2CUMA

The solution structure of the 33rd fibronectin type iii domain of human tenascin-x
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
105
structure length
105
Chain Sequence
GSSGSSGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Tenascin-X
total genus 6
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2005-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cumA00
5DJAB 3ES6B 1YEFL 5HJ3A 4U6VH 4FA8A 4U6VL 1QP1A 4HQQL 1PBYA 4KJYB 4YIQA 5GS0L 4OIIL 4QGTA 1KJ3L 1DBMH 3LHPL 3MRMA 5DDHB 3DX8B 1EEYB 2EICA 1T7ZA 1MPAL 1S7TA 2HP4A 2VLRE 3BKJL 4KKCD 1FDLH 5JQ6L 4QRSB 1QLRA 1UC6A 1N26A 1C5CL 4KXZI 1ETZA 4XPGL 1EJOL 2MHAA 4XPAL 5D1XC 5HPMA 5KAQG 5ADPL 2BVEA 1OAQL 4PJ9A 1LDPL 4NQTA 4X6EA 3MLUL 4L8SC 1A02N 3T8XB 4S1DC 3E6FA 5IR1A 5ISZE 2Q1EA 1RIVH 5TDNB 3H7BA 3CVHB 2R4RH 3K4ZA 1DQQA 1EV2E 2ZUYA 4I77H 3EW3B 3IDGA 4JFHE 4XP1H 3EJJX 2DLFL 1ZTXH 4OCSH 3VXSE 4OCSL 5HDOA 2OL3B 3L3GA 3QNZB 3ILPB 4LSSH 5INDA 1JCKA 3NTCL 5C0CB 4JGJA 5E8DL 4M93C 4LSQH 4RQQB 5IMLA 5I2IB 4GKNA 4Z77A 3D2UD 4JPWH 4NKIH 1A1NB 3TCXA 4BH8A 4ELKB 4NQUA 4P2OD 1KGCE 3VWKA 3MO1A 5BS0B 1OT2A 3NOIA 5JR1L 3IU3A 5L8LB 3S3JA 4HHAA 4ELMA 4JN1L 3PWUB 2O5XH 4G7YL 4R8WH 5IT2L 4HKJB 1PGRB 3HAEG 4IDLA 3QIBD 1KN2H 5FB8A 2ZUSA 3B6SB 3AROA 1MCCA 1S7SA 3B9VA 3VMPA 4GO6B 4ZFZB 1HHIB 4H20L 4F7CB 5EN2B 1RVFL 4NQEB 4GG8A 5D4QA 5ICZA 3ARTA 3RVWD 4P48A 2VITA 3RWEB 4EOWL 2VL5B 3ISWA 1SYSB 4O2EB 4R3SA 5DD1H 3CLEL 1YZZA 4ZSOA 5IR1B 2CGRL 3MODH 5CD5D 3LEYL 5LGJB 4LIQE 4JY5L 3LKRB 1EGJL 3GJFB 5KANI 1BJMA 1T20B 5DFWH 4RDQG 4FN0A 4GW5B 3X14A 9CGTA 2A6DB 4KAQL 1IC7L 5F96H 4KJYA 4OZHB 4M7LT 3QIWC 5CJOH 5DZLA 4G3YL 5F1OB 3JSSA 3CDYA 1LE5A 3KHOA 3QXDA 4NZDA 1S7QA 1GGIH 4E41E 1MHCB 4P5MA 1A4KB 3EHBC 2VDQL 5BMFH 1MIML 1TCRB 5A16A 4LEXH 3VFGH 4UOW1 4RGMB 3WXVL 4LLQB 5JNYB 3GKWL 1RI8A 3GB7A 1WJ3A 4C57C 5GZNC 4X6CA 1K9TA 4V1DE 4PBWD 5D7SL 2NY0C 4G6MH 2R23A 5CAYB 1R3LA 1WWCA 3NGBC 4JM2F 2AEPH 4F2MB 1O7VA 3ROOA 3FN9A 3G5YB 1QG3A 2UUDK 3WS3A 4CRPA 4XNZC 2VDNL 1IGYB 1P53A 1IEBA 5D7IF 4OLZH 1Q9KA 3S98A 3FOMA 1Z0NA 3QFDA 1I9EA 2F53E 1BX2B 4PYGA 1CXEA 3EDJA 4ZYKA 3VXQB 3LEVH 1INDH 1MY7A 1YEGL 1KLGA 1Y6KR 1ZLWH 5D93C 3GMMB 3K4DA 5DHVH 2HWZH 4NGHL 1CDUA 1DLHA 4K7PX 4Z76A 2DM4A 4KQ4L 4ZQKA 1JFQL 5TE7L 4JO1H 5DK2A 3LH2L 1K85A 4UDUB 5IB2A 4PRHB 4JFPB 2XG4A 3OKKB 3UTTE 1YEHL 5E9DA 2J6EH 2QSVA 1NGWB 1FE8L 2G75A 5BVJB 4JREC 1KLUB 4X8JB 5KG9B 2P7TB 1IQDB 3MCKA 3PV6B 3U1SH 4M43H 3R06B 5JORA 3B9AA 3GBLA 3GSQA 1BPVA 5D1QB 3IJSB 2ITDB 1I1AC 3VFMB 5GS1A 1S7TB 2WWMC 4NO0B 4XCNA 4TOYH 5D72H 5DMGC 4G6AC 3OGCB 1KOAA 1XF5B 4XCCH 1YMME 4WWKB 4L8CA 4XX1E 1WZ1L 3RQ3A 3UTSE 4HKXB 3MBEB 4YFEA 3QCTL 1NJ9B 2X4SA 2BVYA 3LEXB 2J8UF 3SCMD 5LXGH 1UQSB 2DQHL 3WHXA 4BFIA 4HKBA 4JRYD 1NCTA 3F62A 4X7FC 2AKRA 2Z31A 4L29B 3UCRA 2XOTA 1E28A 4I3SH 4XTRC 1YYLL 1MREH 3UTTD 1V7ML 4KUZL 1CFNA 1PX3A 3ULUL 2AV7A 2HVJA 3H9SB 1BOGB 4LBEB 1J0ZA 3TBVB 3T0BA 3WEXA 1JTPA 4ENEC 3HAEH 4M1GH 3BX7C 4OCXH 5SWZB 4XNUL 5AEAA 5DUML 4I8DA 3ARGC 3FJTA 1VFOA 2XTJB 4H0HB 4OLVH 2FSEB 3ZE0E 4R7NB 5GGUB 2NXZB 4HX1B 1ZA6B 4TSBH 4LCIH 1D9KB 2X4UA 3RWGB 1HZHH 3CZJA 4QYOA 2XYCA 4LLMB 5IGXH 3ARGA 4X5WA 3J8F7 1GC1L 2X1PA 5HYSG 5DK2B 5BZDB 2XA8L 2Q3ZA 5DQ9B 3SKUD 1QSFD 3MV8B 4G6KH 4G6KL 4HH8A 3L7EA 4P9MH 4RA3A 2Z8RA 2FJGA 4S11A 4JFXB 3RI5F 3RHWF 2EH8H 2DL2A 1D7FA 1ZT1A 3WS6C 1K6QH 3ARVA 3FQXB 4P57B 4XPBL 2A6IA 2GJ6A 3CH1A 1J1PL 1CGXA 1KJ2B 3B9KA 2UYLA 4OF8A 4LSPH 1XGUA 5CBEB 3ZE1F 1SY6H 3WLBB 1BFSA 4PD4J 3KPRD 3QFDB 4AH2B 5TF1L 4EXPX 4TULH 5GRJL 2BNUB 3OKNB 2R0KH 4QCIA 1INEL 4WUUE 5F7LB 3KAAA 4XZUB 3HMWL 4OGAD 2M26A 3UTZA 3UTSD 4E9LA 2HA1A 5FYJD 5EBGA 5B39A 2XWJB 2OSLA 4U05A 4LF3B 4K3JH 4NRXA 4LVEA 3S37H 3MA9H 1ZLUH 4IHOB 4NUGL 1ZEAH 1YY9D 1CFNB 1IAIH 1QSED 4WFHE 5E2TL 3AM8C 2ZJSH 3LN4A 5IFJA 3AS3A 2O61B 1DQJB 5F7WC 5FM8A 5T1LA 4QRSA 3H3PL 1TZGL 4G42A 2OL3H 1EUTA 1IAKB 4OB5H 5C0AD 3HMWH 5AD0A 3MV7A 1NCDL 5D71H 5C07D 2VLMD 3FFCA 3H3BC 3IDXH 3MLUH 4LPWA 2Z35A 3WHE0 3VD3A 3DARA 5C0BD 5JOPD 2DDQH 4J3SA 4IHOA 3UPRA 1FYTD 4QTIH 3PP4L 4HJ0C 4F7TB 3MBXL 4ODWA 4YXLH 2ITDA 4GQ9H 2YHGA 4I18A 3KG5A 2W65A 5IF0A 5DD5L 3UX9B 2AEQL 3KJ4C 5ID0A 4DZ8A 4MS8C 1WBXB 2YKLH 5L0QB 5LWYH 5ESQB 2VN4A 3DGGA 4KKBC 1NCBH 1QSFA 1MHPH 2X4NA 2FEEI 1NGPL 2NY1C 4MNQD 4J3OC 1PY9A 4LAJH 1W0WB 1XIWD 2PCPB 4OCRL 4MD4B 3BGFC 3O11A 3VWKB 4W6XB 4JN1H 3GSVA 3KPMA 4G9DB 3RP1A 1B0GA 1U3HB 2H2PD 5DZOA 5I9QB 1JWMB 3WE6B 3KGRA 5ALBH 2O5YH 2AABH 1T7XA 3MRGB 4WEBH 2KUTA 1A6TA 3VGGA 5I8OH 2FHBA 1FNHA 2X1WL 4Y8AA 4EN3D 4X4YB 4BQCA 2XWTA 4M1DL 3CSYB 2P5EE 1VACB 4LMQI 5HHNA 4GKOA 3NN8A 5DC4B 5DJ6B 3MOAH 2PW2A 1JUFA 3ZHKA 4WHYG 2AQ2A 4MA8H 2MPAL 2Z4QB 3LKQA 4ZO8A 4FRWA 2H1PH 2EEBA 4KVNL 1FG2A 2PYED 1MJJA 1YMHB 2ZWLT 2DLTA 4TUJB 1JVKA 1YY8B 4V1DD 4WY7L 3MUZ1 3ARYA 3DJ9A 3HG1A 3WKNA 2DF3A 1ZGLP 4L9DA 3V6ZA 2A83A 2GJJA 3O2DA 3MYJB 4WFGE 5JOEA 5ESAA 2A38A 2OTUA 4WUKH 1KJVB 1NEUA 2VXUH 3AS1A 1CD0A 5DVKA 2DYPA 2ENYA 2HAZA 3LEVL 5SWZA 1MPAH 3GZKA 3BIKB 2Y7QA 1LEGB 2FWOB 3LKSB 2IFFH 2NW3A 5IB4A 2EYSB 4JRXD 2J8UB 3HNSL 3HZYA 2Y07L 4ODHL 4G8IA 4YX2L 4YX2H 1LK2B 4HUVA 4Y19B 1SVCP 4JAMB 4OAWB 4HK3N 4MX7A 5BV7C 1OLLA 2DMCA 4HIEB 2NTSP 3QDJA 5KSVB 3QJFB 1GPOH 4P2RE 4LF3A 4K94C 3ZSTA 3HHRB 2MJWA 4MD0B 4YK4C 3S88L 5H35A 1NFKA 1P7QA 4Q74A 1U91A 4CL7A 1QRND 4L8SA 2EXWC 4W70A 1FVCA 3TIEB 5IG7A 5A2JH 1PJ9A 1CFQA 3DX9B 2HLFC 2IMNA 3AREA 1UKQA 2BY1A 1OTUD 5DRWA 4O2FB 5D7IE 3VXSB 3U0WH 5CCKH 5CZXC 4PRIE 3RPIA 1A5FL 4HH9A 1YN7A 4XVJL 4PJDB 3P9WB 5CGYC 5SX5H 1T2QH 4P4KB 4R97B 1T03L 2P8PB 4H25B 1N7MH 2WSKA 4HF5H 1PKOA 1GPOL 1MFBH 2BSTB 3IU4H 4XPTL 3LKRA 4M8QA 4P2YA 1RUAH 1TTGA 1JGEA 1ZHLB 4NQDD 1F6AA 5DGQA 3CFKB 4GW1B 1ZANH 4GJTB 5DMGD 4C56D 1DBJL 4QXGL 4NO3B 4APQA 3T65A 3QEQD 4P46D 1H3GA 5DLMH 3EJZD 4X9FA 3BPOC 3CNKA 4MJ5B 5FO7A 1WZKA 3MRFA 5DI8B 1C1EH 3E6HB 4PRBA 1NUFA 1BP3B 1R5WB 3M07A 1RZ7L 1NC4A 2L7UA 2B1AL 5I15H 2H8PA 3VXPB 2BNQD 1J5OH 1Q0XL 2G2RB 4O02L 4ZS6D 3A6BH 4OJFH 3RL2A 4S1SH 1LO3L 1F6AB 3FFCD 1KJ2H 2XPGA 3T0EE 1FYHB 4HHAB 2XZAH 1NGYA 2F5BL 3TO2B 1D6EA 3W9EA 5IHLB 2UV3A 3QXUA 1I8KB 2FHFA 4WV1C 3TNNB 4A2MA 4CU7A 1I8LA 5GGSA 1QFHA 1JGUL 4U3XA 1CLOL 4YQXH 1E6OH 1OAZL 1P5UA 3SBWC 1BZ7B 1NC4D 5EOQH 4X7CC 4X9BA 4PJ7E 2AXFA 3TN0A 5C08B 2FZ3B 1VKXB 1Z9LA 3WXVH 5DQJB 5KZCB 4D0DB 3VCLA 2C1OA 4PJ7F 2X09A 3VGDA 1LO5B 5KBNC 3SKOB 2Y7QB 3WNPA 1RURH 1FFOA 3QT2A 3PJSB 4MDIA 5I1EH 4EVNB 4XI5D 1E27A 4MSWA 1IZJA 4E0RA 5AZ2H 1X5KA 5D7LB 2ZZUT 4DKDC 3GMOA 4WCYH 4TULL 2R56L 5GGTA 1L0YA 4ZNEE 1EBAA 5D93B 4M7KL 4MAYC 3RVUC 4M7KH 4JKPL 3SGJC 4K23L 4K23H 2G75B 1E4XI 2G2RA 2VISA 4HK0A 2Z93B 2R2HB 4Z18A 3IDIB 3CSGA 2NY2D 3RWHB 2G9HB 4HKJA 1G7JB 3T0DA 2ZOLA 4IRSB 1OTSD 1QZ1A 3QIWD 4XPHH 1NKOA 1U2CA 5AZ2L 1T7VA 2BVQA 3NA9H 4IRZH 4XBGA 4AG4L 2O93L 1FL3A 5CD5C 1ZHLA 1YNKL 1YNKH 3HR5A 4S0SD 3I3DA 3B2UC 3K3QA 5DD0L 2DD8L 1WBYA 3SJVA 3QNZA 1SJVA 2P24B 3E2HB 4RISL 1X5FA 3AB0C 3O3BA 1QEWB 2C1PA 2HLAA 1NCNA 1DQQB 2DQEH 3C5JB 4KC3B 4ONFH 5KZCD 3ZHLA 1KB9K 3T0AA 1UWEL 4CMHB 2L4OA 3E6FB 1MLCA 2NY4B 5E7FA 2YUVA 1F4YH 2FIKB 1NC4B 3RKDD 5LVEA 5IJVA 1ACYH 4D9LH 3T1FA 2APBA 2FRGP 5DK3A 5DJCA 4QF1A 5DA4A 3BGMA 4LHUA 5LGKA 4FFYL 2AJYL 1I1AA 2LAAA 1MAJA 2HG5B 4WU7A 2OZ4A 1SJEA 1C7SA 3MXWL 3MXWH 4P5KB 5CWSA 3NVQA 2J4WH 4JM2B 1NAML 4XI5C 2LTQC 3I6LD 5HI3D 3LQAH 5D5MA 4Y4KC 2DQUH 2BNQB 5T1MB 4KZEL 2XTJC 1FFPB 1PG7L 4FQIL 3MRBA 1Q9OA 5D7IB 2EYRA 2ADGB 1RIHL 4NN7C 1CXFA 1ZVYA 1O0VA 2A1WL 3TJEH 3RAJL 4HS6B 4XBEL 1GGCH 5EOCH 3OR6A 1YEFH 3MRPB 1K4DB 1WVZA 2BHZA 2RHEA 1CL7H 1YMMD 2V9RA 3PWPB 3NZ8A 4L3EA 1T6WA 3IDMB 1MCPL 3B83A 3PQYD 3QDGE 4BZ2L 1IC5L 4UI2A 1GOHA 4PJEE 2XTLA 3O45A 3DO7A 4FMKA 2MCPL 4OZFG 3DUSA 4NWTH 1BREA 5AUMA 3KDMA 4CVXB 4XBPB 2IQAA 3UYPA 1T0MB 4XH2B 1WISA 3FQWA 3HNVH 5GRUL 3KYMB 2W0PA 3QXAB 2E9JA 4FFWD 2BOBA 4ZS6C 3DMMB 3BEWA 4XPGH 1LHZA 2GSIA 2VLJA 3O6LL 4LLVA 2Q7YB 4AL8L 4XNUH 1BGXL 1IKNC 2P1YA 3ILQC 4FFZL 4JO2H 3VXSD 1A0QH 3QDMD 4ZOBA 1JYVA 5K9OA 2D7TL 4RFEA 1IC5H 4OZIF 1JZ4A 3GI9L 1BJ1H 2CIKB 1U8HA 1WF5A 5IEKA 4PR5A 5EU4B 2HT3C 3MLRH 3HNSH 1GRWA 2W0FB 3CVIH 5E6IC 1CICD 1KCSH 2V5TA 1KCSL 1JPSH 1S3KH 2P46B 4K7PY 4I5BA 3OF6A 5E6YA 5FOJA 4RMQA 5FM5O 4RAHA 2EKSB 2IQ9H 2XNAB 4WI9A 5CSBA 4P5TD 4J4PD 1MCLA 1KIRB 1IGCH 5DEGA 1FNEB 1QRKA 1H5BB 2ADIA 3EYVA 3QNXA 4NN6C 4NWUH 1QBMH 4NC1E 1CFSA 3QHFL 3VFRA 4HS8H 2BDNL 3VRIA 3H9YA 3MLRL 3WD5L 1CXKA 5HDQL 3BD4A 3X13B 4MQSB 1F90H 1UGNA 3QEHB 5INCA 4ZUUB 5DWUL 3QXWA 1A9EB 1OGAB 3OF6D 4QRUA 3O8XD 1FHGA 1EHLL 3ULUE 3SGEH 3KPMB 4MJ4A 4BSJA 3CZFB 1Z9SA 5D5ME 3U48A 3CFDA 5B4MC 1IGCL 3W2DL 4RIRB 3LY6A 3DVNB 5I18L 4EI6A 3W5MA 2OTWB 2FEDC 4KDWA 1XF4A 4TNWK 1SEBA 1XZ0A 3VD4A 3ARZA 4BSWA 4ZFOA 4MA1C 1WBZA 5F1IB 3U82B 1BQHG 1YNTA 1X5XA 5FYKE 4H88L 2WBJD 4G3YH 2X4RA 3OR7B 4EEEA 5GJTL 2AKRB 3D0VA 4K9EC 1YC8A 3FQTA 3U4EB 3FT3B 1T3FA 3TJHC 4Z7NF 4H1LH 3BEVA 3O6ML 1XMWA 2MCG1 1FVEA 1QFWM 4XAKE 3KDMB 3NCEB 3O2VH 4X98A 4C4KO 3T4YB 2YZ1A 4DGVL 3HE7C 4WJ5A 3S3SA 1WFOA 3TBTB 4N0RA 3RIFK 1CI5A 5F1IA 2D4DA 1CXLA 2GY7B 2X44D 3AAZA 5DRXA 4NT6A 5M7QA 2I27N 4P23C 4EN3C 3GMPB 1JNNH 4P57A 4LEXL 3DPBA 4FZEL 4YAQB 2Y36H 4PRNB 2QADB 3VRJA 5FYKL 4JFOB 4NKMB 1MCSA 2VLLB 5JDSB 1VPOH 3RX5A 4FTVB 1FNEA 2PTUA 3PIQA 1ONQB 3RTQD 1YEEL 2SEBB 3BKJH 1BVLB 5F21B 1OL0A 4Z8FL 3FB5A 1C12B 3O9WC 1DN0B 4MA7H 5B8CA 4J3XA 2NY1D 5F9JA 43CAA 5C0EA 5CJQH 3UPCA 5JLZA 5C9KA 5E8OA 5IBTH 5I8CA 4GAYB 1RZ8B 3BXNA 4KKBD 2DQDL 3MREA 1AP2A 1IGJA 4OFYD 3DXAE 1TLKA 2BVOB 3WCYA 3I50L 4MS8D 3ZT6A 2Z91A 2ILLA 2W0LA 5IIEA 1OAUL 3OMZA 1OAUH 2H3NA 2B20A 4OD3H 1EMTL 4R7DA 3UBXI 2OTPA 3RNKB 2JE8A 1YEEH 1LEKB 1MHCA 4GRLD 1G7HA 4L4JA 1A2YA 1JGLH 4L4VB 2Q86B 5GGRB 5ANME 4WV1A 1V7NL 3EJYC 1GIGL 3ZDYE 1ES0B 1SEQL 2NY6B 3T77B 4YC2C 2C5DC 4LLMA 3ZMRA 5IBTL 1DSFL 1A8JH 4OFDA 2R39A 4DN3H 5C0NC 5I1AA 4WUKL 2J3SA 4PBXA 5DUBA 1GZPB 3QDMB 4U0QB 4PJ8D 5HVGB 1W0VB 4U2YA 5GHWL 4CADB 5GHWH 4M4RA 3RWIA 2XN9B 1WWWX 4KDTA 1SJHB 4PJIB 2F5AL 3ZKXB 2Q6WB 1FV1A 3FN0H 5I0DA 3UAJC 1LP9E 4NHCH 3MGTB 3LPFA 2B39A 4LGSB 1URLA 4APQC 4J1UB 2DB8A 5D5MB 4OGAC 2YA2A 2IAMB 1ULVA 1ZLSH 4Q97A 3QRGH 5B8CC 1BFOB 1IARB 3CUPA 4O02H 1NDGA 2D9CA 1OGAE 2CKBL 4HBQA 4Q7DA 4D0CB 4M00A 1KC5L 4YEFA 3H2WA 4ACPA 3BUTA 3MBEA 1JPFB 2EDEA 4UT6L 3L6FB 4HGWB 4I3SL 2PO6C 4OBSA 4ZFGL 1C1EL 4Z76B 3QDJE 3D3VA 5L9DL 5FUZH 1MHHB 2R1YA 2VH5H 3TVMD 1UWEH 5DQJA 3KYAA 4GRWE 3FB6B 3OAUL 5F7HA 3ULVH 4JPVH 5IHUL 3O4LB 4TOYL 2Q86A 3T0WA 1IKNA 4GRLA 4YGVA 3DI2B 4YFLI 5GGRY 4ETQB 1MFBL 3IKCB 3KWWA 4S1QL 2A0LC 3V5DB 4PRPD 3ZDXF 4E42A 2ZKHH 3ULUF 2NY5H 3D1MC 5EIIB 2P7TA 3MOQA 2AK4B 3BOVA 2X4QB 1SMAA 2FD6H 2DQJH 6CGTA 2W9EL 4EUPB 4TN9A 1A6ZB 4XNMA 4TQEH 5IMMA 2PETA 4NBZB 43C9B 5IMLB 3V9FA 5IB2B 3CAFA 1GHFH 3O4LA 4PJFF 4DK6A 4QRPB 2QL1A 5HYQB 1EO8L 1A4JB 4MA3B 5JXEC 4HD9A 5KAQF 2FDBP 1GC1C 1RZIB 3GSRB 3RTQA 2XRAH 1N0XH 4K55A 3AGVA 3TM6A 5KSBF 5DD3L 1EVUA 1FVDA 3ZYZA 1A3LL 4NQXB 5JTWA 1R3IL 1R3IH 3CX2A 5IVZA 2NX5B 1CXHA 5B22A 3TZVB 2YEZB 3C5ZA 3HI5H 4XNQB 4BZ1H 3HI5L 4BZ1L 2JLLA 3WHE1 1U36A 4RGND 3CFJB 2UVEA 3CDGA 3VXMD 1I1RA 3TA3C 4YBLB 4NKDB 1OF2B 2Q6WA 4MAUL 5E8EB 3F7PC 5TE4H 1EAPB 1FLTX 1DCLA 4Y5YB 4UTAL 5JOFB 1OP3K 1F2QA 4F33B 1ORSA 3G6JA 3MRCA 5HHOD 5FM5M 5B3NA 2G5RA 2DAVA 4Y4FD 3UO1L 3MSPA 3BUYB 4UTBH 2FGWL 1L7IH 3I02A 1FG9C 3BYTA 4F15C 3ULUD 1L4IA 3L5JA 3K1DA 2G5BA 4H0IA 5IESH 3RVTD 2GTZB 4HZAA 3IF1B 3TBYA 3HAEB 1SEBB 1YEKH 4APQD 4HMDA 1KYOJ 1RJCA 3INUH 4HFUL 3TCLA 3TO2A 3HZMB 2YN3A 2AXGB 5H94B 1K4CA 2JK5A 1YQVL 2VMFA 4GLRI 4NKOA 4M7JL 1ORQB 1OPGL 3QNYA 1FYTE 4LGRB 4PJ8C 4HGMA 4PUBH 2CMRL 3S4SB 2BY0A 5CEZL 5HVFB 4X5LA 5DZNA 2V7NA 1KT2B 1HKLL 3LKNA 3W9EB 1A4JA 4JJ5B 2C3GA 5IW3A 3IDYC 3EJYD 1EDQA 1DBBH 2R2EB 4XC1L 4WWKC 5E1HB 5KSAD 3WUWG 1I9RL 5LQBH 1H5BA 1DJSA 2OS7A 2BSTA 3MBXH 1WAAA 1IMHC 2DQFA 4KJWD 4IMLA 1DBKH 1S78D 5GRXG 4ONFL 3Q1SL 3D9AL 4NZRH 1E4WL 3P4MB 5I74B 3KLDA 1G0DA 1ZMYA 1DVFC 3QQ3B 3AM8A 3QCVL 1A1OB 3VH8G 4RWHA 4YPGB 4PS4H 2YPKA 3SQBA 4YHYB 4GBXB 2E7MA 5GPRA 3MV9B 3QA3A 4FP8H 4MXVF 3G9AB 5FYJH 5E4EC 4GKZA 4XPBH 1NL0L 4JFEA 1I1CA 3ZTNL 4DQOH 2YBRB 3O9WD 1TJHL 4ZNEA 3IDNA 5HYIA 1OY3B 3O11B 5T3ZL 3W81A 4IRJD 2MQ0A 3STZB 3MFGB 3VG0L 4Z7WB 4TTDC 3TF7C 5CJ8A 3RGVD 4WHYH 2XZCH 4KRLB 3PHOB 1XF1A 1A6WH 3P4OB 5FK9A 1DL7L 4LQFH 4F33A 2QQQA 2DYPD 1B90A 1UWGH 1FSKB 3HZVA 4IIQC 5DJYB 4FXKB 3MV9E 4LAQL 3O4LE 1NMCC 1OCWL 2EEDA 4U0RC 1EEYA 2ED9A 2OXGA 3TVMB 4B53A 4F7EA 4OD3L 3CU7A 5D6DC 1LVEA 1YMMA 3CMOL 3HRPA 3RNQB 5MEQA 1XEDA 2EIDA 5J89A 4HUUA 5DVLA 3BVNA 2FECL 3GBML 1A7BA 1I3GH 3X3FH 1JJUA 1G7IA 3D39E 5EH1A 4LPTA 3DVFA 3MLXH 1RFDH 2D7MA 3ULSA 4FQJL 4HLJA 3MROB 3L5WA 5CSZA 1DEEA 5BW7A 5SWSB 1TNMA 3EO0B 2Z4QA 4HWBH 4L4TE 2OTUB 3HE6A 3VFRB 4MNHA 2E8ZA 3WJJC 3LKPB 5HVHB 4PP1D 3EYSH 2RR3A 2Y6SC 4PJHF 5EZIL 2A73A 4YHZL 2D0GA 2O5XL 3BZDA 1HH9B 4YXLL 3FT4A 1MCFA 3OSKA 1H3VA 2J2ZA 1ZGLA 5CJ5A 1AE6L 1KT2A 1MEXH 5HGAA 5FKAA 4H20H 1VFAA 1ZT7A 2AI0L 3G6JE 1K5NB 4L1HA 4R2GB 3B5TA 3VGHA 4UIKH 5JIIA 5GISL 2ZSVA 1NGPH 1U58A 1U8LA 3FQNA 5DJXA 3DYOA 5TJWK 4L8DA 3WLBA 5D2NC 1AO7D 4I3GA 1M7DB 5ADOL 4GRLB 3LVEA 1MCDA 1ONQA 4EN3B 2BSSA 2PW1B 4RAUB 4ZD3L 2X4OB 3PQYE 3QDGD 3SKMB 4BFGA 5I71B 4ODTL 4UQ3B 3WIHA 5A3ID 2WWKT 4N0YL 1Q9LA 4LLDA 3FHAA 5T1LD 5JLZB 1FYTA 5JHLL 5GSRA 1BFTA 2BVQB 4XBGB 4QT5A 3CFEB 5HHOA 4BK5A 3GI8L 1G9MH 1BVLA 4MNQB 4X7TA 4DW2H 4JY6A 2GK0A 2ICES 1MFEH 3W2DH 4AK1A 1MVFA 4HPOH 4X4XB 2FLRT 2W59A 2VLJE 5E8PB 4XP5L 4MGXA 4YQXL 1AI1L 3NACH 4OF5A 1HHGB 2JIXA 3NH7H 2NY5C 4L8BB 4YHOL 1QSEA 1QD0A 4G80B 4FZEH 1MUJA 5EZLB 3V4VL 3SDAC 1PQZB 4JR9H 4U1JB 3O9WB 4WU5A 1FH5H 2CIIB 2B4CC 1TPXB 3F6LA 3H9SA 4ODXA 3B9DA 3MJ7A 3D6GA 3PL6B 4JEGB 5HYJA 2WM0A 1EGJA 1B3JA 4M93B 2JJSC 4LRIC 1XF4B 4JY6B 2VQ1B 3U46B 4LU5H 5D70H 3WHXB 2AP2A 5MI0C 2BNRA 3MX0A 4Z0BL 4ZTPL 2NY6C 5GGRA 1CDGA 4Z7UE 3QEQA 4P46A 3HI1A 3GBNH 4XVUD 3KLHC 3BZFB 1A1MA 1L6ZA 3O6KL 3NFNB 5FV2A 4NJ9L 1EEZB 4NJ9H 2DKMA 1UZ8A 4P0DA 5JOFA 2AEPL 2R0ZL 3GJFK 3QNXB 5FKPA 4N9OB 4QXTB 3T2NL 1AGDA 3U7YL 3MUGB 2EIEA 1YEHH 1DQTA 4Y1AA 3GM0A 1MJUH 1I8KA 3TNNA 1KB5B 2NXYC 1QBLH 4JZNB 3ORJA 4E42B 4UIMB 4JRXE 1N0XL 1U8NA 1GOFA 2CDFA 3PL6C 5KSUA 5GGTH 3VD5A 3K80A 5E9DD 1LO0H 1PZ5B 4PREB 2B0SH 4Q9QH 1VFAB 3GBNL 3MA7A 1GH7A 2WUBH 4P59H 3DRQB 3QYCA 3BH9A 4LKXB 1UM5H 5E00A 4OQ1A 5F71A 3R4DA 2IANA 1KULA 3R0MA 1OAXH 1S5HB 3LZFH 4U6HA 4HFUH 4ZOAA 1RJZA 2R1WA 3E8UH 3FRPG 3KPSB 3B9EA 1GVIA 3BHBB 1TVHB 3VRLE 5FA3B 5JO5A 2IAMC 3QO0A 2DRUA 1U9KA 3MV8D 3VXUA 4HMEA 1MREL 2YN5A 2EC9T 2JB5H 3T2QA 1AC0A 4TVPE 2NY0B 1MY5A 4D0BA 3BVNB 4MNQA 2VXTH 3GSNH 4ETQA 2R15A 4PJAE 1PDKA 3NFPA 1R0AH 1X3DA 2QHLA 3U83A 1I9IH 1CWVA 5IQ9A 4PRDB 1AGCB 2AAVA 3I9GH 3RVVC 5GXBB 4GRMA 1KC5H 4S1QH 4EIZC 4MDIB 3TFKD 1MHHA 1WLHA 3OAZK 2E9IA 6FABH 5I66B 5JMRA 1TCMA 4JPVL 5E70A 5IHUH 3S34L 1CU4L 3KS0J 4MXWL 3BZEB 5IJKC 4WW2C 3PWNB 2A77H 1UH4A 3C5ZB 4EI6B 2P48B 4M48H 5ICYB 2ADGA 3LN5A 2VXTL 2ZKHL 2A6DA 1NBVH 1HHJB 1HSAA 1X4ZA 4OIIH 2QV2A 3QP3A 3MLVH 5EFIA 4M4PA 3F7YB 2HKHH 2C26A 1IGJB 2WZPD 4TSAH 1QSFE 3U4BH 1QPPA 2DKSA 2I5YH 4YBLC 5E8OB 2WP3T 5I8CB 1AQDA 5CINH 5C71A 5I1GH 2R2BA 4D9RE 3V5HA 2I9TB 1F11A 5KANG 4HK3J 4XT1C 4AZ8A 4F9PC 2HVKA 4TUJA 4CVUA 3FQRB 5CLWA 3UYOD 2P24A 1RUPL 2E7HA 4X9GA 4PP2B 1MJJB 5BVJA 2ATPB 3O0RH 3C5ZC 1OCWH 1ZHBB 1IT9H 3VXOB 3LQMA 2RCSL 4UDUA 4XP1L 1QEWA 2R2EA 3FRUB 5DJ6A 2C4FU 3GK8L 2ZCLH 4KWUA 4PG2C 1G7MB 5EA0H 1JMZA 3HNVL 3U0TB 1I8LC 5DJCB 4X7SH 4X7SL 4OIBA 1CBVH 4KI5E 3GSXB 3QHTC 2O5ZH 2E9WA 2R0KL 3ZE1E 5IJVB 4F2MA 1S9YB 1NCCH 3I3EA 2XTJE 3BP4A 3RPIB 1F6LL 2N7BA 5K59F 1FO0H 2HLAB 1G9NC 3Q6GL 1O5DT 3KYNB 2P5WB 4LFHD 1EA9C 1F13A 4QTIL 5IWLC 5I30L 5T33L 1FZMB 4NKQB 4MB3A 3PGDB 5H35B 3WO4B 4PGZA 2IH1B 4QXUL 3CMOH 1G6RL 1UACL 2PXYC 1K3IA 4D0BB 1FCCA 4PJXA 1BQHA 2ZJSL 3BZ4B 4DVBA 1VESA 2DTML 4AENA 5FV1L 35C8L 4F57H 1HSAB 2BJMH 5C09B 2VZSA 3SKOA 3KR3L 3GJFA 1HKLH 4PRNA 1ZLWK 4DTGL 1OD9A 5K9QI 1FVDB 1VGEH 1JZ8A 3KXFA 5DQDL 4OKVA 1AQKH 4E41A 1RD6A 1EAPA 4JLRA 1OWWA 3MRRB 1CGWA 3T0XA 2H6PA 1QBML 2ZUTA 5I6XC 4UZGA 4P2RA 4R4NC 4AY0A 5IEHA 2GKIA 3ESUF 4G43B 2FO4A 4OCMC 4HXAL 4NCDA 3U30C 3P77A 4OCWH 5IV2A 5JUEL 4Y4KB 3W0WE 4MQXC 1KENL 4TRPL 5C2BL 4JREB 4YHML 2H8PB 3VXPA 3FTGA 5BW7C 1P7QD 4FQ1L 4AEHH 2VDLH 4Z7QE 4CJ0A 2PW1A 4XHJD 2XPGB 2ICWA 3BQUA 2H1PL 4WWID 4YHKH 4MCZA 5FGCB 1MRFH 1MHEB 3IJYA 4PJ9D 5J6GA 4KROC 4KZDL 4HKZA 3AC0A 5EORH 1FAIH 1TJGL 1WGOA 1D5ZB 4HV8A 1KN4H 3DYPA 4UDTA 5IB1B 1F02I 4FQQA 1K4CB 3STBA 5K9KA 4PJGE 2ERJB 4F7PB 4JDZB 4JFFD 2F54E 3CX5K 4PJFE 4YUEH 4FG6C 3M45A 1J1XL 4KU1A 3BYYA 4H5SA 5I8OL 4OGYL 2CIKA 2EDDA 5TQ0L 4UV7L 4DQOL 2BHUA 2VXUL 4HS3B 4U1LB 3K8MA 1KNOB 4OZGA 4WI5A 1YEGH 1RJLB 3QCUL 3FT4B 3TT3H 5BQ7A 1BFOA 4GS7C 4XCYB 1Y6NR 3H8NA 4LPUA 4MA8L 5INDB 4JRXA 1X7QA 5DMIL 3B5GA 5CIPH 4F9LA 3KYKL 1G1YA 3HI6H 2MTPA 4PRPE 4K8RD 4QHKI 4WW1B 1B4RA 3D85B 2MNUA 3BAEL 3RVXC 3P4LA 5E94B 1U8QA 3AU1A 5I1CH 4I9WD 4BZYA 3RVVD 3KS0H 5BVPH 2PTVA 5C8JB 2V2TB 4QHMB 4HT1L 3MUY1 4X6DB 4F7TA 3LD8B 4E41B 5CEZE 4KK9C 1WITA 2YEZA 3F58H 5DRZB 1R3HA 4FQPA 4D3CL 1BECA 1HHJA 1T6VN 1JZ3A 5ITBH 2YD2A 3QEQB 4P46B 1EEUA 1IGIH 5AD0B 3S8WA 3VG0H 4YXKH 2Z8VC 5BJTA 1F3DH 1T1YB 2ITCA 2V5SA 4KQ4H 3SJVD 4YDLB 4P3DA 1YNTB 1UVQB 3CXDL 1NUNB 3QUYB 5DDHA 4HF5L 4JKLA 1MI5A 3NIDF 4C58B 3E1F1 3FAWA 4ZS7L 1SM3L 4EN3A 3LZFL 1HI6A 1BQLH 2YD7A 1KTKE 4PJAA 1Q72L 3BKCL 3LS4H 2H3NB 2V5RA 1YPZB 3HE6C 4FQXB 1AXIB 4PRIB 1NFIB 2XN9D 2WIIA 4RBPK 5E8PA 1X6LA 2VR9A 3CIQA 4OCYH 1AY1L 2WIMA 3ULVD 5SWQB 3KLAB 4N0FB 2GUOB 3O2WL 4ODSL 4JHWH 1IM9D 5I8KL 1G7MA 3HG1B 4UB0L 3OAUH 3EBAA 3ARWA 3QHZH 3LSOA 3TWCL 5TE6L 1ZV5A 2C7UB 5SWSD 3NPZB 5CGTA 4P5TB 1JHTB 5JXAL 3BJLA 1FNGA 3OKLA 4ZFOL 2EYRB 3EYSL 1CGSL 2R69L 1WZ1H 1UB5B 2X4PA 4MVBC 4NUJB 4U3CA 2QKIA 3BSZL 5I19L 5HI4C 1A3QA 5DO2D 4PY8J 5HD8D 5L88L 2FNBA 2V9QA 4P9HH 3LMJH 4K71C 4CN4A 3NN8B 3S35X 4YDIL 5HGAB 1AI1H 1F3JB 3MTRA 4N5ED 2GT9B 1IKFH 5T3ZE 5EU5A 3D69B 4YZFF 2A73B 4YZFE 1RUMH 3FN3A 4LSVL 4WJ5B 4UNVA 3D2UA 2JELH 5FYLL 4PYHA 2X4PB 4G8FB 5I1EL 1B6UA 1OP3H 2BC4A 3S5LA 3DMMD 5F7NC 3HZVB 1LGVA 1UG9A 4JDTL 1D5IL 4PRPA 1CD1B 3ULSB 1RK1A 2D03H 3LIZL 3LIZH 1IC7H 4PJDA 5F96L 1VHPA 1UXSB 3PWNA 4ZPVA 4U1SB 5FCUH 5EZOH 1HQRA 3KYMA 4WTWA 3ZDZF 4P4KC 1QFUH 4WI6A 2DWDB 2BNRB 3I50H 2WIIB 5D1ZD 4LSVH 1I1FA 5I16B 3TYGL 5GRVL 3ETBF 3QDJB 5KSVA 1FFNA 2NY7L 4XP5H 5GIRB 4L9LA 3O4OB 2XXCB 3EOTL 1XF5A 1FNSH 1J1OH 4LMQE 3QG7L 3ARGD 5BZWA 1CBVL 2HRPL 1U8JA 3LKSA 2CLVA 3ARBB 1RJYA 3VRIB 2D9QB 1OOAA 2CRIA 5FYKD 2VE6B 4DKEL 5LCVH 5FGBC 5F9AC 2B5IC 5ECJE 4KFZC 4Z0XA 2NLJA 1FRGH 2EDOA 5GJSH 4H0GA 4PJ8A 1KG0B 4R3SB 5I1HL 2Y06L 3DHMA 3QWQB 3K7UA 4M8VA 1LILA 1FYTB 1R5WA 1XGUB 5E2VH 2VITB 1AKJA 5FGBA 2HFFB 1TZHA 1KXTB 2DLHA 1MH5B 5D7IA 5BO1L 3DTXB 2ZG2A 3L7FA 4HWBA 1KXVC 4OQTA 3BGAA 1TZGH 3CSPA 4NUJA 4LRNH 2VSDA 2WWMD 1NFDA 4L4VE 1I1AD 1JHKH 5IVXF 1P4LB 4NC0B 3IDXL 2P8LB 2OR9H 3TV3H 2UY7A 3MLSL 1KJ2A 3R1GL 1U8PB 3RA7H 1F45A 1YNLL 1I1YA 3L3OA 3SE8H 3VH8A 2XWBA 5E1AB 4HH9B 2ZOKA 2B2XL 1BVKA 3K81A 3NIGE 2AJUH 1TIUA 1EO7A 1HE7A 3IJYB 5DMYA 2BRQA 5KVFL 3OR7A 1I9RH 5CBEA 2ZOLB 4Y5YA 3B9KB 1CICB 3EUUA 5K9OB 2W60B 2MWCA 5LXGL 1R3JA 4UU9A 2NX5D 1QO3A 1NBYA 2DQJL 1KV3A 1EIBA 3WFCL 1TJHH 4ODXB 3A67H 3I84A 1B6DA 2G5BB 5E08H 3LPGA 1J7VR 4TTDD 2IANE 2OTWA 5DHVA 4FTVE 5IF0B 2JCCE 1CXIA 4GAGH 1S9KC 1N8ZB 2OZ4H 1DUZB 1I9JL 3V7MA 5EBMA 2X1QA 5D2NA 5LJYH 4CN6A 3O6LH 1FORH 4LLUA 5EBLA 4WHTB 3GMOB 2J5LB 5D7KE 2GIYA 4XCFL 4MXQD 4DEPB 1IBGL 1U95B 5FA4B 5CZVH 1QLFA 2ZPKH 2I60L 1G7JA 4JG1H 5T1KB 5E8EA 4R96A 1J18A 2ZP0T 5C08D 5C0RH 3GO1H 1XCTA 3U4BL 5F7EL 3AMLA 3BPOB 4EI5B 5J1TC 3BEVB 1ZLVK 3WFEH 4QT5B 2Y07H 2C1OB 4BUHA 2APWA 1NAMA 1RZFH 3VWJA 3RY6C 3KPQB 1TVDA 2D7PA 1JWSA 1U8MB 3QCVH 4OM1L 4POZD 4XHQA 5GGQH 4DUWA 2QHRH 2AK4E 3EHBD 2Q3AA 4LVOB 3L95B 2NY3C 1Q0YH 4Q6IB 4N1CA 2MQ3A 1GXEA 3HMXL 5D7JC 2DQCL 2R4RL 4Y0GA 5GGSB 1U8OA 4HS3A 5IFAL 5TE4L 4FFZH 2QQLH 3O4LD 4YBQD 3WNOA 1T0NA 5CP3A 1VACA 5HHNB 3MXVH 4OF0A 5DVNA 2DIJA 2JIXD 3VW3H 2PUQT 4QOKD 4ZAKA 3TT3L 1XR8B 3KPLB 4ODBD 1QKZH 5DUPL 4Y16C 3KPSE 1Y0LA 4WFFD 3PWJB 4MQTB 5IESL 3ZSSA 2VXVH 3RVWC 1X9QA 4X0KA 4LLYB 3NCYS 3BAEH 4CDHA 4JO4H 1OGTA 2YA0A 1UB6B 1B0WA 1RZKC 2AJ3A 1X5AA 2D3VA 5IFAH 1T4KA 3S9DB 5F3HB 5ILTL 4YO0A 5T1KD 1YEJH 5F1SA 5J06A 3UJTL 4NO5B 5C07E 4PIRF 1U3ZA 4YLQT 3WXWH 4JFDA 4JJ5A 4J3VA 4HLZG 2OK0L 2XN9E 3MMEA 3LN5B 5JW3H 2E7LA 5LGHH 4JPWL 4NKIL 4ZDHA 2JB6B 5D9SA 4R96B 3FB6A 4RGNC 5I1IH 2B4CH 5TDOB 1MOEA 3QUKA 5T1DH 1KSRA 5MHSD 5FYJE 4UNUA 4YPJA 4D0DA 3EGSA 1JPFA 2ED8A 1IVLA 3NPSB 2NY2B 5FAAA 1N6QH 5C86A 4YHKL 4F3FA 4P99A 4KHXH 3W11C 4S1DD 4H1LA 2H9GA 3BPNB 4RWYH 2VIRA 1RVFH 1JNNL 4OD1H 1WFTA 3GI8H 3MNWB 4GS7B 4JHWL 4Q6IA 1T0MA 4XH2A 2BOCB 3L3HA 2J8UA 3AB0B 3HZYB 1YUHA 3GDBA 1I8IB 4GG6E 5I75C 1LEGA 2FWOA 3F8UB 5FYLH 2H45A 3OHXB 4NSKB 4G5ZH 3HNTL 4GAJH 3ZDYF 3QQNA 4LCWB 2DMKA 4PV8B 2YPVL 4H26B 3QDAA 4V1DB 4Y5VB 1OLZA 3GSXA 1J10A 3V0VB 3UBXB 1UZ6F 1G7HB 4PJEB 4TPRL 5SX5K 3SKNB 4H1LB 5CJOL 1BAFH 5CJQL 1V3LA 3EO1B 1PEZA 3MMEB 4NQEA 4X8XA 1UJTA 1GGIL 3MBEC 1R5IB 1S7RA 3ARDB 1N64L 1N64H 3DSFL 1MQKL 4M3JA 3KNBA 2IC2A 3RKPA 3QQ4A 5IW1A 5FYKH 3GKWH 5L7XL 2DBLL 2VLJD 4YDLC 1BF2A 1KCRL 3LQAC 4TNVK 2FBJL 3WN5A 3TVMC 3UXFA 4JGUA 1R3JB 4X0KB 4NZUH 4NN7B 3E6HA 4PRBB 1NPUA 2CJUL 4IEFB 4R90L 4OTXL 1GIGH 3NCYP 5KVEL 4JDVA 1L9NA 3UZVB 4ZAKB 3RHWK 5KSBA 1BD2D 3CFKA 5CILH 5DRWB 3QUMA 3RDTB 2FSEA 3WDHA 1FVEB 3ARFD 5CP3H 3S97C 4EQ3A 5FGSA 4L3CA 3GSOB 3MRKA 4YNYB 4C56B 4OI8A 4LLYA 5HVHC 2X4NB 4ALAH 2UYLB 3DSNA 2XZZA 5FUOH 1BF8A 3UAJD 4PJFA 3B43A 3GJFH 3BZEA 5BZWB 1F4YL 3JZ7A 5I2IA 4N9GA 5HYSB 4HBCH 4AT6B 4HG4J 5FKPB 3C2AH 4LEOA 4U1JA 4N8PA 5C0FA 3NIFF 4K2UH 3W9DB 3L3GB 2W65B 1MWAH 1PLGH 3LOWA 2FATH 5C0ND 4PGBB 4LHUD 3VG9B 4OUUA 3D39B 5HI5D 4GFTB 3H42H 1OF2A 3SDYL 3MLSH 2R2HA 3UYRH 2B8OT 3ULVC 3MV7B 1MAKA 4PJIF 5I76A 4GRLC 1KYOK 4PJBF 2B0SL 4Q9QL 5HHMB 4X4ME 3MLZH 1KIQB 4ZPVB 4Y5XC 3BO8A 2BY2A 4Z5RB 5ISZB 1QSEB 2ARJA 3EOBB 3MRIB 5T1LB 4KTEH 3WN5C 1VGKB 1XGPA 2MKWA 2CR6A 5EOCL 2KZ1B 4HWEH 2GHWB 4XCCL 2JCCA 1QR1B 2BC4B 5HSFA 1N3NA 1ZKAA 3A0OA 4G8FA 4K3HA 2F5BH 4O51A 1XGTA 2XQYG 4PLOB 4P3WA 1J0JA 5IVOA 5HYJD 4U1HA 4IMKA 2XWJA 4IOSD 4WHTA 1XCQA 4LHJB 3IS0X 3MJ6A 3FQUB 1D5MB 5L6YL 3DVNA 4RAVB 4L5FH 1OAKH 4UV4H 4UV4L 1KLFA 4PJBA 5E1AA 1BOYA 2VC2L 3OXSA 5C0IB 4KGJA 5ESVA 2IPTL 3CVHH 3A6BL 1P6AB 4OUOA 2IWGA 1MVUB 4OF3A 3FO9A 3RX8A 3SDAB 1KCUH 3I9GL 2AK4A 5DUMH 2XRAL 3HZKA 4NHUA 5E99L 5K93A 2PYEB 1FPTL 5KS9E 4ELKA 2COQA 5IROA 1YECH 2EKSA 2C1PB 4YNYA 3QZWA 3QUZB 5DFVC 3MLWL 5EU6D 4P9HL 3FOMB 1AP2B 2BRRH 4QXTA 3KYOA 3WFBL 4FFVD 1HZHL 4QHLB 3GUTB 4AM0A 4ZODA 4QRTB 3RBGA 3G6AA 1CLOH 1D9KD 3SJVB 5AWNH 1CFQB 5FUCC 2FCBA 2BNUA 3RJQB 4ZTOL 4L8SB 3W5NA 5ID0B 2NXZD 3CDCA 2R23B 1C12A 3C09B 2IQ9L 3PWPD 1QYGL 1HWHB 4DZBA 3F65A 4HIEA 1MLBB 3THMH 5JDSA 4NP4H 5MI0B 3VFPA 2D0FA 3H9SD 2F8VA 3UO1H 1JPTH 4WCYL 4KROD 3MJ9L 4MB5A 2VQUA 5IB4B 1A3LH 3D85D 5HGHB 4P23B 5ENWB 2Y06H 3QI9D 4OBRA 1QR1A 5J8OA 3MRJB 4KTDH 3QISA 1A3RH 4ZUVA 4OCNC 1QHPA 2YK1H 1VB9A 3V8CA 2BP3A 4GLRH 1SBSL 2VAAB 5TFSH 1MRCL 4CADA 2GJZA 2A83B 3EKCA 2W92A 1KCVH 1YN6B 4JG0H 4W4OC 4PJDE 4EQ2A 3BDYH 3PGFL 3L1OL 1MJ8L 2V2TA 2UZIH 3BIAX 5KSBE 3CPLA 1OPGH 3QRFM 2LV4A 3RPKA 4ERSL 1Z0MA 4XBPA 3FONB 2ARJB 1JI2A 1FG2B 4Z5RA 3OJ2C 1AXSA 3IRPX 5DSCB 1T2XA 5E8DH 3NZ8B 3UJIH 2HTKD 1LK2A 4HUVB 3E0GA 4OLYH 4AEFA 2Z31B 3NBNA 3IJSA 4J4PC 3BFOA 3BN9C 4Z7VE 5F93C 1RU9H 2OR9L 4OT1H 4FQ2H 4NRXB 5GZOC 4U1LA 4PJ7A 5BJTB 4K7FA 4PB0H 4XGZA 2KDGA 4NFCA 5KVFH 1AO7A 3ALXA 4HG4K 1MIEH 5F6HI 1PSKH 3MLYL 1HSBB 4DVRH 4JHAL 3UTQB 4QXWA 5DS8B 1HHHA 4XVSH 1BJ8A 4FQLL 3OQ3B 5ESVB 2QR0B 1KFAL 3P4NA 1A64A 3HUJF 4QO1A 4IRSD 3OPZH 4QRTA 3BESR 4WEBL 1OSZA 3WNLA 4QCIB 3OJDB 4F37F 35C8H 1MFNA 2HRLA 4F57L 3HC3L 5ICXB 2ZCHH 1ZVHA 3OKDB 2BXZA 4KXZH 4B7IA 2V2XA 3ILQD 2N56A 5EN2A 4MNHB 5H8DA 5DF0A 2YC1A 3BQUD 4OCRH 3U7WH 1PG7X 3A67L 4JFED 4JPIA 3TBWB 4FFWC 1FNGB 3OKLB 2ADJB 3RA7L 5DC9B 4Y7MA 3QCUH 5JQ6H 3PXHA 2DWEA 4WY7H 4L3ED 5CINL 1N4XH 2YRLA 3G9VA 5I1GL 4NQVA 2MHAB 4K8RH 1MCOH 1NCWH 2PXYA 4EI5C 4YEEA 3RAJH 3FO9B 4IRSA 4N8VB 4JB9H 3HPJA 4LCCA 2VUOA 3FMGL 4KK5D 1NFDF 5E56A 3W0WB 1YEDA 5BRZB 3N9GL 5JHDB 3BE1H 3GO1L 4JLRB 3UTTA 3G08A 4FNLL 2VL4A 3UTPD 4PJ7B 3NGBB 4MD4A 1YPZA 2RCSH 3C2SA 4XMPL 3NABL 3IDUA 3EDFA 2FBJH 2DLFH 4LLQA 5JNYA 2I26N 1DTUA 2FZ3A 2CR3A 4YDVA 4PD4K 3HNTH 4GAJL 5BV7L 4G8EB 1P84J 2XTJD 3JVGC 1JTTA 5FFLA 1I3GL 5JPNB 4BFBD 2GCYA 4PV9A 4N0FA 2G9HA 2NY4C 1LE5B 1BEYL 3UJJL 5J11B 2AJZA 1E28B 4LSQL 3S88H 4OZHA 2L0DA 3WIHH 5IBUB 3IXTA 3CXHJ 2X4TB 1YUHB 3E2HC 3DV6B 2IG2L 2ZUUA 5IM7B 5L8KB 4NQED 25C8L 1J05B 5A1AA 5FDYA 2WUCH 5CHNB 1OARL 4ODHH 4J23A 1OM3H 1ADQH 5FDWB 3VGFA 1YEIL 3MRJA 4KKLC 1T7YA 2ORBH 4F3FB 1MJ7L 1T1XB 1QBAA 1JHLH 2AI0H 2PXYB 3TFKC 3U6RB 1FBIH 1NUDA 3MJ8A 3S36H 1RMFL 3GSQB 3EFDL 2VLRA 3QWRA 5ACZB 5KVEH 2IMMA 3IETA 4KV5E 2ZCKL 1T5XA 3QIWA 4L9LC 4WGVB 5J12B 3RGHA 5D1QD 4U49A 5SX4I 1X5JA 4GBXC 1JRHL 1AD0B 2I24N 1K8IA 3TPKA 4IMKC 4OI9A 5K9QG 3VFSB 3OX8A 4L3EE 2J8OA 3V5DA 1ZVSA 5K9KB 1FL5A 4KK8D 3NCFB 4RCAA 2X9YA 4H88H 3B5HA 1D5ZA 3WJLA 4R0LA 4DFHA 4OJFL 3VD7A 3OKNA 1GAFL 3RWJA 5HHQA 3ARXA 2X1OA 5E5UB 5GSVB 3C8DA 2HN7B 4WO4B 1F3DJ 3QQ4B 2YD5A 3UDWA 2DM3A 1Q72H 3TPUB 3NMEA 5DS8A 1XR8A 3KPLA 3W0WD 1FZKB 4GAFB 4U2ZA 1NFDE 1MFEL 4FABH 3CCHA 4G9DA 1P9MC 3BDBA 3EZJB 3NCMA 5I1KH 2YWYA 2BXYA 4G5ZL 4NQSA 4KZDH 1KCKA 3MR9B 1RZKL 4KHTH 3VI4E 2APTA 4LKCB 4ZUSB 4ELME 3WL9A 3PG2A 4QOKE 1RZ7H 1T89A 4YHIB 2I07A 4Y88A 3X11A 4D9QD 3DV6A 2JELL 4DFIA 4CVXA 4WWKA 3BQUB 3MV8E 3OHXA 1MH5A 4KTYA 3MOBL 5C7XL 1KJMA 1I3RB 4FHBD 1M6OB 4P2QA 3U2SA 2B4CL 3QDGA 1U3JA 1MELA 1K8DB 2YR3A 5IQ9B 1K2DA 4PJIA 2LFGA 4PJ8B 2KL6A 2UZYB 5AG8A 3MRPA 2Y5EA 4X6EB 2XXMB 4YIQB 3O6KH 1HOCA 3HRZB 1TZIA 1OP5H 3TO4B 2YXMA 1OAZH 3WYRA 2W9LA 2NY6D 4PTTB 1KIQA 3KVQA 5IQ7L 1U91B 4UBDD 2VDQH 2AV7B 1F4XH 4NJAH 1A14H 5DTFB 3G08B 3MNWA 2YPLD 4OLUL 5HGGS 4JR9L 5E9DB 1R5VB 2YD9A 4YO0B 1C16B 5DFTA 3OB0H 1M6OA 3U2SB 5JPNA 1CTNA 3CH8A 2Z31D 4OGXH 4PB9L 5K9JL 3RNKA 5D7SH 1MNUH 3LEXA 3TESA 4LLUB 1LO0L 4GG8B 4PRAB 1RK0B 4BH7A 5DYOB 4UTBL 4GKNB 4R90H 1ES0A 3G5ZA 3TNMB 4P59L 3VWKD 43C9A 5JPMA 3QSKB 5H2BA 1XIWB 3I75A 1B0GB 1U3HA 5EDXA 4WNQA 3CFCL 4GG6B 3H0TB 3PGDA 4GMSH 1T4KB 3CCHB 2X41A 1A14L 3BP7B 4L3CB 4OZIA 1FRGL 2K7PA 3OX8B 2YS4A 3ARFA 1VFMA 3I2CL 3L1OH 3C5SA 1T83C 3V6OC 3BP4B 4HIXH 3QI9B 4M43L 4FQXC 4PGCA 2FBOJ 3G5ZB 4W68A 2QADD 2UVFA 1G7LA 1NCAH 1C5DB 1OTUC 1HSBA 3OXSB 3H3PH 3HLAB 5SV4A 4CBPA 2HLFD 3BRFA 3AMKA 1NAMB 3U0TA 1S5HA 2J6EL 2ESVB 2F58L 4XP4L 5F1NA 2QQKL 4RISH 3RRQA 3D25A 2KQMA 5GQBA 2R29L 3L9RB 1KXQE 2B1HL 1F42A 1DZBA 2OX5A 3C9NB 1PQZA 4YXHH 4MJ6A 3ELAT 4JQXA 4LSRH 1OT1A 4OFKA 1ACZA 4N8CH 1AKJB 2R1XA 2A77L 5L6YH 1TETH 2R2BB 4AIZA 3MQIA 3PWLA 1UJ3B 5FDWA 1X4XA 2OR7A 4URTB 3ARBA 1L9MA 4R2GC 2XN9A 4N1EA 4BZ2H 1KIUA 1D3CA 3TBTA 5ESQA 2VAAA 3HFML 3SGDH 3VWKC 5ICZB 1NGXA 1J9CT 1BQUA 3MACH 1MWAA 1U3HC 4IJ3C 1S5IL 5MEPA 1TQBC 5IVNA 5E08L 4YHIA 1WICA 2EH7H 3TN0B 5L2KA 4ZUSA 2W9DL 5EPMB 4MLIA 3TN0D 5TF1H 1JNLH 4MNQE 2EKJA 5I1DA 5EC1B 5B38A 4KTEL 1OAQH 1UKSA 4QRUB 2QHRL 1WBZB 4N5EC 2OMBA 2ZCHL 3EDEA 5D2NB 2EYTB 1UJ3C 3HUJE 1YJDH 4O4YL 1IT9L 4RBPH 3WJJA 1NLDL 3UZQA 5IB5A 5FA3A 4I77L 5CEYB 3NABH 2IGFH 1RZJC 3N1MC 2JB6A 4WO4D 4K3DH 4X80L 4NWTL 5EO1B 1M7IA 3B3IA 4GRWF 3ZKXC 3ZTJG 2EH7L 4RFNC 4EXKA 1T5WB 5BV7H 1JK8B 3EDKA 3L3OB 4NQVB 4X6DA 5IK3B 3F5WB 1IL1B 1TZHB 4IRJC 4X7TB 1CDIA 5EUOE 4M6OL 4M6OH 5ICXA 5MEND 3DX6B 5FO9B 4PREA 1OSZB 5EG6C 5SX4H 1T1WA 3TEUA 4R4BA 4YE4H 2BY3A 1X5GA 4ELMB 1YJDL 3FKUS 4LVNB 5L2KE 5I30H 3PP4H 3MJ8B 5CSGA 4PJBB 1OARH 4NIKB 2IANB 1DVFD 2XACC 3DTXA 1KNOA 1T80A 4OZGB 4M5ZH 1ZGLM 5BS0E 5ADPH 5IBLC 3JWNC 1S78C 1MVUA 4K9EH 3K0WA 4WRLA 1NFDB 1EHAA 4JDZA 4JM4H 1EEZA 1PZ5A 4JFXA 4WWKD 3D3VE 3HI1B 5D2LF 4P4RA 4R4FL 4JQVA 2CLRA 4OB5L 1CK0L 3JWDH 4UTAH 3MRQA 3EYQC 1NMBL 5KTEH 3MRIA 3ZKND 3EO9L 1MWAB 3R1GH 3QFJA 4ZOEA 5CMAA 3K2UL 1VSCA 3BO8B 5FGRA 3TBVA 4GBXD 3E3QC 1EFXB 1NUGA 3QULB 5HDQH 1NBQA 3NTCH 4XWOC 5IBUG 1AGFA 4O51B 3G04A 2FGWH 4Z95L 3GIZL 1XZ0B 2A9NL 5I8EA 2CH8A 1YY9C 3QXAA 3SDDB 2W38A 5KW9H 4GW4B 4KJPD 4KGLA 1RU9L 2ATKB 1PX4A 3PWVB 4TSCH 5GGVY 4DGYL 1BZ9A 5JHDA 3GHEL 3W9DA 3Q0HA 2YWZA 2FYYA 3CK0L 1HIML 2RIKA 3VXRB 1ZANL 3V7AG 4KJQD 1EXUA 3TO4D 3F12A 3UJTH 2CXKA 5MEQB 1DP0A 2CRMA 3STLB 1NKRA 4WENB 3G5VB 4CW1B 4YPGA 3T2PA 1FGVH 1UQSA 1GCFA 1SJEB 4Y4FC 1JNHA 2JKXA 5FYLE 2DJ4A 3QUXB 1FAIL 5DHYB 5D1QA 5KVMC 4N0YH 4M9PA 2H41A 5ALBL 3FHQA 3S5LB 3TZVC 1J8KA 4HIJB 3D18B 4F7CA 1A7NL 2VLKA 4EDXB 2BNQA 1IBGH 5HYSA 2P49B 4NO5A 1KIRA 4U1NB 1MI5D 4PJ9C 1D5BB 3EIFA 3OKKA 4HMCA 2EC9U 5DHXB 1U58B 4NNYB 3Q1SH 1A6VL 1MCHA 3PNWB 3ZDXE 3ZKMC 1IGTB 1E4XL 5MEOA 3MCLH 2PYEE 4NZUL 1DL7H 4LQFL 1GJIA 3BKML 3WFZA 1MCRA 1H15B 4X7EC 1WIUA 1K3ZA 3DHJA 4BFEA 5JHDE 3C6LA 1RIVL 3BE1L 4WTZA 4PRAA 3VXRD 4B5EA 2GT9A 5MP6L 1AC6A 3DBXB 1W0WA 1I7RA 5T3XH 1KTDB 1JPST 3F58L 4D3CH 1CDHA 1WIOA 2GSIB 2JJVA 5DEFB 1OHQA 2M8XA 5B39G 1IGIL 2FJGB 3BH8B 4WW2B 4MAYB 4RGNE 2FH6A 3SE3C 1GL4B 4PJGA 3L95A 5J12C 2DLGA 2Y5TB 5JZ7C 2VXVL 5D72L 1X4YA 3HI6L 3S4SG 1TQCB 3LH2H 5IQ7H 4I18B 2I9TA 4PGEB 1INDL 5JQHC 2P43B 2PXYD 4R8WL 2HWZL 4NGHH 1IFHH 4C59B 1E27B 3NA4A 4OZFB 1EK3A 1IAKA 3LQZB 3CFJA 1RJYB 1WEJL 1QTYT 1L7TL 5ITBL 1T1ZB 2DQGL 3X3FL 3KXFB 4OM0H 1AY1H 4R26H 4OM0L 1CGVA 32C2A 3VXMA 4MJIB 1JGLL 1EJ6A 5F9OL 4P2RB 5JW4R 4RA0C 2EE3A 1D5XB 5JW4M 3IFNH 4HWEL 1BBJA 4HSQA 1DN2A 3ULVE 5EU6E 4O9HL 3RIAK 4L8CB 5D1ZA 4HCRA 5C0CE 1RUQL 1A1NA 3KXFE 1FZOA 1C08A 4C83B 4HV8B 3G6AB 3M8OL 1L7TH 4X5XB 3QEUB 4P2RD 4U1SA 4HFWB 2CDGB 1JHLL 1BZ7A 2J8HA 4M5YH 1RZJL 4JDVB 3O6FA 5LBSH 1BVZA 2ICWB 3BWAB 5F9WB 3TT1H 4J2XA 4QRPE 1BQSA 2W07A 3KPOA 3DVGA 4I0CC 2LTQB 3MODL 4HJJL 1KLUA 5C6PB 1KPUB 3ZTJH 4MLSA 4LFHG 4XXCC 4RMWA 2YPVH 3SDCA 2EXYC 3BD5A 3IFLL 5L9DH 1IZKA 4ODTH 4POYA 4KZEH 3SGJA 4LP4A 3VXNB 4MZ3A 2VLRB 5DMKA 3M17A 3T08A 1H3UA 1D5MA 3FQUA 4K7PH 1CU4H 4MXWH 2GK2A 2VERN 4QYOB 2FO4B 5JHLH 2A1WH 4YHNA 5GZND 4DJMA 1OP9A 2NXZC 1JF5A 4X6DE 4WTZG 1QQDA 1F4XL 5H37H 2AJVL 5DJZB 4GXVH 1KLGB 1QYGH 3UBXA 4WUUA 3ZE2E 5MENA 3VXQA 3TYGH 4H26A 4NM4L 4WHCA 4LNVA 3TO4A 3KPPB 3RWCB 1RY7B 1HH6B 4AG4H 3AFLA 3QG7H 1BOGA 4LBEA 2HVJB 3FTGB 4XNYL 2VUYA 2R56H 3VDAA 1QVOA 5C0GB 3S4SA 3BPCB 2WQRA 4YHPB 1X5LA 3MV7D 5C07A 5A2FA 3A6CL 4WI2A 4BFIB 4V2CB 3NAAL 1H5BC 4PY7B 2F54B 2D7NA 4D8PA 2X4SB 3WMSA 3U1SL 1FFNB 4GXVL 1BM3L 1G6RA 1KPVB 3D39D 3VI3E 5GJSL 4LKCA 4ZSOE 5EO0B 1CDCA 3OL2A 1XGYH 1XGYL 1WTGT 3MRMB 5TQ2H 1UM5L 4XPHL 5JA9A 2HMID 3MRRA 5D8JL 2RQ8A 3EOTH 1NC2A 2LAGB 4WDIB 3O41A 2VZ3A 4D9LL 1A7PL 1XH3B 1PYWB 5DK0A 5FHAL 1SQ2N 2EE6A 1EFQA 2VOTA 3AUVA 1BWWA 2KQNA 2NQCA 3S37L 3GNMH 3FT2A 4I3RL 3BW9A 4D94A 3OTTA 2QLVB 2C3WA 5K33A 4NQDE 1U2HA 4MWFA 4PUBL 5EZJB 1T2JA 4DKFL 4PJHB 4ODUB 3DETC 1CCZA 4OQTH 4U1GC 1LD9B 3EAKA 1E6JL 4NQCA 1FJ1A 2DQEL 1AGBA 4F7MA 4MNGA 3K74B 2NXYD 3SE8L 4NRZA 4M5ZL 4WHDA 4M1GL 4JZOA 1CF8L 2X1XR 4QRPA 2UWEE 1DN0A 2P8MA 5B4MD 4JANB 3SO3C 1YEKL 2BCKA 1S9YA 1FN4A 1JGDA 2WW8A 1TXKA 1RHHA 2HJFA 2C3VA 4M7LH 3BDYL 2FR4B 3SDXF 4OZGF 4LSDA 4KVCH 5D1XD 4FZ8L 4ERSH 3V5HB 1IEBB 3SHSA 4ORGA 3AAZB 4HQQH 5FHBL 1WFNA 5DSCA 5E9DE 3UJIL 4LCWA 1NGQH 2EDLA 3SDAD 3KLAA 1TTFA 3L3IA 1A6ZA 4GKSA 4XNMB 5EFIB 1C5BL 4OGYH 5GS3A 5JDJA 3UBXG 5C0JA 3FONA 4QHUB 4OLVL 3VA2C 5GRYA 3HE7B 1MFCH 5L0QC 1PVHA 4OKDA 3NIFE 5C9JA 1A7QH 3SE3A 3NFPB 4L3AA 4DGVH 4NZRL 4YDJB 5I17B 1LE9A 4Q2ZA 5HYJB 5CJXA 3DRTA 4ZFFB 5TDPA 3EGSB 1FZOB 4ZFOB 1T20A 4P9ML 3LRSA 3MGTA 3LV3A 5I1CL 1I1FB 4ONGH 1CVSC 5F9DC 2ADFL 3MOAL 4NFDA 3QWOA 2WINB 3RZCC 4A6YH 4QRRE 3H9SE 5F7FA 3GSUA 3UPRB 3MYJA 3JTSA 4W4NA 5ISZD 3EYOA 3H9ZA 1NMAH 3TYFA 3FO1B 3GIVB 5HHMD 3BIBX 2VDML 3T4YA 4G9FB 5JIKA 3H7LA 2CD0A 4QHNB 4YXKL 3UTSB 4OZIE 4LCWE 5DMIH 1YMHA 1E4XH 1M7XA 3LQZA 1GYAA 4BSVA 4M1CD 1L0XA 1W8OA 4LP5A 4P2QD 3GUTA 2UZXB 1I8MA 3WIIH 1UCBL 4YHZH 5JW4Q 2GITB 2P42B 1EFXA 2VKWA 3GSNB 3QULA 4LOUD 4JRYE 1IAIL 1ADQL 2FX9L 4GXUN 5IKCB 3MRGA 3V8OA 5DLML 3MNZB 4PP1C 2E6PA 4ISVA 1JWMA 3C60A 3OKEA 3U79A 5J4MA 4MAYA 3NFNA 3VFOA 2DTSA 3EFDH 5IB1A 1EJOH 4UIKL 1T03H 2YD3A 2CDFB 4K7FB 1U8KB 4XGZB 3WIHL 1ZT7B 4OLYL 1BD2B 3DX7B 1I7UB 3O3DB 4HC1H 1JP5A 5D1XB 3RWDA 4KUCD 2XG5A 4HZLA 1UADC 1CZ8H 5TH2A 4O2CA 3P4MA 4KMTL 5F6HJ 4UAOC 4LHUG 3MJ7B 2BVOA 3RL1B 3OG4B 4XVJH 3RKDC 4JQVC 2X42A 3FN0L 3LKOA 5LG1A 5J56B 1P1ZB 3FB8A 2O5YL 2DQIH 3C60B 5E4IA 1JGDB 2A9NH 5IWLA 3LS5H 3PHQA 43CAB 3ROLB 5F9JB 1S7VA 1XT5A 2X05A 1HKFA 3V5KA 2AXJA 2XKSA 1U8IA 1CD8A 1T04B 5EUKA 1GGBH 2Z92A 5M95B 1KB5H 4Y8DC 3QXTA 1ADQA 2C3HA 3CLEH 2H2SC 1CIDA 4Y16D 2BFVL 1VPOL 4JVPA 4J6RL 3O6MH 4BKLB 5ADOH 4HIIA 1ZT4A 4X6BA 4XNZB 3QPQD 3V0WL 1K4DA 2XV6B 1P7KB 2IFGA 4Z78A 4OUUB 3PE9A 2F74B 3U0PB 4YBQC 1WT5A 3MRLB 5A43C 1I4FB 2XFXB 4X6CE 4OCWL 1CT8B 3LRSB 3MCLL 3KPNB 4KI1A 2FH8A 2VXQL 3EZ8A 3JTSB 3QDHA 1H8OA 3SQOH 5EOTA 2QSCL 3TVMA 1BIIB 4ELMF 3KPRE 2WNGA 1H3PL 3NFSH 5F3BB 5BXFB 1U93B 5EU3B 2F54D 3RVUD 4Z78B 3WKML 4KJWC 3WIFB 2YMXH 1MFDL 4BQBA 4DK3A 3ZO0A 3H3KA 4HJGB 2D2OA 1KEML 4RX4A 3T0EA 1Q9LB 4LLDB 2RGSA 1FIGL 4ZXBA 3N85H 3MC0A 5HYFA 4PJEF 4LPCA 1AHWC 2PR4L 2UUDH 5TH2B 2PR4H 4U1KA 5ERWB 5D1XA 5DJDA 2VXSL 3HTLX 3RWDB 1F6FB 5GS2H 5CILL 1U8LB 1QLEH 3R8BB 2HKFH 1P1ZA 1HXMB 3P3YA 4I0PC 5KG9A 1U3YA 4XAWL 4XAWH 3CLFH 4BA8A 1B88A 4HWZB 1RV6X 4TVPL 1OM3L 3WKMH 1B2WL 2WUBL 4F15B 2A9MH 15C8H 4ZUWB 4G7VL 2C7UA 3L3KB 3NA9L 4IRZL 4HBCL 3TA3B 2VLRD 5ELIA 1Q9KB 1NCAL 1UCTA 1SM3H 2Q87A 5FECA 5HHXH 2WWKO 4NQCD 3RVTC 3BGMB 2PN5A 3FFDB 4Y5YC 3E8UL 2QKIB 5DMKB 4QTHB 5D7LD 4LNRA 1S9VB 1AGBB 4F7MB 1JYWA 3ULUC 1MJUL 3GNML 3OKEB 2DQHH 5I1LA 4NCC2 1HWGB 3F7YA 2P8MB 1JV5B 1DEEB 2HKFL 4LGPB 3FRPA 2NPLX 5FF6A 4D9RD 5F89B 1A21A 1CFVL 1FZJA 4V2BA 5EOCJ 4Y4HC 3D0LB 5J1AA 3UROR 2FIRT 3FO1A 3LKPA 2B1AH 4LSRL 3RU8L 1N6UA 3BWUC 4KROB 2E7LC 2E9BA 2V2WA 4UINH 4I5BB 4I48A 3JUYA 3ET9F 4BQ9A 1MAMH 3QNYB 4WNQB 3FQWB 3GMRA 2EDFA 5EU3A 1NCUA 4EVNA 5GGVL 3IU4L 4XPTH 5FYLD 2G60L 3QCTH 1J86A 3HB3C 3H6JA 4K94L 4NFBA 4YJZL 1JWUA 5E6IA 4AEEA 4JFHD 1W72H 3LMJL 4LCUA 2ZSWB 4GBXA 1CE1L 1HQRB 2F54A 4D8PB 2H6PB 4G6JH 4KI5D 5HGBB 2V7HB 4KUZH 3VXUD 4ZSOB 3QAZC 3VMOA 3P0GB 1GHFL 1FZMA 4MJID 4YHYC 5C9JB 4MDJA 1RUML 3KXFD 3ZKSD 4EDWL 1Q9OB 5ACMA 4WGWB 3CVHL 1Q0XH 3S7GA 3NIDE 3IFNL 4AIOA 1VEPA 4UT9H 1NGWA 1T21A 1S5IH 3HS0B 5JO5B 1R3KA 4J8RA 1DVFB 4A6YB 3CFEA 5I73B 1OW0A 5D1ZC 2A0LD 1PW3A 5GGQL 1X6NA 2XA8H 4HAFA 4N90D 5C3TA 1QFWI 5T1MA 3EYFA 1M4KA 4EUPG 2EZ0C 1Q0YL 4XC3H 4ZNCD 1MSPA 5MENB 2BNRE 4GRWH 5J7CC 3O3AB 4CN1A 2JJWA 3C5JA 1A2YB 1S9WA 1OB1B 3MNVA 4OGXL 4PB9H 5CWSB 2QQLL 4P5KA 3O3BB 3EDDA 2D7OA 4L1DA 1QPXA 3DVIA 2PO6D 1QRNB 2ZSVB 3JBG7 3F6IA 2IBGA 3MXVL 4F7PA 1I75A 5GRVK 4KMQA 2N7AA 4DAGH 1FJ1B 3QG6B 3CVHA 3O6FD 3HG1D 1S7WA 2NNAA 3OWEA 1JPSL 4PV8A 4IIQB 1BFVH 2CUMA 4AYFA 4P2OA 2R4SH 3MFFA 4KJQC 3TO4C 1FQ9C 5IKCA 4R9HA 3U9PH 4G8GA 1SBSH 4Y4KA 1A1MB 3TIDA 2GSGA 3MRCB 5EUOF 2E3VA 2AXGA 2HH0H 4JG0L 1KCVL 4KJPC 2V5MA 2BVPA 3P9LA 5DD3H 4KK6D 1I85C 3MA9L 1DE4A 1F3RB 2BHYA 4X6DF 3MV7E 4F9LC 5ILTH 2R2CA 1FL6B 3QUYA 1DFBL 4YR6A 5C0BE 1CLYH 5DO2C 3QEUA 5T1KA 5L2KD 5A2KH 3EYUH 1S7UB 4FQHB 4MD5A 1CGYA 4YWGH 5HPMB 2NZ9D 5DUPH 3GGWA 4MDJB 5C2UB 3SKJH 3SKJL 4ORZC 3EYQD 1R6VA 1XIWC 2AERT 1WAAF 3ZDZE 5CEXB 2XKNB 5E8NB 3JTTB 3ARBD 3RIFF 4BYHA 1DVFA 4MZ2A 1MRCH 3HS0A 1FL6A 2V17L 3C6SA 3C08L 3D0LA 4U33A 5J1AB 1YQVH 2LABA 5DJ2B 4PJBE 3JWOL 3LRHA 5I1HH 2CSPA 4FQLH 2EDQA 3SDDD 1QSZA 1LK3L 1DLFH 1XR9A 4XXDB 5I1JL 2AJUL 4HJ0D 2BJML 4CMMB 3VU2A 4OZ4B 4Z7WA 2D4FA 3MLTB 2ESVD 2IPKB 5M94B 2R9HC 5AYUL 4DTGH 4UQ3A 5J3HD 1KBGH 5FECB 1NCDH 5D71L 2VDLL 4FQCL 2PW2B 1KF9B 4XVTL 4JHBA 5C0BA 4G6FB 4KVCL 3VWJD 2EDKA 1VADA 2FB4L 2IH3B 4XMLH 3P9MB 5EU6A 1MFCL 2I07B 4L8DB 4IIQA 4RIRA 4JY4B 4KK9D 5IIEB 1EEQA 4OI7A 1IC4H 1MCWM 1VEOA 3QG6A 4Z7UA 4KAQH 1KN2L 3HUJB 1NGQL 4YBHA 1RZIA 1KPUA 2YOCA 4EUPA 4GAYA 1MCQA 1N2RA 4LCWD 2DQDH 4P23D 4M7ZB 3PABB 1P69B 4NPYB 3QO1A 3H7BB 2Z91B 2PCPA 3VXNA 5T3XD 3ALPA 3RY5A 2EDNA 2QEJA 2GQHA 1KJ3H 1WWAX 4B7LA 2F8XC 2B5IB 3SJVE 3PDOA 4AJ0A 4M8QB 4NDMB 4XWGL 3RZCA 4PLKD 4XP9H 2VDOL 4CKVX 2CDEB 1NH6A 2AQ3A 4LLAA 5T3ZH 1M05A 2NR6D 3TN0C 1HCVA 2IEPA 3DVGB 4RNRA 3PUCA 5E03A 3TJHD 4PJAF 2QSTA 2ADFH 5KS9B 5A2IH 4FP8L 3CSYA 4NT6B 1AGDB 1BIIA 2R8SH 4J3UA 2YPLA 2X7LB 1ORQA 1P84K 5A40E 4UV7H 2XKNA 5E8NA 4I9WE 1MQKH 3QDMA 4WU5B 2EZ0D 2VLLA 4FXGA 4R2GD 4XB7A 4JN2B 1IEAB 2F5AH 3O41B 1T2QL 1F5WA 1MFDH 1RQ5A 4F8TA 5C09D 5DWUH 4IRJA 3FT3A 3QB7C 5C6TL 4KMLB 4UT7L 5D6CB 1FIGH 1KTRL 2YD1A 3O9WA 3C8KA 3O8XC 4JO4L 3Q3GB 1FFRA 1GGUA 4X98B 2VZTA 4HWNA 2Z8SA 2I25N 2R8SL 4LQ1A 3DUUA 2VXSH 3VFTB 1ZTXL 2OM5A 4HIIB 4R4ND 4PG9A 4KDVA 4YHPA 5HY9B 2RFXA 3DURB 4YC2B 2LU7A 5B3JE 1CFVH 2GK0B 3RWIB 1SHMA 5F7YC 1B2WH 2FECI 4QRRA 1JFQH 4RGOL 5ALCH 1QOKA 5GJTH 4AH2A 4NYLB 1GAFH 1I7RB 4HUWA 5J6HA 3FQNB 4ZS7H 1FBIL 2AXHA 1CYGA 4PLJC 4X6FB 1UCBH 4WV1B 2HFTA 4WUUB 2AGJH 4G9FE 3O4OC 5CJBA 3TBSB 1CICC 2DYPB 4K94H 4G6AD 1IGFH 2X4OA 4YK4B 4CVZA 3L7FB 7FABH 5KSUB 2HT3D 5DEFA 3MRNB 7FABL 5C70A 3X3GL 4ESKA 4OFVA 2GYSA 3U0WL 1DQLH 5CUSL 4RGMC 2UY6A 1KG0A 2P5EA 3VRLF 1A6TB 1OWRM 4QRRB 4HWZA 5LGHL 1E4JA 4IOFD 2Y9RT 4MNGB 4D9QE 4GXUM 2K7QA 2VN7A 4HUMB 2ADJA 4RGOH 4PJ5D 5ALCL 2Z31C 5F7MC 1LD9A 3IDJA 4PJ5E 3PIQB 4R97C 4S1SL 1TENA 2NY3B 5DJDB 3W39B 4Q6IC 1OSPH 2RBLA 3LEYH 3WIFA 3BWAA 2WLZA 5FEBA 5EUOB 1A9BA 5C0AA 3OJVC 5ICYA 4M62H 2XWTB 3RDTD 4X4YA 5KN5B 2BRRL 4XRCA 3IAGC 2EYTA 1U8KA 4ZAKD 3LS5L 4S0TD 1AIFB 3C5ZD 2VDRH 4NO0D 4WDIA 4WIQA 1HHKA 2CIIA 1JZ7A 3CXHK 3U7YH 4M6NH 3MJGX 5JW5B 2HTLD 5CKGA 3QPXH 5IB3A 5F3BA 1NEZG 4PTUB 3MUJA 2BFVH 1HN1A 1JNHB 1NDMA 3REVA 4Y4KD 4MQ7A 1W8NA 5DT1L 4G8GD 1KJ2L 3V0WH 3WFHA 2VLJB 5D70L 5HI3C 4YDKH 8CGTA 1D5IH 3MPCA 4MCYB 4OV6F 4U6XB 2YPLB 5CZKA 1I4FA 2J88H 2Z92B 5GRZA 3ARDD 3EOYG 4DN4L 1YYML 1FH5L 3PGCA 3M1BA 1P4IL 3IDNB 3B9KC 2GW5A 4OLXH 3DRTB 3QWRD 2PO6A 4OLXL 2RAMA 3LN4B 4GMSL 2WANA 3QEGL 5CKAA 3SKMA 5EBWB 1GZPA 2VZVA 3IJHB 4L3EB 1FGNH 1KELH 1F00I 4N5UA 4HXBH 3L9RA 4NM4H 1RZGA 2EDWA 1UM4L 4L29A 3JV6B 1CDYA 4JPKH 3Q5YA 1HNFA 3JWDC 2CK2A 5IP4A 3N50A 4GMTH 2F19H 5JA8B 4QRQB 2F19L 3QJHA 2DQFB 3GRWA 4S10A 4C55A 3WL9B 2W0FA 4FFYH 5C0DB 3IFPA 3QRGL 1MWAL 1PLGL 2WLYA 5D1QC 4MAUH 3BRDA 3CC5B 5EWIL 4JM2C 4OZFH 1M7DA 2H2SD 1A9EA 1MQ8A 1OGAA 2FLBT 3EFFA 3H9HA 4HDIB 5INCB 2P4AB 3LDBB 4AEIL 2K1MA 5EUOA 5GGTL 3DV4A 3GMNB 1IM3A 3SN6N 4JHAH 4Q58C 4FQIH 3U30B 4YXHL 4KKLD 1AR1D 1JK8A 1H0DA 1CE6A 3JVGA 4WO4A 3SY0B 2HN7A 5EZJA 3ULVL 3RU8H 5TQ2L 4Y5VC 4JO3L 1ZK9A 3UZEA 1IILE 4KDTC 1JZ2A 4NC2B 3RL2B 3V4PL 4L4TB 5KSAA 5HGDA 1LNUA 1D6VL 1I7TB 2XNAA 2G60H 4P2OC 3GRWH 3C8KB 5K59E 5D1ZB 2MCPH 2GJ6B 1CLZH 3DIFA 5MERB 3TV3L 1AH1A 1T0PB 2Q8BL 3AS2A 1KIPA 2Q8AH 1A4KA 3L5IA 1A7QL 4GUPB 4L5FL 1EZVX 1F8TL 3QXDB 4JCLA 5IMOA 1I9JH 3L3JB 4NNXB 1BLNB 3HR6A 5T5FH 1JGVL 5F70A 2FO1A 4X9IA 1LK3H 2DI7A 3ZLQC 4EIGB 3IF1A 4PY7A 2GTZA 1GGCL 2C9AA 1KCUL 4PJCE 3WBDA 4C54A 7CGTA 5GGVH 4ONGL 1ZHNB 3IDIA 4ZAKC 4KK5C 4OZHE 5GS0H 2XT1B 12E8L 3PWVA 5D7LA 4XVUC 3D85A 3RDTC 2H26A 1E4WH 1T3FB 2H32H 8FABB 1KGCD 1S7XB 3GK8H 2NX5A 3RY4A 2J4WL 1HEZA 2OQJA 5HHPA 1NAMH 1U6AH 1LWRA 4I0KA 1JBJA 1I8IA 2ERJC 4LDOB 1TMCB 3GB7B 4PGDB 3UJJH 1V3KA 1JNLL 1NC2B 2YSSA 1G7PA 3RUGE 2J6EA 2AABL 3MV11 4XPAH 3WO3B 4BSWB 5D2LB 4MSWB 4E0RB 1NCWL 1NBVL 3BQUC 4IOFC 4I2XA 4NQEE 3A6CH 3BH8A 3QQ3A 5CZVL 4NQSB 1UWGL 4MX7B 1N2RB 4NWUL 1FO0L 4WU7B 2CLRB 3CFDB 3TH4T 3EJZC 5HXMA 3JXAA 4P46C 5BOZG 3MLWH 1Z9MA 5DURB 5TDOA 3K2MC 3MFFB 1J87A 1G6RH 1UACH 1C8PA 1GC1H 1U6AL 2BX5A 5F1NB 2A6KA 1RULH 4Z7VB 3MLXL 3C5SB 4JZOB 4Y5XB 3V6ZB 3KPOB 3V52L 5MEOB 4LAQH 1RMFH 2W0KA 4QF1B 4K07A 4P3CL 3X12B 1FN4B 4LPYA 3KHQA 3DXAD 4PJHA 5CGYD 3MNVB 3EO0A 5TDNA 3QI9A 5DA0B 3Q6GH 5HYEA 4LSPL 4WEMB 2HT4D 3QO1B 4JFPA 2H32A 25C8H 5F88B 2DIBA 1E6JH 1YPZE 1NMCB 1FC1A 2EXWD 5TPWL 3VI4F 4IJ3B 1ETZB 1U41A 5KS9F 1TFHA 4U1GB 1F4HA 5DHYA 2GY5A 4ZQKB 4M02A 4NRYB 1H3XA 3QXVA 5KW9L 5DR5L 1H3TA 3KJ4B 3BT2H 4E41D 2HH0L 4LPVA 1BMGA 2IAMA 5T5NG 3P40A 1QFOA 2UZIL 3S96B 4O2FA 4XVTH 2X9XA 2DM2A 5HBBA 1PKQA 4LK4A 2VDPL 1JL8A 5DXWA 4D0CA 4PRDA 2BDNH 5HJ3B 5I17A 1NDGB 1A5FH 1E4KA 3SDDA 4IDJL 4HUXA 4I2XB 4F58L 2OK0H 4OD1L 3K1KC 4E5XB 1HDMB 1F90L 2YSSB 3RGVB 5AYUH 3RBSA 3QUMH 1DANU 1BJ1J 3MJ9A 4LCUB 3TWCH 1C08B 2YBRA 5IVXB 5J9PA 1G9NH 3WS6A 1QBBA 1HEZB 3BT2L 4PJXE 1FAKT 3L3HB 4N8VG 2LQRA 5T1DL 4PLKC 2NW3B 4M6AA 5HDBE 1DBKL 2E8YA 1DQML 4OV5A 4XNQA 2DQIL 2YMXL 3AXLA 1G9EA 4XP9L 4JAMA 4OAWA 3PJSA 2VXQH 3HPJB 4J12A 5DFVD 5DJ8A 3VFUA 1T66D 3C9NA 5FO7B 4UOW0 1F58H 2Y5TA 4FMFA 3O2DL 1Q38A 2IALB 1R24B 3GMLA 3QPXL 3MA7B 5HYQA 5EO9B