1RZIB

Crystal structure of human anti-hiv-1 gp120-reactive antibody 47e fab
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
216
Chain Sequence
QVQLLQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPVFGSANYAQKFQGRVTITADEATSTTYMELSSLRSEDTAVYFCAKGGHGMDVWGQGTTVTVASASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 47e light chain
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 216
sequence length 229
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rziB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rziB01
3BXNB 5JQ6L 5DR5L 4S2SA 1F4WL 2FJHB 4IRSD 4MNHB 1YEDB 2OTUA 4GKZA 1QSVA 2VR9A 3CMOL 4KKCC 5E5UB 4QY8B 4WO4C 2A38A 2DMBA 2ICWA 1FO0A 3ZKQD 2NX5D 4EBQL 4OIIL 1QO3B 3MFGB 4K8RH 2L4OA 1CQYA 1SVCP 1GZPB 4ZUUA 1BD2D 1ZHBB 4PJXB 4PREB 4PS4H 4XBGB 5DZNA 5ADPL 1VPOH 5IHUL 3GSOA 1A8JH 1KXVC 5I76B 1BIIB 5JLZB 1WBZA 2O26U 1CDIA 3PWJB 3QZWB 5D1XB 1WWWX 3GMRB 4JO2L 3LAFA 2VB5A 3RA7L 3NGBC 1FYTD 3UMTA 5E00B 1S7SB 1KC5L 4AG4H 1XGRA 2Q86B 1Q1JH 1E27A 1ITBB 5SX4H 5GJSL 4YDIL 2NX5A 3CH1A 1P6FA 1JJUA 4PGJA 2CRZA 2IC2A 4NNYA 5FGCB 4NOBA 4J4PC 3LD8B 1ZE3C 1BD2A 2DQJL 3TO4B 1HE7A 3TPKA 1AFVH 2R0WH 1MFBH 3L3GA 5GRVL 3FJTA 3VWKB 3X14B 1NAMH 4XNQA 4QHNB 4NZDA 1WFUA 2VXTL 3BRFA 4JDZA 5DQDH 2DWDB 2J6EA 1CFVH 4JAMB 2Q87A 1HOCA 2J4WL 5GGQH 2W91A 25C8H 4TNWF 2CK0H 5KANG 5TDOB 5JA9A 4GLRH 1FYTA 4OLWL 5I1CH 4AMKL 3ZTNL 1FQ9C 1R3LA 1N0XH 1BJ1H 1BMGA 2ITCB 2OP4H 2YN5A 3RZWA 4LAJH 1NBQA 2YBRA 2J5LB 8FABB 3UPRA 2E7BA 4MSWA 2DM2A 4NRZB 5C6PB 4L3EE 3GM8A 4P2OC 1Z9MA 1ZSDB 1RJYA 3VWJD 2DLFH 4GG8B 5T1KD 4NQSA 2WP3O 3CLEL 3Q3GA 2G60L 2VAAA 1RIVH 4U2YA 3VFWA 4DZ8B 5SWZE 3BKYL 2N1KA 4MHHI 3T65B 5D6DA 3GSUA 3SGKA 4HH8A 4Y4FB 1RV6X 3IT8D 5DUBA 4KKAC 3T0DA 2EKSA 1KUMA 3D0LB 5IROA 1UH4A 2EXYC 4D0DB 1X7QB 4Y7MA 1EJ6A 5HDQH 2WAHA 2C9AA 4ZUSB 1VADB 5IM7B 3UYRL 3WFZA 3PP4H 1GAFH 2B7DT 3QNYB 1D9KD 3KPPB 3VFUA 4QCIB 1DFBH 4NRXA 1G9MH 5JOFA 4ZS6C 3V4PL 3REVB 4ZO7A 4M6ML 5DFVC 5DRNB 5GSVB 5T1KA 5IP4A 5F3BA 4L8BB 4GOSA 5DURD 1A1MB 3FT2A 4XP5L 3SCMD 4JN2B 2Z9TA 2VABA 5DMIL 5KN5A 2MPAL 4R4BB 2W1NA 4W4OA 5LAXB 4IHOB 5IMLA 5B3NA 1C12A 3C2AL 1S8DB 4POZC 3BP4A 3U79A 1FAIL 5FECA 3VH8B 1U8NA 5EOQL 3MRQA 1DQDL 4BKLB 3MQIA 4MVBD 3CVIL 4YDJA 1ZGLP 2F58H 2MKWA 4JFXB 3RDTC 3VRIB 3ELAT 4PJ5E 4Z6AT 5A2LH 1AGEB 1DVFB 1GOHA 4LF3B 4DVRL 5I18L 4I2XB 1PEZA 4UOW0 4F7CB 2V2WB 5LWYL 2ZUXA 1C5BH 5C0ND 1NSNL 3PWLA 2FD6L 2W0KA 4P2QE 3ZDXF 2GTWA 4EOWH 5IMMA 1VEMA 3DI2B 3UBXA 2XTJE 1FO0H 5E2JA 3VXPB 1MREL 4OGYH 1FVEA 1FNHA 1K9TA 2OMNA 1MCPL 4XMPL 2VNCA 4X7TA 2HVJA 5HI4C 3VXRE 3FMGH 5GS0D 2QHLA 4R4ND 4PLKC 3DX7B 4G7YH 2OI9B 4U1JA 3QIUB 4FQHB 3AM8A 3IFOB 2W59A 3WS3B 1WJ3A 1NCAH 3MRDA 2K7QA 3NABL 4PRIE 4LSDA 4QXWA 1JV5B 1EBPA 4XPFL 3LN5A 1IAIH 1OLZA 3IDNA 1I3UA 3NCJH 3MUJA 3ULVC 3LN4A 1KIRA 2A9MH 5FGBC 4YR6B 1MIMH 1T7ZA 1BQLH 3TBYA 1L0YA 3KPLB 1QHPA 1WITA 1I1AA 5D2LE 5C0FB 4KY1H 1GZQB 2DJUA 4OFKA 3MBEC 5T5FL 3LIZL 3ULSB 2XY1A 4PV9B 1DN0A 2YK1L 2AGJH 3MJ9A 3OX8B 3QO0A 3MRMA 1MRCH 1H5BB 1UJ3B 3O3EA 3HPJB 3G6DL 3EYOB 3VFRA 2P4AB 1VGKA 2D03H 5EZIH 3EYUH 1B3JA 1KACB 3N50A 4I0CC 4R6UA 1NDGB 2XWJA 1IM3A 2Q8BL 2J6EH 2XNAA 1CG9B 4P5TC 3QO1A 1GSMA 4L3ED 3GBNH 1WK0A 2NY7L 4FA8A 5HJ3B 2HJKA 4JFOA 4F7TB 5FB8B 3T2OA 1EUTA 4KJQC 1A7PL 2IBZY 4OB5L 2OK0H 1LO5B 5FUZL 3QDJB 3DECA 5SWZD 5LG1A 4ORGA 3SQOH 1BM3L 2C4XA 2VDRL 3NH7H 3V5HA 4ONGH 2PYEB 4HUVA 1EV2E 1SYSA 3UDWA 3MUGB 1KPRB 5IFHH 5I8KH 2UY7A 1HDMA 4H20L 5SX5K 4KXZH 4D9LH 1K8IA 3DBXA 5GGTL 1UWXK 2QQKL 3SDYL 1A6TA 2X4QA 4QXUH 3JWNC 4FQ2L 2VISB 3D85D 4KPHL 3L95A 3OKNA 3QEQB 3VXME 2DI9A 2O93L 1CF8L 1CR9H 3O4LE 1I8LC 1A1NA 2B4CL 4ODUA 1DR9A 3HC0A 3HB3D 3N0PB 2DF3A 4NZUL 5IHZA 1PD6A 2VLME 4GXVL 3SGEH 1M1SA 1QFPA 4OLVL 4TPRL 5GPRA 3T08A 3QDGD 4R2GB 4AEFA 3INUL 2ZUWA 4WV1B 5SWZA 1NEUA 3QUML 2OL3A 2F5AL 3F58H 5JW4Q 5JTWA 1QLEL 4C56E 3ARUA 4TSBH 3PXHA 3L6FA 5D7JC 2Z35B 4PRDA 3HR5B 2AK4E 3LQMA 3FB5A 1MCOL 1CZ8H 5GJTL 1M7IB 3RNQA 5BMFH 1U8QA 1JGVH 4F7EB 5EBMA 3V0AC 1M4KA 3NIGE 3W9EA 5CSBA 3ET9F 5EC2B 2GJJA 3B2VL 1PZUB 5E4EB 3GO1L 1BFVH 3MLYL 4TULH 5F97E 4ZFZA 2WINB 3HE6C 1M05A 3G5ZA 4AENB 1T22B 2G2RA 4Y4KC 4XMLH 4QT5A 3QDGA 4YHYC 2VDML 3HMWH 2EYSB 4UQ2A 4HPYH 5A2IH 2M2DA 3ZT6A 3NCFB 2WBJD 5KSAB 4X98B 1Z5LB 2HTKD 3OBAA 4F37K 3QXAA 8CGTA 3FB6A 4P2QD 4MA3A 3WFHB 5JO5A 3REWA 4JQIL 3P4LA 1ZGLM 1JK8B 4XWOD 2EE9A 3GGWB 5FA3A 4MQXD 1ZT7B 5BO1H 3VXRD 2Z91A 1AD0B 2X4RA 4YHZL 3TA3B 4GRWE 5M7QA 3S5LG 2FLBT 5C0IB 2EYRA 2W9EH 5KSVA 1FNEB 4PJDF 4KJPC 5E94A 3KJ4C 1I85C 2HJLA 1Q9WA 4NPYB 3C9NB 2BOCA 1V7NL 3N85H 4LCWE 4PRID 2VWEC 2X70B 3V6ZB 2Y25A 4C59B 4HUKB 3P9MB 5DJ8A 2WBJA 1TFHA 3CFEA 2Q8AH 5KZCB 1EIBA 2PXYC 5EBLA 5KTEL 1LHZA 2XIDA 1FH5H 2E9JA 1L7TL 3NCYS 4ODWA 1M71B 5D7LE 3BPCB 2ERJC 2X4SA 2E3VA 2W60B 3M45A 1ETZB 4LU5L 1KLUB 3TNNB 1EEZB 4DGVH 3GI9H 2NY6D 2DS4A 5KJRL 1LO2H 4UV4H 4BUHA 3M8OH 1IGFL 1MJ8L 4NO5B 2OTWB 3O4OB 3MJ9H 5DJZB 2PNDA 3T77B 3QUXA 1A4KA 3M07A 1RU9L 5GS0H 4FXKA 1I1CA 1RIHL 3RL2A 1A14H 1HYRC 1RIUH 1YDPA 3D39B 3T0BA 1B6DA 2HVKA 3GJEA 3ZYJA 4IMLB 4PY7A 4MZ3A 1JCKA 4AH2A 4WNQB 5IB3B 4R90L 1ZVYA 3SE8H 1PG7L 2CDGA 5C2UB 4HS6B 3MO1A 2B8OT 3GK8H 3U4BL 4PJDB 2GSIB 3B9DA 3E6FB 3UTZA 4XCEB 5KVFH 2EO1A 1NMAH 3JWOH 1BLNA 5E9DA 1C16A 1ROWA 3EFDH 1NCBL 4G43B 4KJYA 4N1HB 4X4ME 1UA6L 1YA5A 1F02I 2H1PH 5IBTL 4X7SH 2VDKL 5IB4B 2JF1A 1WFOA 1LILA 3BGAA 4YZFF 1DQML 5DVLA 1OAUL 2GK0B 3O4LD 4Z7NE 2PYFB 1TTUA 4APQA 2C3WA 2VLKB 1T1YB 4WFGE 5T1DL 1NGXA 3BDYH 2NXZB 5EU6B 4HAFA 5FKPB 1BZ7B 2VLMD 4AK1A 4XRCB 3O6KH 4UU9B 3QFJB 1ZT1A 2ZSWB 2D4FA 4KKNA 1RPQA 2K1MA 3GSVA 4R0LA 4C56D 1S78C 3VGFA 1PY9A 4PJ7A 2W0LA 4QTHA 3J8F7 1T04B 3JTTA 3ABZA 4YLQT 1NFDE 3MRCB 1W0YT 1XR9A 1UKTA 1PLGH 2AK4D 2GI7A 3PV6A 5DMKA 3AY4A 3IGAA 1P5UA 3O9WB 4EVNA 3GI8H 2OL3H 4WI5A 3KLHC 4HLJA 2ILLA 3S88H 1QSZA 3HUJE 2P44B 4I1NB 3TIEA 3EYQD 3O4LA 4HUNB 4PJCA 4XZUA 1HHIA 5KS9F 4N9OB 2BY1A 5GZND 1GRWA 3H3KA 5BQ7B 3M17A 1L7IH 1J0JA 5C0CB 3JVGA 3H42H 3BD5A 2BVYA 5J12B 2HFTA 3GSRB 5D7IA 2XQBH 2V17L 4GS7C 1Q1JL 4NFDA 2EDFA 3AMLA 4C56A 3ZHLA 5C0JB 5CMAB 3EGSB 4U0QB 4KKCD 4QRRE 3U7YH 4WO4D 5ESVB 3Q5YA 1YQVH 3V2AR 1HEZA 4BH8A 2JJTC 4UDTA 3MLUH 5GGVH 4PY8J 4ZXBA 5GGUA 4OLYH 1AFVL 3I3EA 1MEXH 1EX0A 4NN7B 2CDEA 4UAOC 3U46B 3UXFA 4UUJB 5DQDL 4U3HA 4PJHE 4OJFH 2QR0B 4OD2B 5GGQL 25C8L 5J1AA 2VL5A 4OCWL 2UV3A 3S3PA 1NJ9A 3FQRB 5I1CL 3EUUA 5F1NA 4AY0A 4LCWD 5E8OA 1P5VA 3HNTH 2SEBA 2WUCH 3I9GH 1SEBB 1I3RA 3STBA 3RIAF 3MJ8A 1KELH 3WNKA 5L88H 1FZJA 2IMNA 1MRDH 5AUMB 2OJZL 4JFDB 1JHTA 3F7PC 2NTSP 5E6ZA 2GSGA 4HFWA 4WO4A 5KS9B 2DQHL 5FHAH 1RIVL 5D7LD 2J8UE 5B22A 4XH2B 3BSZH 3ULVE 3SE4A 4EUPG 3KPRD 2BX5A 1PKQA 3RUGA 4ETQA 4FQIH 4J8RA 1BQHA 5EU3B 1EEQA 1T7VA 2NW2B 3PQYE 4XVTH 1HXYA 3LKSA 4NZTH 4KKBC 4QRPE 4F57H 4J4PD 4N0CD 3UTQB 1ZANL 3MV7A 4N5EC 4K71C 5HDQL 3QPQC 1F11B 3H3PH 4H8WC 1KGCE 1NL0H 3T04D 2CIKA 4YNYA 5C2BH 1R3IH 1GAFL 1UKSA 4NFCA 4BQ9A 3KXFE 2VIRA 4MDJA 5K9KA 5FF6B 2VRAA 4Z7VF 2NLJA 1XF2B 1ZOXA 5DA4A 3IDJB 5AEAA 3HRPA 4X6DA 5I1HL 1UB6A 4LNRA 3BOVA 3PGCA 2Q1EA 4I3RL 5ICXB 3HKFA 4NCDA 3DURA 3NFNA 4MJ6A 1VFAB 4XNYL 3V0VB 4P3DA 4O4YH 1ZLUK 4P2OD 4WTWA 3HG1D 3KPRA 1ZKAA 3OR6A 3C5SB 4ZFFB 3C87A 5IVXF 5C0AB 3X11B 3D2UA 3TH2T 2OTPA 1UZ6F 3A0OA 4L8SB 4J4PA 1KIUA 3NACH 3IDGB 3PWVB 4KQ4H 1ORQA 4KKAD 1ZS8B 4RZCB 1ZLWK 3QULA 5J6GA 5HPMB 5KBNC 1OGTA 3B9KB 3QG7L 4OZHF 1S7XA 5FFLA 5DMJB 1U58B 2YHGA 1NAMB 2V5SA 5MERA 3NA9L 2WLYA 4R3SB 2PCPA 3UTOA 5DD1H 4OQTL 1MHPL 3SDXF 1AGFB 2Z31D 3MRFB 2F58L 3OJ2C 4CVWA 3I6GA 5KOMC 1MCDA 1JWMB 5CBAA 2C1PB 4P2OA 4YH6A 1W0WA 1ZT4B 3G6AA 4ZS6D 3HG1A 5DFVD 1HSBA 3U7WL 2EEDA 1AIFA 2C1OA 4RMQA 1U91A 1C5BL 4LLMB 2MKLC 4Z7VB 4JFQA 3KPQA 5DC0A 3V52H 1AC6A 5DJ0A 3LB6C 1A5FH 4ZAKB 3ZE2F 1FHGA 2VZUA 4X4MA 4HS3A 4OGYL 3MMEA 3QEUA 3VE0B 3IKCA 1ZGLB 1WICA 1KBGH 2WBWB 5BOZG 1OB1A 3FMGL 3W0WA 1T2XA 1S7TB 3STLA 3F8UB 1OSZB 5IVXB 1SBBA 4G7YL 2IBZX 4L3CA 2Z31A 3MCG1 2IANB 1VFBA 1NCAL 2WWKO 4WI7A 1C5DA 5KSUA 4QRTA 4LPYA 2NY1B 1IAIL 3MGOA 4D3CH 3DX6A 3RDTD 3BIKB 4OFYA 4OZHB 4EUPH 1WC7B 3PL6A 4JFFB 5DUPL 5IBUG 4UNVA 1NFDA 5F1IB 2IFFL 1BQLL 4QRRD 2VLRB 3F7VB 4PRPD 5C08A 2V2XB 1GL4B 1FG2A 5IB2B 3I6KB 5F3HA 1VB9A 1PYWA 2DLIA 4KY1L 5D8JH 1YY9C 3GMLA 4O58L 1KCLA 2DWEA 1T2QH 3HUJA 3QJFA 2AGJL 1IKNC 2R0ZH 3O6FA 2KBGA 4P5MA 1SEQH 2ORBL 5GRZA 5D71H 2FO1A 4HH9A 3UTPE 5EZIL 5HI4D 2NMSA 5DD0H 1U3ZA 1H15A 2FEEI 4Y8DC 4PLKD 3SJVB 4O2EB 4JKMA 1AXTH 2J6EL 3I75B 4ENEC 3MZGB 5K59E 4XPAH 5L2KD 3OXRA 5FKAB 5K9QI 3GBNL 1AE6H 4QHLB 3OXSB 4X8JB 1JHKH 1F4XL 3CX2A 5I71B 1X5KA 2P24B 4ZQKA 4E41E 5F89A 3S34L 1VACB 4MCZA 2OK0L 5E8PB 4HIJB 2VWEE 1T0PB 4PRPA 7FABL 2VDPH 2YXMA 4JO1H 4XGZA 4FZ8H 3SQOL 1MY7A 2EH8H 4U1SA 4PYGA 3NH7L 4ONGL 4U6HA 4S2SB 3PQYD 4UTBH 3C5ZC 4QRPD 4B7IA 1R0AH 2OTUB 5C0DA 4EIGB 5KSBE 4M7JH 3MBED 4GKZB 4PJHA 1N6UA 1RQ5A 4D9LL 3ZT5A 1KGCD 5HTSA 4DAGH 4L9DA 3OHXA 2ICWB 1FO0B 2PTVA 1E28A 4P0DA 2Y9RT 1AGBA 2YD3A 3N1MC 1X4XA 3KXFD 4QXUL 4GRWH 2G5BA 4M9PA 3VI3E 4LVOC 3IAPA 1CT8A 3LKNA 3MR9A 5L2KA 1H8NA 2E7MA 5FA4A 4UTAL 4ZUUB 3ARRA 3SGDI 4JR9H 1AD9A 2YRLA 5D1ZD 4FHBD 3OV6A 3P11H 2OSLA 5J0BA 3WO4C 1MY5A 3GSOB 1CLOH 4NYLA 1GGUA 1Q8MA 1Z9OA 2W65A 3BE1L 1WBZB 3GZKA 4KJQD 2QTEA 3F58L 3PQYA 2RQ8A 2QQNH 1F45A 4S1QH 4TSBL 3ARFA 3HAEG 3MBEA 1XGRB 4OZFA 2P8PA 5L8KB 1U3HA 1CZ8L 5DK3A 3KR3H 5IR1A 1E27B 5BMFL 2WP3T 1SJXA 3CH1B 2NX5B 1JGVL 4GAFB 4YXKH 3T0EA 3I84A 3DGGA 1J18A 1BWMA 1KLGA 2Y1VA 5ESQA 1Y18A 4JY4A 3A67H 4JG0L 4NNYB 3WYRA 1LK3H 1KJ3H 5LJYH 2ZPKH 1BD2B 4TULL 5TGBA 2FCBA 4W70A 2H3NA 5D1ZA 1KCVH 4XMLL 3L3GB 3D25A 5C0RH 1IILE 4I9WE 5FO9A 5IESH 4XNQB 4NCC1 1LGVA 3Q5OA 4HPYL 4JDZB 1KEML 4XNUL 4GAGH 1BECA 12E8H 2BC4A 1HOCB 2BXZA 4I48A 4KWUA 1A02N 4M43H 2R4RH 1FYTB 1R3LB 4X6CA 3B9VA 3P40A 3WE6A 3SDDC 2BP3A 2YBRB 3UPRB 4MSWB 3QNZA 5AYUL 2UWEE 4C4KT 5D7JD 2A73A 2AJVL 1AP2A 4WTZA 1LEIA 5BO1L 2OXHA 1OT2A 1RJYB 5FM5O 4NQSB 1A9EB 1MNUH 1Z2KA 2IGFH 2XZCL 3Q3GB 1RAMA 2VAAB 5B3JF 3VFWB 1KIPA 1LO4H 2W9EL 5CEYB 2JB6A 4XCNA 1F3JA 2BRQA 3GSUB 1KEGL 5DUBB 3N85L 2EKSB 4JPIA 4F7PA 5I8EA 3HE6D 3X3FH 1TZGH 2I25N 3BH9A 4Y4KD 1LE5A 1DBKH 4BK4A 2CIIA 1FH5L 4F15B 3OG4B 2MQCA 5E7BA 2DLGA 1EO8L 3VFUB 1XAUA 2YPLE 3OB0H 1B0WA 1JPGA 1OTSD 3MJ6A 5D7JA 4NRXB 3RAJH 4PGDA 5JOFB 2LAAA 1RZIA 4DGVL 5T1KB 2VO5A 5F3BB 1J0KA 4UV4L 2W9LA 3UTPD 3FT2B 2QBWA 5I16A 5E95B 3JWDH 2VABB 3OGCA 5GRYA 1MCJA 5KN5B 4JG1H 5HDBF 2KQMA 5GS0L 4P3CH 3GKWH 3B6SA 2B5IC 1F97A 3FO2A 4KJPD 4Y5XC 3C60A 5I30H 3K2MC 5IMLB 1JNNL 4Y4KA 5JIIA 1C12B 3MLZL 4Z77A 3BP4B 3DARA 3SE8L 4LQFH 2Z4QA 5FDYA 5FECB 3GK8L 1T7WA 1U8NB 1LO0H 2JCCE 2VN7A 3TEUA 2PXYD 1AQKH 3BUTA 4FFVC 2EDQA 3MRQB 4YDJB 1NMAL 4K7PY 4NWUH 1F4HA 3P73A 3EFDL 4RGMC 5DURB 4MA7L 3ILQC 1IGCH 3DUSA 3RKDC 2BNQD 3QDMA 5EA0H 3QCTH 3MNWA 2RAMA 2HFEA 3PWLB 2GTWB 3PWUA 4NKQB 4G8FA 5IMMB 5HSFA 3UBXB 1KTDA 4LLWA 3BDYL 2A2QT 1FVEB 1RUPH 2FH6A 3BWAA 4LEOA 3WS6A 4CW1A 4GAYA 2QQQA 4U31A 3TH3T 4AQOA 3O6KL 3DMMC 4X7TB 5BV7H 2HVJB 1J0IA 3BFOA 2IPTH 1FZMA 1EVUA 1RZFH 4U1JB 5E5MA 1UYWH 3U7AA 4HBQA 2FWOA 1RUAH 1J7VR 1UB5A 2ED9A 3MZTA 1PLGL 4PJAE 3MRDB 1IQWH 5GS1C 1A3QA 4WUUE 3BDXA 3DHJA 3LN5B 5D2NC 3IDNB 2BNQA 3BHBA 3S88L 1KIRB 3S37X 3TBYB 1YUHA 4OZFH 1UQSA 1I1AB 3G6JE 1L7IL 3S98A 4CN1A 1FFOA 3H42L 5CD3A 1DN0B 4OCRL 4I9WD 4L1HA 1NCNA 4A2LA 3QO0B 5HBBA 5ECJE 3MRMB 4MNGE 2XZQH 3O3EB 5SX4I 2GAZA 4P46A 3VFRB 3R1GL 1VGKB 1VCAA 4NQCE 3TN0C 3SBWC 3QWRA 4HKBA 2XWJB 1IM3B 4A2MA 2DIJA 1YQVL 5T3ZE 1S78D 2XNAB 5JOEA 3QO1B 4TVPE 1OQXA 1QUNA 2HJKB 4JFOB 1T6WA 1U42A 1WCBA 1JZ5A 4GMSH 1OF2A 1MEXL 2R1WA 3VFGH 1EAJA 1F5WA 1KN4H 1HHKA 3KLHD 4MA8H 4ORGB 1MFEH 4OJFL 4Z7OE 4GLRI 3V79C 4DGYH 2V9TA 3QI9A 3V5HB 4IRJA 4HUVB 2R1YA 3HNTL 1SYSB 3I9GL 3T2NH 1HDMB 1YYLL 2HAZA 3WD5L 3KLAA 4LPTA 5L88L 1K8IB 3DBXB 5HHPB 4QXTA 1A6TB 2X4QB 4KMLB 5FHAL 2YPLD 1J10A 3L95B 3OKNB 1CICA 4MCYA 1A1NB 4ODUB 4NN5B 4JRYA 4XVTL 3HC0B 2CRMA 4NZTL 3IDMA 4F57L 5IHZB 4Q9QL 2PETA 4NNXA 1E4XH 3E6HA 4XVJH 5HHOE 2WQRA 3F5WA 5ID0A 4RAUA 5CP7A 5SWZB 1KXQE 3QG6A 3H3PL 3LEVH 3L3JA 2OJEA 4RDQF 1NL0L 4I0KA 2OL3B 3RVUD 2F53E 5C2BL 1R3IL 1V3MA 5FYJE 3L6FB 4PRDB 3EO9H 4NFBA 4X80L 2JIXD 1J05A 1IM9A 3FB5B 5I1EL 2A9NH 2VKWA 3QWOA 3P4NA 3RNQB 3WIIL 3UTSE 1U8QB 2V9QA 2E7CA 5EBMB 5T3XE 4O4YL 5DGRA 2YPLA 1GOFA 1OTUC 3UJTH 3RGVC 5SWQA 5D1XC 4X4ZA 2UYLA 4PBWD 1M05B 3G5ZB 2N7AA 3TYFA 3OSKA 2XKSA 3FN0L 3SEPA 2G2RB 3NACL 4M3JA 2JJTA 1KJ2H 1HH9A 4QT5B 1JYWA 5FHBL 4DOHB 2AKRA 3QDGB 3QWQB 3VFSA 4UQ2B 4KQ4L 5F9AC 4KKBD 3HC3H 3T1WA 3TJEL 1G9NL 3VMOA 3QXAB 1X5FA 3KPOA 1JHLH 3FB6B 4FABH 4MA3B 2D7MA 1G7LA 5JO5B 3QPQD 3REWB 3W11C 4UT6H 3EBAA 4ZFOA 4OF0A 1MHCA 3LD8C 4FMKA 3WN5A 1NFKA 1T80A 1FFRA 3UROR 2DTMH 5FA3B 3TO4C 3I2CL 4LCYA 2Z91B 3MNVA 2X4RB 3VWKC 3WMSA 4RQQA 2CDFA 3D1MC 4KK5C 3BP7A 4LLDA 3R8BB 1HWGB 5D72H 2EYRB 1BOGA 5KSVB 3KPSD 5E94B 2HJLB 4KK9C 1Q9WB 3V52L 4F9PC 3JV4A 2BOCB 4U6VH 1A5FL 4WUUD 3LSOA 2ICWI 4KI5D 4LCUA 5J06A 5BXFA 1Q9KA 5DJ8B 2WBJB 3S37H 4RFOL 3CFEB 4KZDH 1JIBA 3DO7A 1NGQH 4TRPH 1T1XA 1KBGL 5EBLB 1BOYA 5JQHC 2OQJA 4GKNB 4KRNA 4KGJA 2LV4A 2VQ1A 2FJGA 2WBKA 4ODWB 2MWCA 4BZYA 4YPGA 5H2BA 5TF0A 1P4BH 5E03A 4BSVA 4HJGA 2X4SB 1GC1C 3O2DA 4WIQA 4Y4FC 3VD9A 2X42A 1IAII 1NUDA 1IC1A 4NKMA 4D9QD 4DW2H 4X6BA 3ZO0A 5IG7A 4HKJA 1CIDA 3KPSA 4PRNA 3SGJA 4JFEA 3HI6H 4NQCD 2KKQA 5F7FA 4Y19D 1A4KB 5GS2D 4PJ7F 5IEHA 2D0FA 4WUUA 4UDUA 1U95A 4M8QA 4FXKB 4WEUD 3RL2B 3CK0H 4R8WH 1DQLH 5F7EL 4P9HC 1YDPB 2VXUH 4R26L 2HVKB 3PP3K 3GJEB 1T2QL 4G8EA 5DJ2A 4H5SA 3RJQB 1HZHH 2DKMA 2R0ZL 3FFCD 4PY7B 3LB6D 4D0BA 3THMH 5E0QA 4JY5L 4AH2B 1SEQL 3TF7C 3HC4H 5D71L 2CDGB 3MO1B 5CEXA 1OP5H 4GAJL 4PJCF 4BELD 5DYOA 2ESVD 4OI7A 3UTZB 5FIEA 5E9DB 2NY6B 1BLNB 1ERNA 3MACH 1AXTL 1C16B 3BVNA 1AE6L 3TIDA 4KJYB 5D7IF 1JHKL 4CU6A 3D18A 4NQCA 1T21A 4Y19A 2ZUTA 1Q72H 2NY3C 1LNUA 1FC2D 2VDPL 1CDYA 4JO1L 4FZ8L 1P9MC 3CSGA 3LKOA 4PV8A 1TPXB 4HGKC 1BFTA 4GRLC 4EDXA 1EEYA 1XGQA 4UTBL 3FFCA 1NGXB 4XNZB 3ZKND 1R0AL 4LARH 3S97C 4B7LA 3PWPD 5HHOD 1QRND 4M7JL 4KXZI 2EC9T 4WWID 4H25A 1ZT1B 5MENE 1B4RA 1JP5A 2FHCA 2FECI 1DVFC 4TUKH 3M1BA 3GSVB 4R0LB 2F53D 5BZDA 1JPST 1P84J 2ESVA 2FATH 3BKCH 5FYJD 2OBGA 4K3HA 4PJ7B 4QTHB 1FPTH 3JTTB 4GG6A 2A74A 1WF5A 2FHBA 1QHOA 1XR9B 1I9JH 5C92A 3PV6B 1AKJD 4FQXA 4UINH 4NUGL 4NM4H 5DMKB 3IGAB 5F7HA 4EVNB 1RJCA 4Z7WE 4JR9L 1PKOA 3UTSD 4WEMB 1J8KA 3P11L 1UT9A 3SGEI 1CYGA 4MXVE 5T3XD 1CBVH 4Y1AE 1NUFA 4PPTA 3TIEB 1JI1A 4J3WA 1FZKA 3O4LB 4NM8L 5J1TC 4PJCB 4XZUB 4CBPA 1HHIB 3DV6A 1OP3H 4ETYA 3M17B 2QQNL 3SKNA 2OI9C 3DYPA 3QIUC 3PWPA 4HAGA 2HFGH 1KCUL 1QRNA 2DI8A 5DWUH 2ATPA 5D7IB 3BRGC 4GRWF 4U6YA 3KR3L 1OHQA 5CHNA 4JANA 4C56B 2YPVH 4WCYH 1ADQA 1YEGH 2BMKA 3A67L 1KJ3L 4RBPH 2ZPKL 3U6RA 1HEZB 2X10A 3SO5A 1B0GA 4BH8B 4UDTB 3BMWA 1KCVL 5TE7H 5GGUB 1A3RH 5C0RL 3TWCH 5IESL 3BGMA 2CDEB 4M62H 2JJWA 1QSFE 12E8L 1H5BC 1NBVH 1UJ3C 1U3JA 4M43L 2VL5B 4NT6A 5J1AB 1NGWA 1FE8H 2R4RL 1UENA 2ZUQB 1NJ9B 3ZLQC 5F1NB 3LY6A 4WFEE 5E8OB 3WUWG 1BPVA 4HF5H 3PHQA 1QSEA 2SEBB 1I3RB 3GDBA 3FAWA 4F80A 4YHKH 3MJ8B 3PJSA 1FZJB 5SV4A 4YFDB 1JHTB 2BJMH 4UIKH 3HRZA 3BYYA 1A6UL 3UBXI 2CKBA 4N68A 2GSGB 1MNUL 1A3LH 1AC0A 1BREA 4HFWB 1JPSH 4WO4B 5CEZD 1QBAA 1EHLH 5D2NE 5FO7A 1S9WA 1LO4L 5IQ9A 3HZVA 1G7MA 4ZOCA 1PKQB 3RUGB 1EJOL 1WGOA 1FNGA 4J8RB 1BQHB 1VENA 3H9HB 1WIPA 5DQ9A 1CGTA 1JTOA 1HXYB 3LKSB 4HC1L 1WSST 2APWA 4H8WH 4GRWB 1DBAL 3B9AA 5DMGC 2DIAA 5TE4H 3MV7B 4AIXA 3TVMA 3X3FL 1TZGL 4HXBH 4BZ1H 1E6OH 5ANME 1YMHA 4NP4H 3O2DH 1DBKL 2CIKB 4K7PX 4YNYB 3PDGA 3AVEA 2VIRB 4MDJB 2NLJB 2CJUH 4GH7B 1Z0NA 5L9DH 4PG2C 3WV0A 1F90H 1UB6B 1RY7B 4LNRB 3PGCB 3DURB 3NFNB 1A0QH 4P3DB 4KC3B 1MAML 2F9BT 1Z9LA 4WV1C 3KPRB 4LKXA 3OR6B 4NQEA 2EDBA 3D2UB 4YJZL 2PR4L 1CXFA 4JG1L 1KPUA 4P3CL 1HSAA 3FT3A 5I15H 1T7YA 5I30L 4RIRA 1ORQB 3QULB 5J6GB 4HZLA 1OGTB 3ZE1E 1S7XB 5SV3A 3GMOA 5IBUB 1J0HA 1NFDF 1PSKH 2X89D 5MERB 4N0UE 1A6WH 2PCPB 4N9GA 3AREC 5E4EC 1AQKL 2A6JA 1FL3A 3ARSA 5E2WH 3SY0A 4HCRA 5GS2H 1J1XH 1T5WA 3I6GB 1TCRA 3F7RA 3FOLA 3HUJF 3EFFA 4P4KC 4HXAH 4WU5A 5CBAB 4AYFA 3TBTA 4P2OB 1GYAA 1W0WB 3G6AB 1IGCL 3HG1B 1G6RA 3B4NA 1HSBB 4J7RA 4MHHG 1N2RA 1AIFB 2G75A 3KNBA 2C1OB 3QCTL 1KTLA 3N1FC 3S4SA 4JFQB 5DJ0B 2ADJA 3FQTA 2QSCH 2ZCHH 4TNVK 3NA4A 5J6HA 4HS3B 3QISA 5GHWH 3MMEB 4OUUA 3QEUB 1KENL 4G6MH 2DRUA 3DUUA 4Y1AD 1C5CH 3SOBL 3IKCB 1AR1C 5GGSY 1OB1B 1RUQH 2X89A 4N90E 3W0WB 2I9TA 2IPTL 5E1AA 3STLB 5BW7C 2ARWA 3H2WA 3T3PE 1NKRA 5KVEH 3NIFE 4N8VG 1UYWL 2Z31B 4HIHA 3V8OA 3H7BA 5F7UA 1VFBB 1II4E 3ULVL 1IQWL 1C5DB 5KSUB 4QRTB 4O00A 3P0YH 1KV3A 4B50A 5IOPA 3CFJA 2R2EA 3MGOB 4PJHF 2I26N 3DX6B 1MUJA 3PL6B 1NFDB 3EJYD 4F9LC 1NCWH 5C08B 5ISZD 1FG2B 3ILQD 2FSEA 5F3HB 1PYWB 2EIBA 4KQ3H 4FNLL 1ADQH 1HCVA 3GMLB 5FYJH 5DK2A 2DWEB 2Y72A 3HUJB 3QJFB 2ZCKH 4Y1AA 5HHME 3O6FB 4P5MB 1B4JL 3VFMA 5FGCE 2XZQL 4LRNL 2J8UF 1IGMH 4HH9B 4GKOA 2FGWL 4WFED 3DMMD 4R97B 2EIDA 2VSDA 3F6IA 5ACLA 5I1DA 1H15B 1QRKA 1MCQA 3EHBD 3MV11 1NC2D 3Q5TA 3OXRB 3U0TA 3E2HB 4X9HA 3FONA 3V6FA 4ZQKB 1MOEA 2YSSA 3KYNA 4GMSL 5F89B 4MCZB 1O7SA 4MAUH 5HHNA 4QRRB 2X4OA 4PRPB 4RMUA 3VFGL 5ISZA 3TNMB 4XGZB 3O0RL 4MA8L 1MFEL 4S11A 4YDLC 4Y2DA 5IT2H 1KB5A 5JW5A 4U1SB 4U6HB 2EC9U 2GEEA 2CKBH 3T2NL 3VW3H 1RFDL 3I3DA 4XHJC 3DNKA 2B0SH 4PJHB 2E7HA 3O45A 4K7PH 1EERB 3OHXB 4CVUA 3PDOA 3EOTH 1E28B 3DMMA 4LVEA 1AGBB 4JGUA 1MQ8A 3RWHA 3VGAB 2G5BB 2W9DH 4X6CF 3X12A 1CT8B 1NC2A 2FBOJ 3LKNB 3MR9B 4K94C 5BV7B 5HYJA 1HNGA 4MQ7A 4WHTA 5DO2C 5L2KB 1WAAA 4U0RC 5FA4B 4OM1H 4L29B 4PGCA 1AD9B 1DN2A 1FC1A 3H7LA 4UV7L 1FNFA 2BNRD 2NXZC 3LEXA 2OSLB 2YD7A 1GGTA 3ALWA 4HT1L 1IEAB 1RUMH 4WHCA 1E4XL 5DVKA 4XTRC 4NYLB 2J8UB 5FV1L 4O9HH 5L7XH 1MCLA 2W65B 4Q74A 3LEVL 2NTFB 4QWWC 3IRZA 1UEYA 3PQYB 4LOUC 4HZAA 1RZJC 4PJEA 3KWWA 4JO3H 1P53A 2D9CA 2E9IA 4P48A 5CEZH 3ARFB 3EO9L 3MBEB 3U82B 2APVA 4OZFB 2P8PB 4DKEL 5I6XB 3QQ3A 2A9NL 5IR1B 5JPMA 1OAKH 1AY1H 3T0EB 2QQLH 2EZ0C 3TBSA 1KLGB 3Q6FA 5ESQB 1NMCB 4ZPVB 1Y18B 4JY4B 2BVEA 4JPWL 3UJTL 5D5MA 3NCCB 1S7WA 5TGBB 2XKNA 3RWIB 2H3NB 5D1ZB 3RKPA 2BNRA 4R7NA 9CGTA 1KJ2L 5J12C 3D25B 3WIHH 1Q9LA 5FO9B 3FQXA 1OAQH 4J6RH 1JGLH 1MWAA 5MEPA 1KYOK 2Q20A 5JMRA 2BC4B 2C4FU 4I48B 1K2DA 4HCRH 1Y6MR 3O3BA 1JHLL 3D5OF 1ZLVK 4FABL 4X6CB 3H3BC 3ZKXB 3TZVD 3WE6B 1TQCC 2L0DA 2V9RA 1YY8A 2B20A 1G6RH 1G1YA 3QNZB 2VAJA 5DJDA 4M00A 2V7HA 2A73B 1AP2B 1LEIB 1K6QL 2DTML 2Y5TA 1ZAGA 4GFTB 4N90D 4NN7C 4ZS7H 4JO4H 1U2HA 4OZIA 3CZFA 5D72L 1KIPB 5B8CC 4XCNB 1F3JB 5I74C 2X1WL 1OTUD 5JA8B 3RGVD 5KAQF 4JPIB 4F7PB 3HZKA 4OI9A 5B39A 5I8EB 2V5MA 1DBML 3BH9B 3OAUH 3S37L 2HWZH 3TYGH 1KPVA 1LE5B 5J8OA 4KZDL 4K2UH 4TRPL 5HGBA 2CIIB 5CGYC 3TZVA 3BKJH 2OX5A 4OT1H 3KYKH 5KVDH 1MCNA 1JPGB 4LRIC 4M93B 5D7JB 4JPKH 5HHMD 4PGDB 5CD5C 3W11D 4RRPG 5I9QB 4BZ2H 1RZIB 1W0VA 5HDLA 2CRYA 4X5WA 5L0QC 4K8RC 5I16B 5FYJU 5H37G 5HVFB 1G0YR 2CUIA 3OGCB 1NPUA 3CFBA 1MHEA 3EDFA 3U2SA 5LCVH 1QZ1A 4KK5D 3RGVA 5KSBF 3BGFB 3CK0L 4R8WL 3B6SB 1DQLL 4LEXH 4P2YA 2XWTA 3FO2B 2VXUL 1IZKA 5I17A 4Y4KB 1JL8A 1HZHL 4Z77B 3HPLA 4GW1A 3THML 4G8GA 4XP9H 4YHYB 1ZVHA 4MXWL 3FQUA 4RAHA 4OLUL 4JHWL 2Z4QB 4B53A 3H9YA 1Z3GH 3TP4A 5DZLA 2XZAH 5JUEH 1U93A 3B9EA 3ROLA 3MACL 3QBTB 4K3EL 2HRPH 4L8SC 3QDJE 5EZJA 1F58H 4CMHB 3P73B 1KB5H 4JZJC 2ZUSA 4Y4FD 3DUSB 3QDMB 2W07A 4H0IA 4PRBA 1Q72L 3B9KC 3MNWB 3ECBA 2HFEB 2Y4SA 3PWUB 4G8FB 3CDYA 1GGBH 1KTDB 2B1HL 4F9PA 4LLWB 5ADOH 4LEOB 3BWAB 2E27H 2AVGA 4CW1B 5HHVH 4O2FA 4FQLH 1ZHKA 4DWHA 1YEJL 4JY6A 4TUKL 2JJUA 1FZMB 2W0FA 2FATL 3BKCL 4WVRA 4NJAH 3GIZH 5E5MB 2E8ZA 1FPTL 1TDQA 4J12A 4CU7A 2FWOB 3QZWG 5KSBB 1UB5B 1RZKH 5DJ6A 1QYGL 1I1FA 3HN3A 4WUKL 3V9FA 4K3JH 1I9JL 5CJXA 2ERJB 3GSWA 4TUOA 4ZAKC 1CVSC 1KYOJ 2FBJL 2BNQB 3BHBB 5F1SA 2HRLA 5DC4B 1CBVL 4MA1C 2DKUA 3UYOD 1V3KA 4KROC 4G6JH 1YUHB 4HEME 3E0GA 5KG9A 3UPAA 3K7UA 1UQSB 2IEPA 4ZOBA 4R7DA 1KG0B 1FFOB 2NY3D 5DHVA 5CD3B 2HFGL 1KJVA 4XXDB 5DWUL 4GRLD 5J11B 5ID1A 2OCFD 4BK5A 5SX5H 4P5KA 3N9GH 2E6PA 2GAZB 4P46B 2NY1C 5DI8A 5JHDD 2YPVL 4WCYL 4OFIA 3MRNA 3TBWA 1DEEA 1R3HA 1G9MC 2NCMA 3ZSSA 1DVFD 4HKBB 1NBZA 5FUCC 2FO4A 4NRYA 3FRPG 5IFJA 4HWEH 4M61A 2QHRH 5TE7L 1KN2H 1WCBB 3RWCA 4H0HB 1GHFL 1N64L 4S1DD 1OF2B 3TWCL 2R1WB 1IGIH 3TJHC 1FORH 4M62L 4ZFOL 3RWFA 4ONFH 3VDAA 3AS0A 1HHKB 3ARZA 1NBVL 2OZ4A 1YNLH 2VXVH 15C8H 4W81A 2KZ1B 3QI9B 4IRJB 1SJEA 4U2ZA 1C8PA 5FO8A 2R1YB 5C9JA 4GRLA 2X4PA 1R3KA 4LGSB 4YHKL 1CFTA 3KLAB 4R9HA 5JHDA 3N1GC 1OVZA 3QIUD 3MJ7A 5DHYA 3IU4H 5I71C 2BJML 2H45A 3ALXA 2XV6B 5DQJA 4QXTB 5JNYA 5HYQA 3FRUA 4JEGB 2XOTA 2XT1B 3TH4T 1A3LL 1EHLL 4GSDH 4IM8A 1S7UA 5ENWA 1CICB 3T3ME 4MCYB 3QRGL 5I1IH 4JRYB 1L6XA 3IDMB 4YWGH 1C1EH 4H8WL 4NNXB 3E6HB 3F5WB 5ID0B 4RAUB 5CP7B 4BZ1L 3QG6B 4I3SH 2D7OA 3L3JB 2OJEB 4XCCH 1A47A 4PB0H 2VERN 4PUBH 4NP4L 3O2DL 1YZZA 3SPVA 2ED7A 5EUKA 5GRUH 1LK2A 3VJ6A 4HLZG 1ZHNA 4UT7H 2AV7A 5IFAL 1J05B 1F90L 4TQEH 1IM9B 4PYHA 3VD5A 5INCA 3QWOB 3P4NB 5GGSA 4Q97A 2ZJSH 1A0QL 2XZZA 5EZOH 4J2XA 1S5IH 2YPLB 3RRQA 4NHCL 3D39E 5F7KC 2CXKA 2EDWA 2XRAH 1ACYL 2UYLB 4O51A 2IADA 3VH8G 3RNKA 3TYFB 4MNQA 3AB0C 5EZLA 3QDJD 4AEIH 2R0LH 5DEFA 2CSPA 3GM0A 3MRPA 5I15L 3VG0H 3VFSB 2AEPL 5TDNA 1RI8A 3MRHA 4PJDE 1T89A 3CDCA 1QNZL 3E3QC 5DMGD 5FUOL 3KPOB 1PSKL 3HE7D 1G7LB 3RY4A 3U48A 1OSPH 1A6WL 5JXEC 4NKDA 2YD1A 4ZFOB 4DJMA 1MHCB 3VXNA 4KI5F 4BM7A 1CLCA 5E2WL 1UH2A 3VA2C 1N26A 1J1XL 3V4VH 2FX7H 4RMVA 5T3ZL 1TMCB 4LCYB 5F6HJ 1FJ1A 4RGNC 4TVPL 3MNVB 5F7WC 3KYOA 4RQQB 1TVBA 2CDFB 3BP7B 4LLDB 1CGXA 2VLKE 4O5LH 2AP2A 3QHTC 1KXTB 1BOGB 5EU6E 1RURL 4RMRA 2QADC 4HWBA 1VSCA 3JV4B 3QFJE 4JQXA 3LSOB 4ALAH 4TN9A 4LCUB 3GSQA 5BXFB 2ZCHL 1Q9KB 4WFFE 2J1KA 5C3LD 4G6ML 1C5CL 3DO7B 1T1XB 2VITA 4PJBA 3HE7A 4K71B 3B8YA 3LVEA 5JW4R 2OQJB 1WEJH 2VQ1B 4OCSL 2VZTA 2FJGB 5KVEL 2HKFH 4YPGB 2EDDA 3RX5A 4BSVB 4HJGB 3OF6A 4U7KA 5D6DC 3SGKC 4PG2A 4X7DC 3ARED 4JFHE 4OI8A 3PWNA 5IROC 4JDTH 3P0YL 4NKMB 3S36X 1YEIL 4X6BB 4LFHD 5IG7B 4HKJB 5C0CE 5DHVH 3WDJA 4NHUA 3KPSB 3MRIA 5E99H 4PRNB 4P4KD 4G7VH 4RGOH 4K3DH 4QRQA 4JFEB 4P9HH 4HUMB 1NCWL 4QTIL 5IEHB 4WUUB 4UDUB 1U95B 4AL8L 4F15C 4M8QB 4GG6F 3HR6A 4KQ3L 3BD4A 5TQ0H 1ADQL 5FYJL 4ZTOH 5DJ2B 4G8EB 4H5SB 1YEEH 2ZCKL 4YZFE 2YMXH 2WK2A 4IOIA 4D0BB 3BIAX 3G9AB 4JFPA 4XXCC 4NKIH 2YUWA 5CZXC 2ADFL 5HGHA 1IGML 5CEXB 2N56A 1JF6A 5CIPA 5DYOB 1AR1D 5T3XL 1MLCB 4AQ1B 2VN4A 1CK0L 3OAYK 5AZ2H 3IDIA 2OZ4H 3F12A 4Q2ZA 1I9IL 3CFCL 1BVLA 4W4OC 1UKQA 3BVNB 3TIDB 3PUCA 4CMMA 1GXEA 1NEZA 3D18B 4P4KA 1IBGL 2CLZA 1QBBA 1T21B 4MAUL 4NQCB 5J57B 1OD7A 4Y19B 1E0OB 4CDHA 4W6WB 1LNUB 3LKRB 3LKOB 4PV8B 5IT2L 4EDXB 1EEYB 4ELKA 1XGQB 4JFDE 3WFCH 1Q0YH 1PDKA 3FFCB 1I9EA 3C8KA 3PIQA 2CKBL 4J3SA 3VW3L 1HXMA 2B0SL 5D6CA 4H25B 2GHWB 3M1BB 4L3AA 1GGIH 3MLSH 2XWBA 4V2BA 2HFFA 2ESVB 3GRWL 5BZDB 4I8DA 1HINH 2WUBH 4EJ1C 4IOFC 4GG6B 2A74B 2W9DL 4MAYA 4P2RE 3TV3H 4FQXB 4YGVA 4OM1L 2IQAA 2RJMA 1CD1A 4IBLT 4N0FA 1S3KH 2AJUH 2APBA 4RISH 1UFUA 4O9HL 5L7XL 2PO6C 1I3GH 3D39D 3FKUS 1FZKB 4E42A 1JPTH 4OV5A 3DV6B 2DQTH 3RZCA 2CRIA 4M7KH 4KFZC 1OWRM 1N4XH 4F9LA 5LBSH 3BZFA 4Q6IA 3SKNB 4ACPA 4JO3L 3PWPB 4MVBC 4AIOA 1QRNB 1NCCH 3W5NA 1K8DA 4CVXA 2ATPB 2R56L 2PW2A 4OF3A 4JPVH 2MFNA 4U6YB 4ZD3H 4HX1A 5C0AE 5CHNB 4JANB 1AY1L 2BMKB 2QQLL 4XHJD 3MRBA 4OLXH 4KV5F 4NQTA 2D0HA 1RULH 2V2TA 5E24E 5K9QG 3U0WH 1I1AC 3U6RB 2E7LA 1B0GB 3UJJH 5CGMA 3L9RA 2AABH 4NN6B 1NH6A 3KPNA 3WIHL 1H3XA 3BGMB 2QJDA 4J6RL 2YZ8A 1MIEL 2YD9A 5CJQH 3ZDZE 2ZOKA 2VR4A 4U1IA 1F00I 4JKKA 4Q0XH 5C7XH 1FFPA 2NXZD 2IJ0C 4R4NC 4RWHA 4RX4D 4TSCH 4NT6B 5EU6D 1NGWB 3IJHA 5LKNA 1IEHA 4XTRD 1CWVA 2R2BA 1EAPA 4DUVA 3CH8A 4RA3A 3QFJD 4HJ0D 3PHQB 1QSEB 2GK2A 4QWWD 2IPUK 1ZK9A 3WHE1 4LOUD 1EK3A 4WFFD 4M3KB 2JJSA 3HFML 3PJSB 4HWBH 1F3RB 1UACH 4Z7VE 3HRZB 3HS0A 3MOQA 4XBEH 3WXWL 3FO0L 2CKBB 1CU4H 4EXKA 4PJFE 1ZLUH 4JO4L 3AMKA 2D7TH 1NMBH 3JWOC 5FO7B 4J3VA 5IQ9B 1OD9A 1G7MB 3HZVB 1JN6B 4XC1H 1FNGB 4LVOB 4UOJA 2P5WA 1XF5A 5DQ9B 3JV0A 1GJIA 2R2HA 5D1QC 3S36H 2M8XA 5CZVH 1E6JH 3TVMB 3GBMH 3O3AA 1J88A 3OAUL 4RX4A 2HWZL 3WO4B 1UZ6E 1YMHB 4YFEA 4K2UL 1ZLWH 5IQ7H 1JFQL 1HQRB 1P2CA 5CP3A 3BKJL 3MA9H 5KVDL 1LQSR 4Z7UE 2FX9H 1G7HA 4JFFE 4NN5C 3QQ4A 4XWGH 4BZ2L 3IFPA 2OYPA 1MCEA 2VLRE 5FUCE 5JDSA 5T1MA 3L7FA 1SY6A 5C9KA 5IJVA 1CFSA 4HUWA 3KJ6H 1QKZH 4LKXB 4NQEB 4OZ4A 1YEKH 3ORJA 4YUEH 4J23A 3T0AA 4M9OA 1ZHLA 2G5RA 1HSAB 1QQDA 5DA0B 3CFKA 1ZEAH 3FT3B 4RIRB 1S9KC 4IMKA 1K4DA 4HZLB 2RFXA 3ZE2E 2VDLH 3GMOB 1JGUL 4QYOA 4ZYKA 1SYVA 2J88L 3SE9L 4N9GB 4LDEB 4JFDD 1Z3GL 3P0VH 1TXKA 1G1CA 1FL3B 2A6JB 4JQVC 4PLJC 4JHAH 4DK3A 2XZAL 5CGYD 4CJ1A 3SY0B 4MXVF 1T5WB 1TCRB 3HB3C 3FOLB 1N0LA 3EFFB 1KLFA 1F58L 4U1HA 4YC2B 2AEWA 1DQTA 4WU5B 4OCXH 5C1MB 2DQGL 3TBTB 5CD5D 1G6RB 5L6YL 2YRZA 1N2RB 2G75B 4LLAA 3KNBB 1KTLB 3S4SB 1GIGL 3LHPL 2GJ6A 3I3BA 4P2RD 1WWAX 2FH8A 3QDHA 4K8RD 2ADJB 4M1CC 1EO5A 3TCXA 5B8CA 3KLSA 4LHJB 3FQTB 3T2QA 2AXFA 3MPCA 5ADOL 5J6HB 4JE4B 3WNLA 4OUUB 3R0NA 2E27L 3DUUB 1MCIA 5HHVL 4FQLL 1QLRA 1UJTA 3RY6A 1P7KA 1OARL 5D7SH 1Y6NR 3AS1A 2DQCH 2I9TB 4YFLF 5E1AB 3P30H 3GIZL 3V0WH 4HIHB 3H7BB 3MTRA 3CVHA 3LH2L 4NBZB 1A7NH 1PAMA 3HMXA 5MI0B 4UMGA 2ZCLH 4HGWA 5C0AD 2CMRH 3CFJB 2R2EB 5IOPB 2R39A 4XCFH 1MI5E 4OLZH 1MUJB 3T4AA 4NQVA 3MODL 4P2RA 4ELMA 1QR4A 5ITBH 2FSEB 3PNWA 3LEYH 3PHOA 3B9KD 3E3QE 2NX5E 1N59A 1D6EA 4PRHA 5DK2B 1NFIA 4Y1AB 5I2IA 3BQUD 3VFMB 2RR3A 3O2VH 5EIQA 2F8VA 3WIFA 1MCKA 1JRHH 4DGIH 2VDQH 4PFEA 4ODVH 4LSPH 1D3CA 3VDBA 4RGNE 4CN4A 5I1DB 3QUXC 5DD5L 4PJEF 1Z0MA 5IBLC 3HCVB 2AEIT 2ZUVA 4QHKJ 1XR8A 3U0TB 2QHRL 3LN9A 3FONB 1KN2L 3V6FB 2YSSB 3KYNB 1FYTE 1D5XA 5IVNA 1KULA 1IGIL 5HHNB 2X4OB 4BQCA 4JZJA 5ISZB 3OPZL 4ONFL 1AO7D 4YX2L 1X9QA 1YNLL 3B5GA 1KB5B 5JW5B 2A83A 5D5MF 4KROD 4Z76A 4NKOA 1RK0A 5IW3A 4YE4L 3BQUA 4X8XA 2PW1A 4K23H 4YBHA 3IU4L 3PDOB 4NQDE 3DMMB 2X6MA 1XZ0A 4K94H 5GIRA 4XP1H 3STZA 3RWHB 4N8CH 4GSDL 4YK4C 5TFSL 3BW9A 1TETL 3X12B 4FFZH 1NC2B 4QO1A 2Y36H 5HYJB 4MQ7B 1IGTA 4WHTB 1TPXC 4PTTA 2F8XC 4PGCB 4APQC 4XNZC 3LEXB 5CP3H 1FSKB 1C1EL 4KK6D 4LLVA 4PJFA 4YWGL 5B4MC 3VMPA 1TQBB 4S1RH 2RIKA 1AO7A 4Y88A 5CILH 5MHSD 3DWTA 1TVHA 4I3SL 4KTEL 4XCCL 4PUBL 2H26A 3TJHD 5TE6L 2VJXA 1KF9B 4OZIF 2AJYH 4R0LC 3FT4A 2EECA 1G0XA 2CR6A 4UT7L 5CJ5A 4PJEB 1RUKH 3KWWB 1RVFH 4UT9H 4HG4J 1YMMD 1TJIH 5EWIH 3A6CH 3K4DA 4TQEL 1TZIA 3QQ3B 5HD8D 1KNOA 1PFCA 2VH5H 2ZJSL 3NBNA 3VD4A 3CCHA 3TBSB 5EZOL 3Q6FB 3KVQA 3GHBH 1T5XA 3K3QA 2BVTA 3GJFK 4IS6A 5D5MB 1CTNA 3NFSH 1S7WB 1HI6A 2LFGA 2XKNB 3VXUD 1K3IA 2BNRB 1I8KA 1GH7A 3TPUA 4R7NB 4AEIL 3JVGC 2R4SL 2R0LL 1Q9LB 5B3JE 3FQXB 3HTLX 3MNZA 5MEPB 1MWAB 5DTFA 1A6ZA 3CPLA 1NGPL 3T3PF 2A0LD 1K2DB 5E2UH 5GZOC 5TDPA 2XPGA 4OBSA 1ZA3A 3O3BB 5GGRA 2Q3AA 3MXWH 1OSPL 3S9DB 1YMMA 1CXKA 1YY8B 3E8UL 2FZ3A 5DJDB 2V7HB 3MRLA 3DVFA 4RA0C 2FX7L 4ZXBC 1IVLA 1G7IA 1NC4D 2Y5TB 1Q94A 4OF5A 1EBAA 3EYQC 5A40E 4OKDA 3BUYA 3EDJA 4OZIB 4O5LL 3CZFB 5GZNC 1VFMA 3VXUA 5I1KL 3FCTA 4YBLC 1MCRA 2ZUQC 2P46B 3X13A 4S10A 3VXSD 3QEGH 4YHLH 43CAA 2OR7A 5B39B 1MI5D 5HGAA 2QKIA 3BISA 1KPVB 2X05A 5HDBE 1TJGH 5JIPA 3CVHH 5HGBB 4L5FH 1J1PH 1WEJL 3TZVB 5BCAA 1HK6A 4KRPD 3HMXH 1GC1L 3D0VA 3MV9A 3VFPA 3DXAD 1JNLL 3C08H 3SE4C 1EHAA 1FLRH 4EZMA 1NC4A 5JXED 3BJLA 4ONHA 4YHMH 5IJKA 3L3DA 1W0VB 1WFTA 4JDTL 1G9EA 3FN9A 4X5WB 3RY5A 3QR2A 1MHHA 4OCMC 2B2XH 2ENYA 4RGOL 4K3DL 4RGND 1VA9A 3DIFA 4P9HL 3CFBB 1MHEB 3VXSA 3U2SB 2FYYA 3RGVB 3LDBB 2M26A 3BDBA 3VRLF 2XWTB 2QADD 1MI5A 4ZTOL 5I17B 3FHAA 1YEEL 1XIWC 1OQOA 3HPLB 4GW1B 4G8GB 4MGXA 5B38A 3FQUB 4NKIL 3CDGB 3RVVD 1MJ7H 3VI4F 2WM0A 1FNAA 2V5RA 3DXAA 3IFLH 3DUHA 3FO1A 1P69B 5HHMB 5TJWK 1U93B 4ZFGH 5JXEA 3ROLB 1UC6A 1YNTA 2AJXH 2MMXA 5EZJB 2OZ4L 1FP5A 4N0CC 3D9AH 3MLXH 2DTSA 4PJGA 4NWTH 3CD4A 1SJVA 4NQDD 5F72S 5IIEA 1XCTA 2AJSL 5F9OH 4PRBB 4G5ZL 4QEGA 1EGJA 3ECBB 4KU1A 4JJ5A 1H9VA 6CGTA 3QJHA 2FJFA 3RWDA 3L1OL 4IEFB 4KZEH 2ICES 4FQ1L 4O2FB 1ZHKB 1RMFH 3ES6A 1F4YL 4JY6B 2VYRE 3MLSL 2W0FB 2X4NA 1HINL 2Q6WA 2ZNWA 5CZXD 3OKYA 5DJ6B 1I1FB 2A77H 1PEWA 3TV3L 1LO3H 2Q7NA 3GSWB 1IC5L 4TUOB 4OD1H 1NAKH 4NQDA 1UM5L 1NUGA 4LSVH 1CDBA 2AJUL 4OD3H 5EOCL 3NFPA 4RISL 5DDHA 1A4JA 4JKLA 4QHUA 5KG9B 1JPTL 3CX5J 4JM2A 3GSNA 4Y4HC 4M7KL 3ZSTA 1UG9A 2YZ1A 1I7UA 1N4XL 4R7DB 3UO1H 1CE1H 5LBSL 3IXTA 1K4CA 5DHVB 4NC0B 3EDDA 4TYUA 5EIVA 2Z31C 3FZUD 4Z8FH 1KJVB 2NY2D 4AM0A 5ID1B 4JPVL 5ALCL 2VTFA 3JTSA 4ZD3L 4RMTA 4P5KB 3LMJH 5DI8B 1XF4A 5EH1A 3MRNB 4XXCA 3TBWB 1DEEB 1R3HB 3ZYIA 4N1EA 3PL6C 4C4KO 1NCUA 2EDHA 4DOHE 1G6VK 3QDGE 1BEYH 1NBZB 4M5YH 1RULL 3U0WL 4EI5A 4NRYB 5IFJB 1R5IA 3EOBA 2YC1A 2BFVH 4M61B 4GQ9H 2AABL 4IOFD 3RWCB 4M1GL 5ETUA 1DBBH 3JWDC 4NO3A 4PLNC 3O6FC 4GMTH 1QLFA 4Q0XL 4XPHH 5E7FA 4X99A 5C7XL 4X7EC 1B90A 5DSCA 3IDXH 2NY3B 2WLZA 3RX7A 3X3GH 2PO6D 2LAGB 1SJEB 4R97C 5FO8B 5C9JB 4GRLB 2X4PB 3QP3A 1R3KB 3RQ3A 1X6NA 1ZV5A 3VFNA 5AYQA 3AGVA 3IAQA 1CFTB 3QCVH 2DBLH 5JHDB 3RPKA 4HWBL 3E2HC 3MJ7B 1UACL 5DHYB 1VEPA 5JNYB 5DQJB 2ZOLA 3FRUB 2EDTA 1CU4L 5HYQB 3SKOA 3EYVA 4XI5C 2CUHA 2HG5A 2D7TL 1NMBL 1EEUA 1S7UB 5ENWB 2D7PA 5JIKA 5E2TH 4J3TA 5BZWA 1OGAE 1I1AD 3S36L 4I5BA 5GISH 4NJ9H 5CZVL 4EQ2A 1FAKT 1H3UA 1J87A 4NGHL 5CBEA 1QFHA 3SPVB 4H0GA 5IQ7L 4YDVA 5EUKB 2PO6A 1LK2B 3VJ6B 4BUGA 1JZ8A 1ZHNB 2J7LA 3WNPA 2AV7B 3VGAC 5FOBA 4XBGA 5BV7C 2FX9L 2ZUYA 3LRSA 4FOMA 3CJJA 3WO3B 4XPGH 3BRDA 5INCB 2R8SH 5GGSB 1TJHL 4WHYG 3HNVH 4S1SH 5E8NA 4GT7A 1EUUA 5J56B 2XA8H 4PJBF 4LCIL 2FEDC 1UM6H 3OL2A 3DSFH 2N4IA 3KJ6L 2NR6C 3BZDA 4O51B 1V3LA 2IADB 3EDKA 3RNKB 4MNQB 1YEKL 5EZLB 4YUEL 5DEFB 1UM4L 2A6KA 2W0PA 3MRPB 3ARFC 5F88A 4JVUA 5TDNB 1NGZA 3MRHB 2YWZA 5I6XC 3B5HA 3O6ML 1U3HC 2CGRH 1L4IA 1HKLL 3WHE0 2V5TA 5D1QD 1J1OL 2VDLL 4TSAH 3T0EC 5E9DE 2Y6SD 2H8PA 1NMCC 5EO1A 4NKDB 5C0GA 1A2YA 4OTXH 3VXNB 3P0VL 2HA1A 1TZHA 4YFLI 5D1ZC 5KW9L 3UBXG 1EGJH 2FEEL 2IH3A 1FJ1B 4YHPA 1CDHA 4OCXL 3RU8L 3KYOB 4ZNEA 1TVBB 4ISVA 1YEFL 3MRGA 1XGPA 3QCUH 1IGYA 4FZEL 4LASL 2X1OA 1MFCH 2FIRT 1OWWA 4P57A 5JMOC 3ZKXC 2D4DA 3GSQB 4LPCA 3PP3H 3UC0L 5LGJA 5D1QA 5DXWA 3JBG7 4PJ7E 4KKLD 2UZIL 2VITB 4DZ8A 4PJBB 3HE7B 1UGNA 3CXDH 3ARQA 4E0RA 5FYLE 4J1UA 3P30L 2P7TA 1IT9H 3V0WL 4D0DA 3TBVB 2H6PA 2O5ZL 4XPTH 3BI9X 1A7NL 1JF1A 4PJCE 3PWNB 4PLJD 1BAFL 2ZCLL 3SO3C 3L7EA 2DAVA 4OLZL 1INEH 4NHUB 3MRIB 3IFNH 4JFZH 4QRQB 4LL9A 1MCFA 1MVUA 6FABH 4M6NH 5D7IE 1EXUA 4LQ1A 4DKFH 2V7NA 4XX1E 4Y0GA 3LEYL 5A1AA 1F6FB 4HWZA 3SKJH 4L8BA 4M93C 3QXDA 4M1CD 4FTVA 5JR1H 4IOIB 3B5TA 4JFPB 5I9QC 4BA8A 1F6LL 1B88A 3CSPA 4X5XA 2FNBA 1D6VH 5HGHB 1JRHL 3T3MF 5A2JH 5CIPB 3LKQA 3ZL4H 4MJ2A 4UI2A 1BF2A 2AEQH 4OM0H 4WHYH 2J8HA 3AREB 3IDIB 1BVZA 3CSYA 3F12B 2AI0H 3BGFC 3H9SA 4JQVA 4Q2ZB 3D69A 5HI3D 4ZOEA 1BVLB 5I8CA 4CMMB 4YXHH 3C60C 1NEZB 3MUHL 3VG9B 4P4KB 5TQ2H 1G7QA 2CLZB 2FLRT 1N5YH 4X5LA 1X5LA 3ARWA 3IRPX 4NDMA 1VHPA 4V1DA 1DLFH 1EA9C 4XPBH 3JV6A 2BNUA 4HIEA 4OQ1A 3V4UH 4ELKB 2WV3A 1OTSC 1B0RA 1YJDC 4OGXH 3C8KB 3PIQB 1OGAD 1HXMB 3OMZA 2C3VA 5D6CB 4KUZL 3MCKA 4CMHC 4K23L 5I1AA 1G7PA 1ODAA 1PKQE 3RUGE 4K94L 2XWBB 2HFFB 3TT3H 3VGEA 2ICEA 4XP1L 3MGTA 4N8CL 2Y36L 3MV7E 4MAYB 3V5DA 2P45B 3GMPA 5CINH 4M7ZB 5DVNA 3UZVB 4YGVB 1KTRL 2IQAB 2BZDA 1EVTC 4BQBA 1CD1B 4N0FB 3QUXD 4KZEL 5IBLD 2GY5A 3CLFL 3WS6C 5IMKA 4DFIA 4KMTL 4E42B 1RZJL 2NY4D 4X6DE 4OV5B 1FV1A 4P4RA 5C09A 3RZCB 1RD6A 4ODTH 4JVPA 2AJYL 1YYMH 3BZFB 1U8JA 4Q6IB 2GYSA 1OGAA 1RUKL 1V5JA 5I0DA 1CD9B 1RVFL 3NPSB 4UT9L 1FVDA 1K8DB 4L8DA 5D7KE 1CLZL 4CVXB 1X5ZA 1PZ5A 3A6CL 5EWIL 2PW2B 5GRJH 1MCCA 4GW5A 2PTTA 5F96H 3KPRE 4HX1B 4AJ0A 3ZE0E 3UYPA 2ZZUT 4RFEA 1DSFH 3MRBB 4Q58C 4OGAD 5E9DD 1R6VA 3ZKSD 1ITCA 1FL5A 3GHBL 4C55A 3U4AA 2F5BH 2V2TB 4ONOA 1H3VA 3MV8E 5F7LB 3L9RB 1IJ9A 3KPNB 5EORH 2IAMC 5F9DC 3HPJA 3MLTA 4FRWA 4PY8I 3PGFH 4JREC 5J11C 1A22B 4ZTPH 2ZOKB 4APQD 4U1IB 4CUCA 4H1LA 4OV6F 1FFPB 5B4MD 4FFWC 3WL9A 3KHOA 1IEBA 2VXQH 1JWUA 4P46C 3IJHB 5FCUL 1IC7H 4TUJA 2R2BB 3O6LH 4RDQG 1EAPB 2EO9A 3HNSH 4YDLB 3MXWL 2ZKHL 3MRJB 2XYCA 2IG2H 3O3UN 3HG1E 2MQ3A 3F65A 4HIXH 5FDWA 4N1CA 3WCYA 3RX8A 3HS0B 4BJLA 5FYLD 2F54A 2P43B 3ULUC 3NOIA 3CU7A 4IDJH 3SDCA 3QI9C 2P5WB 1XF5B 4IRJC 4ZSOE 2R2HB 4U0RB 3W0WE 3ZTJH 3O3AB 2I27N 1DZBA 1A6PA 4JCMA 3QEQA 1P2CB 4MJIA 5GZOD 1CICC 5D96B 5J9PA 3ESVF 1G7HB 1FLRL 3QQ4B 3RTQC 2E8YA 3IFPB 4K8RL 5C08E 5JDSB 5T1MB 4F7MA 3L7FB 3U36A 5E4IA 1N5AA 3RA7H 5IJVB 4YBQC 1CFSB 3C6LD 4HUWB 4PS4L 4ZXBD 5ABDE 2B2XL 2NZIA 1FIEA 1VPOL 1KC5H 4U05A 1TLKA 4OZ4B 2DQDH 3PHSA 4DCQA 1ZHLB 3SKMA 1QQDB 4YDIH 3CFKB 1SBSH 3Q0HA 3OKDA 1GPOH 1K4DB 1CI5A 2BY0A 4X0KA 3SDAA 2F74A 2RFXB 3DOSA 4AG4L 1DUYA 4Z0BH 5EULV 4M1DH 3RVWC 4ELMF 1QA9A 4QYOB 2DQJH 4ZYKB 1SYVB 3O11A 2P48B 4U7SA 1TQCB 2VXTH 4ZNCD 4PRPE 2AJXL 3BPNB 4U1HB 2DLEA 3MLXL 2X5PA 2XKUA 1S5HA 3OG6B 3C6LA 4HULB 3PABA 4LHUD 5F9OL 2R0WL 1MFBL 3HI1A 4GQPH 1MRFH 1NAML 3RVUC 5F93C 2QEJA 5DHXB 5DUMH 3UZQA 3CSBA 3MV7D 2GJ6B 3EYFA 1JZ4A 1CFVL 5B8CB 2VKXA 2CK0L 5I74B 1DBJH 4PRAA 4WEBH 2AXFB 3EJJX 1N0XL 3WN5C 2OP4L 5KVMC 4FN0A 3S35X 3DRQA 1QLRB 1OLLA 1RMFL 1P7KB 2XG4A 4MJ4A 5GGTA 5L2KE 4ZMAT 1XIWD 3IF1A 2DYPD 4KVNH 4D0CA 2CLRA 2FR4A 2ZUUA 1HQ4A 2DLFL 2EICA 4W68A 5DD6A 5D7KD 3CVHB 5BVPH 3ZDZF 1NAKL 5J13C 1ZWIA 4HGWB 4LHUA 4LSVL 3D2UD 4HQQH 1WUNT 2BSSA 4OAWA 4BSWA 4OD3L 4FQJH 1DUZA 2Q3ZA 4XX1G 3T4AB 5L0QB 4NQVB 4ELMB 4P2RB 2E6JA 5IV2A 3KG5A 4KRLB 3QUMA 3PNWB 4KRMB 3MV8D 3T09A 4M6MH 1CE1L 3PHOB 1EEZA 3PP4L 1N59B 1D6EB 1NFIB 4OCLC 3T0EE 3VD3A 4I18A 4Z8FL 5I2IB 5J7CC 2NQCA 2HYMA 4PJFF 4M03A 1DFBL 1XIWA 5EBWA 3WIFB 1G9ML 2DYPA 2EDJA 5C0EA 3QQ9C 1Z9SA 5HYSA 3WNOA 3PF2A 3SGJC 3DX9A 2C3XA 2NYYD 1BEYL 2E9WA 3C2AH 4CVZB 4H1LH 4KI5C 2XICA 1XR8B 2BFVL 1JYNA 4JGMA 1D5XB 5CSGA 3DTXA 1DBBL 4X6CE 3RBSA 4K9EC 4JZJB 3DROB 4NUJA 5EOQH 4Z7UF 3MV8A 1U8LA 4WY7H 3IDXL 2A83B 4HV8A 4Z76B 1BFOA 1QG3A 3X3GL 4PJ8C 4NKOB 1RK0B 3CFIC 2YA0A 3MLPA 3W0WD 3BQUB 4Y4HD 1OAYH 1BQHG 5C8JA 5LWYH 1A9BA 1Y6KR 3V6OA 1NSNH 2FD6H 2AQ3A 1I4FB 1XZ0B 5GIRB 3K74B 1KCRH 3STZB 5ALBH 3BW9B 3ARXA 1IGTB 1U8OA 2VZ3A 1MCSA 4OFYD 5IGXH 1URLA 3PL6D 4PTTB 2IALA 3AS2A 5E2TL 3C6SA 3ROOA 4EOWL 5C08D 4MQTB 4PJFB 4LLVB 3W9DA 4XC3H 3QFDA 1FO0L 4NJ9L 1AO7B 1R5WA 1TVHB 2MCG1 4MA1B 1A7RH 2H26B 2RB8A 4KROB 3K46A 2UZXB 3O6FD 3RBGA 3L3OA 3FT4B 1QD0A 4ZSOA 5FYLH 1ZLVH 2H2SC 4XPFH 4Y4HA 5JHLH 5MEOA 4MQSB 5DVOA 4JDVA 4ESKA 1XEDA 4FQXC 1BZ9A 3K81A 1TZIB 4XPGL 2XACC 1KNOB 3B43A 3GNMH 3WJJC 1QFWM 5DZOA 3OKEA 3EOAA 3ISWA 4S1SL 1IFHH 3CCHB 4GBXC 4Z7UB 1T5XB 3OAZK 3LIZH 4M6OH 3NCJL 3DSFL 2YK1H 2X2YA 4IS6B 1FBIH 2A9ML 1J8HE 2R1XA 2QLVB 4JKWA 1HI6B 1MIML 2EE2A 5GS3A 4XI5D 1I8KB 4PD4K 3TPUB 3ZKNC 4EN3D 4C54A 1MJUH 3MNZB 1I3VA 1I75A 4PP2A 1A6ZB 2VR5A 3R4DA 2Q8BH 5TDPB 2XPGB 1MRCL 1ZA3B 4TSAL 4JHBA 5GGRB 2FL5A 3BP6A 3BD3A 3R06A 2NY7H 1YMMB 3N1QC 4OTXL 2D03L 2AK1H 2FZ3B 3EYUL 3MOBH 4WI8A 3QDME 3H8NA 3S35H 3U46A 4HK3J 3ZHKA 3SHSA 1U2CA 5C0BE 3H0TA 3MRLB 1EGJL 4NN6C 1EFXA 1G7IB 4YHIA 3K2UH 2QR0A 3FB8A 1BZQK 1Q94B 4KH2A 1JZ7A 4QOKE 5HXMA 3O8XD 3BUYB 3SKUD 5EIIA 1JZ3A 5FXCH 3VXUB 1RZ7H 3FCTB 1CS6A 3MXVH 1MFCL 1X5YA 3X13B 5E8EB 4EN3A 3ZT7A 2FEDD 5GRXG 5EN2A 3MYZA 2NR6D 5GGTH 43CAB 4XNXH 1CGSH 3OJVC 4MYWB 2QKIB 5HGAB 4PJGF 4FQ2H 4KPHH 1X5AA 5IFHL 4I13B 5I8KL 2XXCB 3ARFD 3CXDL 4NQXA 1KB9J 2B4CH 1U3HD 5DT1H 3D0VB 2FECL 3MV9B 3VFPB 1IT9L 4U3CA 4K07A 1IL1A 2BNQE 4KJWC 3T0ED 5I1JH 4GXVH 1YECH 4OLVH 3INUH 1NC4B 3ARGD 4Z95H 4ONHB 2Z92A 1CR9L 2BVPA 3L3DB 4Z9KB 1KIQA 3QUMH 4Y5YA 1AHWA 2F5AH 3O8XA 1QLEH 3TVMC 2LU7A 2B1AH 1INEL 1MHHB 3IFNL 3P9WB 3DIFB 3VXSB 3MA7A 6FABL 4YGAB 4M6NL 1A64A 1MCOH 3T2PA 1HHGA 1VKXA 4DKFL 7CGTA 1MI5B 3QXTA 3AB0B 3LPWA 5F6IC 4OBRA 5JR1L 1RZ8A 2HLAA 3FFDA 4KTYA 5B38B 3MLYH 4KRPB 3IDUA 1JRHI 1D6VL 2HLFD 3LV3A 3DXAB 3ZL4L 3FO1B 3V8CA 2AEQL 4OM0L 4WI3A 3ARGA 1YNTB 3ULUE 5HGDA 4UIMA 1BFVL 2AI0L 2PN5A 5LXGH 4PJGB 2GIYA 4YXHL 3SE3A 2GUOA 1IARB 5IIEB 4F2MA 1XCTB 5TQ2L 4RGNB 4P59H 2GTZA 2BY3A 2ZWLT 4JQIH 5JW4N 2CH8A 3HMWL 1DLFL 4XPBL 4ODSH 4JJ5B 2C3HA 2QADB 3QJHB 4X9BA 2FJFB 4GXUN 3ARTA 3RWDB 4OGXL 1JTTA 3RI5F 5B21A 1ZT4A 1HNFA 3CNKA 2NY5C 1QR1A 4YC2C 3EDEA 3ES6B 3HZMA 5HY9A 1WCQA 1ND0A 4JRYE 2X4NB 1BQUA 2ATKA 2Q6WB 4Y16D 5ITFA 3FHQA 4OCNC 3VD7A 3A6OA 4PD4J 2MHAA 1INDH 5JOPD 4NQDB 4M6AA 2JELH 4OZFG 1D5IH 5DD3H 4XVUC 1L7TH 3TFKD 3NFPB 5DDHB 1A4JB 2FX8H 4QHUB 5CCKH 3C60D 1J8HD 5EU5A 2Q8AL 4UQ3A 1I7UB 1YYML 3IXTB 2Y07H 1K4CB 5H8DA 5D70H 1WFNA 3QRFM 4AM0B 1E4KA 1IGFH 2VE6A 1YC7A 1DCLA 5GRJL 4L8CA 3JTSB 2FHFA 5MI0C 1XF4B 3VDCA 2PUQT 5T5NF 1DSFL 3GI9L 3SDXA 1RIHH 3C8DA 4Y16A 1CTOA 1LO2L 3MJGX 3M8OL 3E1F1 1G7JA 1CL7H 3GKZA 3MJ9L 1R5IB 3EOBB 3QDMD 2YC1B 5C0BD 5K33A 5EORL 5EUOE 5J3HC 5ETUB 1BF8A 3PGFL 1A14L 2K3TA 4NO3B 3C2SA 1RIUL 4U6XA 4LCCA 4QOKD 4WTZG 1QLFB 3UCRA 1J8HA 4X99B 1M6OA 4MX7A 2VXQL 4DUWA 5DSCB 1IC7L 2L7JA 3O6LL 3GMNA 3DI3B 1NCBH 2NY2B 2X44D 2GT9A 4OQTA 2KZWA 3VFNB 3PV7A 5L8LB 5HPOA 1P4IH 1DQMH 1FYHB 3R0MA 5KVFL 1OAUH 3JWOL 3MCLH 4NO0D 2HT2C 2ZOLB 3RVXC 3EJYC 5E1HB 2VLLA 2OXGA 3EYVB 3SKOB 5J89A 2GQHA 4IRZH 4IDJL 2HG5B 5T1DH 5F71A 2GCYA 2H1PL 5FM4A 5L2JA 4X7SL 4Y2DC 5C0BA 1RHFA 4PGBA 5BZWB 3EZ8A 4OSUH 4QOKA 4I5BB 4WHDA 2DQEH 1YC8A 1EPFA 1NANH 2IAMD 3LPGA 2ED8A 5CBEB 2CQVA 2X9WA 5F7DA 4YDVB 3L5XH 2PO6B 1S9YA 3D48R 4RSVA 3IU3A 2Y5EA 5HHXH 4FFWD 3EHBC 5FOBB 4P46D 3LRSB 2R0KH 4CGTA 3KPSE 3O3DA 3WJLA 3D3VE 4JFEE 3VFTA 2UVEA 4NO0A 1LWRA 3QWRD 4PIRF 1QVOA 2EKJA 1FSKC 5E8NB 3GI8L 3K8LA 4HW6A 4KI5E 2OL3L 4IRSA 2PTUA 1TQBC 1RZKC 2A1WH 3LN4B 3MLVH 5HYFA 2DQDL 1RZGA 3NCBB 1EHXA 2V17H 3ULUD 2MTPA 4AT6A 2A6KB 5F88B 1SBSL 4WW2C 1MH5A 1NGZB 5KAQG 1GPOL 2IAMA 2A6IA 3QI9D 5CGTA 3BO8A 4IRJD 4CKVX 3BN3B 2XQBL 4Z0BL 1INQA 4M1DL 1YNKH 2H8PB 4WU7A 4D9QE 1K3ZA 3IDYC 5EO1B 1GCFA 5C0GB 1A2YB 2BRRH 2X1QA 3R8QA 1TZHB 1JI2A 3U7YL 4Y19E 5SWSD 4LMQE 2IH3B 3L3KA 1CICD 4YHPB 3MLUL 5GGVL 4OCWH 1N7MH 3S3JA 4OLYL 4ISVB 1BJMA 3MRGB 4FS0A 4JRYD 1XGPB 4UBDC 3RTQD 1IGYB 3FFCE 1MRFL 5TF1H 3OKKA 5DUML 2NXYD 4TNVF 5D93C 1AH1A 4YBQD 1U8PA 1I8IA 4P57B 2OJZH 2CUMA 1DBJL 2CD0A 2YD8A 4WEBL 4LLUA 3FQWA 2ESVE 5LGJB 5D1QB 1A9EA 1CDGA 2DQHH 2H9GA 2WUCL 4MD5A 2P5ED 4ZO6A 2FB4H 4GG6E 1ACZA 1YEHH 5CEYA 1W72A 1IQDA 2YKLH 2IPUG 1KELL 4E0RB 3S96A 4J1UB 1IM9D 4O02H 1MRDL 1F3DJ 2P7TB 4KVNL 4EI6A 5I75B 5M94B 3QAZB 1UXWA 2BVUA 1ZANH 5SWSA 3RVWD 3OAYH 2H6PB 4F3FA 5BVPL 3BSZL 1J11A 4HUUA 1JF1B 1SQ2N 4HHAA 3L7EB 4FQIL 4QLRA 3RTQA 4HQQL 1LD9A 1DDHA 4FQJL 1T4KA 3PWPE 1BIHA 1QRNE 1MVUB 4LGRB 5I1HH 3TLRA 2IBGA 1EXUB 3TZVC 1S7RA 1JMXA 4I3RH 3W81A 2V7NB 3IETA 3VWJA 4XNYH 4HWZB 2P5EA 3QXDB 3ZZ1A 4FTVB 4G42A 3K1DA 2X41A 2WIMA 2NY0D 5IW1A 4LSTH 3IS0X 4L9LA 5JORA 4X5XB 3K0WA 1PGRB 5CUSH 4C57C 3LKQB 2JTDA 2BOBA 3W9EB 3SN6N 2KPNA 3X17A 1P84K 3LDBC 3CSYB 4OUOA 3H9SB 5I8CB 3D69B 5ERWA 4ZFZB 2EDLA 3QG7H 1D9KA 4MS8D 1G7QB 3NA9H 2YA1A 1QSEE 4OQTH 1MHPH 4NDMB 5D9SA 2LU4A 4V1DB 3NIDE 1YJDH 2XQYK 2ADGA 4WY7L 3JV6B 2BNUB 4HIEB 1PJ9A 4X4XA 5EUOA 2IPKA 5DVMA 1B0RB 3AAZA 1R24A 4W6XB 1C7SA 5DD1L 1OAYL 3SCMA 1QOKA 1S7QA 2C3VB 3U7WH 2ZSVA 3MCKB 2IQ9H 4HK3N 3BKMH 5I1AB 3GUTA 1G7PB 3UJIH 1ES0A 2ICEB 4U3XA 1KCRL 3MGTB 5ALBL 3V7MA 2AJZA 43C9A 3G04A 3QQ9D 3V5DB 3GMPB 3P77A 5IGXL 4KV5E 3D3VD 4JFED 1XF3A 1HKFA 4XC3L 3QUZD 2WZPD 5IMKB 2GFBA 5JXAH 1CXLA 2VC2H 1MF2H 3QQNA 1FV1B 4P4RB 5C09B 1A7RL 1U8JB 5FYLL 2EXWC 1OGAB 5JHLL 2APFA 2Z8RA 5CEZE 4D94A 1FVDB 3L5IA 4L8DB 1PZ5B 3BESR 5DUPH 2HTLD 4PJ8D 5CJXC 4GW5B 2IFFH 2PTTB 3C8HA 2HN7A 2X40A 4NQEE 3GNML 4RFEB 3ZDYF 3AU1A 1IFHL 1FL5B 2HMIC 1N3NA 4M6OL 4O58H 3ZYZA 4D3CL 1S9VA 2XXMB 3IXAA 1FBIL 2AW2A 4U1GB 3D3VA 3QUXB 2ORBH 3MLTB 3QUZA 1TCMA 1MJUL 4WGWB 5D8JL 4OF7A 5DGQA 2AAVA 2NY4B 4H1LB 4B5EA 3WL9B 1IEBB 1LE9A 1JWUB 3HZYA 4TUJB 3KDMA 4FG6C 1XCQA 1IRAY 5H94A 5ELIA 1KCSH 1F4XH 2C3GA 5CJ8A 5T33H 2CKNA 1WZ1H 4PJ8A 3S34H 2AK1L 3MOBL 3MREA 3S35L 2H2SD 1JWSA 5DD0L 1MCWM 5FDWB 7FABH 2PKDA 3ULUH 2MOVA 4R96A 3K2UL 4XPAL 2F54B 1WIUA 4FQXD 1BP3B 3SDCB 2YPKA 1RZ7L 2DJ4A 3MXVL 4GBXD 1UXSA 4YK4B 1WT5A 5EO0A 3QEHA 1W72H 2X7LA 2B39A 2JLLA 5IEKA 5HHPA 2C7UA 3MUY1 2EH8L 4XNXL 1CGSL 4APQB 3QH3A 4G6FD 3GJFA 4L4VE 1X4YA 1NKOA 5AAMA 3BPOB 4L3EA 4MJIB 4W6YB 3FN3A 4UTAH 5DT1L 4DAGL 2OS7A 3RI5K 4I0PD 4JKPH 4ZODA 5J9PB 4G8IA 5I1JL 3LZFH 1WIOA 1YECL 2I5YH 5IB1A 4Z95L 3BE1H 1JYXA 4S1DC 4P23C 3S5LA 4F7MB 3U36B 1MCBA 4RMSA 1AJ7H 3WFDH 2Z93A 1N5AB 3WJJA 3J7HA 1J86A 2B1AL 1NLBH 4GBXA 3RWGA 5E08H 1CLOL 2H2PC 1JNHA 4DCQB 5IW6A 3SKMB 4HKZA 4LPWA 1CE6A 4S1QL 1OY3B 3OKDB 4MXQC 3RFZC 3D85A 3RUGF 4X0KB 4Y2OA 3SDAB 1I9RH 1CDCA 3GEWB 4Y5VA 2F74B 4JG0H 1QSED 2IWGA 1DUYB 1OTTC 1AQDA 1QA9B 4I0PA 5GSRA 2ZNXA 4QNPE 4YXKL 4PJ5D 3QYCA 3O11B 1DEDA 1ZVSA 4QGTA 1TIUA 4XNUH 3WHXA 1KEMH 5ISZE 1LK3L 2APTA 2Z8SA 4OIAA 5LXGL 3QIBC 4KJWD 4X6DF 1S5HB 3C6LB 4ZXBB 4XNMA 3PABB 4HIIA 3QA3A 1T89C 3HI1B 3KYAA 4P59L 5LGKA 4X4YA 2XTJD 4WWKC 5C70A 4BFGA 4GAGL 4ODSL 5AYUH 3TVMD 4DVBA 3EYFB 3BPLB 1DQJA 32C2A 2AJVH 4YBLB 4PRAB 4J3OC 5DRZA 1B9ZA 4G9DA 3ZE0F 4KDVA 3ARDD 3WFBH 5DMYA 3S6CA 2XZCH 3DRQB 1HHJA 4DFHA 3S8WA 5HYJE 5MEQA