4JE4B

Crystal structure of monobody nsa1/shp2 n-sh2 domain complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
SSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGSGGYAWQEFEVPGSKSTATISGLKPGVDYTITVYAGYYGYPTYYSSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
publication title Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4je4B00
1FFNA 1V3KA 5SWSB 4Y4KC 5CEZE 4FQIH 1P9MA 1CXHA 2APTA 4JDZA 4NQSB 4I0KA 5FM8A 2YD3A 1FH5H 4FQCL 1R3KB 2IBBA 2FIKB 2F53B 4NQDB 4R4FH 3WXVL 1MREH 5ERWA 1WC7B 2EO9A 3GO1H 4N0FA 4PJAF 1IGYB 3WN5A 1CG9A 3PWLB 5KVDL 5L2JA 4AEEA 1EH9A 4HD9A 4KDVA 5C0CA 1LILA 4PJHB 1XGRA 3IDNA 3REWB 5SWQA 3MGOA 2DJ4A 5E9DE 2GSGA 4NZTH 2BOCB 4DVBB 4QRQB 4YUEL 1ZA6B 3I9GL 3I50H 1A6WL 1OAKL 2BZDA 3MRFB 3OHXA 1YNLL 4Y4FA 5F1OB 4BFBD 5I1EL 4HBQA 3CXDH 4KPHH 2BNRA 2X6MA 5IESH 1BQLH 3SKMA 2QR0A 5BV7L 1U8IB 2EXWC 3UJIL 3H3KA 3BAEH 2F8VA 1ZVSB 4YO0B 2X9WA 3GJFH 3JVGA 1C5BL 4L8DA 2V17L 3GSNL 3EOBB 4NJAL 3ZYOA 1U3YA 2DJSA 1PSKL 3ARXA 4Y4KB 4ZO6A 1FFPB 2Y72A 3MRHB 1KG0B 4Q9QL 4MS8D 3JV6A 3MLXH 1T3FB 1U36A 1UT9A 4L4VB 3HAEA 1CF8L 4LPCA 1GGUA 4KI1A 4OV5A 2VR9A 4O51B 4Y19D 1G9NC 3W81A 3GB7B 2BY0A 3I02B 4TTDC 2OJZL 4QHNA 1RZJH 3AU1B 4HH9A 4LL9A 5GS2H 5JOPE 5BMFL 3LVEA 1JNJA 2ESVD 3SGDH 2DI7A 4PRHD 1KEML 3MCLL 4L5FH 2Q86B 3QI9D 1GCFA 1EA9C 3EGSA 1KXQE 4YDJA 3ZT7A 1OGAD 4OFKA 4XCEB 5EWIL 4JFOB 1G7PB 3DRTA 2XG4A 1VDGA 2Q8AH 3B5GA 5D72H 1CD8A 1DANT 4KHXH 4CVZA 5F7UA 4PY8I 4XPHL 4RISL 5KSVA 4R4ND 1UZ6F 3BHBB 3UBXG 2C4FU 1QHOA 4LBEB 3VDCA 5D71H 4TUJB 3LCYA 4LSSL 3P77B 4KZEL 1T4KB 2PXYA 2W07A 3CDCA 4XT1C 4ODBD 1WFUA 2BSSB 4WHTB 4Z7OE 1WJ3A 3FONB 3L3IA 4NGHL 3S9DB 1AD0B 4UV7H 4RMUA 5EUKA 5F7EH 2ESVA 4UV4H 4PRHA 2NYYC 2W1NA 3QI9A 3BH9A 5CSBA 4MCZB 1TZGL 1OGAA 2E9JA 1XCTA 5EBLA 4M03A 5AWNL 5C92A 1U8OA 2GEEA 1H3PL 1BFOA 1JPTH 1YYLL 5I73B 5FHAL 3ARGA 2P5WE 4JM4H 1EEZB 4HS3A 4Z0XA 5SWZD 2L7UA 1A7NH 4M1DH 4RMRA 1VB9A 2UZIH 5ENWA 4KKNA 4NRXA 3B2UC 5E00A 5T1LD 5DVLA 4NQTA 3QNXA 1F4WH 2AK4E 2R4RH 3QUXA 1CGXA 4JZOB 1A1NB 4KK5D 1WF5A 4U1HA 4CVXB 4KRLB 1MCBA 5D1XD 2EYTB 3PDOA 2QQLL 4S10A 3ROOB 3RWEA 2AQ2A 2FGZA 4L3EE 5C6PB 4JY4A 1JPFB 1Z9MA 2XY1A 1AJ7L 4JFXB 3H8NA 5GRJL 3WJLA 1FHGA 5E99L 1CDHA 3T65A 2DWEB 4M6NL 4N0CD 1UVQA 4D3CH 4NYLA 2R0ZH 5AYUH 1JWSB 2ZG3A 5T1KB 4ZXBD 4Z7UB 3B6SA 3U9PH 5T1LA 1CLYL 5K33A 5IFAH 1MELA 3QH3A 3BEWA 2V7NB 4HS6B 4CAGA 4E41D 3BGFB 3IB4A 1IGTA 2VXSH 1FVEA 3JUZA 3EAKA 4NHUA 4YDLC 1A14L 4XP5L 1ZLVK 1NCCL 2NXYD 3O2DH 5FGSA 3EYVA 3B3IB 4LPXA 1GC1L 3TBTA 4UUJA 1U95B 3B8YA 3BVNA 3RPIB 1FSKC 1G7LA 1U3HB 3PP4H 1LK2B 1JNLL 3DETD 4KJWC 4S1DD 3DV4B 4LP5A 4NCDA 2FEDC 4UDUB 3V0WL 2Q3ZA 4HXBH 5M7QA 5JW4Q 4JKKA 4R0LC 4AK1A 5ISZB 2LU7A 1AXTL 1B9ZA 3D1MC 3EUUA 4JM2A 4PJIB 3TVMA 5DMGD 5FYKH 4MAUH 4ZUUA 1KPVA 2AKRA 2XZZA 3KPSD 3KS0H 4PG2A 3THMH 1EO8H 3C60D 3MROA 1GPOL 1U8NB 3PWPB 5MENB 2IEPA 2HTLC 3MLRL 2HVJB 4NT6B 1UM6H 1SQ2N 35C8H 2FR4B 3MRMA 4HFUH 5D6CB 4WGWB 2C3GA 4I3SL 5GRYA 1FGVL 1I85C 3MJ6A 1A21A 3VCLA 1BEYL 1S7QA 4MDJA 1AFVH 3JWDL 1KPUB 4KWUA 4X6BA 2EXYC 1AP2B 1TITA 4PJFB 3MRCB 1NCAL 4G6FB 3HRZB 4YDLB 2F8OA 5B39A 3HC4L 1CXKA 2R8SH 3QXWA 3RDTD 1JWUB 4DFHA 3KPSA 4NZRH 3DROA 1BBDH 3ARZA 3BZ4B 4YH6A 2I5YH 4LCWA 1FSKB 2NZIA 2ATKB 5KSBB 1JJUA 4OGXH 3S3SA 3JV0A 3DI2B 1R3JA 3OKNA 2J8UA 3S97C 1DFBL 1BVLA 4HZLA 1FBIL 4R0LB 3MLPA 4NNPL 1X4ZA 4CN1A 3BQUA 5BW7C 5DRWB 4U1LA 3KJ6L 3BIBX 5E2WH 4S1SL 1YN7A 2D2OA 2UV3A 3AS0A 3MA7A 4G7YH 1IFHL 1C5DA 4BH8B 2GAZA 4RA3A 1A9BB 3RDTA 1S3KH 3FRUB 5C07B 2SEBB 1G9MH 1UG9A 4ZODA 2ADIA 1GXEA 4YHIA 4CU8A 2YD4A 3WMSA 3MRGB 1IGFL 4NM8H 3TFKC 3TH3T 3D85D 5CBAA 1CVSC 4M61B 1KT2B 3CX5K 4X4ZA 5JZ7C 4Q6YA 4ELKA 2YRLA 5K9QI 4BH7B 4PB0H 2EYRA 3BPLC 2CGRL 1XGUA 4WJ5B 3STLA 3TCLA 1HIMH 4GRWB 1D5BB 3ABZA 4GMSH 2C3XA 5DC4B 1YJDH 4M1CC 2Y5TA 2DM4A 4XNQB 2Y1VA 5H94B 1JCKA 1F3JB 4J3OC 1U91B 3OXSB 4JZNB 1RI8A 1HQ4B 3QULB 4GG6A 3LS5H 1XGTB 1MCJA 1SM3H 2BNQD 3MNWA 4O02H 4RIRA 1A3QA 4O2EA 4NBZB 2UUDH 4JO3L 2IH3A 5EZOL 2YBRB 3DARA 2DLEA 4GW1B 4S1RH 3WFHB 2MKLC 4XPTH 3W5NA 4CBPA 1S9WB 5I18L 3P0YH 5D1QC 3VFTB 5EU4B 4ZFZB 3LN9A 3ECBA 5A2JH 3N1GC 5IR1B 5ESVB 3SE3A 4NQEB 4RSVA 3SEPA 1WBZA 3TC9A 3D3VB 3S34H 5FXCH 4CW1A 5DR5H 5FECB 1QBML 1ACZA 3ESVF 3BPLB 1T5XB 4RQQA 5TDOA 5D7SL 1YEIH 4I18C 1OTSD 3BXNB 2IGFH 2YHGA 5J0BA 1T1WA 3W11C 3ROLA 4X80H 3O41B 2CR3A 3SY0A 5FOBB 2C3HA 5AUMA 1IGJA 5DD0L 3QT2A 5EZJB 4GKZB 1JTPA 3CVIH 5ADOL 4I2XA 1WCQA 3S3PA 1IEAA 3D9AH 2VQUA 2FGWL 4YHPA 1YUHA 1NFIA 1DQJB 2V5YA 2FECL 1OT1A 3FQRA 3JVGC 1ZLUH 2YN3A 3MJ9A 3RHWF 3MLWH 3S5LB 1QRKA 2BVPB 4FP8H 3UYPA 4FFVD 3SKUD 2ZCLL 4IMKA 1FFNB 2OSLA 4I77H 3CDYA 3TBVA 1MRFH 4TVPH 4Y4HC 4YXLL 4KKAD 3VFNA 1ZANH 1YNKH 1PZ5A 5D1QB 3V0AC 3P0VL 5CGYC 3TT3L 2C7UA 2FH8A 3WFDL 1BECA 1N7ML 3EO9L 2GCYA 3QEHA 3VMNA 5L2JB 3ZDZE 4UT9H 4Y8DC 3FFCE 3A6CL 3B9KD 3W9DA 4I18B 3KPRD 2H8PA 1MQKH 2WAHA 1MFNA 3QWRA 1BPVA 5C0BE 1HXYB 5I71C 2X1WL 3ZKMC 1GGIH 3IXAB 4WO4D 5EU3A 1FCCA 5ICZB 2BNRB 1PBYA 2BFVL 1LO0L 1CQYA 1DQDL 3RWCA 1WGOA 4MNQB 5CUSL 4BSVA 3GKWH 1MCSA 4QRRB 2PXYC 3HCVA 1P1ZB 4NCC2 5DC0A 5F9OL 4Z7UF 1OP3H 4C58B 4Y4HB 4NKIL 1K8IB 2FCBA 4ACPA 3KPRA 3O8XD 2ATPA 4YWGH 5TQ2L 4JN1L 2OJEB 3GK8H 4YXHL 2CLZB 3TH4T 1P4BH 2H45A 2OR7A 4HUMB 5ILTH 1MJUL 3VXSA 1NCTA 1HDMA 3ARGC 3N50A 4M6OL 4UBDC 2ZCKL 3DNKA 1CL7L 3R0MA 5ID1A 2BK8A 2VLKA 3GSUB 5FGRA 1BMGA 2NY7L 2IG2H 3QEUA 3ZE0F 2V2TB 4NO3A 3VE0A 3FMGL 3QUXC 4QRSA 1NBZB 3HLAB 2PW1B 3F7QA 4MNGA 4Y16C 5I71B 2K7PA 3HNSL 1MY7A 1RK0B 4I0CC 1L0YA 1NFKA 1QRNE 3FTGA 4NJ9H 3O8XA 4PJIF 3MGAA 1JHLH 4JPWL 5KOVC 1YEHH 2IBZY 2WINB 3ZE0E 5JDSB 2R4SH 3I75A 4PJ7B 3EHBD 3QZWB 5IJVA 1NL0H 1RU9L 1LO3H 2PXYB 3WNLA 1N0XL 1HH9B 2WIIB 3FQTA 1C12B 5DRNA 3L3IB 3TJEH 1TCRA 3PV6B 1NGZA 5CEYA 4AYFA 1KF9B 2APFA 3O2WL 2VLRA 3TT1L 1V7ML 4QY8A 5FB8A 2BC4A 4EOWL 4YX2H 2PCPA 1I8IA 1FE8L 5KG9B 2NNAB 1NEZG 5BZWA 1U8OB 4Y5YC 3E6HA 5EC2A 1S7RA 3MUGA 1KJ2A 2HYMA 3ORJA 2N1KA 3ARGB 4JFDD 3DX9B 3SBWA 4XMLL 3OKOB 5EO0A 3O3EA 4ZAKC 3V2AR 3K74B 5KTEL 5CD3A 2EEAA 3QWOB 5L0QC 4OZFG 4PGEA 5E00B 5E5UB 4G8GA 5DVMA 5ALBH 1PEWA 4ZS7H 2J5LC 3QNXB 4MJIA 3QUXB 4WHDA 4DK3A 5I1DB 1R3LA 4Y16B 4U1HB 5ANME 5BJTA 5SWSD 1NGPH 1VFAA 1IM9A 3QIBA 1OCWH 2VZ3A 3GRWA 1ZSDB 4LLMA 5CCKH 2N56A 4I48A 3EOTH 1GJIA 4KUZL 2VDLH 3BYYA 4OAWB 4PG2C 4N0YH 3H6JA 3LD8C 3CCHB 1UVQB 3EZ8A 3KHOA 3KPOB 4NYLB 4LIQL 4TQEH 1R0AH 1V3JA 4PJDF 1HXMB 1Q94A 3DVNA 2FYYA 1UWEH 1AGFA 1EHLL 3G6AB 1UB5A 2DQIL 1CIDA 5DJ0A 4BZ1H 3QH3B 3BEWB 2P5EB 1OLLA 3PDDA 4IOIA 3O3AB 4QOKD 1IGTB 1K6QL 2WQRA 2Y07H 3KLHD 4Y5YB 3Q6FB 5JPNB 2KZ1B 2VWEC 2DLHA 2DQUL 3PWUA 2YC1B 2F5AH 4PJDE 3WHE0 3TIDA 5DMKB 2HJKB 3T04D 1CXLA 4F7PA 4XBGB 4ZAKB 4Z7QF 4F7TB 4U0RC 4YBLC 5L0QB 1RZIB 2FRGP 4UUJB 3QPQD 25C8H 2J5LB 4KUCF 3VDAA 4K23H 1OGTB 3IDXL 4HPYH 2XNAA 4XRCA 5IKCA 2HFFA 2HRPL 5CIPH 1RJZA 5J6HB 2VDRH 1HILB 1VFOA 4IDJH 1Q0XH 4TNWK 4XC1L 4BSWA 1Z3GL 3U0WH 3CFBB 2F5BH 4JE4B 5JNYA 3T3PF 4L4VD 1FNFA 2AKRB 4QOKA 3ARDC 2UZXB 3HS0A 5HGHA 2Z91B 1F4YL 4GUPB 2VDNH 3DLQR 1D9KA 3NMEA 1NBVL 4OLYH 5BRZE 5IBUG 1YEDB 3QFJE 4LASH 3EYUL 3K2UH 1AHWA 3VCLB 5HVFB 1S7QB 4DW2H 4TRPL 2WUBL 1MFAH 1ACYL 4R90H 2EECA 4X5LA 1MI5A 2DL9A 4DGVL 1X5GA 5F3BB 4WU5A 4Y5VC 2OBGA 2VXTH 3CFKB 2I9LA 3EFDL 1FC1A 5B39B 3MLTB 1XGYL 3CPLB 3RWGB 1A4KB 4U0RB 4YBLB 2ZOLA 1JUFB 5DDHA 1NEUA 3KYKL 5D9SA 4K8RL 5K9JL 5LWYH 4H8WC 4LCWB 2HJFA 4K07A 1CGSL 3DJ9A 1QFWL 5L9DH 3QRGL 1R3JB 3OKNB 4GKNA 5I74C 2CK2A 4LNRB 1YN6A 2H9GA 1X5ZA 5IVXA 5F7DA 1RUPL 2D7TH 3D25A 4YEFA 1W0VA 3VXMA 4FXKB 4NHCH 5DD5L 5DJDA 1MHPH 4P3CH 1QSED 1HZHH 3ARDB 1A8JH 4FABH 1KJMB 1ZHBB 3D18A 2W65B 1MCDA 3QUZA 3ULVC 4TTDD 3TYFA 1NGWA 4OCYH 4LCYB 1T03L 4RRPA 1LEKA 1S9YB 1MAML 3U30C 1MVUA 2CMRL 2XTJE 4LSPH 1NMBL 1OT2A 2BERA 4Y7MA 5GISH 4WEBL 1AO7E 3L7FB 4NQCA 4FZ8H 5KSAA 2JCCB 4Y5VB 2VOTA 2XWBB 4PP2B 2AI0L 3JTTA 4HKZA 4C4KO 1PLGL 5CGMA 4U1KA 4X7DC 3TA3C 1GH7A 1QSEA 4OBRA 3GMLA 3WHXA 2EYRB 4YHZL 3STLB 3TCLB 4X83A 3HZYA 4X9FA 3ZE2E 5DWUH 4HSQA 2R2BA 4P48A 5I74B 2VXVH 3P73B 1T0NA 2E6JA 3ESUF 1U41A 3G5YA 2Y5TB 2NYYD 1A4JA 2YZ1A 1J1OL 4ZO7A 1L6XA 5JA9A 1BJ1J 2NXZC 2EDQA 5F8QC 4MQ7B 5FO9A 5IEHB 1YMHA 4U31A 2HN7B 3O0RH 2ICEB 1ZHNA 1MFEH 2A0LD 1UWXH 5DMYA 1DBAL 4FTVB 3AAZB 4OLXH 3L7EB 4JO2L 4IMKC 32C2A 3B2UD 4N0UB 4X7TB 1MCFA 1LDSA 1NBYA 1HE7A 1MFBL 2DQJH 3VGDA 4R2GC 1U3HD 1UWGH 1FV1A 3BP4A 1XIWC 1MJ7L 2VDMH 2Z4QA 3VGAC 4DK6A 4LF3A 4NKMB 4YGVA 3BISA 3VI4F 3OPZH 3QO0B 3U2SB 4HUUA 1WBZB 4F58L 4K55A 4EI5D 2W9DH 4Z77A 3TA3B 2IPUK 4KHTL 3RGVC 3VFSA 1KCUL 3R8BB 2XQYG 2EIBA 3PWPD 5IB2A 1KIQB 1S7TB 4LIQE 1T20B 4X6EB 3UPAA 2ZOKB 2RHEA 3UJJL 4JHWL 4Y2DA 2J8HA 2P8MB 1HCVA 4PRNB 3RVVD 1IAIL 3IF1B 2DKUA 4WEUD 4KGLA 2NXZB 4M5ZL 5GJSL 3SDDD 1M7IA 3WFCL 2VERN 1J8KA 4X7EC 5LCVL 3LEYL 4YHPB 3F5WA 2D0HA 1U8QB 4PJ9A 2F74A 3U48A 1PQZB 3CDGA 3DX8A 4H26B 5J4MA 2CIKB 4K94C 1RZFH 3MUJA 4P4RA 3QUMH 5D8JH 1MCWW 3KPPA 4R2GB 3QDHA 2K7QA 3EOAB 1PZ5B 4H1LA 4Y19E 1XIWB 5IW6A 3VGAB 4EUPH 1ZHLB 1I9JL 1MJ8L 1T6VN 4XHQA 2C7UB 4N5EC 3S35H 5JQ6H 1O5DT 4BJLA 3LSOA 1D6EB 1KLUA 2ESVE 4P59H 2ZUTA 4K3JL 5BQ7B 4PRHE 3SDDA 1RIVL 4PPTA 1J1PL 2EH7H 3RGVB 5DXWA 1B0RB 4MD5B 4PJBE 1JGVL 1OGAE 5T1DL 3HUJA 5B8CA 3UC0H 1KB5B 2XZAH 4I3RL 2VJXA 2HTLD 4KTDL 4XNXL 3NCMA 2CKBL 1U8PB 2XN9B 1JGDB 4QXGH 3BUTA 2FO4A 5JXED 4AG4H 4ODVH 1T04A 2D9CA 1QLFA 4RGNB 2EXYD 4PBWD 3C9NB 3GMQA 3ZL4H 4NKQB 3OR7B 4NO0D 4I8DA 5E8EA 3G5XB 1L9NA 4K9EH 2AGJH 4QHMA 4HBCH 2IQ9H 1MF2H 4XBPA 1JYWA 3HC0A 5EUOA 3K1KC 5FKPA 2UVFA 5BOPA 2ATPB 3L9RB 3H3PH 3HAEG 1JHTB 3KPNB 5IG7B 3MXVH 3I6LD 1FIGL 3BKJH 5JXEA 1XGQB 3SBWC 4NRZB 4XZUA 3ARSA 4ZSOB 1WZMA 5HYJD 1MH5A 5KVFL 1QFHA 2O5ZH 3GMRA 4HKBA 4M4RA 4TULL 3QEUB 4OCMC 3GI9L 2WWMC 1YNTA 1J12A 3BIKB 3U0TA 3JV4B 4NO3B 4QXTB 1QBBA 1NAMH 3T8XA 5DD3H 3MJ9L 2DQFB 4XTRC 3VXPB 3VFVA 3ARWA 4O9HL 3OG6B 1TQBC 2ICCA 3FTGB 4KTEH 4LLVB 4JM2F 1DN0A 1A7PH 3DSFH 1FO0H 2EH8H 3I75B 3IKCA 1UXWB 4NZDA 5AEAA 3KYAA 1QLRA 3JTSA 1K3IA 5JZ7D 5C9JB 1EGJA 3D3VD 4W6XB 1D5ZA 3LPFA 3KR3L 2X10A 1YQVH 5HYJA 1KELH 4FQ2H 4QRTA 4E41E 4G42A 1BX2A 2RGSA 2ADJB 4YEEA 5EDXA 5GGTH 4XHJC 5TGBB 1NGZB 4XAWL 5E4IA 2YA2A 2CD0A 3N9GL 4M1CD 2X4NA 5IUSA 1A9EA 1NC2B 4FQLH 4H0HB 4M3JA 1NAKL 5FDWB 1S7RB 4KDTA 5F97E 3L5XL 1YEJL 1QEWA 1XEDA 2CLRB 1T22B 2ICWJ 3O3EB 4JFPB 4YPGB 5CD3B 5SV4A 1CFBA 3C6SA 3RFZC 1UACL 5JQHC 3MODH 2X4RA 4G8GB 4OD1H 1H8OA 3QIWC 4HAGA 3N0PB 2J8UF 1JZ3A 3MLYH 3CJJA 4FFYL 2D7PA 4KGJA 1HKLL 3K8MA 1KC5H 3KPSE 1TQBB 1IM9B 1NFDB 4PGDA 5MEQA 4JB9L 5D1QD 1N6UA 2WBJB 3KXFB 4HJ0C 4YHNA 1JPST 3QQ4A 2J8UE 3RJDA 1I7ZB 5ADPL 5BZDB 4WUKH 4QO1A 4ZFFA 5E5MA 4JPVL 3RWDA 4IRZH 4JKPH 4J7RA 1BWMA 4FQ1L 4ZS6C 3LV3A 1NDGA 3SGKA 1OAZH 5LBSH 4GG8A 2DQEL 1AE6L 3ARYA 1TIUA 2EC8A 4XMKH 43C9A 3TV3L 5KAQF 2AEWA 5CAYB 1JYVA 4IMLA 5K9OB 1MHEB 3NGBC 4LQ1A 2H2PD 5IM7A 1ZHKA 1S8DB 3V52L 1FGNL 4NDMB 4PJ5D 3MLSH 3AM8A 1CT8A 4R97C 1BLNB 2ICES 3PNWA 4PRDB 4D0CB 4ORGB 1LE5B 1RIHL 3F58L 4HC1A 4A6YH 2LVEA 1ES0B 4MNQD 3QIWB 2Q6WB 5FYLD 5DK3A 1FZKB 3GSVB 4G8IA 2HJLA 4AEHL 1CTNA 1BZ7B 3ARFD 4F57H 1YEEH 4Y4HD 4OSUL 1CD9B 1YY8B 3WXWL 2UWEA 3X17A 2UUDK 4X5XA 1P7KA 5CGYD 4GG6F 1UADC 3WIFA 1B4JH 2V9TA 4IDLA 3C08H 2R69H 3ULVF 4RFOL 1QSFB 1U8KA 5L8JB 3QUZC 1DQMH 3IDUA 3QXTA 4M7LL 2CRIA 4ZQKA 4JG1L 1SEQL 1KJ2L 2MMXA 3V9FA 3WNNA 2WNGA 3VXTA 5F7WC 3GI8L 5CINH 1W0WA 3VD4A 4NOBA 5FHBL 2UY7A 3QISA 4WI6A 3G6JB 1KULA 3PQYA 5IFHH 1HHJA 4OQTH 4QRUB 4C56B 3NGBB 5DMIL 4LDLB 3WFBL 5J3HD 3SDAD 3ZKMD 5KSAC 1DBKL 3BKYL 4AL8L 3VA6A 3IDIA 4OZHB 2YRPA 3AUVA 4R97B 2I9LB 8FABB 2VLLA 4OZGB 3MYJA 5CWSB 2E7CA 3GRWL 4G6KH 2ZOLB 4HUWA 4LFHD 1G7QA 2QQNL 5D9SB 4W81A 3R1GL 2FHFA 1SJEA 2DQGL 4QKXB 4WI4A 5BOZG 1WFTA 4CJ0A 2O5YH 3D39D 3SJVB 2H9GB 5F7DB 4GBXD 1ZLUK 2BNQE 4O2CB 5EIIA 4DGYH 2WWKO 1WZ1L 2BHZA 1IQWH 3KJ4B 2OR8A 4BK5A 2ENYA 3FHQA 1PKQA 2X4TA 3U7YL 3QUZB 2AJZA 4YHOL 5HYQA 3TYFB 3MFFB 2XA8H 5DHYA 1S7UB 4I2XE 3CVHH 1R5VB 3OKDA 1EXUB 2BRRL 2MCG1 4JN2A 5GIRA 1MVUB 5C0AA 3V5KB 5FGBA 4BM7A 4DAGH 2J3SA 4XCFL 5KAQG 1A02N 4OLVH 3TYGH 1VEMA 4B0MM 4NO2A 4MA8H 2WUCL 5GGVL 3ZMRA 1KTLB 1M6OA 4JQIH 2JK5B 1LK3L 2YK1L 3GMLB 4R4BA 3O2VH 3NIDE 3MRJA 1ND0A 4JQXA 1CFTB 5JOEA 3WUWG 4F2MB 3TWCH 4O2FA 2R2BB 1T0NB 3F12B 3J7HA 3QEQD 3UBXI 3G5YB 3T4AB 1A0QL 1NDMA 1L7IL 3MV9A 5DTFA 2P5ED 1RVFH 2J4WL 4DN4L 5C0RL 1OP3K 4PJ9C 3HR5B 4JDVB 1GIGL 4X99A 5C08D 4YDKL 1ZHNB 3O6MH 1CXIA 3ZYIA 4P57B 4ZAKD 3V5DA 4LMQE 3QDJB 4JFZL 5ALCH 2AJXL 1NBYB 3DYOA 3EO1A 1N8ZB 3OGCB 3LHPH 2P42B 1FV1B 5C0DA 4LF3B 5SV3A 1KTDB 3QEQA 4F7CA 4M8QA 5HPOA 4OT1H 3I6KA 2IALB 4LAQL 3HZVA 1HI6B 3KPRE 4E5XB 1AKJD 5ICXB 1MFCL 1BIIA 4TSAL 3ISWA 3VFSB 1CFSA 3S36H 4L1HA 5C08A 1D5XA 2DWDB 4LVOC 5IB2B 4YBQC 1BAFH 4HQQH 4HS8L 2BMKB 1IBGH 1UM4L 1DBJH 1CFVL 2DLGA 4HK3N 5GHWH 3PHQA 3QCUL 3KYMA 2AV7A 3QHZL 3S37H 1MQ8A 2VLKE 3CFJB 4NPYB 4JDTL 3VFOA 4CADB 1U8LA 3B9AA 3GM0A 1JZ7A 3T2NH 1CDIA 2PR4L 3F5WB 5GS2D 4PJ9B 2Y36L 5F9WB 2F74B 5KVEL 1TNMA 2QLVB 4H5SB 3GJFA 1GOGA 5C2BL 4JY5L 1DLFH 2DM3A 3EDJA 1INDL 2ZNWA 5F70A 3MJ7B 3CAFA 1JVKA 4LSVL 2AXFA 5LGHL 1ERNA 2DTMH 3MRIA 1GOFA 4OM0L 4PJGB 4JZJA 1ZV5A 2VABA 4U1NA 1KCSL 2OTUA 5ESQB 2FX7L 4F3FB 1OM3L 4Q0XH 4P9HH 5B38G 1CGTA 3L3JA 12E8H 4XPBL 4DKEL 1K85A 2EZ0C 3BSZL 1GRWA 3ARDD 3U6RA 1VFMA 4HGKC 4LVOB 1FZMB 1KB9J 3QO1A 4ODSH 1HYRC 2FX8L 4LSQL 1WUNT 3HG1A 3V5HA 3A6OA 5DSCB 4LHUA 2FO4B 4LLDB 4NWTL 4XPFL 3ILPB 1NC4B 5D2NE 4ZFGH 1S7VB 3QJFB 2XICA 3HZKA 2E27L 4XVJH 4U49A 4N90E 1II4E 1TDQA 4LLAA 4CUCA 3QIUA 4Z78B 1QLFB 3SKNA 5JXAH 3LQZA 4NUGL 5CD5C 1EPFA 4I3GA 5D7LA 4LRNH 3BP6A 3NFSH 4PUBH 4QHMB 4OZ4A 2VO5A 1BJ1H 3TPKA 3PIQA 2Q87A 1UCBL 3AS2A 3IJSA 2R56L 2PYEB 2F58L 3RX5A 3C2AL 4JFDE 4P2OA 4HHAB 1SMOA 3VMOA 1SMAA 1Y0LA 1AIFB 4PLKD 3LZFL 1AQDB 4KDTC 3QCTL 3C87A 2X40A 3O45B 4N1EA 2EIZB 1KBGH 2NCMA 3ZE1F 1AR1D 2AJUH 4F33B 1QFUL 1QACA 4J1UB 1J11A 1I1AA 4ZTPH 3DOSA 4KI5C 4PJEA 3V7AE 5K59F 1T1YB 1DN0B 1YEGH 5DD1H 2IPKB 4TOYH 3GHEL 1ONQB 4G43B 5E8DH 3ZSTA 4PJHE 5F1NA 1QBLL 1C1EL 1RUML 3TPUA 3JTSB 4ODTL 4I0PC 2VSDA 3WFZA 2ZSVA 1QKZH 5E7FA 2VZOA 1G6RA 3HN3A 1U6AH 4JFQA 4QF1A 3L6FB 2FD6L 4RWYH 3SGKC 4QOKE 4K3DL 1L7TL 1KEGH 2Z8RA 3LKSB 2XWTB 3IAGC 5IHUL 1HOCA 3FCTA 1CLZH 2D03H 5IMKA 5B4MC 5F6IC 4LSUH 4XGZB 4NQXB 1BD2A 2W0LA 4ELMA 5FV2A 2NXZD 4HX1A 2JELL 5I6XC 1UZ8A 5E94A 4XVUC 3O2DA 1ZVHA 3MGTB 1XCQA 3CFDA 2JJWA 4F37F 1NCNA 2X4RB 5CZKA 3KPTA 4TSCH 3WDHA 5D6DC 3MV7B 4QYOA 5IVXF 4JQVC 4L4VE 5D7IB 3GMPA 1G1CA 4AY0A 1I9RH 2CIIB 3SKOA 3OV6A 1A6VH 4FN0A 4DQOL 4PGDB 5MEQB 4Z0BL 4FMKA 1DUZA 1VADA 3M8OH 5I2IB 1D6VH 1RZGA 4YHNB 3FB7B 1I3RA 3QQ4B 5D1ZD 4I0PB 4P5TB 3DXAA 5E8PB 3QUMB 1QNZL 2NY1D 1BFVL 3D0VB 2O61B 2A6DA 3VXME 4X0KB 5HYSG 3MBEC 3PHOA 1VA9A 2BOBA 4O5LH 3MNVA 3C6LD 1GSMA 4MA3A 4HIXL 4KRNA 3OR6B 4YBHA 1FYTD 2XN9D 3BIAX 5F6IB 5A2FA 2M26A 4GFTB 4LU5L 1T2QH 3D69B 2BCKA 4JPKL 4OZIA 1MRCL 3SOBH 1CT8B 3WLWC 5I6XB 5KBNC 2Y7QA 2Y5EA 1RZKL 2DF3A 4M6ML 5KZCB 1TZIA 2FATH 3FO2A 4XNMA 4RGND 3RIFK 1WEJL 4YR6B 3V7AG 3VFPB 3K7UA 2WSKA 3EYFB 5IHLB 1KCKA 1KN2H 4NQCE 4Y5XC 3VI3F 3ULUC 1K4DA 2MOVA 4HXAL 3OXRB 2HJLB 1MPAH 2PKDA 4TUOB 4Z8FH 1W0YT 3X14A 3QCVL 1QSEE 2GK0A 1YY9D 3E3QC 4PRIB 5DHVH 4X8JA 5BVPH 4DEPC 5L2KA 4X5XB 3HR6A 1UWXK 1P7KB 1FYTA 3HPLB 4BYHA 1UQSB 1IC1A 3H9SD 2PO6A 1Q9KB 1KNOA 2HVKA 3QDGA 2L4OA 2YR3A 1DTUA 4WHCA 1AC6A 2MQ0A 4POZC 4OFYD 1JYXA 3ZTJG 1Q72H 5IBTL 4OCWL 1QP1A 3ZHDA 3MBEB 2A83B 4JKMA 1P2CB 1Q9LB 5DQDL 3VWKA 4N9OB 1IL1A 2VZVA 3PQYB 1R5WA 1RY7B 2B4CC 5DJCB 5IQ9B 4QNPE 1RFDH 3D5OF 5D5MA 4JFFD 3Q6GL 5F8RC 4G80B 2A73A 3OKKA 3IDIB 4OV6F 3BRFA 2VLLB 4EBQL 1EMTL 3H9SA 4YPJA 1F8TH 2DJUA 4XXDA 5IEKB 1G7QB 1U0QA 3PGCA 4Y5XB 1A6ZB 4OB5L 1SJEB 4OFYA 5IBLD 3DGGB 2OQJB 2GUOB 2HLFC 4JKWA 1RMFL 4HFWB 4JANB 5J6GB 5DJ6B 4DEPB 1ZT4B 4R26L 1H5BA 3LKQB 2EKSA 1P4IH 5DJXB 3CIQA 1PKQB 4EN3A 1FAKT 1NGXA 2X4TB 4JFFA 4LOUC 3EO0B 2AJZB 5H8DA 7FABH 4XNUL 4PYHA 1IARB 1RULH 5EFIA 5JIIA 5L8KB 1Q9WA 1MCLA 1KN4H 2X2YA 4PG9A 3BMWA 4U6VL 3MUZ1 5C0AB 3GSXA 4FQHA 1SYSA 2VYRE 3HI5L 2EC9U 3B83A 1D5IL 3INUH 2XZQL 4HCRH 5EORL 1M6OB 3PWPE 5DJZB 5KN5B 2WBJD 4D9RD 1SBSL 1D5MA 3HUJF 2W38A 2A77L 2VKWA 3TNNA 1FNGA 4TVPD 1YPZB 2XY2A 1KENH 1T0PB 2GHWB 3PWVA 4Z5RA 5MI0C 4Y1AD 5IROC 1LDPL 3L3KA 1EEQA 2ITCA 4PP1C 5GSVA 4JCLA 1RD6A 1M71B 1IEHA 5BXFA 3MRLA 1IM3A 2G5BB 5KSBE 1ADQH 4XMPL 4YFLI 5EUOF 2J6EH 4PJCA 4PS4L 3FO1A 3LS4L 2NY2D 3JXAA 2XKNA 1FZOB 3IRPX 4C4KT 3RPKA 1DJSA 4WY7H 2E7LC 5J11C 4PB9H 5C0DB 2ID5A 2NY0D 3ARPA 4BUGA 2RFXB 3CZJA 4M8QB 1O0VA 5EUOE 2GY5A 3I6KB 1C16A 4HJ0D 1DSFH 3HNVH 4J2XA 1I3VA 1PW3A 1F4XL 1V3LA 4E9LA 3HNTH 1XF5A 1VFBA 1RIUL 4PTTA 3DPBA 4YHLH 4ZS6D 3TBWA 1F6AA 5MI0B 3CSGA 3NAAL 3DVGA 5KOMC 2AV7B 5F1SA 4FXGA 2YKLH 1QR4A 1W72H 4G6JH 4C56D 2B1HH 1IAMA 3QHFH 3QIUC 3CX5J 4OUUA 4KY1L 5KS9A 3BYTA 2A9NL 2CXKA 1VACA 5TDNB 4ZD3L 1IAKA 4OLWH 1EV2E 4NO5A 4KKLD 2VL5A 4X9GA 3I6LE 3T0EC 4TYUA 4ODWA 2N7BA 2BX5A 4H1LG 2UY6A 5HPMB 4OJFL 3QBTB 5F9AC 4Z7VA 5J11B 2GJZA 4OI8A 3HI6L 3H9YA 3MRIB 4P2OC 4LSTL 4ISVB 3ILQD 4FZEL 5C7XL 5DJ8B 5K9KB 3NABL 2AABL 4U1NB 5HYJE 2CH8A 4R3SB 3SJVD 5IGXH 1K5NA 3LPGA 3GUTA 3OKLB 3FOMA 1NLDH 2RCSH 1JF1A 4WI8A 2D3VA 5FYKU 3QG6B 4H88H 1XF3A 5E2TH 2G75B 4LQFL 3U6RB 3ARUA 2YPKA 4WU7A 3FQWB 1MIMH 4FG6C 3LKOA 2YEZA 3QO1B 5IB4A 2VDOH 2CRYA 5D7IF 3HG1B 5H2BB 4KI5F 2CLVA 1I1AC 2H6PA 2H26B 5INDB 4MWFA 1Z5LA 3FB6A 4IIQA 3QFDB 3FZUD 2NPLX 4X6CA 4IEFB 3W2DH 1REIA 3D3VE 4FQIL 2QQKH 3QIUB 5IV2A 1L9MA 3SKNB 1FH5L 3LQZB 1P69B 4R4FL 5CFHA 3FHAA 1MREL 3DX6B 4WW2A 4DTGH 2FEEI 2VISA 4Y88A 2ZUSA 3H9ZA 1WZKA 1QO3B 5IWLA 1PDKA 3IT8D 3LQAH 3T0EB 4U6XA 3WIHH 3MLVH 3JSSA 3IJSB 4DVRH 3ZHKA 4NZTL 3O11A 1GGBH 4APQA 3TZVD 3I50L 3SQBA 1WITA 1Y0LB 5ID0B 1ZT1B 2BVUA 5FA3B 2R9HD 4PGBB 4PLJD 3LN4A 5MERA 4LARH 3UDWA 4G9DB 2NY5C 3TNMA 2EE2A 1M4KA 2KQNA 4X9BA 3CXDL 1F13A 4N9GA 3L5WA 3P30H 4KPHL 1GZPB 2HFEB 2D7NA 1BQLL 5CJ8A 5I1AB 3VW3H 2AQ3A 3BAEL 3WJJC 1IAOA 5F6HJ 1HH6A 1YYMH 4HV8B 3QDJD 4WI3A 4Q9RH 1QTYT 3FT4B 3L95A 2AEQH 5GS1A 2O93L 1OB1B 5ITBH 3VXUD 4ZNEE 4CJ1A 3S4SB 3VMPA 2QADD 5ETUB 5F1NB 3TPUB 3MLXL 5I8CA 1UH3A 2UWEE 4QHLA 3QEGL 2WQ8A 4X98A 2ZWLT 2VXUH 4WNQA 1ZLWH 1AGBB 1KCVH 2R1WB 1RZJL 3C5ZD 3CH8A 4PJ5E 1F4AA 4PV9A 1HOCB 3FCTB 1CLOH 5IMKB 4HIIA 2YSSA 4L5FL 4YDIH 4UTBH 4ONHA 1VERA 4X4XA 1C7SA 4XCNB 1GAFH 4AM0A 5JLZB 4ELMB 2BHUA 4MNQE 2XKSA 4WDIA 1AGCA 4WTWA 3HE6D 2Q8AL 5D72L 5FYLE 4KHXL 4HDIB 1S9XB 2ED7A 4U6YB 3Q1SL 4FA8A 3ULUF 2NW2B 3VGGA 4ZPVA 4UU9A 5KSUB 3RRQA 4M02A 1EHXA 2FWOB 5D71L 4MSWA 3V8CA 1BOGB 2VZSA 2Z8SA 5GRWA 3TESA 3C5ZA 4GAYA 5FO7A 3UTSD 3QUYD 1CFQA 4U3HA 2DYPB 4UV7L 3RI5K 2YUZA 5F7EL 4UV4L 1ORSB 4P4KD 4ERSL 2PO6C 4GAGH 2IC2A 3OF6D 1F58H 4PV8A 5DUPH 3HE6A 3VXRA 4PIRF 5T5FL 3CGTA 2QSTA 1JPTL 1DE4A 3F62A 3EJYD 2RAMA 4HWBH 4JM4L 2MWCA 5B3JE 4L8BA 2QKIA 4M1DL 3GDBA 4R7NB 4YBQD 3VWKC 2BOBB 2UZIL 4XI5C 1PYWB 2AJ3A 2OX5A 5AYQA 4JR9H 1F4WL 5EU6B 2R4RL 1G7HB 3ARRA 3HMWH 4OZIB 1DBMH 2BCKB 3QUYA 2FHBA 3LKPB 5IW1B 1NLBH 2AK1H 2F54A 3FO2B 3VFWB 1LHZA 1IC4H 4ZO8A 2QL1A 5FKAB 4PY7A 1S9KC 3D39E 1EBAA 4YJZL 1DR9A 1CL7I 1K4DB 4O00A 4GS7C 5CSZA 1T1XA 4D3CL 2HT2C 3RVUC 4NKOA 5AYUL 3IS0X 4X8JB 3VRIB 3P9LB 2PYED 1XF4A 3C5JA 5LQBH 3WE6B 1BVKA 3U9PL 2YUXA 3I3EA 3GNMH 2V2WB 5FM5M 4FNLH 5IFAL 3DRQB 2HVKB 4U1IB 1CXEA 4WUUD 4EIZC 2B1AH 3AS3A 5FV1L 5E9DA 2CDFA 3MCKA 4EN3C 3MOBH 2VXSL 4XXCA 1MWAB 1CGVA 1PG7W 1IGIH 5CJXA 1F3DJ 3O2DL 1U92B 3VWKB 2H32B 1F3RB 2PN5A 4ODXA 4MXQC 4RAUB 4J8RB 4P5MA 1R5WB 4UDTA 4GMTH 4F9PA 4ZUWA 3WO3B 1H3GA 1N64H 3PP4L 1V8HA 2AXGA 3EDFA 1RPQA 3UTTA 1R3IH 4HXBL 3E6FB 3WXVH 5HJ3A 4WUUA 2EICA 3PGCB 1TPXC 1U58B 3QEQE 3QDMB 4LAJH 2BP3A 4MAUL 5FYKL 1EJOH 5FO8A 5I1KH 5L7XH 3THML 1EO8L 4DCQA 1AH1A 1H0DA 1TMCB 1WK0A 5F44A 4BUHA 4GS7B 2P5EE 4LVHC 3IFOB 3W0WD 3U4EB 3SPVB 1UM6L 1X7QB 3H0TB 2ED9A 1UM5H 35C8L 4BQBA 4HFUL 5C08E 1AGDB 1F42A 4Z76A 5JHDB 1IGCL 4AQ1B 1L6ZA 3NBNA 4GRMB 2YRZA 4EN3B 1A1OA 4JLRA 2VAAA 3SCMA 5F7LB 1QSVA 1AFVL 5HGBB 5E6ID 3QA3B 2YD2A 2EDBA 1QOKA 5DJYA 4LFHG 5EBWA 1C5BH 3MRRB 3PWJA 2R8SL 4PG9B 5DVKA 1YMMB 1MHHB 2P8LA 4NZRL 4NJAH 1BBDL 5HHQA 2I5YL 3U36B 3IVKA 1KXTB 2IPTH 2W60B 4EDXA 4UZGA 4A2MA 1JF5A 4OGXL 4JJ5B 5HGDA 3WL9B 3VH8A 2EKJA 4GLRI 2ZJSL 5DI8A 5HD8D 2J7LA 4FQJH 5CMAA 1D5MB 1E27A 2E7BA 1TPXB 4P5TD 1I9IH 4JVWA 1OW0A 3HPJA 4X6FA 2X4SB 1IT9H 2OJZH 5E2WL 3VXQB 4IS6A 5E6IA 2G9HB 2WWKT 4FOMA 5FA4B 4G7YL 4LVHB 4NC2B 1ORQA 1NMCC 1LEGA 1S3KL 2VWEE 2OM5A 2CR6A 1OSZB 2P5WA 1G9ML 3IFPA 3X11B 5E8NA 2DRUA 5B4MD 4X7FC 2HT3C 4O58L 1NCBH 4NM8L 3LIZH 3K46A 4OCNC 2ZKHL 4GRLA 4PYGA 2XPGB 5FEBA 2HWZL 3BO8B 2AK4A 1J5OL 5BXFB 1DBBH 5I66A 3ARVA 5T3XH 3MX0A 3NN8A 4PRPB 2JJTC 3SO5A 2Z31D 4LSSH 3PDGA 2CDEA 4HIHA 1CZ8H 4PB0L 4YC2B 3JWOC 1RJLA 1MFDH 1S9VB 2OL3A 4WTXA 4EUPA 3T4YB 4PRID 4GMSL 4RMWA 1JPGB 1YJDL 2IH1B 2I60H 1MLCA 3OSKA 2KDGA 2QSQA 4YHKH 3TJHD 1H3PH 1EERB 3T2OA 4MDIB 2PETA 1MJJA 5J12C 1DL7H 1Q9OA 4JFED 3LS5L 4J4PD 5J57B 5I1CH 1FG2B 4O02L 4LSRH 3MBED 4PJEF 1NMCB 1RUKL 3EDKA 3C8DA 5TDPB 2GSIA 3LKNB 4FXGB 4S1RL 2IJ0C 4WI5A 4WI9A 4GW4B 4BA8A 4BFEA 5BS0B 1E6JH 1R24A 1LD9A 1TCMA 3P0YL 1QA9B 5D7JC 4TVSa 3V6BR 4PJEE 5CGTA 1HHIA 5CP7A 4CNIB 5IJKC 4WW2C 5DURB 2AEPH 2HFTA 1KV3A 4LEOB 5E99H 3F7VA 3M17B 5EOCJ 4M6NH 3RNKB 3S34L 1H9VA 5DR5L 3CMGA 2YPLB 5I30H 3NCEB 4Y2OA 4JFEA 2YD5A 1YEIL 1L4IA 2IGFL 4TNVF 1K8DA 1JGUL 4OCLC 4ELMF 4LLYA 4X80L 1K5NB 1MCWM 3FOMB 3LN5A 5TF1H 5E6YA 5BVJB 5F71A 5IMMB 5FGCB 2YPVH 1XF3B 5IMLA 3CVIL 5DUBA 5CZVH 1GGCL 4WU7B 5DRXA 5J12B 1WWCA 3D9AL 3DMMD 1BD2E 4PR5A 5IB4B 1XZ0A 4OGAD 3KWWA 2FLRT 2D31B 2IPUG 2VC2H 5HHOD 4LHUG 2DICA 1G7MB 3MLWL 2H6PB 4MWFB 5C0IA 1HYSD 4I77L 4JRYD 5IMOA 1VKXB 1MRFL 4GH7B 4TVPL 2CPCA 4NUJB 3AREA 2VN7A 1YNKL 1FO0A 5D7JB 5I1LB 5EBMA 1ZT7B 4ZUVB 3GSNA 2GJ6D 4WW2B 3VFRA 2VISB 4MJ5A 3OJVC 5EC1B 1I8LA 4DKFH 1O7VA 3OKEB 4I5BB 2B7DT 4UT9L 5FYKE 3DMMA 1G9NH 1HSBA 5GGTA 4ZUTB 4B7LA 1A5FH 3SE4A 4ETQB 4XAKD 2C3VB 1TVHB 3BRDA 2QSCH 4OZIF 2NZ9C 1MQKL 1RZ8B 4KKBD 1JZ6A 4OZFH 1KXVC 3AB0C 4P46D 1V3MA 1N6QL 1I8MA 1GGIL 1L0QA 2VTFA 4JFYA 4Z7WB 3QSKB 1HNGA 1MAKA 4HGWA 1OARH 3L5WB 4P2QD 3FRPA 3ZDXF 2C1PB 2Z9TA 5DEFB 3QUKA 2IANB 4YHMH 1A2YB 2E7MA 5EO9B 3GKWL 4YNYB 4ZFOB 3RNQA 3V6OC 5E8OB 3MRQB 4YZFF 3L95B 3VFUA 1NSNH 1PFCA 5I8EB 3I3BA 3ZDXE 3CLEH 3JUYA 1IAII 2EDFA 4F7MA 3N1QC 4YWGL 3DUSA 4J3XA 4RNRB 3GK8L 3KNBB 4B53A 4L3CB 4HG4J 1I7UB 1P4BL 5I8CB 5ILTL 1OSPH 4S1SH 4YZFE 4RFEA 1J05A 1FYTE 2XN9E 2W0FB 2FZ3A 3STZB 1JGEB 1SJHB 2FSEA 4P2QA 5E0QA 1G7JB 5GJTH 4KZDH 3GJEB 1LP9B 3MMEB 2IG2L 3TLRA 3RL2A 3OKMB 4IRJD 1F45A 1YZZA 5D5MF 4RGNE 1F11A 1U8MB 1RZ7H 3AB0B 3NIFE 4AH2B 5JORB 3DTXA 2C3WA 2A38A 4G9FB 4HGMA 4TTGA 4JGMA 1IZJA 1JHLL 1TZHB 1YEHL 4A6YA 3MV8D 4ZPVB 2R4SL 3ZKNC 5D5ME 1UKSA 5EPMA 3IXTA 1ZEAH 4MSWB 3CSYB 1W72B 3RWJA 1NL0L 1LO3L 5FCUH 4LCCA 1KYOK 3H9SE 3FQNB 5FO7B 1HSAB 2VNCA 1SYVA 3VRJB 3TJEL 1G84A 4J6RH 4IRJA 5JDJA 1MEXH 3MREB 3RZCD 1FJ1A 4KROC 5HHPB 5DD6B 4GXVH 4QT5B 1A1MA 3MXWH 3TO4A 3LQAC 3WS3A 1NPUA 2GITB 4IOFD 2HKFH 1OD7A 3HE7A 4XXCC 1H15B 4PJXA 1DE4B 3PHSA 4IHOA 4DGIH 1INQA 4N5UA 2R1YB 4B5EA 2X4PA 4CU6A 3D2UA 4L8BB 3LKRA 5CJXC 1K4CA 3MV8A 3UXFA 2PTTA 4U3CA 4JFFE 3KS0J 3VWJD 2VDPH 4A2LA 2FB4H 3IGAA 4PJ8A 3RVTC 5IB5A 2IADA 2YUVA 3N1MC 1NGPL 3IU3A 3H9HB 4PTUB 1F02I 2F54B 1XGPB 1QVOA 3QNYB 5EU5B 3MRBA 5GSRA 1OCWL 2HTKD 2HT4C 2QEJA 3B5TA 3FT3A 5CCKL 4M5YH 4M7JL 3EOTL 3UBXB 4AIOA 1WIUA 4HUXA 3GIZH 1LNUA 2VDLL 4MNHB 3DECA 4N0YL 2DDQH 5CSZB 1F4HA 5D7SH 2LAGB 3T0ED 3FB8B 4TQEL 2NY6D 2VN4A 1CFNA 1VENA 2OTWB 2WLZA 3EDEA 2NX5B 1UWEL 4JGUA 4LHQB 3VWJA 1ZGLB 4ZDHA 3FFCA 1UC6A 2EDNA 2DKSA 4V2CB 4BQ9A 4TSBH 5GGRA 4BZ1L 1INEH 4KROB 5DZOA 5D70H 1D3CA 5E9DB 1WQVT 3L1OH 5ADOH 3F7YB 5INCB 5EU7E 2OLDA 3IDGB 4L4TD 4PJAB 5C0BA 4PJCF 2F5AL 4I4WB 4FHBD 3O6LH 4PRBA 3WEXA 2A9MH 2B0SH 3BZFA 3CVHA 2DIBA 1NFDE 4QCIA 1JN6A 1CICC 2A6JB 4P5MB 2ZCLH 3FO9B 4RZCB 4YIQB 5C09D 2DMKA 25C8L 4BZ2H 1CI5A 4D9RE 4K23L 5ITFB 3D0LA 4HK0B 4UOW1 3P0VH 4M7LT 4GRWH 4IDJL 4TVPE 4FFZH 1Q0XL 5AD0A 3EJJX 2E5EA 3MC0A 3U0WL 3WFDH 1RK1B 5I17B 2F19H 4EVNB 2X9XA 4MLSA 2R1XB 4Y1AE 1OW0C 4DCQB 4GSDH 4TN9A 5CJQH 4Q2ZA 1BZ9A 4L4TA 1XAUA 3QJHA 4LMQI 3SDCD 1JV5A 4JVPA 1JF6A 5HDLA 2VDNL 2HA1A 4PGCB 4U1MA 4KVNH 4OD2B 4WCYH 1U9KA 4OLYL 4KMQA 4OGYH 5C09A 4LASL 3K2UL 3VG9C 1J18A 3EYQC 5IK3A 5KS9F 1OHQA 1A1OB 4JLRB 1T1ZA 3SHSA 4DW2L 2FL5A 4LLUB 1X44A 1MFAL 4R90L 3P4NA 4QTHB 1A6TB 2VXTL 4ZOAA 2HFGH 3KDMA 5EBWB 1ZKAA 3PWJB 1QRNA 2P8PA 4Z7VF 2P8LB 4YAQA 2L7JA 1CICB 5LJYH 5LWYL 5F7FA 3RL1B 1FRGH 2IAMA 3SDCA 4F9LA 4LDEB 4N1CA 1E4XH 3WLBB 1X6NA 5L9DL 1X5FA 1CE6B 5GZOC 2DYPD 5HHNB 3DBXA 1CLCA 1WAAE 3BWUC 4QRPA 2OTPA 4Z7VE 3MJ8B 2EIDA 2D7TL 1T66D 3EFFA 3BWAA 2DD8H 4NHCL 4M6OH 1MHPL 1AI1L 4U1GC 4P3CL 1UA6H 1JNNL 2C9AA 4TPRL 1I7RB 4C56E 3HZMB 1WZLA 4OCYL 1LEGB 3FMGH 3IDMA 4WENB 5F88A 4X6CF 3PG2A 2P5WB 2RR3A 3BPNC 3HNSH 1A7OH 1EAPA 4OZGE 1ED3B 2Q76B 3MTRA 1RQ5A 2WIMA 1P4LA 4LPWA 4LSPL 5EU6D 1D7FA 1FN4A 3IETA 3O9WA 3V8OA 4K3GA 4WW2F 5GISL 1U93B 2AK4B 3MRNA 4X6CE 5I1IH 4PRAA 5ANMA 3RUGA 2BVQA 5DK0B 1R3HB 2VITB 4N8CH 4OCXH 4XVTH 2DMBA 5DFVC 3SJVE 1Y18A 4L3EB 2UZYB 2OL3B 1FLRH 1FZJA 4DZ8B 3E0GA 1JNHA 5DJAB 3CZFA 5DWUL 2VXVL 2G60H 2X89D 3BP5A 4H0GA 1FE8H 1J8HD 4JGJA 5D93C 1RUAH 4AEFA 3LB6C 2KZWA 4U7KA 1QD0A 1DEEB 5I0ZA 1M7DA 1IEBA 4U1GB 4GAJH 3QQNA 4U0QB 2X4OB 3O0RL 2Q7YB 4FQXA 2J1KA 3BN3B 4QHUA 3CDFA 1QYGL 3P9MB 3X13B 5HBBA 1J9CT 2GT9B 2VLJD 4OLXL 1JZ4A 2LAAA 4XI5D 1P6FA 4U7SA 3TIEA 3BPNB 5I15H 1ZTXL 2QHRH 1R24B 2DQJL 5HYFA 1QLEL 4LKCB 5BV7C 3AREC 5F3HA 4ODHH 1UWGL 3OJDB 4ZOCA 4X6DA 1QHPA 3OX8B 3VXOB 2VDML 3TBYA 1H3UA 1P7QB 2WBWB 1CD1A 3OPZL 3HAEH 5CZXC 4MJ6B 1V05A 2W9DL 2X09A 3IU4H 3QDMD 4K3HA 4ZUSB 1FFQA 1WCBA 1J0KA 3SE4C 2HT2D 3G08A 3GSWB 1DUYA 1K8DB 3MRKB 3REVB 5HYIA 3VG0H 1G7IB 2OMNA 3KPMB 4X5WA 1VCAA 3BFOA 5JHDD 5D93B 3QFJA 3QDJE 1HK6A 3PWNA 1Y6NR 3BZEA 3CXHJ 4JAMA 4JO4L 1XZ0B 1ZA3B 5CEXB 3LEVH 3KWWB 5AAMA 3MRPB 3VXUE 1JTOA 2XFXA 5DEGA 2X4QB 2HG5B 5C0IB 4LSDA 4BKLA 1YMMD 4KJPC 2W9EH 3UPRA 1RZFL 1KSRA 4MD4B 4OIBA 5IMOB 5D8JL 3AREB 4LLQB 1SEBB 1Z3GH 2XT1B 3KYOA 4DOHB 1EVTC 3RQ3A 4E0RA 3QXAA 4D0DB 3S35L 5JQ6L 3QXDA 4P59L 3OAZH 1FG9C 2P47B 3BEVA 1F4YH 2EH7L 3NFNB 1HSBB 1I75A 3QYCA 1EEYA 1NBVH 2DMCA 3EJZD 3UC0L 4M1GH 3LRSA 3UAJD 3L5JA 4PLOB 3FT2A 2DLIA 1FFOB 5FF6A 2N7AA 3LMJH 3P11H 3KYNA 1KLGA 1UJ3A 1BJ8A 4QXGL 4L9DA 2WUBH 3FN3A 4AG4L 4Q58C 3WD5H 1ZLSL 5H35A 4AT6A 2VIRA 4HUVB 5A16B 2AP2A 3QNZB 3UTSE 3ZL4L 3ARTA 3FO0H 4K8RH 1J88A 3O6FA 4NQUA 4R7DA 1AO7A 4G6AC 4K9EL 2AGJL 4LCCC 5FUOH 4HBCL 2IQ9L 1MF2L 3C8HA 3CX2A 5HTSA 4FFWD 3RU8L 5JO5A 4N8VA 4MVBC 1RUPH 5C0JB 3MXVL 2X7LA 3F6LA 4MCYB 1CN4A 3BKJL 1A6AA 1WBYB 5FK9A 2NTFA 3O3DA 4NRYA 2JIXB 2O5ZL 2V5RA 3H7BA 5CBEA 3MSPA 3GBNH 2CMRH 1NAML 1NMBH 5DD3L 5L88L 5ACZB 5TF0A 5BS0D 3NZ8A 5EOCH 4DZBA 4KTEL 4HW6A 5GGVY 5JIPA 1DP0A 3BGAA 1GC1C 2HT3D 3FJTA 1HQRA 2ZUVA 3DSFL 2HMID 4M7KH 1FO0L 2EH8L 5C0GB 3UTTE 2PYEE 4ENEC 1BM3H 4LPVA 1XH3A 4RMTA 5IFJB 1CBVH 4NFCA 2KH2B 4XPAH 4LCCB 4M62H 1GYAA 4WUUE 2YPLD 1YQVL 1KELL 5A3ID 5DHVA 1DVFC 1SYVB 2R0LH 5JPMA 2VE6A 3KPQA 5GGTL 2I9TA 3UTZA 4BFIA 3NTCH 1ZGLM 1MCRA 3K1DA 3GMMA 1A3RH 3PL6D 4ESKA 4FQLL 4HKXB 4AQOA 5E03A 3X3FH 1KJVB 1MCOH 4IHOB 1INQB 4K7FB 3C8KB 4PY8J 4XVSH 4ODUA 3D2UB 1Z9LA 1DBAH 1TJIL 4MQSB 2VZ1A 5J1AA 3MV11 2PTTB 2FX9H 3T1FA 4HIEA 2BVOB 1FL5A 1T0MA 3VD3A 3MODL 5T33H 4OD1L 2UVEA 3JWDC 3U4BL 1T5WB 5IB5B 4L9LC 3MLYL 3OWEA 4KV5E 2HLAA 4R96B 2XRAL 5IHZA 4Z7OF 1KC5L 4JVUA 4KKCD 4Z95L 4OF7A 5D7JD 3W0WE 1EHAA 2YD1A 4HUXB 3PL6A 4Q6IC 4KHTH 1ODAA 3LRHA 4Y19A 1MLBA 1WTGT 3UTQB 4WUKL 3O3BB 5SX4I 4QXWA 5HI4C 4NNXB 2BVTA 1CFNB 4IRZL 1F6LL 2Y23A 5I75C 4JKPL 1DVFB 3RIAF 2H3NB 4WWKC 4JHWH 1OAZL 2ICWA 3GSQB 5LBSL 4ZDHB 1WFNA 2NR6C 1WWAX 2V7HA 4PJBA 4XMKL 2ZUQC 3V4VH 3IDJA 1TTGA 4HPOH 1QR1A 4YLQT 5DJ2A 2B2XH 3WFCH 4S11A 1URLA 1NEZB 4C54A 1S78D 3W39A 3WBDA 5KW9H 2A6IA 3FB5A 4UOJA 1IC7L 3WEXB 2FJGB 3BZFB 4P2RB 1A7QH 1N59B 4HIJB 3NA9L 5FUCE 4P3DA 4A6YL 4OZFB 4OM1H 1WBXA 4DUWA 1ZS8B 2AJVH 5CKAA 2I07A 2P4AB 4RDQF 4L9LB 4H8WH 1A7BA 1C08A 1I9JH 5HI5C 2LTQC 3C09C 3Q48A 3O4LD 4HCRA 4F57L 1YEEL 2KUTA 5HDQH 1I1YB 3RWIB 4OTXL 4RGOH 1CD0A 1QQDA 1UFUA 5DYOB 1J1PH 1B4JL 4Q6IB 4RX4D 1JGVH 3CFCL 1K2DA 3C08L 2R69L 4Q2ZB 1AY1H 2GFBA 5SWZA 1XF2B 1JV5B 1L0XA 3BW9B 4I3RH 5IVZB 5I75B 4KTDH 4U1MB 2O5XH 3FQXA 3ULVH 5GGUB 4WWKB 4L8CB 1LO5A 1BQHB 1ULVA 2AERT 1U2HA 1OTUC 5CINL 2FJHA 2ZUQB 4CMMB 5IFHL 2KL6A 4XCYA 5D1XA 3DWTA 3NPZB 1BGXL 3BP7A 3O4LA 2AVGA 4G9FD 5AZ2H 4LGRB 3BKML 3ZTNH 1I8KB 4MAYC 2FJFB 4NFDA 3KGRA 2J6EA 2R29H 1QRNB 4PRIE 1JL8A 2P8PB 3H2WA 4G6KL 3WCYA 1NGYB 4NSKA 3SDYH 4CL7A 3F65A 2HH0H 2W0PA 2CRZA 2MHAB 1JTTA 5E2JA 5DT1L 2BSTA 4ZXBA 2VQ1B 3VH8G 2LTQB 3C09B 4HJJH 3UZVB 4ZYKA 2O5YL 3DBXB 1MOEA 4JFEE 3BDYH 3CH1A 4E41A 4DGYL 4MMXC 4OF6A 2X05A 1LWRA 3RHWK 2BHYA 3T0AA 3UCRA 4FQXC 4AIXA 1WISA 5DA0B 3P4OB 1X5JA 5IBUB 3CVHL 1AXSA 1I9EA 1VFUA 5CP3A 1J1XH 2GKIA 2R2HA 5EA0H 5I1GH 1NANH 3GBMH 4DAGL 4OLVL 3W5MA 4J3TA 3AMLA 3TYGL 4KK9C 3RTQC 4LCUA 1RHHA 2FLBT 1LO4L 3NFPB 1EFXB 5MEOB 2GTZA 3L3DA 2GQHA 4JQIL 4MAYB 3O6KH 5GGSA 2CDGA 4PREB 3H7LA 3C60A 3ZKND 3ES6A 1WWBX 5J9PB 5I8OL 3O2VL 4EUPG 3KG5A 3ARBD 3TN0D 5DLMH 4P23D 3RKDC 5IF0B 3CZFB 4RDQG 1KB5H 4KK6C 3TWCL 3DO7B 4WHYH 1N5AB 2NX5D 3G04B 4KROD 1OTTC 5HHOE 1S7XB 1RVFL 1A6PA 1IEBB 4IRSC 1RSFA 2DI9A 1FAIH 4JKLA 4MXWH 5D96C 4JRYE 2JE8A 4FQXB 3O6ML 4RAVA 2Y6SD 4XH2A 3FOLA 4PJDB 5F9JB 4WI2A 1E6OH 3RVWD 4K94H 2ZP0T 5ALCL 1UH4A 2GJ6E 3MUHL 3ARBA 2D9QB 4KVCH 5CS7A 2H2SC 3TN0A 3L3HA 3X3GH 4P23A 2QBWA 1PG7L 5DRZB 1J7VR 2GK2A 3LHPL 3RZWA 5F89B 4FQQB 3RTQB 4NQVA 1YPZE 1DQLL 4OT1L 4QTIH 4XAKE 1NMAL 1G0DA 2GTWB 2QV2A 5C70A 3WIHA 1ZVYA 4MX7A 3S36L 2IMMA 3NACH 4U1SB 1CU4H 2EDYA 4U6HA 4HUKB 1HHKA 3WUWA 1AE6H 1BAFL 1WWWX 4HQQL 4JRXB 4P49A 1IBGL 3V4UH 1DBJL 1ZE3C 3KPLA 4P2QE 3QG7L 2AAVA 5GHWL 1UJ3C 3S37L 1KFAH 3V52H 5BRZB 3D85A 1EAJA 1VGKA 1I3GH 4IRSB 3T2NL 1QPPA 5JUEH 5DQ9A 2CKBA 2XTJC 3F58H 5D96B 2C26A 2XFXB 5DEGB 1N3NB 3O6FC 2NY3C 3LRGA 1S7SA 4K3EH 3W9EA 1DLFL 2E6QA 1R5IA 4GOSA 4CVWA 1P9MC 2X5PA 4WGVB 4GW5A 3VJ6A 4XWOC 1FL3A 3ULSA 1IGMH 5CILH 3WXWH 3KYOB 2DTML 3HTLX 4U4BA 1KIRB 4NKDA 4PJXF 4K2UH 3WN5C 2K9UA 4Q0XL 4P9HL 2FBOJ 4RFOH 1RJYA 12E8L 1EBPA 4G3YL 2V6HA 4L29A 2JB5H 5GRUH 5TE4L 4K7PH 1KJ2H 3SGJA 2BNQA 1EEYB 4PD4J 5BO1H 5D2LE 3T77A 4LPUA 5AG8A 4PJXE 5F96L 4R6UA 4OFVA 4ODSL 3GSOA 5F1IB 5FF6B 3N06B 1H8SA 3KYNB 4Y4FC 3U0PB 1UJ3B 1P7HL 4C57C 3MV8E 3R4DA 5AZEH 1UXSB 2YXFA 4ZFGL 2BNUB 2V2XA 3BKYH 5H35B 3BT2L 4P2CG 3FRPG 4XVJL 4AT6B 4G6ML 2XTLA 2XTJB 5IB3B 2OXHA 4HWZA 5JXAL 2YMXH 3PABB 3SQOH 5IOPB 4LRNL 3R1GH 1U8JA 1AD9B 4PUBL 4URTB 1Z2KA 3ZDZF 2GY7B 3BUYA 5ICYA 4JDZB 3GEWB 1I4FA 5T1MA 4AENA 4YFLF 3S88H 2BDNH 1MRDH 2W9LA 3H3BC 4MZ3A 5TPWL 5GZOD 4JREC 5ERWB 4N0FB 1WZ1H 4KRMB 3WN5B 1CG9B 5B38A 5C0CB 2J88L 1XGRB 4YHOH 3IDNB 5SWQB 2MCPH 1JRHH 2FO1A 2FBJH 3GIVA 3MGOB 1ETZA 2VR4A 3U9UA 2GSGB 1S7WA 3O4OC 2NQCA 5CHNA 5JOFA 2AJUL 3OHXB 4UNVA 5I76A 4XCFH 2P7TA 4Y4FB 2OS7A 3UO1H 2VH5H 2DQCL 3UJTH 4ZTPL 3FN0H 4DZBB 4MS8C 1C7TA 1T89A 5GGVH 1YEGL 3MBXH 5DD1L 1OP5H 3SKMB 1LEIA 2QR0B 4TOYL 3T0EE 2R15A 3T0DA 1P7QD 4V1DD 2YK1H 3U82B 4L8DB 2APVA 3U83A 1QKZL 1P6AB 4HMEA 3B9KA 1LE9A 2ARJA 2Z92A 2P46B 2KQMA 4RWYL 5JPMB 2X1PA 2EC9T 4DKDC 2I9TB 3QI9C 3JV6B 1KEGL 3PJSA 4L4TE 2EE6A 4XWGL 5LAXA 3HAEB 3I85A 4JREB 1CLZL 2D03L 4OV5B 5DQJA 5C0RH 4LSUL 4WO4A 1V5JA 2DBLH 5C09E 1I1RA 1U42A 4QHNB 5C8JA 4HH9B 2XQYK 4HKJA 2Q8BH 4KMTH 3K8KA 4V1DA 3O4OB 1ZMYA 1BHGA 3EGSB 2AJXH 3OG4B 4YDJB 4TSCL 3S96A 1S5HA 1SY6H 5DS8A 3DRTB 1TETH 5IT2H 2HLAB 1I9RL 4CVZB 1HINH 1A6VL 4FS0A 1E28A 5KSVB 4K8RC 1FVDA 1KCLA 3M8OL 1D6VL 3WJLC 1WT5A 4TSAH 5LKNA 5HGAA 7CGTA 4QRPE 4MA7L 2AJYH 2JJVA 3GBLA 5A2KH 1KPRA 5EUKB 2ESVB 5CJBA 2A74A 5AG9A 2R0KH 4PRHB 3OGOE 1OAQH 3QI9B 3BH9B 1FYHB 4PJBB 2V7HB 3RAJL 3CUPA 4HWEH 1OGAB 1OAYH 1XCTB 5EBLB 5EO1A 5DJ2B 1U8HA 5HHXH 3O81A 1BFOB 2XA3A 3RUGF 4U2ZA 1T2QL 2A6IB 4Z0XB 4HS3B 2CK0H 5KVEH 3SOBL 5ABDE 5MEPA 2Q3AA 4FXLA 4X4YA 5ENWB 2FATL 4NRXB 2Z35A 4JO1L 5D2NA 2FDBP 2EDEA 4M48L 5J89A 3EOYG 1KN2L 1OPGL 3RVXD 3G9VA 1Z6JT 2NW3A 3RUGE 4JJHA 1MPAL 3PDOB 3RWEB 3SGDI 3IJYA 4Z8FL 2COQA 3TBSA 2YA1A 4JY4B 5BVPL 3L3GA 5TH2A 5T3XD 2F53D 4JM2C 3VFMA 4NQDD 4W4NA 4GAFB 1P5VA 3TVMC 5C0EA 3SE9H 2W92A 1V7NH 3T65B 1FNLA 3DUUA 4JFDA 2NXYC 5DZNA 3OJ2C 1Q72L 2BJMH 5EU6E 2FX8H 3B6SB 4OI7A 2JIXD 5HYSA 1LO2H 5T1LB 4XPFH 5C9KA 3DETC 3QQ9D 5SWSA 2KKQA 1JGLH 1FVEB 2E27H 1RHFA 1FDLH 4NHUB 1RFDL 3TEUA 3S8WA 1R3KA 2FIKA 2F53A 3EYVB 4W4OA 1WC7A 3GMOA 1G6VK 3TBTB 2EEDA 5D4QA 4X6DE 1F8TL 1IGYA 4UI2A 3PWLA 3BVNB 4NSKB 5FOJA 2H41A 1G7LB 1YEKH 2YUWA 4PJHA 3REWA 2APXA 1J8HE 2PTUA 4Y4KD 2BSTB 2BOCA 1T2JA 4DVBA 4QRQA 3R0NA 3BQUC 3IDYC 4JM2B 3MRFA 3PP3H 3TVMB 3CLFH 4ZUUB 1KPVB 1ZK9A 3MROB 1P4IL 2LV4A 2VLJE 3LDBC 1JP5A 3LD8B 3PGFH 4HLZH 6CGTA 2LQRA 4RMQA 3AGVA 4XB8A 5GS0H 5SX4H 3RDTC 7FABL 1U8IA 1F00I 3MRMB 1ZVSA 4YO0A 3O3UN 1PAMA 4XP9H 1RULL 3OL2A 4CDGC 1KN4L 5L6YH 2EDKA 3EOBA 3OAZK 5DFTA 4MDJB 4Y4KA 1FFPA 4HMDA 4X6BB 3MRHA 3QDME 1KG0A 5E2VH 1QBLH 1C1EH 1LMKA 3INUL 3MV01 4HCRL 5IQ7H 4L4VA 2WM0A 2EXWD 3KPSB 3VD7A 3DROB 4O51A 4ENED 2YD6A 1YEFH 1GGYA 4M43H 2JJUA 5JHDE 3MACH 1KENL 2J8UB 1BVLB 4HZLB 3C2SA 5DF0A 1JI2A 5FYJH 3BRGC 1GOHA 2Q86A 3BQUB 4XNYH 3IDYB 3HMXH 4M3KB 4XCEA 4U1LB 4XP4H 4JFOA 1G7PA 4H20H 1YN7B 4ZFOL 2WK2A 3LDBB 1YMME 3MA7B 4NWUH 1C5DB 4CMHC 2GAZB 1X4XA 3RDTB 3BHBA 4P2RD 4LBEA 5JHLH 1ADQL 4TUJA 2J6EL 5A2LH 1JWMA 3P77A 2ADIB 1T4KA 4YHIB 2XOTA 2HAZA 3L3HB 4Y8AA 2FNBA 4WHTA 2EYSA 5CBAB 4WY7L 3FONA 1IE5A 2KBGA 3B2VH 3CMOH 1MCNA 4PB9L 1A7RL 3SDXE 1NCWL 3ZE2F 3SE3C 4S2SA 4ELKB 2QTEA 2GYSA 5TFSH 1DSFL 1J0ZA 1XGUB 1EEZA 1X4YA 4HLJA 3EDDA 4U6HB 1HHKB 4NBXB 4WWID 2WV3A 3WUWB 4EDWH 2W0KA 2BXYA 3OMZA 4YHLL 1DN2A 5T1KD 2VDKH 2F8XC 5CSGA 4JZOA 3GKZA 1A1NA 4CVXA 3D85B 2YKLL 1VGKB 4G6JL 1F97A 2EYTA 3ROOA 4GG6B 2B1HL 3QHFL 4M6MH 3RBGA 3MNWB 4RIRB 1JPFA 4CMHB 4O2EB 4ETYA 3IKKA 2IH3B 4JHBA 3VDBA 4JFXA 1R5IB 2D0FA 1EGJH 4OLWL 3U30B 2DWEA 1OTSC 1FL3B 1JWSA 1KJ3H 3ECBB 5ISZD 3PGDA 4X4MA 1NLDL 4LDOB 4CW1B 2RCSL 1XFPA 2AS5M 4ONFH 4H88L 2J2ZA 2DM7A 4RQQB 2WANA 5TDOB 4OCWH 3ZZ1A 5MEND 1MIML 1JFQH 2H1PH 1SJXA 1T1WB 4W70A 5BS0E 3ROLB 43CAA 3B3IA 2VDOL 3SY0B 3GSOB 1KOAA 5KVGH 5AUMB 1IGJB 15C8H 3RPIA 2E9WA 1U3HA 4KKAC 1LK2A 1MCKA 1MUJA 1TQCC 4I2XB 3DV4A 3Q6GH 4Q9BA 1IEAB 4UDUA 3X12A 3W2DL 3CNKA 1IMHC 2QQKL 1YUHB 1UKQA 3B9EA 1NFIB 4DKAA 2YPLE 4G6FD 5ISZA 4OFIA 4QGYA 3FQRB 5J7CC 1SVCP 4EI5A 4PJIA 4DTGL 3ZT5A 2OSLB 1BWWA 3GGWA 3CSPA 1U8NA 3BUYB 3TBVB 4PGJA 4ALAH 3PWPA 3LQAL 4PJBF 5MENA 1HKFA 3VGBA 3VFNB 4N8VG 3MLVL 3WIHL 4F8TA 3V95A 4KJWD 2HVJA 4NT6A 4AENB 4IJ3C 1N4XL 2FEDD 2FR4A 3HI1A 3WUZA 3T0WA 1GGBL 4I9WD 4DJMA 2GCYB 3QEHB 4WO4C 5B38B 3OAYH 4QXUL 4HG4K 4LARL 2QSVA 1PEZA 4PJFA 3W9DB 3MRCA 3U9UB 3HRZA 2XZCH 3P30L 2H8PB 3VW3L 1OAUH 4HC1H 5JOFB 4JG0H 5C07D 1YYML 4JCMA 1ZAGA 1PG7X 1MIEH 4OKDA 4Q9RL 5EU3B 3O8XC 3NCFB 5KSBA 2AEQL 5ITBL 3OKYA 1S5IH 4KK9D 3MLUH 4R0LA 3RWCB 4BSVB 2W91A 4O4YH 3HCVB 5DRWA 5EOQH 3S36X 3WKNA 1B2WH 3WSQH 4XCCH 1LE9B 5GS3A 1GGTA 2VXUL 3KPRB 4BH8A 1KCVL 4P2YA 1A9BA 4UIMA 1FORH 4IJ3B 4KUCD 3FRUA 1J0JA 4JRXD 4KK6D 5SWZE 3S37X 5C07A 2SEBA 1CLOL 1T83A 3VXSB 4YDIL 4UTBL 1E0OB 4WO4B 1GAFL 3P9WB 3MRGA 1HDMB 1T7YA 4HF5H 2X1QA 5ID1B 4IRSD 2VLKB 4M61A 4NO0A 1KT2A 3EHBC 4XMPH 3O4LE 3VE0B 4QRSB 5GRVK 3U46A 4BH7A 4MNGB 1S5HB 3ULUH 4WIQA 1CE1H 3O8XB 3QIBC 3I6GA 3GZKA 3TFKD 4P9MH 3WKMH 2YOCA 4XNQA 4P0DA 5H94A 3T3ME 4GAGL 1NGQH 2PNDA 4NQED 5IJVB 1LP9E 4Z6AT 2V9RA 1QFWM 1F58L 1U91A 3OXSA 5AAWA 4JZNA 2FIRT 1HQ4A 5DUPL 4NNYA 1RIUH 3FQTB 5DRNB 1TCRB 1XGTA 1EHNA 2VXQL 3ZDYE 5CEYB 5M95B 4PLNC 4KQ3L 2VLRB 5FB8B 4QY8B 2BC4B 2YBRA 4X7SL 2PCPB 2C4XA 1I8IB 5EO1B 2DOCA 3WFHA 5ELIA 5BZWB 4JR9L 3E6HB 5EC2B 3K4AA 1S9WA 3MUGB 1KJ2B 2B4CH 3HMWL 1DBML 4WTZA 3B8SA 2R0WH 2AK1L 5EO0B 5EU4A 4ZFZA 3ZLQC 3V6OE 1K9TA 4YDVA 3ZO0A 5IR1A 1IC4L 5ESVA 4PGEB 1YECH 4NQEA 4MJIB 3D3VA 1KIPA 1KYOJ 3IFLH 5FECA 1R3LB 2NW3B 4DN3L 3P3YA 5BJTB 3P2TA 1T5XA 3HI6H 4KQ4H 1HNFA 1VFAB 3BXNA 2R2CA 3QIBB 1BBJA 3L3GB 4LLMB 5TH2B 4I48B 4IOSD 4DUXA 5LQBL 4QHKI 5C0EB 5FOBA 4FNLL 3KLHC 4I1NB 5EZJA 4PFEA 4GKZA 2B1AL 3ELAT 4JFDB 1IC5H 2WW8A 3ETBF 5E6ZA 5C0CD 3BPCA 1D9KC 4EI6A 3NOIA 5CKGA 1IJ9A 1Q94B 3DVNB 2FYYB 1DQJA 1AGFB 5EZIH 4AMKH 5HYSB 1UB5B 3QPQC 1IGIL 5DJ0B 3W11D 3S5LA 2BVPA 2JB6A 1AHWC 2AEIT 4LLWA 5A1AA 4IOIB 3Q5YA 4GMTL 4Y4FD 1N64L 3PWUB 5C86A 1OLZA 4OF0A 5D1QA 3TIDB 4D9LH 5I19H 4F7PB 4KXZI 2BNRD 1R3IL 2ZCHL 3K0WA 3GMOB 4QRRD 3T2PA 1JZ5A 2NX5E 4ZNEA 2QJDA 2XNAB 3HC3H 1EJOL 4XRCB 5I1KL 5L7XL 5IKCB 2HFFB 1RJZB 3C5SA 4ZG1A 4R9HA 4I18A 4BSWB 4NP4H 5JNYB 3MYZA 1LVEA 1UM5L 5C6TH 4EXPX 4PJAE 1HXYA 3PF2A 4QOKB 4U1JA 3UZQA 5T3ZH 4PJ5A 3IXAA 3HS0B 5HGHB 3BGMA 3BD3A 5ICZA 1F6FB 4BFGA 1D9KB 1F90H 2HKHH 3KLAA 1IAIM 4MNQA 4QRRA 1P1ZA 1AHWB 3GHBH 2YS4A 4OF5A 2X44D 4UINH 3ARFA 2GW5A 2IPTL 4Y4HA 1MI5B 1K8IA 4WU5B 1X5YA 2OJEA 4UT6H 2DS4A 1TJGH 2CLZA 2GJJA 2I26N 1BFSA 5DDHB 4FQJL 3QEGH 5I73C 4Z18A 2DLTA 1I9IL 2HJFB 2PXYD 1CWVA 1IT9L 1GL4B 2A1WH 1U2CA 4GKNB 4LCIH 3GSUA 3OBAA 3RJQB 1YN6B 5IVXB 2P44B 2V2TA 3D25B 1W0VB 3VXMB 1NBZA 3HLAA 2PW1A 5DJDB 3RGHA 1RK0A 2BSRA 3SDAA 3D18B 5F7MC 1ZWIA 3K8LA 3RWFA 3OJMB 1NCBL 3ARGD 3ZHLA 3HA0A 1NGWB 3LIZL 3Q1SH 4UBDD 2WINA 5JDSA 3UTOA 1LEKB 1DBBL 5T3XL 4PJ7A 3QZWA 2A6KA 2VRAA 4UT7H 3A67L 1JWMB 2P49B 4NM4H 4MMZC 3QUXD 3UROR 1A3LH 1HH9A 1CZ8L 2EYSB 1C12A 1FFRA 2WIIA 3NIDF 4Y16D 1RUQH 4ZPTA 1MFDL 1P84J 2VZUA 4NQCB 3D39A 3PV6A 5KSAB 1UZ6E 4ERSH 4GBXA 2XQBH 3JTTB 4HKZB 4S2SB 5LGJA 4K8RD 4TUKH 1EIBA 4U1KB 3BGFC 2I60L 1QSEB 3MRDA 5JIHA 2IFGA 2NNAA 3WHXB 5KG9A 4YHKL 5TE6H 5T5FH 1UKTA 3QQ3A 3DX9A 2A0LC 3HZYB 2ORBL 1DL7L 3BE1H 3OKOA 4CN4A 1OP5K 3UZEA 2NMSA 4Y2DC 5I1JL 3QWOA 5I1CL 4LSRL 4ZTOH 1A4JB 1VESA 5C0FA 1IQDA 4JHZA 2CKNA 1U3HC 5I1DA 4Y16A 2LFGA 5DO2C 5FO9B 1E6JL 1Q1JL 5GS0C 1YMHB 2OP4H 1ZSDA 1J0YA 1NKRA 3U7WL 4EI5C 1OD9A 3CXHK 1XMWA 2AEPL 4OAWA 32C2B 3CCHA 1G6RH 3KPOA 4QEGA 5I30L 3BP4B 4NIKB 1NCDH 2Z4QB 3EYSH 1HXMA 4YGVB 1MCIA 5IP4A 3T09A 4H25A 3G6AA 3RVVC 1N2RA 3OB0H 3PGDB 1EEUA 4HUUB 4JM2D 5TF1L 2P5EA 3SDDC 4Z77B 3TVMD 4OLEA 3O3AA 1Z9OA 2YPVL 5HSFA 4Y5YA 4F37K 2BVEA 3Q6FA 5JPNA 5J8OA 5B8CC 5CZVL 2YC1A 2NY5H 5DMKA 4CDHA 2HJKA 2ZPKH 4XBGA 4ZAKA 43CAB 4F7TA 1UYWH 3T0BA 4Y2DB 1XR8A 1RZIA 5F72S 2VC2L 1Q0YH 1OGTA 4V1DE 2X1XR 1MUJB 1M7IB 3X12B 2DL2A 5J6HA 2XI9A 1HILA 3N85H 5GZNC 1E4WH 1JZ2A 3NZHH 3IJHA 4NN5C 3CFBA 3CDGB 3DX8B 4EI5B 1AKJA 1MCHA 1NUGA 4CGTA 3SKJH 4P4RB 3GGWB 5ECJE 4Y0GA 4DKFL 2Z91A 3NCYS 4LCWD 3KPPB 1G9NL 4GUPA 4H1LB 1DLHA 5IW6B 3HI1B 1A5FL 4UB0H 1YEDA 1LQSR 2NY4C 1T83C 2QSCL 5JXEC 2I24N 1IGCH 3LSOB 1KLUB 3BQUD 3SDDB 1PX4A 1WVZA 1N6VA 3S6CA 5F3BA 3HUJB 5B8CB 3CFKA 1OARL 1JBJA 3IFNH 1VGEL 3CPLA 3MLTA 3RWGA 1A4KA 4EQ3A 1JUFA 3UYRH 4UOW0 4YHML 4DOHE 1AR2A 1PX3A 1RZKC 2HRLA 1T04B 2C5DC 2D7MA 1NSNL 4LNRA 1CK0H 2G5RA 2ZJSH 3CLEL 3GMQB 4NN5B 5HVHC 5E8EB 3CSBA 4F8QA 2KPNA 4FXKA 3FQUA 1OSPL 3ARDA 2DI8A 1C5CH 4XBPB 1KJMA 1ZHBA 3HB3C 2W65A 3HC0B 3MLZH 4OCSH 1VPOH 2WP3O 5EUOB 3V4PH 5FKPB 5HGGS 1MWAH 4V2BA 4UIMB 5GJTL 4LCYA 4KZDL 4QGTA 3BJ91 4YXKH 1HCFX 2NY4B 1KTKE 2H32H 1S9YA 5M94B 4O58H 1RZ7L 1JHKH 4XZUB 2ZKHH 3RA7H 1MH5B 2HWZH 3L7FA 1J5OH 4OIAA 2JCCA 2CJUH 4Y5VA 2XWBA 5SWSE 3GMRB 3K81A 4HKBB 4NO0B 4PP2A 2YD9A 3ULVD 3U0TB 1YNTB 5JW5A 1FNSL 1OP9A 4PJHF 4FTVD 3T8XB 2DQTL 3PP3K 3U46B 3NVQA 1DDHA 2F53E 3DHJA 1ZEAL 4NQDE 5T3XE 4XPGH 3G5ZA 3VFVB 5FCUL 1J0HA 3I6GB 3MJGX 3P73A 3IKCB 1MNUL 5FUZH 3M1BA 1QLRB 4J6RL 5FIEA 5HVHB 1MEXL 2FH6A 1PJ9A 5MP6H 4WI7A 4MJ2A 4GXVL 1D5ZB 3MXWL 4OD3L 3TA3D 3OAUH 4MQ7A 2FEEL 5HYJB 2HKFL 4NNYB 5GGQL 4QRTB 2EDJA 5IEHA 3U4AA 4G42B 1BX2B 2HN7A 2Z8WC 2ICEA 3BPOC 2DQDH 4DGIL 5C3TA 1RUKH 2CUIA 1OAXH 1N5YH 1MVFA 3EW3B 4FTVA 3AAZA 3LAFA 3NH7H 4R8WH 3L7EA 2VDPL 2X4NB 4N0UA 2FB4L 2OR9H 1A9EB 4X7TA 1JYNA 5TQ0H 5EZLA 5E08H 3AM8C 3BKCH 4D9QD 1QEWB 5J1SC 3ALXA 4NKMA 4YDVB 1I7TA 3C6SB 3QO0A 5E2UH 1CIUA 3DX7A 1O7SA 3U2SA 4M5YL 5A40E 1KIPB 4OCRL 2ZG2A 3TA3A 3GIZL 2DDQL 4R2GD 2DAVA 1KIQA 1S7TA 1JGUH 1T20A 4X6EA 1SJVA 1FPTH 4OIIH 5T5NF 1BBJB 1XIWD 1QSZA 2ZOKA 2R2EA 3UEZA 3LH2H 5HHVH 2DLFH 2P8MA 1N26A 4PRNA 3IF1A 2H2PC 4TSBL 1AQKH 1INEL 3M45A 5D70L 1GGCH 4ZFFB 3L1OL 5E5MB 3RWDB 3BPCB 3RGVD 4EI6B 2XXCB 1U8QA 3LV3B 1MY5A 1NDGB 4WFGD 3BPOB 5DGRA 5IVNA 3GSRA 3O6LL 3CU7A 4GG8B 1PQZA 2A9ML 2B0SL 43C9B 4H26A 2JB6B 2CIKA 2OMBA 3QWRD 5DHXB 2E9IA 4IMLB 4LLWB 3ARFC 5IM7B 1ZHKB 4BZ2L 1CDJA 3WDIA 4F7EA 5GXBB 3EOAA 1XIWA 3E1F1 1R6VA 3PNWB 2IF7A 1ZHLA 2K1MA 4FFZL 5D1ZA 1D6EA