2CUMA

The solution structure of the 33rd fibronectin type iii domain of human tenascin-x
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
105
structure length
105
Chain Sequence
GSSGSSGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Tenascin-X
publication title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
rcsb
source organism Homo sapiens
total genus 6
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cumA00
2CDFA 4XP6L 3QQ9D 2ICES 3SDAB 5SX4I 4Z7VE 5C0IA 2ZCHL 5BMFL 3L3GB 3RWGB 4LOUD 1HE7A 3B83A 3TBTB 5CEZL 1JPSH 4ETQA 2NW2B 3UZVB 4G6FB 1F4HA 1IGJA 5FO7B 1JNJA 4OZGB 2P42B 3JWDC 1A14L 4QKXB 4ZPTB 1NGYB 4G5ZL 1CD0A 2X2YA 3B9VA 3WSQL 2B8OT 3LIZL 2PN5A 5T33L 4LRIA 5I8EA 4CMMA 5I17B 3O6KL 4BSWA 1VFMA 4ONOA 2NR6D 5BS0E 2C1PA 5D1QC 3P9MB 3OAYK 1FAKT 4G6KH 5B39G 4HUVB 3MV8E 4X6BB 1E28B 3EYQD 4CUCA 3T09A 4JRYB 1T1WA 5FYLE 5SWZD 1LEIB 3MJ9A 2GHWB 5ANMA 5IT2L 3FFDA 5D2LE 3MLRH 4JM4H 3IDIA 2PUQT 5JDJA 3B9EA 4I0PD 5FB8B 2HG5B 5GGUA 4LF3B 5EIQA 3LPFA 4K7PL 4NJAL 35C8H 3GBMH 3P11H 5DC9B 5J57B 3LV3B 1Q72H 3CU7A 4U1NB 5JHLH 2DWDA 3MV7B 4NDMB 4KHTL 3OX8B 4QRUB 1DLHA 5FA4B 3U7WH 2J8UE 4OLVL 1QFOA 4OD3H 4OT1H 3VI3E 2A73A 1C5DA 2A1WL 2WSKA 2HN7A 2GJZB 5EO1B 4J8RA 5B22A 3RWJB 1HH9A 2HVKA 4LHUA 2AK4A 2WWMC 5FGBC 4YDKL 1OM3H 3VFSA 3WIHL 1T4KB 2H3NB 3V6FA 4RMVA 2E6JA 4WUKH 2HJFB 3MZTA 1ZVHA 3BJ91 4JFFE 4H8WH 4MB3A 1VFUA 2AEQL 1CBVH 3X13B 2IANA 4S1RL 4HPOL 5BRZB 3IETA 4K23L 5DGRA 1M1SA 5DK2A 3O6FC 4PRBA 2YD2A 4BFBD 3NN8B 2X1PA 1KN2L 5EU5A 3C60D 5KG9A 3CVHA 4XBEH 1NDMB 5FYLH 4L3EA 1R3KA 4P46A 3HMXA 4G6JL 1I1RA 4U1LA 5GJTH 4LNRB 1BVKA 4I3SL 5FGCB 3OKNB 1S9WB 3AMLA 3P0YH 1MJJB 2Q8BL 5HYSA 2PYFA 4HFWA 3T4AA 3VD9A 2G75B 3U4BL 4ZOEA 1T83C 2VXVH 3HZKA 3QEQB 3OKYA 3BMWA 1IAKB 5C0ND 1MOEA 4IJ3B 4MXQC 1TNNA 1MCNA 1OW0A 3KLAA 3VFWB 1D6VH 3WN5B 2VZTA 1NSNL 4JGMA 4HZLB 5DO2D 2YD1A 1U8NA 5F6HI 3ROOB 5IB2A 1G7MA 5BVPH 1AHWC 1CFTB 3MRMA 3UTSE 3PQYA 3B5HA 1A7RL 1S5IL 3ULVE 5T1LA 1R5IA 4NZDA 5BV7L 3W2DH 5F7UA 3MO1B 2ADFL 2R2CA 4GRLC 5IMLA 1IE5A 4G8GD 2YEZA 3BFOA 3RU8H 5TPWL 1QPXA 3VGAB 1ZGLB 2FX7H 4X7TA 1Q9LB 4XCFL 3IFLL 1KC5H 1MHHB 4XAKD 2XY1A 4P23B 3D2UB 2R4RH 2NY2C 4PJHA 2DQHL 4ELME 3FCTA 3CFJB 3IDYB 4UBDD 1F42A 1U93B 1W0WB 1XF3B 4U1KA 4HG4K 3V6ZA 1BIIB 3DXAA 2MNUA 2LABA 4KH2A 5EU4B 5M7QA 2XZQL 1E6JL 4RFOL 3MR9B 3G6JB 4GKNB 5JPNA 1NDGB 1DVFC 3KPLA 1AGCB 4ZOBA 2CLRA 3V8CA 3JXAA 1H9VA 1G7PB 4Z7UE 2QQLL 4XCYA 3IFOB 1HCFX 4HT1H 1ZGLM 4P5TA 4URTB 4ZUVB 3WFZA 1VFAA 1NGPH 1OY3B 4KI5D 4R3SB 3GIZH 1KF9B 3QXTA 1BBDL 5BOPA 2UWEA 3SDAC 4XZUB 4RFEB 4JFYB 2OTWA 1RUAL 4BSJA 4CRPA 4NQCD 1MCWM 1F3DJ 5KVEH 3MLUL 4XWGH 1BHGA 4JHAL 1U3HA 4DN4L 1NCBH 4G8IB 1P1ZA 4PJCF 3S36H 4ESKA 5ID0B 4OM0H 3BZDA 1NGZB 2B7DT 4BZ1L 4XRCA 3QFJA 2D31B 2E8YA 4L9DA 3U82B 3ARED 2FZ3A 1IAII 3DV6B 4N5UA 1AXTH 4GKZB 3T0AA 5L8LB 1XMWA 4R97B 5FM8A 3D39E 4GMSH 1RIHL 1VEPA 5SWZE 2DTML 3S37H 3GKWL 4GG6E 2RAMA 3KYNA 1QFUH 1IAIL 3CX2A 2OTPA 3F62A 1U8QB 4RSVA 4N90D 1BEYL 1XGQB 3KPRD 3U7AA 1P4LB 1INQB 4WY7L 3T2PA 2R1WB 4HJGA 1MAML 5F6IB 4AQ1B 5MHSE 2JK5B 3RPKA 2LAGB 3ES6A 3U4EA 1FC2D 4HUXB 4U4BA 3ARBC 2ITDA 4JO1H 1OF2B 4AENA 4FTVB 5EU6D 1W8NA 5L0QC 2CIKA 3RZCA 5HVWA 4MXWH 2AJUH 4OCYL 3EOTL 1D6EA 3MRLB 3V52L 5IVZB 5LBSL 1VEOA 5GSRA 5I1AA 1S7QB 3BP7B 2HFFB 1U8OA 3O8XB 5IV2A 4N68A 1W72A 1OTUD 3RWEA 3RJQB 4XBGB 3KPNA 4PJBE 5DC0A 5F7MC 5I71B 1EHAA 4GJTB 4JG0H 4RISH 5C8JA 5JHDB 1L4IA 1WUNT 2M1KA 3KYKH 5EBWA 1QRNA 2OBGA 4OCRH 5FFLA 4TSAH 2VABB 3QFDB 5KSBA 4DTGL 4OZHE 1X5LA 2LU4A 1KCSL 5C2UB 5D7KE 1LNUA 5BV7B 2OP4H 1F3JA 2F74A 3VH8A 2GQHA 1JPSL 4LDLB 4K55A 1I3VA 4PJAE 5EO9B 4ODXA 4ZTOH 5IQ7L 2C3HA 5JIPA 2YR3A 4GRWB 3LN4A 4GT7A 2IFFH 1F4XH 3WN5C 1JI1A 4TSCH 3TBYB 2D7TH 3EDFA 1IEAA 3BEWB 4A2MA 1KB9K 4I77H 4R4ND 3VXTA 2UZYB 3RRQA 1MVUB 4KK6D 3DGCR 3QNXA 4G6KL 5J1SC 3GBNL 4JVWA 2H8PB 5TDNA 3SE4A 3RTQA 3GB7A 4G9DB 1F4YL 4X98A 2YRLA 3UX9B 3H0TA 3MLRL 2BVEA 4DFHA 4CVXB 5CD3B 1KIPA 1CD1A 1G9NC 1NUFA 3HA0A 3DECA 3GBML 4Y2DA 8FABB 3MRHA 5EU3B 2GK2A 3D0VA 3P4LA 3SKMA 3UTTA 4A6YA 3S34H 4LCWE 4XAWH 4OD3L 4OT1L 4PRIB 4Y5VB 4G7VH 4Y16A 4JHBA 4WV1B 2ICWI 2NY1D 4IDLA 4LVHC 3U2SB 3RY5A 2RCSH 2Y23A 1OM3L 5L8JB 4DK6A 1D5IH 1UACH 3P9LB 3TA3B 4LSVH 5DHYA 3W5MA 4ZQKB 4LIQE 5HYIA 1MPAH 4AIZB 4WUKL 5EOCL 2FX9H 2YD9A 3D69B 4I2XB 4PV9A 5H35B 5T5NG 5IJVA 5FUZH 5JXED 4H8WL 4MSWA 1CBVL 3NTCH 3HR5A 4P2OD 1ROWA 5F3HA 4GAJH 2V2TB 2VLJE 3Q1SH 4IMLB 5BVJA 4JDTH 1WT5C 5DJYB 3AS3A 1GGIH 4B7LA 2MKWA 1OTSC 4XBEL 1GGCH 5FYLL 4L4TE 4P4KA 2QQNH 1X6LA 5HBBA 4JREB 1HH6B 3KVQA 3Q0HA 1U91A 1P7KA 5GJTL 5LG1A 2OL3H 2AQ1A 5CAYB 2J2ZA 1UM6H 3P0YL 1VKXB 5CGYC 5I2IB 4D0CA 5JOEA 5E4EB 4R2GD 1CFQB 3WIIL 1NFIB 4HMDA 4R97C 5JORB 4MLIA 2VXVL 5DMGD 1Q0YH 3KPSA 1UWEH 4MA3A 5J3HC 5C0GA 3TIEA 3A67H 3TM6A 2BVOA 3S5LB 5I1GH 3GFUA 3WIFA 4HG4J 4D8PA 1A6ZA 1D6VL 4G80B 2RQ8A 2ITCB 3CZJA 2Z8VC 3JV5A 2VN7A 3PWUB 4PV8B 1TZIA 4N90E 3KPRE 3DBXB 5I73C 5E6ID 5BVPL 3WHXB 3AMKA 1YEFL 3EZJB 2YD3A 5IMMA 2EDJA 4R9HA 1IAIM 5F6IC 3MNVA 1C12A 3W2DL 2WZPD 5EWIH 1A7QL 3QUYD 2XKNA 4WWID 1OGAD 4NUGH 1KT2A 4KPHH 1KC5L 3P30L 1MI5D 3QIBC 3NCEB 3QULA 3IT8D 3P4NA 1TQCB 4AIOA 2RGSA 2J3SA 1HXMA 5EO0B 5TDOA 1U0QA 5E2TH 1BGXL 3BPNB 3MFGB 2P8MA 4FQ2H 4CN1A 1U8MB 3QO1A 5C3TA 5JTWA 3H3BC 5I71C 5KVFH 2WLYA 2AS5M 1J5OH 3QUKA 4M1CD 1OARL 1YEJH 4LFHD 1HYSC 1S7RA 3P4MA 4KJPD 3SDDD 4WUUD 4LPCA 3RY4A 2EE9A 4HT1L 1B0RB 4OLXL 5FHBH 1F6LL 4ZUTA 5K59F 4KDTA 3GIZL 4FXGB 1CDGA 5BV7C 4YDJB 2H9GA 3CDGA 3EYOB 5CP3A 3ULVL 4YHNA 2GSIB 1X5ZA 3E6HA 4LLMB 2CPCA 5KVEL 3NGBC 1WWBX 4XWGL 5D1ZD 4U0QB 4YH6A 2CO7B 1QSVA 4OM0L 4P59H 5C07D 4D9QD 1NBZB 3UTQA 1U58A 2OM5A 3L7EA 4OZFA 1FG9C 3WFEH 3MRJB 1TJHH 4LEOB 1AXTL 1SHMA 2CLZB 1FAIH 1U8IA 3C6LA 4GMSL 4Z7VB 5FYJD 3DETD 1IM9B 1XGTB 2EYRB 2WBJD 3BP4A 4PGCB 5D96B 3S37L 2F53D 5I1KH 3RPIB 1QFUL 2PCPB 1QQDB 3QDJD 1T0MA 1TCMA 4PLKD 3WCYA 4OF0A 3BIAX 3VI4E 2EEBA 3ARFA 3MXVH 4UMGA 4AEIH 2NY0C 3K1KC 1X5HA 3N85H 4Z7NF 2ICWB 5BS0B 3L7FA 3IGAA 1RJYB 4PRPA 1ZT1A 2CK2A 4NQEE 5D7IA 4MCZB 1NJ9B 1WK0A 5I1DA 1YEEL 3TNNB 4JO1L 5IROC 3KYMA 2X44D 3O3AA 3TO2A 5GS0C 5D2LB 2AJUL 4PG9A 2MPAH 5AG8A 4F3FA 2H26B 4HW6A 3T4YB 4K7FB 3TT3H 3TZVD 5B38G 3ZSSA 4Y19D 2XTJD 3P3YA 3N1FC 1CICA 3ETBF 1EVUA 3DVNB 1RIUH 2FO1A 2JCCF 4N8VG 5DVOA 2Z9TA 1TZHA 1Z2KA 2BSSA 3K3QA 5E5RB 2DAVA 4JG0L 4RISL 5EULV 1KB9J 5K93A 2V5TA 3S88H 3KYKL 5IMOB 2DKUA 4O02H 4OCRL 3QUXD 1JFQH 4TSAL 2JF1A 2BNRD 4XVUD 1T1YB 4RAVB 4LSPH 1JRHH 4DKFH 3RWHB 4OI8A 2OP4L 5E4EC 4OV5A 4JFFB 4RA3A 5A16A 1CL7I 3D5OF 3UZQA 3KLHD 3OPZH 4P5MA 4FXKA 4ZTOL 5D5MF 3FOMB 4DN3H 2PW1A 2X4QA 3Q2CA 5MEPB 1KTRL 2B39A 3GSQA 3PJSB 5E8OA 2AERT 3U46B 3DRTA 1VADA 2IFFL 1OQXA 4TSCL 1F2XK 2QADB 2D7TL 3QJHB 4FFVD 1KLGB 4GQ9L 4M9PA 1HKFA 1KXVC 2PYEE 4I77L 1TCRB 1MFEL 4JRWA 4HKZB 5M95B 3RIFF 3ARWA 3JVGC 3QPXH 3QZWG 3MFFB 2P8LA 2D03H 3OAUH 3VXME 4OZGF 1H0DB 3GSXB 5DVNA 2EDXA 1OGAE 2X9WA 3FN3A 1MI5E 1R6VA 3DTXA 1FC1A 4UIMA 1JNNH 1SYVA 4QOKE 1ADQL 1R3IH 2EEAA 1TQCC 5IIEB 3W81A 3AY4C 4MAUH 1QR4A 2Y7QA 4NZUH 3L9RA 5JDSB 3Q5OA 2Y36H 4LLWA 1ES0B 2HKHH 3BPNC 3L6FB 4RWYH 4PP1D 3UTSB 3VWKB 1K8IA 2ZG3A 1CIDA 5ERWB 3S34L 1UKTA 1M6OA 2EXWC 4XAWL 2BY0A 4Y4KD 3EYFB 3C60A 3MRFB 3K8LA 4G7VL 5EDXA 1JK8A 1HQRB 3HG1D 2F54B 1ED3B 4X6DE 2JJSC 1XCTB 4YIQA 2RCSL 5CBAA 4NQTA 5F9OH 3B9AA 1D5IL 2EEDA 4LSVL 4K94H 2HH0H 1MPAL 4ELMB 3SDCD 5A3IC 4KDVA 2FX9L 4NZJA 1MH5A 2B5IC 3MRQB 3B5GA 4HEPG 4MD0A 4UT6H 5FUZL 3AFLA 3NTCL 2A77H 4U1IA 4WFGE 3MLTB 4GAJL 1BQHA 3Q1SL 2X1QA 5ESAB 5JR1H 4MNQA 4NN5B 1ETZA 5I9QB 2OXHA 4F2MB 4JDTL 3V4UH 1T66C 3VFRA 2NW3B 4CAGA 3GSVA 4HIIB 4M8QA 1XR9A 1I1AB 3REVB 2V2XB 2EIBA 5D6DC 5GZOC 2IMMA 3FO1B 5C07E 5KBNC 1DSFH 4Z7UB 2OL3L 4P2RA 3AROA 2DM7A 4CVWA 4HF5H 1UM6L 2J6EA 1DBBH 1RHHA 4JQXA 5IGXH 5BOZG 7FABH 1MF2H 1NAKH 1S7WA 3I9GH 4G8GA 5FKAA 1Q0YL 5CSZA 2Z92B 5DUPH 1UWEL 2EE6A 4LHUG 1BJMA 3A67L 2H6PA 4D94A 5I1GL 1IGYB 3RNKA 2F53E 4QNPF 5GGSA 4HBQA 2XN9B 1AD9A 1MNUH 1FFOB 1EV2E 5BQ7A 4TUJB 3DX6B 4LVEA 4IRJB 5JXAH 2ESVD 5HDQH 3ORJA 5L2JB 4H8WC 1MFCL 4LSUH 5KN5A 1H15A 1MWAL 3MA9H 1T1ZA 3QXVA 5EWIL 5C0JA 3NOIA 1FCCA 4G8EA 5CIPH 4KPHL 3EHBD 3ZKQD 3D39B 3RVWD 3VJ6A 5D7SH 5KSAD 3RWIB 3QIUC 1I8LC 3DYMA 4PJFB 4GG6B 5J12B 1F02I 5EBGA 3VD5A 4X4XA 1UC6A 3Q3GA 3TVMB 1QBLH 2YBRA 1PAMA 3O9WD 5E2TL 1EIBA 4JM2B 4EUPA 4FQ2L 4NQCA 4L3AA 2BZDA 3U6RA 4CNIB 3BKJL 3GMRA 5KVFL 1G7IA 1RUPL 4O9HH 2EO1A 1J5OL 1FFNB 1ACYH 4KJYB 5HHOA 1YEJL 5IF0B 4OZIA 4H20H 4M02A 3BKMH 5FHBL 1B0GB 2BNRE 2CQVA 3FQXA 4PB9H 4YHPB 4JLRA 4KV5F 5IW6B 5J9PA 3G6JF 3H7LA 3AREA 4YR6B 1FN4B 4YGVB 5DT1H 2DQGH 2OS7A 1HOCB 4JB9H 1MLCA 3FB8B 2JCCA 1T7XA 4F37F 5F93C 4AEFA 2FJFB 1K2DA 1GIGH 4M48H 4PJBB 1VACA 3BZ4B 2NYYC 3NZ8A 4JO2H 4FFWD 3WKNA 3MROA 3OR7B 4F9LA 3QIWB 1TDQA 4P59L 4BFIB 3MJ7B 4Y89A 1BVZA 1BFOA 5GGQH 4PUBH 5J6HA 4XP5H 1K8DA 1FLRH 2CK0H 4OZHB 3WFEL 4IS6A 4P9HH 1XIWB 5C6PB 1TJHL 3QI9D 4FQPA 2EYSA 4LMQE 4ODVH 3CAFA 5HDOA 4KXZI 3EO0A 4V2CB 3UJTH 2IG2H 4NKIL 4PJAB 5EU6A 1HHHB 4NKQB 2E6PA 5F3BB 3EGSB 2HWZH 3AVEA 1WEJH 2OMNA 4GXUN 4OB5H 1V7NH 1CG9A 3CSYB 3EOBA 4CDGC 4M6AA 1WJ3A 3NFPB 3MXVL 4H1LH 4AEIL 1WFNA 5E08H 4ONGH 4DWHA 1IKNC 1TXKA 3BGMB 3N85L 2FLRT 2ZSWB 4WHYG 3TBTA 5TF0A 3U36A 1N0LA 2HAZA 2NW2A 3ULVC 5FO7A 3RNQB 1A02N 3O0RH 4OCXH 2HJLB 1I9RH 1YZZA 4JJ5B 2DWEB 1NGYA 4ONFH 4R8WH 3QEUB 4D0DB 4OIIH 5J7CC 1J8KA 2YPLD 1JYNA 2QKIB 3WJLA 3WXVH 5I17A 3TT3L 4IOFC 1YMMD 2OL3B 3BN9C 1S78C 3ILQC 4OV6F 4KK9D 2WIIB 3HUJA 5GGTA 4HUVA 1JN6A 4GOSA 1I3RB 4TNVK 4ZO7A 5CILL 4RZCB 4HIXH 5I9QC 4JRYA 2ZOLB 1LEIA 3T2NH 4TPRH 2DD8L 4JFOA 4LCWB 1I1AC 1WAAE 3S88L 3HNTH 5FB8A 2HG5A 4O02L 4LF3A 2B1HH 1JFQL 4J23A 1S9YB 3ZTNL 4U49A 3LV3A 3MJ8A 5K9QI 1AR1D 5DMIH 1LO3H 3BH9B 3BYYA 3TLRA 4DKFL 2VISA 1SJXA 2JJWA 4JFDD 5BZDA 4GAYB 3PGFL 2CGRL 3QQ9C 4QRUA 5FA4A 5IMKA 4IHOA 4H25B 2VLJB 4LOUC 1D5XB 4WHDA 2A6IB 1O7SA 3P40A 1HXYB 2GJZA 4NWUH 5C0BD 4BSVB 1CFSB 1U3ZA 2I60H 4L4TB 3OJMB 1J9CT 1JV5A 4ODHH 2BNUB 3PWNA 1ULVA 5JIIA 3GIVB 4PJDB 4XPHH 3SKOB 1DDHB 2D03L 5BRZA 3KLDA 3LZFH 4XNYH 4ODSH 3AU1B 3SGEI 4OIBA 3TN0D 2C3VB 3EYQC 1AKJD 4QGTA 2HLAB 1NDMA 1JNNL 5KTEL 4Z8FL 3ZHDA 2YUXA 1HHJA 4MAUL 5J12C 3TO4B 4NZUL 1VFBB 4LNRA 5I1CH 4I0PC 1DL7H 1X5XA 5JXEA 1S9WA 4PJXE 2Y36L 3VH8G 2VLMD 1PY4A 1NCTA 4JM2C 2I26N 4JPIB 2X4PB 1IEBB 4RWYL 1R5VA 4DZBB 2A9ML 2G75A 5DJ0A 5C6TL 4EI5B 2XG5A 2O5YH 3QEQA 2I07B 1IAKA 3W9EB 1BECA 4FQLH 3VFTA 4XC3H 3IDUA 1D7FA 1BZQK 5F9OL 4YBLB 1F4AA 4KK5D 3ROOA 3DYPA 4K94L 4I3RH 3T0ED 1JPFA 3KDMA 3DRQB 3O3DB 4UT6L 2YC1B 1CCZA 2Y6SC 3GZKA 2A77L 3HKFA 3CFBA 4N1EA 1S9VB 3QA3B 4YC2C 2UVFA 5JR1L 5EN2B 1MQ8A 2CDEA 1TMCB 2DL2A 3MRPB 3QRGH 4N0UE 3PHSA 1WIPA 4Z76A 5DJ2B 4ZS7L 4P23A 2ADJB 3D2UA 3QH3A 2O61B 1OP3K 3C60C 5D1XB 1EEZA 4JDVB 5E6IA 3O2DH 1W0WA 1XF3A 1DSFL 5FK9B 2YKLH 3RL2B 1BIIA 1DBBL 3SOBH 1FIEA 2C4XA 5EU4A 7FABL 1MF2L 1PQZB 1NAKL 3QUYA 1SBSH 5M94B 4X8XA 2P5WD 1N59B 3L3OB 3OKLA 1NDGA 4GKNA 5DUPL 5D7LE 5DJXA 2CMRH 4UDUA 3VFVA 4EKXA 1HHGB 5DSCB 1FYTE 4FQHA 5C0AD 5C0NC 1G7PA 1P9MA 4GXUM 5JQ6H 3X14B 4MAYB 1JZ2A 5JXAL 1ZLWK 4ZUVA 3AB0B 5E6YA 5HDQL 5DO2C 4UT9H 4U0RB 4PB0H 2PO6D 4R3SA 3DUHA 1JGLH 3MYJB 4XZUA 1CQKA 5FM4A 1M7XA 3V0VB 3MA9L 5T1MB 3SGJA 2RIKA 4X5LA 4BZYA 4JKKA 4OF5A 4TVPH 4PGBB 4NQDB 1L0YA 5J8OA 2FCBA 1CIUA 4G8IA 4EVNA 3OSKA 3U0PB 2X6MA 1JNHB 3VRLF 5ID0A 5DRNB 1YY8B 1SVCP 3ARDD 3OWEA 4XNXL 3RGVB 4UBDC 2D31A 2W65B 3WE6B 2B20A 5BJTA 2FB4H 2GJ6E 3DV6A 4MD4A 4Z7WE 2AGJH 4GKZA 5HVHC 2BMKA 4OLZH 3CFIC 2OYPA 3MV01 3FOLB 1E4KC 2I9LB 2G2RB 4NQEB 1AGDB 4MWFB 1ACYL 4MVBD 3TPUB 3D3VD 1DTUA 4H20L 4AMKH 2KQMA 5D6CB 1S8DA 2OZ4A 3ZDXE 3WIHA 1XGQA 5SX5H 1P4LA 1INQA 4PB9L 1BBJB 1ND0A 4X4ME 1EX0A 1U8KB 3BWAB 3I6KB 1JYXA 3GRWA 5SWQA 1HILB 5GSVB 3WUWA 2HTLD 3GK8L 5DT1L 1AD0B 5E8NB 4JB9L 2D2OA 2JK5A 4MB4A 4D0BB 2QSVA 4ZPVA 4XNZB 4Y1AB 1OF2A 5I8CB 3FZUD 4M48L 1YEIH 4JO2L 4KHXH 5GGQL 4PUBL 4CADB 3ARQA 1S7QA 1ZT4B 3BP7A 3O8XA 3MOAH 3SKJH 4CN6A 4P9HL 3ECBB 1BVLB 3DGGA 5H8DA 4ODVL 3INUH 4NKOB 3LN5B 2Z93B 3W82A 3FQNA 4XBGA 3UJTL 2IG2L 5JHDA 3GJEB 1WC7A 4JFXB 3S35X 3VWJB 2Z31B 3MNWA 5HVFB 1NFDB 3FQUA 4ZUSA 1WEJL 3QFDA 4OB5L 1V7NL 3X17A 3ZDZE 2V5MA 2A6KA 2VLME 2PYEB 1J12A 5E08L 1RV6X 1IVLA 2QHRL 4Z7VF 4Z0BH 5CJBA 4RIRA 3DARA 5F7FA 1IQDA 4EI5C 5GQBA 4C56E 1OTTC 2NZ9D 3G6AB 3VXMB 4OCXL 1I9RL 1ZEAH 4ONFL 4QO1A 4R8WL 4RFNB 2BHYA 2VXSH 4OIIL 3H3PH 3QUXA 3TBYA 4YBLC 1Z9OA 3QHZH 1CLZH 4LMQI 4OZFG 5AG9A 1UZ8B 2FBJH 3K0WA 4QOKB 2CRIA 4WW2A 4LCUB 1QR1A 1MVUA 4IMKA 3FRUA 2D4FA 5D2NA 3DHJA 5ISZD 3QDMD 1FSKB 3I75A 4U33A 3GMPB 4HIXL 2BOBB 4G9DA 3T2NL 3C6SB 4TPRL 1PX4A 5D2LF 3HNTL 4TVSa 1R3JB 1PG7X 1UA6H 4F37K 5CD3A 1MCFA 1QBMH 1EO8H 3FQRB 4X6DB 1T22B 2JIXD 8FABA 4EDXA 2VDML 5DMIL 4R96A 1LO3L 2X4OB 5ETUA 1HZHH 3L3IB 3MPCA 2BY1A 2E5EA 2MJWA 4DAGL 1QNZH 1B4RA 5E94A 2DBLH 2J8UF 4Y5VA 3VI3F 4WV1A 5I66A 3U2SA 4NWUL 4RAUB 4I8DA 3P9LA 4MA1C 3TA3A 1XCQB 4OQTA 4MAYC 3BIKA 4ISVA 4MDIA 4AIZA 4S1SH 3B2UD 3QT2A 5HDBE 3D69A 4I2XA 5H35A 3SCMB 3O45A 5B8CB 4U0RC 1XR8A 4XPHL 4R4NC 3CPLB 5D70H 4OGZA 2RJMA 4PJGE 4KK6C 4JZNA 4LGSB 4ODSL 4PTUB 1T2QH 4PLOB 4Y4KA 3S6CA 3HNVH 5DJYA 5DA0B 3DSFL 2OJEB 4WIQA 3STZA 1DLFH 3CFKA 1CK0H 1ZTXH 2B1AH 1YPZE 3HG1A 4YDIH 2X70B 1IRAY 4MMXC 4LCIH 1FDLH 3SE8H 4HIHA 5I1CL 2OR9H 1T2JA 4IM8A 3Q6GH 4HUWB 1J8HD 1VKXA 2ARJB 1KIRB 5HHNA 3O3EA 1FNGB 2XA3A 1NFIA 3GO1H 1XF4B 4LAQH 1EXUB 2O5YL 2PXYD 3GSWB 2VDQH 1GXEA 2KQNA 3SBWA 4Z5RA 3S5LA 4FQLL 4XC3L 3W11D 4G80A 2ITCA 3D3VE 4K9EC 1QG3A 1Y6MR 3PWUA 4PV8A 3LAFA 4FG6D 1HQ4A 4TSBH 2DM2A 2VDLL 4XBPB 4HS3A 5DD0H 3ULVF 3CFDB 2GJJA 5JXEC 1S7TA 3MLSH 4Q9BA 4P2OC 3B6SB 2L7JA 3QRGL 4ZSOE 2BX5A 3MOBH 5GJSL 2CIIA 3GMNB 1EGJA 3U30B 5GS1B 4UNTA 5HYJD 4JANB 4ELMF 3O3BA 3WFHB 1JYWA 2HA1A 4Y4HD 3VXNB 1LDPH 3O2DL 3T0VA 1Q38A 1U8HB 1A6WL 4PRDB 4H1LB 5EO0A 5GGRB 1GZPA 1SBSL 3T3ME 5CMAB 1FO0H 1BF2A 4KKBD 5ICZA 3U0TA 4R2GC 4M1GH 4WTZA 3BT2H 1KG0A 2WINB 2XNAB 3FN9A 3UEZA 1P4IL 3VWJC 4Z7UF 5J06A 5JQ6L 1B0RA 3M17A 4MJ5B 2AV7A 4WWKB 4K94C 2E27H 3ARGB 3O9WA 1BQHG 1KIQB 4PB0L 2FBOJ 4QT5A 1JGLL 4P99A 1CXHA 4AYFA 4KRPD 4YDJA 1NL0L 3E0GA 4O4YL 2GSIA 1QOKA 2R2EB 4LLMA 3R1GH 3NABH 5KS9B 3SDXA 1N26A 3CXHJ 4UOW0 4AT6B 2IPTL 3UDWC 4ZXBB 1W0YT 1A21A 1DFBH 1LP9E 2MTPA 4Q9CA 5HGHB 3PL6A 1NBZA 1MJ7L 3S98A 1E4XH 3THMH 2YUWA 1I3GH 4HBCH 4YFEA 1A1OB 4L4VB 1P7QD 3MRJA 1NCUA 2AGJL 4OKVA 3QDME 3NZHH 4OLZL 2ZOKB 3O6LH 5FHAH 1REIA 1IM9A 1XGTA 4PGCA 1MJ8L 3VXSE 4GG6F 2A6JB 3P9WB 4JHWH 3GSRB 1KEMH 2NY6D 2PCPA 1QQDA 4CKVX 4POZC 4M1CC 4KUZH 4PJ5D 5FYJU 4JM2F 5HSFA 4XVJH 1CXKA 4KJPC 3SDDC 3QQ4B 5L9DL 3WO4B 2O5ZL 1OT1A 5C09B 1SEBB 3CZFB 2EKSB 2MHAB 1TLKA 4MJIE 1U42A 1ZT7B 2KZ1B 3QXAA 3TNNA 4HWBH 5DJDB 4P2QD 3Q5TA 2XWBA 1I7UB 2HT3D 3EO9H 5D1ZC 2H26A 5IKCB 4K7FA 4KHXL 2BNQB 4JN2B 5ABDE 4EUPG 3SKJL 3L5HA 2UUDH 2OMBA 5LKNA 3DVNA 1BQLH 3IF1B 5IJKC 4RX4D 1T7ZA 1QTYT 4XXDB 4U7MA 4LLQA 1OSZB 2K9UA 4PJBF 1QA9A 4WDIB 5F44A 2V5YA 2YPLA 5IMOA 4QXTB 5EZOH 2WBJC 5DFTA 1AIFA 1WZLA 4OZHF 4V1DD 4PGJA 4MQTB 1UG9A 5IK3B 4PLKC 5ITFB 3R8QA 2XI9A 4L8CA 5SWSE 5HPOA 3RWHA 4Z0BL 1FFPB 5I1JH 1UJ3C 1NC4D 3BXNB 3L3KA 4HKJB 4X4YB 1WZMA 4XCNB 4Y0GA 2IAMD 2V7HB 5MEPA 3DX7B 3PJSA 1PKQB 3U46A 4K3DL 5F72S 1U41A 2VXSL 5A2FA 1XGPB 3H3PL 4KROB 4XWOD 5JLZA 1KLGA 3QHZL 1G7HB 3HRZA 4HDIB 5HHXL 2FBJL 4LVOB 5DVLA 3QDGD 4MDJB 4HKZA 2FYYA 1LEGB 1IMHC 2RHEA 1KBGH 3MFFA 3TZVC 4P9HC 1B0WA 4PJXB 4Y88A 1OL0A 5HD8D 1H0DA 4LVNB 1IGTB 2ZPKH 1N2RB 1F13A 4NO2A 4XP9H 5C7XH 1D5ZB 5C0BA 1ITBB 2XQYG 4YHIB 1UA6L 4KVNH 3UTZA 5GS1C 5HYJE 1DUZB 1QBML 1EO8L 4HWEL 5JOPE 4ZUWA 1FL3B 4L8SC 1AGEA 4J7RA 4EN3D 5IIEA 1HNGA 1QSEE 1LE9B 1KCKA 4LSRH 2YZ1A 2OK0H 2BCKB 5JNYA 1HZHL 5DYOB 3O4OC 3VWKA 3ZE1E 4LQFH 5B3NA 1QNZL 3CK0H 1MFDL 3CVIH 2DBLL 4MQ7B 2I9TA 3QEHB 2OCFD 4DJMA 2F54A 4PJIB 1XCTA 4N1CA 2P5EE 5DEFA 1BJ1H 1A47A 1YJDH 2ZKHH 4WWKC 5CFHA 4S1SL 1N4XH 2APXA 3ARGC 4XI5D 5D70L 5CINL 1D9KB 2H41A 3SEPA 5F70A 1MAKA 4B53A 4RMTA 5ESAA 5KVDH 4FHBD 2HT4D 5F9WB 4G43B 4KU1A 1DLFL 3IDJA 1CK0L 2B1AL 3REVA 2PF6A 3STLB 2EYTA 2V2XA 1RK0B 1ZA6B 3O2VH 1YYML 3P77B 5D7LB 2LQRA 5HI3D 3QXWA 4LCIL 2KKQA 1FDLL 3SE8L 4DCQB 1IC5H 1LD9A 4X6CE 1FYTB 3T0EA 2OR9L 3WHE1 4XMLH 2YMXH 4HSQA 1PLGH 4KDWA 1J0HA 4GUPB 3WS3A 1JMZA 3NACL 2CUHA 3LQZA 3BQUB 3GO1L 2UZIH 5EZJB 2VDQL 2Z92A 3MSPA 3REWA 1SEQH 3WFBH 1QZ1A 3OV6A 2XN9A 3O41B 4MB5A 2RBLA 4M03A 1HWGB 4TUJA 3DX6A 4TSBL 4IRJA 1LILA 3X3FH 3GI8H 5I30H 5IFAH 4TNWF 2R69H 3H2WA 4NQVB 5L2JA 5DD0L 3WO4C 1I8MA 4TTDD 3D9AH 4ZMAT 4QRPB 3OKMB 1D5MB 5KOMC 5D8JH 3SDCC 2XWJB 5F7YC 1AGBB 3CDYA 3MLSL 3BZFA 4P57B 1P2CA 4BFEA 1CLOH 4APQB 3LD8B 2GJ6B 4Z7WB 1FG2A 1JHKH 4NHUB 4FABH 3D39A 3KPQB 4BQBA 5FEBA 3RWIA 4P2QE 5C0AA 1GJIA 4F33A 5CJ8A 4RCAA 5CHNA 3CMOH 1FZKA 4PJFA 1LDPL 5DURB 2Y72A 1XAUA 3CCHB 5E8DL 3TVMA 1U3YA 4PY7A 3W0WE 2GITB 4ZO8A 2EDYA 5TGBA 4X7SH 1ERNA 4MA8H 3MJ6A 5EBMB 4GBXD 3UO1H 4RBPH 3EO1B 4M1GL 4GW1A 3BT2L 3DMMD 2DIBA 3MV11 2NTFB 1FFNA 4KJYA 5D7JB 2V17H 5IF0A 4BZ2H 4G8FA 4HKXB 4HJ0D 4Y4FD 1B0GA 2YD8A 2F5BH 3T0BA 2E27L 1WBXA 4KQ3H 5IW6A 5HGDB 4X5WA 4YR6A 1G6VK 5EUOE 4G42B 1FN4A 4GG8A 4WI2A 3MGTA 4BUHA 4F80A 2FJHB 1S7UA 3BISA 1CS6A 5L6YH 3NABL 1E4XI 1LWRA 5EIIA 5D93B 1DE4B 2FJFA 4QRRD 3QJFB 2XICA 5I8KL 1OCWH 9CGTA 3BRFA 3EHBC 2XQBH 3OR7A 3QEGH 3RDTD 5KSAC 1VDGA 1HSBB 1H5BB 1EEQA 4LVOC 1H8SA 2ZJSL 3IS0X 5INDA 3BPCB 2SEBB 2R23B 1E4XL 4ZAKD 3THML 1I3GL 1XIWA 1WTGT 2H2SD 4HXBH 2QQQA 1HSAB 3FO2B 3HHRB 3NZHL 3O9WC 3B3IB 3O6LL 4YPGB 2VZUA 3TBVA 3CLEH 2Y25A 1H3UA 1B4JH 4AEHH 5E0QA 4PJAA 5DRZB 4U6TA 4C56B 4J1UB 1HHHA 1DQJB 3S7GA 5DWUH 4JHWL 4ZG1A 5F3BA 1KEML 2A6DA 4EIGB 1A9BA 3KS0J 3ZKMC 3CSYA 5GRWA 3NCBB 2PTUA 3VI4F 1OD9A 4XVJL 4YHYC 1JZ5A 1EMTL 3F7RA 5FM5O 2R1XB 4QCIA 4YXHH 43C9B 4IIQA 5KSUB 2ZSWA 1H3TA 1QBAA 5AAWA 1AQDB 5CJQH 4NBXB 3RNQA 4LEXH 4M6NH 1P5VA 4HWBL 3OKOA 3QEUA 5EZIH 1S9KC 1MHCB 2ZCKL 2CRMA 2K1MA 5DD5H 4J12A 3EO9L 2W60A 3AM8C 5JO5A 4E5XB 4FFWC 2X4TB 4JVPA 3W9DB 3UAJD 4NOBA 3RUGB 4FQJH 1A4JB 2WIIA 3FRPA 1BQLL 3W39B 1D9KC 3KWWA 1IT9L 3LY6A 1IGIL 3IAPA 4RZCA 4ODWB 2J5LB 3QI9C 4JKPH 5F9WC 2ZOLA 1SJVA 4XPTH 2FHBA 3P4OB 4LCWA 5ADOH 1DN0B 3RIAF 4R7NB 2BSED 2DIAA 5EZOL 1M7DB 3V5HB 4UOJA 4HMCA 4Y5YA 1X4ZA 4N9GB 2W0PA 5ACZB 1E4JA 3WUWG 3DV4B 3BESR 1T0NB 5ISZA 3C5SB 5I1JL 4KKAD 3HAEB 4GAYA 2VQTA 3BQUC 1BD2E 4OFYA 4QXWA 4DQOH 3G04B 3SJVB 4PJGB 2EDDA 3RAJH 3DI2B 1D5XA 2R8SH 1EK3A 2A6IA 4ZFGH 3P0VL 1HXYA 1EBAA 4LLYA 3DIFB 2C3GA 3QQ3B 4K8RD 1NEUA 4L4TA 3HC0A 2VDPH 3VFPA 3CSBA 4U2YA 4JQIL 4F8TA 1BX2B 4NKDA 2VRAA 3MBEB 1KBGL 3GIVA 4PJDA 3ALWA 3FAXA 3LEYH 3PGCA 5E8PB 3SKOA 5J6GB 1LO4H 1QSFB 2IBZX 3IDGB 4KK9C 1FO0B 2EDNA 3HZYB 3AU1A 3NPZB 2CDGB 4JFPB 2AJZA 5KVGH 2ZPKL 5C0EB 4AZ8A 1R5WB 4XP9L 2W9EH 2Y5TA 5BXFB 3EBAA 4WU5B 4KAQH 2R0ZH 4KVNL 3BMVA 3Q5YA 5FYKD 4WFED 2ILLA 4HGMA 3JV4B 3UXFA 3JTSB 5E99H 4NN6C 4MS8D 3TO4A 1VFBA 4DEPC 1NMBH 4LSRL 2OK0L 2YRPA 3T2QA 2QQKH 3LRSB 4R0LA 4JPIA 2X4PA 1IEBA 3KXFD 1AR1C 4DZBA 4PYHA 2MQ0A 1RD6A 4LQFL 5E00A 2VNCA 3CK0L 4S1QH 5DLMH 2I07A 3CVIL 5KZCB 4U1JB 4WCYL 5SV3A 4RGMC 3VXRD 3PABB 2I5YH 4H0GA 4X6DF 3ZLQC 5IM7A 1GH7A 5EOCJ 4ZSOB 1JVKA 3GNMH 1RZJH 3T77A 4JRXB 3ZTJH 4XCCL 2EH8H 2ICWJ 1GZQA 2EDWA 2ZKHL 3GSNH 3PWPE 5E9DD 1W0VB 3DRQA 5E5MB 1N4XL 2EH7L 2YC1A 4L3CA 1HHIB 5CWSA 3BO8B 3V6OE 1NKOA 1AJ7H 2VAJA 1S9VA 2VITA 3CIQA 5KVDL 4X83A 5INCB 1FNSH 1JUFB 4LLUA 1UXWA 5DJ2A 1QEWB 3E6FB 2ADJA 3BGFC 3TN0C 4OGAD 3O2VL 1KCLA 2O61A 3IJSB 1L7IH 3RKDD 1RZGB 3RZWA 5D1XA 2WK2A 4OTXH 2BOCB 4JDVA 1IC5L 3ARUA 1H5BC 15C8H 5FK9A 5CD5D 1W8OA 4XMLL 3BRDA 2YMXL 1PLGL 3D0LA 5HVGB 3BYTA 1GGTA 4JY6B 5JW5B 2QL1A 1PQZA 3K7UA 2NX5E 4YXLL 3TJEH 3DUUB 1K85A 4NT6A 4PY8I 1N59A 4YHZL 3FMGH 1XZ0A 2DYPB 3JWDH 3WFBL 1ZHNA 1PY9A 5DRWA 4WGWB 2HKFH 2IGFH 3VGEA 2O26U 3A6OA 1IAOA 3SPVB 2GT9B 4X7DC 5TE4H 1KTDB 4F7TA 3X3FL 3GI8L 5I30L 4KK5C 3UYPA 3JTTB 3D9AL 3WNPA 5D8JL 4FQXD 3V0VA 5T1MA 4HH9B 1CLOL 1MCEA 3PWVB 4I9WE 1U8JB 4PGBA 4NQDA 4XX1E 2IC2A 4FABL 2HTKD 1G7LA 3F12B 3L3JB 3U0WL 1EBPA 2L0DA 3U0PA 1JNHA 2DQIH 5IEKB 3CMOL 2VLRD 3VXSB 5DRNA 5DVMA 3LS5H 3RGVA 4CW1B 2W65A 4RQQB 3PIQA 1TQBB 2HJKB 4X7SL 3I6GB 3OHXB 4MA8L 4UV4H 4J3SA 3S5LG 3UO1L 3AC0A 2J5LC 4L8DA 4M00A 2V7NB 1N64H 3WYRA 2G2RA 4ZNEE 4MJIB 1BZ7A 3FO0H 4MWFA 4NQEA 3FB7B 3NFSL 4LCCA 2V17L 1KCVH 4OZ4A 1IGCL 4BZ2L 2VLKB 4YBHA 5EG6C 2R2HB 4OD1H 5E5UB 2DDQH 4E42B 2EDQA 4KQ3L 1QO3B 3I6KA 3QUZD 4QYOB 4PYGA 5GSVA 3TPKA 4NC2B 3BKCL 3OKDB 5ENWB 4L1DA 5LJYH 2PO6C 5F89A 1UJTA 2DBJA 5MP6L 5L6YL 1EFXD 4WO4D 4JAMA 4Y1AA 3BN3B 1ZS8A 4ETYA 1OCWL 4YO0B 1CT8A 4U6YB 1I7ZA 2XQBL 3BSZL 3IU3B 1A7OH 3K80A 1ZVSA 3NAAH 1VENA 3EOYG 4C55A 5I75C 1NFKA 4YUEH 3MBEC 4QTHB 2R29H 2GUOB 4HXBL 2MCG1 1BVLA 3U1SL 4TNWK 2DKSA 3ARDC 2CUMA 4UUJB 4NKOA 3H9ZA 4WTZG 3BDYH 5SWSB 5JMRA 5EORH 2Z93A 3E2HC 3QNZB 3IRPX 2X42A 3CLEL 4NRYB 1B4JL 4AEHL 1ZWIB 3GJEA 1ZVYA 4JFXA 2VC2H 4U6HB 1IAMA 3OJVC 3I3BA 5DWUL 2Z31A 1NFDA 3UBXA 3BP5A 2ERJB 1INDL 3T8XA 4FXLA 4LPWA 2GTZB 4YXHL 4OFPA 3VFOB 1BOYA 5H37H 4RX4A 4AH2B 1QHPA 3HE7D 1LK3L 2AJXH 5CJQL 3G6AA 2P24A 4LEXL 5I8OL 4M6NL 3U9PH 4UDTA 3GJFH 5F97E 4HX1A 3PHOB 4YHKH 4ODUB 4PJ9B 5CJXC 2HT2D 4V1DA 2IADA 1UZ8A 3BH8B 4NP4L 2DIJA 5GRJH 4IEFB 3WS6A 4FQJL 1QSEB 2GFBB 2GY5A 2IJ0C 2EZ0D 2IAND 5I1HL 2E7MA 4LK4A 3QWRD 4JKPL 2IAMA 4XPTL 3F58H 4WRLA 5TF1H 4DVBA 3W5NA 4F15C 3EKCA 1WAAF 3MRRA 5B39B 4Y5XB 4Q9QH 4L3ED 4EOWH 3FQRA 4P46D 5C08E 3QDGA 4WW1B 2P5EB 1T22A 4U1HB 5LWYL 5IOPB 1FZJB 4PJ7E 2DQDH 4XVSL 3DO7B 2EIZA 2W0KA 4CMHB 5I1EH 2VUOA 4DQOL 2Z8WC 5CIPA 3MODH 3RAJL 3VFNB 2R8SL 4ZFGL 5A40E 3TH2T 4U3HA 4EN3A 4NGHH 1UB5A 4WEBH 2VDPL 3SCMA 4KUCF 4HWZB 4X6CB 4DW2L 5B8CA 2NXZB 3PQYD 2LFGA 4Y5YC 1A6VH 1LO4L 2W0LA 1MJUH 3Q6FB 1B90A 4X99B 2YS4A 5K9KB 4PTUA 5HGBB 5KVGL 1MHPH 2F5AH 2L7UA 4NQSB 2X70A 4QWWC 4KAQL 1G9MH 2R0ZL 3TBWB 4JFHE 2QR0A 1RUMH 5E99L 3KPPA 1RU9H 3RQ3A 1PZ5A 4GS7B 4PJXF 1ZHLA 4OCMC 4HUWA 2MOVA 1HKLH 4HWNA 4U3CA 5I1LB 1TQBC 4LSQH 3GKZA 3JBG7 4S1QL 1XF4A 1QFWM 5DLML 1EXUA 1XT5A 1PFCA 2HLFC 2NXYD 4EI6B 3GSWA 3MUGB 2J4WH 3KPTA 2BERA 1JCKA 4QHLB 5GXBB 2OLDA 2VH5L 2I5YL 4HCRA 1J0JA 5IVXE 4MQSB 4WI6A 1PVHA 4GRMB 2WUCH 3GNML 1MRFH 1RZJL 3RIAK 2X9YA 4I1NB 4Y7MA 1LE5B 3ARTA 3A0OA 2EH8L 2P44B 3DX8B 1JMXA 1NBYB 3GSNL 2BSTB 2DJUA 4XBPA 4P5TD 4KTYA 3TBSB 3RY6A 32C2A 4M61B 3CFDA 3W0WB 1AJ7L 3HC4H 4HLJA 3EDDA 3I50H 1FNSL 3B6SA 4RGND 1FIGH 3EZ8A 1FP5A 4DOHE 2E7CA 5GGVH 5J1AA 4JGUA 1L7IL 1AXSB 1II4E 1SYSA 4OTXL 2D0FA 1DJSA 2YD5A 15C8L 3VD3A 3F7VB 1NAMA 3N1GC 4H1LA 1RJZB 5DFVD 1R3LA 3QFJD 3R8BB 2APTA 1MRCL 1CXFA 5GGRA 4K7PX 5CMAA 3TJEL 4ALAH 3IKKA 1MFAH 5EUOB 2NLJB 3H9HB 3FMGL 3BE1H 3JWDL 2WBWB 5L2KB 2WINA 2XNAA 3SGKC 1BP3B 5C92A 1J0KA 2PXYC 3VA6A 5ANME 2IGFL 2ZUUA 4YEEA 1OP5H 3W11C 5TE4L 2VLLB 1BAFH 4YGAB 2B4CC 4FG6C 3UTPD 5H94A 2GIYA 4GXVH 2VWEE 4GBXA 4PRHD 1S7VB 4P3DB 4F9PC 1NUDA 2R2EA 4MHHI 1QRKA 3UC0H 3DMMA 5KS9A 1Z0NA 2YOCA 1G7JB 3TJHC 1MIMH 1Z0MA 4ZXBA 4Q7DA 2LVCA 4Y4FA 4E41B 2AK4E 4M7JH 2AK1H 3LS5L 1MCCA 2KPNA 3GMLA 1A22B 1WV7T 4Y4HC 4R7DA 1A1OA 3EFFB 4L4VA 4Z7WF 1RIVL 3FFCA 4XXCA 4XH2B 2DJSA 4L9LB 4KKBC 5FCUH 3AS0A 3SE3A 3P2TA 2ED8A 1JHLH 3GSRA 4LKCB 2MMXA 3WSQH 1KCVL 5EA0L 3ELAT 3RX8A 4L3EE 5DJ6A 4OD1L 3ZDXF 5ICXB 2D7PA 5CEXB 1U8PA 4NFBA 4BFGA 3G5YB 5C09A 2HYMA 1T7VA 1ZK9A 2BDNH 5HHME 1SEBA 2R56H 3CZFA 2EE3A 3RFZC 3WKML 3MV9B 3VXUD 1JPGB 4CMHC 2MHAA 4WI7A 3T65B 1ZT7A 5JPMB 1WBYA 4NYLB 3JSSA 2FL5B 1YEKH 5CEYB 5ICYB 1I7UA 1A7OL 3AAZA 4I3GA 5IKCA 3NAAL 2BNQA 2YD6A 4JN2A 1G0YR 4YUEL 4RNRA 4Z9KB 2XFXB 1FGNL 2R29L 1TTFA 2NXZC 4NM4H 3PQYE 1H8NA 3IB4A 3BDYL 4PJ8B 5EORL 4XXDA 4UIKL 1FNFA 1OSZA 4OLVH 1RZKH 3WLWD 1BD2B 2LU7A 1ODAA 2VC2L 3L3HB 2FR4A 3GI9L 5BW7A 3LPWA 4QXTA 1X3DA 4AG4H 1RURH 4PJHE 1F11B 4S0SD 2M2DA 1HINH 4I18A 3CVHH 3ZDZF 2NY6C 3GSNB 4Y2DD 1ONQA 5IK3A 5ITFA 1KTLA 3TNMA 3WUZA 2AEQH 4OLYH 1YMHB 3DXAE 3PF2A 3BXNA 4S1RH 3UTTD 3NPSC 4K23H 5IHZB 4X4YA 3FB6A 4IRSB 1JYVA 1AQKH 3LS4H 3DX7A 4ODBD 1PKQA 4Y16D 3U9PL 2W0FA 4I48B 5IW3A 3QWOA 4YHKL 4HDIA 3H42L 3O2DA 1RZIB 2NY4B 1QLRB 4PLNC 4G9FD 5IR1A 5GRJL 2HT3C 3LRGA 1CE1H 2OSLA 4FZEH 4C58B 2CXKA 4MZ2A 3C9NB 1UQSB 4Z78B 2UWEE 4HIEB 1I1YB 4RMSA 2D9CA 1FQ9C 5TF1L 3F58L 5IQ9B 1IKFL 1GHFH 4YHIA 4HUMB 1QFPA 1KB5A 2Z91A 1DUZA 2VAAB 4Q9QL 1RUKL 4EOWL 3MRGB 3EYUH 1XGRA 1WVZA 2BVPA 1BJ8A 1MELA 1SJEA 3ULSB 4KKLD 4XT1C 5D1QB 3KJ6L 4OCSH 3TCLB 2BCKA 4QY8A 2DQDL 3S3JA 3PWPB 5BV7H 4Z77A 1Y6KR 5I1EL 1FPTH 4JY4A 3MODL 3MRKB 1DN2A 5FKPB 1M05A 3KPSD 4R4FH 4ELKB 4PJIA 4Q6YA 3TGXA 4NGHL 2DQHH 2FX8L 3UPRB 1UVQA 3CC5B 3BAEH 5KAQG 4WEBL 3FRPG 4XHJD 4XWOC 4YNYB 4MA7H 5HDBF 3CNKA 5DMKB 1U2CA 3KXFA 1BQSA 4B0MM 1WISA 1A6VL 4I5BB 4PJGF 1MJUL 4U1MB 5LCVH 1WLHA 5EBLB 1MEXH 5ID1B 5DJZA 2F5AL 1FNAA 4G43A 2NX5B 5T1KD 3BZEB 4WI5A 1INEL 5DHXB 3VXRA 5HD8C 3FAWA 5FO8B 1YPZF 3QBTB 1RK0A 1ZA6A 1CDHA 1G9ML 2C4FT 5D7LA 4KMLB 5J11C 3HC3H 1MCJA 4FN0A 5DJCA 43CAB 3DI3B 3BUYB 1RU9L 2PTTB 5E9DA 4O2FB 5JOFB 2UY7A 4H0HB 1T7YA 4GUPA 5LGJB 2W59A 3C5ZD 4CU6A 4WU7B 4X8JB 1OSPH 4D9RD 4UAOB 2J4WL 4L9LC 1KPVB 1KFAH 3LEVH 3MLUH 3L5IA 3FT2B 6FABH 1A9EB 4Z0XB 1IL1B 5GS0H 2WUCL 4O2CB 1QRNE 4ZS6D 4XP4H 1FL5B 1YEGH 5KSBE 5CSGA 2NY3B 3LKPA 5B21A 3LKNB 3P0GB 4QRPA 3OKMA 1KTKE 3MRBA 1AGBA 3HC4L 1LO2H 1NC2D 4P57A 2X5PA 3X3GH 1LGVA 4XI5C 1GL4B 4APQA 2X09A 4Z7WA 3HI1B 1RIHH 4NHUA 2R4SH 2PNDA 3KPQA 4Z7QE 1F8TH 2HT4C 5GGVL 1CN4A 5GRUH 1KJ2A 4PLJD 3L5WB 5HI3C 2OX5A 4J3OC 1KEGH 4WY7H 4XHQA 2E8ZA 1K4CA 3EJYD 4KGLA 2XACC 3IFPB 1JWMB 2F19H 5D72H 1MAMH 4IOIB 2D0GA 3T3MF 4U6XA 3RL1B 4ALAL 2VMFA 4GRLB 4PJ8C 1MFAL 2IH1B 3C6LD 3DURB 2GKIA 4NNYB 2AJYH 2IQAA 5DUBB 3G9VA 5D7JA 4FZ8H 2IBGA 1KYOJ 2VLRA 3GJFB 4KQ4H 3B2VH 4OCYH 1PSKH 3N0PB 2YA0A 2GAZB 3EOTH 3V52H 1B6UA 1P53A 1UXSA 5IW1A 1BAFL 3VXQB 4YBQC 1EH9A 1RK1A 5HGDA 2AJVL 3JV6B 3DVGB 2VZ3A 4S1DD 4MJ6B 4QHMB 5IWLC 1MCLA 4GXVL 4TTDC 5JW3H 5F1NB 2VE6B 3UC0L 1DVFB 3J7HA 1CDYA 4AK1A 4XNQB 3SKUD 3FB5B 5D5MB 1Q8MA 1LP9F 1MQKH 3UYRH 4M7JL 2AK1L 3FTGB 1F6FB 1ZHBB 3QUZA 2R23A 1IEHA 1KCSH 1YECH 5C0CD 1CICD 4HJJL 1WCBA 4WJ5A 5JZ7D 5F71A 4MNHA 1ORSB 1FVCB 1ZV5A 1JZ4A 1EFXA 4WO4A 3WXWH 2X40A 5IQ7H 1CGYA 5DRZA 5FCUL 5FOJA 3S35L 4C56A 1BFTA 1DQJA 1JHLL 4NC1C 3F7YB 3S4SB 5D9SB 4I13B 1NGXA 4B50A 4K3JH 3PDGA 5EOTB 3HPLA 4K07A 3GMMB 2ID5A 4W68A 3VRIB 1EO7A 2G9HB 4H5SA 1HN1A 3G6DH 1WIOA 4LBEB 3C09B 2BDNL 1Z9SA 4DZ8A 2R56L 3GBNH 1BIHA 1YUHA 3H9SB 3HE6D 1CE6B 3V6OC 2JB6B 1ZHKA 5FOBB 1W2KT 1F4YH 3TYFA 1EEYB 5T3XD 3RWFA 2AXHA 1MHCA 1YEKL 3TT1L 4ERSH 3B9KB 2C1OB 3ABZA 5DTFA 4OGYH 4E5XA 1I85C 5SX5K 2XPGB 2X4TA 3W9DA 1U92B 3RUGA 3RDTC 5C08B 3HS0B 3NCJH 4NM4L 4ZAKC 4KK8C 3HE7A 4GW5B 3V6BR 3I3DA 2E3VA 4PJ7B 4ODWA 1S7SA 1WFUA 1Z6JT 3IJYB 5B38B 5KSVB 1RZKL 3P4OA 3ARBB 4GMTH 1DN0A 5EZLA 4R7NA 5L0QB 4AG4L 1M7DA 1RURL 3G5XA 4QHNA 3A6CH 3V5HA 1FZMB 4HS8L 1HINL 3CVHL 4NRXB 5DDHA 2KZWA 3DUSB 2D7NA 5ACZA 3K4ZA 3DV4A 5EOCH 1MFBH 1FNHA 1LO0L 1T0NA 4OLYL 1M4KA 1Z5LA 4FQIH 3L3DA 1AO7B 4W81A 3LKSB 3QWRA 3QNYB 3WEXA 3G04A 3SJVA 4BH7B 4UAOC 3D25B 1JF5A 1AQKL 3HR6A 3LS4L 3ARPA 4OCLC 3IXAA 5GS2H 2VL4A 3VRJB 1T6VN 5DEGA 1WITA 4AQOA 4OBSA 1JNLL 4YQXH 5I74B 4LPUA 2VL5B 1BLNA 1BX2A 2NY3C 4U31A 1CE1L 4FZEL 3BGAA 4I0CC 3J8F7 5E8PA 1NLDH 3S36X 1QSFA 3IDGA 3UAJC 2ATPB 1FO0A 2E7LC 1F6AA 2X41A 4JGJA 3WIIH 2CDGA 4JFPA 4RRPA 4MNQD 5T3ZD 2V2WA 2W9DH 2XXCB 5MI0B 3UBXG 1GHFL 4WU5A 3NMEA 4NZTL 2LU3A 2P8PB 5LQBH 1LO5B 3I6LD 4NWTH 3JTSA 4M93C 1HCVA 2JJTC 3EYUL 3NCCB 4TYUA 5KW9L 4HKBB 4FFYH 3S37X 1YEFH 4J3WA 4P2RD 3LRSA 4OCSL 1TENA 3OXSB 1NGQH 3ZE1F 2WNGA 1A7QH 2Q76B 4W4OA 1FPTL 3MGOA 3PABA 1R3HA 3P30H 4R4FL 4ETQB 3AGVA 3OGCA 1IGJB 1IQWH 4DOHB 1BWWA 2WWMD 4L29B 4JRXA 3BAEL 3OBAA 3GSOA 3V5DB 4YX2H 4MA7L 1W0VA 2A83A 2DI8A 4JZJA 4K8RC 4IDJH 1HHIA 2UVEA 1S7XA 1BGXH 4BSWB 4LCYA 5LCVL 4PIRF 1MEXL 4S0TD 2C1PB 2FSEB 1JUFA 4PRPE 3O6FD 3SDYL 3FQWA 3ULUD 3E6FA 1D3CA 5CP3H 3EFDL 4NC0B 3IJSA 4LVHB 1L0XA 1RZGA 3HC3L 1EJOL 5DQDH 1OARH 2BOCA 4X6CF 3FFDB 4OLXH 4RMQA 5FDYA 2H2PD 4BQCA 3IDIB 3FL7A 3DHMA 3N1PC 4DKDC 1G84A 5F1KC 4UQ3B 3ZYIA 3DUUA 1OSPL 3T1FB 3ULVH 2DWDB 4HD9A 4OZFH 4C59B 1TPXB 3D48R 4HXAH 2XYCA 1KFAL 2DYPA 4BQ9A 3LEVL 2GSGB 4HWBA 4MXQD 4ZD3H 6FABL 4QHUA 2VUYA 3SPVA 1YEDA 5GS0L 4PG2A 5HHOD 2LV4A 4NN7C 2A73B 3DX9B 4XP4L 3VD4A 1YEGL 1KTDA 3SE9H 3PP3H 4J8RB 2HVKB 4LHUB 2AK4B 3U79A 2R2BB 3C09C 5C1MB 4G7YH 1LO2L 3X3GL 4HH9A 12E8H 3C5JA 1U8JA 3RX7A 2WWKT 5MEND 3O4LD 4JPWH 2R4SL 3L3JA 1J05B 1R24A 1F8TL 4NHCL 3G08A 1G9MC 3BPOC 2OTUB 4NO0B 5GRUL 3VXSA 2NY2D 5EU5B 2W07A 3B9KC 1KJVA 4MLSA 3PV6B 3CVHB 5I73B 4Z6AT 1KEGL 4XMKH 1R3KB 4RQQA 2CSPA 1K4DB 4YXKH 4X80H 4U1LB 1A0QH 5CD5C 2F19L 5D72L 1F5WA 1BVKB 1I8IA 1LK2A 4PRHA 3I6GA 3OHXA 2ZCLL 5HHMB 5F96L 1LMKA 1LDSA 4EDWL 3RVUC 1W72L 2PYFB 5HYSB 1YEEH 2AJYL 3UJJL 3QIBB 4FZ8L 2HP4A 3EYVA 3HZKB 4KQ4L 4OD2B 2VLKA 2Q3ZA 3B2VL 1PSKL 4JQVA 4E42A 3KLAB 1QO3A 2VERN 1U8NB 2J8HA 2X7LB 5IB2B 5EUOF 1I75A 1G7MB 5ENWA 1FJ1A 3SDAD 3MRMB 7CGTA 3NIGE 4QRQB 5JW3L 5CCKH 1C08B 2NCMA 1R5IB 4FQXC 5T1LB 4G6FD 2IPUG 5LVEA 2MQCA 2YEZB 4HGWA 4YO0A 4U6YA 4C83B 2HTKC 3IU3A 3SN6N 1MQKL 4H1LG 2DRUA 4NO3B 3UYRL 1I7RB 5GGSY 4JPVH 1OT2A 5I74C 5DQ9A 4QRTA 5F1SA 1YN6B 4PJHB 1YECL 2N7AA 4QTHA 1JWUA 4EXPX 4RDQF 4U1KB 1TFHA 3VXUA 3V6ZB 2IPKA 2FIKA 1C8PA 3KPMB 3QNZA 4B41A 4NRYA 3DXAB 4MNQE 3WXWL 4JRYD 3QO0B 5MI0C 3NGBB 4G6AC 4U6HA 3I6LE 3TIDA 4K3JL 1MCOH 4GQ9H 1CL7H 1T89C 2J8OA 3GMQA 3CSGA 1MFEH 1MLBB 3LDBC 2GTZA 4P2RE 4KWUA 3HB3C 5AAMA 3G6DL 2AXFA 3MV7D 4H88L 3HMWH 4CU8A 5F1IB 2BVUA 5L88L 5IB4B 4G8GE 3PXJA 2UWEB 4DKEL 1J0ZA 1FV1A 2WAHA 3PWLB 4XAKE 1E27B 3PHOA 3MUHL 1ADQH 4ERSL 4ODUA 4PJ9A 3SQOH 4OGYL 1U3HB 1QLEH 1RJLB 3V9FA 1C16B 1P1ZB 5ALCH 1AXIB 2ED7A 4V2BA 2NY0B 1Q9OB 3NCJL 4LRIC 3B5TA 3IXTA 2GFBA 4LHQB 1PX3A 1CF8H 4XRCB 1NH6A 5BRZD 4PR5B 4CJ1A 2Q7YB 3AXLB 3ULUE 4UU9B 4XB7A 4GMTL 3RBSA 4Y5XA 5IP4A 1GAFH 3M07A 3WDIA 3A6CL 4HLZH 3UMTA 4G9FA 4WW1A 2P5EA 1MFBL 3KYNB 4U1HA 1IFHH 4HPYH 4WTXA 2VB5A 2UUDK 4KI5E 1U9KA 1YQVL 1OLLA 4FQIL 2GYSA 1OB1B 2C9AA 1DQMH 1TPXC 4NQCE 2V9RA 2VWEC 3QEQD 5F7KC 4XGZB 5IBTH 1A6TB 1P4BH 3JV0A 2ZUTA 1AGFB 1A1NB 3ES6B 3U4EB 3VG0L 5HHOE 4OZIE 2ITDB 4YQXL 3O81A 4JFQB 3QXUA 3DPBA 2AQ2A 2CIKB 3RZCB 4MX7B 3SGDH 1Q9WA 4JE4B 1D6EB 1NLDL 5A1AA 4X99A 5K9KA 2FLBT 4Q6IA 3VG9C 6CGTA 3M8OH 2W9DL 1RZKC 4NQSA 4EQ3A 3EJJX 4P23D 1CYGA 3RWEB 5LQBL 3D2UD 3QPQD 4NWTL 1F58H 1T5WB 4K3HA 4PRNB 1MAJA 5C8JB 1AC0A 1IC1A 4FFYL 3E1F1 4PJCA 4YHMH 1QRNB 4P46C 3OXRA 3I84A 5KSBB 4LIQH 1JL8A 5I1LA 1MFCH 1NGQL 4UILH 1CGTA 4CVUA 3OJDA 1MWAH 1E0OB 1E6OH 1L6ZA 3EIFA 4HV8A 5T1KA 5CEZD 3DO3A 3MUGA 4H26B 3B8YA 4HMEA 3EJZD 4S11A 1IGFL 1YY9D 1F3JB 4QHLA 1L0QA 4EUPH 1A2YB 2N56A 3IRZA 4C57C 1N5AA 1XH3B 2D0HA 5EU6E 1IQWL 5C0RH 1Y0LB 5FGRA 2ZZUT 1I7TA 3DX8A 4YX2L 4YAQB 3LN4B 3FO9B 1OW0C 2E9WA 4IDJL 1IEAB 3C5ZA 4M61A 4QRSA 1UZ6E 1UH4A 4R4BA 3MNZB 2WQ8A 3D85B 2O5XL 1MCWW 3OJ2C 3ZKXB 1Z9MA 3BKJH 5C9JB 1VA9A 1RUPH 2YHGA 3RTQB 3GB7B 5HI4D 5MEQA 1UWGH 1OTSD 5DQDL 1GOHA 4WFHD 1FBIH 3ARVA 3LEXA 4DGIH 1PYWA 2E6QA 4KC3B 1CD1B 2B5IB 1RJZA 2YSSA 1NC2A 1UWXK 3HUJE 1YNLL 1S3KL 1CXIA 2I25N 3D0VB 4E0RB 1UH3A 3H9HA 3V5KA 4HXAL 3ROLB 4WHCA 4UTAH 5L2KA 2NXYC 4ZD3L 1TETH 1MCRA 1JJUA 3MMEA 1ZMYA 5F7HA 3MLPA 5D71H 1NCNA 1KJ3L 3QXDB 3SE9L 4N0CD 1DBKH 4MCYB 4JFEB 5J56B 2DN7A 3MREA 4PFEA 4G7YL 4P5TC 5MERA 5I0DA 2GEEA 5CZKA 4JDZB 4PV9B 3ZL4H 2X89A 4P3DA 5IJVB 12E8L 5EC1B 1CU4H 2JELH 3HR5B 4JPWL 2D3VA 4NKIH 1Q0XH 3ZYJA 1G7QA 4TUOB 4E41A 4FTVD 2BP3A 1U3HC 1I3UA 5IG7A 4KXZH 2HVJB 4P4KB 4XMKL 5F1OB 5KJRH 2DLIA 2EDTA 4YXKL 1G6RH 3EFFA 4X80L 5JUEH 1A0QL 3O8XD 1JHTB 4QXGL 2EDFA 3F65A 3QISA 5DFVC 1ZKAA 5BRZE 2VZ1A 5GGTH 3MV8B 4BQ6A 1BZ9A 3CUPB 1AY1H 5JHDD 2ZUWA 4TULH 3QIUB 1JGDA 5C0GB 1A7BA 1IM3A 4MA3B 1UGNA 3TIEB 3OAZH 1EA9C 3WIFB 1I1FA 3MRIA 2HRPL 5FGCE 5C0CA 3G5YA 3G9AB 5GRYA 3WDJA 3FN0H 2UV3A 2R9HD 3LOWA 3BD3A 1XF5B 4ZYKB 3MV9A 1JPGA 5IMMB 4X0KB 5CILH 5CCKL 4RBPK 1JZ7A 5JW4M 3MNVB 2DD8H 4NYLA 5DRXB 2XKNB 5SV4A 3ESUF 4NCC1 2J8UB 4HS6A 4PGDB 3QAZC 5CEYA 2NZIA 1EUTA 3ZTNH 4JPVL 4WEMB 3WO3B 3RZCC 2XFXA 2VKXA 4ZFFB 3OKEB 4CN4A 5DJ8A 1CDUA 4JQVC 3HE6A 3PGFH 3WFDH 1HXMB 3WL9B 2CGRH 4N1HB 1VB9A 4KJQD 1BD2A 5FF6A 4PBXA 1MUJB 2P8MB 2XKUA 1EPFA 3QO1B 2JKXA 3L3HA 1I9JH 4K9EH 3X11B 5CJOL 4WI4A 1MCOL 1CL7L 3QUKB 1OOAA 3ZYZA 4M5YL 3P4MB 4K7PY 4LKXA 4XPFH 1PD6A 5TQ2H 4JPKH 4JO3H 3HMWL 4ZUTB 4B7IA 3D6GA 5CSBA 4IRSA 25C8H 1NCAH 5AEAA 2HMIC 1MHEA 3SY0A 3TC9A 1KXTB 3WJJA 4PRID 3CLFH 4YHNB 4RMUA 3CFEB 3SQOL 5KVMC 5KTEH 4Z8FH 1N5YH 4HC1H 2BFVH 3DWTA 3TA3D 1QLEL 3SGEH 5ALCL 3VCLA 5DK3A 2RB8A 3FQTB 1X6NA 4X9HA 2X4RB 2IALB 4Z78A 1CF8L 1YEHL 4HIEA 2A9MH 4LASH 3UTQB 1I1YA 4FNLH 2R1YB 1U58B 3L7EB 1CXEA 4OZFB 5C6TH 2ZUYA 1UB6B 3ZKXC 3SE4C 3H9YA 1T7WA 3RTQC 2VAAA 1GAFL 3BPLB 4OFKA 4WUUE 3BP4B 4F7MB 3JWNC 3HPJB 1DANT 2FO4B 1H3VA 2DMKA 2ZSVA 4ZDHB 3ULSA 2CKBA 1IFHL 4HPYL 5D1QA 3TCLA 2WMPA 4PJ7F 5CLWA 5FA3B 4Y2DC 3ARFB 4NQXA 2HFGH 1DQML 1N6VA 5LXGH 4W6WB 3DYOA 3SGDI 5FKPA 5I8OH 2UYLB 2CLVA 4PRPB 4ZS7H 5IBTL 4ELKA 2YN5A 1P4BL 3LKRB 1ZT1B 3UPRA 3CC5A 3ZT6A 4Y16C 5HYEA 4YNYA 2C4FU 3KYMB 3OQ3B 3O3AB 4D9QE 3SKNB 5JA8B 2GY7B 1KJMB 4PG9B 4F3FB 4I5BA 1H3WM 1IILE 2BSRB 4M1DH 4OFIA 5ID1A 2NY5C 2XV6B 3N9GH 4HQQH 3M8OL 4G6MH 5FYJE 3QCUL 3GSUA 1FVDB 3V95A 3WFCH 1DP0A 3ULUL 5FGBA 5K9OB 1F58L 2BSSB 3QDJE 1DEEB 43CAA 5FO9B 3HI5H 5DXWA 2PTTA 3RWCB 2H1PH 3DOSA 5JOFA 4YHML 3MACH 4P4KC 3IDMB 4KKCC 4YK4C 1UCBH 4LIQL 4KVCH 4UILL 5I18H 1E6OL 3O6FA 1YYLH 3WNLA 5IVNA 1MIEH 1KPVA 2EXWD 4OV5B 4ORGB 5IBUB 1BJ1J 1L9NA 4GSDL 5A16B 1YN7B 3FT2A 4JKMA 5IVXF 4Z95L 1KELH 2MSPA 2WP3T 5C0RL 3KLSA 4XC1H 1IL1A 1U95A 4Z0XA 5SWZB 3OB0H 4O2CA 3VD7A 1FL5A 1DCLA 4I0PB 2P1YA 3BUTA 3G5ZA 4Y19E 3LKNA 2XTJE 4XNXH 3HFML 3BDXA 1A4KA 4RRPG 3GUTA 1UM5H 3MUZ1 1FZOB 2DM4A 4XNMB 1O7VA 3GRWH 3HI1A 1T83A 1Z9LA 3RGHA 1TVHB 1X7QB 3UP1A 3DVIA 5IB3A 3RBGA 1FORH 5FYJH 1TITA 4GRWE 1UWGL 1UEYA 3LKQA 1QD0A 1OAYH 1FBIL 3L5WA 4DGIL 3C8KB 4UIMB 1AHWA 2FD6H 1SYVB 3HCVA 3IVKB 3IAGC 3PL6D 1GVIA 4YZFE 3IFPA 1JWMA 2Y7QB 3L9RB 5D2NE 4IOIA 5IESH 1H3XA 3GK8H 4GRLA 5TDPB 4GAFB 4LLWB 4YC2B 5MENA 1ZSDB 3O4LA 3BI9X 5C2BL 4HUUA 4NOFA 2A0LD 5DF0A 1T6WA 5DK0A 3DURA 4UTAL 2QV2A 1K8IB 2R0WH 4GW4B 5K33A 2ZNXA 1IM9D 2A74A 3NFNB 1TETL 5TJWK 2IH3A 4PY8J 2AXJA 1M6OB 1M7IB 3VE0A 3GJFA 3C60B 5D71L 5IUSA 2GAZA 1YDPB 1DBKL 4FMKA 4J3VA 3HZMB 3VXQA 4YIQB 1QPPA 4ZS6C 4XNUL 5F88B 1IC4H 3JV6A 3LHPH 3DVGA 3Q48A 4QHMA 5CS7A 4ENEC 3ZL4L 5ESVB 1C7TA 3DLQR 5BS0D 5T5FL 1HEZB 3BRGC 1KENH 4KDTC 2VE6A 1CU4L 1DR9A 2JELL 3OMZA 3ZDYE 5CZXD 2KDGA 1DVFA 4U1IB 1TJIH 4MJ2A 1AP2A 4K71B 3RP1A 1Q0XL 3N50A 3ZHLA 4LPVA 2EC8A 3FB5A 5D5MA 5LAXA 4PP2B 5FYLD 4J3UA 4M8QB 4OF8A 2BXYA 3FTGA 2VXQH 4U1GC 5H2BB 4YHOH 5KJRL 2K7QA 4I2XE 1G6RL 2ZUXA 5JUEL 5C0FB 2OQJB 1KNOB 4HK0B 2FHCA 2QHRH 3SDAA 3L3GA 1J0IA 1GPOH 3RWGA 4TOYH 5E1HB 4LLDB 3EJYC 3MRCB 1NPUA 1RHHB 5GGTL 2ED9A 4OZGA 4I0KA 4KZEH 1S7WB 4ZPTA 4G8GB 1AY1L 5E2VH 2EC9T 3HG1E 2CO6B 4TULL 3C6LC 5FKAB 1DBAH 3S4SA 3BPLC 5D9SA 3MLVH 2CJUL 5EOTA 2VZOA 4FQQB 3RNKB 3GMMA 4GFTB 2G9HA 4WFFD 3FN0L 3P9MA 5BQ7B 5ITBH 2F15A 4JKWA 1KPUB 2ADGB 2NTSP 5DJAB 4MNGE 3ARFC 3H9SA 1V7MH 2CRYA 4X6BA 5HVHB 4JFFD 1E28A 5DD3H 2JB6A 5FOBA 3QRFM 5KN5B 3PHQB 3G5VB 1KACB 2Y06L 5C0JB 1P7HL 2R0KH 2QADD 2XPGA 4UNVA 3JWOL 4HZAA 1PW3A 1T03H 3MZGB 4U1NA 4OCNC 1U92A 2VDMH 5HY9B 5DI8B 3MV7A 4OQTH 1GRWA 4X4XB 3Q3GB 1WZ1H 4OLUL 3WFDL 1MWAB 4NDMA 4DAGH 3OX8A 1CICC 5JZ7C 1BFSA 5KSVA 1WCQA 1JI2A 2A38A 1NCWH 2L4OA 3ARBA 3MLYH 4EUPB 1HI6B 3L5XH 4NQCB 1MCPH 3GBLA 5EO1A 3RWJA 1I9JL 4K9EL 2ARJQ 1WGOA 3U6RB 4PJHF 3GMRB 1G7IB 1T4KA 2H3NA 3DUSA 2ESVE 3VXPB 4OZIB 2HJFA 4XPFL 5MEOB 5TQ2L 4JPKL 4JO3L 4LP4A 3FQXB 2NR6C 3UTSD 4XPBH 3X13A 1NBVL 3VWKD 1AO7A 4JLRB 5EUKB 5E2JA 5J9PB 4BH7A 3AREB 1OWRM 1WSST 25C8L 1NCAL 1WWWX 4TN9A 3NN8A 2EECA 3DSFH 5IVOA 4EXKA 1SMAA 1SY6H 3CLFL 3U9UB 1MLCB 3A6BH 2F54D 3U48A 1BOGB 1N5YL 4O51B 4HC1L 1QKZH 2BFVL 1K2DB 4LL9A 3EDJA 4XMPH 3OKNA 4IOFD 3NZ8B 3MROB 2J88H 1MJJA 3BN9D 3KPRB 3ILQD 2Z8SA 3V2AR 1K6QH 2UWEF 4LASL 4FNLL 1K8DB 5E70A 3GDBA 4IS6B 1OAUH 1OQOA 5AD0B 3IDXH 2C26A 3SDXE 1I1AD 3QR2A 3VFWA 3GJFK 3WN5A 2Z4QB 4HZLA 5EU6B 1EGJH 1CFTA 2VDLH 3BWUC 3RJDA 1CG9B 3EOBB 2D7MA 2YUVA 3MO1A 2HFGL 2Q76A 1KPRB 5LXGL 3V7AG 2P43B 1ZGLA 1Q9LA 1O0VA 3U36B 1MHHA 1CXLA 2NNAB 5GJSH 4U1SB 1OPGH 4MD5B 2WP3O 4PD4K 2XN9D 4L29A 3CFJA 2APVA 1OP9A 1U2HA 3V5DA 2OR8A 1U93A 1JZ8A 4IRJD 1A6WH 1J1PL 3QCTH 1G6RB 1XF1A 4F7CB 3ESVF 2YD4A 3LVEA 3RIFK 1ZLVH 4M1DL 1BF8A 3MR9A 2FSEA 3G6JA 5I16B 4P3CH 3F6IA 3ZE2E 3N9GL 3HUJB 4HQQL 4OBRA 4G6ML 1JN6B 1K5NB 2VOTA 2AP2A 1AGCA 4K71C 3WFCL 3D39D 1P4IH 2V9QA 5FUCE 3IFOA 3HI5L 4MA1B 4JFOB 1GC1C 2H1PL 1SJHB 1AI1H 1FVEB 3MACL 3TVMD 1UCBL 3HN3A 4BA8A 2W91A 4KVCL 3U4AA 4JM2D 2B0SH 3VMOA 2V5SA 3MGAA 3MJ8B 4RFEA 4UQ3A 5I18L 4JFYA 1NL0H 3T1FA 5FV2A 4O4YH 5D4QA 1YYLL 5FXCH 2VSDA 2VISB 4AL8H 4JQXC 1MIEL 1WT5A 5BZDB 1LQSR 5KANG 1RVFH 2GSGA 5MHSD 1X44A 1KELL 5IMKB 2IPTH 4IHOB 4AY0A 4XC1L 4HAFA 1FH5H 2YPLE 1XF2B 3DX9A 3AS2A 1IGMH 5KSBF 1NGZA 2Q87A 5HHQB 1YMME 1MJ7H 2XG4A 4WFFE 2OZ4L 2R2BA 4M7LT 4U6VH 3S97C 2Y6SD 1H3PH 1NUNB 1JV5B 3PWNB 1UM5L 3GRWL 4BUGA 3IKCB 4Z7QF 3RWDB 1J05A 1MJ8H 1FORL 5FIEA 3OR6B 5FYJL 5F9JB 3ULUC 2OTUA 1KOAA 4NO0A 2DLGA 1U8QA 1F97A 1OAYL 2QLVB 2NY1B 3PV6A 3QIWD 2FD6L 4F57H 5L9DH 2APWA 1K4DA 2O5ZH 2H2PC 1HHJB 2R1WA 2DQCH 1V3LA 4UI2A 1XIWD 1WF5A 3I02B 4JFDE 5IESL 4KI5C 4YE4L 5DS8B 1P69B 4P2OB 3F8UB 5D7KD 1R5VB 4HUXA 4YFLI 2R0WL 3QIBA 5DJ0B 2V9TA 4BK4A 4FTVA 5C0BE 2VYRE 4OD2A 3V79C 1QUNA 4H0IA 1B88A 1NEZB 3MRLA 4ZOCA 5AWNH 3VFTB 2EDEA 5IVZA 3VMPA 1F00I 3AUVA 2HFFA 1IC4L 4ZUUB 3LHPL 2X7LA 1RUQH 1JPFB 3KDMB 4QRQA 1KENL 1C08A 2DI7A 3AREC 2WIMA 4R2GB 1TJIL 4F7EB 3CFBB 1H8OA 1BM3H 1Q9KB 4Y2OA 4C83A 2F54E 3PNWB 1FYHB 2W9LA 2CDEB 2VABA 4NO3A 1I7RA 1OP5K 4Z76B 3QWQB 4LP5A 4M7KH 2VXQL 3QH3B 4YHOL 1YN6A 2O93L 4F9LC 1EEZB 3LKOB 5E6IB 3BIBX 1GPOL 4TOYL 5TQ0H 2FECI 3KPMA 5EO9A 1B2WL 4OAWB 3MCKB 3QUMH 3QO0A 3QUYB 4KZEL 1OGAB 2OI9C 1CD8A 5E2VL 4LCWD 3SO5A 4K3DH 3OKLB 1DBAL 2F58H 5JW4R 3MLVL 1MI5B 5DJXB 4UDUB 3BEWA 3VFVB 2FECL 5HHXH 1X5FA 4FS0A 4R6UA 4FQHB 3T0EE 1MLBA 2ZP0T 2X4UB 5DZOA 4RDQG 5ITBL 1HYRC 1MY7A 5F1IA 2H8PA 1V7ML 5DD3L 5IB4A 2OXGA 4OFYD 1NCCL 5ADPL 2VLJD 3PWLA 2GK0B 3E8UH 1OTUC 1E27A 4PBVC 1K3ZA 3I3EA 4CVXA 2R0KL 5GZND 4HWEH 2XN9E 4DUVA 1PJ9A 1RJLA 1C16A 4EVNB 1T03L 4L4TD 3SDDB 4WUUB 5EU3A 1Q9OA 3VFGL 4JEGB 3IJHB 4OQTL 3WJLC 4X7EC 1WZ1L 1IJ9A 3TYGL 4PR5A 1QLFB 1MFDH 2Q7YA 2P5WE 3AXLA 5BJTB 4MD4B 3ALXA 4UU9A 4PRIA 1NCWL 3MLYL 2BMKB 3L5XL 5IROA 1UM4L 1MCPL 3MCLH 2G60H 4KRLB 5C0AE 3VFMB 5D1ZB 1XGUB 4PJFE 2MQ3A 4ZQKA 1PGRB 5GRZA 3TO4D 1VHPA 4B5EA 5C07B 1S8DB 3NIFE 1GYAA 1NLBL 4N5ED 5CINH 2FH8A 1IARB 1ND0B 3S3SA 2DM3A 4XPBL 2V2TA 1EAJA 1A7PH 1OB1A 2VN4A 5SWQB 3NCFB 4IMLA 4EI5D 3WUWB 4M8VA 1OTTD 4XGZA 1SY6L 2IFGA 1A6TA 2AJ3B 3ARSA 1AGFA 1A1NA 1YYMH 3A6BL 4ZPVB 1EO5A 1D5BB 2WBJB 1HH6A 3UROR 3VXOB 1QKZL 2F53B 4JFQA 1ZGLP 3JWOC 1T5XB 4XMPL 4Z18A 3QDJB 4MX7A 3EW3B 2J88L 3B4NA 1MRDH 5I2IA 5E7FA 1K6QL 1UJ3B 3NACH 4R90H 3MTRA 1CFQA 1I8KB 2P7TB 5JORA 1QVOB 3S9DB 1OAUL 1L7TH 3DGGB 4PD4J 2XZAH 3IDXL 1JGUH 3ZTJG 5E6ZA 3FQNB 1T5WA 1RZFL 1JWSB 4PRNA 5D1XD 2NY1C 1CZ8H 1WC7B 3RX5A 3DBXA 1EGJL 3WHXA 3IYLW 3MNWB 2N7BA 3FQUB 4ZUSB 3JVGA 2DI9A 4M7LH 3TZVB 4BJLA 4M4PA 4A2LA 4Y19B 3HAEH 2A6KB 2XTJB 4H26A 4OCWH 1N3NB 3H3KA 1A2YA 4RIRB 4IRZH 3F5WB 4X9IA 1IQDB 1XH3A 2J1KA 3FONB 1OPGL 4YLQT 2DKMA 1Y0LA 4IJ3C 4L8SB 1RSFA 3AY4A 4YAQA 4MAYD 3FO9A 5E8DH 2PW2B 3QUXB 1DQTA 3QCTL 3TF7C 2BNRB 3B9DA 4WW2B 3O4OB 4HULB 1QR1B 3MNZA 3RVXD 3FRUB 2LTQB 1U8MA 3D85A 4P3CL 5D2NB 1ZOXA 2R39A 1QYGH 4P9MH 4NQDD 5D7IF 5C9JA 3I75B 4NO5B 5DMGC 2JJSA 3VGAC 2VQUA 4P23C 4JM4L 3QPQC 4MJ4A 1AI1L 3RGVD 3IDYC 3VU2A 35C8L 3HNSH 5E6IC 3P11L 3OF6A 4FXGA 2B0SL 1Q72L 3TH3T 1CGSH 4EDXB 5JHLL 2VKWA 2IQ9H 4R96B 3EYOA 4E0RA 3R0MA 5ETUB 4AL8L 3ROLA 4ODTH 3QUYC 1RVFL 4UV7H 5DZLA 5E94B 2NY7H 3EJZC 3U7WL 1YY9C 4NQED 5I8KH 5D6DA 4UB0H 4MHHG 1FH5L 4HFUH 2FATH 3QXDA 5I66B 1IGML 1RJCA 4MCYA 4MGXA 2ZJSH 4JFEA 4AIXA 1P9MC 3DSNA 4OUUB 4U6VL 1YNTB 3BIKB 4ISVB 2CH8A 4MDIB 1H3PL 1RZ8B 5ISZE 4LEOA 4JDZA 5HI5D 3O45B 3MBXH 2CLZA 5EC1A 1CR9H 1VFOA 1XR8B 4Z7VA 3CH1B 2IBBA 3KNBB 4JZNB 2EYRA 1UEMA 5DR5H 3SGJC 4Y1AD 4TUOA 4Y4KB 3QDAA 5K9JH 1YA5A 3RPIA 3STZB 2H45A 2IF7A 3CFKB 3HG1B 2QJDA 4LSDA 4X4ZA 5HI4C 2HVJA 2A9NH 4F57L 1EMTH 3KYOB 4HIHB 4PJDE 2DQCL 1JHTA 3SDCB 2YPVH 2ICWA 5BS0A 1RJYA 3V8OA 4N8PA 1V3JA 5HHNB 2ZG2A 4XX1G 3O3EB 4J3XA 3MV8A 4MNGB 4NCC2 4Q2ZB 4MCZA 1NJ9A 2YUZA 3CUPA 3QIUA 1I8LA 2ZCKH 3VWJD 2Z31D 5D2LA 4Z5RB 2E9IA 1CGXA 4LHJB 5AWNL 3T4YA 3RI5F 3LSOB 3ARYA 3IS1X 4N0CC 4GKSB 2PYED 1HQ4B 4Q0XH 4BKLB 1RUQL 1XF5A 4ZYKA 4X7CC 2DF3A 1IT9H 4HS3B 1IGIH 2PTVA