1RZIB

Crystal structure of human anti-hiv-1 gp120-reactive antibody 47e fab
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
229
structure length
216
Chain Sequence
QVQLLQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPVFGSANYAQKFQGRVTITADEATSTTYMELSSLRSEDTAVYFCAKGGHGMDVWGQGTTVTVASASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 47e light chain
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 216
sequence length 229
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rziB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rziB01
4GW1B 3K46A 1T5WA 3MLSL 2WIMA 1OGAE 3DMMB 2A83B 3NCJL 2FR4A 2P8PA 1AE6L 3GMPA 4NHUA 2VDKL 4OQTA 4RGNE 3KS0H 4U6XA 2VXUH 3ES6B 3L7FA 1UCBH 3O9WD 3EYUL 3QXAA 4HKXB 5SWZE 1Q9LB 2WZPD 4PGEB 1AQKL 3DRQB 1RU9L 4PLKC 1TITA 4E41E 3FO2B 4QGYA 2Y25A 2ADFL 2GJ6E 4L4TD 2XFXB 3GSNB 3OV6A 3MCKB 3CVHB 3CH1A 4Z0BL 3CXHK 3L3JB 1RULL 5ITBL 3A6BH 5KVFL 4L8DB 2R69L 3IF1B 4OZFG 2BY0A 2AJSL 3LN9A 4HBCL 4YDJA 4DK3A 1DN0B 2Q8AL 2D03H 1UWEH 2FZ3B 5I9QB 5GGQL 1G7PB 3BKJH 2VJXA 1BMGA 2X09A 3ZKMD 2VLMD 4JREB 1A6ZA 3B3IB 3FQNB 5T5FL 3SE9H 1I3UA 1T4KB 4HHAB 4K8RL 3V52L 3W11D 4DEPB 2X4QA 4HZLB 3G5XB 3OAYH 4ZAKC 3LSOA 5F1OB 2ZSVA 1IGFH 2W65A 1LK3L 3B5TA 3HNSH 4WFHD 3IXTB 3P73A 4LSRL 4JKWA 3TO2A 4GAJL 4HWBL 4YHML 4LLYB 1HH9B 1CT8A 1MHCA 4JO3L 5E00A 4U7KA 2NLJB 4OLUL 1EGJH 4FQPA 4U1HA 1FAIL 5EU7C 3D2UB 3UXFA 1GH7A 5DUBB 2CJUL 5HI4D 4Z5RB 3MLTA 1EJOL 1FH5L 5EU6D 4JM4L 3IVKA 3RWIA 4GOSA 3U4BH 1N6VA 3QDJB 2OTWB 4F9LC 2AW2A 4Y1AA 1JPFA 5BZWA 3VD4A 1P6AB 3MNVA 1ORQA 1N7MH 5EH1A 2V5SA 4LCWE 3WUWA 2BSSB 4QCIA 2DL9A 1R5VA 4H8WC 1YPZB 2WQ8A 4Y4FC 3P0YL 4TRPH 4OI8A 2MTPA 3O6LL 2FX7L 5EU6A 3TT3L 4L5FH 4MA7L 2K1MA 1RK1B 1K9TA 3GMRB 1T0NA 2X6MA 2AEQH 4Q7DA 4MB3A 1HXMB 3WDJA 2CIKA 3QUYA 5J8OA 1OAQH 3OR6A 1LNUA 2VLLB 3PGDB 3DXAA 3NVQA 1T1XB 4JFFE 4PYGA 5E94B 2Z8WC 5KSUA 4JKPL 2IPKA 1JGDA 3VXRA 4AIXA 3LRHA 4J4PC 3JWDH 4K23L 5LQBH 4PV9B 2EDDA 4FXGB 2VLKE 4U1MA 1CFNA 3PABB 4NN7B 3IDXL 2OBGA 2HTLC 4HXAH 4Y16D 1J0YA 1PG7W 2ENSA 3REVA 4TTGA 4HS6B 1DANU 4JO2L 4M4PA 4Y4KC 4IDJL 4S0SD 1DBKL 4RRPA 1RI8A 3OX8B 3ZDXE 4PJ9C 4J7RA 1RZGA 3PDDA 1YUHA 3C5JA 1M1SA 4F58H 1FG2B 4BZYA 3VJ6B 2QSTA 4HT1H 3LEXB 1Q0XH 1UWGH 3RL1B 2HLAB 2BRQA 4NQEB 2D7QA 2FRGP 1CD1B 2EYSA 4KKLD 5IVXE 5IROC 5C0GB 2V7HB 4RMVA 4RMTA 1UEMA 5HHOD 4FFYH 5L2KA 4KK6C 2R2HB 3T65B 2H9GB 4Z7VF 3NOIA 1KIRB 5AUMA 1DBBH 1OD7A 5IEKA 5CJQH 5IOPB 5CAYB 1T1WA 1LVEA 2BRRH 4MXQD 5JORA 4P49A 3DVNB 4W4OC 4ZUVA 3IXAB 1GSMA 5GS1C 1G7HB 2I60H 2AXHA 2DKUA 4N1CA 3FFDB 3D69A 5HYSB 3CDCA 5I1JH 4KRPB 2IFFL 1JPTL 2PYED 1M6OA 3ZE1E 3FQXA 4XNYL 5KW9L 4UU9A 5HI5D 4ESKA 2AV1A 3RDTA 3WKNA 3KNBB 3SPVB 1EFXD 3GSQA 4NCC1 4H1LH 2O61A 3L6FB 1K8DB 3IKCA 1NBZA 3PDOA 4ZOBA 5EZIH 1DBAH 1QBLH 4NZTH 2DKMA 5H2BB 5FDWA 3UTPE 3DSNA 3M1BB 3MTRA 4M7ZC 2IALB 1A2YA 2JELH 1J05B 4ZPTB 4QHUA 3S5LG 3CFIC 4KZEL 1EFXA 3H0TB 1BP3B 4YX2H 5JMOC 2AJUH 4N5EC 2W92A 1K2DA 3C8KB 2IAMD 5IF0A 1UJ3A 5D2LA 4MXWL 1P2CA 4Y2DD 3WKML 5IMMA 3K4AA 3SGKC 4DCQB 4RGMC 4FFWC 3BD5A 3SDCD 3C60B 1I1YB 2AK4B 2OCFD 4P3CH 5FIEA 1OTSC 1FBIH 3OXRB 4KTEH 1FNGB 1IAKB 1G9MH 4P23D 2P8LB 5IG7B 2IAMA 3EO0B 5KN5A 1MLCA 2JCCF 5GSVA 1RZIA 3TV3H 2C1PB 1BM3L 3OKMA 1IM9B 2FJHB 3GSWB 3SDDA 3GSOB 2R0LH 2Q7YB 5D7IE 4FTVA 4OJFL 1FFRA 1ZVHA 1UACH 3ULUL 4JM2F 4LLVB 4Q6IA 1H5BC 4JKLA 4ETQA 1V7NL 1P5UA 3V7MA 1A0QH 1BZ9B 4M6ML 2OL3B 3UPRA 2PW1B 4P57B 4QKXB 3QHFH 2EDOA 4NO2A 3WEXB 2WWMD 3H3KA 3WXWH 4UQ2A 3V4UH 1FLRL 3U0TA 4XBEH 1PYWB 4CADA 3DO3A 4LQFH 1ZXQA 4NKDB 4EI5D 2DJSA 3UBXB 3F7YB 2VABB 3BQUD 1RHHB 3O3AA 5GGTL 1E6OH 4D0DB 4ONHB 3SJVB 3U1SH 3L3DA 3C5ZB 3VCLB 1JHKH 1OW0A 4YBHA 4PJCE 3VXMD 1B0GB 5CS7A 2BNQA 3O2VL 2XQBL 2ZUSA 3O2DH 2EICA 1J8KA 4ISVB 1MY7A 1A1NA 3KJ4B 3VFMA 3O0RL 1A14L 1AGFA 4IRZH 1OB1A 1P53A 4QF1A 3TPUB 5EOCJ 3RZCD 3DIFB 3VGAB 4HULB 2OMBA 1NAML 1MFCH 4KXZH 1NLDL 5EIIB 5F1KC 3PWUB 2E5EA 2VXVH 5IB4B 2W60B 3WIHH 3EYQC 4GRWE 2NNAB 2B4CL 5FGRA 1PQZB 1XGRB 4HJGB 4NJ9H 4NYLB 2BERA 1I1AD 4HUUB 4E5XB 4HKBB 3RU8L 3B9VA 4XH2A 4FXLA 5E2TL 2DQCH 3N1MC 3NCEB 1WZMA 1YMME 3RWDA 5HGAB 4MQ7B 4WIQA 1QZ1A 4H1LG 2VDOH 3BJLA 2ESVD 1BBJA 1TJIH 2A9NH 5GGVY 2CKBA 1GPOL 4ZUWA 3V6FB 5CGYC 5GHWH 3O4LE 1FN4A 5C0FB 1OAZL 4G8FA 3QT2A 3V7AG 4HC1L 1FNEA 2OSLB 3FQTB 2YWYA 4Z7VA 1KEGL 1NC2D 4LDEB 5IFAH 4PJIB 4U1GC 2FSEB 2JB6A 3K74B 4XRCA 1MJUL 4UV4L 1UB6B 1YN6A 5BRZE 3BZEB 5FYJU 1EBAA 1A7NL 1IM3B 4F80A 5IV2A 5KSAB 1OF2A 4PLJC 1L7IL 5DTFB 1VEPA 4JFXB 3HZKB 4HUMB 4TVPL 5T3ZE 1I3RA 1MREL 1C12B 3L5IA 4ZS6D 4JCLA 1B4JH 1CBVH 4U6HB 3AXLB 1MIML 3FHAA 4NO0D 1YDPA 2CDGB 4X83A 3U0PA 1C8PA 5LGHL 5F8RC 1UXWB 5C0IA 2EDNA 1IAIM 5F7UA 1TZHB 1N59A 1RZKL 3BEWA 4S1QL 4U0RB 4WI7A 3SKNB 5ITFB 3V4VL 2X4SA 3T0XA 1OOAA 1IT9L 4L9LA 3EFFB 4NO0A 5HHPA 1A6TB 5IW1A 1KPUB 1ZGLA 2V7NB 4GAGH 2DDQL 3WIIL 1H0DB 1YJDL 32C2B 1YYML 4DN3H 4OZIF 5D5MB 1JBJA 2QV2A 2GUOA 1KEMH 2J7LA 2FGWL 4WGVB 1H3PH 4IHOB 2AGJH 3S35H 2VZOA 2VIRB 4YHZL 5EC2B 3PJSA 4OD3L 3CPLB 4QNPF 1DLHB 1NGQH 5MENB 1IFHH 3T4AB 2QQQA 5HJ3A 3ARDC 1BQHA 5IFJB 2F74B 3L3GA 2A1WL 5KSBF 1WWAX 3ROOB 2VDNL 4ZD3L 4HJ0C 1II4E 3EW3B 4M8VA 3T04D 5AAMA 4OB5L 1WIPA 1TCMA 4URTB 3L5JA 2RFXB 2ICWA 5JW5A 4FZEL 2FX9L 3KYNA 3U6RA 4BQ6A 4JM2D 4NCC2 3FKUS 4J3OC 3JV6B 4KHTL 2EO9A 2JCCA 3KXFD 5AZ2H 2FJGB 1C5BL 2GW5A 2HMID 3BN9D 1MVUB 4NRYA 3GJEB 3SDAC 2LU3A 1N3NA 1QFWL 2WSKA 3DUSA 3TWCL 3VXSB 4XZUB 3BKMH 3TBTA 3S4SB 1WV7T 4K9EH 3P30H 3KPSD 2FEDC 5FO9A 1MWAH 4RX4D 1IKFH 1ZTXH 2VDML 2G75B 3OHXA 3JUYA 5DD6A 5J1SC 3LAFA 1U8QA 4XXDA 3VFWA 2ZWLT 1GC1C 3KYMA 1U8OA 5E4EC 4NQCD 1Q9WA 1N64L 4WWKB 5EBWB 4XVUD 4JO1L 4G9DB 3BWAB 1INQA 2EYTB 5T33H 1XGYL 3MLXL 3VWKB 2FH8A 1NKOA 5CD5C 1WAAF 1X7QB 1KBGL 3KPSA 2H2PC 4R4FL 3LS4L 2FX8H 5J89A 2AJVH 3QQ3A 2BCKB 1DCLA 4XP6L 5IHZB 1OLLA 2JJSA 4NQCA 4LARL 1KT2B 4PREA 3RX5A 1KGCE 1QO3A 2G2RB 5HYJA 3H7LA 2I07A 5GGRB 1RVFH 4A6YL 1NLBL 2FL5B 5CEZD 5JNYB 1A6UL 4NWUH 4HWUA 5E8DH 4JR9L 4ELMF 4B41A 1Q1JL 4MA1C 5IVZA 1FYTD 5FKAA 3LPFA 1XH3A 1JNNL 1CXFA 1FL3A 5GSRB 4ZO7A 5AYUH 3BGMA 4GMSH 4G9FE 2HKHH 4H25A 2HJKA 2WANA 3PQYE 4ZAKB 1D9KC 1OM3L 4P2QA 1A6AB 2NXYC 3BRDA 1ZT1A 5DYOB 5HVHB 5JIPA 3F12A 4WTWA 5J11B 2BFVH 1RUAH 4PJEF 2P8MA 3FO9B 1VGEL 3JVGC 4LSSH 1LEIB 4P9HC 4PR5A 4TUOA 1WBXB 4P9ML 2C3VA 1MAJA 1VPOL 1UM6H 2B1AH 3VG0H 1YEKL 1IEAA 4ODTL 4MJ6B 5IBTH 2B8OT 2XG4A 4X6CA 2ZUTA 3EYFB 2P5EA 5CINH 4HH9B 1IC4H 2A77H 5I8EB 4PJGF 4DOHE 5FF6A 1V7ML 2C3HA 3GSXA 1AR1D 4OT1H 4TVSa 3R8QA 3B9KA 3WMSA 5IQ9A 5GRUH 4PGCB 5GZOC 2RCSL 4Y4FB 3BHBB 4UNTA 3CSGA 3MRKB 4JPKH 1IGFL 4X4MA 5LXGL 2GCYA 3JSSA 3AREC 4BZ2H 1BVKB 1BPVA 2WMPA 4BFGA 1C16A 1E27B 1H3WM 3HE6B 4WTZG 3OB8A 3GI9H 5ELIA 4YNYA 2AEPH 1M7IA 2XWJA 3EJZD 5E6IC 1U8KB 5DC4B 1KG0A 2ERJC 1QP1A 4X8XA 2Q86B 1P4BL 3FFCA 1ZA6A 4WEBH 5D7JA 3VGHA 3UTTE 4Z18A 4PLNC 1S7QA 3WDIA 5F89A 1N7ML 4AQOA 3K8MA 2R9HC 1ONQA 1OTUD 1K5NB 3PL6C 2BC4B 3B9DA 1RIHH 4OZIA 4P5TD 1QSFB 4XGZA 4LEOB 3GRWH 4PBVC 1J8HB 1C5CH 4RZCA 3ARQA 1EHXA 2W1NA 4PJXE 5ESAB 1I9RH 3TCLA 1CFSB 2DYPB 1AXSB 3BKCL 4ZTOL 4CVZA 4X4ZA 5TDNA 4OM1H 5KVEL 3RQ3A 1YN7A 3BO8A 3KPPB 3N50A 5L8JB 3RWGA 5C09D 5INCA 3RHWK 4OLXH 2QL1A 3NCYP 4CRPA 1FP5A 1S7UA 2O5ZH 1MFBH 1U8LB 3NAAH 4JE4B 4CMHC 4LLAA 3RWFA 3P0VL 4BH8B 3EO9L 1IQDA 1MVFA 4W6XB 3IFOB 2DQTH 3JWDL 3RIAF 3G6DL 1LDPH 4P2RA 3OB0K 3GEWB 4OTXL 2RIKA 5C0AE 4GKOA 1JHTA 4PP1D 5C09A 3QHTC 4OSUL 1HKLL 4N9OB 3JTTA 4XTRC 1T0MA 1KJ2B 1ZHLB 4M62L 3VRIB 3HAEB 3MREA 4QRSA 1ZLUH 4XCFH 5GS1B 4JFDE 3MRGB 2H6PA 2GSGB 5CSZB 5HHQB 5TQ0H 4UMGA 4K94H 4QRTA 4BJLA 3WD5H 4PJDE 3PHOB 5D93B 4ZFFB 5I76A 4QHNA 3PXHA 4YE4H 1BOGA 1B3JA 4KMQA 1N26A 2B5IC 4X6DB 1UWGL 3BVNA 4RA3A 1I7TA 2FWOA 1OP5K 2R2BA 1RURH 1KJVB 4KC3B 3TH2T 5FM5O 2ITCB 2VSDA 1WAAA 4JZNA 2NY4D 3T0EA 4ENEC 2APTA 3Q5YA 2O26U 1M05A 1BIIA 1WSST 2EKSB 5E2VH 4XP1L 4IBLT 3BIBX 5E9DB 3T8XA 4M7ZB 5C7XL 2DWEB 4XXCA 3O6FD 2XTJD 3DRTA 1CXIA 1Z5LB 4LLQA 1OAKL 4F8TA 4XT1C 5I75B 1G6VK 2VWEC 1OD9A 4P2OD 3KYAA 4HJJH 2B1HL 5T1KB 4PPTA 3ZTNH 1NBQA 2VL5A 4HLZH 1MCNA 3PWVA 2V5MA 4M02A 1MCRA 1A4KA 3S7GA 1QLFB 4NWTH 2O5YH 5I1JL 5GS2H 3W9EA 4RGMB 2VERN 4MCYA 1HN1A 3QRGL 5CIPB 4HWBA 3O6FA 5E8EB 5FA4A 5KVGL 5GS0D 4NN6C 3GB7A 1L9NA 2KBGA 3TO4A 1X5AA 4J2XA 5IBUB 4P2OA 2LAAA 4JAMA 3FQUA 1FYHB 1NDMB 3IDUA 3WS3B 1J5OL 3W39B 1DUZB 3GJFA 4JQVA 5EC1B 2Q8BH 3BE1L 3P9LB 1NCBH 3VE0B 1JWUB 5ABDE 4PJEA 2X4PB 3HFMH 5DK0B 4Y8DC 1BF2A 4X5LA 3FO0H 1AP2B 5B21A 1KTRL 2P5WA 3U36B 2APFA 2AJUL 1KB5H 3UYRH 4JJ5B 5F3HB 3DX8A 4DVBB 1H5BB 3BYYA 3MBXH 2B0SL 25C8L 3B9AA 3C2AH 3PNWA 1A1MA 1T66D 3P11L 1PG7X 4I13B 4RWHA 4Q58C 4GMTH 3UZQA 3BRFA 1Q0YL 4CDGC 3WL9B 1CZ8L 1A6WH 4J23A 1LK2B 1G9EA 2OTPA 4ORGA 3N9GL 4KTEL 3IDGB 3IDIB 4LMQI 2NX5D 2VXQL 4AK1A 1RUPL 5DHVB 4LVEA 4OM0H 3MRCA 3OF6D 4Z7OE 4EKXA 2EO1A 2FHFA 4I2XA 3QAZC 1JGEB 4JPIB 1AQDB 4FQIH 4HF5H 4P3WA 5T3XD 5J56B 3QIWC 4HX1A 1HHKB 3QZWG 1YNLL 3CX5J 3T3ME 2FJFB 1AD9A 2X4UB 5DK2B 1AY1L 5EZJB 4AEEA 4Z77A 5E8NA 4LSUH 4RNRA 3QUXC 1UM5L 2VITA 2CRMA 3JXAA 2HRPL 3O8XB 2F9BT 2APVA 1NCAH 1AXIB 2H26B 1VGKB 4JGMA 4XNUH 4G42B 2VLJA 4KGLA 2VXTL 4MA3B 1QR1B 3CX2A 2VQUA 4WHYH 5HGHB 3GMQA 4RFEA 4U1JB 4IM8A 1JF5A 4WW1A 3PV6A 3LQMA 4W81A 3U1SL 2NY2C 2QTEA 3QNXA 4G3YH 1EMTL 5F9WC 4PLOB 2XNAB 2PW2A 2L7JA 1FDLL 3LKOA 5AEAA 2WUBH 3LY6A 5IR1A 3IAQA 5F7NC 2P42B 3GMNA 4UBDC 1SJHA 4IRZL 3LN5B 4J6RL 4FABL 2C4FT 4GRLD 4J8RA 2VLME 1YPZF 4H5SA 4M5ZH 1OSZB 4PV8B 5GPRA 2MKWA 4Q2ZB 1REIA 1F11B 4HLZG 4Z7NF 5EO9A 1FNSH 3VFPB 1O7VA 5JHLH 3STLB 4K7PH 5FUZH 4GRWH 4Y1AE 3JV4B 5E95B 5C0CD 3X13A 3D85B 3K4ZA 5EUKB 5GISH 4WFHE 2FECI 4B5EA 2Y36H 4H8WL 3HCVA 3TA3D 4WHTB 4ZFOB 1MHPH 4BH7B 1QSVA 4KI5F 4EXKA 1BIHA 3S88H 1K4CB 3ET9F 3OKKB 4RAHA 5JDJA 2QR0A 4YWGL 4AT6B 2DQHH 4AM0A 5H35B 1UZ8A 4TOYH 1ZLWH 4LHUD 3TT1H 1JI1A 1U95B 5EFIB 3BWUC 3VWJB 3G04A 1IZKA 2H45A 4YHNA 5FUCE 1MEXL 2HG5B 4KRMB 1FZKA 4WU5A 1N0LA 2PCPB 3KPQA 3QFJD 1A7PH 1IGYB 4WO4C 5IFAL 3DXAE 5F7LB 4APQB 1DBJH 4GO6B 4GLRI 2A0LD 2DIJA 3IFLH 2WAHA 2M1KA 1XF3B 1N4XH 5F72S 2VR5A 3LEVH 3N85L 3QDME 4WDIA 4DVRL 4U31A 3VXRE 2PN5A 4XCEA 4DGYL 3I50H 4TNWF 2NY0D 4D9RD 5K59F 1JZ2A 1PZ5A 5FYKU 5D9SA 3X17A 5T3ZH 1INEL 5I8OH 4HKZB 1TVBB 1DBML 2F54A 4WV1A 3RIFF 4JRWA 4OCSH 4RIRB 1SY6L 4OD1L 2DB8A 3SO3B 3QHZH 1VFBA 3B4NA 2XN9A 2BOBA 2QADC 3K1DA 1T03H 5SX4H 2WBJA 4HIJB 2Y1VA 4XVTH 3PIQB 4N8CL 3SDAB 4KKCD 3O3EA 3TFKD 1FGNH 2QHRH 2EDYA 4IMLB 1RUKH 3P9WB 1U6AL 4NQDB 3DMMD 5E2WH 3UC0L 1DVFC 4NSKA 4BELD 1WIOA 5DJXB 5ICYB 1FO0H 4UIKL 5EU5A 4UB0L 5J6GA 3RY5A 3GSUA 5GGTA 4MCZA 4KDVA 1FVCA 4LCIH 5E8PB 5L2KE 2FH6A 3OJDB 4ZUTA 3EOAB 3S96B 1ZLVH 1D5IH 4HPOL 4YFEA 2AEIT 5CGMA 5IKCA 1G6RB 3OKDB 2ZUWA 4YEEA 1G9MC 3ES6A 4HPYH 1JZ4A 4R0LC 3GJFK 1IBGH 5ANMA 1Q9LA 4PGEA 1DQLL 3FO2A 5MEPB 4EUPB 4DQOH 1E4KC 2DAVA 1NAMA 3RPIB 2G5RA 5EBMA 3RJQB 3MCKA 2GT9B 1MFDL 4PJFB 1HYSC 3SDXA 2HT3C 3B2VH 4L8DA 1WFTA 3ULVC 1UEYA 5FYLD 2AQ1A 4MA1B 1OTTC 1LD9B 2UUDH 3U2SB 3T2NL 4NUGL 1MNUL 3QDHA 3O6ML 1S7VB 1Y6NR 3B3IA 3OG6B 4Z7UB 1PY9A 1KCRH 4AG4L 3D2UD 4D9QE 3NIDF 3TJHD 3ZHDA 2NXYB 1GXEA 4FQHB 4X4XA 2YRZA 3QDJD 5JQHC 3MRQA 5KSVA 4I5BA 5D2LE 3U48A 5C6TH 4TVPD 2X4OB 3G6AA 3OAZK 5EU3B 3QIBC 4HC1A 3CCHB 4WI3A 1HKFA 1JHLL 2FYYB 3QEGH 4YZFE 1EUUA 5DUBA 5GRVL 4ZFGL 4TUKL 4G6JH 1S7SB 1UCTA 3MV7B 1AXTL 1XIWA 1ZHBA 3QDJA 5E8DL 5FV1L 4GAYA 3INUH 4RFOH 3RVXC 3ETBF 4O51B 4QY8A 3MPCA 3RBGA 1KC5L 4EQ2A 2D9QB 1MI5B 4JFQA 5HY9A 1EEZB 4KI5D 3EYOA 5C0BB 5I19H 4F8QA 1SVCP 2DQGH 4FTVE 1J9CT 2HKHL 4AEFA 1B6UA 4HV8A 3UTOA 4L8SC 2ENYA 5FXCH 1RK1A 4BUGA 5ERWA 3RWHB 4NKMA 2BFVL 4Y19B 1LE9B 1D6EB 1HXMA 2EDHA 4RBPK 2X7LB 1JIBA 3ZMRA 3K7UA 5I1GH 1NCWH 4JLRB 5E6IB 3VG0L 2JB5H 2VKWA 4LASL 4RDQG 2X4NA 1G7LA 5HDQH 3LKNA 3QUKB 2A77L 4IOSD 1T21A 5HDBF 3HUJB 3ARBA 4NM4H 4XPFL 3RIAK 4OT1L 4NKOB 1LDSA 4FXGA 5BV7B 1L0QA 4MQSB 4OZFB 1VCAA 3ZHLA 3NBNA 3O9WC 3RPKA 4NFDA 3CSBA 2BNQE 4NQED 4QYOA 3S37H 4JPKL 3PP4H 4OF7A 3UDWA 4KVNH 5KTEH 2XYCA 4BZ2L 5EA0H 3ZT7A 5LAXA 1NFDA 1S7WA 3DTXB 4LCCB 4HIEB 3OJVC 3QB7C 2HJFB 4UDTA 3LEXA 1QTYT 1DSFH 4ZXBC 3RL1A 1AIFA 4XPGH 4RCAA 1WZLA 3EZJB 1P9MA 1G7MA 3NIGE 3ZKMC 3C6LB 3DYMA 3HA0A 4PRIB 1B6DA 1FPTL 2HVJA 1HYRC 2E7LA 3DECA 3WNMA 2YR3A 1I7UB 4MQXD 2H9GA 1K8IA 5DD0H 4PJIF 5E08L 4M7JH 3BZFA 3TBYA 4R6UA 5J4MA 5IOPA 1C5CL 4WGWB 1EFQA 5GZND 5IW6B 1FZMB 2H32A 4LGPB 1RIUH 5ALCH 1WZKA 5DQ9A 5HI4C 3V5KB 4I0PB 5F6IB 5GS3A 3E6FB 1L9MA 2OP4H 4Y4HA 4Z7VE 4AYFA 2O5ZL 4HS3B 4IOFC 3KVQA 1LO5A 1VFAB 3BAEH 3KGRA 4LRIA 5D4QA 4JFEB 4LPTA 1NH6A 5DZNA 3HNTL 4A6YA 5FOBA 1S78D 2PO6A 4KJYB 2D7MA 1PKQB 1W8NA 4KUZL 2D0HA 5H2BA 2FBJH 3EZ8A 3X3FL 1SJXA 2DQTL 4NP4L 4UUJB 4E42A 2EIBA 2IANB 4IOIB 1CTOA 4P46D 3IFNH 4FQ1L 1A5FH 3C60D 3CMGA 5LVEA 2AK4D 1U8HA 4ZPTA 4ZTPH 2HH0H 5D5MF 4ODUB 3BP4A 4OFIA 2GITB 5IVOA 1UA6L 5DZOA 2VDQH 5AD0A 4NQXA 4JHZA 3S36H 4NQSB 1Q9KB 3QCTH 4OKVA 4YXHL 3DGCR 4P46A 1T2QL 1IM9D 3I6LD 5HPOA 2CGRL 1KIPB 3RTQA 3C60A 1I1YA 3QDAA 1ED3B 4NN6B 4O00A 1OVZA 4LLWA 1JPGB 1FNGA 1L7TH 4L8CB 2VQ1A 5ISZB 5L6YL 1ACYH 5IG7A 3EO0A 4F7CB 7FABH 1IC5H 5SWSB 7CGTA 4Y16C 1IEBB 4AIZB 5E2VL 5FB8A 4N8VA 3UEZA 2F19L 3GSWA 4CW1B 1MFAH 4P4KD 3QJFA 5EBLB 5D1QA 1VACA 5D7LD 2BHZA 2EDLA 5DS8A 1NGXB 3ZTNL 2X9YA 3SE8L 1IMHC 3TIEB 2JCCE 1HILB 3PGCB 1XGUB 1D5BA 5A40E 3SJVD 3FMGL 2Z91A 2AJ3B 3MMEB 4ACPA 5HXMA 4KKLC 4P4KA 3C5ZD 2Z93B 2NY7L 4QWWD 3CFJB 3GIVA 5D7LA 3ZT6A 4ZS7H 3UYOD 3BP6A 1IKNC 3UBXA 1QQDB 2VABA 1JRHI 3REWB 4HWEH 3FT3B 3QAZB 2DM4A 1GC1L 4ONHA 5E99L 1KACB 1RJZB 5FHBL 3A67L 4RGNC 5EOTB 3VCLA 4QTHB 3OKEB 4FNLH 2IQAA 3KYOB 5F6HI 1B0GA 1RJYB 2NQCA 2HAZA 2XTLA 5I17A 4Y5XC 3WIFA 3BPCA 2HN7A 3MBXL 3QA3A 1GGBL 1UH4A 3QUXB 4QXGH 3U7YL 4F7MB 1JPST 3KPSE 1IGJB 5IB5A 1WEJL 1PSKL 4G6MH 4PFEA 4PY8I 4XWGH 1KCUH 2EIEA 2VXSL 4GSDH 3H3PL 4PRHE 2V2TB 1PFCA 2VOTA 1RJCA 5HYJE 2OK0H 1F97A 4OLVH 2NNAA 3OJ2C 2V2WA 1S7XB 2JJWA 1KFAH 4L29A 1DZBA 5DC0A 4GW5B 5F97E 4F15B 1K6QH 2QQNH 3T1FA 3D39A 5BVPL 1MCIA 4EIZC 1YEIL 1FZOB 3G6JB 5HGAA 4MQ7A 5GRXG 3BXNB 1G7JB 5FYJD 3OPZH 4Y2DC 4PJ7A 1WVZA 4QRPB 2OJEB 5FDYA 5K9JL 5CEZE 4P2QE 5KSAD 3SDCC 2EYRA 12E8L 2XKNB 1QSEA 3LIZL 3VFSB 2VLRB 3OGCA 4OQTH 4P23C 2YN3A 4O2FB 4M5YL 3BT2H 1XZ0B 3NACH 2GI7A 5E70A 4LPVA 4JEGB 4PJIA 2G5BA 3LN4A 1I1FB 4R90L 5B3JF 3P9MA 4NQUA 1WQVT 4MD4B 5IHUH 3SKJH 1EAPA 2VDPL 2H1PL 4X6CE 2YHGA 1RJLB 2PTVA 3B8YA 5TFSL 4LU5H 2P5EE 1AHWA 4DZ8B 3UYPA 3QEUA 5ID1A 2OXHA 5GGVH 3GNML 5LCVH 5F1NA 1AFVH 4TNWK 4Q9QL 1NAKH 4QXTA 3CXDL 1I8MB 5D7SL 4AEHL 5JUEH 4G5ZL 3QJHB 3RIFK 2ZUVA 2W0KA 3KPLB 3ROLA 1T20B 4M7LT 4ZO9A 4XC1H 4X4ME 1U91B 4POZC 5MEND 4I4WB 2WWMC 1X5LA 5IMOB 2FIKB 2R1YB 3RNQA 1CGWA 3EFFA 1A6TA 1G0XA 1KPUA 3RVUD 4EI5C 5CILH 4YEFA 3QP3A 1MFEL 5I8CB 3BQUC 5FGSA 3VW3L 5F6HJ 4P2YA 3WO3B 2EIDA 5TE6H 3M8OL 5IJVA 4PG9A 3DUUB 1KXTB 3FFCE 4V2CB 5JHLL 3GBMH 3GK8H 5IT2L 3MLWL 5HSFA 1SYVA 4PY8J 4HUXA 1HWGB 1S7TB 1I85A 5DTFA 1Y0LA 2OLDA 1S9VB 3KG5A 5CHNA 5CGTA 1N8ZA 5I1CL 1B90A 4NO5A 4MJIA 3NZHH 1SEQL 4R26L 3VFGH 3CX5K 3HPLA 2DQHL 3BKYL 3VXSD 3RZCC 4L9DA 5EG6C 3RVVD 4H1LB 3JV6A 1EEYB 4QNPE 1RZ7H 3TBVB 2FJGA 2QADB 4FMFA 4K55A 4UILH 2X9XA 1A7PL 2ZG2A 4FMKA 1CFQB 3GJEA 3FN0H 2YMXL 3MJGX 1NGWA 1I1AC 3AY4C 5C9JA 4OZHB 2A74B 4WWKD 4ZG1A 3PG2A 3VDCA 3IFLL 1KN2H 3VWKD 4Q0XL 3HI6H 3S4SA 3WLWC 2F53B 5FM8A 4NT6B 3T3PF 3LEVL 1URLA 3SGJC 3HNVL 2HJLA 4MZ3A 4PLKD 2ZCLL 4KZDL 3GGWA 4P2RE 3BESR 3VXQB 1EZVX 5C09E 3NCCB 5C07A 5EBWA 5ICXA 3TYGL 4X6DF 3MRIB 2NXZC 3L7EB 1WC7B 5EOQH 1P4IH 3GKZA 4I77H 1IGMH 3ME0A 5C08B 2Y7QA 4LNVA 4R0LB 5DR5L 2X40A 1T6WA 2H2SD 1T03L 3WFEL 1HIML 1N5YH 4OZGA 2XZAL 1OHQA 1ODAA 1NMBL 5DJ8B 1YEFL 5E5MA 4S1SL 2C3XA 1VFUA 1S5IL 3VI4F 5GGRA 2YA0A 4ZAKD 5F88B 4Z95H 4ODBD 2FB4L 4EDWH 1OAYL 1WAAE 3UTSB 1NANH 3T0EE 2WUCL 4PJ5B 3LRSB 1R5WB 2GK0A 1RK0A 4LF3B 4XBPA 5J6HB 1IAOB 4P48A 1FFPA 1T1YA 2AQ3A 1CVRA 3RY6C 5EPMB 3O4OC 3HG1A 3KDMB 1DLFH 1MLBB 3BH8B 4PRPA 3PWPB 4PRBA 5DYOA 4NOBA 3FAXA 5HI3C 4QRRB 5I8KH 2VUYA 1MJJB 4UT9L 3SHSA 5DRXB 1KN4L 4Q9RH 3I9GH 4YQXH 3CLFH 4O02L 4Y4FD 2D31A 1HWHB 3ZE0F 1QR4A 3RGVC 4U6VH 3TN0C 1U3JA 4XI5D 1WCBA 4U1SB 4YHLL 2DI8A 4F9LA 1WZ1L 1NGYA 4HH9A 4JFZH 1UZ6F 2Z4QB 2XICA 3BUYA 5HYQB 3GMLB 4PJEE 3HE6D 2BMKA 2LVCA 3DWTA 4JM2C 1FRGL 1KLUB 2COQA 1AGDB 1L4IA 1O5DT 2D7TH 3U9PH 4Z7WA 4Y4FA 1Q72L 1DQJA 5IMLA 1XR9B 2AABH 2WM0A 2P5WE 4XHJC 3BN9C 4KUCF 4L8SB 5DQJB 4EOWL 4F57H 1FLTX 4KTDL 3AS2A 1BVKA 2X89A 2CUIA 4LSVH 2A6JB 4J4PD 3CVIL 1FVDB 2PTUA 3OAUH 5C1MB 3VFOB 4JRXA 1TJGL 2WIIA 3VFNA 3BZDA 4M8QB 1BGXH 4PJBF 5EWIL 4DKEL 1E6JH 3EYVB 3QEGL 5DK3A 3LZFH 4Z76B 1QSFD 3D5OF 3P0GB 1HOCB 1U3YA 2Q86A 4Y4KD 2UWEB 4FQ2H 4N0FB 3C9NB 3E6HB 4M6OL 3AU1A 1I3GH 3N1GC 2DYPD 4XVUC 5C0EA 4RFOL 4J4PA 4I2XE 4MNGB 1QRKA 4PJHB 4RISH 3B83A 1BLNB 4HK3J 5H94A 5JO5B 2I5YL 1XF5B 2ZOKB 4JB9L 3MLZL 4WI2A 5I19L 4TTDD 1FNLA 1S8DA 3CH8A 3V4PH 8FABA 5C92A 1EAJA 4Y4KA 4YO0B 3SGDI 3HKFA 3MRJB 4C56D 1SY6A 2NMSA 2DYPA 5DRNA 4QXUH 4HAFA 4L3EB 4R2GB 4MA8H 2FEEI 4PJ9A 4C4KO 3T0WA 3KPPA 3QO1B 5GGSB 2VLJE 5MEOB 3AS1A 3MV8A 1G0DA 2UZXB 3PWJB 1EEUA 2CIIB 4QRQB 3TGXA 2YPLB 3BH9B 4EBQL 4FQLH 2YA2A 3T77B 2BSRB 2NW3A 5LGJB 4C56A 5J1AB 4D8PA 5IROA 3CUPB 3VH8A 3A0OA 1CG9A 2GJZB 3IFOA 3KWWA 4FQJH 2BVEA 2IH1B 4JDZA 4ZQKB 2BP3A 4JY4B 5E7FA 4IRJC 3QO0A 2IF7A 1I8KA 5EUOE 1XR8B 2DQDH 4U1LB 3ZKQD 5BQ7B 1KJ2A 3VRIA 4O2EA 4W4OA 5IMKB 5DJAA 3HAEA 4L8BB 5LBSH 3QPXH 4KVNL 5GS1A 1QRNB 2MHAB 1ZWIA 1X5IA 5HHQA 1OSPL 3ALWA 4O5LH 5E9DD 1HHIB 1NCCH 2BJMH 1P1ZB 1BQLH 4KKBC 4E0RB 2Y5TA 2H3NB 3Q1SH 2LTQC 4XPGL 2ICES 3E3QE 3Q6GH 4N5ED 4XAKE 2GY5A 4QRUB 4FXKB 2ADJA 1RV6X 3GI8L 3L95A 3D3VB 2D7NA 2IPUG 3LH2H 4WUUA 3DUHA 4X4YB 2GKIA 5E9DA 4FFWD 5DRZA 2X1XR 3FQWB 3PHQB 1Z5LA 3VXUB 3FOLB 3PP3K 1OTSD 3MR9A 3BW9A 1J18A 1W72L 5FUOL 4OLYH 2SEBA 5ICZA 3EJZC 1T0PB 5JXAH 3GHBL 1AGCB 2CKBH 4CVWA 5CD3B 1TZIB 3QNZB 3SGKA 1YC7A 1MWAB 1CU4L 4DTGL 1IC7H 3HZMA 5CIPA 5E8EA 3IGAA 5F7EL 3O3BA 5DEGB 5D6CB 3F58L 1UXSB 3W9DA 3WFDH 1NDMA 2AXFA 5J3HD 3WS3A 4K7PX 4RQQB 5TH2B 2E8YA 4BSWB 3MA7A 2YEZB 4P5TC 2UY6A 1JZ7A 5TGBA 1RUML 5CUSL 2R1XA 4KROC 4ZTPL 1A1OB 2DQFA 5FKPA 2EKJA 4ZSOA 1A7OH 2F54E 3V5DB 3HR6A 1ZGLM 4KMTL 2ZNXA 3MNZB 4KUCD 4DVBA 2MCG1 3D25B 3ULUE 1M71B 3K2UH 2N7AA 2XN9E 4LAJH 4ELKA 4GQ9L 1NCDL 1P6FA 2Z35B 3NFNA 2XWTB 4JRYB 4X6BB 2YPVH 5CEYB 3WL9A 3P4MB 4R8WL 1LK2A 2MQCA 2XWBA 2R1WA 3VXNB 4DGVL 4JDTL 3IDGA 3IDIA 4LLUB 4L3AA 2ZKHH 4HGWA 5D1XC 4PP1C 1AH1A 3MJ7B 3F5WA 2CK2A 3R1GH 3O8XD 4YHOL 1OGAB 2YBRB 1JGEA 4JPIA 1Z9SA 3ARUA 4RGNB 5BVJB 3B2UD 2EEDA 3F7RA 4PJBA 3RA7H 2KDGA 1XGQB 4YR6A 5SWZB 3DVFA 5TE4L 5AG8A 5DK2A 4HQQL 5CZXC 4E41B 4GW4A 4Y5XB 1Z6JT 2FD6H 3DVGA 4XP9L 2NTSP 1QACA 4PJFF 3PGFL 2GQHA 4V1DA 4XCNB 1MCKA 2GJ6B 2JJTC 3W0WB 1ZSDB 5ANME 5IEHB 5JW3H 2D0FA 2H26A 1VGKA 5CMAB 1WITA 2G60H 1QYGL 4O4YH 2NY4C 2YSSB 5DD3H 1U8IA 1ZT4A 2N7BA 4Z7UF 2FHCA 1KJMA 4I3SH 1ADQL 4P3DB 2EDWA 4ZS7L 5HGHA 1H9VA 3ULVL 3BX7C 4P5KB 2BOCB 4U1JA 3G5ZB 3SDXE 2XTJC 4N90D 4WI8A 3U82B 4HWEL 3MBEB 4TUJB 2DLEA 2OX5A 2A6KA 4DW2L 2AAVA 5L7XH 4EVNA 4DWHA 3F6LA 5TF0A 1HXYB 3MLUL 4PRDB 2EDXA 1OGTB 1MQKH 1KV3A 4L3CB 1Y18B 2DS4A 3VA6A 4QXGL 4JHAL 4U0QB 4KPHL 3KS0J 5EU4A 3D85D 4DGIH 3HZYA 3LN5A 4HIXL 3FB6B 3W82A 2EEBA 4OGAC 1MF2H 1R3KB 3TZVB 4PV8A 1F6LL 3WJJC 4Q2ZA 4S1RH 3BN3B 2LABA 4OGYL 1F11A 3QEQE 3MGAA 4LCWB 3MLRH 3VWJD 4NNXB 4AL8H 1I8IA 3CDGB 1NMCC 4LHJB 4UTAH 3D85A 3QWOA 1BFTA 4TVPE 5DUMH 4BH7A 3NABH 1JP5A 4APQD 3OKKA 5K9OA 5JOPD 4MJ5A 3B9EA 3ARFB 5CJXC 3QZWB 1YQ2A 3PF2A 4LIQL 3DROA 4P2CG 5DFWH 4YGVB 5E4IA 3VFTA 4CN4A 4MB5A 1E28B 5FV2A 3BD3A 1N6UA 5FYKD 3HUJF 5CEZH 4AZ8A 1KCSH 4JFFB 1DQDH 1NDGB 3NGBC 5CLTA 5F71A 3NPSC 4AH2B 1N0XH 3D1MC 2VISA 3OBAA 1JNJA 1IGTB 4J3TA 2WNGA 3NIFE 4S2SB 2DN7A 5KANI 4ZNEA 3ARDA 1A3RL 5DZLA 1F4XL 1FORL 1ZANL 3RRQA 4NNPH 3V6OC 1UB5B 4OZ4A 3SDAD 4CVXB 5I71B 5INDB 2R23B 1TVBA 3F8UB 1IAMA 4NQDD 4LCUA 2YZ1A 1DANT 4N9GB 2ADGA 3MRPA 4YDIH 1EO8H 5TDPB 2WK2A 5I18H 3ZT5A 2WLYA 3DX9A 5DJ2A 4WW2B 5GGSY 4WVRA 1NFDE 1WTGT 1KENH 4NDMB 2BXZA 3MV9A 1X5ZA 4MAUL 3LS5L 1NBYA 1QPXA 4NN5B 3UJJH 5FFLA 1MAML 2KPNA 1BOYA 3OR7B 3O81A 4JKMA 5CD5D 5JHDE 3NTCL 2H2PD 5L88L 3I2CL 4YDVB 4GG6A 2BNRA 3MGTA 5DWUH 2GAZA 2MPAL 2FLBT 3U7WH 3L3OA 3MODL 1A3LH 5TPWL 1I7ZA 3EOAA 2EIZA 1JTPA 2NXZB 4ODWB 5JPNB 3S96A 1FG9C 1W0VB 1FV1B 2XA8L 3S37X 2ZUQB 4D9LH 5MHSD 4KU1A 4EDXB 4XPAH 2HFFB 1EK3A 3OKDA 4GRLC 3WFCL 4NBXB 5D1ZB 3ZKXC 3KPMA 5T1DH 4JQIH 4HAGA 2HA1A 3O6KH 1H3UA 2K7QA 3U83A 4DKAA 1CLZH 1N6QL 1CCZA 4NQVB 5C0RL 3CMOL 5DXWA 4OD2A 5J9PB 4M3KB 1KN2L 1TMCB 5DMKB 3KYKL 3BZ4B 4WFGE 3TA3C 3AAZB 2NXYD 4PJFA 4PUBL 1KB5B 1MPAL 3QI9B 5TQ2L 2F5BH 4WY7L 1NGPH 3G9VA 3MC0A 2IH3A 4WNQB 2FLRT 3GSRA 4LLMA 5E0QA 2CDFA 4HFWB 4IS6A 4WFEE 3IU3A 4Y5VC 2KH2B 1R3IH 1L6XA 1YEJH 4XMKH 1P4IL 4X7TB 4N68A 1D9KA 4I77L 2DQIH 2WINB 5IQ7L 3I85A 1JK8B 3MV7D 6CGTA 4FQHA 5HD8D 4QHKJ 3BJ91 3MLSH 2M8XA 3NN8A 2A0LC 1N5YL 4GKZA 3MYZA 1ND0A 3JVGA 3MX0A 3NCJH 2X4OA 3HZVA 1AE6H 2VDKH 3MFGB 5I1HL 3VRLE 5GZOD 3EYUH 5C0BD 3ZHKA 2FYYA 4U3XA 1AQKH 2X4RB 1RU9H 4K71C 4X98A 2W59A 3RGVB 3HE7C 4OBRA 3TN0B 3CC5A 1HI6B 1TNMA 3CZFB 3VGEA 3CFCL 4PGJA 4EDWL 2ADFH 4WI6A 3UTZB 4PIRF 4Y19D 2FO1A 4WWID 4Z0BH 2Q3ZA 2EE2A 5E1AB 5ITBH 3I6LE 3DV4A 5KVFH 1RZJH 2UZIL 2R69H 4HIHB 3L9RB 5C0BA 5E6ID 2AJSH 1U3ZA 4KXZI 1F4YL 4HBCH 2Q8AH 43C9B 1CF8L 5GGQH 4JY6B 3L5XL 1CL7L 4B53A 3AREA 3TFKC 3V52H 5T5FH 3RWHA 3GHEL 4K8RH 3QPQD 4Y19A 2YA1A 1HE7A 2Z31B 3DMMC 1HSBA 1ES0B 2X7LA 2R9HD 4XPBL 1LK3H 2AI0L 2O5XH 4JLRA 3HI5H 5E6IA 2IADA 5IM7A 4ODXB 4EN3B 5FGBA 1U8JA 4LSRH 5D7LE 4HWBH 4YHMH 5IB3B 4JO3H 1F42A 4OLUH 1UVQA 1JNHA 1FAIH 4PJCB 2OR8A 4N0RA 4BQBA 2CJUH 5F21B 2YK1L 1NGZB 4ZDHB 1FH5H 3GJFH 4JM4H 3VFVA 1QKZL 3PL6A 3FB7A 3LKQA 4MJ2A 4KJPD 1KSRA 1BFVL 3BPLB 5I9QC 5GS0H 4F57L 1FAKT 3MV11 1J1OL 2JLLA 3C6LD 4R3SB 4P5MB 4DJMA 1S9YB 1EDQA 4PRID 3P0YH 3ISWA 4DEPC 2R2EB 3O6LH 2FX7H 3D0VA 4GRWB 4YHPB 3G6JF 4HIEA 1BGXL 4MA7H 4WU7B 2DBLL 5DRWB 1F00I 3HC3L 1FIGL 1HHJA 2DQEL 1YMMB 3FOMB 3WS6C 4QT5B 4HCRL 4GAFB 1F90L 1AGBA 1BAFH 4TSAL 1ZA3B 5JXED 4R7NB 5F9DC 3TJHC 4JPWL 3WN5B 4I0PD 3D39E 2AS5M 4O58L 1NJ9B 1CDIA 5T1MA 4JKPH 3O4LB 4H0IA 4IRJB 1NFIB 5C8JA 3WNOA 3V4PL 2IEPA 4PJ8C 1F6AA 4PJ7E 1RIVL 5DI8B 2DTML 3MFFB 4G8GA 3QEHB 4JFED 2V2XB 3H7BB 5IW6A 4JFYA 4OFYA 3IDXH 1IGIH 5HVWA 4UT7H 4FFVD 1QSEE 2C1OB 5ACZA 5BRZB 2IAND 1LEGB 4JO2H 1ZHNA 4ZFZB 1DBKH 5MEQA 3BRGC 1QEWB 4PJIE 2EECA 2K3TA 1U2CA 4CU8A 4LK4A 4RAUB 5DJ0A 2ZCKL 4LVNB 2EE6A 5E8OB 3LV3B 1YZZA 3EDJA 3G5YB 4UUJA 4WUKL 4QHMB 4IOIA 3QUML 5GGUB 4YPJA 5C0JB 2GIYA 4OFVA 5B38A 2ZOLB 5JOFA 3FB5A 4AENA 4RWYL 3T0BA 3SGEH 5ISZD 3SQOL 5I6XB 2Z8VC 4UT6H 4NN7C 3GBNL 4NQSA 1VADB 5SWSD 4N0UB 3PWLB 3SY0B 2JF1A 1FO0B 5IB2B 1NL0L 5I73C 3DBXB 1CLYL 4DZBA 3IAPA 4ODHL 3SBWC 4HEME 3R8BB 3CU1A 3G5VA 2IFFH 1JPTH 1XGTB 5C0ND 4XNYH 5KW9H 4Z0XB 1BWWA 4LBEA 1I9JL 3GUTB 4AIZA 3MRNA 2JJVA 4ODSH 4LVHC 5HHNA 3AB0C 3CGTA 4KROB 3LQAC 2A73A 2OTUB 4OZHF 4MJIE 4ZPVB 4WFFD 2LAGB 4MVBC 5FK9A 2VN7A 2CRIA 4NC2B 3HI1A 2YD3A 3ZSTA 3ULSA 5LG1A 3AFLA 3EBAA 1XF4A 3ILPA 4KZEH 3W5NA 5DMJB 2AJ3A 3WHXA 5GRYA 3OKOA 3WLBA 2Z93A 3MGOB 4MXWH 1MCPL 1TZGL 4DKFL 4PY7A 3WKMH 5CWSB 2J4WL 3RWCB 3LHPL 4KRPC 2I24N 3KPNA 5D1XB 5JW4Q 4KJWD 2QHLA 3QUXD 4MQXC 1QQDA 5AZEL 4CMMB 4QTIL 4YXLL 1YEEH 3SQBA 3QIUC 3MRRB 4UI2A 2E9IA 3QIWA 4O2CA 2R8SL 4F3FB 1R5IA 2BVUA 5C07E 1BD2E 5IB1B 2IFGA 3RI5F 5F1IB 1BM3H 2NZ9D 3QSKB 3QUXA 3S5LA 1U8MA 4MHHI 3D6GA 4YDKH 4F7MA 4OJFH 2JK5A 5E6ZA 1IQWL 1MRFL 1HQRB 4OZGE 2LU7A 3ULUH 4NGHL 2NY2D 4HK0A 3FRUA 3MUGA 1V7NH 1E0OB 1BF8A 1ZHKB 2D0GA 3TBSB 1F4AA 1CS6A 1CFVL 3F7VA 2NY3B 4QRPD 3QWQB 1GVIA 1TENA 1OPGL 5DSCA 2DQJL 2QLVB 3MUZ1 2VLRD 4ODVL 4UBDD 4GW5A 1FLRH 1T83C 3PQYB 2X1OA 5I1AB 1FZOA 3EJJX 3ZZ1A 2VE6B 2W0FB 5ADPL 1HSAA 1ZV5A 2ZG3A 4MZ2A 5GGTH 4QRPA 4DAGL 1J0KA 2W9DL 1R24B 3HG1E 3ZL4L 1EEQA 1WUNT 3FT4B 3S6CA 4PRPE 3ZDYF 2X70A 1JV5A 5B8CB 2RAMA 1QLRB 1RZFH 1JVKA 5JW3L 3FN3A 1VFMA 3O2VH 2XQBH 4O2FA 4YJZL 4UAOC 2G60L 5KJRL 3QDGA 1DQQB 4OUOA 2LV4A 1XZ0A 4X9HA 4B0MM 4I9WE 5DHXB 1A14H 1KPVA 3NFSL 4MD4A 3ESVF 3RNKB 2AERT 1NAMH 1NLDH 4H0GA 5A2KH 5F3BB 3DVIA 4M1GH 4POYA 2JIXB 4YPGA 3ZO0A 5HPMB 5ETUB 1W0WB 4Z7WE 1WK0A 3RU8H 4GKSB 3FO1B 2Q6WB 5E2TH 5EZLA 3FB8B 2YC1A 1W72A 2UWEF 1FZJB 1T20A 5DC9B 3C5ZC 1JPSL 1NMAL 2C3WA 4I4WA 4NPYB 1MCOL 4QWWC 2FO4A 1A7QL 4DGIL 2FIKA 2IJ0C 3PXJA 3NGBB 4PJHF 3FL7A 4MNQB 1CD0A 5C3LD 3NPSB 1F2QA 1GPOH 4WO4A 5FYLH 4JRXE 1I4FA 1KYOJ 3UTTB 3KJ4C 3GMOA 1EHLL 4HC1H 3L3HB 4O9HH 1A9EB 2BVYA 3VGAC 2IBGA 3EFDL 1KEGH 4AL8L 2BVOB 1V3LA 2R56H 5J13C 2QADD 2HKFL 4UV4H 1LQSR 3X14A 4FA8A 1U92B 2KL6A 1UQSA 4PJXB 4BKLB 1A7NH 3NABL 2VKXA 1L7IH 1BWMA 1QNZL 2BVPB 5EO1A 3RUGA 3OZ9H 4NIKB 4TVPH 5IIEB 1MREH 4EXPX 1DVFD 5DQDL 5IFHL 5JW4M 1ZLSL 1MIMH 1MH5A 2F53D 3L3KB 4WI4A 1EEYA 5BJTB 5GRWA 3TBVA 4K7PY 2NCMA 1RZKH 3ARSA 4HWZB 4S1QH 4Y5YB 4G8EA 1N0XL 3MV8E 4H88L 3UO1L 1DVFA 3Q3GB 2J8HA 4WTXA 5C0AB 5C08D 4C56E 4LEXL 5EO0B 5IWLC 3WIIH 1YJDH 1YYMH 3QXTA 2A6DA 4F7EA 2FGWH 1TCRA 1FL5A 2HFTA 2JTDA 4YHZH 1J0JA 4OD3H 3VD5A 4WJ5B 1P7QB 5KSAC 1BFOA 4D3CL 4JFDB 3ARYA 3BMVA 3L7EA 3MRIA 4NJAH 4ZD3H 3SKMB 35C8H 4M7LL 1EXUB 2HT3D 4HKJB 4R96B 4R0LA 3UTSD 1QFWM 1YEDA 1T3FA 3MXWL 1EO8L 2DKSA 4OB5H 4XNMA 4PJ5D 2W38A 4LAQL 4FZEH 1KIQB 3I75B 4M6NL 1KENL 3N0PB 1E4KA 4EJ1C 2R4SL 4X7CC 4U0RC 4HD9A 4KHTH 3NPZB 1C5BH 1MUJA 4BSJA 5CEXA 4XCYB 1HK6A 2D7PA 1J0IA 2DIBA 4GKNB 4FS0A 3NCMA 3ZKSD 1ADQA 4L4VA 4X7FC 4MDJA 2Q7NA 3PWPD 1QFWH 3TWCH 1OQOA 1T04A 5JLZA 4MAYC 4U6YB 1JNLL 3LRSA 4QRRD 4WUUE 4JG0L 1I7RA 1S5HB 2DMCA 5E9DE 3WO4B 2KQMA 4LFHD 1C5DB 4TQEL 5KG9B 2ZJSL 3KAAA 4X99B 1A6PA 3E0GA 2VDMH 3JTSA 4M6AA 2ZUXA 3HR5B 3KDMA 3BH8A 3EAKA 3DO7B 1UT9A 2M2DA 3O11A 3PWPA 4TN9A 4NNYA 1N64H 1S9WB 1S9XA 3LKSB 3OAYK 4JO1H 4F37F 1XGYH 3MLXH 3QIBA 1U41A 4MX7A 5T1LD 2H32H 4JANB 1KBGH 4R4FH 3ARGC 3LS4H 3AMKA 5TE7L 3HE7B 3L5WB 1R3HB 5BO1L 2AJYL 4NRZB 4XP6H 4TNVF 3I6GA 1AO7E 4U1SA 4FQCH 4LARH 1MCWM 1QVOA 4DUWA 3FT2A 3TIDB 3GMLA 3QQ4B 2CMRH 4A6YH 1NLBH 4PS4L 5T1LA 1A6UH 1KLUA 3RVVC 1IC1A 3AMLA 1R3IL 1YY8B 3P4NB 3Q6FA 4JR9H 3MRHA 5E2UH 4BUHA 1XR9A 1Q1JH 3Q0HA 1GZPB 2IBZX 2OZ4A 5A3IC 4ZSOE 1HZHL 1A21A 4L8SA 4F7TA 2GTWA 4C58B 5FO7A 4PRNB 4WWKC 2A6JA 1FVDA 3TBWA 3VWKC 3IKKA 1SBSL 3VFOA 1OM3H 4OF6A 1CN4A 5E5RB 4RMSA 1DTUA 3MOAL 4Q9CA 2CKNA 5I66B 4Z76A 1GYAA 5DJDB 5FA3B 1KELL 3WFBL 1DFBL 1VGEH 3L1OL 2UWEA 4P9MH 3AM8C 4N0FA 3DOSA 3E6HA 1VPOH 1YEKH 4L3ED 4R2GD 5DGQA 5ADOL 1T5WB 4MNGA 4ODTH 5I30L 4PJHA 5JO5A 2HLFD 3HLAA 2ZOKA 1XF5A 4U33A 2FR4B 4NHUB 1PZUB 1RZJL 4FP8L 3O9WA 4PJBE 2DQUL 3L7FB 3MRBA 4ZXBD 5EOCL 2H2SC 3WE6A 5M7QA 4JQXC 3QXAB 1V7MH 3JWNC 2YPLD 5B39A 1JTOA 5C3TA 4LPWA 2B2XH 4V1DE 2RCSH 4L3EA 4L4TA 3DI2B 3ZYOA 4DN4L 3BEVA 4KV5E 3CH1B 3QO1A 5DJZA 5LXGH 1U3HC 1J1XH 2O5XL 4JKKA 3HI5L 5HVHC 4QRQA 5F7HA 1DUYA 4QEGA 4ZXBA 3U30C 5J11C 3R06A 2YPLA 2EH7L 3T77A 2BSRA 4YDJB 3BIAX 3P40A 3EOTH 1HQ4A 4LKXA 2R0WL 4RAVA 4HG4J 2GK2A 1VFOA 1A6ZB 1QRND 1JGUL 2ID5A 5TDOB 1G9NC 1BVZA 1MCSA 2X4QB 3CFEB 4BFBD 4LNRA 1P4BH 1JF1A 3MUY1 2ZSVB 4G6KL 2W65B 1TVDA 3QXWA 3ZKNC 4YHIA 4PJ8B 4WEMB 4IOFD 2DM3A 2QKIB 4D0BA 5BQ7A 1JYWA 4G43B 5ALBH 5IMKA 5GS0L 1MRDH 4L8BA 4OFDA 3EHBD 1MHCB 1DL7L 1MHHB 1N5AA 4OGXL 5E00B 2P43B 3D3VD 4G8IA 4N90E 4U1HB 2OJZL 1JZ6A 1MCHA 1WBZB 4XI5C 4M7KL 3IVKB 3RWIB 3BKCH 5JR1L 4ZTOH 4Y1AB 4XVSL 3VXUD 5BZWB 1XFPA 2H3NA 3U0WL 3GM8A 5KVEH 3MNVB 4KY1L 3HE6C 5SWQA 1ORQB 2NTFA 2V17L 5CP7A 3WUWB 1M7DB 4FXKA 3U4EB 1XF2B 1EIBA 1R5VB 1OY3B 4PYHA 5DMYA 1BAFL 3WV0A 5F44A 3P0VH 3EO9H 3MNWA 3MV01 5SX4I 3IU4L 1T0NB 1YA5A 3SOBL 3LKPA 5L2JB 1A22B 1JF6A 3G6DH 3QUYB 4OTXH 4BK5A 1IGIL 1HKLH 1MAKA 4OSUH 4XX1E 3DXAB 4UT7L 4OCWL 5HGBA 5EB9A 4IRSC 2NY6C 5M94B 5I73B 2N56A 3I6KA 2YUXA 3B6SA 4M62H 4EEEA 5I2IB 3QDMB 2HFEA 5KSUB 2ZCHL 2IPKB 1JGDB 1I9IL 5DEGA 3VXRB 3ZDXF 1RFDL 3GM0A 4U2YA 5T3XL 4I3GA 4FQQA 4M43L 4U1MB 1CFNB 5TH2A 4TTDC 4Y16A 4QOKE 1H8NA 1MOEA 4WW2F 3REVB 4LVHB 3GSVA 3AB0B 4JRYD 2EE9A 3DSFL 3MJ8A 1GAFL 4P0DA 5L9DH 2YOCA 3X12B 1OL0A 2BDNL 4YUEL 5DDHA 2Y6SD 4XP1H 3RI5K 3NZ8A 3MRFA 3MNZA 5C7XH 5DVLA 1YUHB 4UT6L 1FQ9C 5T5NG 4N0CD 5KZCB 3X3GL 1OAKH 4HXBL 3TM6A 1KB9J 2PETA 1OGAD 3EO1A 1NFKA 4NHCL 1AC6A 4RGND 2B1HH 1OT2A 1QPPA 5CEYA 2EYSB 2XACC 4N8VG 3MV9E 5SWZD 5HHOA 3T4YA 1J87A 4E41D 3KJ6L 2VDLH 3OTTA 1IKNA 4G7VL 3RHWF 1JCKA 3ZE1F 3QRGH 5D93C 5L2KB 2OMNA 5KVGH 3U46A 2GJ6D 5AUMB 3QIUB 3W0WD 4ODSL 4GG6E 3D18A 2BNRE 1G7IA 1T1WB 1MCWW 4ZO8A 4ERSL 4PGDA 4ZUVB 1J5OH 3IJHA 3BE1H 2IBBA 3D69B 2PYEA 4Y5XA 4LSPH 4IJ3B 1M6OB 1S3KL 2MQ0A 3FQXB 4UU9B 3RDTB 1X5GA 3UAJD 1ZVSB 2ADIA 3MBED 3Q48A 3W0WA 3VXPA 5I75C 3WNLA 2O61B 1NEZA 3IKCB 3PDOB 4OFPA 2B0SH 25C8H 3P11H 2JE8A 1QA9B 4K3GA 4LKCB 1UWXH 4P5KA 3TNMA 1Q0YH 2BZDA 3T0VA 1CZ8H 1A2YB 2NY5C 2CPCA 3MXVL 4BQ9A 2B7DT 1YEEL 1W2KT 3N9GH 3RY4A 4QHUB 2XIDA 4HCRA 4OV6F 5H37H 2VXQH 2ARJA 4ZUSA 1RUPH 4PB9L 1K2DB 4H0HB 5GJTL 1UJ3B 3TZVD 4Y2DA 5D2LB 1OGTA 2BVQB 3DYOA 4P99A 5IMMB 1UGNA 3H9HB 3A6OA 4LCWD 4MMZC 4NRXA 5A2FA 1Y18A 3WBDA 3SDCA 4WEUD 4YDKL 2QSVA 3F62A 1KIUA 1EO5A 1U36A 2CK0L 1YNLH 2NPLX 2YXFA 1AY1H 4P23A 4XVJL 3GKWL 1I8LA 4UAOB 3T09A 5IK3B 5J3HC 4YDLB 1UM5H 4JFHE 5ILTL 5KN5B 1MLCB 4K3EL 1SYSA 2HRPH 5B22A 5GSVB 4U2ZA 1LO2L 3RVTD 3ARFD 4XNQA 1MIEL 3OKMB 1H8OA 1YQVH 1HHHA 2G9HA 4POZD 2VXTH 1ZS8A 3SDDB 4FTVB 1KXQE 2FGZA 4JFFD 3BP7A 2WV3A 2EZ0C 3K2MC 5MI0B 2DM2A 3QUMA 4X5XB 3D0LA 4ETQB 2IPTL 1T22B 3CU7A 1ULVA 1U8NA 1KTLB 3QZWA 1AJ7L 2XZQL 1EMTH 5EN2A 1E28A 2VAAB 2FNBA 3J7HA 4PJCF 1RZFL 1Y6KR 4JZJC 1FDLH 1GIGH 3S9DB 2H8PA 4EI5A 4KAQH 4CADB 3BQUA 4LGRB 3QXDA 3O3AB 3DPBA 3O8XC 3SCMC 1IGTA 3QXVA 1KJ3H 2BY2A 4J6RH 1M7XA 3WYRA 4FABH 1C08A 3B2UC 1F3DJ 2YUVA 5KANG 3GSNL 3L3DB 3CVHL 5J13B 3VXMA 4UINH 1UB5A 2BNQB 4GRWF 4M1GL 3OWEA 4XPHL 3H9SE 1A1NB 5INDA 2R23A 4RFNC 4Z7QE 1P69B 4JG1L 1WJ3A 2CLVA 9CGTA 1AGFB 4HFUL 3RZCA 1OB1B 4KDWA 3WLWD 4H8WH 1HINH 2YD5A 4G80A 1GHFL 3CK0L 4GS7B 4YWGH 4X6FA 3GFUA 5M95B 4C4KT 1CDCA 5FYLL 4PTTB 1IILE 5A2LH 1I1AA 3AY4A 2NYYC 2J1KA 3WSQL 1MEXH 5GS2D 2BK8A 1QHPA 2NXZD 1ZT7B 3OR7A 1YNKL 4NZRL 4O9HL 3MROA 4K2UH 3BDXA 4D94A 3TYFB 3SGJA 2E9WA 5HDLA 1XCQA 5MP6L 2R56L 2ESVA 5D1ZD 2F58L 5FECA 3RWEB 1A6VL 5HGDB 4ETYA 1BBJB 1LP9E 4AMKL 2CKBB 4U3CA 3N85H 4ZUWB 4HUVA 4TSCL 3OZ9L 4LPCA 4DVRH 1TQCC 1QFUH 5JPNA 4DGYH 4XWOD 2AKRA 3UTPD 1BJMA 4G8GE 1FNEB 2DM7A 1JMXA 2MMXA 4HIIA 1NC2A 1INEH 3QI9D 2DJ4A 4RDQF 3F7QA 1DBMH 2JB6B 4XNZB 5JZ7D 4XRCB 4F37K 1YN6B 1SY6H 4OD1H 1PY4A 5FHAH 2J88L 3VWJC 4B50A 4CUCA 1DDHA 1OF2B 2CRZA 3IDMB 1I3RB 1ZE3C 3AAZA 4N8CH 3ARPA 4TNVK 3P4OA 3MRDA 3H42L 1YDPB 1LE5B 1Z9OA 3U0PB 4MAYB 4X80H 4XMLL 5HI3D 4APQC 1G7QA 5C0IB 2GFBA 3WXVL 1U6AH 4LLDA 3G08A 3UC0H 1N59B 4HFWA 3BEWB 4ZUUA 4A2MA 4UIKH 4X0KA 3C6SA 4UB0H 2GTZA 3RY6A 4NJAL 1T7ZA 3DYPA 2X4SB 1H3GA 3RGVD 2VWEE 3AC0A 4YXKL 3AS3A 4L9LB 35C8L 3TN0D 1JGVL 3UJTL 5HHPB 5IW1B 3MJ6A 1ZGLB 4BFIA 5KS9E 1KJ2H 4HPOH 3HAEH 2GUOB 4PTUA 5HHXL 1V3KA 4KTYA 3SO3C 4LFHG 3ARGB 1KYOK 2P48B 1DQLH 1YEGL 2X5PA 4XHJD 5F9JA 2HYMA 3TN0A 4YHKL 4PGZA 3CZFA 4RMWA 3V0AC 5J0BA 1DJSA 3JWOC 3CD4A 5D70H 4UOW0 1Z2KA 3ABZA 2Z31D 2ICWB 3LQAL 5JW5B 4JM2A 1ITCA 4JN1L 1MFDH 3KYNB 3TESA 3KXFA 4HIHA 1SM3L 3MRMA 4EN3D 4BYHA 1YYLL 3T2NH 2GJJA 1MNUH 4MD0B 3BP5A 4NUGH 4L4JA 43C9A 3O6MH 4NRYB 1ETZA 1N3NB 3DUSB 2I27N 2ICEA 4AG4H 2I9LB 3TBTB 3TC9A 4R7DA 5DD1L 2Z92A 1N2RA 4RX4A 3V5HA 4JN2A 1RUQL 3OHXB 2CLZA 3NCBB 2UV3A 5DD6B 4XXDB 1T7VA 5CIPH 1S9KC 3DX6A 3KYMB 4GBXC 1GOGA 4FQCL 3O41A 4M48L 5JDSB 3M17B 1JHLH 4OF0A 2PXYC 3LB6C 4JDVA 3O3DA 1INQB 2CMRL 1T2JA 4ZFGH 1IARB 2ZPKL 1GGIL 3FCTA 4TUKH 1AXTH 4MXVE 5EBGA 4CNIB 5E2UL 5J7CC 3QQ3B 4OIAA 5HHME 2C3GA 3RVWD 1KC5H 1BHGA 4TPRL 3QUZC 3V8OA 4UTBL 4PRHB 4P5MA 1Q9OA 1S9YA 5GIRA 1NSNH 2APBA 4OCRL 4PREB 5HYJB 1QO3B 2VQTA 2I07B 3O45A 3EKCA 4PJAE 2VZ1A 1HEZA 2ATPA 1U3HB 2M26A 3O4LD 2DIAA 4IRJD 1G84A 5KVDL 2B4CC 1KUMA 4UV7L 3U30B 1W0YT 1FYTA 2FATH 4ONGL 5FKAB 5KAQG 4XP4L 4K7FA 3VG9B 1FL3B 2R0KL 3QULB 3BGMB 2VDRL 4LASH 1LO3L 5BRZD 1WBYA 2HJKB 4P2QB 4PD4J 3O4LA 3LD8B 4IRJA 4KKBD 5HD8C 1ZT1B 3DV6B 1BVLA 3F12B 2P24A 5T3ZD 1K3ZA 4C57C 4QRPE 3MFFA 2P8MB 4XPFH 3MJ9L 1U93A 4PR5B 4TUOB 2B2XL 2IWGA 4Q74A 3STBA 2ITDA 1UFUA 1IEAB 3ALXA 4ZFZA 3CFKB 3QDGE 1J1XL 3KPOA 4X6CB 5BS0E 2N4IA 1XIWC 2OL3L 2P5EB 3ZSSA 4K3JH 5FF6B 1ROWA 3O2WH 3GSXB 5F70A 3ARRA 3V0WH 2BVTA 3EOTL 1AGEB 4YK4B 1BEYL 5E8OA 3B9KB 4GG8A 5ESQA 5IQ9B 1ZK9A 4JY5L 1C1EL 3G5YA 4QHMA 2V9QA 5GGUA 1CYGA 1U8PA 4BK4A 5GRJL 3BYTA 1KCKA 5D2NC 3QPQC 1FPTH 2HVKB 1T1ZA 3KLAB 3MLYL 1C16B 5ALBL 1MRDL 1VB9A 5BV7C 3V2AR 4YNYB 1M7IB 2XWJB 5E08H 3DURB 1VADA 1HHGA 4N0UA 4IRSB 2NY6B 1ORSA 4H20L 3DBXA 5BXFA 4PJXF 5D7JB 3FFCB 1ZA6B 4KROD 4AEIL 1CE1L 3VI3E 1RPQA 4BZ1L 5KSBA 4GXUM 1X4ZA 1PD6A 5F89B 2PR4L 3V8CA 1XGTA 4LCCC 2YUZA 5DLML 4LVOB 3DX7A 2HT2D 2CR6A 3TVMC 2J3SA 4P5TA 1PLGL 4I48B 1PVHA 4KJPC 4XGZB 4EI6A 4RZCB 3H3BC 3HNTH 3QG6A 5TJWK 3C6LC 3TCLB 5K9KB 4D0CA 4KUZH 2A6IA 3GMMA 1CGVA 3RUGE 5F9OL 3X3FH 5TDNB 4NZJA 4NP4H 3W5MA 4NBYB 1YN7B 4FZ8L 5D1XD 1FHGA 4FQ1H 1JUFA 3LDBB 3UJIL 1S7UB 1NANI 1UA6H 2YD6A 4OF5A 1IQDB 4M9PA 4DFHA 2DWDB 2QBWA 3IDNA 5JXEC 5CZXD 3OKNB 4F9PC 3JZ7A 4YXHH 1T2QH 5D1XA 4P2RB 4I0PC 5F6IC 2IBZY 2CGRH 5C71A 5FYJL 1XGPA 4CMMA 1CWVA 4HG4K 2YKLL 1KGCD 1UYWL 3VU2A 4UDUA 5GXBB 3IFPA 5L6YH 5FYKH 4PGBB 5DVNA 5A43C 5L9DL 1J0HA 2ORBH 3MREB 2FECL 4QRSB 4FFVC 3LRGA 4W6YB 5IB1A 2H6PB 2NY3D 1IVLA 4LP4A 4N1HB 2F19H 3FTGA 5ENWA 1LILA 5ID0B 5I76B 4QHNB 1A3QA 1BOGB 4MHHG 2JJTA 4GXVL 1QG3A 3BVNB 2Y72A 1I7TB 3PQYD 2R2BB 2EH8L 3BMWA 1TXKA 1R3JA 2OR9H 3SE8H 4ELMA 1ZHKA 3T0EB 1RZ8A 4HMDA 1TVHA 1M05B 5FCSH 1BIIB 1K4DB 2VDLL 3FMGH 1HDMB 2HFGL 1OARL 4YAQA 2Y06L 4L4VE 4M4RA 2NY7H 3ULVE 3DRTB 1IRAY 2J6EL 3ZDZE 5L8LB 1FGVL 3PQYA 2A9ML 4K3DL 4FQXC 1GZQA 4M93B 3V9FA 5I1AA 2AJXL 3QFDA 4OGAD 5D8JL 3DHJA 2VE6A 3Q2CA 2OXGA 3PWVB 1NBVL 3P77B 1GC1H 5E99H 1A4KB 5D7KE 1R24A 4JO4L 4GXUN 1O7SA 4LSPL 5FHBH 2OQJA 3A67H 4H26A 1ITBB 5I1DA 2C7UA 5FA4B 4QHLA 3GB7B 4YIQA 1RAMA 1QLRA 4JVUA 2E27H 3TO4B 4C83A 4HLJA 4P2OB 4XB7A 1JGLL 3FQRB 3FQUB 5C0NC 2JIXD 1GGBH 3U7YH 4P4RB 4OV5A 1D5MA 4PJGA 3WJJA 1YMHA 4MGXA 3K8LA 4NO3A 1WEJH 1PSKH 2J8UF 5CBAA 2VXSH 3ESUF 3H3PH 2IQ9L 4G7YL 3QCVL 2P5WB 1L0XA 2VNCA 1VKXA 1JWSA 3QYCA 4JVWA 4MNQD 1OQXA 3DX8B 4J1UB 4Z7OF 2PTTB 3UTTD 3PNWB 5D71L 4XP5L 3FO1A 3IJSB 5CJXA 1KPRA 5BVPH 1YEIH 3BUTA 3UTQB 3TNNA 4NZDA 3T3MF 1ZLWK 3WJLC 4LIQE 4JZJB 4ORGB 4D2NA 1KB9K 2IC2A 2NX5A 1EH9A 4KJWC 4MNQA 4XAWL 1JZ5A 5K9JH 3OF6A 3VXTA 3UTTA 3MRCB 12E8H 4ZYKB 3LIZH 3SCMB 3OKLA 4I2XB 1DP0A 3KHOA 4P9HH 1IGCL 4HUWA 1XF1A 1L0YA 1PAMA 4M5YH 1A9EA 1YQVL 3UPAA 3ORJA 4GUPA 2UWEE 1F4HA 3HC4L 4HX1B 1K3IA 5L0QB 4PBWD 4R90H 5HHVH 5F93C 4XX1G 3MLPA 5DJ6A 3V6OA 1U92A 4MNGE 4LOUC 4Z77B 2VDPH 1O0VA 2CXGA 2H1PH 5E8NB 4I8DA 1UH3A 4M61B 2NZ9C 4RNRB 5TFSH 1HH6A 3B8SA 1VDGA 4RFNB 5CSGA 5E7BA 2VITB 2E9BA 4YFLI 4C59B 3GNMH 5JIKA 4RGOL 4F15C 1KXVC 4Q9QH 2VLJB 5C0AD 5C9KA 3QR2A 5CCKL 3MYJA 3CXDH 4YLQT 4NC1C 5D7SH 4AEHH 4L4TE 4QLRA 1PX3A 1UADC 1GIGL 2AEWA 4G5ZH 2K9UA 4I1NB 1D5ZA 3GMQB 4RFEB 3QQNA 4KAQL 1P7QD 4JFDD 5I74B 5I16A 3OJMB 3KR3L 1KJ3L 2YPLE 4WW1B 3PV6B 3RZWA 3D9AL 1G9NL 3JWDC 5EO0A 1JE6A 1IL1A 1CFTB 1MFEH 3QNXB 4JZOA 4LP5A 4J3UA 3VW3H 4UINL 5EUOB 3RL2B 2PW2B 3M8OH 1F58L 1GGUA 3LOWA 1F5WA 1P7QA 2CDEA 2J8OA 1TQCB 4NCDA 5IT2H 4M1DL 4OUUA 3MLWH 1U0QA 1SJHB 5K33A 3IDJA 4GRLA 1HINL 1ZLVK 5I1CH 5J57B 1SEQH 4M3JA 1JFQL 4H5SB 4R26H 3BKYH 4X8JA 1KIQA 5EU6E 3RJDA 4F7PA 2ATKA 3L3IB 5ESVA 1S7RA 5C0CA 3X13B 4GKNA 4K2UL 3TA3A 4PB0L 2YMXH 4Z78B 1DEDA 4NM8L 5F7MC 3ZE2F 1X5JA 2F15A 3CAFA 2CUMA 5DFTA 4Q0XH 2QR0B 4LHUA 1UZ8B 4LPXA 4NUJA 4Y5VA 1C5DA 1TETL 3G04B 2UUDK 2WW8A 4JHWL 1WFOA 4YHNB 3RWJA 4X99A 3HNVH 1QFUL 4UQ3A 1FZKB 4WU5B 2ZCLH 3HE7D 4KZDH 2CRYA 3QFJA 2AV7A 3WNPA 2EDFA 2CUHA 4UIMA 3K80A 1F4WL 5CFHA 3TYGH 2XPGA 2UYLA 4P59L 3TLRA 4LSQL 1Z3GL 5FHAL 3V0VB 5DR5H 3NFPA 4W70A 1WFNA 1BZ7A 4OF3A 3WFEH 1HIMH 3HE7A 1TQBB 2XZAH 4XCEB 1NMBH 1PZ5B 1YEFH 5D9SB 4S1SH 1BX2A 1P7KA 1FJ1A 4X80L 1GCFA 4U1KB 1S5IH 3C08L 2MSPA 1RQ5A 2F54B 1TTGA 4WV1B 2ICWI 1F3JA 2FB4H 4JFPA 1OAYH 1FVEA 3HMXL 1VFBB 3ZLQC 3HTLX 2WUCH 2XN9B 3KLHC 2BOBB 3THML 2J8UA 1J1PH 2WBJB 2NW2B 1PW3A 3O3EB 4GW1A 4PRNA 3CNKA 3I3BA 4WHYG 1KJ2L 6FABL 3DMMA 2BXYA 5FOJA 2A83A 5DFVD 3GO1L 4U49A 4X9GA 5KBNC 3VDBA 5C6WH 5I0ZA 2NR6C 4NSKB 1JZ8A 4HKXA 2X1WL 5EU5B 3DRQA 5HHOE 4BSVB 5J6GB 4WENB 4UT9H 4IDLA 1YNTB 1AKJB 1FVCB 4GBXB 1KN4H 4Q97A 5AWNH 5D70L 4O02H 2PXYB 2XFXA 4ZUTB 3GSNA 3CVHA 3WDHA 3LVEA 3S98A 3L3JA 1VHPA 4BFEA 1LO0L 3QG7L 5IKCB 4YHLH 4I18C 1WZ1H 3IF1A 1D6VL 1T2XA 1T89C 5ANMB 4CJ0A 4LHQB 2F5AL 1DN0A 3QUZB 2FZ3A 2PYEE 1G7PA 1FRGH 3FQNA 1T4KA 4HHAA 1Q72H 3QCUL 4NKQB 1NAMB 4HZLA 3QWRD 5EBMB 1CDYA 3G5XA 3W0WE 3OXSB 2XZCL 4U4BA 1EHAA 4EOWH 4KTDH 3SDXB 3RKPA 1VEMA 2Q3AA 3R0MA 5D2LF 4PJ8D 3CVIH 3IXTA 2P4AB 1TJGH 1HH9A 2NY5L 4LLYA 1J11A 2NLJA 1LO4H 2PYFB 1NKRA 3WS6A 3EYSH 3ARTA 5EWIH 4DKEH 1I75A 3MA9H 1WT5C 3QWRA 3D2UA 5TDOA 4YZFF 1B9ZA 1VEOA 3CFEA 1FFQA 1JL8A 4Z5RA 4M6OH 2OTWA 3ZTJH 4X4XB 1NCTA 3MRQB 4PJ8A 4Y1AD 4YFDB 5DA0B 5KSVB 2QKIA 3DLQR 4I5BB 4R4BB 5TF1L 3BPNB 4G43A 4HEPG 2I5YH 5CZVH 2BSSA 3G6AB 4JB9H 3MLZH 1MHHA 1CGYA 1YPZA 1NSNL 3JBG7 4TULL 5CJOL 2QSQA 1WBZA 3QEQB 2ICWJ 2UY7A 3UZEA 2YD2A 1XIWB 3GMRA 1ZHBB 4F33B 1QBAA 4GAYB 2FATL 4QY8B 3I02B 3QUYD 2VLLA 3PGDA 1M7DA 3U4EA 1XF2A 4JFQB 5HY9B 3DXAD 3EYOB 1JYNA 1T1XA 3VRJB 4EBQH 5E94A 1H15B 1JRHL 1BECA 4HV8B 4B7IA 3PDGA 3QDMD 5D2NB 5ERWB 3VXRD 4NKMB 1XMWA 5F7KC 5L2JA 4PV9A 2EXYC 1T80A 3M45A 3PABA 3OKYA 2NY1C 3BDBA 2ZSWB 1UM4L 1CTNA 4HS6A 2W9EL 2X4NB 1G7LB 4JVPA 5I2IA 3QDMA 1AI1L 3LKNB 3SBWA 3OX8A 4YFLF 4R2GC 1T21B 3BDYH 5B38G 4K3JL 1OSPH 1VENA 4MVBD 3ARBB 3O2WL 4Z8FL 2HLFC 3V0WL 4S1DC 1EHNA 1FG2A 2EC9U 3VJ6A 3QRFM 4OCYL 3TVMB 5KZCD 1YEHL 3VXME 2HLAA 2CO7B 4NQEA 4LPYA 4AIOA 5I1KL 4QYOB 1A9BB 1CD1A 3NIGF 1F8TL 1PDKA 3GI8H 5C0GA 5K9QI 2V7HA 2DLTA 3LKRB 3X12A 5LAXB 4MD5B 1NFDB 2PUQT 4KRPD 4X9BA 1S7WB 5L2KD 2R2HA 4X5WB 5CKGA 3T65A 1KIRA 4F2MB 4UDTB 3QIUD 1W72H 1AIFB 2R39A 4GQPH 5FUOH 3DVNA 5JHDB 3IXAA 3V6ZB 1G7MB 3CSPA 1G7HA 3GHBH 3FFDA 3T0AA 5HYSA 3SDYL 1DQML 2HVJB 2RGSA 1CU4H 2BHYA 4DTGH 5F7EH 2ZG1A 3RDTD 1K8IB 3KNBA 3SPVA 3QIUA 2ESVE 3BZFB 2DI9A 1V3MA 3TBYB 3L6FA 1K8DA 3F58H 4FN0A 1R0AL 1PEZA 3MCLL 3EHBC 5E2JA 4PD4K 2VZTA 3GIZH 1YY9D 2H32B 4ZFOL 1RUMH 2AK1L 5DQ9B 3M1BA 2IALA 2AVGA 5CUSH 1J05A 5IESH 4Y4HB 1ZVSA 3H0TA 4CVUA 4JPVL 3C5SB 4D9QD 1LO5B 4KMTH 3BSZL 3ZTJG 2IG2L 3C8KA 4A6YB 4S10A 5FOBB 2PO6B 1QA9A 4K9EC 4LKCA 2V5YA 4GQ9H 1LEKB 1NCDH 2HTKD 4DCQA 4E42B 4KQ3L 2MCPL 2AK4A 4R8WH 1DE4B 1U8HB 3OXRA 1IAKA 4DGVH 4JDTH 3BP4B 1T83A 1NUFA 3LMJL 4FQXB 2P8LA 2RB8A 3TJEL 5FYKL 5DHYB 5AD0B 4NQXB 2ORBL 2XRAH 4YHOH 2BVQA 2C1PA 1B88A 1IM9A 4N8PA 4OKVB 2FJHA 3H9HA 4P46B 3GSOA 3MJ9A 2Q7YA 3RTQB 2R29L 3SDDD 5B3NA 5TE4H 4FTVD 4LLWB 4HQQH 1MRCL 2VQ1B 4XP9H 5IK3A 3SO5A 4LLVA 3PGFH 2OR9L 1XEDA 4KHXL 2D9CA 1GJIA 1BZ9A 2OL3A 3JWOL 2PW1A 4P57A 5FB8B 2WP3O 4N8VB 1QYGH 3WEXA 3QJFB 4TSBL 2Y6SC 1ADQH 5D6DC 5D1QB 1PYWA 1VACB 3ULVH 5DS8B 4NKDA 3E2HB 3F7YA 4X5XA 4N0CC 1RHHA 3S34L 4PRAB 3KXFE 4OFKA 3F6IA 3MOQA 4D0DA 1INDL 1UC6A 4MWFB 4DW2H 1T22A 5CBEB 1D5BB 3SJVA 1KTLA 2Z91B 2XXMB 3VGBA 4GT7A 3BGFB 3C5ZA 3MLUH 4P4KB 2FDBP 4ZODA 2VAAA 4ONFL 1G6RL 2E27L 3GIVB 2BNQD 1CE6B 5D7LB 3BP6B 1CIDA 2DICA 3C09B 4ISVA 5D72L 1MCDA 4HBQA 1CGSH 4JHAH 4KPHH 1UENA 4K3HA 1FSKC 4HIXH 3TPUA 3DIFA 1CD8A 5HTSA 2X44D 4NQCE 5EIIA 3PWUA 1GGYA 2E9JA 2F8XC 2IQAB 5IB4A 2W60A 2DLIA 4OGYH 4RMRA 4X7DC 1CXEA 4OIBA 5I17B 1PQZA 1XGRA 4HJGA 4NYLA 3WIFB 3BPCB 2HN7B 3QA3B 4HUUA 4E5XA 4HKBA 3UAJC 3MBEC 5IB5B 3I84A 3U9UB 2GY7B 3N1PC 2OZ4H 4ALAL 5FM4A 4I0CC 3V6FA 4PTTA 4LIQH 2V2WB 5C0FA 1CDUA 1MCCA 4P9HL 4HUNB 3K3QA 4L29B 1ZT7A 2APWA 3PV7A 1FYTE 3BPOB 3TYFA 3T1FB 3D39B 2OSLA 3FQTA 5IWLA 4LRNH 3SGEI 2FSEA 5HHVL 3TZVC 3RWEA 1UB6A 5I1EL 5HGDA 4PJ7B 3BZEA 4KKAD 3DETC 3ECBB 8CGTA 1IM3A 5KSAA 4X6CF 1U2HA 2IMMA 2EYRB 1KCVH 3R4DA 4JFXA 3HZKA 1A3RH 2VH5L 1QSEB 5JQ6L 1F4XH 1FORH 1C12A 3OGCB 1ZANH 2VZ3A 3LCYA 1WICA 4U6HA 3AXLA 5F96L 2X05A 4HGKC 2CDGA 5EIQA 4HZAA 1X5FA 3G9AB 4KQ4H 1SEBB 1UXWA 4XNXL 4MAYD 2G5BB 3LN4B 3P9MB 3RVTC 1TZHA 2DD8H 3ARFC 1EAPB 1BJ1J 3BOVA 3SKNA 5ITFA 1AHWB 4FG6D 3IDMA 3QEUB 5ID1B 3HB3C 3F7PC 4KK5D 1QBML 1XT5A 5F1NB 4YBLB 4OCXL 2V7NA 4KJQC 4G6FB 4MAUH 1H0DA 2VO5A 32C2A 3HS0B 1LE5A 4QXTB 3LS5H 4MAYA 5D5MA 1T5XB 1MAMH 3TH4T 2XA3A 2J6EA 4IHOA 2VIRA 5C2BL 5EC2A 3CPLA 3NTCH 4IMKC 3ARZA 3ROLB 1DLHA 5MENA 3T4AA 2R15A 3ARGD 1ZEAL 3OMZA 5L88H 3I2CH 3HPJB 5IFJA 2F74A 1V8HA 3RP1A 3ROOA 5BV7L 2ARJQ 3RNQB 2MPAH 2J12B 3MODH 4POUB 2H41A 1CXKA 5TPWH 4CN6A 4OLWL 4KRNA 4K94C 5I71C 5BMFL 5MERB 5CP3A 4OZIE 2RFXA 5D96B 1CQYA 1IAIH 4N0UE 2XA8H 3P4LA 5IJVB 3V6BR 4PG9B 2XY2A 2Z8SA 2FEEL 1YECL 3WFCH 3ARGA 5A1AA 1Z9LA