4JE4B

Crystal structure of monobody nsa1/shp2 n-sh2 domain complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
b'SSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGSGGYAWQEFEVPGSKSTATISGLKPGVDYTITVYAGYYGYPTYYSSPISINYRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
publication title Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4je4B00
1VEPA 5ESQB 3RZWA 2P8LA 4JKMA 5I0DA 4LSVH 3CPLB 25C8H 2EXYD 3NFPB 4PV9A 3RL1B 4S0TD 5I30L 1G7LA 3EDEA 4EZMA 4R4BB 4KRNA 2QQQA 3TNNA 2UY7A 3ZKSD 3VDBA 1QHPA 1E4XI 2EH7H 4LCCA 4Y19E 1X9QA 4YIQB 1U6AL 3T09A 2DOCA 1B90A 5DO2C 3O4LD 3QSKB 3BD5A 3VE0B 4IOFD 3DIFB 1S7TB 3MRHA 4DVRL 3EOTH 4YBQC 1H5BA 1QYGL 1IM9B 2GK0A 3NACH 1RFDL 4GUPA 3EDDA 2PKDA 5D1ZC 4ZFFB 3QIUD 3NZ8B 1B0GB 3QA3B 4DEPC 1IEHA 2WBWB 3GMNB 3V5HB 3QXTA 1U2HA 3ZKXB 4LBEA 4QRQA 1NBQA 4W4OC 1YEGH 1S9WB 4XPTH 4O02H 1ZHKA 1T83C 4NQCE 1IEBB 1DEEA 3TZVA 1Q9OB 2EDKA 1ADQL 3KAAA 3KPRA 4WEBL 2HMID 2YSSA 3SDCC 1QLRA 3RIFF 3QUYB 1FLRL 4I18A 4PP1D 5CD3B 4FQXC 1U58B 5DVMA 4JPVH 3LKSA 2OI9B 5IESL 3FB6B 4RRPA 3S37X 1RURH 3HE6A 4P5MB 1ZT4A 3MNVB 3O81A 4GT7A 1IGFL 2EIZA 2ZOKB 5DMKA 4OD1L 4MAUL 4E0RA 3X11B 3ALWA 1Z5LB 2BVYA 3RWEA 2AV7A 1VGEL 2RBLA 3TBWA 3RUGB 1G9NC 5IF0B 4JO4L 1JYVA 4O2CA 3LSOA 5JDSA 4JN2B 4LCIL 4QCIA 4KROD 1MCPH 5GGQH 5SWSD 3PL6A 2OM5A 4I13B 3G6JF 2HTLD 2X7LA 2R15A 3K1DA 1F4WL 4HUXB 4LSSH 5DHXB 5DHYA 1UGNA 4OFYD 3IDGA 1FN4A 4M93C 1XMWA 3G6DL 2UZXB 3L1OH 2WWKT 3QJHB 4BYHA 1DUZA 1KJMA 4KTDL 4M9OA 5E7BA 1JN6A 3GSUB 4KMLB 3LRSB 1CTOA 3EOAB 4OLVH 1PW3A 2VXTL 4JO2L 2QQLL 1BVZA 1YEIL 4K71C 4P3DA 1NUNB 4H25A 3EBAA 1KXQE 3MLTA 3MR9B 3LN4B 3UTQA 3R06A 3OX8A 4U6YA 1T22B 5T1MB 3CSBA 5K9KA 3NCJH 3F65A 5D4QA 4EN3C 4Z95H 5DJ6B 1U8IB 2WK2A 3KPMA 2WUBH 5DDHB 2YD3A 5GS0H 1IRAY 5KANG 1JGVL 5D7LB 4NN5C 3PXJA 2A77H 4HX1A 2A0LC 3EYUH 4G7VL 3RVWC 1XR8A 1A1NA 3FQNA 4I3RH 2Q87A 4WU7A 1KF9B 1MF2L 5L8KB 2J8UA 4XCNB 3QH3B 5BQ7B 5IG7A 5INDA 3K4ZA 5BVPL 4L3CB 1EGJL 4N0FA 5ALCL 5F7DB 2ZCHH 3DYOA 3JWOC 4O2FA 5C0BA 3WNMA 1CWVA 2YA1A 2MHAA 3CXDL 3ARGC 5HHQB 1BZ7A 3G5XA 3V6OC 4HKZA 4EOWH 4PBXA 2GTWA 3W2DL 3D2UD 3HZYA 1XCQA 3O8XB 5FF6B 3CUPA 3O4LE 4E41D 2D03L 3MRIA 3BP5A 1GGCH 1SYSB 3WUWA 5I15H 5JXAL 3SDXA 1NLDH 3MX0A 1YYLL 4JPWL 4NQDE 1FL3B 5HVGB 2BHYA 4BSVB 5CEZD 5JPNA 1R3HB 4HJ0C 2Q7YA 5D7SL 3D3VD 3RIAF 1RPQA 1N2RA 3NAAH 3RZCD 1YNTB 2WM0A 4M62L 3WNKA 4KVCH 3HZVA 4OF5A 1BLNB 3F6LA 2NXYC 3CDYA 3OQ3B 3QISA 2R0KH 1I7TB 2I60H 1DVFD 2MTPA 4S1DC 5HVHC 4G6KL 3EYQC 4KK5C 1ZSDA 4I4WA 5I1CL 5IGXL 2VLKA 3D85B 5DUPH 5KS9F 3S3SA 1LEIB 3SDDC 3P4MB 4TVPH 2HT4D 1L9MA 1FFPB 5DT1L 3WLWD 3QIWB 5KANI 3ZE0E 2CGRL 1MSPA 1NAML 1AP2B 5D6CA 4HWNA 3VI4F 2MCPH 1XGRB 4BZ1L 4HUVA 1NCTA 4XPGL 4KDWA 4O4YH 2QKIB 2E9JA 5E0QA 1RULH 4PP2B 3CVHB 5SWSE 1FZJA 1DSFH 4MQTB 2D4FA 4OF7A 3OKOA 4PD4J 5T1DH 1ZAGA 3H7BB 2PW2B 3WFDH 3CFCH 1MRDH 4QOKE 1S7XB 3U0PB 1GC1H 5GJTH 3EFFA 3MUJA 1OT2A 2F8VA 4XNQB 3L7FB 4PRPD 4J12A 3D1MC 2YWYA 4M8VA 3TJHC 4UNVA 5IFAL 3T77A 2CDEA 2DI7A 2Y1VA 3BW9A 4NHCL 2F53B 5HI4C 1UENA 4U3HA 1F11A 1QFUH 2IQ9H 3C5ZA 2D9CA 3CXHJ 5CCKH 1B4RA 2B2XH 4HS6A 4L8SA 5FO9A 3JTSA 2P5WA 3MODH 1IM9D 5DGRA 5C7XL 3C6SB 4FMFA 3RQ3A 1IQDA 1OAUL 4J23A 5EPMA 1MCDA 4KJYA 3UBXG 3C09C 4LL9A 3IFPB 2D7OA 1PG7H 1BJ1J 2EYRB 3QUYD 1QR4A 3LV3B 3MRDA 1N6QH 4RDQG 3WE6B 4HXBH 4M7JH 2G9HA 3HI5H 1M6OA 3B9VA 3CVHL 2IBBA 3RWIA 3O41B 3BKJH 1YYMH 2ZOLB 5I17B 2OL3A 5IBUB 1KOAA 2IPUG 1AGBB 2QHRL 3F7RA 4X83A 1EO5A 3I02B 4P46C 2NY6B 4AL8L 2L7UA 3U7YH 4WTZA 5FM4A 3QG6B 4U1KA 5I66B 4ZAKD 4PJXE 4Q9BA 5H35A 2NNAB 4AYFA 1UXSB 3RKDD 2VDPL 3BZDA 1OP9A 4PJFF 3FZUD 3JSSA 2XZCH 1U93A 2Y5TA 4KMTH 5CEZE 1ZVYA 4OZFA 4DVRH 1MCIA 3QUZB 5ID0A 4YDKL 4PGDA 4ORGB 2AV1A 1A7NL 3TN0D 5FDWA 1INEL 2FH6A 3BRDA 1CICA 3DX8A 1MHHA 4QTHA 4DTGH 3PP3K 2BFVH 5C0ND 1Q9WB 3MCKB 4PRHB 5C6PB 1P2CA 1EUUA 4PJGA 1MHPL 1MCHA 4OCYH 2RR3A 1J8HA 1UB6A 4GAGL 2VSCA 2DQGH 4POZC 1UM5L 1CLYH 5CZKA 3BJ91 1I8KA 4XT1C 4OZGE 4B53A 1FORL 5CWSA 2G2RA 5L9DL 1M71A 4PLKC 5C2BL 1YA5A 5D7LD 2H32B 3ARZA 2ZG1A 2APFA 2X70A 4M6ML 5F8RC 1C5BH 3O9WC 3OR6B 4RGMB 1IT9H 4TN9A 5B39A 5BS0D 2DD8H 2NMSA 2E6PA 1OPGL 1WQVT 1J05B 4YC2B 3BE1H 4HXAL 1FG2A 3VXUA 3N85H 3VGEA 5D7IF 3T3PF 2DYPB 4PRPE 4XXDB 4Y5VC 1OB1B 2EXWC 5D96B 5GGRA 1EO8L 4GBXA 2DL2A 4Y2DB 2B0SL 3AREA 3ARWA 5LCVL 4Z78A 2EE2A 2LU3A 4M5ZH 5BW7A 2FBOJ 4NP4L 1NDGB 4YO0A 1BWWA 1CK0H 4M6NL 2V6HA 1NC4A 2ZKHH 4XZUA 3O8XD 4Q6YA 2XKUA 2AJ3A 2KQMA 3ZSSA 1OT1A 1WCBB 1AE6L 4AIXA 3GI8H 2M1KA 4FXGA 2IAMB 5IHZB 4WFHE 4C58B 5IVZB 4IEFB 1U91A 2FRGP 1I9JH 1YN7B 4OIIL 2BCKB 3PQYA 2MKWA 5DMIL 4X6DA 1I3GH 3R1GL 1F90H 1JGVH 2UWEA 3R4DA 4NC0B 2VERN 4ZUUA 2GUOB 3CZFA 4HZAA 5FYJU 1HH6B 4RFNB 4M5YH 4S1SL 2P7TB 3P0VL 1IGCH 1G7JA 3W39B 5ACLA 3VW3H 3VGFA 2W65B 2NZIA 5IFJA 3RJDA 2X89A 3QIWD 4Z7WA 3KYMB 1JNJA 1UJTA 2FGZA 4XVUD 4Y0GA 3FFCA 2NZ9D 3VJ6B 3RUGE 3KDMA 1Y18A 3WFZA 4MNHB 4JZJB 4JB9H 1TETL 1HIML 3BP4B 4NNXA 3OKKA 2NTFA 4R2GC 5FOJA 1JPFA 3GDBA 4NKOB 3W2DH 1KNOA 1PYWB 3MQIA 5HDLA 3ULVC 1SY6A 1T7WA 1BGXL 1WTGT 5DQJB 1NGWA 3MNWB 1LO0L 4AEEA 2WLYA 4Q58C 5EDXA 4GMTH 2WP3O 3NCBB 5AD0A 1S9KC 1IFHH 2E7CA 1CQKA 4KTEL 3GMOB 1QVOB 3G5YA 4YBLB 1OM3L 3SHSA 4PTUA 4NRZB 5FM5M 4BUHA 5GGUA 1F2QA 4HLZG 4DVBA 2ZNXA 2F53D 5L88H 5F9OH 1MCWW 4BQ6A 3O0RH 2HKFH 4PYHA 5L7XH 3HUJB 4YDVB 1F4HA 4NO5B 4WV1C 1ZHBB 4FQ2H 3TCLA 4ZFGH 3L5WA 4D0BA 3UP1A 3TO2B 4ZFOA 4NC1C 5I1EL 3UAJC 2QL1A 4WJ5A 3T1FB 1ORQA 1RIVL 5IQ9A 1MJJA 3VGHA 5DLMH 1LP9F 1NAMH 5D7LE 1TPXB 4OLWL 4Z7VA 2W9EH 1C12B 1JYNA 4LHUB 3STLB 4YDLC 1T6WA 4HBCL 4YZFF 2FIKB 4DKFL 4QT5B 5CJXC 1C7SA 3S5LG 3HRPA 4GAYB 1JK8B 5MENB 4IJ3B 5F9DC 5HYSB 1NLBL 1EFQA 4XTRC 3U30C 1P1ZA 1A02N 1I3UA 4PUBL 1K4DA 4NWTL 2NY6D 5I1KL 3SGKA 4PLNC 3P77A 1JZ2A 4WW1A 3TJEL 3ZTNL 1Q9KB 2PO6B 3ZHLA 4K3DH 4ZXBA 4YEFA 1OP3H 1F4XL 4I77L 3HZMB 1QRNB 4PJDB 2FBJL 1A8JH 5C0EA 3F58L 2JB6B 3QAZB 4EI5A 5F71A 3HPJA 1ZLVK 1M7DA 1DUYA 4EUPA 2X41A 3QUKB 3GMQB 5D1ZA 3VXRB 1NCDL 4M00A 3TPUA 2AXFA 2AJXH 4P3CH 3QUZD 2Y07L 4MDIB 1A1MA 1INDL 1ETZA 4K23H 4LCUA 2Y7QB 1ZLUH 4PJAE 4LEXL 4YHKL 1W0WB 1U42A 1IZJA 2BDNH 3DECA 3SDCA 3CMOL 1S7QA 5DWUH 4GAJH 3V5KB 4Y5XA 3OXSA 5IB1B 4P5TA 3TV3L 1FO0B 3OR7B 4CMMB 4Q6IB 2R23A 4ODTH 4PRHD 3QEGH 3E2HB 4MB4A 5ELIA 5J1SC 3QXUA 4OJFH 3BPNC 1F2XK 2I9TB 1N3NA 3PWVB 4YE4L 2D0FA 4AG4L 4U1NA 1G7QB 2ICES 4RNRA 4UMGA 3N1QC 3VRJA 2YZ8A 4LPCA 3T1WA 1A9BA 1ZXQA 3FKUS 4ZTPL 3JV4B 4L5FH 1O0VA 4GLRH 2B5IC 4UT7H 3EDKA 5D2NC 1ZTXH 4E9LA 5MEOA 3GBNL 2PW1B 4M7ZC 1LEGB 3C8HA 2BMKA 3PWPB 5T5NG 1BM3L 1CF8H 4LIQL 4CADB 1RUML 2AXJA 1OQXA 1R3LB 2C3HA 4YHLL 3PP4L 3GZKA 1K9TA 1R5IA 2BP3A 2DYPD 5IW1B 1FAIH 2FECI 1T0NB 2ED9A 4FQ1H 2DM7A 3VFVA 4Y2DD 2MFNA 5JHDB 1PY9A 3P73A 1FDLH 4Z76B 3QQ9D 2PNDA 3ARBB 4XWGL 1RK1B 2AJVH 2F53E 5E9DB 3VFWB 3ARSA 3P9MB 1I7UB 1U8HB 4JG1L 1G84A 1GGBH 5HYQA 4PJBB 5FYLL 3O3DB 2P46B 4J3TA 3NVQA 5IB3B 1J1PH 4HD9A 3UXFA 1QBLH 1D5IL 1XF2A 1NFIA 2IAMD 4GAGH 1S3KH 3RVTD 5LXGL 2OR9L 1BWMA 1R3KB 3GNMH 4PJ5B 4OLXL 3GK8H 1J1XH 4J2XA 1T89C 1D6EA 5C6WH 3GEWB 1KIPA 5INCB 3ZO0A 3KPLB 1MCOH 1S5HA 4FFVC 1ZA6A 2NR6C 5D7JC 3H8NA 1RJCA 3X12A 5KVFH 5EC2A 1JYWA 4GKSA 5HI3C 3KYNA 1HWHB 4MXQD 1LK3L 3G6AA 5E99H 3FT3A 3DGGB 1N0XH 1N4XH 3BVNB 2PTTB 3SE8H 5IHBA 2XN9B 5HI5D 4G6AC 3QZWA 4MNGA 2F5BL 3C5SA 3VMNA 1NGPL 3EO9L 1F3JB 1S9YB 1YEKH 1X3DA 2B0SH 4NIKB 3SBWC 4XPHH 1KCRL 3GJEA 5DJYB 2H6PA 1J0YA 5EU6B 3U82B 3JUYA 5DGQA 1PKQA 3GSWA 3ARQA 1CXFA 4ZUWB 1OW0A 3WS6C 4ONHB 5GS1B 3RWGA 4IRZH 4PY7B 4GRWF 5D1XC 1RU9L 4J3XA 1TTGA 5E4EB 2XRAL 5KSUB 5E7FA 3D18B 4UDUB 3VWJA 5C0FA 3ZKND 4O2EB 3I6KB 3IXAA 4XHQA 4Q9CA 3RPIA 2JF1A 1MCEA 4UIMB 5D6DC 1PY4A 3P4NB 4OT1H 2UZIH 3QEQA 5FXCH 5LWYH 4TSAH 2GHWB 2X4QB 5TPWL 4PRHE 2X4SB 2JTDA 4KUCF 2C4XA 3QQ3B 3BH9B 3S36X 1S7RA 1EFXA 3JXAA 1LGVA 4L4VE 2HRLA 2Z8WC 5D9SA 1YECH 4ZMAT 4RBPK 3P0VH 4ZS6C 2SEBA 4RMQA 1CDJA 2AJUL 5CLWA 1KSRA 5H2BA 3DYMA 4R7NA 4QRSA 1XT5A 2C1PA 4LHUD 3IT8D 4RZCB 1UYWL 4HIXL 4MXVF 4YXLH 1BP3B 2CMRH 3HE6D 2DICA 4OB5L 3O2DL 4FABH 1NGYB 4MD0A 5DRWB 5FYJH 1A14L 3BPLB 3L6FA 4M43L 5MEND 1R5WB 1U41A 3FQTB 4XNZB 3JUZA 1RIHL 4NJ9L 3KPOB 1XF4B 3Q6FA 1KJ2B 1MH5B 2VZ1A 4L1HA 4PJCA 1MRCH 3L3DA 1BQHA 1K6QH 1H3PH 2PO6D 2ED7A 5C0GB 4KTEH 1HHHB 1ED3B 9CGTA 2LTQB 1GZQA 1RZIA 2VQ1B 1NBZA 3NA9L 4FP8H 2FR4B 1QRND 5DD6A 1MUJA 2CKNA 5I74B 1JGLH 5FV1L 4ZUSA 1YN6B 1K5NB 1JNLL 4P5KA 3VXRD 1NFDB 2D31B 2F58H 4NFCA 3SE3C 1YEJL 2OK0L 3OXRA 4MA1B 4OCWL 3I3DA 4K7PH 3G04A 3BPCA 5TFSH 1L4IA 1YJDH 2B1HH 5A16B 2XZZA 4WI5A 4MA7L 3QQ4B 5FYLD 1M7IB 5ESVA 2EEBA 5DI8B 1ZMYA 1I8LC 3T4AA 3P9LA 4AENB 4F7PB 1WFNA 1IVLA 4LLDA 4HWUA 1PSKH 4OLYL 4LP5A 2NCMA 4BK4A 4HF5L 2QSQA 4LARH 1ZGLM 1HQRA 4FQCH 4P48A 4YNYA 2C1OB 3REWB 5F97E 5GGTH 1OF2A 3IDJA 4R26L 4BSWB 5IV2A 4UB0H 1A4JB 3JWDC 3QO0A 1W0YT 3DMMC 4ZDHA 4KHXH 2MQ0A 5I1KH 1KJ2L 2E6QA 1H3GA 1VFBB 4LSDA 1Y6MR 1OTTC 3I75A 4Y1AB 1AIFB 2WNGA 3FMGH 2GSGA 3O4OB 4GW5A 4P9MH 2DQDL 3RTQB 3MBEB 4IS6B 1CXHA 5JZ7C 4RFEA 5EC1B 3MACH 3PWPD 1FCGA 2YPKB 2YPVL 1J86A 4OZHA 2OR8A 4GG6F 3H9HA 4B0MM 2H45A 2HLFC 5F1NB 4NBXB 5EU3B 3TM6A 1K3IA 2B1AH 4OF0A 5FO7A 3L3IB 5JHDD 1LDPL 4JO3H 1T80A 4PJIA 3ARBD 3TVMB 5DEFA 1Y0LA 3PUCA 5GRJL 1J11A 2XXMB 3CMOH 4AZ8A 4FFYL 2OXHA 1XZ0B 3HR6A 1ACYH 4G8EB 1XF3A 3CU1A 5D8JL 1FFNB 3HMWL 4YWGH 2BVEA 3JTTA 3TO4C 3HC4H 2R56H 4EDWH 5IVOA 4X4ZA 4U7KA 3GMRB 3LS5H 4RDQF 4PBVC 5EU7E 1NMAH 3WEXA 5HDQL 4PJ5D 5MEPB 5AG9A 4XAKD 3T2NL 1EZVY 2FZ3A 3SGDI 3KJ6L 1KLGB 3DXAA 3IKKA 4XMPH 4KK8D 3C6LC 3CU7A 4NWUL 1R5VB 4JREC 5CJOL 3SGJC 4MCZA 4JQIH 1A1OA 1KT2A 3C87A 2BVUA 4Z0XB 1U36A 3BZ4A 4NKMA 5GSVB 1AGEA 1U8KA 4AEHH 3EDFA 2XT1B 3LD8B 4X4YA 1FGVH 4M6AA 1MJ7L 4WO4C 4L8CB 1CD1B 4GKNA 1QFOA 5EOCJ 4YHLH 2XN9D 5CHNB 5C0DA 4HKXB 4U6HA 2HKHL 3MJ9A 2VLRD 4TSCL 3UTZA 1RIUL 1A6VH 1ZVHA 5MI0C 4XNMA 1KB5B 4P23B 1QRNE 5LGJB 1OAYL 2PXYC 4PJDE 1SJEA 1S8DA 2YR3A 5JOFA 1I1AC 3S35X 1IBGL 3V0VA 2R2CA 5C3LD 3L95A 2YS4A 3IDXL 1WVZA 3VXRE 5EIQA 4XX1G 1AD9B 1UEMA 3MLRH 1R0AH 4BZ2L 1W8OA 5JORA 1SJHA 4PG9B 2P5EA 3WHXB 4JCMA 2E27H 3KYKL 4QXTB 4M4PA 1T04A 3SKNB 1JF1A 1D3CA 4OCXL 5EG6C 2WINA 1T7XA 4P2QB 5FYLE 1MPAL 2F74A 3K0WA 3WO4C 3GJFK 3EYSH 1HYSD 4XNUL 4U1SB 4AM0A 4OSUH 5DVOA 1E28A 4LNRB 1F58H 3P0GB 1JYXA 4I0PC 2H9GA 1HKLL 1QR1A 4MD5B 1S78C 3RVUC 3LQAL 2OTWA 3ZHKA 1JNNH 5HHPB 3BYYA 4HUWA 5TQ0L 5F1SA 4UBDD 5F9JB 5I8KL 5D5MB 1T0MB 3HR5A 5CINL 5DZLA 4Y4KB 1FIGL 3BPOB 3BWUC 3U7WH 3HNSL 1V7NL 5GRZA 2HH0H 2JE8A 5E00B 1UVQA 2ADIB 1VPOH 2ZUTA 3LQZB 4CUCA 3X13A 4NZUL 2LAAA 1KB5L 4ZO7A 3IDIB 3PWPE 5IK3B 3ARVA 4CVZB 4X6FB 4JRXB 4ODSL 5DR5H 4ETYA 4ZUVB 3AS1A 4XGZB 1FNLA 3FTGB 1DQDH 3U9PL 1NC2B 5JHDE 2WQRA 2WQ8A 1N5AB 3QCVH 1LD9B 1WK0A 3VXNA 3VWKC 3O2WL 1P4BH 3FL7A 3EYFB 5FCUL 5I1DA 5F1IA 5E9DE 1GGIH 4YGVA 1Q72H 1EBPA 1CYGA 1UWGL 4PJBE 4L3AA 4M1GH 4HPOH 4DZ8B 3SY0B 1DQQA 5AWNH 4XI5C 1WAAE 5E2VL 1IC1A 4CNIB 5HGBB 2Z31A 1N64H 1YMHB 3VXOB 5DF0A 1JPSL 4JJ5B 4S1QL 1IGIL 3TA3C 5ITFB 3MUGA 1AR2A 1TZGH 4E42A 4K8RL 1N5YL 1AXSB 3QXAA 4ZODA 4LLUA 4PJ5E 4XAKE 4FQXB 1BBDH 1UKSA 2F8XC 2AJUH 3PHOA 4K9EL 3SQOL 2QADC 5CP3A 4JY4B 2B4CC 3ROLB 3LAFA 3WO3B 4IHOB 1OP5K 1ITBB 1KTDB 1J5OL 3C8DA 1IAKA 4LEOB 3NH7L 1P6FA 5T1LA 2APBA 4J4PC 1I8MB 4F57L 1FFRA 4LLWA 2COQA 3L5HA 3TFKC 1R24A 4ONGL 2HAZA 3TNMA 2HT3D 4KY1H 2BSSA 3OKDA 5E8PA 3MA7B 2XN9E 2BOBA 2D0HA 1I85A 2BSTA 3MRMB 4R8WL 5KS9A 2CK0H 2IGFH 3NABL 4AT6A 1D7FA 4ETQB 1YUHA 1M4KA 2VDOH 4G6JL 5EU6E 2P24B 4Y1AD 1T66C 1RZFL 4W68A 4M93B 4HJGB 4X7CC 4TSBH 3RTQD 4ONOA 4KRLB 4NN7C 3MBED 3WXVH 4KUZH 2IMNA 4D9LL 1I8IA 5EN2A 4KJQC 4TUJA 4GG8A 3QDMB 3MLUL 1NCWH 4LSRL 3MRJA 1DP0A 4K71B 4YHNA 2GTZA 3GSNA 4H5SB 5KVGL 4OD3H 3CZJA 3L5JA 2JCCB 4H26B 4QHNA 2V5TA 3QHFH 3SKMB 5J6HA 4ODUB 4IBLT 1A21A 1U8LA 5EOCH 1AGDA 3TVMD 4O58L 1HI6B 4WEMB 4LHUG 4JPKL 3OJ2C 4RRPG 3GI9L 3LH2H 3B2VH 4FXKB 2NY7L 4MZ3A 3RWJB 4EN3B 1E27A 4WW2C 5FHBH 5SV4A 4K7PY 3DTXB 3B8SA 1C8PA 1SBSH 1T20B 2YKLH 4KTYA 4DFIA 5HYSG 1W72B 4NN5B 2BNUB 2OL3H 3DUUA 4PRIA 4K3EL 4WU5A 4GXUM 3GSOA 1T5XA 1Q9LB 1G9NL 4XCYA 3FJTA 4XNXL 3S96B 4ENED 1P7HL 1P4LA 1UZ8A 4X98B 1KTLB 1LO2L 3LKRA 4UILL 3TBSA 2O5YH 4C56A 1ITCA 4JFDA 2YXMA 3ARUA 4ZPTB 2VZOA 2C3GA 2CUMA 3QFJB 3U6RB 1MIML 4DJMA 5T5FL 5J13C 4KKCD 5GJSH 1JUFB 1QA9B 1JWMA 3VXSA 4U1LB 2FJGA 2R2HA 3CFKB 3ARGB 2LVCA 4GW4B 1W0VB 4P59L 2VKXA 4HUKB 4OZFH 5K33A 4H20H 3UDWC 3AM8C 4AMKL 1QSEA 4CGTA 1WWAX 2OZ4L 2GFBB 3MOQA 3BEWB 4RAHA 1NKRA 5DJCA 4YR6A 1KLUB 3I2CH 3LHPL 4JANA 4P23D 2VXVL 3VXQA 5FKPA 3HC3L 4XP6H 1B6UA 4XBEL 3U0TB 1A7RH 3U46A 4PV8A 1NFDE 4KZEH 8FABA 4GSDL 4XVJH 4Y2OA 1E6OH 2VUYA 3M17A 1MEXH 2AEQH 4PJ8A 2HFEB 3ECBA 2Q20A 4PJFA 3BEVB 3VFOA 3C8KA 4TOYL 1LEKA 3D48R 2NY4B 2NXYB 1W72L 2Y25A 3RFZC 5I8CA 5I8OL 1RZKH 4GW1A 4LGPB 4KK9C 4P2QD 4TRPH 4HH9A 4EXPX 5HVHB 1IC5L 2R1XB 3T0EA 5D7JA 3SDDB 3WSQL 1J0IA 3BWAB 1BBJB 1KB9J 3GBLA 5CIPB 5DJDA 3WKML 3EGSA 4XRCB 4K8RD 3SKOA 3QNYB 2XKNB 5EO1B 3X3GH 1DBAH 3FT2A 3ES6A 4JDVA 3VXTB 3JWOL 1HCVA 4Y4KD 3OAYK 1DBJL 1KJVA 5T5NF 2P1YA 4AK1A 5C6TH 4GKZB 1TQCC 2AP2A 5DRZA 3VFNB 3DO7B 1F3RB 1I7RB 1P84K 4NUJA 1JMXA 1WV7T 2NX5B 4LPTA 3WS6A 4DUVA 1GJIA 1PAMA 2RJMA 1F6AA 4OTXH 3OGCB 4JRXD 3GRWL 3HI6H 4ELKA 5DURB 1FVDB 4U1IB 3T65A 3PGDA 2XPGB 4PLOB 5LBSH 3MRCB 3CK0L 4LLYB 2HN7A 3KG5A 3W0WA 1WCQA 1FRGH 3AAZB 2R69L 2M26A 3MO1B 1V3MA 1LO3L 5D7IA 5CD5C 3KLHC 3OAZK 4U2YA 5ESAA 3WFCL 5DO2D 2KBGA 4I5BA 5SX4I 4P2RB 4EDXB 2A38A 4YBQD 1MPAH 3UJJH 3UJTL 2OJZH 5ADOL 2WBJC 2ZUQC 3RUGF 4KAQL 3HPLA 3C60B 2RGSA 4S1RH 4JPIA 3MJ8A 5CZVL 3IDMB 1HN1A 1RUPL 4PTTA 4POYA 3C09B 3FOMB 3FFDB 4X0KA 4M7KL 4J8RA 1VKXB 5JPMB 2C3WA 2DTSA 3RP1A 3OMZA 2P49B 3IETA 4FQXD 3BFOA 4BQCA 5DYOB 1T7ZA 4DGIH 1C7TA 2ZUUA 4DN4L 3JBG7 2ORBL 4EBQL 1S5IH 2ZUXA 4YHZL 3ABZA 5GGSB 4RISL 3V4UH 1AGFB 2Z92A 3MRFA 4FTVB 4P46B 5I1HH 1ZGLB 1ZEAL 3I84A 5IW6A 3VFTA 2OTUB 3PG2A 2IANB 1SY6H 2GQHA 3GGWA 4Z5RB 1HOCB 3PWJA 3CNKA 5TJWK 1GZPB 4DGVH 1WZKA 4HS8H 4IRSC 2JELL 2P8PA 4LSQH 1YEHH 2JK5A 3RI5K 5I75B 4H8WH 3GHEH 1IKFL 5HJ3A 5I1IH 4CJ0A 3OV6A 5D1QA 3OKEA 1CG9A 1RZJH 2J6EL 4MVBC 3HCVB 3QDMD 5K59E 3O3BB 5BZDB 1KC5L 3UTPD 3EOBB 4DGYH 1YPZB 2DQEL 4ISVB 2A6KB 4R0LA 2HJKA 3I85A 3ARYA 3GFUA 4P2QE 2Y23A 2FJHA 2VAJA 1I8LA 1TJHL 4WI4A 4I8DA 5F7MC 3UTSA 2DWEB 4EQ2A 3MV9A 5IJKA 3RNQB 1J1OH 1NGQH 3FOLB 4DKEH 5C08B 1X4ZA 4EN3D 3MROB 4K7FA 1AO7B 1REIA 4IDJL 1EMTH 3WIFB 1LWRA 1JWUB 1YY9C 1SEQH 5D5ME 4UNTA 4O51B 2ITDB 1A7QL 4RA3A 2A0LD 5SWZB 3MLWL 3RGVA 3O9WB 1CI5A 4HCRL 3I6LD 3GM0A 3MSPA 5EO0A 4OCRL 5ALBL 4YK4C 2QQKL 1KEML 5ISZB 4FQLH 4G8IA 4G6FB 4G8GA 4N1CA 1FL5B 1LP9A 2HTLC 3K4AA 4WWID 4RMWA 4X7SH 4JRXE 1CIDA 4Y5VB 3QFJD 4OZFG 4NYLB 2QR0A 1CDIA 2VDRH 2XZAH 1JGDA 4M4RA 1FE8H 4QNPF 1D5XA 5JNYA 4EUPH 2VXUH 5EZLA 1JI1A 3ARGD 4DK3A 3MLUH 1CQYA 2VLLA 2VR9A 3CVIH 3OKNA 4NRYA 4PJ7B 1BOGA 4HS3B 3L3HA 1LE5B 1BIHA 5EUOA 1QKZL 3PGCA 2VDKH 3RWCA 2MJWA 3MLZH 5CP7B 1S9VA 1U8MB 2PCPA 4Z7UB 3QFDA 1FVCA 4QHLB 4K94H 3WN5C 1G7MA 3B9KC 2DQHH 2XA3A 5KVMC 1BHGA 4N8VB 1BMGA 5HGDA 1HXMB 5AZ2H 4HLJA 3VA2C 2AJZB 1FBIL 3HMXL 4MNQB 1J9CT 2NXYD 2NY4D 4F2MA 5EBLA 4KU1A 5E8OB 5TGBB 5CMAA 3WNNA 2PYFB 1F5WA 2IPKB 3H3KA 4G5ZL 5MHSE 4NJAH 4S1DD 3VCLB 3QR2A 4KK5D 4XP1H 1MREH 1GPOL 3SGEH 3BESR 3SDDD 1LO2H 1A22B 4UILH 1QSFA 4P2OA 1KBGL 4U3XA 4ZTOL 5F7WC 1XGTA 4YFLI 4OV5A 1TENA 1L0YA 3C9NA 1AY1L 1DEDA 3WL9B 1K85A 1J87A 2ZCKH 4GRLA 1RJLA 4F9PA 4P59H 1KPRA 4JN1L 4R2GB 1MCKA 5J9PA 3ARPA 4F7EA 1UM6H 5GISH 4BFIB 1QO3A 1KN2H 1BQLH 5H37H 1MFBH 4YQXL 5KVDH 2NX5D 2VXVH 5DK0A 4NQTA 3EO0A 3MZGB 3QDME 5HDOA 3TJHD 4OAWB 3SE4C 5DURD 5JO5B 5E94A 1UJ3A 4LPWA 3GIZL 1RQ5A 3TNNB 2CR6A 5BRZA 5HI4D 3O2VH 2AKRA 4ZOEA 3FQWB 4URTB 4MSWB 3MRHB 4HH8A 2YD2A 3E8UH 5I8OH 4WV1B 3V6FB 4NDMB 3MOBL 4OV6F 4OFVA 4QRTB 2BY2A 1GHFL 1NSNL 1L6XA 5ADPL 4Z0BL 3IRZA 4XC1L 3DX7A 3SQBA 3U2SA 4Q9QL 3RWDB 3MLXH 4FZ8H 5HD8C 4DCQA 3REVA 2ZCLL 2IADA 1UM4L 5B38B 1MI5A 3I6LE 5DRXA 3HG1D 5DQ9A 3QDGA 4NO2B 3T04D 3H3PL 5J1AB 3QNZA 2FDBP 3B2UC 5TF1L 2D7TH 3MRGA 3SKJL 1MFCL 3SDAA 1DE4A 3U30B 1FFOB 2ATKB 3ULVL 3QFJE 3VFUA 4GKOA 4FTVD 4P46D 1U8PA 5IJVA 4JHBA 2DQFB 1AI1H 5D70H 3TWCH 2XA8H 2DQIH 3OBAA 1GAFH 2V7HB 3AS3A 3L3KB 3V6OE 2AK4E 2IAND 2NYYC 5GGRY 3OHXA 1WGOA 2VLJB 4L8DA 5CBEA 1K2DA 1SM3H 2XI9A 4UQ3B 2Z0BA 4JFQA 3TIEA 4JG0L 5FV2A 3AS2A 1TCRA 3WFCH 3A6BH 3FB5A 4DK6A 3U36A 2ADFH 4MAYC 1WFOA 3IYLW 3QCTL 4D3CH 2BVPA 3B6SB 1NEZB 1RK0A 4HSQA 5M7QA 5HY9A 2W60B 4NM4H 2VTFA 3PXHA 4PJHB 3IDNA 3V4VH 3UJIL 2YC1A 4MXWL 2OSLA 1X4YA 1KPUA 2A6JB 5C0IB 15C8H 2XQBL 4MJ6B 3BHBB 3BPNB 3WFHA 1JNHB 2W9DH 4POZD 5DRNB 5SX5H 2NW2A 2ARJA 1KACB 1CTNA 4GQPH 5E2TL 1XF5A 5C08D 1P4IH 2YRZA 4Y4FA 1AO7D 1FL6B 4YHZH 5KJRL 5J3HC 4BKLB 3OKMB 1CN4A 1KIRB 1BEYL 5IBTH 4PLKD 4XPFH 1MHEA 2B5IB 5DMGC 5L6YL 5D2NB 1XIWA 2B7DT 5SWZD 3S7GA 5IHUH 4F58H 3ULUC 1XR8B 3O9WD 4M7ZB 1KXVC 2ATPA 3WFEH 4LAQH 2GKIA 4U1JA 1MWAA 2BC4B 4GRMA 1IC7L 4E5XA 4LLMA 4YUEL 4O5LH 2DKUA 4ONFL 1DDHB 4G6FD 4R97C 2IPTH 2NX5E 4XP9H 1YDPA 1CFNA 4TUKH 4HIHB 1IQWL 3CAFA 1NGZA 1IKFH 2EXWD 2VC2L 2ARJQ 3BQUA 5EO9A 5TDOB 2E6JA 3MRBA 1KLFA 2GTWB 3NMEA 3HFMH 1EHLH 1MJ8H 2VZSA 1ES0A 3MV7A 3TH4T 3CFEA 5E70A 2GJZB 3KNBB 4L4TB 5IB5B 1A5FL 2CKBB 2EDLA 1YMMB 1QUNA 3CFBA 4P2RE 3Q0HA 2O5ZL 3B3IA 3O6LL 5C0NC 1H0DA 4NQSA 3TYFA 4KJPC 5CUSL 3WNLA 1JGEB 3HE7C 1I9IH 4YJZL 3VRIB 3ZDYE 4C54A 3MMEA 2EDEA 2GW5A 4JFFE 4UDTB 3HZVB 1EXUA 4NCC2 5IMLA 4WHDA 5DQDL 1D9KC 1QEWB 4M8QA 1C5DA 4MNQD 4QHUA 4F8QA 5F72S 2C7UB 5TQ2L 4FXLA 1ZLSH 4G42A 1ZSDB 4RIRA 4X6EB 3HKFA 5KSAA 4H88H 2G5RA 4G9FB 4PFEA 4FQIL 2QQKH 1A64A 2XIDA 3LDBC 4FTVE 3RWFB 1HE7A 3FO1B 5GSRB 1KUMA 4X4XB 2IANE 5B8CC 5IEHA 3AM8A 3OKOB 2VR4A 4WIQA 3FB8A 3HUJF 5H37G 5DUMH 4MA3A 1NL0H 4G3YL 4PB0L 3CIQA 4R2GD 3QULB 3ROOB 1KIQB 1M1SA 3ULVD 1A6TB 2C4FU 3CFIC 2OYPA 5D1XB 3T8XB 2XACC 5FA4A 1I9RL 2VQTA 4V2CB 2FWOA 3RWHB 1B6DA 1AXTH 3VH8B 1HWGB 5DK3A 4CVXA 1YPZE 5EIIA 2MPAH 3FN9A 1I4FB 4X5XA 3QUXC 4NQCA 5JXEA 3D69B 3O3UN 4JLRA 4OM1L 4ZSOB 3QI9C 5EBMB 3RBSA 1TJIH 3WKNA 1X5IA 2P5WB 4JO1H 4LNVA 5AUMB 5EOTA 3QB7C 4HIJA 1CGWA 1YEDA 5C08E 1LE9A 3KJ4C 3UAJD 1D6VH 4DW2H 1BIIA 1NCUA 4N9GB 1QBML 3ZMRA 2R2EA 1UWEH 2RCSL 4PJDF 5SWZE 4NGHH 3UBXA 2NZ9C 3EYVA 3TBVB 1VB9A 3CFDA 3LEXA 5DD5H 4XMLH 3IGAA 1D5ZB 4JDZB 5C0JB 1QHOA 5ISZE 2BSRA 3L7EA 3MJ9H 4LSUL 5AYUH 1HSBB 1XGYH 2WV3A 4LLAA 3X14A 4DN3L 2FX7H 5TDNA 2Z91A 2C4FT 4XTRD 3SKUD 1WIUA 1F45A 3TT3H 3QUMB 2YMXH 4HPYL 5EA0L 3KWWB 4ZD3L 4YQXH 2XQYK 5FK9B 4EVNB 1NMCC 1HHJB 4DWHA 3FRUB 2UVFA 4XBPB 3P0YH 1QFWH 1UQSA 1A7BA 3MJ7A 1IARB 4DQOH 4PJ7E 1P9MA 5FYJE 2VLJD 2CJUL 2CR3A 4LASH 3GIZH 4DUWA 4TVSa 4QWWC 1H3XA 2R8SL 4Z7UE 3TT1L 3WIIH 1NH6A 4K3JH 4LRNH 1M05A 2WUCH 3MOAH 5E2JA 2WSKA 5ID0B 1EO7A 1BZQK 3QDHA 1CGXA 2MQCA 2YPLB 4R4FL 4IMKA 1GHFH 3L3OA 4X7TA 5DHVA 1DLFL 2XG4A 5F3BA 4F7MB 1PZ5B 3DURA 2X4NA 2ZUWA 1YC7A 4OZ4A 4MNQE 4RAVA 4Y16B 5KZCB 1NANH 4QY8A 2AEPL 2EE9A 1D5BA 2HG5A 2ZSVB 4ZS7H 5T3ZH 1N8ZA 4LK4A 1T1WA 3GM8A 5ITBL 2R0ZH 2FATL 3O3EB 3QWRA 2IBZY 3UPRA 1CFSA 2A74A 1RI8A 3A67H 1BX2B 1E4JA 1HILA 3S34L 4PG2C 3QIBC 3IU4H 2D7NA 4PRID 3DMMB 3DUSA 1HXYB 3QUML 4UTAL 2R0LH 2CDFB 5E08H 3GO1L 3IU3A 3MXWH 3DROA 3IXTA 2VOTA 1BQHG 2K9UA 5IB2A 1FHGA 3PDOA 1WAAF 1DBML 4WUKH 5F7EL 1KPVA 4HUUA 4IIQA 4KKBC 3RU8H 3CSYB 2JIXB 3ULVE 1IM3A 4YPGA 4PJ9C 5LAXB 1V8HA 4XCFL 5IMKA 3O4LA 3B8YA 3ME0A 1KENH 4NZTL 1IKNC 3QIUA 3Q48A 5E56A 3KPSB 4X80H 4LSTL 4UT6H 3MRNB 3LMJL 4BH8B 1IAMA 4PREA 1AHWA 1Q0XL 4R3SA 5C9JB 4HK0A 4L4TD 3D0VA 5GS2H 1LMKA 4HV8A 4MXWH 2IG2L 1NBVH 1YMMD 4HT1L 5DA4A 3TO4B 2J4WL 5EZOL 1MHCB 5CP3H 1DBKH 4BFBD 1GOHA 2EYTA 4G7YL 3PQYB 4XNYL 5BMFH 5JQ6H 1G9MH 3EJYC 3JWDL 4YHOL 3V7MA 4N90D 3C6LB 4PJEB 3DX6B 3WXWH 1UKQA 4WHYG 5IWLC 4FZEH 4JREB 4ZUUB 2R2BA 2XTJC 4FFVD 4NM8H 2NR6D 4LKXB 2ICEB 1FZOB 2E9BA 5SWSA 5HI3D 1I3RA 2D2OA 2EC9T 3ZE1F 3CDGA 1IC7H 4G9FD 2HJFA 4Y7MA 3OZ9H 5DVLA 4OFYA 1YZZA 4YFDB 3VD5A 1FGNH 2CDGB 4G6AD 5LGHH 1KJ3L 3IS0X 4UUJA 4CBPA 2CLZA 4WHTB 1X6LA 1NKOA 5GGVY 2VDLH 5MI0B 5TDPA 2QLVB 1WJ3A 3BAEH 5F3HA 3GB7A 4F37F 2VLJE 2VIRB 5DTFA 3QG7H 1B4JL 2H2SC 2PXYB 3OKKB 4UINH 2IH3B 3GSNH 2ZUSA 1I1AB 1NAKL 3LN5B 3RPKA 3E6HB 1JTPA 1N7MH 2I07A 1FZMB 4TNVF 5BZWB 3WN5A 4AIZB 3IJSB 3F7PC 2Z8VC 1JV5A 2R9HC 1MCWM 6FABL 5D1XD 4MLIA 3O6LH 1E4XL 5JW4Q 2VLMD 3C2AH 2HVJB 3DSFH 4JE4B 5EBWB 3FO9B 2KZ1B 3LKNA 4NQUA 2FNBA 4OKVB 2VITA 2YD7A 1CR9H 2DJSA 4PJHE 2VH5H 3FONA 5DD1L 4JFZL 4I2XB 2W0FB 1E6JH 2CLRA 1MLCB 4GXUN 1FNGB 3L5XH 1SVCP 5F6HJ 4PY8I 1YEFH 4I0PB 5I0ZA 3C08L 5DJ2B 1FZKA 1Z9SA 1PDKA 5DJXB 3ZDZF 3BUYA 1SYVA 2FGWL 2V17H 3HS0B 4ZS6D 2X1QA 4NUGH 4RFNC 3HNVH 4FQIH 5C0RL 5DJAA 1OAKL 3V5DA 2VJXA 4W6WB 3GIVA 5D2NE 5E8NB 2MOVA 1KN4H 2X1WL 5FGCB 4ERSH 4OUUA 2JB5H 1FJ1B 5F96H 3U9UB 1MVUA 3PWLB 1R3IH 3QEUA 4AY0A 1NCCH 2AQ3A 2DLTA 1NFDF 1UACL 4HFUL 4PJXA 3D2UA 4D0CB 4E41A 3U0WH 3G5ZA 4G3YH 4PB0H 3MCLH 1BFTA 2DLFL 1YQVL 4F80A 43C9A 2FEDC 5DEGA 3MRRB 4DOHB 4FQQA 2VXQL 1FAKT 1IL1A 4N8VG 3VWKB 4LCYA 5CILH 3FCTB 5IKCB 3V79C 4HFWB 3VI3E 3D3VA 3AROA 5I18L 1OGAB 4L4TE 2AXGA 3RZCA 2VZUA 4XC3H 4YBLC 1DQML 4UU9B 4KZDH 1EAJA 1YMME 4X7DC 4C4KO 5KTEH 3IJHB 1VADB 1OCWL 4PD4K 4PGBB 5I2IB 4P49A 1DVFA 3TA3B 1ONQB 3FRPG 2XFXB 2DDQH 4WI8A 3TCXA 2Q76A 3K81A 1G0DA 2O26U 1ETZB 1JTOA 1NJ9B 4NQVB 4XP4H 3F8UB 4WDIA 4KMQA 3MGTA 5JIIA 2YPLD 3W9DB 1ERNA 5ILTL 4LDEB 2RAMA 3P40A 2KZWA 2AJSH 1ADQA 1Q0YH 1JMZA 4IRJC 1FNFA 1K4CA 2QADB 1ZWIA 4OZGA 5EU7C 2A83A 2R23B 1W2KT 3CGTA 4Y16D 2VDMH 1C08B 5KZCD 1T1XB 3ZE2E 4S0SD 1HSAA 4RQQB 4S2SA 4ESKA 3JWNC 4G9FE 4HWBL 1ZKAA 3QRGL 2X1XR 5EOQH 5HPMA 3SOBH 5BXFB 1ND0A 4UV4L 1TVHA 3NFNA 3DMMD 4P3WA 1FP5A 2FL5A 4PRPA 3S4SA 1R6VA 3WV0A 2E9IA 2EDXA 3DBXA 5ESQA 1A3LL 1PLGH 4KDTC 3I9GL 3CPLA 3NFPA 3RY6C 3RL1A 3BIAX 1Z0MA 4NN7B 2DF3A 4R4BA 3WMSA 5JZ7D 4J3SA 3CC5A 1EJOL 2J2ZA 2ZJSL 2JIXD 4LU5L 5T3XL 4HIIB 2BNRB 5HGHB 4PPTA 1Z3GH 2HLFD 3VE0A 3DIFA 1S7TA 1TDQA 5EBGA 4X6DF 2VLME 2WWMC 4HMEA 3ZT6A 1IM9A 4ZFFA 2UWEF 2R1YB 3NZ8A 1B0GA 3QA3A 3I6GB 3GMNA 3V5HA 3KPSD 5EFIB 1S9WA 5EU5B 2BRRL 3ARTA 3X3FH 1Q9OA 5B38G 1HHKB 1G7HB 4ZSOE 3SJVB 5F7FA 5ECJE 2B4CL 2P5WE 3D87B 4NQEB 4WW2B 3QUYA 4Z7WF 2WANA 5CD3A 2VXSL 4ODVH 1U58A 3IFOB 4NT6B 2AEPH 3TO4D 5ACZB 1AD0B 1OAXL 1C5CL 2BHZA 4P5MA 3MNVA 4F3FB 3DVNB 4MZ2A 4JAMB 4UT9L 4OF8A 3X11A 3CDCA 1Z5LA 3LKQB 4Y4HC 1MNUL 1OTSC 3K8MA 1CDBA 4LHQB 3C6LD 4ODXB 2Y36H 4HMDA 3RUGA 2C3VB 4NSKA 5IF0A 3BT2H 4JN2A 5TE7H 1L7TL 5F89A 1S7UB 5K59F 5IROA 5J13B 3NFSH 1BOYA 2I5YH 4HUXA 4WO4D 1FSKC 5DK2B 1WT5A 1EGJA 2L7JA 4WFFE 1OP3K 1NEZG 2R29L 1A0QH 5F7YC 5JA8B 3TN0A 1V05A 1Z0NA 2DJ4A 3GSUA 3RY4A 1YY8B 3LRSA 2PXYD 3EOAA 4UOW0 5IVXB 3P11L 1Q0XH 4MA8H 4KV5F 2BSED 2JJVA 1I1AD 5KW9H 4Y19B 1A6UL 2IEPA 3MR9A 3LN4A 5J1TC 2VDNL 1B9ZA 2IG2H 1ZLUK 3OB8A 4Z7VF 4ZG1A 3ZDXF 4WGWB 2YPLE 1AJ7L 2J4WH 4TUOB 1U8OB 5IB4B 1T22A 5T1MA 1UC6A 4K3GA 3BN3B 2OBGA 2AJYL 4LRIA 4WNQB 5FYKU 5GXBB 1U8IA 3DHJA 5DDHA 5EZJB 4ELMB 1D5MB 4PJGE 5D7LA 5I1JL 4KQ3L 1IC4L 4I0PD 5IT2L 5JLZB 2J88L 5C09B 3D9AL 3BX7C 3RVUD 3MXVL 2HFGH 1CD9B 3PHQB 4OLUH 1UG9A 3DLQR 2ZPKL 1F3DH 5FOBB 4XCNA 1G6RB 1HHIB 3H9YA 3QH3A 4FFZH 5D72L 5BQ7A 5A2LH 1UADC 4L3CA 1C1EH 5F7DA 3Q6GL 2NY5H 1WEJL 2EKJA 3BKCL 2FLRT 2HRPH 5HHQA 2C9AA 3A6CH 1RHFA 1PQZB 2H41A 3GHBH 3ARRA 3CD4A 4RWHA 3O8XA 5FF6A 4Q74A 2EDTA 5F9WC 3RRQA 3BDBA 4DAGL 1SYSA 1KEGL 1HINL 1Z9MA 1N59B 3GKZA 4ODHH 2UYLB 3KPSE 1FL3A 4BSVA 3ZT5A 2IALB 1HDMB 3VWKD 3QXDB 2F9BT 1R3HA 4O9HL 1XH3B 1MUJB 1V7ML 5E4EC 1JHKL 1OGAD 2A1WH 5T3XD 4I1NB 2A9ML 1YNTA 2WBKA 4OLZH 1BLNA 1QACA 1VA9A 2WBJB 2ZUQB 4XI5D 3ZHDA 4HDIB 1DN0B 3GMPB 1U3HC 2PUQT 4CKVX 2YD4A 3KXFB 4OI9A 1H3VA 2I9LB 3TA3D 5DJ8B 5GQBA 1PBYA 1LEIA 3K74B 3P4MA 3PQYE 2PETA 1FFPA 3PJSB 3QIWA 3NPZB 3INUL 4IM8A 1AP2A 1G6RL 2KL6A 4PJEE 1R3JB 2QADD 5FGBA 5BO1H 4N1EA 2QKIA 1TJGH 1QNZH 5DSCB 3VFGH 4PP2A 3CVHA 3MYJB 5HHVL 1EIBA 4J4PD 1MVFA 3TFKD 3MUZ1 2FCBA 1IAIH 2HFTA 2PW2A 2DLHA 3CCHB 1F8TH 3H7BA 3LVEA 3M8OL 5GS0C 4C55A 5I1AB 3UYPA 3BSZH 1S7XA 4NZRL 2JCCF 3U0PA 3F7VB 3P30L 1YQVH 4DKAA 3V7AE 1KELL 3VD7A 4C57C 2JJUA 4XNQA 3L7FA 4IRSB 3SDYH 3VH8G 3QHZL 2ERJC 3STZB 2GJ6B 4UOW1 3K2UL 4JM2C 2JJTA 1T66D 4RFEB 1CE6B 4JGMA 5E6IC 2R4RL 2V7NB 4JR9L 4DKDC 2F53A 5H94B 4IMLB 4XWOC 4KJQD 3I3BA 2BNRD 3EDJA 4XXCC 4QXGL 1OTUC 2OCFD 5FO7B 4NQDB 2J5LC 3LKOB 4KXZI 3AY4A 3VFMB 3OAUL 4PRAB 3C6SA 3LIZH 1XR9B 4EEEA 1RHHB 5LVEA 3GKWH 3BKYH 4I2XE 3TBYB 1EBAA 2RB8A 3IFPA 3SJVD 2NY3C 1BFOB 4Q2ZB 4NQED 2EYRA 3KHOA 4IDLA 1A6WL 3LV3A 3W82A 5J11C 1JIBA 3O41A 5FECB 5D2LB 4QXUH 4YXKL 3KVQA 2ZOLA 5I17A 2DN7A 1AGBA 3QRGH 4RGOL 4CJ1A 2A73B 3JVGA 1OAQH 3LEVL 1CDCA 3I02A 1RJYB 5EWIL 1NCNA 4NZJA 4JQXC 4YK4B 5FGCE 3O6MH 4PGCB 2HWZH 3QG6A 3MGOB 3S36H 1AQKL 1MCSA 1PVHA 1BF2A 2NNAA 4ZPVB 2DTML 3AB0C 1UXSA 4KDVA 4I3SH 1FNSH 2JJSC 3S37L 4DOHE 3QUZA 2B8OT 3O6KH 4ORGA 4XVTH 5HHXL 5E6ZA 3V0WL 5JHLL 4HK3N 2IWGA 4YDIH 1OGAE 3VRLE 1JFQL 4ACPA 1GC1C 5E2UL 1OAZH 3QHTC 1CBVH 2C26A 3B9KB 3CX2A 4Y19D 4M7LT 4XMKH 1IAOB 1Q9WA 1Q38A 3MCKA 4NQXB 4PRHA 2BX5A 4GRWH 3G6JB 2E7MA 2ICCA 4JDTL 2AQ2A 1DQLH 3QP3A 3DRTB 1T5WB 4X6BB 5IWLA 4KK9D 2FX9H 4XPBL 3G08B 43CAB 4QKXB 2H32A 2XOTA 1QR1B 3OR6A 1YNKL 5JW3H 5C09D 1VFAB 1RUQL 2E9WA 2QSCH 3LPGA 1BFSA 1MWAH 5T1KB 1J05A 3MPCA 1CFTB 5FDYA 4NRXB 3LS4H 3P3YA 1Q1JH 2DQCL 4CW1B 1LNUA 3F7YB 4KKCC 4WHCA 2DYPA 1FLTX 4XXDA 1OB1A 3FHQA 1UVQB 4Y2DA 4BSJA 2ITCB 2GY5A 4OGXL 5CGMA 3EFDH 3TH3T 4JY6B 4MCYB 1SEBB 3ZDYF 4JQVA 2BNRE 4N8CL 1VEOA 5GRUH 3D25B 3KLDA 5F6IC 1ULVA 5DFVC 3ZKMC 1WCBA 2VDNH 1RVFL 4JKWA 1NFKA 2IAMA 5IHZA 3M45A 5IVZA 1YN7A 5CD5D 3KLHD 3ZZ1A 2BCKA 1NUDA 3P4OB 3SJVE 4WUUB 3RA7H 4NQEE 4MYWB 2H3NB 2WBJD 4P4KC 1CLOH 4QTIL 2GUOA 3KXFD 1CE1H 1HH6A 3HA0A 1CLZH 1DFBH 2QTEA 4FNLL 1UZ6E 2P7TA 3W39A 3KPQB 2W65A 2MWCA 2DQJH 1CGSH 1BQSA 1GIGL 4UNUA 3V7AG 1P7KB 3GJFB 1X5JA 3VJ6A 1F13A 3V0AC 5FYKH 2DIBA 4JFYB 4Z7NE 1CFVL 3FN0L 4OGAD 3TYGL 3PABB 2PTUA 3I50H 4MNHA 4JZJA 1XFPA 4JEGB 3BP4A 5CBAB 5A1AA 4H0GA 4NKOA 1PYWA 1YPZF 3V95A 5JUEH 5JW5A 1F02I 2HJLB 5DQJA 3JV0A 1MFEH 3MNWA 3VG0L 5I71C 4IRSD 2DQUH 1A7OL 3GMOA 3HNTH 1NCAH 1QVOA 2GJ6D 5IVXE 4NRZA 5I19L 4A6YL 3WD5L 4MAYB 2FECL 5GZOC 4LOUC 2GITB 2ADJB 1WBZB 4HC1L 5FUCC 1ZHLB 2BRQA 4MVBD 3EUUA 3HUJA 4YDVA 3WDIA 4NO5A 1ZHBA 1ZS8B 1PEZA 4NQDD 2CSPA 2VDQL 3TO2A 5M95B 3T1FA 1EX0A 2ENYA 4KI5C 3EOYG 3U4EB 4ELME 4Z8FH 3S35H 1E27B 2OJEB 1C12A 1EEZB 4LHUA 3STLA 4OCSL 4L9LC 5C09E 1RMFH 4BELD 2FIKA 1VCAA 2M2DA 2VR5A 1T2QH 3BGMB 4QT5A 1DL7H 1E4KA 2G75B 2AEIT 1YY9D 1J18A 1T5XB 4FFWC 3U1SH 1YQ2A 2LAGB 2YEZB 2PR4L 4GAYA 1JK8A 5MENA 5HYSA 1TZHB 4LSPH 3MNZB 5BV7H 5FUOH 4NZRH 2EYSB 3RL2B 3LKRB 2V2WA 1Z6JT 4R4NC 4Z7UF 3CLEL 5E2WL 2V5MA 4KVNH 3WFBH 4JFEB 1Q9KA 2PO6A 2VAAB 4R97B 4UIKL 5I1GL 1T4KB 3V52L 3HZMA 1EH9A 5JDJA 1QRNA 4PJDA 2JB6A 4QOKD 3OPZL 4G8FB 2FB4H 1JGUL 3QUKA 3GMQA 4PYGA 2CLVB 3VXRA 3C2SA 3MRKB 1X5YA 2CQVA 4MDIA 2Y7QA 2E7LC 4QRRB 5DHVH 1WICA 1W0WA 2FO4B 4WGVB 2X4RB 3V5KA 4XPAL 4C4KT 5IB1A 3B9KD 3PNWB 1HQ4B 3HE7B 2FHBA 3FQUB 4H1LB 3OR7A 1FO0A 3KXFE 4CMMA 4Q6IA 1JZ7A 1MFDL 1MY5A 2OQJB 1T21B 4HAGA 5DJZB 3SCMC 2I9TA 3SO3C 3PWVA 4Q9RH 1JRHH 1D9KB 5I8CB 2A6IB 3GSRB 1G7QA 3K46A 5HYJB 2WAHA 3ULVF 3ULUL 5KSBB 4XCCH 1IE5A 3JV4A 5GIRB 4GJTB 3WUZA 2G60H 1AXIB 3LDBB 3H42H 3H7LA 5FGSA 2PW1A 1LEGA 1GSMA 4M7LH 5T1KD 3PWPA 1IGTA 4UV7H 5J7CC 3LZFH 3FT4B 4CADA 5B8CB 4L29B 3O6FC 1R3LA 4GMSL 4XB8A 4M6OL 1JZ8A 3IFNL 5EZIH 5IW1A 7FABL 2GJ6E 3NIDE 5JHDA 3UROR 4Z76A 3V0WH 3ARBA 2KDGA 3ET9F 1RK1A 3ZKQD 5E9DA 3VFWA 4Z7OF 3P9MA 1I7UA 1U8QB 1U8HA 2ZWLT 1WC7B 4PJBA 4S11A 3O3DA 3RVVC 4WFED 1I7ZB 5IB3A 1WAAA 2BXZA 1MRFL 4F7CA 1X6NA 4PRBB 4KFZC 2Q3AA 2XWJB 3QUXB 4V2BA 4PJIE 3TEUA 1KTRL 1GGUA 4PJAB 3QI9B 1R3KA 4PJ5A 1CGUA 3F12A 5EORL 5EH1A 4WUUD 2NY4C 5INCA 3KJ4B 2V9TA 5ANMB 3L3GB 2CUIA 3KPLA 5JW4N 4HWZB 3E6FB 4X9HA 5JIKA 1Y6NR 4KWUA 5D2LE 5HD8D 5LGKA 3ESUF 4GXVH 3O3AB 2MCG1 1KCUH 1XGPB 1K8DB 3LKPB 4KHTH 1MCFA 4HEME 1T03H 3DXAE 3DGGA 3H9SB 3BVNA 2PTTA 2XN9A 3B2UD 3WJJA 4N5EC 4WEUD 3QJFB 2VLRA 4L1DA 2YUZA 4YHMH 1Q8MA 1F3JA 1S9YA 2WIMA 3O2DA 5DJYA 4I9WD 2Z8RA 1A2YB 4KQ4H 1NMCB 4NNPH 2ESVB 4P9HH 1MAML 1U0QA 5CKAA 4ZUWA 3RDTC 3UC0H 4M1DL 5KVEL 2CH8A 4ONHA 5GS1A 2NYYD 3THMH 3PGFH 5C0AB 1MQKH 1OHQA 4RCAA 3Q2CA 4PY7A 4TQEH 1BD2B 4WENB 3DX9A 4WWKC 1RUAL 4XCEB 4LF3B 2V2TB 5KSUA 3D18A 4UDUA 4XVSH 4O2EA 4RFOL 2CUHA 4ZYKB 3I6KA 1S7VB 4UIMA 2DQTL 1C16B 32C2A 3GBML 3OF6D 3P4NA 4MAYD 1CL7L 2X4QA 2GAZB 2BJMH 4HLZH 1UCBL 3BIBX 3G6JE 4ZFZB 2X4SA 3QQ3A 3Q1SL 3BH9A 1DZBA 2BOCB 5KSVA 1KTKE 4WFHD 4HWEL 4U3CA 3C60C 1CFQB 1I1CA 4B5EA 5KAQG 5AZEH 3EO1A 3UTTB 2W9LA 1AFVH 4RZCA 4JHWL 1OGTB 4QGTA 1G6VK 3PWUB 1IGMH 5J3HD 3QIBB 4U6VL 3RX7A 1KCVH 1I1YB 2XNAB 1HH9B 1RZGB 1Z9LA 5IFHL 2FO1A 5DMGD 1NGYA 4KJWC 5DRWA 5FO8B 1A3RH 3ULUD 3FQTA 4LMQE 5EO0B 3KPOA 4WY7L 1XF4A 1KJ2A 5ICZB 3AXLA 5CEZH 4PJ9B 1F4YL 4JFED 5ICYB 3Q5TA 5C0GA 2I27N 3F7QA 1HHHA 1ED3A 3GMLB 3ARDC 5I30H 2VQ1A 2FR4A 1KFAL 4WFEE 4PLJC 4XXCA 2H8PB 2DM3A 2NTSP 1U6AH 5I75C 1YN6A 1BVLB 5T33L 3BKML 1K5NA 2CXKA 2VLLB 1QYGH 1NFDA 2D31A 4EKXA 1RFDH 4NKIL 5ICXB 3W9EB 1S9VB 2K3TA 4KK6C 2YBRB 4YX2L 2QBWA 4QRRD 3NZHL 5A16A 4WUUE 1ADQH 1U92B 4WEBH 4U49A 3QQ4A 1M7IA 5DI8A 4KJPD 1FLRH 5BJTB 3HE7D 4P57B 4AENA 4F7PA 5IESH 2IF7A 3BP6B 4L4VB 4JKLA 3VXMB 3REWA 2C1OA 4OM0L 1IGFH 3VDCA 3W5MA 1D9KD 4BSWA 4OD1H 4YDJB 4MAUH 5F7LB 2XTJB 4KI1A 4Y5YC 1A4JA 3DV4B 4JFOB 5HYJD 3NOIA 1VGEH 1JHLL 1QSVA 4K3HA 3PV6B 5IQ7L 1NQBA 5LQBL 1QSFB 1MY7A 1YNLL 4JO4H 1PX4A 4J1UB 1VFBA 2R4SL 3H0TB 4I9WE 4LCIH 4MQ7B 4N1HB 4Y1AA 1JL8A 1AIFA 1XAUA 3H2WA 3V52H 3HAEB 3RTQA 3B4NA 3MBEA 1NMBL 4IS6A 1F4WH 5EC1A 1LO5B 3VMOA 2YPKA 2FHFA 4UQ2B 4Q0XL 3U48A 3PDDA 4I0CC 5ETUB 1VESA 3AMKA 3ARFC 2AAVA 4U6XA 3JV6B 3G6DH 4TULL 1RUKL 3BMWA 1ZANL 5F1NA 2I24N 1MQ8A 5K9JL 5J9PB 2D0GA 5EU3A 3VI4E 4KTDH 4F9LC 3IVKB 4CMHC 5E8EB 1E4WL 3L3IA 2YD9A 3RVXC 5J8OA 2A2QT 2VXTH 4JO2H 2QQLH 4Z77B 5F88A 3TVMA 1YEIH 3D39B 4GS7C 1XZ0A 2HFFB 1HNGA 2P4AB 3RAJL 4G8EA 4L8BB 1FFNA 4K2UL 4RWYL 3FB7B 2AKRB 1MFDH 4HKJB 4HG4K 1KYOK 3QUXD 3GMRA 3PF2A 1JPTL 1JHTB 3DVGB 3KR3L 3QI9D 3ZYZA 4CVUA 5MEPA 4YAQB 1ZA3B 3S3PA 1OOAA 3IB4A 5E5MB 1KLGA 3MRPB 1QLEL 2D7QA 3R0MA 1R5VA 3DX7B 2F19L 5FM5O 4G7VH 3K1KC 3KLAA 3D85D 1YJDC 3MTRA 4Z0XA 5GSVA 4KRPC 4OQ1A 3DUHA 1MF2H 2Q86B 2LABA 3ULUE 4K07A 1NCBL 4L8CA 1CD1A 5BVPH 1EGJH 5ALCH 1UWXH 3H9SD 3MBXL 5TE4L 4NKDB 3WJLC 4APQB 5CHNA 4HKXA 3VFRB 4M6OH 4JFEE 4G9DB 3CXDH 4ZNEE 4M61B 1KB5A 4P23A 5LGJA 5CZXC 2WWKO 1KB9K 1BJ1H 1TNMA 3DVIA 4QHMB 2ESVD 1UA6L 2D03H 1BF8A 4N0YL 1ZOXA 1AD9A 5JXAH 3UO1L 2MQ3A 1HZHL 7CGTA 3V4PL 5C0AD 3BD3A 1CXLA 1FPTL 1YYLH 2RHEA 4JFQB 4JPWH 1BD2D 4PG9A 3WHXA 5ID1B 1U8JB 1JWSB 3BH8B 4QWWD 4QXTA 5DC4B 3SKNA 2FD6L 4QRRE 4NNYB 1MCLA 1H3TA 5D7SH 2CO7B 4LCCC 4P2QA 4M62H 2GIYA 5EORH 2IFFL 2KKQA 4U1SA 2FLBT 1H5BC 1WBYB 4LNRA 4PGJA 3QPXL 2DBLL 35C8L 4RX4D 4MD5A 4G6KH 4IRJB 5IGXH 5I1CH 1OD7A 3MYZA 2O5XL 2ADGB 2W38A 3RY5A 5HHPA 3TZVC 5DT1H 5F9JA 4OGYL 5D5MA 1T0MA 2CGRH 5HYJE 4CN6A 4HQQL 5ERWB 5KSBE 4Y4KA 1OL0A 2CD0A 4BZ1H 3IJYB 3G5VB 4I18C 4TPRL 4XPGH 2QQNL 4TNWK 3UTTD 5E00A 5IIEB 2ADIA 1CDUA 3LQZA 3RNKB 1CU4L 3IDIA 3QIBD 5IK3A 4CVZA 4X6FA 5EUOF 2FSEB 3HC0B 4JRXA 1MFAL 4F8TA 4MJIB 1WWBX 1OVZA 2ATPB 4ZUVA 4R90L 4XGZA 3FTGA 4EI6B 4JZNB 4QRUB 3WIHL 1QFWI 4KKBD 5IFAH 1N5AA 1LD9A 2F5AL 4AEIL 2XYCA 4PJ9D 3PL6C 3EYFA 4J6RL 3TC9A 4NHCH 1QP1A 1LVEA 1TXKA 1VFMA 2L4OA 2Z8SA 2EDHA 5J0BA 5IMMA 3IS1X 2O61B 4DZ8A 3FO2B 3SY0A 4A2MA 1L7IL 3RHWF 4PJEF 4XP5L 4CNIA 3MLVL 4OBRA 4W4OA 5HGBA 3VXOA 5L2JB 4JJ5A 1T83A 1JPGB 3Q1SH 4N0RA 5ITFA 3T3PE 5C7XH 3ISWA 1AXSA 1ACZA 1BAFL 1OAUH 2I25N 4OQTL 1FYTB 4FQXA 4RMRA 5BOPA 4PS4L 4R7DB 1ZGLP 4RMSA 2AI0L 2P44B 4JY4A 4JM4L 3ROLA 5CJQL 5ANME 4IHOA 4MWFB 2V9RA 1KTDA 2YOCA 3QCUL 3MA9L 5CGYC 4LEOA 3CVHH 4Y4HB 3SPVB 2BERA 4U31A 4BM7A 1I8MA 3EJYD 4L4VD 4LMQI 4D94A 1WIOA 3VXMD 1BFVL 1IGJB 1VGKB 2QHRH 4CU8A 5DD3L 3S4SG 3H9SE 3MA7A 3KYOB 2XTJD 4G43B 5L0QB 4AL8H 3MRMA 1A7PL 1ZVSB 3ZL4L 2BVOB 1A9EB 1B0RB 4ETQA 4F33B 1QQDA 5C8JB 2VABB 1FSKB 2P24A 4JFPB 1IEAB 3QYCA 2ED8A 2ESVE 4HJGA 2DIAA 2VDPH 5BVJB 3M1BB 3MV8B 4FQHB 5C0AE 3U4BL 3QDMA 2VRAA 1BD2E 3UYRL 3BKMH 2H2SD 4X99B 3WS3B 4YDKH 2OZ4A 1A7NH 4H5SA 5I8EB 4GH7B 5FHAL 4H26A 2JCCA 3SKMA 1INEH 4CN4A 4ODUA 2R9HD 4MJ2A 4WCYL 1HI6A 2FWOB 2IQAB 4JHAL 3D39D 1FO0L 2FX8L 4FXKA 4U1HB 3QWOB 4PB9L 3RWJA 4EN3A 1MHPH 3DTXA 3QNXB 3R8BB 4G6ML 1T20A 4JLRB 1UM5H 4GG6B 12E8L 2W1NA 2X4PB 1W72A 2NY0C 2BNUA 4OM0H 1GOGA 1Q9LA 5SX5K 1FORH 3DV6B 3S96A 1MLBB 5L9DH 3UTTE 3WLBB 5C2BH 1I3VA 4X98A 1KTLA 4N0UB 3IFLL 2X09A 2DL9A 4WI2A 4ALAL 4M6MH 3MJ6A 4MQXC 1BIIB 4TTDC 1OSPL 4ZPTA 1OPGH 1YEEL 3QFJA 4HXAH 3U6RA 1L0XA 1JUFA 1QA9A 5KG9B 1LK2B 5FCSH 3HLAB 4U1LA 3CFKA 3ARGA 4GW4A 3V6OA 1W0VA 4JY5L 1EO8H 5LCVH 1LP9E 2GT9B 1UXWB 1NBYB 2GFBA 1E4WH 3BEWA 5F9WB 1KLUA 4NP4H 3IKCB 1RJZA 3P2TA 4M6NH 5I6XC 2AGJL 2FEDD 3V9FA 4LLVB 3GRWA 4MD4B 4LSVL 25C8L 3CSGA 3U0TA 1AE6H 1OWWA 1ORSB 2EH7L 2PYEB 2HFEA 5F93C 1S7SB 3BEVA 2XV6B 5A40E 4OIIH 3C5ZC 1U3HB 3NACL 4X9BA 2HVKB 5DMIH 3R1GH 4HBQA 5IR1B 4L8SC 1P53A 2J8HA 2R1XA 1YEGL 4XPTL 3SDDA 2H32H 3BWAA 1BBJA 5CIPA 4XRCA 3VXME 3MRQB 3QNYA 4S1SH 4IRJD 2XKNA 3ZYIA 2BNQB 1FG9C 3NCFB 3CX5K 5EO1A 3KLSA 4JPVL 4AQOA 3VXTA 2XTJE 2KQNA 1NCBH 1EEYB 1RURL 3BJLA 4U1MB 5IMOB 1QSFE 3O11B 3DO7A 3VFNA 1I7RA 2VO5A 1TETH 1AQDB 1HIMH 2NX5A 4M02A 3BZEB 3OGCA 2DLEA 3O45B 4RAUB 1MCPL 2ERJB 4MJID 4OIAA 5GGQL 1FVDA 4U1IA 4JM2B 1BGXH 4WW2F 1ZT7B 2XPGA 5E6IB 1LO0H 3MRCA 4LLYA 4LSSL 4EQ3A 1MCBA 3AAZA 1OM3H 3MO1A 3L1OL 5C2UB 3MGAA 4IOIB 2XY2A 2HTKC 5GZNC 3DI2B 3T0VA 1HEZB 2FEEL 3D39E 2WWMD 4EDXA 2J5LB 4XH2B 2GSIB 4HIEB 2CIIB 2J6EA 5B22A 4OLVL 4PREB 1RZ8B 2Y72A 2GK2A 1UH3A 4HKBB 2VL5B 5B3NA 3C60A 2FH8A 1CICC 3IDMA 1CGTA 5I1EH 1P7QB 3FOMA 2BVQB 3LPWA 2NY3B 3FFDA 4F15C 1RIVH 4BH7B 1VKXA 3V6ZB 5JPMA 3HG1A 1FYTD 2E7HA 5IEKB 5FUZL 4Y16C 3NCJL 3P9WB 4OLWH 4Z95L 5J11B 1HNFA 5K9OB 4HBCH 1DLHA 2DIJA 5H8DA 2VZ3A 2WUBL 5HGAB 4DKFH 5GGSA 5HTSA 5GS0L 3RIFK 2HLAB 1AGFA 2EECA 1CGYA 4Y4HD 4FTVA 4P46A 1RZKC 2A77L 5DS8B 1OTSD 5K93A 1ZGLA 5I76B 5IVXF 3QPQC 1NLBH 4PIRF 2OTUA 2F54B 4HCRA 3L3JB 3QEHB 3HHRB 2IANA 4PUBH 4TYUA 4NWTH 4P4RB 4Z5RA 1HOCA 4WI6A 2FYYB 4MJ4A 3L5IA 3TJEH 3ZTNH 3AB0B 1GZPA 2XZQL 4AJ0A 5CSZB 1F4XH 1DBBL 2Z4QB 4I77H 4ZQKB 4N0CC 2ZCHL 1UEYA 5GS3A 2FBJH 3F58H 4I48B 2VSDA 4LGRB 1J12A 4V1DB 3ALPA 3MV8D 1KCSL 1H8NA 1NCDH 4GBXC 4EOWL 5HXMA 3AREC 4XP5H 3O3BA 5BZDA 2X4UB 1TMCB 3LPFA 2Y07H 1CL7I 2MSPA 1INDH 4HULB 3EOBA 4OZIB 5BW7C 1YPZA 1GGCL 5I15L 4ISVA 3U4AA 3BDYL 5FB8B 1J8KA 2A6KA 4LEXH 3H3BC 4YHKH 1NLDL 5E9DD 2DWEA 4PGEB 4WVRA 3RNQA 3WHE0 3CFJB 3HI1B 3TV3H 2IH1B 4MHHG 1BREA 3GUTB 4NPYB 5KAQF 3FOLA 2BZDA 5C08A 3MROA 5IBUG 1AO7A 5A3IC 3NAAL 4KVCL 1XCTB 5HHNB 3WIFA 3FN3A 1JWUA 4YE4H 4GRWE 3HMXA 1T0PB 4AG4H 3V8CA 4O51A 2ITDA 2R0KL 4QYOB 2I60L 3MZTA 5KBNC 2DBJA 5SWZA 3O9WA 4JZOB 4FOMA 5DUPL 2XWTB 3QRFM 4ZTPH 2O93L 3ZSTA 4TVPL 1F6FB 1WBXB 3OB0H 2OMNA 1RAMA 5ISZA 1TZIB 3GBNH 5JIHA 2MCPL 4HEPG 1ZV5A 1FL5A 3GIVB 4G80B 1BM3H 4LIQH 4Y5VA 1RUMH 3EHBC 3OKLB 4MJIE 4NYLA 4PR5B 1RULL 3ILPB 4R6UA 1DSFL 4RGNE 3ZLQC 3PP4H 5T1DL 3CFCL 1MRDL 4E41B 4PJ7A 2NLJB 4HS3A 1LE5A 1GC1L 5GJTL 3S5LB 5EU6D 1JZ6A 4XWGH 5FHAH 5CP7A 3TGXA 1U8MA 4Z7UA 5F6IB 4JG1H 3OJDB 4QHLA 4FQQB 5FYLH 4X7EC 3IF1B 4U0QB 3CH1B 1D5IH 3MV7E 1QFUL 4N8VA 5SX4H 2IQ9L 3RZCB 5HVWA 1HXMA 5CCKL 2PYED 2B2XL 3FHAA 3BP7B 4Y8DC 4H8WC 1FYTE 5LXGH 2OR9H 3H6JA 2AJZA 1NDMA 4P4KB 4MNQA 1G7IB 3MODL 4OLXH 4MHHI 4OFPA 2KH2B 1U3HD 5E8OA 5TGBA 5I16B 3N06B 3WDJA 1RZJC 2IPKA 1J88A 3VCLA 3T0DA 3RIAK 3FRPA 3IFLH 3HAEG 5GHWL 1MCJA 3KPPB 1PG7L 3NIDF 1FC1A 3KHQA 4GOSA 5E1AB 2BNQD 2ENSA 1LK3H 2EDJA 1N6QL 1GVIA 3WL9A 4RMUA 4HXBL 4M7JL 3HI5L 1NGXB 3BKJL 2W91A 2F5BH 2NXZC 1NGPH 3B9DA 3EO9H 3R8QA 1FVEB 1JZ4A 2VISB 5J56B 5GS0D 1KCRH 4WRLA 4BFIA 1PD6A 1T6VN 5D93C 4PRDB 1MAJA 3U7YL 2X9YA 3MV8E 3VFPB 3DBXB 5I71B 1FV1B 3WYRA 4OAWA 3SGKC 4YHIB 5JO5A 1RU9H 3NN8B 4JM2D 4ZXBC 5MERB 3CC5B 5E6ID 5L2KB 2XRAH 5J12C 2XZCL 4QRPB 3VXPB 3FQWA 4KMTL 5E24E 4XWOD 5D2LF 4MSWA 4DFHA 1QRKA 4MJ5B 4EI5C 1A6PA 3ZE0F 3ELAT 3WHE1 4WV1A 3V6FA 4NDMA 1OTUD 5TPWH 4QRTA 5IOPB 3UPAA 3EAKA 4JRYB 3D0LB 5FA3B 1J0HA 1KG0B 3VMPA 1G7PB 4DTGL 1BJMA 2BFVL 3RWDA 4GG6E 1P7QD 3B5GA 4K94C 5JTWA 2NY3D 1FQ9C 4OCYL 1XEDA 5B38A 4L9LB 4NCDA 4Y5XC 4NO2A 4P5TC 5J1AA 2DQGL 1AGCB 3OG6B 1ZLWH 5CJXA 1CLYL 4N0UE 2X5PA 1MCRA 1UYWH 4HIXH 5E4IA 4OB5H 1FFOA 2ATKA 2V2XB 3O2DH 1JPST 1IAII 3BRGC 4ODWB 2DQFA 1C5BL 1F97A 1A14H 1IT9L 1WSST 4NSKB 4M43H 4ZAKB 2F54D 1RIHH 2DD8L 1U8NB 2V7HA 3L3KA 4NJ9H 1U3YA 1I1FB 5F89B 3PIQB 4TVPD 2EIDA 1SBBA 3BE1L 2VLJA 3N1MC 4UQ3A 5ENWB 3N85L 5DD0L 1BZ9B 4XBGB 1JTTA 4HHAB 5B4MC 3NA9H 1HKFA 1JVKA 5F1KC 1OY3B 1BQUA 3TN0B 4V1DD 4IOSD 4M5ZL 1XGUB 1JNLH 3B6SA 3N50A 1NEZA 1CK0L 4QF1B 2WP3T 2PYEE 1YEJH 2OK0H 2X4OA 2ZKHL 4OCWH 5C07B 2W60A 2H26B 3K2MC 4PJHA 3B83A 5CAYB 3GI8L 2EC8A 2A6JA 5C0IA 1A4KB 4MA7H 4MJ6A 3BHBA 4RSVA 1I9JL 5FUZH 1XGQB 3SCMB 1JNHA 5DRNA 3SO3B 3I3EA 4OLYH 4YEEA 5DJ0B 1ZT1B 1I3GL 1FL6A 4HF5H 4KRMB 3NTCL 2BNQE 1F90L 4X5WB 4BKLA 3OKMA 1KIRA 4PJXF 2EZ0C 4X8JB 1T3FB 4R26H 1OLLA 1BVKB 3QDJB 5D2NA 4M5YL 5BS0B 1KULA 2ZG2A 1LQSR 3DRQB 1J0JA 1IGCL 3EYOB 4MDJB 3VW3L 1WZMA 2BC4A 5F7UA 1KJ2H 1NAMB 1T1YB 2X9XA 2X4TB 2XZQH 1DDHA 3O6FB 2F8OA 2N1KA 1DBBH 3ULSB 2DQDH 4HGWB 5JOEA 4HIHA 2YPVH 5IVNA 2FJFB 4JB9L 5TDOA 2AK4B 2WIIB 1KCSH 4CU6A 4OUOA 5EUKB 1G0XA 3TH2T 1A6AB 3KNBA 1LDPH 2GJZA 4L4TA 5IB5A 3HN3A 2CKBA 3BDYH 1CXIA 3K7UA 1YMMA 5GRJH 1OW0C 2G5BB 3ZKMD 5DFVD 4GMTL 1IFHL 4FFYH 4OZGF 4KKLC 1JGEA 5D8JH 5GPRA 3HMWH 5KN5B 4QO1A 3VRIA 2ZSWB 3VWJC 5L88L 4UDTA 5F9OL 1T89A 3FQRA 3O0RL 2HKFL 5L7XL 1CZ8L 1ZHNB 3U7AA 1QEWA 5HDQH 4P4KD 3VFSB 4ZUTB 4FQ2L 3T2NH 4ZFGL 3BO8A 2C7UA 3KJ6H 3FQXA 4X6EA 4NWUH 2E8ZA 4MX7B 4AH2B 5CJOH 3Q3GB 3EZ8A 1X5GA 4G9FA 4MMZC 5DLML 1DQJB 1J7VR 4Q7DA 3ZTJG 2APVA 1FNEB 2W9EL 1V3LA 4UTBL 3RWFA 3FO1A 1TVBB 4D8PB 2EO9A 5GSRA 4CU7A 1N6UA 1MJ7H 2F54E 4PBWD 2IC2A 3FAWA 4X4XA 4TVPE 3SBWA 3T3ME 2HKHH 3JV5A 4QHKI 1OWRM 4TSCH 1RIUH 3TIDB 5EU4B 1U95B 3RDTB 5CEYB 1FFQA 3QULA 3ROOA 1L6ZA 1KIQA 1OAYH 1A6TA 2A6DB 4YLQT 3B5HA 5D1XA 4V1DE 3T8XA 1IBGH 4WWKB 4K3DL 3IDXH 3L9RB 3RWHA 4QEGA 4NHUB 4D0DB 2VUOA 4BZ2H 3D5OF 1NC2D 2AABL 3VH8A 4OZIE 5D6DA 3CDFA 3KYKH 1I4FA 4B7LA 5L2KD 3N1GC 5GZOD 3D69A 2NW3B 4LOUD 4QRPD 4OCXH 2ICWB 4C83B 4ZSOA 2NY1C 5EBMA 2XY1A 2AJXL 4P3CL 3T0WA 3ULUF 4K23L 4XNUH 5AUMA 1X5FA 2LE9A 4JRYD 2BDNL 4PRNB 1IJ9A 1HKLH 5DWUL 1K8IB 4M3KB 4KI5D 5I1LB 4GAJL 4JFFB 3LQAH 1PEWA 1OQOA 2CK2A 4N9GA 5GHWH 5TQ0H 3MREB 4ODTL 5I8KH 1X5ZA 5CINH 3QEGL 3BN9C 4LVHC 3BZFB 4OJFL 3TBVA 1FIGH 3HNSH 3WCYA 1V7NH 5MHSD 1D5ZA 3MLYL 4JDZA 4OGAC 5C0JA 3PDGA 1HSBA 4FFWD 5FIEA 3BIKB 2EEDA 4NZUH 5F7KC 1KB5H 4L5FL 5HYIA 2BY3A 4UT7L 4NO3B 4R4ND 4ODSH 3QUMA 1ZTXL 1UB5B 1VFOA 3KWWA 4EVNA 5FK9A 2ZNWA 1HHGB 1HHJA 4FG6C 3FRUA 4XBPA 4DZBB 5F21B 3ARDB 1CF8L 3U9PH 4E41E 3DYPA 1A6ZA 4NO0B 2YD8A 4GO6B 3O2WH 2YWZA 5FCUH 4LCWB 3S3JA 1FAIL 3GMMB 4FQ1L 1UWGH 3DO3A 1VACB 4GQ9L 3SE3A 1FDLL 3K8LA 1VENA 5KSBF 5E2VH 1S7WB 3D3VE 2YPLA 2AJVL 4LDOB 1JPSH 4S1QH 1IGIH 1GGBL 4L3EB 3TBTB 4K8RH 3A0OA 4F7MA 1PZ5A 1N5YH 5C07D 3LB6C 1WTLA 3RHWK 4JFXB 1J1PL 1QBLL 4Y16A 5A43C 4K55A 1WFUA 3AMLA 2ZSVA 2E8YA 1AC0A 4K9EH 3SQOH 1OSZB 1T1ZB 5HVFB 1S3KL 2D7PA 3HTLX 3SCMD 2R1WB 3GNML 3O3EA 4FS0A 4J3UA 5FKAB 2CIKB 2XWBB 3UBXI 1J5OH 4X6CB 3GK8L 3GSXB 1J1XL 3NH7H 1BX2A 4Y5YB 2M8XA 4F57H 4ONGH 5CEXB 3DMMA 4ZOBA 1MCOL 1TITA 1HXYA 1Q94B 2CDFA 3LOWA 5KVFL 3QDJD 2EKSB 4R8WH 2GCYB 3NABH 1QPPA 1EAPB 5E99L 2IMMA 2AK1L 4G6JH 3MFFB 1N0XL 1N4XL 2JIXA 3CSYA 3HZKB 3SE8L 1CT8B 5LAXA 5DD0H 4HZLB 3TPKA 1LNUB 5JQHC 3ARFB 5SWQB 1RZFH 2XQYG 3O6FD 4PJAF 1IGYA 1YEKL 3GSVB 4XPHL 4D9LH 4X4ME 4CMHB 1VERA 5DUBB 2AK4D 3KPSA 2P45B 4LSRH 5MEQA 3KGRA 3MRNA 4U0RC 4BH8A 2FEEI 1CDGA 2Z35B 4YHPB 5L2KE 2EDQA 4Q97A 4QRPE 5FUCE 1P5VA 5KVGH 4GS7B 4J3VA 5C9JA 3F5WB 4W6XB 4IRZL 2Y6SC 3RVVD 2EDRA 2P8MB 4O58H 5IM7B 3BXNB 4JPKH 5J6GB 2YN3A 4PGZA 3TO4A 3BD4A 5IBLC 3GI9H 4JRYE 1MHCA 2NY7H 4HUMB 4KI5E 1FNHA 1INQB 3PWNB 1QLFB 5J4MA 1H8SA 1JE6A 2EDDA 2UZIL 4OT1L 2VE6B 4TSAL 5LWYL 4LVNC 2UZYB 3T2OA 5DMYA 2VKWA 3BI9X 3NTCH 3UX9B 2VN4A 1JRHI 4LLQB 2WMPA 3C6LA 4K3EH 4PJEA 3DX6A 2DKMA 1G9NH 4XNXH 4LKCB 3SGJA 2EDBA 2ICWJ 1YECL 5E1HB 2EEAA 4LKXA 2ICEA 1FZOA 2OLDA 4KRPB 4EIGB 2YD1A 2N7BA 4OD2B 4WO4A 3GSQB 1WWWX 1MIMH 5T5FH 2CDGA 5HHOB 3HRZB 4WHTA 4N5ED 5TH2B 3RJQB 1MCNA 3ZYJA 4YXLL 2CMRL 2A9NL 2DWDB 1U2CA 3C5JB 4R9HA 2Y9RT 3DVFA 2VIRA 1AKJB 3STBA 4FABL 2PXYA 5E5RB 1H15B 5C0CB 3EJZC 5FYJL 5GRVK 2IH3A 4AMKH 2NPLX 1I1AA 2OZ4H 1X7QB 3LN5A 3E6HA 3MRLB 1FZMA 5BZWA