEA 3S9DB 1NL0H 5B4MC 4JRXA 3OAYH 3DJ9A 4OI8A 2X4RA 1FZOA 2QV2A 4FXGB 2CIIB 4FQHA 3WFHB 4JY6A 3FQUA 5FGSA 3QWQB 1DANT 3I6KB 1T1XA 1WBZB 4Y1AD 4PJFA 4B7LA 5MENB 2H6PB 5B39B 3NAAH 1QLRA 4WFHD 4TUKH 1UADC 4GMTL 3WFCL 4L8CA 5F3HB 4TTDD 4BYHA 4YFLI 5T5FL 4NQXB 3RTQB 3T0AA 2CH8A 3I50H 3GI8L 4GMTH 4ZUUB 4PJEE 5EO1A 5DJ2A 3FT2A 1EV2E 2DD8L 5HPOA 1HHIA 4XMKL 4PS4L 2VXVL 1X3DA 3KJ6H 5FA3A 3NPZB 4JFHD 3QH3B 1J88A 2IQAB 5DD3H 4HWNA 4OB5H 3ZYZA 4LPUA 5C7XH 1R3KB 3NCBB 2IGFL 4U1KB 1OP9A 4U4BA 2E6JA 3QUMB 3MRJA 5D2LA 5LGHH 3GJFA 4Y4FD 3U36B 1B4RA 5ID1A 3LH2L 1IAII 4X98A 5J1TC 4F7CA 4BM7A 2BVUA 3DBXA 4LHUG 3LH2H 2FECI 5LAXA 3PP4H 4L4VA 1W2KT 1LQSR 3UYPA 5I9QC 3MRBB 5L9DH 4OJFL 5F72S 1I8MB 2F74B 2NTFA 3JTTB 4HXAL 3MJ7A 3UCRA 4OJFH 3L3HA 5FGBC 2N4IA 1I8IA 4HXAH 3LEXA 3EYFB 3KPOB 3WLBB 2QQLL 5D70H 2O5ZL 5E08L 4G6ML 4BH7B 3BQUD 4MHHG 5JW5A 1DFBH 4P23B 3MV8B 3BP4A 3EZ8A 1RUML 3BDYH 2O5ZH 4YE4H 5ENWA 1CD1A 5IB1A 1GCFA 3F8UB 5C09E 3VFVA 1WBYA 2FCBA 1WFTA 1RUMH 3HE6C 4UUJB 5I30L 3QEHA 2BRQA 4JY5L 1J0KA 5DQDH 4DUXA 1UWGL 3CFKB 4C57C 3VFTA 1NCWL 4JPIB 5JA9A 3Q6GH 4XRCB 4WDIB 5C0JB 1PFCA 3QYCA 3RI5F 5L2JB 3AAZA 2QQNL 4BKLA 2A6KB 1Z3GL 3VH8G 1RHHA 2E27L 5D1ZB 3THMH 3IJYB 5F1NB 2D4DA 3QWOB 4WHCA 4X6CF 2QQNH 1OARH 4LLAA 4LLUA 4PY8I 4LSDA 5F1OB 2E27H 3RU8L 1IKFL 1RIVL 1RU9H 4KK9D 4R7NB 3CSYB 4MLSA 3OAZK 4RZCB 1UQSA 4ZOAA 4Z7WF 4G9FE 1IKFH 3HE7A 4KHTH 4G8GA 5IFJA 3BH9A 1TTGA 2ESVB 4Y5YC 5BJTB 2IAND 2K3TA 1F3JB 3V6ZA 3V0VA 2VDLL 5KZCB 1C5BH 1FYTD 1ZVSA 3DO3A 4XPFL 2X89A 2UYLB 5KVGL 1JHTB 2FZ3B 1KTDB 1FL5B 4CVXB 3RVUC 5GRVL 4XPFH 1G6VK 5DJXB 5GGSY 5E24E 2K1MA 3MA9H 3X14B 1NLDL 1KNOA 1UKQA 2AXFA 5LGJB 2R0KH 1F3DH 4LASL 5T1MB 4WUUD 1OGTB 4N0UA 3K80A 1NCCL 3BUYA 1CU4H 3D87B 4QEGA 4ODSL 4YDVA 2W65A 1A21A 1CK0L 3JSSA 1RUKH 1Y18B 1YNKL 1TJGL 3FQRB 1QO3B 4MXQD 3VRIB 4ODSH 3SE3A 3ZSTA 4HWEH 1CK0H 5DMIL 3VW3L 4KROD 5J6HB 1TJGH 3GHEL 1QLEL 4YHZL 2OZ4A 4HS6A 1OTUC 3KJ4C 5DMIH 3VW3H 5D71L 1E6JL 3GJEB 4F7TB 1WBXB 1J8HD 3GHEH 1QLEH 5ACZB 3MV9A 1U8NB 4I48B 4X0KA 3CFCH 3UBXA 5D71H 1LDSA 1ZXQA 3L5HA 1RUQH 2OI9B 3O41A 4D8PB 3D3VE 2EYTB 2X41A 2OXGA 2A73A 2X7LB 3MOAL 4OFYD 4HGWA 1DUYA 3SKOB 5HYSA 2VDNL 5I8CB 4KJWC 1ED3A 1W0YT 2XZQL 3TBVA 3MOAH 4KRPD 2ZCKL 5JMOC 3QWRD 1IC1A 5FM8A 2D7TL 1F8TL 1F13A 1I7UB 5EZLA 2UUDK 4KRMB 2WINA 2Z92A 5I1KL 4YAQA 2D7TH 5FYKU 2XA8L 2HT2D 3MBXL 4G6FB 2H2PC 4M93B 5I1KH 3D25B 3MODL 5T1KB 2XA8H 3PE9A 3MBXH 3MUZ1 3CX5K 1DLFL 5IB4B 3MODH 2GTZA 3QSKB 3B9KC 2ICWI 3SDAA 3RWHB 1H3UA 4NM4L 4JFEA 5F9WB 3ULVC 5T3ZD 4PJ7E 4XC1L 3RHWK 5DJ0B 5IQ9B 4P46D 4Q0XL 4NM4H 3GMLB 3LKQB 4V2CB 5ALCH 3QO0B 3QUYA 5CIPB 2HKHL 2XWTB 4BSVA 5CSBA 5TDOA 2OP4L 3UTQB 3ILPA 1IM9A 1FP5A 2HKHH 3P4MB 5BMFH 1TZHA 3I6GA 3U0TA 3DSNA 1A6WH 2FD6L 2P5EE 4N1HB 5EN2B 1HHKB 3JTSA 3DUSA 4MCZA 3BWAB 1H3VA 2FD6H 5KSUB 3SDAC 5IHZA 5F70A 4GXUM 4HUUA 5ISZD 3B43A 1NKRA 2DQIH 4UTBL 2G9HB 2GHWB 5EU5A 5C2UB 4MLIA 3TVMD 3ZTNL 2PO6D 4KVNL 2VL5A 4MDIA 1VESA 3LMJL 5KSVA 3VGEA 5DDHB 5TE6H 3L3OB 3FT3A 4Y1AA 3ZTNH 2IH1A 3T0EC 3LS4L 3V6OA 3LMJH 4URTB 4M5ZL 4X5LA 2L0DA 4M1CD 4LCWD 4OLUL 3B3IB 1LEIA 2VDMH 2DL2A 2XQYG 3O3DA 1KUMA 3V79C 3FFCA 3LS4H 5ESQB 4XXDB 3FQXA 4QHMB 3MJ8B 3ESUF 1ES0B 5KG9A 1XF5A 4NZRL 4NYLA 1IFHL 3IFOA 1WAAA 1LDPL 4LLYB 3SE9H 4D9LH 5E2UH 1U95A 4S1RL 4NZRH 1FNHA 5JW4M 3T0DA 1KELL 4ZNCD 3EGSA 4Z7WA 4FTVD 1A7BA 1IJ9A 4NPYA 1PEWA 3VXQA 4S11A 4K7FA 5ANMA 1KELH 1KG0B 2IQ9L 5FDYA 1R0AL 4X7TA 2DQTL 5EIQA 1KT2B 4Y4FA 1RJZA 3QEUA 3D2UD 3FQNA 4E0RA 2IC2A 4NNXB 1A1OA 4U1SA 2BNRD 1RHFA 3P0VH 2Q7YB 5E2WL 4J12A 3DGCR 4YUEL 1I3RB 3MC0A 5HI3C 2AJYL 2ZOLA 3B5GA 2JELL 3OPZL 4YUEH 2VJXA 1NGYA 3QJHB 4G80A 4FQXB 4NN5B 3D0VA 2VZTA 3D1MC 2JELH 3OPZH 4LPVA 4WI4A 4ZUSA 3IAQA 2NNAA 1TPXB 1ND0A 3FZUD 1K8IB 5DSCB 1AQDA 1RIHH 4N5ED 1BQHB 1UB5B 4L1DA 2DIJA 1U8OB 2ZNWA 1NUNB 5J57B 3RWIA 3H42L 1DE4B 1Q9OB 3CUPA 4XB8A 3ISWA 3U1SL 1WCBB 4FZ8L 1D9KB 3FKUS 3WN5B 2BSED 3QP3A 3P3YA 4F58H 1NCNA 3T1FB 4FZ8H 4OZIE 2UVEA 2JB5L 2XZAL 4BFBD 2W07A 2DIAA 4ZFZA 1WCQA 4XBGA 2P24A 5DMKB 2VABB 3E0GA 2JB5H 3P9MB 2YPVL 4P2QE 2Z4QB 5EBLA 4IBLT 2YPVH 2GSGB 5FF6B 3P40A 1B0WA 1K5NB 3KXFD 4O4YL 5DJYB 5CILH 1NFKA 3RVWC 2XQBH 4NUGH 5C08E 3CAFA 2WP3O 5DK0A 4O4YH 4QY8B 5E94B 4OFDA 2AV7B 2ZSVA 5BO1L 3QNYA 4RNRA 2X1XR 3KR3H 4PJCF 3JV5A 4WCYH 1K4DB 5EIIB 4JZJA 4UT7L 5IVXB 5D72L 1JF6A 3DOSA 2BSTB 4UT7H 5KAQF 2XNAA 5D72H 3OG4B 5EUKB 4PLOB 5DRNB 4MMXC 3OKDA 3ZHKA 2PW1B 2PXYB 4OIIL 3GJFK 5LGKA 4XP1H 2MHAB 4N8VB 4P3WA 3GGWB 4OZFA 1N2RA 3RWCA 3STZA 4OIIH 2YUVA 5EPMA 1PZ5A 5C08B 3ULUD 2LFGA 3QFJB 4HUMB 4IOIA 3ARPA 1ODAA 5IKCB 4AIXA 4HWUA 4JZJC 1S7XA 1R5IB 4MJIE 1NBQA 1FBIL 4NRZB 4DVRL 4QRQB 3O4LB 3FAXA 5CBAA 2C1OA 4QO1A 1LD9A 3M17B 1S7TA 1FBIH 2B4CL 3WUWG 4DVRH 5JDJA 4CDHA 3MCG1 2L7JA 2HRPH 4QHKI 2UV3A 4OFYA 4UV4L 3HPJB 1EAPA 3PNWB 1WZKA 4XCNB 4DN3L 5HDQH 1VPOL 4ZDHA 4AEIL 3VRLF 2LTQB 1H9VA 1LNUA 3K3QA 4FXKB 1LEGB 3NZHL 4DN3H 5LJYH 2DTML 3ZTJH 1NDMB 1T2QH 3PHOB 1VPOH 5EOQL 1YZZA 4ZFGH 3S35L 4OZHE 1JWUB 2ID5A 5F6HJ 1H3PL 5DTFB 3MRQB 1CFTA 3QXDB 4RFNB 2DTMH 2WSKA 3IDYB 3S35H 1ADQA 1XZ0B 1MAJA 3T0EE 3RDTA 1M7IA 2HT4C 2X4QB 3NGBB 3SKNB 4X6EB 1WTLA 4TUJA 5I71B 1PYWA 3BO8A 4P57B 1U3HD 4BQ6A 4KRPC 4P46A 1AGDB 2FL5B 4H1LB 4KKCC 1E4KA 5GRXG 5F6IB 2VR5A 4HXBH 4YDKL 1LE5B 1CICA 3ZKQD 3DPBA 3H7BB 3L5IA 5CINL 1FG2B 2DKMA 4GUPA 3V5KB 3MOBL 1HHGA 4TN9A 3W2DL 4F15C 1N0XL 3QR2A 3ULUF 4JZNA 1FGVH 2P5WE 5CINH 4JANB 5FK9B 4JLRB 1YECL 1E28B 3S4SG 3W2DH 3RDTC 1N0XH 2PW2B 3N1QC 4JO2L 5ICXA 1A4KB 2NYYC 2NY3D 3TYGL 1VHPA 3MRFB 1FAIL 4K3DL 3UTSE 1JGEA 3CFJA 2YD9A 4JO2H 5JXEA 4P46C 4Z78A 4P2RE 1FAIH 1GAFL 5GRWA 1E4KC 5K9JL 1G7LA 2R4RH 4S10A 3CDGB 4GRMA 2VISA 5DEGA 3D39E 1CICC 3TP4A 1NEZB 3BP6B 4ZS7H 5FOBA 1QFUL 4BFEA 4CRPA 2V2XA 3IDXH 3ES6A 3QQ9D 4LCWA 4IDLA 4ZXBD 3QCUL 1ZMYA 3REWB 3ULSB 5K9KB 2P5WB 5K59E 2GUOA 4RMQA 1YEFH 5DJDA 1U93B 3SKJH 5JXEC 1OAKH 3UTSB 5E8OB 3BH8B 3DTXB 1GZQB 1AGEA 1VFBA 2VC2H 4ONOA 5HXMA 1MH5B 5H35B 4PJXF 5TPWL 4X5XA 3D39B 4K71B 2ITDA 1CBVL 1AD9A 3AB0C 4RRPG 3D2UA 5TPWH 5CHNB 4MX7B 2ERJB 3QUZD 1KJVA 2YK1L 1CBVH 3FOMA 5HJ3A 4OZ4A 4YZFE 4P2OB 2YK1H 3DX8A 4RAUA 5KN5B 4YHYB 4I1NB 1XCQA 3KYKL 5F93C 4TPRL 2EDJA 2L7UA 4GXUN 2R2BA 1FZMB 1VGKB 1OSPL 5FYKL 3KYKH 5FUCE 1UWEL 3MNZA 3WXVL 3G9AB 2X05A 1BD2D 1HDMB 4V1DD 5FYKH 1ZLSL 1LK2A 1UJ3B 4X4XB 3KPMB 3WXVH 3BYYA 1FN4A 3MYZA 4FQ2L 2ORBL 1ZLSH 3VFUA 2VN7A 4PREA 2H9GA 4DK3A 2AJUH 1SEBA 3DROB 1JRHI 1A6AB 2ORBH 3TA3C 1V3MA 1P7KA 3JUZA 4RGOL 4Z7OE 4HD9A 4HKBA 2EYRA 3RIAF 3P11H 1DUZA 4P5TD 2JCCE 4UNUA 4RGOH 1I7TA 5JW4N 1XGRA 4GSDL 1T4KA 2Y6SD 2C3HA 1A9BB 1TZIA 5IBLD 3FZUC 2X9XA 1BAFL 3W9EB 4XVJH 2AEIT 4LSTL 1DANU 1S8DB 5SWZB 1F97A 1RZ8A 3WNPA 1ORQB 4N0YL 3KXFA 1BAFH 5ID0A 3WSQL 4PRNA 1F00I 3K1KC 2BCKB 3DUUA 4XNUL 1JGUL 2Z31D 4PJHF 4N0YH 1TJIL 3RI5K 4RAHA 5TF1L 3WSQH 1HEZA 3E1F1 3AU1B 2W9LA 4XNUH 1FIGL 3GM8A 1P1ZB 3VFWB 1CWVA 3DUHA 5TF1H 1I3GL 1JHKL 1T03L 2IPTL 4CW1B 5BZDB 1I3GH 1JHKH 1MJUH 4YHOL 1RIUL 2YRZA 4OI7A 4OFPA 4C56E 1VGEL 2QQQA 3HFMH 4GW1A 1RIUH 4K8RC 5DRWA 3RP1A 1I8KA 1NFIA 3SGJA 4HJ0C 5I1CH 3KPPA 4JKKA 2EIBA 15C8H 4QRSA 1NMCC 1WZ1L 2G2RA 3E3QE 3ZDXF 2NY1B 4OZGE 1WZ1H 4Y5VB 3ZDZF 4HWZA 3L7EA 3UJTL 1S9YB 4Z7VE 1T66D 4H8WL 1T0PB 4JDVB 1CGSL 2N7AA 3TJHC 4WI3A 3IDIA 3UJTH 3E2HC 4PJ9D 1HYSD 1F4AA 3QNXA 4H8WH 4LCYA 3SDDD 3VXNA 2Y36H 2I07B 3D0LA 4C56B 1U8MA 3SDXB 3SGJC 1G9NH 2IADA 1DQJB 1QFWL 2AQ1A 3IYLW 3OG6B 4LL9A 4JR9L 1UYWH 3HI5L 4LLMB 4MJ6A 1OOAA 2BOBB 1QFWH 2DLTA 3RWDB 3BKCL 3HI5H 4CU7A 3C8KA 4XP4L 3MCKB 2CXKA 3BKCH 4XP4H 5EBWA 3B83A 2CLZB 4UOJA 3TO4D 1KB5A 5CWSB 3GSNH 4Q6IB 3WS3A 3QIBD 1JF5A 3N9GL 1CFBA 1C1EL 5JPNA 4J3UA 4PJXA 4ZYKA 2QQKH 3IFNL 1KIPB 4NC1C 4G8EA 3K4AA 3O0RL 4N1CA 3S35X 3N9GH 1IGTA 1SYSB 1C1EH 3CH1B 3B6SB 2P8MA 3OGCB 3F12B 1QQDB 2H8PB 3HAEG 3IFNH 4WV1C 4ODTH 4J3XA 5JR1L 2HFGL 4EI5C 1T1ZB 1MHEB 3EYQD 4DVBB 5E6ZA 3O4OB 3GMRB 3O2WL 4IMLA 4YXLH 5IR1A 1AHWA 1G7HA 2HFGH 5C6TL 1ITBB 1RZKH 3I6LE 5SWQA 2DM7A 4I0CC 1S7WA 4OD2A 1CCZA 3O2WH 1XCTA 1F02I 2X4OA 4GQ9H 1JN6B 1W0WB 1OPGL 1EVUA 2BVTA 4O2CA 1HHJB 4PTTA 1KN4L 1BVLA 1MJ8L 1KGCE 3FOLB 5JNYB 1I3UA 4YDJB 1KN4H 4HJGB 4LCIL 1MJ8H 4LNRB 4LSQL 1I1AC 1DEDA 3FRPG 1IGYA 1INDL 3MGOB 3MRGB 4OSUH 4HS8L 2CLVB 4LSQH 5FUZL 1AHWC 3B2VL 1NC2A 5E8NA 3L5WB 4U2YA 3O9WD 4L1HA 5FUZH 1ZT1B 1SMAA 4RFEB 3VE0B 4YIQA 2YBRA 4EVNA 4ZXBA 2D3VA 2LV4A 4JVUA 5H94A 2ZOKB 1OGAB 5E1AA 4YHMH 3HKFA 5K9OB 4XZUA 3RUGF 4M00A 1AR2A 1S78D 5FYLE 4WW2A 4C54A 4U1HA 2W60A 4POUB 5JHDE 4DKFL 1FGNL 5C0AE 5MI0B 5I17B 3E6FA 5GHWH 1FQ9C 4PJHA 2J88H 4HQQH 3T0VA 3U6RA 5INCA 1FGNH 4B0MM 3F5WB 3EAKA 2DOCA 2AS5M 4HAFA 3RZWA 5HGDA 1CZ8L 3FL7A 3LKOA 4X6DE 3RBSA 3PWVA 4CN6A 2I9TB 1NBVL 4XCEA 4OV6F 4ZXBC 5C71A 3AGVA 3QUZA 2H26A 2HVJB 2W0FA 5LG1A 2D7PA 1NBVH 3BP7B 3QXAB 2HH0H 3E8UH 4UTAL 4OF3A 4WW2C 1TMCB 3HS0A 2A1WL 4W6WB 1DN0A 1Z9OA 1HHHB 2CIKB 2YZ1A 2X9WA 3HC4L 4UTAH 4F7PB 5JHDB 5C1MB 3LQAH 3QG6A 3HC4H 3MRRA 5HDBE 1SY6H 2JJUA 4G43A 3JWDH 1BD2A 4HJJL 4V1DA 2ZCLH 1I3VA 1ZHNB 4JN1L 4ZS6D 1MFDH 3EJJX 1CDBA 1U92A 4N8PA 4X6DB 4P9HH 4RGND 4ETYA 1WWCA 5BS0E 1F4XH 2R2HA 1PG7H 4XAKD 4XTRD 4CKVX 1R3HA 4I9WE 1GGCH 3OKNB 4YDIL 1NGXB 2VLJE 4P5TA 3MLWH 1Q1JL 3QBTB 4MQXC 4YDIH 4IHOA 3MJ9A 5DJ8A 2OTWA 3FCTA 1QSFA 3VXMB 2H2SD 5KVEH 1Q1JH 3QZWG 3SO5A 5HGAA 5IHUH 1WVZA 4DW2L 4Z76A 4WFEE 5CP3H 2YXMA 5C0FB 4ZFOA 3ILQC 2YPLA 2FGWL 2N1KA 4OCSL 5KSAD 4FQJH 2NCMA 4DW2H 1Z9MA 1CIUA 4QWWD 1CFQB 5ITFA 4XHQA 3MREA 3UC0H 2FGWH 2JIXD 4OCSH 2BVQB 4XH2B 3UROR 1K4CA 5FEBA 1NCAL 5CP7A 2Z31A 3BZ4B 1MHHA 3DETD 4IOSD 5BS0B 4UQ3A 4G42A 1BFSA 1OWWA 4NJ9H 1A6VH 1WQVT 4LVNC 1J12A 1YMMD 4M3JA 3RNQA 3FT4A 4ZAKB 4NQEB 3D18B 3MLZL 4JZOB 1IQDB 1ACYL 4YXKH 3GSWA 1CLYL 2FDBP 3O6FA 4PRDA 5IBLC 4YNYB 3ZT7A 1CLYH 1FZJA 5T33L 4R7DA 2NXZB 3KHQA 2K7QA 4YGAB 5T33H 3BPOC 2HVKB 4KJYA 4RMRA 3QEQD 3HAEH 4PRBB 2Z31C 2ZJSL 3HI6L 3RX5A 4K7PY 4U6YA 4O51A 1VEPA 4X8JA 4MCYB 4IEFB 3SGEI 1G7QB 1YEHL 2F9BT 5IW6B 3O6FC 5C92A 5JO5A 1ZT4B 3VGAB 1OLZA 5M95B 3BD5A 1YEHH 1AO7E 4JG1H 4WW1A 4HDIB 4BZ1L 2X09A 1DQLL 3VXOB 4NKDA 4JRYE 5D6CB 3CLEH 4P4RB 5EC1B 2D7NA 3AY4A 4BZ1H 4F8TA 4PJGF 4IMKA 1V3JA 3S6CA 1VKXB 3FRUA 3RUGA 1RVFL 4OUOA 3GBLA 2FWOA 1MREH 3BEWA 4XCFH 4CU8A 1Z9LA 1HN1A 1HOCB 4RSVA 1X4ZA 1OTTD 4FP8H 5DJ6A 1T66C 4HFWA 4R9HA 3RIFF 3TO4A 4ONHA 4GRWE 2PTTB 3GSOB 1UCBH 1RURL 3QIBA 2A6JA 1XEDA 5GJTL 4UILH 4DGIH 1PQZB 2XWBB 3HC0A 2DMCA 4U1LB 2FNBA 4AT6B 1U8JB 2FH6A 1WEJL 5SV3A 3GMQA 1UM6H 1KPUA 3C6SB 4IMKC 4PJDA 5EBGA 2VDRH 2HFFA 3OB8A 4NJAL 5IMOB 4J4PD 1O0VA 3QIWD 4BJLA 3MLTB 1G7MA 1UH2A 4X4ZA 2APVA 4GRLB 2MQ3A 4NJAH 4JJHA 1QSED 2Z93B 4ZD3L 3QUXD 3ROOA 3TO4C 3ZE2E 1ZT7A 4WO4D 3C2SA 3KAAA 3QIBC 4L3EE 1A4JA 1CTNA 2EYSB 12E8L 3F65A 5EWIL 1U8PB 1VFAA 1U3ZA 2GTWB 3ZKNC 3NFSH 1HILA 1IEBA 4R26L 4ZNEA 5JW4Q 4DZBA 5EWIH 5GS3A 1BF2A 4MD5B 3TBYA 1A7NL 3I9GL 3AS2A 3CVHA 3EOYG 3EYQC 1PG7W 5IFHH 1FO0H 2P8PB 4MYWB 3RL2A 1QEWA 4OUUA 5C0RL 2YN3A 3IRZA 1S7RB 2FLRT 2OQJB 2HN7B 3OXSA 5F44A 3O9WA 3EDDA 5C0RH 2XPGA 3O8XD 5EA0L 4JY4B 5C0GA 5DMGD 1NMAL 4M6ML 3K2MC 4L8SA 8FABB 5D4QA 5EA0H 1DEEB 2XWJB 3PGCA 3KPSD 2ESVD 1NMAH 4M6MH 1P7QD 1FNGB 1U8IB 1FVCB 4WI6A 2Z8SA 3PIQA 3ZHDA 5JW3H 2XTJE 3T4AA 3TIDB 1G7IB 2AGJH 4U6TA 4BFIB 4N0CD 3WLWD 2DQGL 2MJWA 4UIMB 5IMKA 3OAUH 4XI5D 5J9PA 1B2WH 1L7TL 1AD0B 4OGYL 3DI2B 2DWEA 2DQGH 5DFVD 1QPPA 4LK4A 1BOGB 3C6LD 4N9GA 4GOSA 3IDMB 1L7TH 1BFTA 1UVQB 2J7LA 1N4XL 4YFEA 5EORL 3GUTA 1UG9A 3I84A 3T2NL 3AREA 1DBJL 1NFDE 4WU5A 2OZ4L 3KPQA 1CGWA 4PGDB 5DD6A 4XNXL 3UYOD 1DBJH 1A3LL 2JJSC 3VXRB 4FQPA 2F5AL 2LAGB 2BC4A 5FYJD 3BJLA 3RGVB 1ZHKB 5FO7A 5MEPB 3W81A 3KPRE 4W70A 2KL6A 4KGLA 2F58L 3VI3E 5FUOL 4NHCL 4W4OA 2BOCB 2XA3A 3QUKB 3LQZA 3O2VL 3ULVL 2YD7A 1KCLA 1ZS8A 4NKIL 3TBTB 3PDOB 2F58H 4R90L 5FUOH 4NHCH 1M6OA 1CFNA 1YEKL 2SEBA 3O2VH 3ULVH 2MFNA 4UT9L 1ERNA 1AP2B 3RFZC 2WBWB 1CLOH 3EYUH 5CEZL 1XH3A 3AREC 3T65A 2OR8A 4KAQH 4Z77B 3MJGX 4KK6C 1PG7X 5I74C 1P7HL 1RZJC 5CEZH 1PKOA 3OF6A 1JL8A 3EYSL 1PLGL 3GZKA 4I13B 4Y5XA 3FB8B 3IU4H 1N5YL 3T4YB 5J3HC 1FV1A 3B2UD 3EYSH 4Y0GA 3G5VA 3RIAK 1J1PL 4W4OC 1W72H 4KI5D 1TQCC 4JG0L 5KSAA 3BXNB 1SBSL 1TENA 5C8JB 4R97C 4YX2H 1JFQH 5DZOA 1AC6A 4Y19A 4CNIA 1J1PH 5H2BB 5FDWB 4JG0H 3UPRA 2JIXA 2VXSL 1SBSH 4MS8D 1ORSA 1MRDL 4MAYB 5E6ID 4QOKA 4EZMA 1MF2L 4WJ5B 2EDQA 2VXSH 5ICYA 3C5JA 2APFA 1MRDH 5D2NE 1CQYA 3A6CL 3SHSA 1CFSA 2J4WL 1GHFH 4WHTB 3R0NA 3CGTA 1KXTB 2OSLB 4L9LB 2DYPB 5L2KB 1QSVA 1CLCA 3BKMH 3EOBB 4Y5XC 3A6CH 1JNHB 2PNDA 2Q86A 2WQ8A 1HZHL 3VWKC 4LGRB 5KSAC 1L9MA 4QRPD 2H3NB 4M02A 4JFDB 1HZHH 4QWWC 1PKQE 1QFHA 2HTKD 2IEPA 3QEQA 3FB5A 4KKAD 3BT2L 4K3HA 3QDGD 4LIQL 2WW8A 4AEHH 4MNHA 4PRIE 1BVKB 3HHRB 3BT2H 2NY5L 1U8QA 4IOFD 4P59L 4NFCA 2H32H 2WNGA 4YEFA 4WEBL 2ARWA 1FFOB 4IM8A 3VFNA 1S9XB 1RZ7L 4A2LA 4P59H 2X2YA 1JPFB 3ARGD 4WEBH 4JM2A 2BNQB 4YHLL 1CE1L 3EUUA 5DZLA 1RZ7H 2NY2C 5FKAB 3HAEB 4JRXB 4UI2A 2KUTA 4YHLH 5HYFA 2X4RB 4EI6A 1BEYH 3WO3B 1FDLH 4P2CG 4DGYL 2ADJA 4FQHB 1JJUA 4JY6B 3QQ3A 3FQUB 3ZDYE 2ARJA 3FN3A 2WWKT 5D2LE 2ZUQC 3EOTL 1T1XB 3FMGL 3MRLA 4Q2ZA 4PJFB 4XPTL 3NH7L 4PRIB 2VDOH 3FMGH 4OCLC 3MFFA 4L8CB 3VXTA 2VQ1A 3NH7H 1H5BA 4OFIA 2D7MA 4JM2C 3CXHJ 5EO1B 5AD0A 3FT2B 3LN4A 5E56A 4IRSC 4L4TD 5I9QB 1C5CL 3V5DA 1HHIB 1KXVC 5F7FA 4PRAA 2VRAA 1AJ7L 3BVNA 5ESAA 3O6LL 5GS0C 5D7LD 4EUPA 1JIBA 2CSPA 2WIIA 4Z8FL 2MKWA 1MWAA 4XAWH 3C09C 4HG4K 1AGBA 3MRJB 2AJZA 3MLYL 5D2LB 1QRNE 3GJFB 4J4PA 4Z8FH 3QIWA 1P6FA 5ID1B 4M1DH 2NY0C 3V9FA 2YXFA 2RBLA 3OJDA 5GGUB 4F7CB 4HUVA 3WHE0 3DBXB 4ZSOA 1QSEA 3VCLA 4DK6A 2E7LA 1H5BC 3STLA 5LAXB 3QUXA 4NOBA 3ZE1F 5ITBL 3FO9A 2UVFA 4L4VB 3SCMA 2BVOA 4WO4A 2BVPB 2PCPA 3VFSA 1FSKB 1QACA 5JOPE 3RBGA 4XNQA 1ZA6A 2IAMD 5ITBH 2Y9RT 9CGTA 2FHCA 2NTFB 3S96A 5F3BA 3NIFF 5GJSL 3MJ7B 3L3HB 4U0QB 1FZKB 3LN9A 4CN1A 3LEXB 1IBGH 4J4PC 3D85B 3QIWC 1HINL 1CD9B 3LS5L 1QRNB 5T1DL 4JDTL 3ELAT 4TUOA 3VU2A 5JW5B 4P5KA 3BP4B 5GGVY 2BY0A 5DVOA 6FABL 1CD1B 4M7ZC 2E7LC 3D6GA 3VFVB 5T1DH 4JDTH 5DGRA 3SCMC 1M7DA 4AH2A 4PD4J 3QEHB 5GQBA 1I7ZA 3PWPA 5D6DA 4NN7B 3T0WA 4ELMA 4UBDD 1BLNA 4JFPA 3KPSA 4Y7MA 3VFTB 1P7QA 1FCGA 2P47B 4OM0L 3LZFL 1MCOL 3P4LA 5L0QC 3AAZB 2VWEE 4BKLB 1RHHB 1KTLA 5I0ZA 4OD1L 2UWEE 4OM0H 1MCOH 3AM8A 5D5MA 3DXAE 1DQMH 1UEMA 4OD1H 1C7SA 5CEYA 3V6BR 1UQSB 4J6RL 3C6LA 3HE7B 1S7VA 3N50A 4G8GB 1Q9WA 5FIEA 1B4JL 2NY6C 4NNPL 3BH9B 3RQ3A 2DBJA 1W0VB 3V6ZB 3V0VB 3NCYP 4WTZA 4BQCA 2GKIA 3EZJB 1ZVSB 5KANG 1DVFD 2NTSP 1BGXL 1Q0XH 1YQVH 4XGZA 3EDKA 1ZANL 1J7VR 1F4YH 3OHXA 3UTPD 4X4YA 4K9EC 3WLWC 5I2IA 1R6VA 3RVVD 3AM8C 2DB8A 3OJVC 1EO7A 4G5ZL 1KNOB 3CXHK 2AXFB 2H1PH 4PJIF 3IDNA 1INQA 1MVFA 1ZANH 2BVYA 4XI5C 4N0UB 4NZUH 2QADD 3BUYB 2PYED 4H88L 3C6LC 3R1GH 1QBAA 2X44D 4YDVB 2W65B 2MCPL 3EIFA 4H88H 1MCBA 3BE1L 4BELD 1FFPA 3IXAA 4RMSA 4WI9A 4S1DD 1IC7H 1Q9KA 2D0GA 4HS6B 3WXWL 4P9MH 4EJ1C 4OT1L 3PP3K 1QFWI 1ADQL 4NQCD 2NZ9C 3MV9B 3WXWH 3MPCA 1PZUB 3IFLH 4OT1H 3UBXB 1FFNA 3MRDA 4WY7L 2DF3A 2XXMB 2A73B 2P7TA 4CGTA 4HGWB 1DUYB 3MACL 3QA3A 5I6XC 5HYSB 4LQFH 4RBPH 2X4PA 1ED3B 3TBVB 3HZMA 5INDA 3V4PH 3TYFA 3JV0A 2VLKE 1SJHA 4TNVF 5E6IA 1IL1B 4JM4L 1K85A 5EZLB 2WINB 2Z92B 3B8SA 3QG7L 5MEQA 3I02A 2GI7A 4IIQA 4JM4H 1IRAY 1Z2KA 4X5WA 3NCFB 4K3EL 1UJTA 4O2FA 4AIOA 2ICES 1JCKA 5IP4A 1QBLL 1AFVL 1E4JA 3BWUC 1D5BA 2ILLA 4E41E 4PD4K 2GTZB 4KI5C 1XAUA 4QRPA 3SDAB 4JFEB 2MWCA 3M45A 4X6FA 3SE4A 2HWZL 1TITA 4NO0D 4MS8C 4B50A 3EFDL 3QDGA 4LF3A 3QUYB 2HWZH 4BSVB 5D8JL 5TDOB 4NGHH 2OJZH 4PJ5D 3EFDH 3MRKA 1KYOJ 3ILPB 3V7MA 4HW6A 1IM9B 5D8JH 1HXYA 1QR4A 1MCFA 1TZHB 3I6GB 3U0TB 3ARRA 3ARYA 3G6DL 4LHUD 1XFPA 2Z35A 4Z7QF 3PG2A 3DX9A 2ZWLT 4GG6F 1IGCH 4O9HL 1I1FA 3JTSB 3DUSB 3QPQD 2IG2L 3ARGA 4X6CE 5DLMH 5LKNA 4MCZB 4DUWA 3HB3D 3SOBL 5IHZB 4HUUB 4O9HH 1XGTB 1X5YA 2IG2H 4GKNB 5DT1L 3SE4C 4I18A 4LKXA 2HTKC 1L9NA 3PF2A 5EU5B 4MQSB 2DLGA 2BMKA 4KKAC 5ANME 1P69B 1DR9A 2XKSA 5DT1H 3K7UA 2VL5B 1T6VN 4MDIB 5KSVB 1OD7A 5CJQH 2YD6A 4OCXL 1J05A 1I7RB 3FT3B 4Y1AB 3WDJA 2CDEA 2IH1B 4KV5F 5IFAL 1AXSB 1LEIB 4ODHL 4OCXH 3O3DB 5ADPL 4YPGB 3FFCB 5IFAH 3L9RB 3ZLQC 1TQBC 5DJAA 1RPQA 3TT1L 3FQXB 5KG9B 1XF5B 4GKSA 1H8SA 4NYLB 5T3XE 2B1AL 3IFOB 4X6CB 4L4TA 4PRHD 5IESH 1OAZL 4I18C 2B1AH 1MFCH 3NIGF 3EGSB 2GK0A 3LD8B 4Z7WB 4YQXL 4UDUA 1Q72L 4Q7DA 4NPYB 3VG0H 1JGDA 1H15A 1QOKA 3G5YA 3VXQB 4K7FB 5ANMB 3RIFK 3GM0A 4X7TB 2YUZA 1Q72H 2R15A 5HHMD 4NQSA 3BGMA 4Y4FB 3QEUB 3QRFM 3FQNB 3MLPA 3VI4F 4E0RB 3KWWA 1YEDA 1MJ7L 4NO5A 1A1OB 4KJQD 4U1SB 2R1WA 3F6IA 3VRJB 1OY3B 4I4WA 4K94C 3RWFB 1IKNA 1MJ7H 1TDQA 4FFZL 5AYUH 4KUZL 5IEKA 2ZOLB 2OS7A 1XF4A 5B21A 1NGYB 2IAMA 1UWXK 4G80B 4PJIA 1DBML 4FFZH 4KUZH 3D0VB 3P2TA 2IF7A 1QUNA 4QGYA 4JCLA 4ZUSB 3QXTA 2NNAB 5F9JA 3QDMD 1KULA 3CXDH 1ND0B 3AFLA 4LBEA 3RZCA 1AQDB 3AVEA 3DVNA 3RWGA 3BQUB 4Z7UF 4K8RL 3CUPB 1CL7L 1AIFA 3BESR 4OKVA 4MA7L 2F53E 2HYMA 3RKDD 4LU5H 1DCLA 3TBSA 2DLHA 4K8RH 3ZKSD 1CL7H 1IGML 3S37H 2X40A 4MA7H 1CLZH 5HHOD 1DDHA 5A2IH 2IANE 5I1IL 2ICCA 4U31A 3T8XA 1ZLVK 2MCG1 1T22A 2IAMC 4FQCH 5J6GA 2DJUA 1FYTE 3PGDA 3HZKA 4ZFZB 4XBGB 4FNLL 3VGHA 2P24B 1KYOK 3GSVB 3IDUA 1CDYA 3U9PL 1MCJA 1PJ9A 1T5WA 1JE6A 5BVJA 4LPWA 3RZCC 5EBLB 2BNUA 3H6JA 4OIAA 4NM8L 3OJ2C 4PUBL 1A3RH 5TE4L 4WUUE 1NCDL 3G6JF 5K9QI 5HHXL 5DK0B 2GK2A 3ZT5A 4WUKH 3ULUL 1T7WA 2ATPA 2ZSVB 3K74B 3QNYB 4NT6A 2R0LL 2D31A 4XHJD 4RNRB 2NY7L 2V9TA 2V2TA 3TJEH 2IANB 2VR4A 4JZJB 1KACB 1GJIA 3K4DA 1FYTB 2NY1D 2YHGA 4HBCH 25C8L 5D7KD 3RVXD 5IMMA 2YZ8A 1J8HE 4E42A 2XNAB 1DVFA 4HWBH 4NN6C 4M9PA 2IBGA 3T3ME 1X5XA 3U7AA 2WUCH 4EEEA 3OKDB 3U0WH 1GOHA 3EO9L 3QCVH 4PP1D 2Z8RA 1A6ZA 5J11C 5MHSD 1IGJA 2HKFL 4OZFB 3RWCB 3STZB 5EPMB 2PYEA 1Q8MA 1PZ5B 4M62H 1A64A 4IOIB 1CVRA 1J0YA 2O5YL 4GG6A 4HUXB 2DS4A 5J13C 4R2GD 1D6EA 5AZ2H 1CT8A 4U6HA 5F7MC 4KROB 2O5YH 3PXHA 2C1OB 1LD9B 6CGTA 1S7TB 1DVFC 4MZ2A 2MMXA 5FM5O 4NQCA 1KB5L 1QYGL 2XY1A 3QO1A 4LVHB 3HN3A 2X4SA 4O02L 4O58L 2AJSL 5C9JA 5M7QA 4B7IA 3CFBA 2YPKA 1K6QL 1KB5H 3MCLL 1Y6NR 4O02H 2AJSH 5T3ZE 2QADC 4HKJA 3F7YA 1XR9A 1EAPB 1MCCA 4LSUL 2I26N 3MCLH 4IRJA 4NBZB 4KRPB 4ZDHB 2G75A 4CVUA 4LSUH 4ALAL 1LNUB 4Q9QL 1MFNA 3HUJA 4S1DC 3JXAA 4ORZC 1CFTB 1XGQA 5DWUH 4Q9QH 2BY3A 5EZOL 1X5FA 2L4OA 4GRWH 5CD3B 1CGVA 3CFEB 2ICEA 5F9OL 4EBQH 3RDTB 1M7IB 4NQDD 2G5RA 4PJBE 2M8XA 3T77A 4OGZA 4P3CL 4OF6A 3V5HA 2AQ2A 1ZWIA 5ISZE 2C3GA 2CK0L 4UOW1 4D9RE 4KK8D 3V7AE 1NCTA 4TUJB 2E9BA 4IRJC 1JZ7A 1PYWB 3BO8B 4U3XA 4NO0A 4HF5L 3C5SA 4QXWA 4P46B 1PEZA 1WGOA 3ARQA 1AE6H 4U49A 4PTUA 1CICB 5D96B 1BWWA 4JFFE 4OF5A 4PJ5A 2P49B 3PXJA 4LCWE 1YYLL 4KVCH 3FQTA 2AEPL 4ISVA 4GUPB 1OP3K 1HHGB 4D0DB 4JZNB 1T2XA 2R39A 3L3DA 4GAGL 1ZLWK 2XXCB 3BSZH 5ICXB 2BK8A 4XPAL 4ZG1A 5HI5D 3B9DA 1JGEB 3CFJB 4Z7UA 2GITA 5F9AC 3IKKA 1MCWM 4FTVE 1DBKL 4LLVA 4Z78B 5J1SC 1DQQA 1G7LB 1NMBH 1T89A 2PO6B 1JYXA 1GOFA 4PJCE 5DEGB 4GRMB 4LSRL 2VISB 1HCFX 1DBKH 3QPXL 5FOBB 3VFRA 1J87A 3Q1SL 4HKZA 4Y2DD 1AI1H 4AK1A 3SBWA 4LSRH 2V2XB 2VDQL 3ES6B 1NAKH 2BNRE 3PHSA 3QPXH 4GAJL 3AMKA 4LCWB 3SGDH 3VG9B 2JE8A 2NX5D 1S7SA 2QKIA 5J1AA 4ZMAT 5CMAA 4GAJH 5EUOA 4P2YA 5IB2B 4XP5H 2EEAA 1OHQA 4OGXH 5D93C 1H3WM 3ZKMD 5DJDB 1HSAB 1INEL 4PRHA 5EH1A 3UXFA 3GBML 3G6JA 2Y25A 3MRIA 1VFBB 1AGEB 3DARA 1T89C 4XBPA 3GBMH 3VH8A 5GGRY 1I8LC 1HH9A 4PJCB 1O7SA 4X5XB 1JTTA 3FFDA 2ITDB 2OK0L 2F8OA 4UINL 5IG7A 1AD9B 1MFEL 3D2UB 5C3TA 5IBTL 4ZO7A 1KJVB 3BEVA 2BNRB 5KS9F 5GGQH 1SVZA 2OK0H 5KSBF 1QRKA 3FOMB 1MFEH 4ONFL 5HJ3B 4OZ4B 4UT6L 1MHPH 1OP5H 2NW3A 3UBXI 2DWDA 3DX8B 4RAUB 5JIHA 1XCQB 4ONFH 3HR6A 1P2CB 1QA9A 2R2BB 4A6YL 1LMKA 3MJ9L 3VJ6A 4TYUA 3EKCA 4L3CA 1FYHB 4CAGA 3N85H 4A6YH 3MNZB 2E7BA 2D9CA 4XPBL 1NGQL 5FYKD 3VXMD 3MJ9H 1G7JB 3RJDA 4M8VA 4ZFOL 3LEVL 1LK2B 2X70B 5TH2A 5SX5H 4XPBH 1NGQH 1FN4B 4UIKL 3VFUB 3JVGA 4PREB 3RA7H 3LEVH 2H9GB 4JO1L 4KJQC 3NFNA 3X12A 3I3BA 1SEBB 4DJMA 1P7KB 2B8OT 3D9AL 4JO1H 4U7SA 4G9DA 4ZFFB 5IM7A 1G1YA 4HKBB 2EYRB 3GKWL 1JGLL 1MQKH 1DUZB 2VZOA 4XBEL 4FFWD 5DA0B 1NC4D 3H9HA 3PV6A 5E9DD 3WL9B 3OAYK 3GKWH 2EEDA 3MXVH 1JGLH 5JW4R 2F54A 3WFBL 4NO3A 1WIPA 1BQLH 5JHLH 1T4KB 5ETUA 5F6HI 1UEYA 3IJSA 1FG9C 2QHLA 1TZIB 5A40E 2I27N 3WFBH 1G0XA 2CKNA 2AERT 2RIKA 5A43C 4ETQA 5IJVB 5DHVB 3FONA 2JJWA 3JVGC 3KXFB 5DYOB 5ID0B 2VLMD 4PRNB 1IVLA 4UZGA 3O3AA 3DUUB 2NXZD 2R23A 2Z9TA 3RKDC 2AEWA 3MRPA 1YN6A 3H9SD 4POZD 1HEZB 3FHAA 5I18L 1AXIB 1NMCB 1F3DJ 5EU3A 1M7XA 4HIXL 2J8HA 2XKUA 4EN3C 4HBQA 4M03A 1UKSA 1F4HA 4PBXA 5JIIA 3OX8A 1JWSA 1D5ZB 2DIBA 2X42A 4GW4A 1EEQA 4U0RC 1DBBL 2A6DB 2VSCA 4QYOA 1CE6A 3HMXH 4GW1B 1DBBH 5DRWB 5IROA 1I8KB 4MAUL 4ODWA 1WIUA 5EOCL 4LDLB 2FX7L 3KPPB 4QF1A 3IF1A 4X80L 4MAUH 4XHJC 2ENYA 4QRSB 5EOCH 2G2RB 4NO2A 2D4FA 1ZEAL 2FX7H 2VIRA 1GGTA 5BVPH 1OWRM 4X80H 1D6VL 4CADA 1J8KA 3T04D 1IT9L 1ZEAH 3ARDD 1D6VH 2R29H 5FGRA 5FYJU 3LPFA 1MNUL 2J6EH 2OX5A 3EOAA 5JZ7D 5K93A 3VDBA 3QNXB 5HDLA 4LCYB 3VXNB 1VA9A 3H3KA 3D0LB 3P77B 3PL6D 2IFFH 1U8MB 3OQ3B 1FRGL 5I1GL 1OF2A 2IADB 3VMNA 1C12A 4MJ6B 1LO0L 3U0PA 4CMHC 4ZOCA 5I1GH 4R2GC 4L8DB 2EE3A 4V2BA 4G3YL 3C8KB 3AUVA 1LO4L 4MXVF 3UTZA 5C07A 4EIZC 1F58L 4LCUA 1X44A 5A1AA 4G3YH 4YHIB 1U41A 1UGNA 1LO4H 5E00A 5EBWB 1CXIA 1XT5A 3OKMA 1KB5B 3WS3B 4JKPH 4RWYL 4MNQE 4XNZC 5JPNB 4PJXB 4KKNA 4ZYKB 4TNVK 2YKLL 4G8EB 4NQDA 5TQ2L 1DZBA 4BUHA 1IGTB 2HT3C 1CIDA 5A3IC 2P8MB 5LQBL 2EC8A 2PR4H 2VR9A 2YKLH 4LKCA 5TQ2H 3O2DH 2GJZA 3DURB 4WHYG 5KSBA 3K2UL 1H0DA 1U3HB 3CVHL 5GS2H 1NSNL 2EDWA 4MD4B 4NNYA 4IMLB 5IR1B 1AHWB 1G7HB 1RY7B 2ZUYA 3L1OL 3CVHH 3X11B 5SWQB 2CLRA 3N1GC 5IBUB 4OD2B 5TGBB 5DMYA 1XCTB 1KJ2H 2GT9A 3RJQB 2X4OB 2FX8H 3L1OH 3BMWA 5TQ0L 3LAFA 3L95A 4O2CB 4LEOA 1BQSA 4PTTB 3MSPA 1BVLB 2XG5A 3EHBD 4D2NA 4OCMC 3RVTD 4H0GA 5GRVK 2NY3B 5KW9L 4TVPL 1IGYB 1A0QL 1TCMA 3IS1X 3O45A 4IRZL 1MVUA 5E8EA 5KW9H 5DQ9A 4TVPH 4KMLB 1A0QH 4IRZH 3IDJA 4QGTA 3NIDF 2QJDA 2V5RA 3S5LG 3MLXH 3WE6A 4Y2DA 5C09D 5T1LD 3MO1A 2WM0A 1BJ1H 3S98A 1EFQA 1EDQA 1WITA 4J3TA 5ALBH 1YUHA 4YIQB 2YBRB 3C60C 1R5VA 5FKPB 4ZXBB 4EVNB 5CD5C 4N90E 5H94B 1U3YA 5E1AB 5IOPB 1Y6KR 4RIRB 4XZUB 4JFOA 2VZ1A 4QLRA 3PWJA 1UM4L 4WW2B 4U1HB 5FFLA 2W60B 5HI5C 5I8KL 2ZG1A 1N3NA 3PWUA 3O6ML 1DBAL 3FJTA 3E6FB 5ECJE 5GRYA 4PJHB 2EE6A 1N59A 3HPLA 1JNJA 3U6RB 5INCB 5I1DA 1RZJH 3O6MH 1DBAH 3FTGB 3VXRD 3ALXA 3STBA 3ZDXE 4Z0BL 5DO2D 1O5DT 2HJFB 1HQRA 4M9OA 2F15A 3ZDZE 2EKJA 3H9YA 3LKOB 3PWVB 4XCEB 1MEXH 4AY0A 3QUZB 2H26B 1KCSL 3L6FA 2W0FB 1N5AA 1NLBL 3FHQA 4XMLL 1A2YB 1FH5L 4WGVB 5I76A 1KCSH 2V6HA 1I1CA 1NLBH 5H37G 4CN4A 3HS0B 3CDYA 1BFVL 3MRHA 3N1PC 2I5YL 2DDQL 2VYRE 4RMUA 1N64H 1BFVH 3MRRB 2EXWD 4LRIA 4G43B 2YD8A 2DDQH 1BD2B 1X7QA 4V1DB 4MJ2A 4GBXD 3WIHH 1JUFA 4RQQA 4TRPL 4FQ1L 1U92B 5F7LB 1CXKA 3OBAA 5J4MA 3TCXA 4JHBA 4Z18A 2R2HB 4TRPH 1A3QA 3K4ZA 2Y4SA 4KTDL 3LOWA 1R3HB 3IS0X 4RWHA 4LLDA 5DQJB 4MWFB 5F1IA 1BZQK 2GJ6E 3TZVD 1I1YA 3MRCA 4LVNB 3QDJE 4P5TB 2XY2A 5DRZB 5E9DA 2DBLL 3WS6A 3QFDA 4IHOB 1ZSDA 2OTWB 3FCTB 4M61B 1QSFB 5DJ8B 4IS6A 3WUWA 4OQTH 1DTUA 4PB0H 3VD9A 5HGAB 5L2KD 3BP5A 4Z76B 4ZFOB 1EHXA 2YPLB 5BW7A 3W5MA 3G04A 3GHBL 4UNTA 3MTRA 5ITFB 3NN8B 1FJ1A 4OLYL 1QP1A 5E7FA 3MREB 5HYJD 4JFDD 3BPOB 4DN4L 1K4CB 3GHBH 5BQ7A 2Z31B 3TBWA 1MHHB 1TCRB 4PGCA 5E03A 4UQ3B 2PETA 2XN9D 4G42B 4I5BA 3WFEL 4BQBA 2ADGB 3TFKC 1IGIL 3GO1H 1NH6A 3RAJL 1B0GA 2BY2A 1B9ZA 2J1KA 2PYFA 3OR7A 3GKZA 3WFEH 3GSWB 2Q8AH 2VXTH 4HHAB 1IGIH 4JVWA 3PWNA 3O6FB 1Y6MR 5FHAH 1J10A 3RAJH 4PRDB 3TEUA 1JPTL 1RQ5A 5I1LA 4I77H 5GGRA 1FZJB 2MSPA 4I2XA 5BW7C 4R7DB 4FXGA 4GAYA 5I1EH 4MA3A 1FC2D 1JPTH 3BZDA 3WNMA 1OLLA 5GS0L 1WTGT 4KJYB 2NY4C 4EDWH 3ABZA 2RCSH 2ZP0T 3RUGE 2DQDL 1RUAL 4Y89A 5I15L 5GS0H 1A14L 4U6YB 2ZKHL 4X8JB 1VFMA 2V2WA 3RTQA 2O5XL 3OB0H 1RUAH 2AK4A 1NAMH 5JXAL 2ZKHH 3SJVE 4KDTA 5HYQB 3ARDA 4Y4KD 1Q94B 3T1WA 4FABL 3S4SA 1IC5L 2AJVL 4R8WL 4JE4B 4WW1B 3PL6A 3VXSE 3P0YL 2A77L 4NKDB 4R8WH 4LSPL 1MWAL 3NPSC 3P0YH 3MXWH 4S2SA 3GSRA 2A77H 5A2JH 4G8IA 4N8CL 3NCMA 3FRUB 3RUGB 4LSPH 2FWOB 3BEWB 4R3SA 3RTQC 2FATL 2APBA 4N8CH 2EXYC 5DJ6B 4KDTC 3ARDC 3L5JA 4PJEA 1I8MA 1IC4H 5T3XH 1XGYL 4XPGH 3TO4B 2W91A 3GSNA 5JZ7C 4ONHB 1XF1A 5JUEL 3QIBB 2A6JB 2Y06L 3R8QA 1G1CA 3HE6D 3V7AG 5HHNA 3HC0B 2YS4A 3EYFA 2D7QA 2AQ3A 1F3RB 5GPRA 4R4BA 1VADA 3GMQB 1KPUB 5JA8B 2Z8VC 4M7LT 4PJDB 1A1MA 3MUGA 3TC9A 5GRJL 1BX2A 4K7PL 4X7FC 1YYMH 1G7MB 1KXQE 1LP9F 1IGFH 2M26A 4YXHH 4BQ8A 4RRPA 5GRJH 5IT2H 4GG8A 2UY7A 1WWWX 4KTYA 4JFZL 4M6NL 1IEAA 3ROOB 1ZT7B 3PHQA 2QHRH 1A4JB 1NUGA 1YNTA 2VLLA 5C0DA 3KLHC 1VFAB 1J86A 4JFZH 4JPIA 4M6NH 5I1HL 3KG5A 2M2DA 5H37H 2CDFA 3VXUE 5L2JA 1HILB 1KJ3L 5EU6D 1IEBB 2X5PA 5F1NA 1NDGA 5I1HH 3TBYB 1GYAA 4HV8A 2X4UA 3HNSL 4P23C 3PQYE 4UNVA 3GSUA 4HMEA 2GAZA 1RZKC 1QEWB 4K9EL 4QHNB 3RL2B 4OUUB 4RZCA 3A6OA 4X9GA 5C09A 3O9WB 2EH8H 5T1LA 4N68A 1Q9LB 1U0QA 4OBSA 3VGDA 1MI5E 4XP9L 1HNGA 3P9LA 4LPTA 3PUCA 4L8SB 1MIEH 3EHBC 4XP9H 1EAJA 3PGCB 3TH2T 2GCYB 5E6YA 4NCDA 3UYRH 3AC0A 3SE8L 2FYYA 5DJXA 4DZ8A 2Y7QA 5HHVH 4P2QD 3PIQB 5E99L 1JYVA 2DICA 5SWSD 3T4AB 2BJML 4YHNA 3SE8H 3WEXA 5FYJL 4HMCA 4Q6YA 5T1MA 2QR0A 2HFEA 5IMKB 2JK5A 1X5HA 5HDOA 4XB7A 2BJMH 5J9PB 2ZCHL 1Y18A 2VKXA 2DWEB 4JHAH 3S8WA 3B9AA 4G9FA 3BRDA 4RGNE 2XQYK 4F7EA 2EDLA 3P0GB 3W82A 5F8RC 4XAKE 2ZCHH 3WFDL 3WIFA 5E8DL 3L3GA 3HMWL 3GUTB 1LILA 5DURD 1HIML 1EBAA 3KPQB 3MX0A 5GZND 2DQJL 5L6YL 2QSCL 5I74B 5DD6B 1I9RL 4OLXL 2E6QA 1HIMH 4PJGE 2EYTA 5L6YH 1SY6A 2BC4B 5E1HB 2X7LA 5FO7B 1AXTL 1I9RH 4OLXH 1M4KA 5EULV 3KLDA 2FR4A 5DO2C 1TQCB 4GBXA 1YEIL 3LQZB 1ZS8B 5JQ6L 3B9KD 1G9MH 1M6OB 1CFNB 1WV7T 2SEBB 4RGNB 1YEIH 3ULVD 1P4IL 3CPLA 4MJID 5J06A 5JQ6H 3BAEL 4F3FB 3FO0L 3QCTL 1XH3B 1YMME 2AXJA 4WNQA 3T65B 2F19H 1P4IH 3TZVA 1MPAL 3C8HA 4H0IA 3QJFA 5CEZD 4D3CH 3BAEH 4ZPTA 3FO0H 3LQAC 5HYIA 1NPUA 2XG4A 1YEEL 2OI9C 4YO0A 5IMLB 1MPAH 2WUBL 3IAPA 2EXWC 4OZIF 4Y5XB 1FVDA 3D3VA 5CP3A 2FRGP 5F7WC 1FV1B 4X4MA 3IT8D 4OF8A 3G5VB 1CR9H 4GBXC 5KSAB 2IJ0C 4LDEB 3GMLA 4OKDA 4P9HC 4Y19B 4CNIB 1P9MA 3UPRB 3DO7A 2JIXB 1KJMA 3W9DA 4NP4L 3GK8L 1RMFL 5F96L 1R3JA 3DGGB 4QOKB 4MA8L 5ICYB 3IJHB 2XN9A 3C5JB 4FMFA 3TZVC 4NP4H 3GK8H 1RMFH 3DHJA 4XT1C 4KZDL 5MENE 4F37F 5CUSL 4MA8H 4PRPD 3WIIH 3U30B 3UAJC 1CFSB 5GXBB 5CGYD 5ERWA 3T0ED 4JPVH 1Q0YH 3TIEA 5AAMA 5F9WC 4XVSL 1C5DA 4M5YL 5IUSA 2NY2B 4PJ7A 4OCYL 3GIZL 2LQRA 1LP9A 4XVSH 1P9MC 3QEGL 5F9DC 3P9WB 3HR5B 5DDHA 3L3OA 4OCYH 3GIZH 3FB5B 3QEQB 2FH8A 2HFTA 4MXWH 1V05A 5B8CA 3QEGH 2OCFD 3VA2C 1KFAL 4MNHB 3B3IA 2C9AA 4M48L 3N06B 3SDYH 3NAAL 1U8QB 1KFAH 2XI9A 4TUKL 4XXDA 4KPHH 1UZ6E 4M48H 3L3IA 2P5EA 3MJ8A 4JGMA 3VFNB 4M4RA 3I50L 2HTLC 4K94L 5D9SA 3ULVF 4G6AC 3FFCD 3RX7A 4JM2B 5IIEA 4Y4KA 1ZOXA 2DAVA 3SGDI 4AIZA 4K94H 2E3VA 2DTSA 3KJ6L 3ZO0A 5HI3D 1CI5A 3GMOB 2R56L 1T1WA 5C0NC 2DL9A 3G5XA 3FRPA 5DD3L 1KG0A 4OB5L 5DEFA 2ADJB 5C7XL 5B8CC 2IALA 3QQ3B 2R56H 2ARJB 1OAYH 3MA7A 1A1NA 3C09B 3CCHA 3MRLB 5LGHL 5FGBA 4NNXA 4B41A 1RFDL 5CZKA 1OT1A 3EDEA 1EH9A 1OQXA 3ROLA 2NY0B 3MFFB 4ZSOE 3VXTB 2VQ1B 1RFDH 1BJMA 3MV8E 3FO1A 4NRXA 2HAZA 3PP4L 1H5BB 3PGFH 4Y4KC 5AD0B 2XOTA 4ZQKA 3LN4B 5L9DL 4OZHF 5BZWA 3V5DB 2ZG3A 1QZ1A 2HP4A 1X5LA 3HE6A 4PRAB 3BVNB 4U1GB 5ESAB 3LPGA 4ERSH 4EUPB 3WMSA 2C3VA 5F89B 1CDHA 2WIIB 1MWAB 1AGBB 2AJZB 5D70L 1HKFA 5IF0A 1Q9OA 5CGMA 3QIWB 3UJJH 1DFBL 1D9KA 1PY4A 4Z5RA 3HLAA 3BDYL 4YE4L 3OJDB 3T09A 5HGBA 5DJCA 4HUVB 3Q5TA 4YEEA 4GLRH 4X7EC 4ZSOB 1QSEB 3VCLB 4M7ZB 3STLB 3QUXB 3RVWD 5GS1A 3FO9B 4FQXC 3SCMB 4WO4B 2PCPB 3VFSB 3EO1A 5DQDL 4K7PX 4HUKB 5DMKA 3W0WD 4XNQB 1ZA6B 2ESVE 5ELIA 2Y23A 2ED9A 3S96B 1NGPH 4FQIH 5F3BB 1QKZL 1TLKA 4FG6D 1EXUA 4OCRL 5EU6A 5GISL 3Q6GL 4Y5YA 3IVKA 1QVOB 4NZTH 5L7XL 5IVZA 4GJTB 3DHMA 1QKZH 5L0QB 3THML 4OCRH 5GISH 1QSZA 2EDXA 4ONGL 1FO0A 3P4NA 5L7XH 1OARL 3SPVB 3BD3A 3WN5C 1D9KC 1RU9L 4P5KB 1WAAF 4ONGH 3BZFA 3V4UL 2AK1H 2E9JA 5GS1C 3CH8A 3O8XB 4KHTL 2WBJD 1M7DB 4AH2B 1MCNA 3ARWA 4OZIA 2IMNA 3V4UH 5FO8A 1F90L 1I7ZB 1B6UA 3T08A 4ELMB 1ZHBA 5I1AA 1C5BL 3KPSB 2AJXL 1F90H 1P7QB 3ARFA 1OQOA 3RNKA 5DRNA 4P2QA 1FNLA 2AJXH 3QZWA 5SWSA 1KTLB 2GEEA 1X6NA 4RISH 3MA9L 5KVMC 3WD5H 2R0KL 5D5MB 3UTOA 4WWKD 2R8SL 1CU4L 5CEYB 1NBZA 3C6LB 4R96A 3LDBC 1RUKL 1S7VB 2R8SH 1Q9WB 1HI6A 2EDYA 3C5ZA 4HWEL 2J8UF 1VEMA 3EFFA 2HMID 4ODXA 5KOVC 3TNMA 3ARFC 3VXPA 2JLLA 3K0WA 4OD3H 2FGZA 5CZVL 1X5AA 4L29A 1NGZA 4XGZB 3CFCL 3OHXB 5CZVH 3TH4T 4PLJC 4X4YB 1RUQL 5B38G 5I2IB 3LPWA 5I8OL 2C1PA 3IDNB 4Q9CA 4C59B 4F33A 4XVTH 5I8OH 5GGVL 2HT4D 3EDJA 3B9KA 4KKLC 3C5ZC 5GGVH 4MJIA 1AC0A 3F7QA 1FFPB 1T7ZA 3QXDA 3IXAB 4KKCD 5LBSL 1Q9KB 5GZNC 1QHPA 3CK0H 1BBJA 3VD4A 1ZHLB 5LBSH 4U05A 3HA0A 3RL1A 3IGAA 2PF6A 4TNWF 4PJ8D 2JCCF 5ACMA 1FFNB 3MRDB 3IU3A 4X6EA 4QRPE 1KSRA 1W72A 5C0BD 1JV5B 4PJAF 2JJTA 2P7TB 1LO2H 3RDTD 1JPGA 2AXGA 1FL3A 4H1LA 3QA3B 4HEPG 3KDMA 2NYYD 4LMQI 3ZE1E 1KBGL 4X7SL 1ZK9A 3HZMB 3EBAA 5INDB 5ALCL 2Y72A 3TYFB 3CC5A 1JZ5A 1SJHB 1DQTA 5E6IB 1KBGH 4X7SH 1S9VA 4JQIL 4OZHA 1U42A 3IDYC 2FBOJ 5MEQB 1CICD 5BMFL 3I02B 3CIQA 4IIQB 4JLRA 4JQIH 4PRPA 1A6WL 3ET9F 3C08L 4X5WB 4M43H 3T0EA 4TULH 3GNMH 4O2FB 1L0YA 3C08H 1D5BB 5I71C 2JJTC 5IEHA 1WC7A 4QRPB 1EERB 3HCVA 5F6IC 1LGVA 2DQIL 4M4PA 3TNNA 4RMWA 1TVBA 4X6FB 3S3JA 1CD8A 1F6AA 3I2CH 2CUHA 2VKWA 3OJMB 5K33A 4F2MA 5JXED 2EO1A 2VITA 3QDGB 4KGJA 5TE6L 1UACH 1BIIA 1MHCA 2XRAH 5L8KB 3KYNA 3MRKB 1RJLA 4X8XA 1CFVH 4U7MA 3K81A 2VDML 2H32A 3ULSA 3BIAX 4BUGA 1HSBA 1HXYB 5BV7C 5CGYC 2CPCA 1XGPA 2NW2A 2Z35B 2VB5A 3DX9B 1KGCD 1WIOA 1U93A 1I1FB 5DUMH 3ZHLA 1TQBB 1MCSA 5IW3A 3ARGB 3OXRA 4OZGF 3U79A 3OMZA 2R2EA 3SE9L 4D9LL 4UQ2A 5E2UL 3UTSA 2E7MA 3TT3H 1T6WA 4LVOC 4YK4B 5D7LE 3EO0A 4I18B 4LKXB 4P2RA 1AR1D 4OAWA 2BMKB 5JQHC 3Q3GA 5KTEH 4RAVA 3WUZA 1GVIA 1J05B 2CDEB 4LARH 3CU1A 4HAGA 3RWJB 5AZEH 3P0VL 3LVEA 3BIKB 3RPKA 5DJAB 4WI5A 5DEZA 4MZ3A 4GKSB 1BOYA 5EU7E 4PJIE 3TA3D 1J1XH 1KCKA 2O26U 4HCRH 4L4TB 5C0AD 3LKRA 1EMTH 5KVDL 5EBMB 1F2QA 1CG9A 1T1YA 1ULVA 1NJ9A 2GK0B 2XZCH 1X5ZA 5D7LB 2F8XC 4K71C 4UDUB 5KVDH 4X4XA 3WJJA 1JGDB 1H15B 3JV4B 1EK3A 2H45A 3G5YB 3LB6C 4QHUA 5ILTL 1RIHL 4G7VH 2J8UA 3VGBA 3BGMB 4H26A 5FM4A 4AMKH 1ZGLM 3KWWB 5ILTH 3OR6B 2OMBA 2GFBB 4NO5B 4XPHH 1FFQA 2GSIA 3WNKA 2R1WB 4EIGB 5HI4C 4FA8A 4I4WB 1SJEA 3MBEA 1WWBX 5JIPA 3KPLA 2RB8A 4F58L 4UU9A 4XP6H 5IEKB 1N8ZA 4KQ3L 3KNBA 3U7WL 1XF4B 3W0WA 2IAMB 4NKQB 4PJIB 3LY6A 5IVXE 4KQ3H 3DWTA 3FB7A 4J1UA 3U7WH 3W9EA 5J0BA 3WJJC 35C8L 2HJKA 1JP5A 1S8DA 5A2FA 4LBEB 2GIYA 3RZCB 35C8H 1EGJA 2BCKA 4RA3A 5CILL 3DVNB 1CQKA 3RWGB 2XQBL 1HE7A 2ED8A 4NUGL 1ZKAA 4I9WD 3MBEC 2I9LA 3CLFH 4K8RD 4PG2A 3DYMA 1CGUA 1JWMA 2WBJA 4G6JH 3TLRA 3KR3L 3QFJE 1DDHB 4HJ0D 2JCCA 4WCYL 3T8XB 1T22B 4HPOH 4APQD 5J6GB 3E6HA 1LE9A 2EDKA 5FUCC 3MGTA 4GAFB 4PJAA 2I60H 4O2EA 3PGDB 3HZKB 4FG6C 4I0PA 4ZODA 3JBG7 3O4LE 2A2QT 3MLUH 1JYWA 1J18A 1T5WB 2IBZY 4PG9A 5BVJB 4S1SH 5E4IA 2BNUB 3UZEA 1FNSH 3Q48A 4GKOA 4FRWA 1ZLUH 4XP1L 5CZXC 3TJHD 3VA6A 2J2ZA 4KZEL 5J11B 3BPNB 3MROA 4WWKA 4PG2C 4KZEH 2A9MH 2WBJC 2ATPB 4NT6B 4OLEA 4L8BA 2D31B 1J1OH 3WDIA 2XKNA 4U3CA 5J13B 2V2TB 1R3IL 4I0PC 5F7YC 4IDJL 3TO2A 1R3IH 1A7RL 4W81A 1FL6A 4WENB 4E42B 3FB6A 1DVFB 2AAVA 4IDJH 2HRPL 5EC2A 3DYOA 1UXSA 4P4KD 1A7RH 4C56A 3CZFB 5F21B 1A6ZB 1EVTC 1IGJB 4WWKC 2VTFA