4JE4B

Crystal structure of monobody nsa1/shp2 n-sh2 domain complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
SSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGSGGYAWQEFEVPGSKSTATISGLKPGVDYTITVYAGYYGYPTYYSSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
molecule keywords Tyrosine-protein phosphatase non-receptor type 11
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4je4B00
1LE5A 1AD0B 3QG6A 5GRZA 2G60H 4HC1L 3BWUC 1ZHNB 3MV9B 4W6YB 4LNRB 3F58H 5IKCA 1RUML 4NM4L 4F37F 1QG3A 5ANMA 5LCVL 3PP4L 4ODVH 4U6YB 1MHEB 4QHLB 4L8CA 1CFBA 3QA3B 4P2QE 3VWKD 4TVPH 3TN0C 3BGFC 2H32A 1RK0A 4WFGD 1KCRL 1BIIB 4YAQB 3DV6A 4HHAA 3ARGC 4C55A 3B5HA 4ZUUB 3QO1A 3SKNB 5GGUA 3RKDD 2L4OA 1T6VN 4I5BB 2P42B 2NTFB 2EZ0C 4OZFA 3UBXI 4AMKH 1K8DB 1FO0B 4XNUH 3CSYA 1IEHA 5ICXA 3V79C 5DHYA 5J1TC 2A9NH 1CXEA 3NFPB 5D96C 2E7LA 3KXFB 4PGDA 1NFDE 1AE6L 4LLYA 4W70A 4XWGH 3RX8A 2AK1H 3LS5H 3VGDA 1TZIA 2VZTA 5GZNC 5ADPH 2P5EA 2FJFB 3QDGD 1IRAY 4LCYB 3DETC 4LKCB 2DOCA 3H2WA 3CJJA 1C5BH 1HQRA 1FPTL 1ZHNA 3BO8A 3G5VA 1N5AB 2Y7QB 3PF2A 4QGYA 4U1KA 5E7BA 4KMQA 1OB1A 2A6IB 4GKOA 2X40A 4OB5L 2YD3A 3T2PA 5J56B 4U1KB 3HFML 3MJ9A 2Q1EA 4Y16B 1RUAH 4HCRH 4LARL 2X10A 3KR3H 3QH3A 4QHKI 1LK3L 4L3EE 5FF6B 4AIXA 5IVXA 5J6HA 2CDEB 4Y4FC 2XZCL 1NL0H 1OY3B 4DVRL 4LVOC 2R2CA 4POZD 4X9HA 1AY1H 1GZPA 3UTZB 4NRXB 4UOW0 2GITB 4M3KB 1BOGA 4Y1AB 3D87B 3U82B 4YHNB 5J9PA 4OZFB 3T0EB 3MGTB 6FABL 1CE1L 1U2CA 4PV9A 3BXNA 2WLZA 5TGBB 2O61B 4KROD 3BE1H 1J5OL 3MRCB 5GGRB 3O3BA 4IS6A 1J05B 5F89A 3OBAA 4PRDA 2JJTA 5KSAD 1JFQL 3AREB 3DX8B 1XCTB 3QXDB 3STZA 1EERB 4JN1H 1C16A 2NMSA 1QVOB 2W65A 1RU9H 4PJBA 4TOYH 5C0AB 1KJMB 4WJ5B 2ERJC 4BM7A 3HE7A 2CO7B 2CMRL 1WBXA 4JEGB 4JFDA 3AB0C 3WD5L 2IEPA 4L4VB 4OZFG 2NTSP 3RL2B 4HULB 3RBSA 4N9GA 1O0VA 4O4YL 1FBIL 1MAML 1CK0H 1CR9H 4HWEH 1FLTX 1ROWA 3OMZA 1JHKH 4XXCA 5FB8A 5LQBL 2BOCB 4R7DA 5ILTL 4YUEH 4KK6C 1N3NB 3BPLC 4G6JH 2ADIA 1G7LA 4PJFF 4JANB 3X14A 4LLUB 3UBXG 1KFAL 3O6LL 1U3HC 1NC4A 2MFNA 4KRPC 2X2YA 3O8XD 4YHMH 5D1ZB 5E6ID 3WFEH 2HYMA 4PJ8B 4R2GC 4K7FA 4QXTA 5D93C 4F9LA 3MJ7B 3IDGB 3U0WL 5C86A 1CG9A 4DKFL 1N4XH 2K1MA 4O2CA 4OFVA 2VKWA 2P8PA 4RZCB 1I3RB 3ARBA 3BEWB 3MX0A 5D7IF 4OGYL 2OK0H 2X9YA 1C5CL 2XKUA 3CC5B 3OXRB 4UIKH 1O7VA 3B9KD 3PHQA 2CDGA 2IWGA 1NGZA 1X5KA 4JM2A 2I9TB 5EU6D 1LNUA 4IRSA 5HDQL 3DX6B 5FHAH 4Q0XL 3GFUA 3MBED 2A0LC 4HUUB 1OTSC 2BNUB 4KKAC 1JNHA 1ONQB 4HJJL 4PJEB 1CIUA 2Q86A 1IGMH 3EOAA 4XPGL 4YDLC 3C5ZC 4EBQH 4P5MB 3RNQA 3T4AB 4NUJA 2H41A 5F1NB 1I1AD 1QLFB 3RKPA 3BP7B 5CIPH 5ICZB 1B4JH 5L2KA 1L7TH 4PBVC 3UTOA 4LHUA 2HFGH 4NO2A 1UWGH 1PYWB 3QPQD 1EEQA 5D1ZA 1GRWA 3JWOL 4F58H 1EIBA 3NCCB 4D8PA 2JIXA 4N5EC 1JNLL 4JANA 1G7QA 3DX9B 4FQLL 1U8HA 3MPCA 5EA0L 3WIHL 5JHDA 4OIIH 3V95A 4V2BA 1F3DJ 3MCKA 3DX9A 2ADGA 5I18L 2FYYA 1N6VA 4JM2F 4OF6A 1QFPA 2CLRB 3D3VD 5ECJE 4QHMA 2UY6A 4OV5A 1FL6A 2ED9A 4YO0B 2FECL 2HT3C 4BSWA 4PJXB 3MMEA 2AEQH 5DYOA 1LEGA 2EIEA 1JWMB 1E0OB 4Z5RA 4JG1H 3V4UH 2H6PA 1FDLH 4NHCL 5F96L 3S8WA 4JCMA 4OM0H 4U1SA 2LABA 3BISA 4L5FL 4WVRA 4P2RB 3ZKXB 2X4SB 4PJ9B 1AXSA 4WUUE 4PS4H 4Q2ZA 4ZDHA 3TPKA 5CZXC 3W82A 4RAUA 1B6UA 3ZLQC 4LMQE 12E8H 4NJAH 2R2BA 3UAJD 4NKIL 1Q9WB 4HEPG 2YC1B 5F7MC 2AJZB 1NMCC 3I85A 3TLRA 1OQXA 2YA0A 3VWJA 1H8SA 3F7QA 1YJDC 3LVEA 3DX7A 1WWCA 3EFDL 3WN5C 2GT9B 5JNYB 2HFTA 4JRYD 3KJ6H 4Y5YA 3AGVA 1C1EH 4IDJL 1ZVHA 3TJEH 5LAXB 5GSVB 4QRRE 1EZVX 1P5UA 3HI5L 2WWKO 3QH3B 3U1SH 4Z7WF 4ISVB 1SVZA 1MCQA 4R4NC 5E4EC 3FO2A 4R4FL 2V9QA 2VE6A 1CD1A 2ZJSL 4WW2C 1JNNH 1NEZG 3KYOA 4OZHB 3VFGH 2G2RA 2P8LA 2PR4H 5HGGS 5I1DB 3BDYL 5ICYA 2AI0H 3U0TB 2CDFB 3TO2A 4RGOH 2YS4A 3WLWC 5DC0A 3IKCA 2DLFL 3U0TA 5ELIA 2ZOLA 5CJQL 2AW2A 5L9DH 4W4OA 3WS3A 1U0QA 5T5NG 1Y18A 4MA1C 3C9NA 1UEYA 1A3LL 5EZJA 3UTSA 4RDQF 5DD1L 1A6VH 2RCSH 1D5ZB 5DI8B 3SKMB 3TO4A 3W0WD 3B6SB 1LD9A 4P9HC 4C83A 5SWZA 5B4MD 3TBVB 8FABA 1PY4A 2HJFB 3S5LB 1CBVH 4YAQA 2NNAB 4CKVX 3NAAH 1YN6A 3UMTA 3UYPA 3DSFH 3E8UL 1X5ZA 1INQA 1TNNA 2VXUL 4MJID 2VLRB 5EU3A 1FZJB 1KEMH 5GSRB 1L6XA 2F58L 3L5IA 1IC1A 4NCC2 1T3FA 3FO0H 1M7DB 1HH9A 1QLRA 2AK4E 2P8MB 3X12B 2M26A 4HWBL 3QIWA 3L3KB 1HH6A 1IEBB 4RFOL 3SJVD 3BX7C 2IPUK 1TJIL 2NXYD 3O8XC 5E6IC 3TA3B 5FGBA 2FJFA 4LKCA 4ZSOE 3L5JA 5HDLA 4R96B 2A9ML 3MACL 5IFAH 4BQ9A 1N2RB 2D7OA 3ARRA 3ROOB 1NMAL 1OLLA 5D5MA 4H1LB 3BGMB 1JHLL 5C3TA 2X42A 3LOWA 3C8HA 2LAAA 1MCDA 3S36L 1XIWD 3UP1A 1OWWA 5IVNA 2DQHL 2J5LB 2IPUG 2DBJA 5H94A 5E8NB 4Z7WA 3EYFB 4LAJH 1CBVL 1MCCA 4UU9B 4YXKL 3SO5A 2NY4C 5IG7A 3O2VH 4YWGH 5DLML 3S3PA 1A1NB 3GHEH 5CILL 1PYWA 3WO3B 3PWLB 1JIBA 3ZKXC 5F9JB 3G9AB 4FQ1L 5E8EA 1NEUA 1MJJB 4CU6A 1H5BC 4XCYA 5GS0H 5KVDL 5KTEH 1T1WA 3CDGB 4FXKB 3S36X 5J7CC 3IRZA 1LWRA 1BJMA 1JF6A 1MCKA 3DO7A 2AV7B 1INDH 3U48A 2XQYG 2FDBP 4HJGB 2DLFH 4ONGH 3DURB 5BV7B 5KSAC 2PYFB 2X4UB 1C5DB 4YGAB 5C0FA 1VADA 3O8XA 5E6IA 1EHLH 2E9BA 1NCNA 3TYGL 1WBZA 4NZTH 3BDYH 5I74B 3ZE0E 3RDTD 2PR4L 1NGZB 2F9BT 2J3SA 4JZJC 3WSQH 5ACZB 1YEKH 1SJVA 5J13B 5FM4A 2XACC 4UBDD 4TSBL 4O51A 4YHYC 5JPMB 2HH0L 1UVQA 5HPOA 2VL4A 1AJ7H 3ARZA 3LQZA 1ZKAA 4MB5A 2JJVA 5IGXL 2MTPA 4D9RE 4S1QH 3LEVL 4KJYA 3BRGC 4NN7B 4U1HB 3KNBA 3O3UN 5JXAL 4R90L 2FBOJ 3VE0A 3BSZL 4LASL 4QTIH 1KYOK 4PJAF 3D2UB 3QRFM 5BZWB 2NLJB 1KXVC 1NDMB 1J8HA 3VXME 4JKKA 4EN3C 5ERWB 2DIJA 3OF6D 5IB4B 4NJAL 5EBLB 1IZJA 5BV7C 3DECA 2Z31D 4PPTA 4P49A 1VDGA 3QJHA 2JKXA 4JDVA 3MMEB 1HSAB 4P4RB 3VFMA 1QVOA 1JWSB 2VZUA 5IMMA 1CICC 1LO3H 4OM0L 1FDLL 4NHCH 2IPKB 3EYQC 1KC5H 4K7PH 4V2CB 4WW2F 1Q9KA 1X5FA 2H8PA 2Y07H 4OCWL 2Q7YA 1KCUH 4G8EB 1QTYT 1NLBH 3RVXC 5HYJB 3BD3A 1JV5B 4DGIL 1LP9F 3F7YA 3MNVB 1RJCA 1Z5LA 3SQBA 3RUGF 4M9OA 4H0IA 4PLNC 1JI1A 4CJ1A 2DI8A 1ZEAL 4YHIA 1CL7L 3ULUE 5C2BH 4OUUB 3VFGL 1OGAB 4ZFOL 2D03L 1G0XA 2FNBA 1J1PL 2WBKA 2Q87A 1ZXQA 1VFMA 2GJZA 2XV6B 1FG9C 4G3YL 4JRXE 5SX5K 5IB1B 4OM1H 4X9BA 3ZZ1A 3WKMH 3ESUF 3TP4A 1FFPB 4M8QB 4Z95H 1EMTH 1IQWH 4PGBA 4IJ3B 1WBZB 1JP5A 4G43A 4LLWB 4WEBL 2BFVH 5L7XH 4ORGA 3V5HB 2VXQL 3G5YA 5CEXA 2OCFD 3KPSE 1JZ4A 3MOAH 1OAKH 5I16B 4XNYH 1J0KA 4HS6A 1YY9C 5HVFB 3RA7H 3HA0A 1T1XB 4OZGE 3OAYK 3CCHB 2D31B 4AH2B 2R0KH 1IAIM 1ZHKA 2ZCKL 4U3XA 4HFWA 4XPTL 4MJIB 5IB2A 2J1KA 4KC3B 1LK2B 3O41B 4KVNL 2DM7A 4OSUH 4QRUB 1FAIL 2IGFH 5FKAB 3QNZB 3VRJB 2R56H 3Q3GB 2APXA 4LRIC 2XY1A 3V4UL 5C71A 5KTEL 1BIIA 4E41A 3QUYC 1VGEL 2RGSA 3HE6D 1ORSB 4JRXA 4PJIA 4J2XA 1WAAE 2EDEA 3EOYG 2OXHA 2VN4A 3GHEL 4IBLT 1FBIH 5DRZB 4D3CH 1T0NB 5DD3L 3DHMA 3CFKA 4CN1A 2AVGA 4PY7B 1I3GH 5ICXB 2HT4D 4HX1A 3H9SB 1T2QH 2FX7H 4X99B 1ZT7A 4XX1G 1S7XB 4ZTPH 1RJLB 5JORB 1M7XA 3DV4A 3L3IA 4K23L 4LBEA 4FP8H 4JN1L 4QLRA 2A6DB 5EZOL 4ELME 1JFQH 3UPAA 1Q0XH 4XBEL 1B4JL 1N6UA 3P77A 3VD4A 2OP4H 5IB2B 3WE6A 3MFGB 1MEXH 2FR4B 1KN4L 4JRWA 2JIXD 3KLDA 5T1LA 4HJJH 3NN8B 3IFOA 4HAGA 15C8L 2PETA 3DTXB 4KI5D 4YGVA 5K9JH 4PJBB 1Q8MA 5FDWA 4RFOH 3V9FA 3VWJB 4F57L 5LGJA 4F3FB 1VCAA 1D6EB 2RBLA 4P23D 1QR1B 4YE4L 3LKSA 3MRLB 1C8PA 2P43B 3HNTL 1SY6H 4P9HH 4OQTL 2R8SL 5DMKA 4XMPH 1HSBA 1H3XA 5E9DE 4OIAA 5FFLA 1OAZH 5HTSA 4PJFB 4PD4J 4G9FB 3T0BA 1AH1A 3R0MA 5HYIA 2IAMD 1M7IA 4WHTB 1YMHB 3QDMD 5GIRB 2ADFH 3GNMH 2E6QA 2H26A 4MJ5B 1ZSDA 2ARJQ 4DQOH 3RVWC 2DYPD 3SKJL 5ILTH 2J8UE 4XWOD 3ZL4H 4YHPA 4A6YL 5DJ2B 1P2CA 3C87A 4JM4L 4O4YH 2NY0D 3BMVA 3BPNC 1JMXA 3FQXA 4FQJL 4Z7UB 1HCVA 2AK1L 1QBAA 3FO9B 2HVKA 4DTGH 4RMTA 2EH7H 2EO1A 5C0DB 2H9GB 4X6DE 2X4RB 1A2YA 2BNRE 1BBDH 4OI7A 3UBXA 1BQHB 1QSZA 2XN9D 3D2UD 4U1MA 5DJCA 5D6CB 3LKQA 1MOEA 4B53A 1ACYH 1DBML 1HXMB 3THML 4U7MA 3J7HA 3BAEH 4PP1D 3MXWH 3T4AA 4UTBH 4KV5F 3MO1A 1HXMA 2NY5C 3SQOH 3QXUA 1GC1C 4PG2A 4UT7H 4XBPA 2C3WA 3QUMH 4MX7B 3DRQB 2NXZC 2ZKHL 4UUJA 6FABH 3FQUB 4MA3B 5JW5A 3U1SL 3FT4A 3HI5H 1FE8L 4JQVC 3WXWH 4XH2B 3KPTA 3QUZA 1QFWM 4XPBH 3JZ7A 5I1EL 5I8KH 1S9VB 2EXWD 3F5WB 1S5HA 32C2A 1IM9B 4JHWL 4Q6IB 3S9DB 5D1QC 3GIVA 2NY6C 3BH8B 3W0WE 4F7CA 2C7UB 4R4ND 4PJDF 1KEGL 5C09B 4AEHH 4RCAA 5JQ6L 2FEDD 1XR9A 1QFUH 1HWGB 4PRPA 5EC2B 5DUBA 3UEZA 3U7YL 1I1YA 1B0RA 1XH3B 1JZ2A 1N5YL 1A6AB 2DLHA 5E6ZA 2M2DA 4WCYH 1LE5B 3C6LA 3VFWA 2G5RA 4B7LA 3OQ3B 3KXFD 4PJ8D 3T2NL 4NQCE 2VYRE 3DUSB 5F6HJ 5JIIA 3GMMA 1IC7L 4GRLD 2N4IA 5GGVL 3REVB 3ROLB 2ESVA 5JLZA 1W72L 3PG2A 2KL6A 2V6HA 4G8FA 3TV3H 3JSSA 4Z78B 3RZCD 3SDXE 32C2B 5EA0H 1JHTA 2W9EL 4V1DB 1PG7W 3C6SB 3RGVA 1Q0YH 5T3ZE 3AREC 4JFXB 4HMCA 1BLNA 1QFHA 4J3SA 4L4JA 4LCWE 5KS9E 2EE9A 3VWKB 2ZSWA 3D69A 1WZKA 1KTRL 1N0LA 5E00A 3BZFB 4U1GB 3VG0H 3EYUL 3WNKA 3CXDH 1VKXA 4M7KL 3IDIA 5TF1H 1LNUB 3BMWA 4FFVC 4IHOA 3HPLB 3Q6GL 4K3EH 1I9JL 4JLRA 3B4NA 2EDKA 3QIUA 4L4TD 4C4KT 5IMMB 2I27N 4X4XB 4JM4H 3DMMC 4TYUA 1ZS8B 3WNMA 4A6YH 5ITBH 2QQQA 3Q2CA 3ZL4L 4JVUA 4OT1L 1D5MA 5MP6H 3T0ED 1KB5H 1JTOA 4ZOBA 4DZBB 4BK4A 1IQDB 2ADFL 3GNML 3SE8L 1FH5L 2XWJB 3MLVL 3MLSL 3BKYH 3LZFL 1I1AC 2X4PA 4WV1B 4UIMB 4PJGF 2F19L 5BRZB 1BJ8A 5AWNH 1EJOL 3RUGB 1LDPL 2IAND 3MLXH 4HUNB 3RAJH 3L5XH 4FQIL 3WJJC 4KWUA 4ODWA 4RBPK 4UQ2B 1RUKH 4P48A 1LP9B 3RWJA 1K8IB 3QIUB 4M1DL 5I1LA 1OD9A 1KELL 5CD3B 4HWEL 4OGXH 1CK0L 1CR9L 4WW1A 1VKXB 2GCYB 1CU4H 2Q76B 2XFXB 3ZKND 1AHWA 4PJFE 2NQCA 3QIBD 4PV9B 3M8OL 3TVMC 2BXZA 3VCLA 5JIPA 3BGAA 4XBEH 3HRZB 4EDWH 5J9PB 1Q9KB 3VRIA 4PJAA 4QKXB 2A6JB 1YECH 1G9NC 2AJYL 2VLKB 3DUHA 3SE9H 1T03H 3Q5OA 4JY4B 2JK5B 1KYOJ 3MLUH 2F53D 3O4LE 1T6WA 4OUUA 5DQJA 1RZKL 5IOPB 1UYWH 3BQUC 2DYPB 1VACA 4XVUD 1GPOL 2CLRA 5F3BB 2D7MA 4IMKA 4DW2L 5HY9A 2PCPB 5E2VH 1DBBH 4Y16A 5INDA 2XYCA 4G43B 2RR3A 1I4FA 4RBPH 5JIHA 4DVRH 2AJSL 4MD4A 5EOCL 3CFKB 4WWID 1JJUA 3MRPA 2ZCKH 2E7CA 2KQNA 3P0GB 1LGVA 3KXFE 4AK1A 1I7ZA 1DL7H 3EZ8A 2VXVL 4KXZH 2ADJA 1I7RB 3KPMB 1UCTA 3C5ZB 2WIIA 1SYSB 3D39E 4IRJB 2FSEB 1MY5A 1MI5D 2GY5A 4YPGA 3S4SB 1Q94B 4EVNA 3Q48A 1MCPL 1KG0A 1DUYB 4G8IB 5EZJB 3UTSB 3NPSB 3E6HB 1W72B 4NQUA 3JTSB 4GKSA 3RBGA 4DN3H 2DQEH 1CCZA 4ZUTB 3TZVC 1A7NL 3VW3H 3NIGE 1YPZF 3PQYE 3WKML 4HWZA 5DJ0A 2O5XL 4NQVB 2VJXA 1ZHBB 3MBEB 1T22B 1RK0B 2ENSA 1BIHA 4DKEH 3I6GA 3VGAB 4CU8A 3ULVC 1OARH 1U3HB 3PGFH 4YBHA 3U9PH 2PTTB 4WU7A 4N8CL 3LQMA 5GQBA 5DJZA 5LJYH 2H1PL 5I9QB 1KB9K 3ZHKA 1N3NA 2Y5EA 1T21A 3QDGB 5E5MA 5HGHA 1KJ2B 3MYJB 3OL2A 4EXPX 3N1QC 1Q38A 1KTLB 3HE7D 2Y07L 3WFCL 5CJXC 3UXFA 2BSSB 4YFLF 1S7SB 5FO8B 4YX2L 2HMIC 3A6CL 2Y72A 1R3IH 4DOHB 3TZVD 3QCUL 1XCQA 3CU7A 1P9MA 3HN3A 3W2DL 3ARWA 5DEGA 3EFFB 1GGIL 4YH6A 1J12A 4Z7NE 3IFPB 1B2WL 5IF0A 2D2OA 1F13A 4PJHB 4HWNA 1NAMB 1QSVA 3P73A 5HHME 1YEJL 2R1WB 4M62H 4K3HA 5AZEL 3QEGL 5H94B 1JPFA 5DT1H 3M17A 1N0XL 4Z77A 4HIXL 3BYTA 3UYRH 5TE6L 5F71A 2OR9L 2WWMC 4GRMA 1OLZA 2VLRA 2RFXA 5E8OB 4JO3H 3DRQA 5BZDB 1QRNB 3LEVH 1H15B 1A7QH 1UWEL 1AO7E 4YHYB 3ZE0F 4BFEA 1LO2L 2E9WA 2P7TB 2W9DL 5KVGH 3MA9H 3IF1A 5TDOA 3PQYA 5E08H 2N7AA 5TPWH 4OD1L 2LU3A 4A6YB 1OSPH 2OSLA 2WUCL 1F6FB 3FB6A 4PJ9D 5MI0C 4FFWD 4LOUC 3FQXB 1DQLL 3ZE2F 3AUVA 5SWQB 4WI6A 5FYLH 5EBWA 4BSVB 3CZJA 1MHCA 2DDQL 2P46B 3WJJA 1KPRA 4U1SB 4S1RH 3D39A 4TNVK 1TTFA 3GM0A 1U8MB 3QIWD 3QUZD 2QEJA 5KSVA 3JUZA 4X6CF 1Z9OA 1Z6JT 5ID1B 4Y4HD 5LGHH 2C4FU 4C54A 1TETH 4XNMB 1A1MA 1F4YH 4XMLL 1OGTB 1FNEA 5EC1A 1F3RB 2EDJA 5DWUL 3KPRB 4LRNL 3FQUA 4MA3A 3ARGD 3KVQA 1CDBA 3BXNB 5TGBA 3PIQA 3MZGB 5D5ME 2R2EB 3E6FB 4NC0B 4EDXB 3CK0H 4D8PB 4KGJA 4RX4A 3ARBB 3V8CA 3TIEB 3BP5B 4P57A 4Y5YB 1N7ML 2VLKD 5GGTL 3MV8A 3QRGL 1MLBA 4NNYA 4F8QA 4UQ2A 1X44A 4OF0A 5DR5L 1MHPH 4JVWA 1NAKL 1G1CA 2VLKE 5D6DA 4OCYH 5EZLB 4YFLI 3VXTA 3OJDB 5HYJD 5FYKH 1BFOA 1J0YA 4TSCH 4NZJA 4DUWA 1OD7A 2EDRA 2Z8WC 1S7XA 4NQDA 5DO2D 5TE7H 4RMRA 3QZWG 1QFWH 5F9OL 1U58A 3K2MC 3MNZB 1R3LB 4PJXF 5I1JH 3H3PH 3LN4A 1UKTA 4U7KA 2B2XL 3DPBA 2X44D 4LSVH 4R3SB 5KSVB 3PDDA 4X7EC 1FZMB 3EDFA 1YEEL 1N2RA 1SEQH 1FCGA 2D0HA 4N0UB 4HIIB 2Q3AA 5F21B 3QDJA 3UTPE 2AP2A 4QXTB 5ITFB 1SHMA 3IT8D 1MFDH 1HKLH 3OGCA 2R69L 2R29L 2F5BH 1AGEB 3MC0A 2O93L 4TULH 1CQKA 3TN0D 2MMXA 4Y4FA 4ZS6D 1AO7A 1UB5B 1HK6A 1DEEB 3HPJB 2C3GA 4XCNB 2CDGB 5DMKB 3D69B 2UYLA 1XF2A 3NFSL 4H25A 2VERN 2PO6D 4X9FA 5I76B 3QO1B 1A7QL 3TZVA 1CS6A 4YFDB 3L6FA 5SV4A 2OJZL 2R0ZL 4MAYA 4WFGE 2VXTH 5I1LB 3SGJC 4NHUB 5IESL 1GZPB 4ZUSA 3IXAA 1J1OH 4HS8H 3BP6B 1D5IL 4R2GD 3V7MA 4TPRL 1IGJA 2ARJB 2Z91B 3PWLA 2DQGH 4Y5VC 1ZOXA 1P7QB 3KGRA 1DEDA 1H3PH 4NZRL 5AZEH 2EYTA 3FN0H 1CICD 3N06B 5DHXB 4TNWK 4KQ3H 4KQ3L 1JNNL 1FHGA 1UT9A 2OL3L 3FJTA 4RIRB 5JPNB 3BD4A 3BPLB 2GQHA 1E28B 5EIQA 4RQQA 1M1SA 1EO8L 1BOYA 3P2TA 1CLCA 4IOFC 2C4XA 1SJEB 4XCCH 3DIFA 4BH8B 1ZK9A 4MDJB 5HYQA 3TJEL 2OJZH 2R0ZH 4BZ1H 2ZUWA 4MHHG 4MB4A 5CP3A 1T7ZA 4J12A 5JDJA 4YPJA 1KJ2H 4TTGA 3QZWA 5E24E 1RZKC 1U8QB 4DKAA 4H1LG 3EBAA 3TPUB 1G7IA 2J4WH 4JHBA 4TQEH 3QDME 3GMPA 4HH9B 5HHVL 4MMZC 1OARL 3OKLB 1EXUB 2RB8A 5D2NE 4K3DL 3DO7B 2MWCA 1SEQL 2DWDB 1RUPL 3SBWA 3MODH 2ZUQC 3MCG1 4O2CB 1PLGH 4Y4KA 5C09E 5DQDH 4HS3B 1TZIB 1MRDL 1T66D 4HKJA 3VFMB 2R2HA 4N0RA 2Z35A 4AZ8A 1LD9B 2NW3A 3DYPA 2ZCLL 1BD2D 3DVFA 3HAEB 3GB7A 4PGCB 4PJ9C 1NFDF 3QYCA 3HMXA 2HWZL 5I6XC 4WHYH 2CH8A 4Y16C 3P3YA 4OIIL 5DTFB 4KJYB 4QRPD 4KKCD 5HVGB 3BVNB 3QRGH 3JUYA 1IBGH 4UDUB 3QT2A 1SM3H 3MJ9L 2X1OA 2OMNA 4JPKH 3CZFA 3K3QA 4UDUA 2LU7A 5C08D 1IKNA 1ZGLB 2KH2B 4H1LH 1AGDA 2ZG3A 3QEHA 1BQSA 1MWAA 1NC4B 3QAZC 4IOIA 3NIGF 4Q7DA 4IOSD 3P4OB 4OCSH 3QDHA 3MJGX 3GMOA 2CRZA 1HH9B 1QLRB 5E6YA 4Z7VB 1YN7B 2WWMD 2DKMA 5GZND 2M1KA 1E28A 4XAKE 1P5VA 2BNRA 4GXUN 4C56E 1HQRB 4JFEA 2X4UA 3V7AG 5DDHA 1C5CH 1KCVH 2F74A 4O5LH 5T3XE 4UNTA 2VAAB 5EO0B 2IFGA 3JWDL 2YUXA 1AD9A 3QUYA 3SE9L 3QULA 3Q1SL 2L0DA 4M03A 3UZEA 1HNGA 2O5ZH 3EDDA 4XP6L 1YECL 3QUYB 4PJEA 5SWSE 3LH2H 5GZOD 3BGFB 5HI4D 4K8RH 1VHPA 1DQLH 2NYYD 4M5ZL 5EUKA 3RPIB 3OKKB 5GJTH 5TQ0H 4UT6L 4LNRA 2A77H 3O0RL 3DVNB 1V5JA 3H0TB 4NGHH 2CUMA 5CCKH 2UZYB 3HMWL 5IG7B 1NGPH 3M1BB 4NBXB 1TQCC 1QA9B 5LQBH 4MQ7A 4R26L 5DD5H 3PHOA 3Q6FA 1A3QA 3CPLA 4FNLH 3FQRB 2BJMH 4M8QA 2DB8A 2UUDK 4MGXA 1RZIA 5HHNA 5DURB 1CI5A 5F7KC 1GOGA 3MV7E 4JG0L 1Y6NR 5FGCB 4IIQB 4M4RA 4XCFH 4S1SL 2W91A 4M7LT 4X6CA 5ACZA 3CXHJ 1F6LL 3HPLA 1F6AB 4Y4KC 3MXVH 4MNGE 4HAFA 2AJVL 1I3VA 2YKLL 1KCVL 5IR1A 2OI9B 5I2IA 1FIEA 4M43L 4K94C 3P40A 2WBJB 5HYJA 1A6ZA 2WQRA 1IGFH 3KG5A 4QF1A 4X8XA 5F7WC 1GGIH 3VGFA 3QNXB 2EE6A 4FFVD 2EC9T 1FNGB 4X8JA 1NBVH 2CSPA 1TFHA 4OT1H 5D2LB 4N5ED 2PO6B 4P99A 4NKOA 2E7BA 5ICZA 3CCHA 3SY0A 5C0AE 3OKDB 1S7TB 1MCJA 5LWYL 1MJ7H 1B3JA 1T1WB 4Z7QF 5KS9A 4R0LC 5CMAA 4ZAKB 3VXSE 5C09D 5E2TL 5CLWA 5KOVC 4LU5L 3JVGC 3FB5B 4D0BB 2JF1A 4N8CH 4G5ZL 4JFOB 1K4CB 3VFTB 2VWEC 1IC4H 5BVJA 1EEZB 2I5YL 1S7WA 5IM7B 1V3LA 5CJ8A 4LQ1A 5EC2A 1L0YA 4QWWC 3MV01 2BRRH 3O2DA 5BO1H 2EXYD 4U6TA 1ZT1A 3VI4F 3QUXC 5D5MF 1U91B 3ZKMC 3VXUA 3FFCD 4O2EB 3RWFB 1IGCL 3D39B 2H3NB 1EAPA 3S37X 3U4BH 2PO6A 1OGAD 1MRDH 3ILPB 4FXLA 2FEDC 1AE6H 2J5LC 5JDSB 2YD7A 4UQ3B 1HH6B 3QWQB 3IRPX 4XNXH 4HK3J 1ITCA 4KK6D 5L0QC 1H3UA 3BIKB 3I6KB 2VXVH 4Z7UA 1D6VL 3V0WH 1NCWL 5EIIB 2W07A 4GG6B 1F02I 3VG9B 3HAEG 1NBQA 3TNNB 5F93C 4J8RA 4MLSA 4PJXE 4TN9A 1FNHA 5B8CB 3O4LD 5EOCH 5ETUB 1IKFL 4G42B 3RGHA 1BJ1H 1QSEB 3TBVA 1JYNA 1HHKA 4E0RA 5LWYH 5FYJD 2K9UA 3ARYA 2YD5A 1E4XI 1XF5B 4LCUB 1OT1A 1HIMH 5DD6A 4NFBA 4EQ3A 5E4IA 1RUMH 2ZUXA 4OLXH 1NCUA 1IEAB 4UT7L 3TN0B 1T7YA 3TH4T 5A3IC 3KPMA 2YPLE 4YHPB 3NIDF 4MNQB 4LDEB 1ZHKB 2I24N 4Z7UF 4X6DA 2CQVA 2Q6WA 1DUZA 1I7UB 4QRPA 4LK4A 3PDGA 1H3PL 1PJ9A 4X6DB 1A6PA 4POZC 3GBNL 2QQNH 4RNRA 3BQUB 4D9LL 1X5AA 4HS8L 1J1OL 1DR9A 1ES0B 4MA1B 1A7BA 2VC2H 1T89A 3I6KA 3MOBH 3FRUB 5DSCA 1RIHH 4Z18A 3H3KA 4TNVF 2PW2A 1MIEH 3B9EA 2O5YH 4N9GB 2FL5B 5E5RB 1CIDA 1J8HE 3GSOA 3C5JA 3QQ9C 2SEBB 5GS2H 4MQXD 1DLFH 4LAQL 1Z0MA 4W6WB 3MRMB 2VLMD 2DLIA 3RAJL 4OCRL 4KAQH 4WHDA 3LS4H 5DQ9A 2PTVA 2HFFA 3CZFB 3BN3B 1G6RA 4QHKJ 5EUOE 1NANH 4XMPL 3G6DH 4ONFL 3I50H 3TCLB 3CPLB 5MENA 3ZHLA 3LZFH 4NO0D 3MRCA 5GGRA 2YA2A 3FT2A 4I3GA 1N64L 3RI5K 3BFOA 5AUMB 4N9OB 3VMOA 1R0AH 3RU8H 4XP4H 2DQIH 4NQEA 1P2CB 2PNDA 3EFFA 5F9OH 3FAXA 4ZD3H 5DGRA 4Y2DC 43CAB 5BRZE 15C8H 2Z35B 5JA8B 5ABDE 4WO4A 2Y5TA 5KG9B 4OCSL 3TT3H 1ZTXH 3WUZA 3B9VA 1EFXD 2EEAA 3VFUA 1NMBL 3Q6GH 1S9YB 2X89D 4LSTL 5FYKE 1FN4A 3AMLA 1AP2A 5EZOH 2OL3A 1OPGL 3QNYA 4NUGH 4FP8L 3TO4C 2XTJB 4CNIA 3QXAA 2QKIA 3A67L 5ENWB 1VPOL 2AJUL 2FL5A 5C07A 4YHLH 3UJJH 2A1WH 5I1KL 1G7LB 1S5IL 3GI9L 4F37K 2VDNH 3H0TA 3I6LE 4KQ4H 4NC1C 3VD5A 4GSDH 2YPKB 2NX5E 5J0BA 4QRRA 5EBMB 1VFBA 4L3CB 4JPIA 4PJHE 5GGVH 4G9FD 1TETL 2ZCLH 1UH2A 1Q72H 3PABA 4XPFL 5DD0H 3NN8A 5AZ2L 4P3DA 4S2SA 1YNKH 5FA4B 4NCDA 3MR9B 1PX3A 1IAMA 2IGFL 2QSQA 1S7WB 2QQLH 4R7NA 5IM7A 1G6RL 3VXPB 4Z7OF 5E0QA 4GKSB 5I8EA 1K3IA 3HR5B 2BNUA 4XRCA 1OP9A 1ITBB 5C0EB 3D18A 4K3DH 1INEL 4N8VG 2ZCHL 2R0KL 1HXYB 2ITDB 3N9GL 4G6FD 4N0CD 4Q2ZB 5TQ2H 2FHFA 5DRXB 4XBPB 4YXLH 4P3WA 3V6FB 2OTWB 3WMSA 5EU4A 2ZOLB 5DMJB 3GRWH 3HZVB 3WN5B 3ROLA 1FGNL 1IC5H 4KK5D 4H88H 1F42A 5TFSL 3UAJC 4LSSH 4KDTA 5MEPA 2VDOH 5KVFL 4RMWA 2R4SH 2WLYA 4OBSA 2IPTH 3EIFA 4JO3L 4RAVB 3G5XB 3QIUD 4EKXA 4GUPB 1XR8A 4HUXA 4DVBA 2NLJA 5TE6H 2ZKHH 5SWZE 2CGRL 3IFNH 4HIXH 2VQTA 3V8OA 3O45B 1LEIA 5IMOB 2X9WA 4OZGB 1MCNA 2V5MA 4OZIE 1UZ8A 3QEGH 4UTBL 3GMNB 1MCRA 4PRPB 3KPPB 1JUFB 4PTUA 1XGTA 3SDCB 5DK2B 1X6LA 3IETB 5C2BL 2ICWJ 2DL9A 1OHQA 5FEBA 1A6WH 2H2SC 4JKPH 3LPFA 5E2UH 2C1PB 1CFQA 1ORQB 2EIZA 4WI4A 3LKNB 5DEFA 3NCJL 5HYJE 3P30H 4XCEA 2GJ6D 1KBGL 3VG9C 5A16B 3B2VL 5DJXA 3I3DA 5EU4B 5ACMA 3D3VE 3C6LC 3CVHA 3HB3D 5AD0B 3MRQB 3L3KA 3EYSL 3WNLA 1J0JA 3IDNB 5DFWH 1TXKA 4L29B 5JTWA 5DJAA 1ZAGA 2P5ED 4HFUH 5TH2A 5E8PA 2Q3ZA 4F7PA 5D1XB 3BESR 5IFHH 5CUSH 3BIAX 3W0WB 3ZDYF 4U6VH 3B8SA 1FNSH 4MNQD 5CSBA 2F5BL 5JW3H 1RHHA 3AM8A 4ODSL 2Y06H 4MAUH 3RIAK 4BZ2H 3HZYB 1ZA3B 4DKEL 3X13A 2WUBH 1OAYL 5CEYB 4ZFZB 4BH7A 5SX5H 3HNTH 3QWRD 4WFHE 3ZE1E 3E0GA 2EDOA 1CD1B 4EUPG 3HE6A 4JRXD 5JXAH 1T20A 3PXJA 4WI2A 3TBSA 1WZ1H 4HH9A 1ZHLA 3ARFB 3KDMB 3HE6B 2HN7A 3T2OA 4NFCA 2YSSA 4FQXA 3OR7A 3FFCE 4KDWA 3O6KH 1ND0B 2F8VA 3BPCA 3P9MB 4UNVA 3O6MH 1ZE3C 1UEMA 4JR9H 2EDHA 5CZVH 5L88H 4R0LA 5FYKL 1HEZB 3L3GB 4LLAA 4TSBH 1C08B 4N1CA 4L3AA 3MROA 5HGBB 3RTQD 2DQTL 3LSOB 4QRSA 5DMGD 1VB9A 1DBJH 1M4KA 4PRHD 1F4HA 3TYGH 4IRZL 4LNVA 2Z4QB 4ZTPL 2D7TL 2VLJD 1Z9LA 1CFTB 4FFYL 4HBCL 2NY0B 2YK1L 2APBA 1J0HA 2DI7A 1OT2A 2XA8H 2C5DC 3PNWB 4Z7NF 3P73B 4LP4A 4N1EA 1CLZH 1DJSA 1FJ1B 1FRGH 1T2JA 4NQDD 5CD3A 3DV6B 3IXTA 1URLA 1VGEH 2EIZB 4ENEC 2XKNA 3TNMB 3IXAB 2ZNWA 4FMKA 4LMQI 3CFIC 3TVMB 4JKWA 2Z92A 1UA6H 3HRPA 5B3JE 3TO4D 4U1NA 3LMJH 1BM3H 3NA4A 4XGZA 5IQ7L 2YEZB 3JV4B 3QUXB 3CVIL 2BY3A 2XTJD 4RAUB 5IKCB 1JK8B 4IRZH 4YIQB 2IBGA 4JREC 5JDSA 4GRWB 4XP9H 2HFEB 3C5SB 5CIPB 5DJ2A 1YNLH 2X4PB 1CGUA 1FFNB 3KWWA 5T3XH 5F7YC 4M6NH 5C09A 4EJ1C 1EDQA 3FMGH 1V7ML 3BGMA 2WWKT 4PJCB 1GGYA 1OAKL 5F3HA 3MOAL 2YUZA 2AK4A 2D7NA 4JQXC 4V1DD 4WV1C 1ZHBA 3MBEA 4HQQH 4ZS7H 1S7VA 4IRSC 5C6WH 1UQSA 5D70L 5DFVD 5FUZH 3FZUD 5D6DC 4FQIH 4H25B 4NJ9L 5DRXA 1JV5A 4LQFH 3MJ6A 3LD8C 5DVLA 2XRAL 4YNYB 4X6DF 1YUHA 4LLDA 1JGDA 5BQ7A 4XNMA 5I1CH 4F9LC 4P5KB 1KTDB 1J1PH 2XXCB 4U4BA 2VMFA 2ZUQB 2OXGA 1D5XB 2P5WE 5F70A 2W60B 5C08E 1MLBB 4Y4KB 1IT9H 2LV4A 2G5BB 3ZTNH 3WE6B 5C70A 5HHQB 5A1AA 2BSSA 1T89C 2IQAB 5B38G 5E2WH 3EAKA 4OV5B 5C0IA 5ITBL 5HD8C 1NUNB 4QOKE 5D2NC 4P46C 2CUIA 1BF8A 3JV5A 3KPLB 2VLRD 5I6XB 4G8IA 2X4RA 1YEDB 2X5PA 4GXVH 4UDTB 4AIOA 1IM9D 3VRLF 1G9MC 1BJ1J 4PJAE 2JTDA 3ULVF 3BWAB 4PJ9A 5DJXB 5IB5B 4MXVF 2J88H 2AI0L 1DQML 5EPMB 3EO9L 1H3GA 3D0VB 3QFJD 5B3JF 4K8RD 1CGVA 1OCWH 3PWUA 2JJTC 1T22A 1X5LA 5FUCC 4AQ1B 1MFNA 4H20L 2JELH 4I9WE 3WN5A 2MSPA 4ERSL 3FKUS 1T04B 4GRMB 5IFJA 3P9LB 2XZZA 1KTLA 5MEOB 4ODUB 1NAMH 2WQ8A 4J3UA 4U33A 4IMLB 3TT1L 2Q8AH 3I75A 1EZVY 3O3BB 3ECBB 4BSJA 1T83A 3CIQA 3RWCB 1FV1B 2P24B 2YD9A 1J1XH 4TTDC 3IF1B 1BFOB 5GSVA 4YJZL 1YJDH 3IFPA 5IGXH 1DE4A 4Z6AT 4LEXH 4D0DA 4JVPA 4DGYL 3O11B 1J18A 4OD3L 5LGKA 3HE7B 3L3OA 3SGEH 2HH0H 1JWUA 1R24A 4LCCA 3QHZL 3TBTA 5I1DA 1RZJH 5JQ6H 3P11L 4AEHL 5E03A 2QV2A 4FQXB 4O00A 3VJ6A 1YZZA 5D2NA 5CSGA 1JPTH 2DLTA 1XGQA 3EYFA 5D7LD 4PJAB 1CWVA 1YMME 4GJTB 4YBLC 5D7LE 3RZCC 3SJVA 5J89A 2B5IB 1FE8H 5GS0L 3WFHA 3QXWA 3DVGB 2ZSVA 3WHXA 5J1AA 1TQBC 3U7WL 4NQCD 4WDIB 3QUML 3DX7B 3V2AR 3FB7B 1UYWL 1XF1A 5JOFA 5FM5O 2VDRL 3SDXA 3SQOL 4JHAH 2EYSA 1MI5B 4Q6IA 3FN3A 2XQYK 4KKAD 4FQLH 3MJ8A 2GY7B 5E1AB 3FTGB 4PJGE 3BQUD 4PRIB 2DQHH 4GOSA 4NYLB 3MREB 4XP5L 4XNZB 2ZWLT 5D7SL 4NUGL 4ELMB 3VJ6B 4A2LA 2GCYA 3ULUF 2V5SA 1RY7B 4M02A 1Z0NA 4Y1AA 3DROA 2D4FA 3ILQC 5D71L 1T1XA 1RJYB 1WWWX 3ARBC 1CU4L 2DJ4A 3IU3B 1FLRH 1FZKA 4HXBL 4YR6A 1TJIH 3VFVB 5JMOC 1D5BA 4PV8A 2XG5A 2R2HB 3RNQB 4M1DH 1Z3GH 3PGCA 4LCIL 3P9WB 3VFVA 3CDFA 1AIFB 2DQIL 3E6FA 1NEZB 4LLVA 2BVOA 1GIGL 5EIIA 1CT8A 2EH8H 1BECA 1I1FB 2DD8H 3L3HB 2OBGA 4HGMA 1LDPH 3VXMD 1UB5A 4HG4J 1JZ7A 4WWKB 5JUEL 3GJFH 1AHWC 4ZSOB 1KT2A 2Z31C 1KXQE 1RZFL 3HCVA 1AR1D 1AGEA 3KLHC 2EKJA 4PREB 1DVFC 4DKFH 5ADOL 2JB6B 4PRIA 4JO2H 5FO9B 1MI5A 2ITCA 4YE4H 2DQCH 4GBXC 1AC0A 2Z0BA 3OZ9H 2YRZA 1DVFA 2RCSL 5DHYB 5DRNB 2HN7B 2VDPL 3X12A 4ZPTA 2Q7YB 2DWEA 1MVUA 4LIQL 3HRZA 5L2JB 3QEQB 4WUUA 5D71H 1I9JH 5AUMA 3TH3T 1KULA 1ZV5A 1OSZA 5HHPA 5A2KH 3ORJA 1ZLWK 1FP5A 3BJLA 3VG0L 4DUXA 4RGOL 3F6IA 1SEBA 3SDDB 2NPLX 4M7LH 4ZO7A 1R3JA 2AEPH 4U0RC 4G6AC 5FYLE 1U3ZA 2ZJSH 5B8CA 1W0YT 2HVJA 3L5WA 4PJ5D 3FQNA 2E9IA 3GZKA 1TZHB 4HGWA 3QIWC 3B6SA 5MEQB 1DEEA 3HPJA 2W0FB 2XWTA 1UKSA 4M00A 4L4TA 5E95B 3T2NH 3DJ9A 1A6TB 5I66B 5JHLL 1A4JB 2GK2A 3FT4B 5I71C 5L2KE 1T04A 4ZO8A 4ETQA 4LOUD 3K8LA 4Y5XC 5C0BA 4I0PA 1A02N 1TCMA 3QR2A 4QHUA 2H32H 3QEHB 1TCRA 4JPVL 3CAFA 1DUZB 3PE9A 3P11H 4R8WH 4N0UA 4DJMA 3S35X 1RZIB 3HFMH 5HHNB 1MWAL 3KPRD 1OP3H 2ZUYA 3E2HB 4PTTA 4XNYL 2NY5L 5JR1L 3QEUB 1YC7A 1GYAA 4WFED 1KB9J 1KT2B 4OF5A 4HT1L 4GG6E 4QRRD 2VXQH 5F7DA 4XNQB 3CFCL 1FO0H 1VACB 1FYTB 3LS5L 3HAEA 2OL3B 5EUKB 1IAIH 3HNVH 2AEQL 2J12B 2NX5A 3K4DA 4FHBD 2V2WA 3SY0B 2NCMA 4EUPA 2BHYA 3G08B 3ZSTA 1QYGL 1U3YA 4Q9BA 3ULUL 4Q9QL 1F4XL 1P9MC 4ZFGH 2YC1A 2BNRD 5DJ8B 3K4AA 1RJZA 3DXAA 3THMH 4AEFA 4G5ZH 4GQ9L 4OCNC 1MY7A 2ED8A 2BNQA 2ID5A 1UWXH 4P5TA 3ULUH 3JWOH 4F58L 2P44B 1F4WH 4RA0C 4KUCD 4YDJA 4OQ1A 4PP1C 2QHRL 1QRND 1I3RA 3QQNA 1YY9D 3MR9A 5CD5C 4P9ML 3MRJB 3O6FB 1RK1B 3MV7B 5ISZD 5GISL 3K1KC 2X09A 3RIFK 2YPVH 3FQTA 1A9BA 1RK1A 4KKCC 3RFZC 1QFWI 2HP4A 2DQCL 3S6CA 2IH1A 4KTDH 2K7QA 1FNGA 4X8JB 1UXSA 4O51B 3NPSC 1KN2H 5JW4Q 3MA7B 4OGYH 1A6TA 4OKVA 5E56A 5INCA 1G7HB 5ADOH 4XVJH 4KY1H 2DRUA 1IAII 1BX2A 5FHBH 1TVBA 1S8DA 4LASH 2XTJE 2HKFL 4H26B 1GGBL 3GO1L 3GSVB 4G8FB 5C0CA 4JGJA 3IJHB 3UTTA 4ODBD 1IE5A 1HHGB 3RVVC 1K4DB 3HC4H 2VITB 4BFIA 1FYHB 1HYRC 2DQUH 2EDXA 3TIEA 4WI7A 1JHKL 1J05A 1S7QA 3S5LA 1MQKL 4NQEB 3W11C 1V3KA 4HXBH 2FIRT 5FGBC 3S37H 4YDJB 4N1HB 5FYLD 4PRAB 3A6BH 2A77L 5SWZD 5I0ZA 3LKPA 4M1GH 2YBRA 2QL1A 3AU1B 1N6QL 2DI9A 5D7JA 4C58B 2XN9E 3TJHC 4K8RL 4LCUA 3PV6B 1KLFA 1YNTB 2VLME 4MSWB 4PB9L 4XP9L 2V17H 3PWPA 3U9UB 1QSFD 4ZNCD 4XXDB 2ZPKL 4Y2DA 2X05A 2FRGP 3ILQD 1ACZA 1BZ7A 3WFBL 2YOCA 1NGXA 1RVFH 1C08A 3IFOB 5IIEA 3PWUB 2ZNXA 1ZLSH 3NOIA 3BE1L 1J5OH 2F15A 3Q6FB 2EZ0D 2F53B 5T33L 2ZUTA 4H0GA 4U6XB 3WNOA 1TPXB 1NANI 1P6FA 3VXOB 4MVBC 2JLLA 1WAAA 3GK8L 1PKOA 4D0CA 5DA0B 2L7UA 4JGMA 4E41E 1U8NB 1FAIH 2XA8L 4JO2L 2HT3D 3G6JA 1HHIA 1BBJA 3MBXH 1PGRB 4ZMAT 5FYKD 2NR6D 4HDIA 4LSUL 3SDDD 5LG1A 2VZOA 3A0OA 1RIVH 3L3OB 4MJ6B 3L1OH 5FV1L 3HC0A 4OJFH 3ZT7A 5F1SA 1IKNC 3VWKC 4AM0A 4ETQB 4JR9L 3D1MC 5KZCB 4PJ7B 3MRIA 3RZCB 1FZOB 2IANA 4MMXC 4WW2A 3MRQA 1Z3GL 2Y36H 5J11C 3W39A 1DBKL 2AKRB 1HDMB 1QO3A 5F7FA 1AGCB 4LPVA 3UO1H 2VR4A 1Q94A 1IGTA 3ZYZA 3T1FB 4RMSA 1OTTC 1NBZA 5L7XL 4XTRC 5ESVA 4X6FA 4QTHB 5DJYA 4K94H 4G7VL 4FQCH 2D7QA 4ZFFB 1NAML 4ZYKB 3PHSA 4YGVB 3ROOA 2DLGA 1FG2A 2W59A 4KZDL 4XNUL 1W2KT 1M71B 4UAOB 1E4XH 3GSOB 3RWGB 5JPMA 4DGVH 5JW3L 4DK6A 1DQJB 1CL7H 4ZUWB 3KPPA 3V5HA 4OZHF 2J4WL 4TQEL 2VDRH 3D9AL 3PL6A 3GGWB 2QKIB 2AJ3A 4X99A 3OWEA 2I9LA 1AGFA 4PJIF 1CVRA 3TPUA 1KJ2L 2R0WL 4OCWH 3WIHA 4PY7A 1FZJA 5IBTH 2A0LD 2YEZA 3JV4A 4JQIL 4BZ1L 1QEWB 3T0XA 1D5MB 2YXMA 4ODVL 1SVCP 4OD2A 1Q9OB 1CFVL 2ARJA 3GUTB 1CXFA 4F15C 4TUKH 5I73C 3F58L 3O9WA 1JTPA 2HKHH 1YYLH 5GRUL 1I1CA 2FJHA 1EFXB 3Q5YA 1UJ3B 3P77B 1MCBA 2B4CC 5AYUL 1A6WL 3QHTC 1B4RA 4P23B 2ED7A 3LRSA 3VRJA 5FUOL 3HR5A 3HI6H 4LF3B 3WIFB 5I15L 3U7AA 3SDCD 4R7NB 4OF8A 4P2CG 5EU6A 1MJUH 4JFQB 3BKMH 4HGWB 3GSWB 1V7NH 2ENYA 5F7UA 2HJLA 5DRZA 1RUQL 2HG5A 1A0QH 3OX8B 4P2OD 3IFLL 2NX5B 4YDIL 1KENH 1C1EL 5EORH 1BAFL 4C59B 5IP4A 1TVHA 1VEPA 2VDOL 4HMEA 2Q8AL 3MNWB 1E6OH 2OJEA 4WUKL 2EO9A 4MLIA 5B39A 2KZWA 3EFDH 3CD4A 1GH7A 3UTQB 3IDJB 5D1QD 5DUPH 5J06A 3LB6D 2FH6A 4LVOB 4PUBL 5AYQA 4UQ3A 2FGZA 2NY1B 4ZAKC 1M7DA 5FCUL 1YEKL 4NNXA 5GGSY 3UX9B 1BFTA 1EK3A 4YK4B 2R23B 1WWBX 4GUPA 4KKLC 3JWNC 5EWIH 3ULSB 4EUPH 3WCYA 1FORL 4ZO9A 3UPRB 5GPRA 3O6FA 1JWUB 1R24B 4LCCB 4NRZB 4LSVL 4APQB 4L5FH 1BM3L 4ZPVB 5KVEH 4E41B 2PTUA 5DRWB 5A2IH 5IVZA 5ISZA 1YQVH 3BWAA 4RDQG 1QFWL 3V6FA 3WHE1 1K6QL 4GW1A 3X3GH 4JZNB 4YBLB 1P7HL 3GIZH 4DKDC 4G8EA 3WKNA 1K2DB 4J3OC 3TA3D 5D2LF 1EEYB 4J3TA 4IRJD 4KHTH 4XI5D 4S0SD 1CYGA 4LRIA 4XBGA 1NGQL 4PJ7F 4U1HA 4X4ZA 2MPAL 1IJ9A 4LKXA 4KUZL 4GBXD 5EU3B 5I1HH 2ATPB 3H9YA 1S7TA 5GGTH 3GUTA 4MB3A 3TCLA 2EICA 5DMIH 5HDOA 5I1CL 2AV1A 2AJUH 1VPOH 3S36H 4PRPD 3A67H 5FM8A 4CJ0A 2QADD 3UC0L 3HE7C 4GLRI 2OTUA 1NGQH 2XRAH 2DWDA 3TBYB 3CFBB 3PWJB 1A14L 4ZTOL 3EO0B 2ESVD 4Y5VB 4EBQL 5C08A 4K2UL 4LRNH 1PQZB 5SWQA 1QNZH 5CD5D 2Q8BH 1RURL 3X3GL 4NYLA 1ZHLB 4ZD3L 1HILA 5FK9B 5HYSG 5EULV 3S3JA 2FB4L 2FATL 1XR9B 3FMGL 5KVEL 3ZT5A 3FO0L 2VN7A 5HVWA 3MRGA 2CLVA 3QXAB 2COQA 4J3WA 4LSQL 5D7IA 4DZBA 4UOW1 4GAJL 5A2LH 1YNLL 4ZOAA 3QIBC 4XHJC 3NFPA 4UILH 1LQSR 1YMMA 2GUOB 5JHDD 3MUJA 1S9WA 2ICWI 3DGCR 2GTWB 2IC2A 3FFCB 3RWDA 3F8UB 1Z5LB 3LHPL 3S35H 3QDMA 2VLKA 3HE6C 4OCLC 5FCUH 4N0YL 5I1IL 3LMJL 4U1LB 5GHWL 3PIQB 3CSPA 2DTMH 3MRFB 1ZWIB 5TH2B 5GJSH 5JW5B 3AY4C 1I8MB 4Q97A 1BVLA 1LO0H 3MRFA 4ZAKA 4O02H 4I0CC 4KK8D 4X5WB 1MNUH 2VITA 4BFIB 4CGTA 1X4YA 1BAFH 3GSRB 3BEWA 3HUJA 3JTTB 1FRGL 4OLYH 5ETUA 5HHQA 5IWLC 3IVKA 2LVCA 1NCCH 2X4NB 3T8XB 2IADB 2OR7A 1J87A 1IFHL 4LSDA 3X3FL 4MNHA 1T83C 2CJUH 3UJTL 1ZA6A 2R1YA 2R1XA 2VDLL 4HDIB 4HXAH 2D0GA 2CLVB 2OZ4L 4QYOA 4W68A 5B3NA 4OAWB 3IETA 5LKNA 1K3ZA 3WUWG 1NFDB 3IDXL 3PL6D 4M62L 1DBJL 1R3LA 3GDBA 2R15A 1KJVA 1MJ8H 2IMNA 5SX4H 1G7JA 4JPWH 3MCLH 3C6LB 3I6LD 3D85A 1UZ6E 3IS0X 4F8TA 2G9HB 4NKDA 5E5UB 5ID0A 3DARA 1W0WA 3A6CH 2X9XA 5KSBB 4FG6C 5FKPA 1OGAA 3BD5A 3O9WC 3F12A 1RZGA 1S9VA 2R4SL 5JZ7D 1SJEA 4YC2C 3LEYL 4NO0B 1HHHA 3JTTA 3V6OE 3GIVB 4OLUL 2DQDH 1FGNH 1IC5L 1TQCB 4Z7OE 43C9B 2WUBL 3E1F1 3D9AH 4L4VD 3ZKNC 3CX2A 5DHVB 1U8PA 1RUAL 4HCRL 4OLWL 4YXLL 1G7MA 5IHBA 4FXGA 3TBSB 4GAYB 3V0WL 1HSBB 3ETBF 2EDWA 2YA1A 5E00B 3QDJD 3LQAH 2WK2A 4KDTC 2W92A 2R9HC 4Y2OA 2LTQC 3MUHL 3ME0A 4OB5H 4QY8B 3R1GH 4Y5YC 2OQJA 1IGJB 2BVQA 3VU2A 1KACB 4FQCL 3AXLA 1RAMA 4Q58C 3QBTB 4HFUL 3I2CL 3TO2B 2Z93B 5D1XD 1U8OA 3VWJC 4WEUD 3PP3K 4KK5C 4EI6A 4GRLB 1QHOA 3VMNA 3AS1A 1BZ9B 1H0DB 2FIKA 4W4OC 4JRYA 3REVA 3F7RA 3V6OA 4I2XA 5FIEA 2CKBH 1BWMA 4EI5A 1HYSD 2Y36L 4LPYA 3FO9A 3P30L 3QEUA 3S34L 5I30L 3HS0A 3BIKA 4JKMA 1OGAE 4LEOB 3W81A 5C0IB 1G9ML 1RD6A 3EYOB 3WIHH 3P4MB 3GSXA 5H35B 5IVZB 3TF7C 5I1KH 4G7YL 1RULL 5BW7C 1YY8B 4E42A 3QUZC 4XVTH 1FN4B 1JMZA 3I3BA 1YN6B 5DJ0B 3R8BB 4YFEA 4KHXL 5HXMA 1KCKA 4JDZB 2AJSH 2NXZD 2NZ9D 3MRPB 4NQED 4Z76B 1JYXA 3P4LA 1KTDA 3GSQB 1FL3A 4HKBB 4Y4KD 5J12C 5T1MA 5F6HI 5T5FH 2PXYA 1ZTXL 1YA5A 4TVPE 4MD4B 1M7IB 5E2VL 4DW2H 3UJIH 5LCVH 5KVFH 2ADIB 3VRIB 5F6IC 2EDYA 2G75B 3MLTA 4LHUD 1EAJA 1F3JB 2XIDA 1HCFX 3GRWL 4OZIA 3MGTA 4P2OC 2JB5L 2VWEE 3TH2T 4P3CH 3PGCB 4DUVA 4WWKD 3CFBA 5FO7A 4M43H 2WIIB 2GTZA 4WU5A 1R5VB 4TNWF 2ATKB 2E9JA 3Q5TA 3QJHB 3FCTB 4YK4C 1INEH 5EUOF 4Q9CA 4OZ4A 2A83B 1R5IA 3GEWB 1H3TA 2ZPKH 5DFVC 4PJXA 5FDWB 3STLA 5LGJB 1DE4B 2QSTA 3NABH 3NH7H 3BI9X 4OZFH 2WIMA 4O9HL 1G6RH 3RWIB 1WIUA 4KAQL 5D6CA 3OKMA 3B3IB 1GVIA 4P4KD 1G7MB 1P4IL 4LAQH 4Y7MA 5INCB 5IJKC 1Q72L 5T1MB 1S7UA 2CXGA 5T3ZL 5KBNC 2UV3A 1EFQA 3NCBB 4U1NB 4YHNA 3FFCA 3BEVA 3HC4L 5EU7E 1MAMH 3NBNA 5CCKL 5FYJL 1AR1C 2EYRB 2BVEA 3T0VA 3LIZH 5F7EH 3MOBL 2WP3T 5BJTA 3OG4B 4M5ZH 2NY3B 2VDNL 1ZSDB 4O9HH 1DSFL 2NY3C 5AWNL 3RPKA 4CVZA 3BUTA 1ZMYA 3WIIL 4O58H 1RU9L 4MQXC 2A38A 4X4MA 1NC2D 2VLLA 5I71B 1KV3A 4YIQA 3ULVL 4E9LA 3LKPB 3TT3L 5CHNA 3QXTA 1N5AA 2Y7QA 3VXTB 4P59L 1EGJA 3RL2A 5EUOB 4QOKD 1A5FH 3ULVD 3RY4A 4NOBA 5D7IB 3RU8L 5T3XD 1F45A 4P9MH 2HG5B 5IBLD 1KIPB 5DS8B 2QQKL 4K55A 2Q86B 1SBBA 5TF1L 4LPUA 4HPOL 1A1NA 4KHXH 5TF0A 5C92A 4X9GA 5HGHB 4PLKD 3D25B 3ECBA 1XGRA 4G7YH 2W0LA 2O61A 5HHOA 4MJ2A 5BZWA 1CTNA 1VSCA 3C8KA 3RI5F 3UDWC 3TESA 3EYVA 1G9MH 3CLFL 1HHHB 2VLLB 5F6IB 1X9QA 3CNKA 2OTUB 1ZANL 1H3VA 1DN2A 5JOFB 3HZYA 1I7TB 1FPTH 4U1JB 3NPZB 4Z5RB 3L3DB 5I1GH 4QNPF 1IC7H 1EO7A 3RGVC 1MRFL 1PZ5B 3O3AB 4DOHE 1G84A 4V1DE 3U4BL 4H0HB 5C6TL 3F65A 1OF2A 3EDEA 2ESVE 4ZFOB 3CSYB 4WCYL 4LSRH 1E4KC 3K46A 5DFTA 1V8HA 2C1OA 3MODL 2A9NL 1EX0A 3QUKB 1RV6X 1N5YH 3FQWB 4NRYA 3SN6N 2LAGB 2VDQH 4L8SC 3VFOA 2CLZB 4PGEA 3V0VA 1P7QA 1Q1JH 5ENWA 3HC3H 4EOWL 1HYSC 1LEKA 1NMCB 1GAFH 5DJ8A 4JPVH 5L2KB 5KJRH 5EFIB 5KS9B 1FQ9C 3FZUC 1V3JA 2LFGA 4K7FB 4AEEA 3DRTA 3OV6A 2BSRA 2DQDL 4OLUH 3QUXD 4GAFB 5SWZB 1MFCH 5JHDE 5ERWA 2FX8H 5D1QB 3QQ3A 5JHLH 1OTUD 4X7FC 4LVHC 3WXWL 4C56A 3JVGA 1QRKA 2PCPA 3UTSE 3SGJA 3WL9A 1Y6KR 4PJHA 5DD6B 3GSNA 5T1KB 3QZWB 5SV3A 3W5NA 3O2DL 3S3SA 5KJRL 5E1AA 1BQLH 4W81A 5DRNA 3UTZA 2PXYB 4EOWH 4HD9A 4LDLB 3RWFA 2V9RA 4X5XB 5IT2L 3MXVL 4QXWA 4BFBD 3LEXA 3GJEB 2BERA 4OZHA 4YC2B 4RGNE 4GQPH 4I9WD 4YLQT 4O2FB 3X14B 1D5IH 4P2RE 4K9EC 3MLYH 4RIRA 3VXRE 4PRPE 2I60L 3MV9A 4DTGL 1T1YA 1R3HB 4JZJA 4FQXD 2HJKB 4ONOA 4EI5B 2OI9C 3SJVB 3VXOA 1VFAB 3FRUA 4PJCF 4FFWC 4YEFA 4F9PC 5C9JA 1NGPL 1CT8B 1LO0L 4MDIA 1FVDB 4JM2D 2W1NA 4DQOL 3AAZA 3RWIA 1HHKB 1I8LA 2DTML 1XIWA 3QFDA 5TDPA 5TQ0L 4ELKB 4HWUA 3QPQC 3CVHH 1U2HA 4FQPA 4EUPB 3TYFA 3MUZ1 1H5BA 8FABB 5IVXB 3P4NB 1XIWB 2R69H 4JFDD 1ZGLP 4GW5B 4NO5B 4ZUSB 1OAZL 2CKBA 1RZFH 1U6AH 2BY0A 4Z9KB 3RWHA 3L95B 2PYEB 3TN0A 1FVEB 2GYSA 2XPGB 3BT2H 1NCBH 3GSNL 1MJ7L 5CBAB 3NCFB 3Q0HA 2CK0L 1YDPB 3C2SA 4WW2B 3SEPA 4H5SA 1TJGL 1R5WB 2G75A 4Z7VA 3CSGA 3UTTD 3QQ4B 4PJ8C 3WDJA 5I17B 1YYMH 3PUCA 4J6RH 1WEJH 2WNGA 1GZQB 1QNZL 2FO4B 2JCCE 2YN5A 1UM4L 5D7KE 3V5DB 1X5IA 3UDWA 4WDIA 1QKZL 4QCIA 3MRJA 1A7PH 4R96A 1Q0XL 3CMOH 3TFKC 4PJCA 3MFFA 4G80B 2CK2A 3ZDZE 3GMRB 1RSFA 3OSKA 4K3GA 4FZ8L 1WFTA 3GSXB 2WINB 3EYQD 5GRJH 1K4CA 5F7DB 3VFWB 3AS0A 2DM2A 3EO1A 4MVBD 4R9HA 4PRHA 1R3KB 2NY4B 1F4AA 5AAWA 5C0JA 4BH7B 1XF5A 3PWVB 3PWPE 4KHTL 3LIZL 3VI3F 2GJ6E 5DZNA 1L0QA 2N1KA 4Z7VF 1EUUA 1VEMA 3HI1A 4F33A 3QI9B 2FX9L 4LIQE 3GJFB 3QDAA 1Q9LB 3KLAB 3HI1B 4P0DA 4YR6B 2XN9B 4PRBA 3MLWH 2XG4A 4FA8A 3CMGA 3AXLB 3VGBA 1I1AA 4QXGL 1MJJA 5DUMH 2R56L 1X5JA 4ACPA 3M07A 3RRQA 4PB0H 4OF3A 4S1RL 3X17A 2EDDA 1ZT4A 4FABL 3C9NB 4PIRF 2B1AH 4JO1L 4NZUH 4XPTH 2O5ZL 3OR6B 3CFEA 4OGAD 4AENA 4AIZB 1WBYB 1YN7A 4QRUA 1CDIA 1ZT4B 2AQ3A 4LLWA 1NCTA 2FWOB 5C8JB 4XXCC 4YBQC 4Y4FB 1DCLA 5HHOE 1DQDH 1YEFL 1UADC 1ZLWH 5EU7C 1EVUA 3FONB 1BVKB 3QHZH 3UCRA 1Z2KA 2X4SA 2HLFC 5GGRY 4N90D 2V2WB 4P46D 1BVKA 1V05A 4ALAH 2ITCB 1IAKB 3CUPB 5KN5A 1YMMB 1E6OL 1JYWA 3HMXL 5EPMA 3DUSA 5BV7H 4G9FA 1J1XL 1H9VA 3L9RA 5EO1A 2IANE 4MQ7B 3OXSB 4P5TB 3BKML 3UYRL 3L3IB 4LFHD 3D25A 4N8VB 3RX7A 1UGNA 5CJXA 3RVTC 2DQJH 3MJ9H 1SM3L 5CZKA 5F1KC 1IBGL 2GT9A 1MF2L 1UKQA 5CMAB 5JNYA 1KB5A 2D03H 1MIML 5GRWA 5J12B 3OPZL 2GJZB 5LAXA 5FUOH 3RVWD 2A74A 1L4IA 1MQ8A 2BNQE 4HS3A 1EBAA 1LMKA 1TPXC 3NIFF 2PUQT 3FN9A 4M48L 4JLRB 4GAGL 3LPWA 1YNTA 4MSWA 4YHOL 4MAYB 4IOFD 5IESH 1AO7D 3WUWA 2J8OA 1I9IH 3GMQA 4HW6A 4NOFA 2ZOKA 2R0WH 3ULUC 1ZT7B 1K2DA 5F88B 1Z9MA 5C0GA 3BPOC 1S9WB 3MRRA 2QADB 3KNBB 3RKDC 1WK0A 4X80H 3LV3B 2D31A 2NY7L 2ESVB 3GI8H 4MAYC 4L3ED 3OB0H 4FRWA 5T1LB 3TWCH 4I77L 2IH3A 3JV6B 5B39G 4NNXB 2X4OB 1WCBB 4N8VA 1CXLA 3SOBH 3VWJD 5KANG 3Q3GA 2E7LC 5HY9B 2BNRB 3LY6A 4GKZA 4WGVB 2AEWA 1R6VA 4Y2DD 1TTUA 1UZ8B 1BVZA 3ARFC 3EKCA 1UZ6F 1MUJB 1REIA 4RWHA 3C60D 4F2MA 3G5ZB 4PGBB 1BFSA 4S1QL 2C3HA 2J6EH 3DURA 4KVCH 3ARGB 2OYPA 5DUBB 4GW5A 4NO5A 2AXGA 4X6CB 4YHOH 4MXQC 4KI1A 1T0NA 4GAGH 1ED3A 3VD3A 2EE2A 5B4MC 5EO0A 1A9EB 3DO3A 2NY1D 1MJ8L 1UVQB 4P5MA 1RIVL 1L9MA 1U93A 2Y9RT 4NZRH 4PJEE 5SWSA 3S4SA 1EUTA 3V4VH 4EVNB 1CN4A 5K93A 5CGYD 3V6ZA 4ONGL 4JM2C 1R3HA 4JZJB 3CVIH 5CEZD 5IW6A 1CLOH 1UJ3A 2DJSA 3VDAA 5HYEA 3N0PB 3V6ZB 3BH9B 4KPHL 1KCSH 3HZKB 5JO5A 4ODUA 1UA6L 1JZ8A 3BP4B 5FUCE 4HJGA 5DWUH 4EQ2A 2R4RH 2HTLC 2D3VA 4G6FB 1WSST 3RJDA 5T33H 3TJHD 3VMPA 3LRHA 3ZSSA 3VDCA 3R06A 4X4ME 3IDUA 3BVNA 2X4TA 3LKRB 1U36A 4N0FA 2ZUUA 2GFBB 3UTPD 1KGCE 5H37H 4ZG1A 4LBEB 3DXAE 4HBQA 2GFBA 4DK3A 2DMBA 2F54A 2GJJA 5JXEA 4K71C 4PB9H 1T3FB 3RPIA 1DFBL 1KLGB 4EDWL 3H9SE 3H9ZA 3P4OA 1F8TH 3LPGA 4XPHL 4I13B 4Z7WE 4I4WB 3WFDL 3DVIA 2XWJA 4KGLA 3MACH 4WFHD 4PV8B 4PLOB 3U83A 5MEPB 1EHXA 4LPTA 1MQKH 1PKQA 3HB3C 2FX9H 3O6KL 4TSCL 2P45B 4NN7C 5IB4A 5IW6B 4H8WL 4ZUTA 3P4MA 4KJPD 2WANA 1EGJL 1JPGA 1L7IH 4ZSOA 5IROC 2F58H 4XVSL 1HHJB 3DMMA 2Y6SD 3FB5A 3UC0H 3LKSB 1BZQK 4R97B 2A73A 2DIBA 4XP1H 1CL7I 1NJ9A 3IDYC 5IB3A 1MCLA 5T3ZD 4S10A 1IAOA 4KUZH 3MO1B 4WW1B 2MPAH 3G08A 2MCG1 4I48A 1P4BL 1FNSL 4YQXL 1AKJD 3LKNA 3SE8H 4KKBC 1EHAA 1A9EA 3GHBL 4MJ6A 5B38B 4J1UA 4PGJA 1SYVB 5EU5B 1MCSA 3CLEH 3DROB 1F4YL 4HZLA 1WEJL 3MNVA 1RPQA 4M1CD 1YYML 4YHZL 1WF5A 4Y16D 1GGTA 3QIWB 4QRQA 5GISH 3HUJE 2V2TB 4XPAH 4Y4HB 2AABH 2E8ZA 5HHMB 2HRLA 3DETD 3MV8D 4JAMA 4DEPB 1Y18B 1PQZA 4MJIE 1MREH 5D7KD 1U8IB 3SCMC 4NN6C 5IB1A 3EYUH 1CGYA 2J2ZA 4GKNB 3N1PC 1ES0A 2IQ9L 3O3EA 2YMXH 3ARQA 2GSIA 1NFIA 5F1NA 3CVHL 1LE9B 2AS5M 3TV3L 1AQDA 4I3RL 5TPWL 5C9KA 4Q9QH 1KLUA 1EBPA 4JY6A 4JRYE 1T66C 2R0LL 1T2XA 3B9KC 1NCAH 2BVPA 2A73B 4FFZL 4RMQA 5IHZA 1I8IB 3CU1A 2PW1B 3VXNA 1A7NH 3VW3L 1W8OA 1E6JH 5CFHA 3ZYIA 3SE3A 4V1DA 3IFLH 1FO0L 4QHNB 4K07A 3KJ6L 4PRBB 4CVZB 2CUHA 2OR9H 3GSUA 4LCWB 1B90A 3UTTB 1F90H 1EFXA 2ZG2A 5FOBB 4NBZB 1ETZA 1S9KC 5AEAA 3GRWA 1A1OA 1RZJC 25C8L 1SJHA 4NSKB 3KPQB 4P23C 2UY7A 2XQBL 5DEZA 3FCTA 3PABB 5DYOB 3KPQA 3PXHA 2FR4A 3TA3A 3CFJB 4HPYH 5IT2H 3GBMH 3FRPG 1MHEA 3BUYA 4QHLA 3K74B 4RISL 5I1AA 1BQLL 4KRLB 3IGAB 4CADB 5K9QI 4I8DA 1HI6B 1V3MA 2KKQA 5GRUH 1FAKT 3T77A 4P4KC 3QJFA 3MV9E 4JZOA 3QCUH 4TUJA 4UAOC 3IKKA 1HOCB 1UH3A 4IDLA 4QWWD 4MD5B 3G6AB 1M05A 3MGAA 4HUWA 3V4PH 4M3JA 1YNKL 4PP2A 1U8KB 3QNYB 4CNIB 4NO2B 4QNPE 4HC1A 5F9WB 1FSKC 4HIIA 5B38A 1H15A 5IW1B 1BD2B 1WUNT 4AT6A 2LVEA 3DVGA 5F9JA 3SKOB 2FHBA 3LKOA 3RY5A 4NDMB 3SE4C 1CLYH 2UWEB 3K8KA 4HKZB 4OZIB 4U0QB 4XH2A 4U6HB 1JGEA 2FYYB 3BW9A 4IS6B 2HFEA 3C5SA 5CIPA 1P7QD 1U8PB 2M8XA 3QUZB 4N8PA 1T03L 1HINL 2AJYH 1NSNL 3S96B 4JO4H 1JYVA 3BOVA 3ZT6A 5I8EB 3H7BA 5C08B 1MFAH 5MENE 1EPFA 4RWYH 1QBLH 4G6KH 4ZFZA 2X1XR 1KJ3H 1NCDL 1P4LB 5C6TH 1ZA6B 2R1YB 3BP6A 4FQJH 2VOTA 3ARPA 2Z93A 4APQA 3MLPA 2VDPH 3OJ2C 1S3KL 5DJCB 3PJSB 3SDAA 2E5EA 5J13C 3C60A 4NO3A 2FO1A 5A43C 4NQCA 1KOAA 4OKVB 5D2LA 2R2BB 1QSFA 4XVUC 4NWUH 2Y4SA 3L1OL 3OKYA 3KPRA 4UIMA 2OK0L 2VDKH 4NKMA 2Y6SC 1QSFB 2H2PC 4XAWL 4I2XB 5MEOA 1CFNB 4LSPL 1C12A 1MCFA 3BRDA 3SPVA 1SY6L 4P9HL 4Q9RH 5JW4R 5JUEH 2VDKL 3F7PC 4OCXL 4L8SB 1OP5H 3RVUD 3VRLE 3HUJF 3WFEL 4YHML 2F5AH 1GIGH 5GS1B 4Q6IC 2NNAA 3UPRA 3CFDA 1XGPA 1NDGA 3ZYOA 5BVPH 5JOPD 1T0MA 4M6OL 4MYWB 5CSZA 4RMVA 5EBWB 4BSVA 1T5WA 4OFDA 1GC1H 3RY6C 3AFLA 2YD2A 2PYEA 3QJFB 3PGDA 2HLAB 5MERB 1NCDH 3IJSB 4PRNB 1KJ3L 3RGVD 2X89A 3PV7A 3BN9C 1WWAX 5AD0A 4M7KH 5IMLB 4MZ3A 3MRIB 3RZCA 3T65A 3VA6A 1B6DA 1KIPA 1H8OA 1OAXH 1MLCB 2QSCH 4K7PY 4XP5H 3LSOA 3ZDXE 2V17L 2QSCL 2X1WL 4PJBF 5C07E 1FC1A 2LE9A 3MUGA 4X7TB 1VENA 1I3GL 3ESVF 4X83A 4HZAA 3DRTB 3BRFA 2BZDA 3DUUB 1UM5L 3HLAA 4OFPA 4X5WA 35C8H 4LCCC 3S37L 5D1XA 3HZKA 3WLBB 4M7JL 1X5XA 3O3DB 4I2XE 1FYTA 5BRZA 4U1IB 4A6YA 4OGZA 1F3DH 3EO1B 4DVBB 1QQDB 5J6GB 1QRNE 3MRHA 4GH7B 1NDGB 1IKFH 3VXRB 1OF2B 1WVZA 1DLHB 4NPYA 1I9EA 2DF3A 3B2UD 4XAWH 1U91A 3BEVB 3FT3A 2XI9A 5AG9A 1QEWA 4QHUB 1PD6A 3LN4B 1VFOA 4QHNA 5DVMA 4DZ8A 1BPVA 1YMMD 4MNQA 4Z8FH 3IYLW 4PRDB 3I9GH 5DC4B 1I1RA 3MYJA 2YD4A 1CF8H 3EOTL 1B0GA 5DJAB 2RJMA 1UXWA 5SX4I 1J11A 1DUYA 1KB5L 4JHWH 1A7RH 25C8H 2PYFA 4GO6B 3CFEB 4AENB 4AIZA 1F90L 1N59A 2Z4QA 4OF7A 5IQ9B 4XMKL 1LK2A 3O41A 4WTZA 4MQSB 2DYPA 4JFDB 1CE6A 4UMGA 4WEBH 1R5IB 4YDLB 1AD9B 1S78C 5D1QA 1ZVSA 4RMUA 5BO1L 5C0AA 1GJIA 2BRRL 4BKLB 4WIQA 4OM1L 4NC2B 1ZLVH 3SDCA 4AL8L 3IAQA 4ERSH 4GQ9H 3NFNB 4H20H 3RNKA 1MRCH 5CBEA 1MRCL 2HLAA 5MERA 5DHVA 1CLYL 3DGGA 4ZFGL 2J88L 4TTDD 1F4XH 4YNYA 5E99H 1DVFB 1QP1A 4PJDA 4DZ8B 1FL3B 4HKBA 4IOIB 4DGIH 1T1ZB 5DK0B 4B7IA 1BEYH 1OVZA 1MVUB 1SYSA 1XF3B 2BY1A 3QISA 4RZCA 4TVPL 5FM5M 4AEIL 3S5LG 5BJTB 1KC5L 1PEWA 4G8GA 4JFHE 4U1JA 3PP4H 1FZMA 4JY4A 1YEHH 2B1HL 3G9VA 3U4EB 2A74B 2Z8SA 4QRPB 5GS1C 1T5XA 3ZDYE 5FO8A 3JTSA 1I7TA 1JUFA 4PTUB 3UZVB 1Y0LB 5I19L 3B5TA 1NUFA 3I9GL 3SO3C 4Z8FL 1I3UA 3VXQB 4XRCB 4JY5L 1HI6A 4R8WL 4HUVB 4QXUL 2N7BA 4JFYA 3E3QE 4UOJA 5A16A 4XP1L 5HGAB 2AEIT 1A6UH 1SBSL 4KTEH 5I8KL 1NPUA 2CKBB 1NGWA 3CSBA 4XPBL 3O2WL 1MCHA 4N90E 3SDDC 3O4OB 3BP7A 2B5IC 3LEYH 5GGVY 3IXTB 4OLVH 3NTCH 5D70H 1U3JA 1NLDL 4R26H 5MHSD 4RFNC 3DI2B 1BVLB 2HT2D 5FO7B 1FNLA 3RTQB 5I75C 35C8L 4NGHL 4HH8A 2QHLA 4I3RH 1F3JA 4JPWL 4KKLD 1D9KA 2P24A 2ZSWB 4OLZL 4GS7C 3O4LA 3BAEL 4PRAA 5F72S 1RFDL 5IF0B 4HIJB 1YPZE 3BQUA 1EHLL 5L6YH 1CXHA 1CZ8H 1JWMA 3IJYB 4HXAL 3VXUB 2CJUL 4WO4B 1PDKA 2YHGA 1RHFA 4POYA 2YUVA 4D3CL 3I84A 3U30C 4G9FE 3OAYH 2MHAA 3MRRB 1S9XB 4PJDE 3D3VA 5ISZE 5I66A 4PJDB 1LO5B 5HHOB 2E6PA 3T0EA 2ICEA 4P4KB 4BQ8A 2PTTA 4WU7B 5FYJE 3B83A 4AG4H 5IROA 3OAUH 3VD7A 3T4YA 3QXVA 5T1KD 4FFYH 5FA3B 2BMKB 1R5VA 4B50A 4LSPH 5FOBA 2Z9TA 2P47B 2IALB 2IBZX 3RHWK 5HGDA 1RQ5A 2X70B 3E6HA 4NHUA 1I8KB 4N68A 2UZXB 4FXGB 2AJ3B 3H6JA 5EUOA 4P46B 1U8LB 3IDIB 2P1YA 5I8OH 3LQAC 5I76A 3PHQB 1U41A 1YDPA 3ARVA 3WUWB 1NC2B 3MOQA 2Q76A 4Z0XA 3IJSA 5LXGL 1A6AA 4PJHF 3RWHB 4ZFOA 4CVWA 4I0PD 1AP2B 3U36A 1A14H 2ICES 2OP4L 2CDFA 1F8TL 3B8YA 1EMTL 5ID1A 1MAKA 3RL1B 1RUPH 2BSED 5ID0B 4ZS6C 1OTTD 3HKFA 3O4OC 3GKWH 4CDHA 2D7PA 4R6UA 4J3VA 4MXQD 3N1FC 3SPVB 1TQBB 2BSTB 4RQQB 1G7QB 4JFPB 1XR8B 4HUXB 4JFOA 4FQHB 5KSAB 5IBUG 2XWTB 3GIZL 4JFXA 5BOZG 5EZLA 2NY1C 4KDVA 2AXHA 1NLBL 1KCUL 5C0AD 3MV8B 2I07B 1H5BB 4I18C 5DQ9B 4ETYA 3EYSH 4HUMB 9CGTA 5KSUA 5CJQH 2I07A 5FOJA 1KBGH 2ORBL 5CGTA 3IU3A 3EGSA 4Z77B 5C0RH 3VD9A 1N8ZA 3V4VL 3OHXA 3UPCA 1HDMA 4MXWH 4RISH 1IGIL 4H5SB 3FQWA 4NRYB 1YPZA 2Y25A 3T2QA 2HJKA 1P7KB 4WUUB 4WTZG 2EDFA 1MF2H 1A4KA 5F8RC 5IHUL 1WT5A 4IMLA 2VNCA 2XNAB 4DGYH 4QTIL 4LEXL 1CG9B 1D6EA 4PYHA 3STBA 3V5DA 1HHGA 3SDXB 4WWKC 2EC9U 3O3EB 4HJ0D 4NO0A 4LHJB 2AQ1A 4BSWB 6CGTA 2ARWA 3L3DA 1JE6A 2DKUA 4ONHA 4EN3A 1FVDA 2ADGB 5H2BA 3D5OF 1V7NL 3FO2B 4OZGA 5IB5A 1KF9B 4OUOA 2NX5D 1QPXA 3GGWA 3SOBL 2R0LH 1F97A 2YBRB 1CGWA 1R3KA 4ISVA 3S88L 1UENA 4I77H 1U58B 2VSDA 4CVUA 2JELL 2C3VA 3W11D 1MAJA 4JE4B 1SMOA 2PF6A 4QEGA 2R29H 1SYVA 1EEUA 1HKLL 2EYTB 1DDHB 4NZTL 4O2FA 5AYUH 3RVVD 5JQHC 4NN5B 3GJFA 2YRPA 1A1OB 3TBYA 3QWOA 3GJEA 4G6AD 4FZEL 2G5BA 3BH8A 3TIDB 2XT1B 1FZKB 4KUCF 2B2XH 1QBBA 1RI8A 4YHIB 2HRPL 4QXGH 5IVXF 4XPAL 5E8PB 1BREA 2H45A 4UZGA 3AROA 4M6AA 4PLJD 4FQHA 5KSAA 3GMQB 1UG9A 1H3WM 5CS7A 4M48H 3K4ZA 1IT9L 5TDNB 4IJ3C 4WNQA 3GB7B 2JCCA 4XC1H 2FH8A 1LE9A 4OCYL 1CDJA 1NAKH 4KH2A 3K0WA 1P4BH 3BKCL 7FABH 4J4PD 2VQUA 5DS8A 1N7MH 1ZGLA 1WLHA 3QI9A 5MI0B 5BXFA 4KZDH 3L7EA 4X5XA 1T7VA 5FO9A 5GIRA 5E9DA 4NKOB 4F80A 5C0BB 2LQRA 2IAMC 4LLUA 1JHLH 2EYRA 3FQRA 3KDMA 1JF5A 5E5MB 4CRPA 2VUOA 4MXVE 2APVA 3OB0K 4OGAC 2XTJC 1IEBA 5FUZL 1OSZB 3PDOA 1SQ2N 4XHJD 3MCKB 3ARTA 3O45A 2FEEL 1LEIB 5L2JA 2X4OA 4HQQL 4Y4HA 2CO6B 2B4CH 2CD0A 1WFNA 4X7SL 5L2KD 1AXTH 4XP4L 2NW3B 3FHQA 4S11A 1UM6H 1VA9A 1VFUA 3N1MC 2HVJB 5CJOH 4BQ6A 1CFSA 4MQTB 4JDVB 3MTRA 3TBTB 2YUWA 1DFBH 4OI9A 2Z8VC 1U6AL 2DDQH 1VERA 2F74B 2NY2B 4ZNEA 5C0GB 3QDJE 4IRSD 3PV6A 3NA9L 1EHNA 3OAUL 3TZVB 4C83B 1X4XA 1WITA 2ZOKB 4PB0L 1S7RA 1K5NB 4N5UA 1BMGA 4GRWH 3ES6A 1FNEB 4ZPTB 3NZ8B 4XNZC 2NYYC 2DICA 4K8RC 5M94B 2R4RL 3OGCB 5HHMD 4CW1A 5DLMH 5HPMB 2ADJB 2RAMA 2VC2L 5FA3A 4JFZL 3VFPB 4KK8C 3IU4L 3LRGA 4S2SB 3WFBH 1E4WH 2CMRH 1SEBB 3BKJH 1WV7T 2QQNL 4WU5B 4JFEB 5EBLA 4UNUA 5DT1L 3WHE0 4URTB 4QGTA 1QPPA 4X6EA 1P69B 5IMKB 2A6IA 5I75B 3ARFA 2WINA 2DAVA 1GSMA 3B2UC 1QKZH 5D9SB 3B43A 1FC2D 3ILPA 3O6ML 1W0VA 4KKBD 4ODTH 1DQQB 1R3IL 3KPSA 1G1YA 2J8UF 2PXYD 4J3XA 4X6FB 3QDGE 1PAMA 1NGWB 1UACH 3BZ4A 4XHQA 3ARED 1FIGL 2RFXB 2PYED 5E8OA 1M6OB 4JFHD 4CW1B 2HKFH 4KTEL 1A6UL 3EYOA 1OAYH 2R2EA 1DP0A 3TVMD 2YD8A 3TO4B 3EJYD 4GXUM 4WWKA 5H8DA 4U1IA 4PD4K 3RWCA 1XEDA 2OLDA 4ODXA 4EI5C 3BJ91 4ODSH 1MFEL 1C5DA 5CKAA 3HC3L 3BZEB 1KN2L 4Y88A 4FQQB 4NC1E 3WJLC 4KJQD 4WFEE 5IFHL