2CUMA

The solution structure of the 33rd fibronectin type iii domain of human tenascin-x
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
105
structure length
105
Chain Sequence
GSSGSSGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tenascin-X
publication title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 6
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cumA00
4Z8FH 2CK2A 5SWZE 1ULVA 5DO2D 3CPLB 3F8UB 1C5BL 1ND0A 1UA6L 3TT3H 3ULSA 4XNZB 4ZTOL 5MEND 1I1RA 3CVHA 1LK3H 5GGRB 2E7BA 1JYVA 3V5HA 3LZFL 1P4BL 3IDMA 2C7UB 4YDIL 3BH8B 3H9SB 4MQ7B 3QFJE 1DDHA 2H6PA 4DN3H 2P44B 1T1XA 3QRFM 4B50A 5MENA 4PTUB 3RL1A 4MXWH 3LKSA 1M4KA 5DJCB 1MRFL 4UOW0 2F74B 2DD8H 3BH9B 1RZGB 3DRTB 2D7NA 2EZ0D 4LNRB 2FJHB 1P9MC 5GGSY 4ZS7H 5FFLA 5HYEA 3MPCA 1SMAA 4KI5E 2OK0H 3BE1L 5HYQB 5J1TC 3ILQC 3W9DB 1ROWA 1ZLVH 5E94B 3BPNC 1OARH 4NM4H 3GM0A 4CAGA 4HD9A 3IF1B 3BPNB 3IU4H 4YHYC 2XWBB 1UWGH 5D4QA 4XBEH 2JB5L 5JZ7C 1JPSL 4YHYB 5I1CL 1CG9B 5EZLB 3VG9B 3PP4H 4QKXB 4MA8L 3RKDC 3WUZA 4XNYL 4WTZG 1U36A 2CKBL 1W72L 5JIPA 1G7QA 4H8WC 4P9HL 3PHQB 5KN5B 4ZOCA 3ZYZA 1Q72H 3CLEH 5EC1B 1T66C 3DUSA 3VU2A 2X1QA 2VLJB 3V9FA 1SVZA 3ZSTA 1MJUH 4O4YL 3E8UL 2OYPA 1EDQA 2XRAH 5ILTH 3JWNC 5I71C 2W0LA 1Z5LA 4LOUD 3T0EE 5I71B 4C83A 1ZANL 4POYA 2NZ9C 4UIMA 3A6OA 3T0DA 1UKQA 4Y2DC 1L7TH 3UPRA 1TVDA 3NIGF 5ICZB 5B38B 1KNOA 3HI5H 5I75C 4Y2DB 3VW3H 5I1EH 4KROD 5I75B 3S97C 2HLFD 2Y4SA 3WN5A 1Z9SA 4JFYA 4OZ4B 1S9XB 4MS8C 5GIRA 1JZ3A 4EEEA 4QCIB 4LDOB 4CVWA 4KK9D 3B9VA 4P5KA 5DJ8A 3SPVB 2EDFA 2BXYA 8FABA 1AGDA 4DFIA 3DSNA 2HTLC 3WIHA 1SYVB 4L8CB 1U8OB 2XACC 4P5MA 3SCMA 3S36X 3TBWA 1QSEA 2VERN 4ZXBA 5EIIB 3HC4H 3O3DB 5DHXB 5E08H 2HA1A 5SWSD 3HZMB 3QUXC 3MA7B 1BFVH 3UC0L 5F1IA 3SO3C 1T2XA 5M7QA 1KN4H 3QUXB 5FHBL 1GC1L 4Y0GA 3GGWA 2GCYB 3SO3B 4Z7UA 4P5TA 1ZT7A 3I6GB 3D2UB 1PYWA 2CJUH 5JPMB 3EDDA 2XXCB 3PV6B 1FL3A 3OPZH 3WSQL 3U7WL 2VOTA 3OKYA 3GHEH 4JDVB 1JUFA 2X44D 3FZUC 4G8EB 1KJ2L 2Q6WB 1KCSL 1LO3H 5LQBL 2HJFA 4TNWF 3I3EA 4FG6D 4NKIL 2QR0B 4TNVK 1X7QA 2Q7NA 3OG4B 3MYZA 1UXWA 1JZ7A 2MJWA 3S5LB 1TQCC 3T2OA 3D85A 2X4TB 1TQCB 4B7LA 3WLBB 4NN7C 4IOFC 4DAGL 4NN7B 1AR1D 5IB4B 3MRHB 1U8HA 4P9ML 3IYLW 2A2QT 5MI0C 5D1XC 4NZJA 2LTQC 1QSEE 4S1DC 1H9VA 3NA4A 5MI0B 5D1XB 2LTQB 2FEEI 4Y4KC 3ROOB 2DBLH 4W6XB 5AWNH 4FQ2L 4M1CC 1UADC 4Y4KB 4J4PC 3CJJA 2IQ9L 4Z7UE 2YD5A 5FYKL 1DE4A 4M7LH 3CXDH 4XVJH 4KWUA 3RVXC 3QFJB 2XWTB 3QSKB 2ZUVA 1I3VA 3SDCC 3QA3A 1LE5A 1CFQB 1EGJH 1SM3H 3CH8A 2J2ZA 1L6ZA 3QWOB 3SDCB 3L1OL 4ZODA 2CO7B 1LO2L 4PB0H 3PHOA 4E0RA 4HKZB 3V7AG 3C6SA 3MNWA 1W0WB 1KACB 4FZ8H 1HSBB 4OLVH 3V8CA 3D0VA 3S35L 2W1NA 2RQ8A 4MNHB 3S4SA 4MQXD 3WLWD 3STLA 3RWCA 5MEQA 5F44A 2BHZA 2PW1A 4WWID 4OLYL 4L8BB 5FO8A 4Y89A 1P4IH 1A6UH 2OJEB 1OW0A 1PZ5B 1X6LA 4JO4H 5JOPD 4JHWL 1IJ9A 4XP5H 2HJKB 5JPNB 2BNUB 2H1PL 4O5LL 3ARQA 3DVNB 3C5JA 1ND0B 1NMAH 4FTVD 1P53A 1UB6A 1ZXQA 4QRTA 1KELL 5AZ2H 2FX8L 5BVPH 3EGSB 5F7EH 5JNYA 1A3RL 1WT5C 4I3RL 2OJZL 3V5HB 3V4VL 3FJTA 1MFAH 3HZKA 1HH6A 1FNGA 4JG1H 2PUQT 3T0EC 2ADGB 4HAGA 5E03A 2H6PB 3B5GA 3EBAA 3T0EB 5CS7A 2AJUH 3SKJL 1NUDA 3C5ZA 3RL1B 1LO4H 2UZYB 3PXJA 1TVBA 4AEIL 4U1IB 5I30L 1BF8A 3VFWA 3V7MA 1S7UA 3OJMB 2Z93A 1DEDA 2GFBA 1FFPA 3O8XA 5MHSD 3QPQC 3VE0A 4A6YA 1AGBA 4JPIA 1G6RA 4TQEL 3MLSL 2XOTA 2DTML 1ZS8A 5F7WC 3ZKNC 3O2DL 5TE7L 3LS5H 3WFBH 1OB1A 4JHAH 1FV1A 1CXEA 4R7NB 2V5YA 3HA0A 4QF1B 5CLWA 2AJXL 3FQRB 3UPCA 5DRZB 4HS8H 4L3EB 5CEZL 5DI8B 2YD4A 2NY2D 3L3DA 3S3JA 1JWUA 3HE6A 5IVXF 2R23A 2X5PA 4JREC 4HIHA 1AGEA 2XQBH 3QIBD 3Q5OA 4HZLB 4JREB 3DJ9A 4U6HB 3NCBB 4LSDA 5EWIH 5BXFA 4EUPG 4MB3A 3PWVA 3JV5A 4NQVA 5CMAB 2EYRA 1NSNL 4BSVA 4UIMB 1SJVA 3MXVH 3Q5YA 4WUKL 4J1UA 1AP2B 3H2WA 3P9MB 4XRCA 3WN5C 1CLYL 3QIBA 2P7TB 4F33B 4R4FL 3H0TB 3WN5B 3QIWB 4ELKB 4JFYB 1J1XL 2CD0A 5DZNA 1B3JA 3B5HA 3ZYIA 5SV3A 3NTCH 2NCMA 4CBPA 4RGOL 1BZ9A 3MRDB 4FFZH 5JO5A 1PY9A 4Q9RH 3IDJA 3LN5A 4P5KB 1TXKA 3QDGD 1ZLVK 3TPKA 2EKSA 1IM9D 1WK0A 4KVCL 4HK3J 5E5RB 1F4WL 5E00B 1AGDB 4PJCA 3JV6A 3SCMC 1ZV5A 3FB5A 2XQYK 3DV4A 3SCMB 5BCAA 4PJDF 2Q1EA 5GZOC 4P2OA 1BMGA 2I9LA 5IV2B 2DWEA 1NJ9A 2PR4L 3S3SA 2P48B 4R4BB 2MWCA 1IM9A 1VEOA 3M17B 4YEEA 4YXKH 4XPAH 2CKBA 1W72A 1ZT7B 3C9NB 2HH0L 1N0XH 5GGTL 3ESUF 4NIKB 3IJSA 35C8L 5CGTA 1DQLL 1HI6A 2JLLA 1FL3B 4PP2B 4ETQA 1ORSA 3ZZ1A 4OFIA 1KG0B 5DMGD 5GGVY 1MCHA 1URLA 3P2TA 1BWMA 4HUUA 5T1DH 1MFBH 3NH7L 4HS3A 2SEBA 1XAUA 1AGFA 4G6ML 1U6AL 4X9GA 5IUSA 1EAPB 3B8YA 1UXWB 4OCMC 4JVUA 4P2RA 4NNYA 3MRGA 3PGFH 3NIDE 1QYGL 3D85B 5DFVD 3SKMB 4J2XA 4UTBL 4PRAA 5AZEH 4MQTB 1VHPA 4MZ3A 2IBZX 5BVJA 1MHHB 4JCLA 4PJCE 3BP6A 3EW3B 4JFHE 5T3XL 4AJ0A 1MCCA 2X4QB 1J11A 5IG7A 4XAKD 1SHMA 3L7EB 1M7XA 4RAVA 3IAQA 3OZ9H 3HAEG 4U2ZA 1INQA 7FABH 2Z35B 4O9HL 2YPKA 1EBPA 2MPAH 5IJVA 3K74B 1YPZA 3NFPA 2JCCB 1KEMH 4OCXL 4LSUL 5LKNA 4PV9A 1S7VA 3WV0A 1H15A 5GS0L 1YA5A 2GY5A 3QA3B 4UU9A 1LE5B 1UM6H 4U0QB 3DX8A 4WI9A 1S7RB 1OAUH 3H6JA 3PHOB 3RQ3A 2V9TA 4RCAA 1G84A 3BPCB 3MNWB 2JIXB 4R0LC 4NZDA 3REVA 1GGTA 1XCQA 4R0LB 1KJ2A 3L3GA 1NEZG 3I84A 2BJMH 3S4SB 4P2RE 3RNKB 5MEQB 4LAQL 4N1CA 5JQHC 1EEYB 2YA1A 1L7IL 5BMFL 2MKWA 3PDGA 1OW0C 3PGCB 1JTOA 1DTUA 4LFHG 4GRMA 5EOQH 4F7EA 3IJHA 2HRPL 4YDVA 1E6OH 3DV6A 1NAMH 4NJAL 1X3DA 4FN0A 3ZTNL 1NCWH 4X7TA 4K2UL 3T1FA 2NY1D 1U0QA 3GSUB 1FZJA 1T7ZA 2A83A 1BQHG 4JZJA 5IT2H 1CD9B 1YPZE 3EZJB 3HZKB 1HH6B 4Q7DA 5DMJB 5E2TH 1FHGA 5IMLB 3F6IA 4KHXH 4IEFB 1FYHB 1IKFH 1PKOA 3C5ZC 3P73B 2OR7A 2IANE 1ZHLA 3C5ZB 4MB5A 3G04B 4PUBL 1N2RB 2CLVB 4TNVF 4N8PA 1MFEL 4OT1L 5IVZB 2AXJA 1S7UB 3CSPA 1WUNT 2W59A 2V9RA 2WLYA 1IGML 2GFBB 3VRIA 5FUZH 4YFDB 4WV1C 4KTEH 1QRNA 3ULUF 3MRBA 4XCNA 4A6YB 4WV1B 4N0YL 4EUPB 1RPQA 1LP9B 1MLBA 3B4NA 3D48R 3GBLA 4QHNA 2QQNH 3A0OA 4RDQG 3OGOE 1TZGL 1I1CA 4EI5D 4KPHH 1F3DJ 3EYVB 2A74B 1TJHH 4M6NL 2XN9D 4XP4L 1FV1B 1FNAA 3BW9B 3VFGL 3U46B 1YY8A 2NY5C 3FKUS 4JN1L 5INCA 1FAIH 4O02H 2Z4QB 5K59E 1D5IL 3A6BL 1NPUA 1BBDH 4XP9L 3FONA 2XFXA 3IRPX 3EYUH 1T1YA 1DL7H 1L9NA 4U7KA 3M1BA 4HIHB 5ITFB 5SX4I 1DQMH 4JZOB 2XTJE 3F58L 5ESQA 3QEGL 5BQ7A 3I9GL 1BVZA 1ZVYA 5BXFB 5C08A 5DEGB 4AL8H 3ECBA 2PN5A 4JFFD 3OJDB 5FYKE 3VI3F 3VD3A 4BSVB 1LD9B 5IJKA 3R06A 4OCYL 3W11D 3ARGD 4UDUA 1WFUA 5KAQG 3MBEA 1J1PH 2APBA 3MV8A 4J1UB 4LEXH 1DLFH 2DI9A 4OIBA 3VMPA 1AQDA 1H3GA 1HHIA 5DT1H 5DEFA 4HKXA 5EBGA 4GXVL 4LLQB 1BWWA 1QRNE 1QHPA 2ICWJ 1MEXH 3ZE0E 4DWHA 3ARGA 3CMGA 3IDJB 5JHDD 3PWJA 4R7DA 4S1SH 4TTDD 1H0DA 3TN0D 5A1AA 3LMJL 4L4TD 4PJCB 3TT1H 3KPSA 2X9YA 2QTEA 5CEZD 3FB5B 5TJWK 2FJFB 3O2DA 4P2OC 3WEXA 2GK2A 1OTSD 5DRXA 1PFCA 4M3KB 4P2OB 2DWEB 3DYOA 1NJ9B 4ETYA 3O3UN 2A6DB 5H2BB 3SGEH 1A7QH 4JFXB 4K3EL 3K2UH 3VXQA 3HZVA 1I8IB 2GJ6A 2ZWLT 1ZA6A 3ARBA 4L4TA 4P9HC 1V7NH 5LGJB 3MRIA 1W0VA 1MWAH 4LHUD 5C08E 3HNTH 1CFNA 2XZCH 5CSZA 4KY1L 2FNBA 1UZ6E 4BKLB 4ETQB 5HY9B 1TTFA 4HUKB 1IQDB 1UC6A 3VXPA 3K1DA 3HAEB 3MV8E 4HUUB 5T1LA 4EI6B 4WU7A 2Y07H 1G1CA 1IC7H 4B41A 3HB3D 1WTGT 1KTLB 3VFPB 5BV7C 4LLYA 1OCWL 3CX5K 3T1WA 4ORZC 5BV7B 1NCCH 3E6HB 5T1MA 5A2JH 4Z5RA 1AO7D 1PG7L 5HI5D 3WFHB 2YWYA 4KKAD 1U3YA 2JELH 1F6AA 3I2CL 4HQQL 2EIZA 4JG0L 2IALA 1BQSA 4LCIL 4MLSA 5I1LA 1NGZA 5BVJB 4EBQL 2AEWA 3UMTA 4MJ4A 2UV3A 4OD3L 1TNNA 3WXVL 3KPSE 1WEJL 3ULVF 1UH4A 1DBJH 2F19L 2CLZB 5IG7B 5IM7B 1NEZB 4XBGB 4RAVB 1WCBB 4NO3B 2X4RB 3TIDB 1U8QA 2AGJH 1INQB 2WBKA 2BOCB 1HZHH 2GJ6E 3H8NA 1QSZA 1YPZB 3NFPB 5EU4A 3VJ6A 3MV7B 1LDPL 3DMMD 5CEZE 1OM3H 2G2RA 1HHHB 1S7VB 1H15B 5KOVC 1H3PH 2O5ZH 4JJ5A 3T4AA 5EZJB 5T3ZE 2Z31D 4UU9B 2C1OA 1ZT1A 4PJGB 1K2DA 2IANB 3TA3D 5GGTA 1RJCA 2HFGH 3DX8B 2HT4C 1K6QL 2WMPA 3G6AA 3NZHH 4LQ1A 2Y9RT 1BQHB 4Q2ZA 4KQ4L 5FKAB 2G9HA 2EXYD 4X7DC 3REVB 3U9PH 1U95B 1XCQB 5I19H 2ZUUA 1KJ2B 4RFOL 3FHAA 4OFVA 4HHAB 3Q6GH 1JZ2A 4MAUH 4M93C 3CZFA 5CHNA 1FH5H 4XC3H 5GRUL 2I9TB 2VN4A 1M6OB 4M93B 3B2UD 2PW2B 1C1EL 2V5MA 3B3IA 4WNQB 3FN0L 4R96A 2LV4A 4MD5B 1N26A 4QXTA 4F7EB 3DX7B 1WZ1L 2VDKH 1X5GA 1ZHBA 3VD9A 5E8OA 1FFNA 2G60L 3WS6A 5HVFB 1WWCA 3IFPB 2WUBH 4JM2A 3UCRA 5I1HH 5HHOD 4OBRA 1IAKA 4U6YB 5CJBA 3JUYA 1FZJB 5D7IA 3MJ6A 4H26B 2DQUL 3LRSB 5KVFH 1QQDA 5FA4B 1C12A 3FB7A 5EB9A 4R3SA 1HHKB 2DKSA 4XI5D 4X4ZA 4MDJA 4M5ZL 3OAUH 1IT9H 3B43A 1ZLSH 4FMFA 4UTAH 2YUWA 4KRNA 4LQFH 3HI1B 1EERB 1GRWA 5D6DC 2DTSA 4LLMA 5DR5H 3VI4F 1S9WA 2DQJL 2YA0A 1P4LA 1L0YA 2EYTA 1IC5H 3DLQR 5DWUH 5CINH 2GTZB 3O11A 4XCNB 3O3EB 3CH1A 3U0WL 2VMFA 2I07A 4ODXA 1AXTL 3KXFB 3LQZB 1MAKA 5D2LA 5D71H 2I26N 4PGBB 3RKDD 3C6LD 4LLUB 4PJXE 4KKCD 3U9UB 4PJBB 3BMVA 4KU1A 2E7LA 2PTTA 5DD5H 3RVUD 1J7VR 2ZG3A 1TPXC 2VITA 4HPYL 2VQUA 4JR9L 3VFMA 2ATKA 1TPXB 3QXVA 5T3XE 3FONB 5T1KD 1KCRL 4OF0A 1T1YB 3OXRB 4QHMA 4P3WA 2NZ9D 5I76B 5DVNA 4A2MA 1T0NB 2NW3A 2CR3A 3WIFB 5HI3C 2H41A 4XTRC 4JFDB 1JGVH 1TETH 1VGKA 1CDIA 1DN0A 4P2QD 1CZ8L 3ECBB 3HG1A 4N5EC 3WNKA 2NTSP 3MBEC 4OF6A 4PRDA 5J0BA 4RFNC 4XX1G 3WHXA 4UDUB 5I16B 4PY8I 1KB9K 3MBEB 4RFNB 4R26L 5IW6A 2W9DL 1FBIH 5ABDE 1AQDB 1IBGH 1HHIB 5DEFB 4EDXB 4OZFH 3S88L 1P7HL 4P2QA 3EDFA 3EFFA 2HTLD 1G7MA 4KJYB 1U8JA 5D2LE 4HT1H 3CVHH 3DUUB 3PHSA 1IEBA 5K9JL 4XX1E 4YR6A 4R7DB 3W2DH 1M71A 3JTSB 3SGKC 5IR1A 43CAA 4EOWH 3BRDA 4FRWA 2AJVH 3UBXI 3FRUB 4AG4L 4W4OC 4F37K 2DYPA 3P9LA 4F7PA 4XGZA 2YBRB 4KDWA 5HGHB 3EJJX 3GMPB 3D2UD 3BFOA 4QRSA 3WEXB 4FQIH 2VLRA 3OKNB 1H3WM 4MJ5B 2YD1A 2NY3D 4ALAL 1T89A 5EA0L 3BZFB 4BFEA 3L5JA 3R1GL 3KPMB 2XZQH 2YD8A 3ARBC 3QHZL 4NRXA 2IG2L 3TNMB 4O2FA 3HZVB 5DRNB 3ARBB 1ZA6B 1RIHL 4U1JA 4RWYL 5JXEC 4NFCA 5GHWL 4FS0A 5HHXH 3FZUD 1W0VB 2DM4A 2R1WB 1U91A 1FVCA 2ZSWA 1CFNB 1GGYA 5CFHA 4YGAB 3HG1E 4D0DA 5EO9A 3CX2A 5SX5K 4HKBB 4NRYB 3VXPB 2JJUA 2KQMA 2ARJA 2MFNA 4OIAA 1MCWM 4X6CF 1AFVL 2F8OA 3LPFA 5IIEB 4OKVB 3UYRL 1CD1B 3GSVB 3DO7A 4YDJB 4JKWA 1NKOA 1YN6B 2EH7L 3MRJA 2ZCHH 2UZIL 4M6OL 4Y4FA 4Z5RB 1OSZB 1RMFL 5DK0A 3NPSC 3G5XB 1LNUA 3LEYL 5EPMB 2BVOA 3NPSB 4X6BA 5DURD 1G7JA 2E6PA 1B2WH 4Y4KD 4K3JL 4PGEB 2VLRE 3MMEA 4AH2A 4G6JH 4BH8A 1S7QA 1ZTXH 4JFZH 3TBSB 4PLKC 1EO5A 2O61A 2VAAA 2VE6B 5GSVA 2YPLD 4ZNCD 1MCBA 2Y36L 4QTIH 3BSZL 2QLVB 3TBVB 1I7ZB 5TGBA 4OFYA 3VXMD 1BIIA 5ID1A 1K2DB 5C8JA 2X4PA 4JPKL 3G6AB 1CFBA 1WF5A 3FCTA 4Q2ZB 4YHNA 4AIOA 1W2KT 5M94B 1B90A 2YPLA 3WIHH 3CFKA 4MJIE 3IETA 3VXMA 4CW1B 4JFEB 3ZKXC 5HGDA 3MLPA 4UUJB 3K2MC 3CZFB 3ZKXB 1C7TA 3PP3H 4OCLC 2PTVA 4L9LA 3WL9B 4PJXB 2A38A 4TSCL 1RVFL 3TO4A 2NX5D 4RGND 4YXHL 3WS6C 1OAQH 5J1AA 1ZHBB 2FRGP 3T65B 5KVEH 4N68A 1HYSD 1QO3B 2BY3A 4JM2C 1JHLL 5GRJL 4C54A 5CJ5A 1NDGA 1KYOK 3CFEA 1EO8L 5EFIB 5J8OA 5LCVH 1UENA 1MVFA 4H88L 1FVEA 2QQKH 1HIMH 1TVHA 1KXTB 3EO0A 3HI6H 5I18H 1J18A 3CFCL 1J9CT 1DQQA 3BZ4A 1C12B 3FB7B 4FQLL 2ITCA 2NX5A 1H5BA 3TF7C 1V5JA 1UZ8B 1MRCH 3KR3L 3G5VA 5BO1L 3C87A 5IMMA 1SQ2N 4JQVA 1FSKC 4K8RL 3PQYE 5A2KH 3Q1SL 1FSKB 5EO1A 5GS0C 2E7CA 1K4CB 3QCUH 1S9WB 2HT3D 1QSFA 3MUGB 2VR5A 4F7TA 2CDFA 4XP6H 5DJYB 4D8PA 3QJFA 3SQOL 3MRKA 4ZPVB 4JPWH 1OGTA 3MRMB 5DMIH 2HAZA 1T21A 5K93A 3MUHL 2ZG2A 4HIXH 4L3ED 3N50A 3IFNL 3FQXA 4JO1L 3FN9A 2D7TH 1JPTL 1X4XA 2FH8A 1G0DA 5DQDL 3FT4A 4MCZA 4NQEB 1T1WA 2ITDA 5C9JB 4ZUTA 1A1NB 2W0FA 3DETC 5AUMA 1FNFA 2FWOA 4GAJL 4NWUH 4GLRH 5C0DA 2EXWD 2PKDA 4S1RL 5IWLA 5KSUA 1L0QA 1T5WA 4GW1B 1RUQL 1E4JA 2K9UA 3SKUD 3RBGA 1G9EA 3GI8H 2H3NA 1EEZB 5INDA 4NN5C 5L8KB 5JIIA 4XMKL 3VMOA 4NN5B 2EDJA 3QIWD 2IPTH 5E70A 3HG1B 5B21A 4PRDB 5B3JE 5I1KH 1SEQH 1BJ1H 2AV7A 5E5MA 3WHXB 1N4XH 4M5YL 5HDLA 1QSFE 4YBHA 2DIAA 2EDNA 4MJ6A 3O81A 2HVKA 3IDIB 3QEUB 5D7JD 4PRHE 4YFEA 3BIKA 4LKCB 2Q86B 2IPKB 4YFLF 3U0PA 1G7MB 2YOCA 1KPVA 4JO2H 5IW1B 4JDZA 5TFSL 4AENB 2FJGA 4U6XA 3DHMA 1RFDH 3P4MB 4YR6B 4GMTL 5IR1B 1M71B 2ORBL 5GZOD 43CAB 1JGUL 3MOAL 1YEIL 2E7MA 2HJLA 5I8CA 5TE6H 5D7JA 4M43L 1NBZA 4HGWA 4YGVA 3EHBD 5IROA 4F7PB 3WIIH 1FRGL 4XVUD 3U7YH 1V8HA 3VWJC 5BJTB 4QRSB 1T89C 2VLRB 4IRSD 4YUEH 4JM4L 3VWJB 4X5XA 1FC2D 5JORB 4PJ8A 4X8JA 4YH6A 2JJSC 2XG4A 3VFVB 5ADPH 5E8NB 1T2QH 3GHBH 4K7PH 3K4DA 2WIIA 5F9JB 3EZ8A 4YHML 3UTZA 3O3AA 1SJEA 4LKXA 3QRGL 1AC0A 4LRNL 2ARJQ 4FXKA 1U91B 4NQDE 5E8DH 1FVCB 2ZSWB 4A6YH 4FFYL 5ANMA 4HXAH 2P46B 4D0DB 4GT7A 3CLFH 4RX4A 2OTWA 2ED9A 4HH8A 3NIFF 5DTFB 3BP4A 1NBYA 4URTB 1F58H 1G7LB 2BP3A 4NT6A 2NNAA 5HHMB 4NZRL 2CK0H 4XNXH 2D7OA 3DO7B 3LKRB 4MJIB 3EUUA 3MRJB 1JPGB 2NY5H 1JIBA 2VLKA 3QPXH 4PV8A 4FNLL 2H45A 1BGXH 3VFSB 2DL9A 3QG7H 5DK0B 5IMKB 1LNUB 2RCSH 4XPTL 1A1MA 1HKLL 1KUMA 1FCCA 1SYSB 1DZBA 3PWLA 5DD6B 3OR7A 3CUPA 5EZOL 1C5BH 1UA6H 1HH9A 4JY5L 3LY6A 2X4UA 1X6NA 3RL2B 1UEYA 3LZFH 1P4BH 4I18A 1S7QB 2K7PA 4BH8B 2ATPA 5K9QI 3WNLA 4YDIH 4BQBA 3X11A 5EBMA 1A5FL 2UZXB 4JAMA 4XBPB 1DBML 4Y1AA 2VAAB 4TUKL 2VZUA 3FFCE 5EORL 5GSVB 5EIQA 1MRFH 2JIXD 2IC2A 5ERWB 4GAGL 5ANME 5IOPA 2APFA 5EZIL 4XNUL 3HE7C 3PQYB 2X05A 5I17A 2AXGB 4PJ9D 3HE7B 3TLRA 4KGLA 1YEHL 3BE1H 3CX5J 5DD1L 4APQA 4HEPG 4HWZA 4PIRF 1PEZA 1JPFB 1EV2E 4U3HA 4RAUA 3D3VD 4GQ9L 1U8IB 4L5FL 3KAAA 4NHUB 4NNXA 5IQ7L 2VLKE 2JB5H 3GJFB 2X10A 4PJ9A 1JPSH 2OTPA 5I1CH 1BLNA 1T1ZA 4L9LC 4F37F 4MA8H 1MIML 4ZFOL 3TO4C 1IM3A 2P8MA 2CDGB 4YBQD 2CKBH 1W72H 3TO4B 3MLVL 1BQUA 4P9HH 5D5MA 1CDGA 1O5DT 3D3VA 5DUPL 2FL5A 3X14A 2DJ4A 3KLAA 5EH1A 3CFEB 1NFDA 4O4YH 3E8UH 2NQCA 1YC7A 4JFPA 1FVEB 2FSEA 1TVHB 1JL8A 1A6WL 1RZKL 1ZANH 3TYGH 4Y1AE 4AYFA 1DN2A 2DIBA 4LK4A 4PB9L 5FGSA 1UQSA 2C5DC 2CIKB 4JQVC 5IMMB 1HQRA 4C56B 3VD7A 3QG6B 1E6JL 5F1SA 1PBYA 1GGBH 3UDWC 4E41A 1PZUB 3HC0B 2GW5A 4AEEA 5I2IB 1QSFB 2ZUSA 2YEZA 5F96L 1T3FB 4RQQA 1JNNL 1CDJA 4PRHB 1KIQA 3QI9A 1KOAA 1UM5L 1DQTA 2AJYL 5FHAL 5KG9A 3BYYA 1YEDB 3QJFB 3O4OC 4NSKA 2W60A 3O4OB 2FECL 2PCPA 5CP7A 5EG6C 5E1HB 2V9QA 4EXPX 2VL5A 1RHHA 4N0FA 4J3SA 3X17A 4PREA 4X99A 3RGVA 1AGCA 1D6EB 1V7ML 3TNNB 5AG9A 3DTXB 3UC0H 3UYPA 3IDGB 4IIQA 1Z6JT 3FT4B 4MCZB 1T1WB 2ITDB 5FHBH 4CVUA 3PWPD 2AXHA 4AIZB 1NFDE 2FWOB 1A4KA 1YNTB 5GJSL 4GUPA 5E2UL 2W9LA 5TPWH 1MHPL 4WO4C 3TVMD 5D6CA 3WSQH 4WO4B 3U7WH 3BWUC 4PFEA 3UBXG 5BW7A 2IGFL 3V0VA 1KJ2H 4NQDB 3L3JA 3PWPA 5FDWA 5IVXA 1KCSH 1A6VL 3BISA 3RTQC 1WZKA 3OKEA 3QXUA 5LQBH 4PYHA 3RTQB 2AV7B 4NKIH 3VH8G 2C4XA 3TVMA 1WZMA 4E41E 1UG9A 3MGOA 5C07A 4MJ6B 4GRWF 3KPQB 3FQWA 1XGRA 5DD3L 5DHVA 4GAYB 3LKPB 4DAGH 5FYJL 2NYYD 5KS9A 3B6SA 4P9MH 3MFFA 4U6XB 2JKXA 2Y72A 2AV1A 2CIIB 4X80H 3QBTB 3EDJA 4CVZA 1CVRA 2KBGA 1K8IA 5EU5A 4Y5YC 1NBZB 5CEXB 4PJIF 5F7DB 1U92B 4FQ2H 4JQXA 4Y5YB 3CCHA 3BOVA 5L8JB 5J1SC 4UT6L 2IQ9H 3LKNA 4X5XB 5FYKH 4M4RA 3RX8A 2FBJL 4P2YA 4ZOEA 2CSPA 1MHCA 1G7PA 1LWRA 2N7AA 4H0HB 2E5EA 1CQYA 3I6KB 1EMTL 4PJDA 1L9MA 4JVWA 4LKXB 3FFCB 3VFUB 3L1OH 4P46D 3EOAB 1DBBL 1LO2H 2MOVA 4HFWB 5IVXE 3WNPA 1UH3A 1KB9J 3V6OE 1CGVA 1U93B 3SGDH 3PG2A 4DW2L 1WFOA 4BZ1L 1CBVL 5A16B 1ITCA 4ZO6A 4O2CA 4OZIF 3S35H 2AEPL 3HCVA 3RWFA 4NT6B 3VXRA 5C07E 4LCUB 4HBQA 1V3KA 3RWGB 5E1AA 1CYGA 3TBTA 4LLWA 4KHTL 4TSBL 4NKMB 3RJQB 2BNQD 2VLKB 4PRBA 2Y7QB 1KFAH 5KS9E 5E24E 5GGUB 4JHWH 5J06A 1FL6A 2ICWA 4WI2A 4P4KA 3OJ2C 2DQFB 2H1PH 4O5LH 4FFVC 2BC4B 3CUPB 1IL1A 4MB4A 1KELH 4NUGL 4CU6A 2FX8H 4LFHD 1I7RB 1A3RH 3HLAA 1JV5A 4I3RH 2OJZH 2JF1A 1G9NL 2NW2A 2E6QA 2FX7L 5LBSL 1S7XB 3R0NA 4IRZL 5CD5C 4Z78A 4FQXC 4JAMB 4PJDE 4Y1AB 3SKJH 1AJ7L 4FQXB 1N3NA 4LSPL 4NO2A 1J88A 1F42A 4NO5B 4AEIH 2WSKA 2UYLB 2ZOKB 5I30H 5IHUL 1TQBC 3KPPA 4G80A 3I75A 3MXWL 4HS6A 4QXGL 5IOPB 3E3QE 2Q8AL 5DJ6B 4APQC 4KV5E 4APQB 5C6TH 3VXRE 5I1DB 4TQEH 5DS8B 3MLSH 1C5DB 5B39G 3RZWA 2DTMH 4Q6IC 3MV11 4KJPC 1MLCB 3O2DH 3BGMA 1P2CB 1ZSDB 1RJLB 3C2SA 3N0PB 4LSQL 4NNXB 3GSQB 4Q6IB 5TE7H 5CD3A 5D72L 5FA3A 4WW1B 4ZUUB 1EAJA 4YLQT 1XGQB 1KULA 4AT6A 2AJXH 4ZYKA 4L3CA 3T04D 4X98B 3OKOB 3PDDA 1K3ZA 5CEZH 5FUCE 1W8NA 4K94C 2MMXA 4O51A 1EO7A 2I25N 3EYFA 2FL5B 2V7HB 4IHOA 3X14B 3A6CL 4KGJA 5JDSB 4Z0BH 3MBXL 5T3ZH 4P23A 3DOSA 5F8QC 1J5OL 3AROA 4QHKJ 5C0BA 1ACYL 4KI5F 1VKXA 6FABL 4WUKH 1UQSB 1ZLWH 2CLRA 3LQAC 4JY6B 2ZUYA 4U1MA 3V6ZB 1CLYH 3K4AA 1HQRB 5GQBA 1QOKA 4R4FH 4ODBD 2FD6H 3ARDD 3UX9B 1ZOXA 1J1XH 5C3TA 3H7BB 4RIRB 3KXFD 32C2A 1IEAB 3UJTL 4PGZA 5CP3A 3DVGA 2HG5A 4D9QE 3VGFA 3P4NA 4RGOH 2VWEE 1FG2A 3QI9C 3V52L 2CUMA 1NL0L 3UBXB 3QI9B 4ZDHB 4AIXA 1OP5H 4KVCH 1QLEL 1RSFA 2OS7A 3DX6A 3O6FC 3GRWL 1JF1A 4KUZL 2IMNA 1MFNA 5SWQA 3P0VL 3ARDA 1FZKA 3O6FB 4ZQKB 1IAMA 4Q6YA 3AAZB 3LV3A 5CP7B 3BVNA 3MLTB 1A7RL 3RGVC 1QP1A 2VL5B 1RHHB 2APXA 4UDTA 1JYXA 3RGVB 3RVWC 2PR4H 3UTTA 2XKSA 4U3XA 4U4BA 5FM8A 3BD4A 1E27A 5E6IA 5IFJB 2DL2A 4NZUL 4ZFOA 4YIQA 4PS4L 2F5BL 4JFDD 3OKDA 2HH0H 5GGTH 1A4KB 1K9TA 1NC4D 35C8H 4IMLB 3JV0A 4GUPB 4GXUN 1MAJA 1DQLH 3EO9L 4DVBB 3CC5A 3THML 5C0BE 2XNAB 4Y5XA 2YC1B 3RP1A 1P6FA 5A3IC 4Q9QL 3FOLA 4KJQC 4NQXA 5DGRA 4XWOC 2V5SA 2QL1A 1YEEL 2EE2A 3AREA 5FDWB 3V0VB 1DANT 5T5NF 3V6OC 1U8LA 5IVXB 4YC2C 1XR9A 1QTYT 2VXUL 3B8SA 1JE6A 3NH7H 4YC2B 4JRXA 5TQ2L 4XNMA 4G6MH 1WIPA 3B9KC 3HRPA 4K8RC 1U6AH 1DQJB 2OCFD 3T0BA 4J8RA 5HDQH 5EU6D 1GSMA 2EO1A 3B9KB 5C07B 4WFGD 1EVUA 3H3PL 1K4DB 1QYGH 2ADJA 5F1KC 3ALWA 1G7HA 4U7MA 3ARWA 3DGGA 3KPTA 4IDJL 5ACMA 2OSLB 4S10A 1WLHA 4XWGL 4N1HB 4RA0C 4V1DE 4GKSA 5T3XH 2HRLA 3U6RB 3ULUE 2H32B 5EU6A 3QJHA 1NGWA 3LQMA 4HGMA 3UTTE 2YRPA 4QRPA 3MOBH 1FO0B 1I9IL 4O9HH 3MRPB 4G8GB 1N0LA 1JRHL 4MA7L 4XHJD 4KUCD 1HDMB 4ODWB 5ID0A 4LSUH 1FVDB 1Y0LA 3B5TA 1G7PB 3VGGA 5GS0H 5F7HA 1A6AA 3FQNA 4MQSB 1X5HA 3BDYH 3BN9C 3E3QC 4OLZL 1S9VB 4TRPL 4OI9A 2X4SB 2R2EB 4JRXE 3RUGF 4U0RC 4Y19D 1XF3A 1QR1A 2P24A 3CFDA 3G6JF 4U0RB 4OD2A 3RWFB 3MA9L 2BRRL 5C0IB 3D25B 4NKOB 3VXRB 1I7TB 3L95B 1N59A 1YJDL 2GT9B 4PLOB 1O7SA 3LN4A 1IGJB 5BMFH 4JB9L 4KRPD 5I8OL 3TH4T 2YD9A 3UAJC 4P4KC 4GW4B 4U1HA 1WISA 2PF6A 2HRPH 4P4KB 4NJAH 1CFTA 5EU6E 3LPGA 2XV6B 3S34L 5GGQL 4ZD3L 3SE4A 1IL1B 4K2UH 3RWDB 4QRPE 5B39B 3TFKC 1KIPA 4GG8A 5I1JL 3HLAB 4LSTL 5F70A 4QY8A 5KSAD 1BJMA 3KYMA 4NN6C 5KJRL 2N1KA 1MREL 4NN6B 2XA3A 4Z78B 1NUGA 1HSAB 1L4IA 1FNSL 5ALCL 5CEYA 4L8SA 1SEBB 4LCYA 4LSRL 5KSBF 5D7LA 2AKRA 3NOIA 1MFEH 4OT1H 3KPPB 1YY9C 3I75B 3S36H 4BSWA 4HMEA 4CADA 5KSAA 3F5WB 1IGMH 3PGDA 4QOKA 5I8EB 4OLEA 5CZXD 2VWEC 2ADIA 3KS0H 4CKVX 4N0YH 1TTUA 4F15C 1WWWX 2VB5A 4XVSL 1TZGH 2OZ4L 4F15B 1RD6A 1H3UA 5CD3B 3VRJB 4K55A 2RFXA 1J0KA 5FA3B 3V5DA 4XMPL 1BBJA 4M6NH 3NCMA 4WHYH 3VFGH 1R5IB 3QDJD 4JN1H 5F9WC 3S8WA 4HH9B 4ZYKB 4RMTA 2NXYD 5FYJE 4I5BA 1D5IH 4WUUB 3A6BH 5F9WB 1I1AD 4XP9H 2IH3B 4ZFFA 3VXTB 2OR8A 1DFBL 1CS6A 3F7YB 4Z76A 5JW4R 4IHOB 2OQJA 2A77L 2HFEB 1EX0A 3KLHD 4ONGL 4HIIB 1BD2B 1U2CA 4KK8C 5FGBC 3IU3B 3UTQA 3ULVE 3QEGH 1KCVL 4J3TA 4OV5A 2XWJB 1KPRB 5ADOL 3HR5A 3GJEA 1SBSL 1I1AA 4CN6A 3SE3A 4OCYH 2FYYB 1VKXB 2OTUB 1ES0A 1XIWD 5HYJA 5D7LE 2DLGA 1R5WA 2CLRB 3OG6B 1NFKA 4F8QA 4JRYB 4EN3C 3GUTA 4QOKE 4W68A 3OWEA 4EN3B 5HPMA 3MRCA 5E95B 2X70B 3DBXB 4L4VD 1S9YB 2NXZC 3T2NL 2XQYG 5I1GL 5A2FA 4QRUA 2Z8WC 2NY7L 2NXZB 1A6TA 2BVQA 1JF1B 4V1DB 3IDYB 4NQED 2F8VA 3BEVB 1BIHA 1A9EB 3ULUC 3QCVL 1S3KL 4KKBD 2H2PD 5FGCE 1Q38A 4WGWB 3MCG1 2ZSVB 4Y7MA 4W6WB 4L4VA 3RX7A 3UTTB 1TDQA 3TM6A 5DVLA 4NFBA 3FQUB 4K3EH 3U4BH 3X13A 5IKCB 1JF6A 4ZSOA 1A7NL 5HHQA 4Y5XC 4QGYA 3MJ7A 4Y5XB 4KY1H 2YHGA 4NQXB 1M7DA 4UV7L 4F7MB 2VZVA 4QYOA 5HYJE 5CBEA 1RZKC 4UQ3A 1VEMA 4DGIL 1A4JA 4FQHB 4NJ9H 3VA6A 1QLFA 1I4FB 4PTTB 4G42A 3SDDC 1GPOL 3GJFH 2LABA 5GS2D 4JRXB 1B6DA 1OCWH 2ILLA 4XNMB 3SDDB 1S78C 3RWHA 5HYSA 5JLZB 3QO1B 4TSAL 1QFOA 5IBUG 2J4WL 3RWJA 5KOMC 1PG7H 3QZWG 5SX4H 1KENL 3I2CH 4HQQH 4U1KB 3KWWB 4PJEA 2N56A 4JG0H 3VI4E 4WI8A 4LCIH 5FYLD 3C8HA 4NO0A 4EBQH 3OSKA 4OD3H 3WXVH 2Y25A 1WEJH 3VWJD 2F19H 1MCLA 4Q0XL 4HJ0C 1QEWA 3QJHB 3ZYOA 2E9BA 3PJSB 3GRWA 2F15A 4FQJL 3KPOA 2NTFA 3QQ4A 2J8OA 4QRPB 4YDLC 2DMCA 5FKPA 4YDLB 5IHLB 1CFSB 1A0QL 3ARFA 1LDPH 5L2KB 5ID0B 3TPUA 4ZMAT 1IQWL 4ENEC 2WBWB 1A6AB 3F7PC 3B9AA 5CJXA 4L1DA 1FL5B 1H8SA 3SDYL 3UTSE 1U58A 2ENYA 5HHMD 1K6QH 5AD0A 4U6VH 5F3HA 5DJ0B 1ZWIB 3ELAT 4KQ4H 3QUZD 2BY0A 2ICEA 2V7NA 3RWEA 1I8KA 1XF3B 3S96A 3QQ9C 3SGEI 3MACL 5CUSL 4RFOH 1OWRM 4UAOB 4JDTL 3J8F7 3RY5A 5GRUH 4NOBA 5HHNB 1BZ7B 2A0LC 2ENSA 2WQRA 3QH3A 3BKYL 4G9FA 2VABA 4RNRA 4X6CA 1C1EH 3ZKQD 1F8TL 3QUZA 5F88B 4ZUWB 3FN0H 1ZA3A 3J7HA 4U1HB 1MI5D 1WZ1H 3N06B 4BZ2H 2BSSA 4YHOL 1ZHNB 4HWBL 1CFTB 4M62L 3SE4C 2G60H 5C09A 3KDMB 1KIRB 4JN2A 3FFDA 3VXSE 5DUBB 1F4XL 3SO5A 3OB0H 5C2BL 2FBOJ 1NBVL 4WW2C 4DUVA 3EDEA 2DQUH 3CSBA 4WW2B 1MJ8L 1KC5L 1ODAA 3OHXA 4MAYC 4NOFA 3ULVC 1NCBL 3KYMB 4MAYB 2VZSA 4NC0B 2HFFA 3P4OB 5C71A 1FP5A 5D1QA 1VACA 3GMRA 2WWMC 3RWIB 1MCPH 3MNZB 5AAMA 3MRQB 2BSTB 1RK0B 5IB5A 4LCCC 1WIUA 4PJHF 5D7LB 2VTFA 2C4FU 3QUKA 4R8WL 4LCCB 3IVKA 4CADB 2DQJH 2C1PA 1GZQA 3VXNA 5HYIA 2X1WL 3LVEA 3PGDB 4QGTA 4Y5VA 3WFCL 3U0WH 2EE6A 5IBLD 3D39E 4NYLA 4UNUA 1MVUB 1RY7B 3JWOC 1EA9C 1TJGL 1TIUA 1AXSA 4G9FE 1P1ZA 4X6CE 3KYKL 3MC0A 4D9RE 3P77B 3DROA 4HX1A 5EC2A 4L29B 2FZ3A 5C09E 2DB8A 5T33L 4JR9H 3ZMRA 1D9KD 2G5BB 4YHPA 3BQUC 4OGZA 2VSDA 4YO0A 1KCRH 2OQJB 3SE8H 5DLML 3BQUB 4YHKL 3N1PC 5EO0A 2FHCA 5FOBA 4PY7B 4PLJC 4C56D 5DJ2B 2J7LA 1Y18A 3GJEB 1D9KA 1G9NC 1CZ8H 5BRZA 5IB2B 3LB6D 2GSGB 3L5WA 2XKNA 1GOFA 2W91A 3Q6FA 2A73A 4R26H 2W9DH 4UV4L 1GXEA 5KTEL 5FUOL 4WFHE 1PW3A 3UZEA 2KUTA 1E28B 3S88H 1QKZL 3O9WD 5HXMA 3M45A 4X4XA 3MRCB 1XF4A 3DPBA 1NFIB 4DKDC 1AIFA 2B4CL 3GKZA 2A6KB 5K9JH 1CGXA 3MV9A 3N9GL 1A2YA 4ESKA 3F12A 1SMOA 4AG4H 4KDTC 3O9WA 1EHLL 3PF2A 2OZ4A 2F54B 2FCBA 4GW5A 5J89A 4ALAH 5EA0H 5DJDB 2LAGB 3R1GH 1YZZA 4WWKD 3HS0A 4WO4D 1IGFL 2Y5TA 4GS7C 4V2CB 3GEWB 1RIHH 1UVQA 4GS7B 4RWYH 3KLSA 3LAFA 4KQ3L 4OF3A 1ORQB 1AI1H 4R9HA 4NRZB 3D0LB 15C8L 5HHQB 4PD4J 1OQXA 4BFIB 3RTQD 3ZDYF 2ED7A 5BRZE 3REWB 4WWKA 1LO0L 3U2SA 3UTSB 3QUMB 3VCLA 3OAZK 43C9B 1ZK9A 1AFVH 1QA9A 5FB8A 1QLFB 1VFAA 3NGBC 2R8SL 3UYRH 3AUVA 3S37L 3TWCL 3NGBB 4IMKA 2P5EB 3MLXL 2FIKA 3X3FL 5E5UB 1FYTE 2EH7H 2V2XB 3QXAA 4M6OH 4K7PX 1CLZL 4JANB 3RWJB 1D5ZB 1RMFH 2GIYA 4NP4L 2PO6D 3MV9E 2QHLA 5F89A 3GSXA 2UWEB 4K94H 5DK2A 1TCRB 4GKOA 1NKRA 3MSPA 2BOBA 4BFBD 5DJXB 3MNVA 1AH1A 4K3JH 2E9JA 3F7VB 4D0BB 1MJ7H 2DQHL 4GJTB 2AJ3A 4M61B 4QRQA 1QEWB 2YZ1A 3ZHKA 25C8L 3DECA 4PP1C 4LL9A 3VXSB 2NTFB 3U7AA 2UVFA 4GOSA 1T5XB 4NWTH 1EXUA 3BT2L 4I0PC 5D8JH 1IZJA 4ODTL 3U4AA 3BP7A 4HV8B 4I0PB 5CILH 1OTTC 1XCTA 4QTHB 1CT8B 1XF5A 2Y36H 3BSZH 4ONFL 5CJXC 5DJZB 3QDMD 1A1OA 4I9WD 1B0WA 5F7LB 3DNKA 1ZEAL 2P5WA 1U58B 1A64A 2VDLL 4JPKH 4X7SL 5D7KD 3QUYD 2OM5A 2GK0A 1YN7A 5JW4N 2F53A 5LXGL 2ICEB 4LEOB 5MERA 4O2EB 3V6FB 4WI6A 3IDUA 4ODHL 3QDMA 5C0RL 1M7IB 1QFUL 4WEBL 2WINA 3MYJB 3D39B 1OP3H 1HOCB 1G9ML 4WHTA 3FT2A 3QUYA 2VABB 4PR5B 4X6CB 4ERSL 1VFBB 2KQNA 4TSCH 4I2XE 3P30L 1RVFH 2D9QB 4XP1L 3CZJA 3KPLB 4YXHH 4KZEH 1NC2B 5C09B 1JHLH 1M1SA 3CU1A 5E9DA 1EO8H 1HNGA 2RJMA 4H88H 1R3JB 3WCYA 1PJ9A 3CFCH 5TE4L 4Q9BA 4FQLH 4KRMB 1J0ZA 1KCUL 3X3GL 5C0GB 5D1QC 3KR3H 5BZWA 4LPUA 5D1QB 1F45A 1J8HD 3GMRB 4K8RH 5EDXA 3BP5A 2P5WE 3Q1SH 3DXAA 3R8BB 1D5BA 3OKKA 5DHVH 4OQ1A 2WANA 3QUKB 3L7FB 1I8MA 2F53E 2H2SD 2HT2C 2HMIC 4LLAA 1WBZB 5HHPB 2DQIL 3QDME 4ZOAA 1HEZB 4MWFA 4YNYB 3SQOH 2IAMD 4LP4A 5GSRA 3E6FB 1CTOA 3T4YA 3NIFE 1JN6A 4WU5A 2GITA 3IFNH 1F3DH 4JO1H 4Y16D 5HGGS 1M05A 2ED8A 4D3CL 3VWKA 5ACZA 1JPTH 3DROB 5EC2B 5ELIA 5DQDH 2BVUA 4G6FB 2GKIA 4XPBL 5E9DE 4IRJC 3OXSB 4OI7A 4GAJH 4MVBC 5DD0L 4ODVL 4IRJB 3DI3B 4S1RH 4QRRD 4YO0B 4HWBA 5AG8A 1ETZA 2H26B 3AS0A 4RRPA 1RUQH 1LO5A 3BO8B 4CNIA 5J9PA 3MRFB 4XNQB 2AEIT 4PJFF 2AERT 3ROLB 1I3RA 5FOBB 4XHQA 1YEFL 3B9DA 1JJUA 4NUJB 1Y18B 4M8QA 5BRZB 1CLCA 1E4KC 3L3OB 5C0IA 4QRRA 3DXAE 1OAXL 4M5YH 2JJWA 1BFOA 2NR6D 4PG9A 5DRWA 2YRLA 5FCUL 3C5SA 5T5FL 4A2LA 4OLXL 2Y06L 5TDNA 1I9RL 3PWNA 1FYTB 2DLFL 2L0DA 3T0VA 4B53A 4X4XB 5C0CA 5IF0A 1MCQA 5TFSH 3STBA 2E8YA 3ZLQC 1CL7L 2VLLA 3GSNL 4G9DA 3NACL 4GMTH 2ORBH 4WI7A 1JGUH 3MOAH 1QFWL 5D7IF 1JWMA 4I3GA 4M43H 1FRGH 1A6ZB 3CDFA 1BJ8A 5I8KL 4JM4H 1F4YL 1TZHB 2Y1VA 3SE9L 1F2XK 4LRIA 5C0AD 2Y5TB 1RZIB 4H1LA 3I02B 1UVQB 2PXYA 1LK2A 3TJHD 4YHMH 5FECB 4BK4A 3QIUC 4YDKL 3QRGH 4QWWC 1B0RA 4LRNH 3WMSA 4MSWB 3QIUB 1KTDA 2R2BB 2OL3L 3FRPG 4FFYH 5IP4A 1XF2B 5C0JA 2BMKA 3JV4A 3SKNA 2DQEL 2X4OA 3DHJA 4AM0A 3U2SB 3TH3T 3B9KD 5C0AA 3ARTA 3VCLB 3SDXF 1FGNL 3D18A 5D2LF 3IB4A 4JKLA 3W0WA 1VFAB 4NZRH 3NZ8A 1F97A 4ZFGL 2FIKB 4XZUB 4GLRI 1YYML 4LBEB 3GSWB 1QD0A 1N5AA 5C0CE 4NZTL 4FNLH 1NGXA 3NFSH 3ALPA 3AM8C 5LAXB 4XPTH 1HKLH 3BMWA 5F89B 2BDNL 4FFWD 5EZOH 4I2XB 5EBWA 1HN1A 3MNVB 4G8GD 4JY5H 5H35A 2KDGA 2BCKA 4LF3A 1KT2B 3LSOA 4KMLB 4NC1E 3O6KL 1SJHB 2YKLL 3BRFA 4MYWB 3S35X 1F6LL 3MJGX 1HE7A 5GGSA 1A5FH 2HWZL 2PYFB 4J6RH 3L9RA 4LDEB 1DBMH 1I8LC 1T04B 4GKNA 4TUKH 4U7SA 5EORH 1XCTB 2NLJB 5EUOA 1P7QA 5AAWA 5E0QA 5ETUB 2PTUA 2V2TB 3MRLB 5CP3H 4GAGH 3KPRA 1FORL 4XNUH 1RUML 3PE9A 2DLEA 1G0XA 4NBZB 1NUFA 3KYOB 4WEUD 4DN3L 2X7LA 1RZ7L 1YEHH 4M7LT 5CGYC 5DD1H 1YEGL 3RU8L 3W0WE 4E42A 4OFKA 2GK0B 5D2NC 1YN7B 1YNLL 2F53B 3BEWA 5EIVA 1KCLA 5MERB 5D2NB 4HWUA 1DQDL 5TF1L 4GQ9H 1RJZB 4L5FH 5K33A 5IQ7H 3RZCC 3I6LE 1FNEA 2LU4A 3RZCB 1U3HC 3UO1L 3FT2B 3GMQB 1U3HB 1MIMH 3A67L 2Z91A 4LLDA 4R2GD 5GGVL 3PL6C 2DMBA 3WUWA 4GRWE 2BFVL 1TZIA 4PJ7F 2BRQA 3MLVH 4F57H 1OARL 2BERA 3PL6B 5DUPH 1MNUL 1ZGLB 3VXUA 4BELD 3C08L 4MDIB 3QNXA 4PRPD 2P42B 2WBJC 2OXHA 4MNQA 4GG6B 2WBJB 2EC8A 2OXGA 3CDGA 1BZQK 1IAOA 1A6WH 4OZHB 2J1KA 1RZKH 4BH7A 3FB6B 2BSRA 4P3DB 3TO2A 1HINL 1FNHA 4PB9H 5EUOE 2BNRB 2VXQL 1YY9D 3KPRE 4PRPA 1XH3B 4I4WA 3BP5B 5ILTL 1MCOL 1QBML 3AMLA 1E6JH 2C3GA 5J13C 4YAQA 2YUZA 5J13B 2CRZA 5ISZB 2HN7A 2R39A 2O93L 1L7TL 5F96H 1JNNH 5FHAH 1UM5H 2AJYH 2Z0BA 1Q94B 5L7XH 3FQTA 4OF8A 5DC0A 5KSVA 3CFBB 3IJYA 3GSRB 5HVGB 3GMNA 4MNGE 1I7UA 2HP4A 3CFJB 2QQQA 4WUUD 4WU5B 3L3KA 1OP3K 3HFMH 2ESVD 2DQCL 4LSSL 4N0CC 4RMWA 4HLZH 1V7MH 3VFNA 1AKJD 1UB5A 1YMMD 4WTWA 3VXUE 2N4IA 1BD2D 3MZGB 3OKLA 4MNQE 3UTPD 2R1YA 5FO9A 4ISVA 2FGZA 5E2UH 5GJSH 1XR8B 3QEQA 1MHPH 4CNIB 5J9PB 2IADB 2KL6A 2XY2A 1JNJA 3HC4L 4PGCA 4PJ5D 1JGEA 1JFQH 1YMMA 1U8KA 1I3RB 2P8PB 4JRYD 3S5LG 2IGFH 5A2IH 3T0AA 3F6LA 3U4EA 3R0MA 1R24A 4PRPE 4ZAKA 1A6VH 3VFTB 5IGXL 5J6GB 3EYOA 2FR4A 3ZHDA 3I3DA 3MJ8A 4MD4A 1FZOA 4MD0A 1CDUA 4BSJA 1FIGL 2GJZA 5E7FA 4MXVF 5DRWB 3OPZL 4ZO7A 2Q87A 3GHEL 3TESA 4WIQA 2AXFA 3PWNB 4LCWB 1KBGL 4OKDA 3HUJA 5DD3H 1A7BA 5DSCA 2X6MA 2VIRB 3RIFK 5FYJH 5IF0B 5C0CB 3PUCA 4BA8A 3UZVB 4XXDB 1OGAA 1IAIL 2VLLB 1QBLL 5FXCH 4PRID 3UZQA 2RHEA 4OUUA 3WNOA 4WEMB 3ULVH 4TUJB 3S98A 3SGJC 1KGCD 3U82B 4UT6H 3VXOA 2AQ1A 3SDAD 3BD3A 5EN2A 2EH8L 3IKCA 4OLWL 2VKXA 1KJVB 2FBJH 1MJJB 1EJOL 1WAAF 2V2WA 3QEQE 2DM7A 4H1LB 5B3JF 4PRIA 1EMTH 5HHOA 2XZAL 4EVNA 1B0RB 3KLDA 3M8OL 5JIHA 3U36B 4N90E 3G08A 3ES6B 4X9HA 1DBBH 4NPYA 1RU9L 2X4NA 5C0JB 1FFOA 4GH7B 3SDAA 4GKZA 5FM5M 4DW2H 4BZ1H 1CBVH 3O4LD 4GRLC 3VFRA 3JWOH 2AEPH 4OZFG 5JDJA 3WJJC 3QULA 4MHHI 1RK1A 4GRLB 4QO1A 1MWAB 2R29L 3LKOA 4G6AC 3FO0L 4RFEB 3EOBB 3BWAA 5BS0B 2A6JB 1L0XA 3KS0J 4KHTH 4TSBH 2B1HL 1MCNA 1TCMA 4G5ZL 1U8NA 5TDPA 1OGAE 5DHYA 4I13B 3O4LA 1FDLL 5KW9L 4RA3A 4PGDB 5B4MD 1BF2A 4GRWB 4NNPL 4LF3B 4NUGH 3GSNA 4MXQC 2W9EL 5L2KD 2GI7A 4HUVB 1NAKL 4Z7VA 3FB8B 1G9NH 4Z95L 5LBSH 4ENED 4R4NC 1IGTB 5ICYA 1JMXA 1NDMA 1KJMA 3L9RB 5HHOE 1AJ7H 1J87A 4FQCL 4LSPH 4PJIB 5BVPL 2EDWA 2F5AL 4Z0XB 5DMKA 5MENE 5IHUH 2D7PA 3KPRB 4QXGH 1CGSL 1UXSB 2Q8AH 1LEKA 1HKFA 3TJEH 3IKKA 4M9PA 4NQCD 3MROA 2Q8BL 1P5UA 3GSOB 4HUXB 5ENWB 2OL3A 1TENA 3C8KA 4DKFH 2C3WA 1RV6X 4UNTA 3ARPA 5KZCD 4LSQH 2X2YA 2IJ0C 1OY3B 5D72H 2Q7YA 4XCYB 4MNGB 3RUGA 4NQCA 2HLAA 4OZIB 1DUYA 3IFOB 3G6JA 5C1MB 1H8OA 2Z91B 4CJ0A 2EDEA 3WUWB 1MHEA 1YYLL 4CVXA 3SGDI 2E27L 1XGTA 4RMRA 3GMLA 3DIFA 1KLGA 3A6CH 2I24N 3LKQB 4MAYD 3QNXB 1B6UA 3MBXH 5CWSB 3Q3GB 1I9JL 1F11A 1KB5L 1S7WA 3QUMH 5EU3A 1J5OH 2X9XA 1JNHB 2D2OA 1CDBA 1ZT4B 1ACYH 1WC7A 1X5AA 4XH2B 6FABH 3SKOA 1ACZA 4Z7WA 5SWSA 5DDHA 2ZOLA 1AR2A 3FT3A 1YMHA 1YEKL 3UJTH 4DCQB 1MCEA 3HZYA 2AVGA 2VLMD 2E6JA 1MCDA 5GS2H 5IEHB 3MXVL 4U1LA 3V52H 3OR6B 4NDMB 5IEKB 1NL0H 5KSBA 2JE8A 1ZVSA 2VH5L 1QLEH 3GRWH 4KUZH 2N7BA 2P8LA 3P0VH 2H9GB 5GS1C 3RUGE 2QADC 2CRYA 3TC9A 3ARZA 5GS1B 1A7RH 3G6JE 2QADB 3BQUD 2C3VB 1PSKL 5SWZB 1D5XB 4NZUH 4PS4H 4M03A 2F5BH 2X09A 4X9BA 4CMMB 2B1AL 2MKLC 1KTRL 3GKWL 3FO2A 5FO9B 4ISVB 3EO9H 3GMOA 3SJVD 3QEQB 3THMH 3TYFB 1PKQA 1XGPA 4Q9QH 2AJZB 3O41B 1T0MA 4OJFL 1YEEH 2P49B 5SWSE 5JW5B 4XCEB 1R24B 4XPAL 2VXUH 3O45A 1FIEA 3EYOB 4K9EL 3MJ8B 4M1GL 4MD4B 4MD0B 5TQ2H 5KANI 4FZEL 1DLHA 5DC4B 1GCFA 4KI5C 2O5XL 3OQ3B 4J3XA 3BZEB 3NCYP 3CD4A 4KAQL 1S5HA 3H3PH 4OIIL 2AXFB 4UINL 3STZB 3G5ZA 5KSBE 5DSCB 4P0DA 4IDJH 5D5MF 4QT5B 4XWGH 2XPGA 4ZUVA 3TZVC 3LEVL 2KZWA 4TPRL 3TZVB 5F71A 2R0WH 2AS5M 4BUHA 1U8MB 1NFDF 3RNQA 1FN4A 4LU5H 4OZFB 1AD9B 5TH2B 2AJSL 3LIZL 2R4SL 1PQZA 3I3BA 3ULSB 3AB0C 3UJIL 2G75A 1JRHH 3CVHB 3B83A 3VXOB 4MA7H 3AB0B 4JFOA 1CDHA 3EFDH 4JFQA 1PG7X 4WJ5A 4NKDA 3IDMB 1PKQE 2OR9L 1MCSA 2D31A 3S4SG 1DDHB 2FGWL 1WZLA 4EVNB 1T1XB 4FTVA 3G08B 1JTTA 3PDOA 2Z8RA 1YNKL 4OLZH 5MENB 2P5ED 3LKSB 4HSQA 4YWGL 1FFOB 2AI0L 4TRPH 2VQ1A 3QWRD 1V3MA 4UBDD 3P0GB 3RRQA 4H0IA 3FN3A 3H7LA 2ZG1A 3MA9H 3BI9X 2BRRH 1FPTL 1YJDH 1I9EA 2DDQL 1ZHKA 5GXBB 4U1GC 4AY0A 4JB9H 3WFDL 4BUGA 4U1GB 4U2YA 2EZ0C 1FFRA 5TDPB 3IDNA 5DHYB 5JMOC 3NCJL 1XT5A 3PIQA 3S34H 5GGQH 4ZD3H 4HIEA 1IGCL 3W9EA 1TJIL 1QRKA 3AXLA 1P69B 4TVPL 3MCKA 3T77A 5I1JH 2J12B 1G7QB 4LSTH 4IS6A 3JBG7 3JUZA 2APWA 3DUSB 3QNZA 5ICYB 5JOPE 5KJRH 3CSYA 4M6ML 1MREH 1KJMB 1O7VA 1JTPA 1J0YA 1FNSH 1Z5LB 5ALCH 5E2VL 1PVHA 1I1YA 4LSRH 2R0ZL 4C83B 4FTVE 3KYNA 3FHQA 1K8DA 5DMKB 1JGDA 5F6HI 3UPRB 4KJWD 1KNOB 2Y6SD 5CKAA 1VA9A 2R15A 5KS9F 2EE9A 4AEHL 3RIFF 3C8KB 1BOYA 1CICD 3EDKA 3LRHA 4XVSH 5GIRB 2OZ4H 3G5YA 2DIJA 1VGEL 5DJ8B 4KROC 4XMPH 2UUDK 3RUGB 4KROB 2HLAB 8FABB 1Q9WA 5IQ9A 1I1FA 5IHZA 3G6JB 4KK5C 5MHSE 5KVMC 4ZXBC 2QQNL 1CICA 4P5MB 1IILE 3TBWB 1QSEB 1XGTB 2VDNH 4KK9C 1EZVY 4ZXBB 1DFBH 3RDTD 3GMLB 4ODSL 1DUZA 3V6BR 3ZKMD 1KLGB 4MLIA 2A77H 1JWSA 4FA8A 3QDGA 5F1IB 4ONGH 1S7SA 4P5TC 2EEDA 3GGWB 1SY6L 4Z7UB 1KCVH 4P5TB 4Y8DC 3ZE2E 5ADOH 1PYWB 1SBSH 1WC7B 3VDAA 4KV5F 3VD4A 3RDTA 1PGRB 5F72S 1BPVA 1RZJL 4GMSL 5SWSB 5DDHB 1JUFB 5MEPA 2HMID 1BFSA 2PYED 1IGIL 4XPFL 2FX9L 5C6PB 1Q9LA 2NY0C 2HJFB 3QWQB 3RPIA 5BOZG 3DSFL 4F7CA 2NY0B 1X7QB 3BHBA 5E4EC 3T2NH 5I1GH 5KSBB 1XZ0A 1PLGL 4I0KA 3DVIA 2NY7H 4PJHA 3VGHA 5E4EB 1C8PA 2WUCL 3W82A 4G6FD 2PYEA 4ACPA 4FG6C 3QCVH 1S3KH 1PD6A 1U8HB 4JZNA 2XG5A 4MVBD 1XFPA 2V17L 1T03L 1EFXD 1VFOA 4X6DF 3IFLL 1AE6L 1WVZA 5HTSA 1RJYA 2VZ1A 4X4YA 3QDGE 5CBAA 4CN4A 1A7NH 3FO2B 1J12A 5I66A 1DE4B 3GMOB 1B0GA 2X41A 5K9KA 5I1IL 2X1PA 5HJ3A 1E4WL 1EFXA 1KB5A 3BAEL 1UWEH 4UV7H 2AEQL 1T7WA 4DGIH 2M1KA 1FGVL 3INUL 5MP6L 3P11L 4M4PA 4FQ1L 3X12A 1GPOH 2Z92A 4G6KL 4XXCA 4E0RB 1ZE3C 2HVJA 1DLHB 3C6SB 4UQ2A 2R1XA 1UKTA 4EQ3A 4TSAH 5FOJA 3D0VB 1NLDL 1S5HB 5H94A 4HUWA 3QDHA 1D6VL 1UKSA 1KENH 1WBYA 4FXLA 1RHFA 3STLB 4PJHE 3RWCB 3H9HA 3KVQA 2VDML 2XPGB 2BVPA 2PW1B 3FOMA 3IGAA 1ONQA 5FO8B 4F9PA 4PBVC 2D7QA 4Q0XH 4FMKA 4X6EA 2VDQL 1WWBX 4MQXC 1SVCP 4MHHG 3WLWC 4OFDA 4WFED 5C3LD 2XI9A 4FQJH 3L6FA 2HKFL 4I0CC 5I73C 1F4HA 3LEXA 5GRWA 4DOHE 3C5JB 4H8WL 2G75B 5I73B 1UB6B 4QRTB 5F7NC 1EIBA 1A0QH 3V5KA 4QWWD 1Z9MA 5JNYB 1A14H 1Z0MA 3C60D 4MJ2A 1CCZA 1IQWH 4HAFA 4M48L 3WDJA 1FNGB 4TULL 3Q0HA 4XAKE 2D31B 4LP5A 3U1SL 5HVWA 3SDYH 2VISA 1GOHA 4FTVB 3RI5K 3NFNA 3PDOB 5EULV 2DKMA 1TVBB 2CKNA 1OM3L 3C60A 3VFWB 3O8XC 2Z93B 1OAKL 5ITBL 3MACH 3T8XA 5CUSH 1FFPB 2EDXA 4GBXD 3O8XB 5L88L 3RVVD 4JDTH 3VE0B 1CLOL 4RWHA 4ELMF 1AGBB 3BDBA 4JPIB 1RAMA 1G6RB 5KAQF 3BKYH 4NQSA 3WS3A 2MQ3A 4PJBF 1F8TH 1UYWL 1ZS8B 1JI1A 5IBTL 4YHOH 4HWBH 4GBXA 4P48A 1OB1B 1OHQA 5LWYL 2MHAA 4N0RA 4YPGA 12E8L 1C16A 1F4XH 2KKQA 3WKML 4LPTA 5C2BH 1NBVH 3HE6C 3TV3L 2GSIA 4BQCA 4CJ1A 3L3DB 1MJ8H 1A7OL 1KC5H 4CN1A 1JWUB 1NCBH 3HE6B 1HCVA 4EI5A 2R23B 1U41A 2ZCKL 1AGEB 2XN9A 3NCEB 2JTDA 1C5CL 4KTDH 4JEGB 2M26A 3MLUL 2GUOA 4HPOL 5D96C 5SX5H 2NY2C 3PWVB 5CGYD 5ECJE 1UJ3A 4NQVB 4CMHC 2EYRB 2APVA 5D96B 4KI1A 4NHCL 4R8WH 4HULB 2AK4D 4CMHB 1KLUA 2YPVL 4M02A 3QIBC 1DVFD 3MGTA 4G3YL 4XRCB 3QIBB 3RZCD 3WFCH 2ARWA 4KKLD 3ZDYE 1IT9L 4N8VA 3QDAA 1U3HD 3TIEA 5EUKA 1G6VK 1TJGH 4JFFA 5DZOA 4DTGH 4G8FA 5FAAA 3G5YB 1BZ9B 4DEPC 3KYKH 3PL6D 2AK4A 5JO5B 5DMYA 5I15L 2R9HD 1LILA 3LN5B 3MLZL 4DEPB 1OAYL 2EKSB 3OX8A 3ZL4L 2OX5A 4TVPD 2IEPA 4OCSL 3NBNA 4V2BA 5IQ9B 4H1LH 1I1FB 5IHZB 5T33H 3JV6B 3Q2CA 1X5IA 3QO0A 1FJ1A 3DV4B 3LOWA 2QKIA 2J88L 5F7UA 1MQKL 3HMWL 2FDBP 2ZNXA 2I9LB 3K80A 3MODL 1DUZB 5DLMH 5C0NC 4OZGF 5JHDA 2BNRD 4OUOA 3QDGB 1IM9B 1II4E 3TN0A 1F3JA 1S7TA 4KUCF 3HNVL 2XN9E 1AD0A 2CKBB 1W72B 2QV2A 5JXAL 3IJSB 3ZTJH 4HDIA 2EICA 1HI6B 4GXUM 4XPHL 4G7YH 4BQ6A 5ISZD 3ILPA 2FO4A 5DVKA 1ORSB 1WBXA 2EC9U 5KTEH 4MA3A 5FUOH 2DJUA 2IH1A 1KSRA 1TETL 4DN4L 1QLRA 4PRNA 1QKZH 1Q9LB 3KNBA 4HS3B 2SEBB 3RPIB 8CGTA 1AGFB 2YUVA 4LHUA 4GRWH 1JZ4A 4KK6D 3BUYA 5I0ZA 4JFFE 2B4CH 5IK3A 4P2RB 2HTKD 4NNYB 4PJHB 3MRGB 3RY6A 1FBIL 4HF5L 4JKPL 4DVRL 4LGSB 3OKMA 4PRAB 5FF6A 1G7IA 1EHLH 5KANG 4R90L 3WBDA 2XA8L 3BP6B 2K3TA 5HD8D 4POZC 1IVLA 1J86A 3IS0X 5DFVC 1AO7A 1IGFH 5JHDE 1MCFA 1JZ5A 1T83A 4KQ3H 3WJLA 4TVPE 15C8H 2YPKB 4L4TE 2P47B 1BVLA 3QQNA 5IJVB 2BY1A 4Y4HD 5K9KB 3BPLC 4HBCL 1GC1C 5E8PA 1NCDL 4PV9B 3BPLB 1E4XL 2XZQL 1U3ZA 1LO0H 1P6AB 4OI8A 2E7HA 4GSDL 1SY6A 4LCWD 1HXMA 4XXCC 2R8SH 3S37H 1Y6MR 4PJFA 5IB3A 3QNYA 1OD9A 3MLXH 4OTXL 3X3FH 5E2WL 3DMMA 5FIEA 2ZPKH 1CLZH 2NZIA 1WQVT 3L3GB 2Z31A 1T22A 1WBYB 4YZFF 3TA3A 5D1ZD 1V05A 4HXBL 5MEOA 3H9HB 5B3NA 3PABA 2BVPB 3T0WA 2ZNWA 3FRPA 4B0MM 2DQHH 3MR9A 4GRMB 1UFUA 3IJHB 3JWDL 25C8H 4YDVB 1JHTA 3DV6B 4JO3L 3L6FB 5D1ZA 3H9SD 1AO7E 3GIZL 4X7TB 3T1FB 4JZJC 1X5FA 3BT2H 2A83B 4JZJB 4ODTH 1T80A 4FXGA 2XTJC 5JQ6L 5GGRA 4ONFH 1N5YL 3ZE1F 2XTJB 5D7SL 1ZEAH 2EIBA 4HZAA 3BH8A 4GRLD 3H9SA 4MQ7A 2NY1C 2VDLH 3NFNB 4X7SH 1GGIL 1ZHLB 1FFQA 4HJGA 2NY1B 3GBNH 1NH6A 5BS0D 4PTUA 5LXGH 2ZJSL 4PJFE 3ILQD 5DJCA 2F74A 5DYOA 3BH9A 1MFCL 1RZGA 3G6DL 3QEHA 3N85L 5C0RH 3VRIB 2VYRE 5GISL 5HPOA 4LNRA 1QFUH 4WEBH 1QRNB 2R56L 1P9MA 3MRBB 4OQTL 5L9DL 1G9MH 3CGTA 4U05A 5JZ7D 3SDXA 5HYQA 1OAZL 2FHFA 3WS3B 4ERSH 1MLBB 4QHNB 3W9DA 4X7EC 4MXQD 3IF1A 1AHWA 2XWBA 2MNUA 5FDYA 2VLJD 4YPGB 1YY8B 1JF5A 1C16B 1T66D 1CG9A 5INCB 5EZLA 4QLRA 3RBSA 4XAWL 4WHCA 1A6PA 5TE4H 2GJJA 4EI5C 1AQKL 2XFXB 5CJOL 5D7IE 3C6LA 4EI5B 3GM8A 3PHQA 1KCUH 3M1BB 2OBGA 1KN2L 5EC1A 2X9WA 4Y2DD 2V5TA 5ESQB 5BQ7B 1K85A 5C08B 2GUOB 5IJKC 1IC4L 1NGYA 2EKJA 1CK0L 3R06B 4QNPF 3T2PA 5T1KA 2ZCLL 3C09C 3H9YA 2VXSL 4MS8D 4PJEF 3MV8B 3MGTB 3C09B 5ICZA 5B38A 3FMGL 2DQIH 4XCCL 4HKXB 4N8VB 1P7KA 3BN3B 5EUKB 3TIEB 3W11C 5GZNC 4JFFB 3ARGC 3SDXE 1LQSR 3QCUL 4OZ4A 2I60L 3ARGB 1J1OL 4D3CH 3PWJB 1QBBA 3FO1A 1H0DB 3MV01 3SPVA 1KEGL 3QUXD 3KPSB 4XPBH 1FJ1B 1NCTA 4YEFA 1MPAL 1SYVA 1K5NA 1U8OA 4ODVH 2QKIB 5DD0H 4L8CA 4HIXL 5DRXB 4BZYA 5JHDB 1JPST 2QHRL 5EIIA 2FLBT 2D7TL 3O3DA 3TN0C 3D6GA 3HZMA 3MA7A 4PJ7A 3VXQB 3RVTC 3TN0B 2GJ6B 1MF2L 1F3JB 4L4TB 1YEFH 3QUXA 1AD0B 3RI5F 2GCYA 3MRIB 1OTSC 3D2UA 2ZZUT 4KVNL 5FO7A 1OVZA 1J10A 1SBBA 5CSZB 5JPMA 3P0YL 2ZP0T 4F9LA 1OAXH 3U83A 3BDXA 3WO4C 2CGRL 4JDVA 3WO4B 5T5FH 2Y06H 5T1LB 4WU7B 1I9RH 5GRVL 4G8EA 4PRNB 2L4OA 4K23L 2DLFH 2IPTL 3AMKA 5K9OA 4LLYB 4U31A 1CE6A 4LHUB 3CVIL 4IOFD 1X9QA 5I1KL 2QR0A 4P2QE 5T1MB 3RY6C 2YR3A 1CL7H 3GSNH 1Q0XL 2DQTL 3OMZA 3NACH 1V3LA 4WHYG 2VDPL 3HMXL 5SWZD 5D1XD 1QFWH 1F6AB 3HB3C 4JRWA 4OM0L 1ZLUK 1MRDL 2EIZB 3MRNA 2IALB 4S1DD 2X4TA 4LVOC 2X89D 3D9AL 5KVDL 5I1LB 1NGZB 1EVTC 3WLBA 3O0RL 4LVOB 1UT9A 5I8KH 1D5MA 4M1CD 5IB4A 1PG7W 1X5KA 1Q1JL 2HKHL 3MRHA 4J4PD 3SE9H 1RFDL 5HI5C 4TOYH 4KKAC 1AO7B 1DEEA 3QFJD 3SY0A 3WJLC 5D1XA 3RVXD 2P43B 3ZKSD 1U8QB 3ROOA 5GRZA 4PJ7E 3SDCD 4YDKH 5HHVL 1TLKA 2AABL 4Y4KA 5EU4B 2RAMA 1BEYH 3VJ6B 1A3LL 2OL3H 2G2RB 1PX3A 2CUHA 4J4PA 4D9LL 2WNGA 3GHBL 4JJ5B 4Q97A 4OSUH 1QNZL 4ZO9A 3T4AB 1MAML 5C6WH 2XWTA 2FLRT 4LASL 4KI5D 2C1OB 1ZT1B 1FGNH 2ICCA 4X5WA 1CFQA 3QWOA 4PJFB 4FQQA 2BVTA 2Q3AA 3DMMC 5SV4A 4ZFGH 3SBWA 4H20H 4HKZA 5EOCJ 2B2XL 2G9HB 5GGRY 3TZVD 1W0WA 3TEUA 4NZTH 1WTLA 1GZPA 3BIAX 1HSBA 4FP8L 4MNHA 2BDNH 3K46A 3WKNA 5CHNB 2WAHA 3ET9F 2EXYC 4L8BA 3B3IB 3V95A 1X5ZA 4R96B 4I77L 1UEMA 3O6KH 2NY4C 4QXTB 2YKLH 3WD5L 2WP3O 3QPXL 5FYKU 1PZ5A 2NY4B 5E8OB 1FFNB 2HJKA 2QBWA 2VXVL 2BNUA 2VR9A 1EEQA 4BYHA 2ICWI 2HWZH 4JM2B 3B2UC 3T0ED 3DVNA 4DKEL 1IAKB 1VB9A 5F3BA 4CDHA 4HWEL 5D7IB 4LGPB 5AYUL 1KJ3L 4FXGB 1QQDB 3EGSA 3CIQA 4R3SB 2NY6C 3UXFA 1FORH 5ESAA 1MOEA 1RUMH 1WT5A 2NY6B 3LHPL 2ADGA 1JYNA 4MDJB 1I3UA 1EUTA 1WAAA 1RZ7H 3T0EA 4HJGB 1YEGH 3RU8H 3QPQD 1F5WA 4G43A 1QVOA 5JUEL 4WTZA 1YNLH 4LLMB 1X44A 4U1IA 5DYOB 1DQDH 4XI5C 5TF1H 3GDBA 3QEHB 4ORGA 1P4LB 4EIZC 2EYTB 2YPLE 2YD2A 3ZKND 3HR6A 3O11B 1IGYA 2BVEA 4J12A 3CH1B 3VXME 2EYSA 3UO1H 4JGMA 2I07B 4ODXB 4MXVE 3SDXB 1N7ML 3A67H 5ESVA 5D2LB 2IPUK 2QSCL 5GGVH 3Q48A 2BFVH 5FM5O 1AHWC 1MNUH 2E7LC 1NBQA 4Z6AT 1AHWB 3C08H 1CIUA 4RMQA 4X83A 2PTTB 4U3CA 3VG9C 3UJJL 4R7NA 4S1QH 2VITB 4QF1A 3VFMB 3K3QA 2ATKB 5F9DC 3FQRA 3C6LC 5DRZA 3K1KC 4KKCC 4L3EA 2YK1L 3C6LB 4AK1A 5DI8A 4QHMB 2VZOA 1HINH 4XMLL 5JA9A 2VXQH 3NN8A 2NX5E 3F62A 2NW3B 4RGNE 3RVUC 3JTTA 2MQ0A 4HZLA 5E6ZA 1VGKB 1MCOH 1QBMH 4U6HA 3CFIC 4CL7A 1DN0B 2GYSA 1WAAE 4OM1L 1NGYB 4F58L 5CMAA 3TYGL 5T1KB 5EOTA 4EIGB 2VXTH 2DI8A 3MLRL 5IW6B 3ARUA 5BV7L 2L7JA 3NABL 1ZMYA 5DXWA 5DEZA 1AP2A 1QHOA 3P9MA 2YXMA 4UT7L 1CGYA 2P7TA 4F33A 3H0TA 1ZVHA 1P7KB 3EIFA 3QIWA 4ELKA 4P2QB 4KK5D 1GGBL 3EFFB 1U8JB 4I1NB 3SCMD 1QSED 4ZXBD 3QXTA 2DQCH 4LSSH 3MRDA 1IEBB 5C0EA 1QSVA 1YECL 3WXWL 1CXLA 3FO1B 4OQTA 4KXZH 1AXIB 1N64L 2DF3A 5E00A 2DYPB 3P9LB 4HW6A 4OGAC 4XGZB 4P5TD 2IBBA 1K5NB 1JHKL 3VMNA 1NGPL 4OFPA 2IMMA 4PBXA 4L3EE 5IV2A 1FLRL 4NRXB 4HK3N 4PJ7B 2RBLA 4R4BA 4O2FB 1RZFL 1BQLL 3M17A 4U1JB 3SOBL 4NCDA 2W38A 1MIEL 4Z7OF 5IGXH 3C9NA 4JPVL 1I3GL 2NY3C 4F9LC 4IRSA 5FO7B 2NY0D 2NY3B 1G6RH 5TPWL 1FIGH 5EO9B 4CRPA 1OF2A 4PP2A 1X5JA 5TF0A 2ARJB 4ZOBA 1KG0A 3QISA 4IM8A 3D85D 1KBGH 5K9OB 4N8CL 1CE6B 3JZ7A 4TYUA 5IVOA 4Y4FC 1IAIH 4N9OB 4Y4FB 1EAPA 1T6WA 4XC1H 1QBLH 1A47A 4YX2L 4U1SA 2BVOB 3QR2A 2P45B 3MRNB 4X5LA 4X6BB 1G7JB 3SKMA 5E7BA 1GL4B 4P99A 4ZTOH 2J8UF 3CNKA 1MHHA 3CXHJ 1D5MB 1WSST 1CGTA 4F2MA 2EH8H 4OLWH 3MMEB 2X4QA 4AH2B 1EJOH 4X80L 1DEEB 2EECA 3SY0B 3L7EA 5DVMA 5DURB 1HYRC 2XZAH 4AMKL 1ZGLM 1BAFL 3M8OH 1MY5A 2Z35A 2O61B 2FECI 1RU9H 2JCCA 5IW3A 1REIA 5TGBB 1B88A 3BZDA 1BIIB 2A1WL 4YBLC 5ID1B 1VERA 4X5WB 5C8JB 2X4PB 4XVTL 4YBLB 3ZT6A 3SBWC 1S7RA 2R29H 3FCTB 4FQQB 3FO0H 4YHNB 4S2SA 1G0YR 5JW4M 3ARYA 2B1HH 3BPCA 2YPLB 4K7FA 2JIXA 4G5ZH 3K8KA 3CFKB 1GZPB 3IETB 3VXMB 4R0LA 5D93C 1FDLH 5HGDB 5KW9H 4QXWA 2W92A 1GAFL 3RNKA 5D93B 1R3IL 3C2AL 4NNPH 1EEYA 4L9LB 3E2HC 1KPUA 4XNYH 3MTRA 3PGCA 2IFFL 3E2HB 2W9EH 3V7AE 3HMXA 4P59L 1NAKH 4ZFZA 5J1AB 1KFAL 4Z95H 1NDGB 1CD0A 3LN9A 2YSSA 5F3BB 3C5ZD 3EO0B 1H5BC 3GSUA 1YUHA 4FQCH 4RGNC 1DQQB 3BZ4B 2F5AH 2ITCB 2KZ1B 2NX5B 1H5BB 4RGNB 1S9KC 1HYSC 5GJTL 5ESAB 2JCCE 1CGSH 1LHZA 5IMLA 3G5VB 2KH2B 3O8XD 4JLRA 1CQKA 2AP2A 2Q8BH 3P73A 4XPGL 4G43B 5EO1B 1QVOB 2IBGA 3G04A 1N2RA 1NANH 2ICES 2CLVA 1QACA 1X4YA 5IVZA 1P84K 4ORGB 3DUHA 1CVSC 4F7TB 2CDFB 1GGCL 2OMBA 4D8PB 1IGYB 2FEEL 3N1FC 2EYSB 3MRKB 5C6TL 1OGTB 4H0GA 4WV1A 5ESVB 3QFDA 4EUPA 1T21B 2HT3C 1LP9A 3MOQA 1YYLH 3KPNA 3FQXB 4MMXC 2E27H 3HE6D 2YMXL 3EYVA 5D5ME 2A74A 3D3VE 4WRLA 5L0QC 1I9JH 3BKJL 3BW9A 1KB5H 3U46A 1GC1H 2DQDL 5L0QB 3JWDC 4ZUTB 4FHBD 2W0FB 5IWLC 2Z4QA 1VCAA 5AUMB 3WYRA 5C0DB 2KPNA 3ZO0A 5KSUB 1T5WB 3NAAL 3NN8B 2H3NB 1NEUA 2ZUTA 4Y88A 1F6FB 5INDB 2UY6A 4J3OC 4C57C 4Z0BL 5ITFA 5T3ZL 3JTTB 4JZOA 1YQVL 5D70L 3L5XL 4Z7NF 2EXWC 5FCSH 1YEKH 5DEGA 1R0AL 5DUML 3OJDA 5EOTB 3ESVF 1LD9A 5E5MB 4M3JA 2HVKB 4Y2OA 2VH5H 3QIWC 2FD6L 3BIKB 4HWNA 4Z9KB 4JFHD 4LLQA 3U0PB 1KPVB 1CXKA 1HWHB 4JDZB 2XZZA 2FJGB 1LP9E 1JNLL 4P2OD 5C0EB 1JBJA 3KJ6L 1KV3A 1PSKH 5D7JC 5IROC 5C0ND 2HJLB 5I8CB 5D7JB 4YGVB 4HGWB 5EUOF 2B1AH 4S0SD 3DO3A 3GKWH 4PJ8C 1SJXA 2FJFA 4WI5A 4PJ8B 4X8JB 4UT9L 2D0FA 2A6DA 2R4RL 5H2BA 3AVEA 3T3PF 2WIIB 3EHBC 2DS4A 4JFXA 4XVUC 4OJFH 1JGLL 1I8IA 3UTZB 3O3AB 1VFUA 2EDHA 1SJEB 4IRSC 5LGJA 1J0HA 4FXKB 3PWPE 4K9EH 1EK3A 4IRSB 2CQVA 4WENB 4M1GH 3V2AR 5ANMB 2DLTA 4FZEH 5H8DA 4NC2B 1OF2B 2OTWB 4P2RD 4P3CL 2O5XH 1FQ9C 4BKLA 5HY9A 2QSVA 4IOIA 4KAQH 4J3WA 1IQDA 3BP4B 4OIIH 1NBYB 2LE9A 3HAEA 4KTYA 2XIDA 4UINH 1HWGB 1XGUA 2NNAB 4EI6A 4DGVL 5C7XL 4P46A 3QYCA 4OBSA 1KTLA 5JTWA 3VFPA 3LEVH 4OLYH 4TPRH 4YJZL 3E6HA 3VRLE 4L9DA 4PV8B 5HDQL 4HLJA 4POZD 4NM8L 3QQ3A 4U1SB 1CXHA 1A1MB 3WFHA 2AJSH 3LIZH 3PWLB 2R4SH 3OR7B 2YXFA 2F58L 1HH9B 3QHFL 3UJIH 2FATL 1N6QL 2B0SL 4QHUA 3MV7D 3UP1A 2FO1A 2X4UB 5E99L 2BNQA 4I18C 4F2MB 1INEL 4HC1L 2CLZA 3V4VH 4DK6A 5IM7A 4I18B 2ATPB 1H3VA 1NEZA 4UNVA 3AC0A 4XBGA 4PY8J 2ZKHL 2OR9H 4ZO8A 1WCBA 4NO3A 2IAND 2X4RA 3X11B 3TIDA 5EBMB 2FGWH 3MOBL 5HGBA 2BOCA 3V4UL 4X6DA 5F8RC 1YNKH 2WP3T 3MREA 2HT4D 4WDIA 4YWGH 2AI0H 3MV7A 4P4RA 4YE4L 1X5XA 3GNML 1HHHA 1TQBB 5EZJA 5I17B 4JHZA 4PJGA 1FPTH 2IANA 5HI4C 3BDYL