1BVLA

Humanized anti-lysozyme fv
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
116
structure length
116
Chain Sequence
QVQLQESGPGLVRPSQTLSLTCTVSGFSLTGYGVNWVRQPPGRGLEWIGMIWGDGNTDYNSALKSRVTMLKDTSKNQFSLRLSSVTAADTAVYYCARERDYRLDYWGQGSLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Humanized antibody
molecule keywords HULYS11
publication title Structural consequences of humanizing an antibody.
pubmed rcsb
source organism Homo sapiens, mus musculus
total genus 21
structure length 116
sequence length 116
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bvlA00
3RIAK 3MNWA 4G43A 3L3OB 4LGPB 3DVNB 3ROLA 2HJKB 5A43C 5E8PB 3MC0A 1NUNB 1ZGLM 4CN4A 5GGTL 3QH3B 3R1GL 2EDDA 3UX9B 5FECA 3RY4A 2B8OT 5B8CC 1NLBL 3MSPA 1HEZB 3MV8A 4GAYA 1M05B 5CWSB 1OT1A 5DVMA 4Y5XB 5TH2B 4U1KB 1AE6L 2Y23A 1B4JH 4IMKA 4JFHD 4V1DB 1PSKL 4LMQI 2RAMA 3ME0A 5I9QB 1J0ZA 5AZ2L 1CDIA 3I2CL 5DF0A 2Z4QA 4EOWL 3WHXA 1F6AA 1P1ZA 2DICA 4JDTH 4RSVA 1KFAH 3GO1H 2JJTC 2GT9A 5EN2B 3X12A 4WEMB 4IOIA 4BZ1L 3N1PC 3ZE0F 5KJRL 1S9WA 1ADQL 4RIRA 5LGHH 1NBZA 1MPAL 2P5EB 1T1XB 2GJ6A 1AGDB 3QCVL 4YNYB 5H35A 5J06A 1EO7A 1DQJA 4JO1L 2IQAB 5A1AA 4K3JH 3MRNA 3MBXH 2BVOA 4P3WA 4WW2B 4OD3H 1X4ZA 1I7TB 4LCYB 1P2CB 4HUUB 4ISVA 2H3NA 2PW2B 4RWYH 3PV7A 4NJ9L 5SWSB 1C7TA 2EH8L 1YNKL 3EYSL 4IRZL 3MLTA 4Z0XB 2NTFA 2VLJD 3MRIA 5IVXE 1J86A 3BKMH 4N1HB 1NAKH 1SEQL 2YUWA 4ZFZA 5DUBA 5C0DB 2J2ZA 3FQWB 4APQA 1CD1B 3BO8A 5DZLA 4DAGL 4EKXA 1MWAB 4XPGH 4MA3B 1F42A 3NIFF 4KZEL 3FQXA 1A14H 3BPNB 4GRMB 4KI5D 2CUHA 4NSKB 3SGDI 3AXLA 3K1DA 2DQEL 5D5MF 3V52L 3KHOA 1CLYH 3VFPB 5DEGB 1OSZA 3O4LE 4JQVC 2VLRD 3RX8A 3QXDA 4F7MB 2BCKA 5H8DA 2IAMB 1NFDB 1E4KC 2OJEB 1X5IA 2DMBA 3ARDC 4CUCA 3VXSA 1MHEA 1IC5L 1IGTA 2H26B 4A6YL 4HPYH 4X0KA 4ODUA 5CIPB 3HC0A 1ZT7B 2DI9A 5DR5H 4NP4L 1RI8A 4ZOEA 3KGRA 4PRID 4OCYL 4BFIA 1LMKA 4OUUA 1IL1B 2HG5B 2QHRH 3C5ZC 4I48B 2Q8AH 5BQ7B 4KHTH 2DQGH 5F96H 3TBTA 3N50A 2OL3L 3AU1A 1VSCA 4NO0D 2C9AA 4AH2A 1QSFB 4OZIF 3KPRB 1CU4H 3AREA 3EOTL 3QHFH 4KRPB 5E5UB 1VFBA 2CLRB 2DTML 2NW2B 5AZEH 3MGTB 2V2TA 1CE1L 5GGRB 4N0YL 1XH3A 5AG8A 2XA3A 4FMKA 4K94L 4X5WB 4XVTL 1CL7L 2LU3A 4ZG1A 4LPYA 1RK0B 5IBTH 5DJXB 4Y4KD 1BQUA 1BD2B 3NOIA 3KXFE 5LAXA 5FO8A 3BPOC 4JPWH 4XP6L 3HMXA 4PJEF 4KGLA 5HY9A 2HAZA 4KY1L 3LPGA 1QSEE 1MHCA 1S78C 1OARH 1EO8L 3G04A 2XTJE 3PWNA 3HN3A 3VFRA 2VSCA 2AGJH 4L4TB 4NZTL 1IZKA 1EMTH 4ZOCA 1A6TB 3RWGB 2KZWA 5JMRA 1D5MB 3INUH 5LQBH 4YXLH 4JZJC 3SDCB 1A7RL 1RZJL 4NBXB 3HRPA 1J0KA 1DEEB 4K8RD 3QDJE 5C0CB 4OQTA 3KJ6L 3JUYA 4WFEE 4HJ0D 4JY4A 1D6EB 1MHHA 2GUOB 2UWEA 5J13B 1BF2A 1EXUA 4JY5H 2DL2A 3BPLB 5ECJE 4Z7UE 2CDEA 4BZYA 4ODVH 1KENL 4HT1L 4XWOD 5EZJB 1N5YL 3B2VL 4QGYA 3B5TA 4H8WC 4WWID 2ICWI 1HNGA 4OCSL 1LO2H 5F89B 3VI3E 3EDJA 4JJHA 4PJCB 3D39B 3UTZA 1CN4A 4PRPD 1VGEH 3MRPA 2VDOL 2NY2B 1BFVL 3ZE1F 3NVQA 1UYWH 2BY2A 1EIBA 3PWJB 3L9RB 3ULVF 3E3QE 2AV7A 43CAA 8FABB 1E4WH 1I8KA 1QD0A 4NQDD 4RBPH 2PXYB 4OGYH 1IKNC 3TYGH 5TFSH 4MNGA 3X13A 1W0WB 4YDIH 5JZ7D 3ELAT 4PJGB 1EGJA 1YEHL 2OP4H 4XP4H 5FYJH 5IW3A 3DWTA 3DV6A 5C6PB 1X7QB 5GSRB 5L7XL 5GZOD 2GY5A 5B4MD 5IWLC 2GYSA 4YWGL 4YDKH 2EO9A 2BHZA 2PTTA 4FQCL 4NZDA 2M1KA 5GRUH 5K9JL 4PLNC 4MVBC 4Z7QF 1CDHA 1QBAA 3WNPA 3CFIC 1I8LA 1MY7A 5E2TH 1GJIA 1BVKB 1CE6B 2HYMA 2VXUL 3DRQB 4G6AC 2V5YA 4NKDB 4IRJA 4NM4H 4MXVE 4WTXA 2HWZL 4GKSA 1FN4A 3BT2H 4ORZC 4NO0A 1OTUC 3JVGC 3KPSD 2BY1A 3TZVC 1XMWA 5KZCB 1MCQA 1OGAB 2VN4A 5B3JF 1BIIA 3IU4L 2EICA 3QJFB 3RVUD 5DWUL 2DBLL 1QSZA 5I1GL 3HI1A 3HZMB 1RURH 5EC1A 1FZOB 3P4MB 3T2OA 2WBJD 2RFXB 3LQAL 1KELH 3V6OE 4D9RE 5EBGA 1EVTC 2GK2A 1GOGA 4P4KC 4R97C 5I1DA 1VEOA 4Y4KA 2HLFD 3BP6B 3TIDA 4AIOA 3ULVL 2IALA 2G2RB 5HDLA 3X14B 3UC0L 1KEGL 3CGTA 4PD4K 5IGXL 4IM8A 1FO0H 5BO1L 3MCLL 4URTB 1HHGB 1FCCA 3D39D 1DQLH 1FNGB 1DANT 3GMOB 3WNLA 1TVBB 1ZHNB 3RHWK 4H1LA 4M02A 5BV7L 4I5BA 4O51B 5GS1A 4MNHB 4YHIB 3MCKB 2D4DA 4S1DD 4PJIE 1HE7A 4DGVL 2AEPL 3P4LA 4X99A 2QQLL 3EYVA 3H7BB 4HH9B 5FB8A 1L7TL 1PYWA 1HWGB 4U1GB 1I8IB 4CU8A 5EC2B 3JV4B 3OKYA 4YZFE 2NY6B 1SVZA 2DLFL 3R8BB 2DDQL 3UZQA 4DVRL 3ARGD 1TTGA 4IEFB 4PRPA 5CBEB 5DJ8B 3CZJA 1YNLL 5I17B 4CVXB 2X1PA 3Q0HA 3FCTA 4X7TB 3BZ4B 5EORH 1UCBH 2YWYA 3DUSA 3X3GH 3RL1B 2F58L 5CILH 5D8JH 1U93B 2I9TB 1IVLA 4JANB 3MZTA 4RAVA 4LLQB 2HT4D 2DQFA 3C60B 3MUY1 1FFPB 4R26H 3MGAA 1OP3H 1JK8B 4FN0A 1SBSL 1RZGA 3BHBA 4RMUA 3VXUE 1NKOA 4FFWD 5HYJE 3FB6B 4R90L 4MCZB 1DQDL 3RPIA 4FTVD 4OQTH 4YJZL 1UADC 4JRXE 3BRDA 3G6AB 5T3XD 2VLME 5BVJA 4EI6A 1X5YA 4U1LA 5F6IB 5CFHA 5GISH 4XAWH 3IDIB 1ZWIA 4QTIH 1V7NL 1E6OL 2XWJB 5HD8C 2DQHH 4JFXB 2NY4B 4ZAKB 1BVLA 4P4RA 1T7XA 3BKCL 1BIHA 3KPSA 5FYKD 5I1HL 3OR6B 1QBLL 3LS5L 3ULSA 4N90D 2JJSC 3O6FB 3UYPA 4U6XA 1GAFL 5CLWA 1YEDA 4ORGA 3QCTL 4RWHA 4TSBH 3TEUA 3BSZL 4JEGB 4BQ6A 3B9KB 4TUJB 1Q72H 2WBJA 4HV8A 4E5XB 4HKJB 2AJVL 4S1QH 2XNAA 2P5WD 3DXAA 4KKLD 5E9DE 5F3HA 5TDNA 4F15B 5IHBA 25C8L 2CRMA 1QRNB 4B53A 1FORL 1IE5A 1N59B 4TYUA 1JGVL 3ISWA 4ZFOL 4FQLH 3NAAL 3BESR 3PL6C 3RJDA 4UILH 2SEBA 3R06B 1ED3A 1KG0A 3GSRA 1YN7B 5I1KL 3HR5B 1JF1A 1H3UA 2DJUA 4CNIB 1U6AL 4L5FH 4XNYH 4MMZC 5A16A 3QNYA 1N64L 2VDLH 4BH8B 3MLYL 4LDOB 1CZ8H 2NY6D 2G5BA 5DJ6B 1KF9B 5JHDD 4OCMC 2EDTA 3PQYE 2C1PB 2CUIA 4UV7H 4XI5C 4Q2ZA 1A0QL 1TENA 5L2KB 2ICES 2NY7L 4K7PH 4PYHA 5I0ZA 4J23A 1AQDA 4X8XA 3V4UL 3VWJB 2D31B 2C7UA 2GSGA 4NPYA 3TBSB 1G9EA 1UH4A 4XC1H 1VKXA 1AHWB 1U3HB 4O58L 4Q9QH 2O61A 5C8JA 5E8NA 4ELMA 4KTDH 1E6JL 1LK2B 2ARJQ 3FOLB 5MEOB 9CGTA 5C0BD 1HH6B 4QHMB 1CBVL 3ARGA 1DBJH 2EE6A 2ZPKH 1A1NA 5HYFA 4PRDA 1H8OA 3P73B 2YC1B 3CCHB 2IGFH 2EE3A 2NTSP 3OTTA 2GITA 2O5YH 4HWZA 4TVSa 4FQHA 2HT2C 3RY6C 4TOYH 2VAAA 2V5SA 5CSZA 1NEZA 5J6GA 3QUZC 1OAKH 1MFDH 1XR9B 1H3PH 1HXYA 2VXQH 2JIXA 5EPMB 1BREA 3EYQD 4KUZH 1XAUA 4V1DE 4WHCA 1N6QH 4JDZB 4WTZA 3WKML 3QDGE 4QXUL 1IC7H 1K4DB 3HPJA 1AJ7H 2AABH 5TDPA 4ONOA 3SO3C 1A47A 1ROWA 4K8RH 4K7PX 4LSRL 4FTVA 1TZIA 3U30B 1JBJA 2CLZB 5ADOH 1QOKA 3U9PH 1D5IL 3WDIA 2P45B 3B43A 1RU9H 5C9KA 3S35X 3VGAC 2ZCKL 4P49A 3T2QA 4K71B 4F9PC 5D1XB 3VFWA 4PBWD 2P5EE 3RGHA 2DS4A 2GQHA 1A3RH 3RKDC 2EC8A 3D0VB 4OGXL 1IQWL 3TBVB 2J5LC 5A2IH 4G6FB 1I3RA 3OJDB 5SWSE 1N0XL 3SKJH 3KPNA 2QSVA 1HWHB 2IH1B 5L6YL 5D7SL 1J8HB 3SCMB 4U1MB 1PFCA 1UZ8A 4CRPA 4P2QA 2R2EA 4PGZA 5DVKA 2P5WA 1I9RL 1F4YH 1KN2L 5F7EH 1BOYA 4LQFH 3FL7A 1TETH 2H32A 4I18A 3FTGA 5CHNB 3WFZA 3VWJD 1FAIL 1RFDH 1U9KA 2JF1A 4YUEL 5DD5L 1C5CL 3OXRA 1F90L 4HJJH 1HDMB 5J4MA 4IMKC 3GKZA 4LSTL 5D1ZC 1G7MB 3VI4F 4P5MA 4DTGH 5E8DL 5C09E 5IT2H 5GIRB 2JJWA 4HDIA 5JHDA 3BP7B 4X4XA 4R3SA 4E41D 1UZ6E 5DUPH 1QFWH 3MFFB 3L3JB 4M1DL 4DN4H 3WIHA 2FX9L 1R3HB 2VH5H 3OB0K 5I73C 3I50L 4PFEA 1QTYT 4FZ8L 3L7FA 4XB7A 2OCFD 3WFBH 1AGFA 5C08D 4GUPA 3PDGA 3KPRE 1SYVB 4IOSD 1W8NA 2NCMA 2OI9B 4AJ0A 3CX5J 5HXMA 4NRYB 4XAKD 3LEXA 4Y5YB 2F53D 1CGSH 1IAIM 3T0WA 5ENWB 2W65B 2ADGB 3KPQB 4U6HA 5K9OA 4WWKB 5CAYB 4XP5H 5C0BA 3BZDA 1C08B 1RK1B 2VDNL 4L8BB 4XPBH 3TO4D 4BSVA 5BMFH 1XZ0B 3I75B 2V9TA 2XT1B 1OF2A 3GRWL 5D1QC 2ZNXA 3O3UN 1YJDL 1BQHG 3FMGH 1BWWA 3GB7B 3U7YH 5D7LD 1BD2E 4QXGH 1QA9B 1FZMA 2ZCHH 1YEKH 5FGBC 2DRUA 4CMMB 4YBHA 5B22A 3L95A 3LHPL 5EULV 4QWWD 2PYEB 1NBVL 1FNEB 4L4JA 4JAMB 2N56A 4XBGA 4TVPD 3QUML 2HTLD 1QEWB 1B0RB 2OQJB 4W4OA 1U8OB 1RZIA 3MV7E 5JXAL 4JPIB 5CZVL 4QRPE 2EE9A 5A3ID 3FO2A 4O5LH 5C0CE 4DCQB 2VDRH 5FEBA 1RIUH 3MNVB 5JW3H 5KBNC 1EJOL 5D6DC 3CLFH 3ZZ1A 3U48A 4JN2B 3CX5K 3FN3A 2ARJB 2EXWC 2ZUQC 4FXGB 3FQNA 5DC0A 1C5DB 3SKOB 1EERB 5HPMB 4PJ5B 3ES6A 1D5BA 1Z9MA 5E0QA 2CO7B 3QFJB 4NQED 2QEJA 2DL9A 2PW1A 4P2RE 1WF5A 4J4PD 1K3IA 1U8IA 3EAKA 1KB5H 1GGUA 1BQLH 1NGQL 2VISA 4ZSOA 4PJCE 1NGXA 3CFCH 4D8PA 2VZ3A 5CEXA 2AKRB 1EEZB 1YQVL 4MA8L 3Q6GH 1J5OH 1YEJH 1MRDL 5I2IA 4G7VH 1UA6H 3DETC 1XGTB 1JWSB 1GIGH 1JNLL 3AB0B 1L7IH 2AQ1A 3R8QA 2ID5A 2R4SL 4OKVB 1T22B 3U1SH 4L4VB 4PJGE 4OLWL 1N6VA 5ADPL 4ZUWA 4UQ3B 3SDDD 4FHBD 5C9JB 1UM5H 4MYWB 3EOYG 4CW1A 1S7QA 4G6JL 3RBGA 1UJ3A 1YNTB 1JWUB 1K4CA 1HKLH 5D2LB 1CFQB 4PLJD 5CINH 2XICA 1V5JA 3JTTB 3PIQA 4U33A 4PG2A 4PP2A 1J1XL 1FC2D 1OB1B 1M6OB 1A6UL 3VRIA 5IF0B 5FYKH 5HGDA 4U3XA 4LHUB 4XPTL 1CGTA 4YFLF 2B2XL 2CD0A 3FFCB 4P5TB 2VE6B 1NGZB 4BQBA 5DJYB 3U7AA 3IRZA 2BC4B 2H9GB 2F53A 1JYWA 2QKIA 1UWGL 5FGSA 2J8OA 5KG9B 4XPFH 4YC2B 5H37H 4L3CB 4QHNA 3IDXL 4F7EA 2XZQL 3TO4A 3UJTL 3V0WH 1Q9KA 1MCSA 2P24B 4LARH 1L6XA 3IFNH 4A2LA 2H32H 1YECH 5DRWB 1MI5D 3PGDB 2VQ1B 3IAQA 4J3TA 5D7LA 2NW3B 2Z93B 4I0PB 5D5MA 2XQYG 4P3DA 3X17A 1ZGLA 2VERN 3WUZA 2YOCA 5HHOD 4M7LT 1KB9J 1SMOA 1ZS8A 5CEZD 5IHUL 2DQUL 2EDXA 4XP9H 4ZMAT 1D6VH 1JZ2A 4OGAD 4AK1A 1S7XB 3ZKND 4G8IB 5I30L 3GNMH 3MRGB 5T33H 1A7QL 4Y2DB 4FQ1H 3C5SB 3FFDA 1XF3B 3MRHA 1ZAGA 3VW3H 4OFPA 1ZGLP 8CGTA 1KUMA 2I5YH 4KXZI 5JDJA 3WEXB 1OSPH 5E4EC 3PGCB 4PJXF 4PLOB 3WHXB 4FABH 3X12B 4X5XA 4NNPH 4IOIB 4I2XB 4HFUL 1S9WB 3MODL 4XP1H 2Q8BL 4RIRB 3S4SG 3IFOB 1HHIB 4NQEA 2X4PB 4J4PA 1OAYL 3UMTA 3BE1L 1MREH 32C2A 4YHKL 4KJYA 1DQJB 1T2JA 1DFBH 3OKOB 4V2CB 3OQ3B 1HYRC 3ARSA 3DTXA 12E8L 1A4KA 1LVEA 1WAAE 4C83A 1ACZA 1K6QL 3G6DH 4JFED 1J18A 2H3NB 4UIMB 3VI3F 4D0BA 1KCRL 4LVHC 3KPOA 4L1HA 5C0FB 4JB9H 3RY5A 2APWA 4Y4KC 2BJML 3SN6N 1T7ZA 3NIGE 4YDVB 1LE9A 1WJ3A 5EOCJ 5D7IE 4KK6D 1U41A 3PWUB 3TO2B 4M5ZH 2ZOKB 2C4FU 3FQXB 2WBKA 4WW2C 3QFDB 5E6ID 3SDDA 2X4TA 1JWMA 1OLLA 4G5ZH 1RUPL 2VDQL 1EEQA 4DGIL 4KQ4L 2BVUA 1G7JA 4TUOB 2IFFL 4JFOB 5K33A 4B50A 5JHLL 2X7LA 1A7NL 4K8RC 2JE8A 5K9QI 5DURB 2DTSA 3LVEA 5DYOA 4LCUB 5D96B 5CJOL 5GS1C 3IVKA 2OJZH 4X0KB 1WFTA 4TQEH 3HC0B 3HCVB 3ARFB 4XWOC 5A2LH 4X4YB 3BW9A 2B1HH 4LLUB 3BN3B 2Y4SA 1O7VA 4JREC 1FNAA 6FABL 1ZHLA 3BJLA 4PV9B 5TF0A 4Z7WB 4QXTA 5TGBA 1Y0LA 5FIEA 1RJYA 1ZVHA 1I9IH 5CEYA 2CKBA 2XFXB 2LV4A 3K4DA 4OIIH 3VGHA 4ZNEE 1FL3A 2EKSB 1C16A 2YPLB 2XZCH 1MI5A 4JCLA 2R0WL 4IMLA 5INDB 1JPTL 3KG5A 1PJ9A 4HS8H 1ERNA 3NFNB 1FIGH 1UM4L 1AO7B 1NJ9A 4Y8DC 1F2XK 5JZ7C 3DHJA 2ZSVB 1VACA 2X05A 3SJVD 2BNUA 1LEGB 1I85A 5DVNA 3VWKD 5DD3L 3DX8A 2HJFA 2HKFL 5GZOC 3JV6B 5B4MC 2BFVH 1TTUA 3NZ8A 5ESVB 2NX5D 4F9LA 3MRJB 4JHBA 4RGMB 3NABH 5L2KE 3KYKL 5GGVL 4AEHH 1KJ3H 1JHLH 2DWEA 1H9VA 3GJEA 3I84A 2HVJA 1ZLVK 2X4UB 4XVJL 2PO6B 5EA0H 5C0AD 1IBGL 3H9SA 2YUXA 1ZLSH 1S7UA 2P7TB 4HQQH 3NA9L 4YE4L 2X89D 3NIDE 2XY2A 4R9HA 4U3CA 4OZHE 4MLIA 5I76A 1D7FA 2W0FA 3PNWA 4M48L 3RVUC 3H3KA 4RRPA 1T7YA 1ZLUK 4TSCH 1TJIL 4NKOB 3IETA 3QUYD 5LGJA 4TNVF 4JFEA 2H8PA 3OAUH 4XCNA 2R69H 2WBJC 3SDCC 3GUTB 3MNZB 5C0JB 3EZJB 2F19H 5HI3D 3MLXH 5FGCB 4MJ5B 1MCJA 4P3CL 4YXKH 3VFTA 5J13C 4CGTA 2HLFC 2I9LA 5CZXD 3BPLC 2O5XL 4D2NA 3FB5B 4GBXB 2JK5A 2IPUG 1HHJA 4Y16B 1KPUB 4KRLB 4QOKB 4DWHA 2A83A 4HX1A 5E6IA 1XF2A 3WLBB 2X4NB 5DRZA 4P9HL 2BOCB 4Z7VB 4TVPH 2APBA 2FEEL 4CVWA 5JXEA 3SOBL 5GGRY 4BZ2H 2XZAH 4EN3B 5ID0B 2W60A 4I77L 4DKFH 2A9ML 3IDJA 5I16A 2XYCA 1WZKA 4AG4H 1PG7X 2ITDA 3BN9D 3C8DA 4KAQH 4PRNB 1IGMH 1AKJB 4S1DC 1FVDA 3TJEL 5IOPA 2YN5A 2J4WL 1L0XA 1DCLA 3K2UH 1A7OH 2V9QA 4KMTL 5E2UH 3PDOA 3GHEH 3MRRA 1T0NB 4RCAA 5IB4A 3L3IA 4IRJB 2YD9A 4X6CF 3PABB 2YD3A 1OP5H 1ES0A 4K9EH 2ESVA 4OI7A 4J1UB 1QYGL 4GAJH 2QADB 3NCBB 5MP6L 3ARGC 3DVIA 4JRYB 3DYPA 5IEKA 2UZIL 3ZDXF 2Z91A 3TNMA 1I7ZA 1F3RB 4ZFOA 5ICYA 2HFEB 4BKLB 5ISZD 1A3QA 1ULVA 1S7RA 1JZ6A 2RJMA 4U1JA 1LQSR 3IAGC 3I9GL 2HN7A 3HI1B 1CFTB 4EUPA 5EU7E 5EU5B 1VENA 1XGUA 4ZUTB 3EOAA 2IPTL 1HINL 1YPZE 2HT4C 2VIRA 1QR1B 3MRBB 3QXAA 2FX7L 2BNRD 3SJVA 3VWKA 1IQDA 5HHPB 3E6FB 3WFDH 4P57A 5D72H 3WFEL 2A2QT 4FFWC 1RJZA 2NX5A 4RNRA 2YK1H 3QI9B 3KJ4C 3JBG7 4FQPA 4NO5B 1MVFA 4H26A 3LKRA 1LEIB 3T4YB 1AP2B 3IJSA 2XQBL 5IJVA 3VFMA 2R2BA 3T1WA 3HE6B 4JM2D 3HAEH 4H1LB 4Y16D 5E7BA 5KVDL 3T77B 3MV9D 4HBCH 4I5BB 4HZAA 3LS4H 3MQIA 3QO1A 5GGQH 4AQOA 4LFHG 3E0GA 2CKBH 5HHNA 2X2YA 1NCCH 3QUYA 5T1LB 2VDPH 2XN9D 3FO9A 3PP3K 4EN3D 1HIMH 3AMLA 3KPMA 1PYWB 5IB1B 5IW6B 1EUUA 3S3PA 1HOCB 4XXDA 5EO9B 3MO1A 1F4XL 3P0VL 1OD9A 4XBPB 4KKLC 3FOMA 4PJDB 2AJXH 3OKDA 4EDWL 1VEMA 2XXMB 4U1SA 4C56D 5T5NF 4I18C 1G9NL 4JFYA 1JGDB 3NN8B 1F00I 2YPVH 1SQ2N 4PRBB 4ZTPH 5CEZH 1IKFH 4KC3B 4GW5B 1FFNB 3RIFK 2LAGB 2VQUA 1Q94A 2EIDA 3CFEB 2PYEE 1F8TL 1BX2A 2C3GA 4UV4L 1MUJA 1E28A 4NWTL 1NAML 2ICCA 5CD3A 4NZRL 2NY6C 4XHJD 5HGAB 3QQ4B 3MJ9L 3GSUA 3RWEA 1G7PA 1U8PB 1QLEL 1RZGB 5C92A 3TYFB 5GJTL 1DUZA 1UCTA 3GIZH 1LP9B 4QNPF 3VH8A 5FCUL 3Q48A 3KYMA 3ZDYE 5MHSE 4KJWD 3SDXF 5IMKB 5IW1B 2YXFA 2QJDA 5E8EA 4Y1AD 2LTQC 3C60C 1N6UA 4JN1H 1RD6A 4ZS6D 3PDDA 4L8CA 4Y5VB 1CD9B 1BVLB 4P4RB 3UTPD 3T0ED 4NHCH 2FJHA 2BK8A 2R1WB 4LVOC 2ZNWA 3EFDH 1LDPL 2P4AB 5ISZA 3N1MC 2ZUVA 3OSKA 3F12B 5F6IC 3SE9H 5D93B 4M6ML 4CMHC 2GK0B 5DD0L 4NNXA 3QG6B 3IFLL 4J3VA 5I71B 2CK0L 3GJFK 4KHXH 1N0LA 2F5AH 4MJ2A 4L4VE 1FHGA 2XNAB 5SX5K 4GMSL 3F58L 2AK4D 2BNRA 4HIEA 4LRNL 3HUJB 2OZ4A 3MRCA 4UBDD 1HCFX 3TCLB 1ED3B 5D2LE 3G5XA 3AC0A 1R5VB 4OT1L 5EOCL 4HWBA 1KCKA 3KVQA 2A6DB 2FYYB 1JF5A 3RNQA 3UTOA 2EH7H 4HGMA 4KU1A 1ZKAA 3UTTA 1F3JB 3T3PE 1NL0L 1UZ6F 2XKSA 1QSVA 3SKNA 1SY6L 4QHKJ 3FFCE 1BJ8A 1EAPB 4Z76B 4Q2ZB 2E7LC 1FL5A 4HS3A 4N9OB 4HCRL 1SVCP 3MV9A 4L8SA 2YD1A 2JCCA 1NC2D 3GSQA 4M1CD 1T21B 4BFEA 3QEHA 2E7CA 4MDIA 4X80H 1JI2A 4PJ7A 3FHQA 3FO1B 2QQNH 2XN9A 1BJMA 5FKAB 3QDMD 1INQA 2XY1A 1MH5A 5F1SA 4LVNB 3L5JA 4BSWB 4G9DB 3DUUA 1NMBL 3RAJL 5J1SC 1SM3L 2DM4A 3UO1H 5GS0D 4MD4A 5IMMA 2F5BL 2VZOA 2AJZA 3PWVB 3B9AA 4OB5H 4C56A 1CK0H 1RZFL 4HK0B 4NC1E 3QWRD 5T1KD 3NFSL 4WFHD 1KLGA 3VWJC 3ARVA 1DANU 5J56B 1YUHA 5EFIB 3LSOA 3CPLB 3QR2A 2AV1A 15C8L 1P6FA 5C0EA 2DYPB 2A73A 4ZD3L 4UTAL 2EDHA 2MPAL 4K2UH 2BZDA 1UJ3C 1QLFA 4G9FB 3IDGA 3C08L 3BXNB 4AIXA 3H3BC 2BSRA 1JV5B 5ESAA 3NPSB 3U0TA 4LCCA 3MLZH 5FYJE 4GT7A 3EYUH 4N0CD 5IMLB 5L8KB 1A6ZA 3GSWB 3L6FB 2E7HA 1T5WA 2YD2A 3RUGB 2Q7NA 4WV1B 1JNNH 2AJSL 3I6LD 1XCQB 3RZCA 5IBUB 5GGSA 1QHOA 3T0BA 4JFDB 4M43H 3O4OC 5ILTL 4Z95L 1A1MA 3DV4A 5DI8B 3IB4A 2FGZA 2GJ6E 4WGVB 3T8XA 1R3KA 1TFHA 1YY8A 2QTEA 1J11A 4P5KA 5E6ZA 2VDMH 1TVHB 4G3YH 3T0EA 3TO4C 4ZUSA 1I3RB 2NXYD 2W9EH 3VD7A 4AENB 1FPTH 2FGWL 3QIWB 1IEHA 5FKPB 4OCXH 4ZFGH 3F7PC 5GJSL 1A1OB 2Y72A 3BH8B 4K71C 2O93L 1OAZH 1YEEH 1KIUA 2HTKD 2OR8A 4P2QB 3VMPA 4JLRB 1G1CA 2HFFB 3HS0A 3QEQA 3KS0H 1JZ3A 1GH7A 3L3HB 4QWWC 7CGTA 2AK4A 4GXUN 2ZCLL 5CJ8A 3FTGB 3N85L 3CK0L 3FRPA 5EBWB 4LSVH 4QT5B 3HZVB 5JIPA 3MOBH 2HTLC 3LEVH 2R29H 4LOUD 1TNMA 2G60L 1CCZA 1Z3GL 5A3IC 1Z0NA 4P5MB 1QBMH 1GGYA 2VZVA 1WWWX 1AD9A 3VXSE 2A74A 1NC4D 3QO0B 3HNSL 4OLYL 5LBSH 5DC9B 4CN1A 5MENA 3I6GA 3AS0A 5K9KB 1C8PA 3QA3A 5CJ5A 3B83A 1V7ML 1FIEA 1MCFA 5EBLB 2R8SL 3QRGH 4NGHH 3PHQB 1NC2A 1U36A 2DYPD 4O9HL 5F9OH 4GKNB 2O5ZL 2Y7QA 4J4PC 4O2FA 3WHE0 4XBEH 2XPGB 4GUPB 5CCKH 3HB3D 3X11A 2P43B 4K9EC 3QDMA 1GGBH 1I75A 4I8DA 3REWA 1WWBX 4NQXA 3UJJL 2EIEA 1YMMB 1CD0A 5BVPH 4PJ8D 3C9NB 1MJ8H 3AAZB 1T83A 1I8MB 1T5XA 4M93B 4BSVB 5E56A 5T1KA 3QWRA 4ONGL 3HNVL 1G7QA 4X9IA 5ACLA 3D0LA 5H94B 1X5JA 1AO7E 4ODXB 4NRXA 1TTFA 2VZ1A 1S7TA 1AXSB 3GK8L 1R0AH 3SDDC 1P7HL 3HG1B 3MBEB 3VMNA 4Y5YC 4YXHL 5I15H 1FZMB 1QPXA 4PTTA 5HVHB 4OAWA 1UKTA 4ZPTB 1WC7B 3OKEA 1K8DA 2IAND 3FJTA 1BGXH 4PLJC 4WY7L 2EKJA 3KPLB 4YH6A 2ATPA 2QSQA 5CS7A 4NZUH 3QIWD 3B6SB 1CF8H 4XBGB 1S9YB 1YDPA 4LVEA 2R0KL 1BJ1J 3SDYH 4FG6D 5D71L 2DM7A 2JB6A 1W72L 1TJGL 2GAZB 3MUJA 4F2MB 2WUBL 1HHHB 4XCYB 3M17A 4LIQH 2UWEE 1JPSH 1INDH 5CJBA 1KGCE 4WI7A 4G42B 5EU6D 3L5XH 5DJAB 5C6TH 4CADB 1SJHA 4HUVB 2VXTL 1C1EL 5IVOA 2PW1B 5EZLA 3VXRB 3WXWH 3O2VL 4KROB 2BMKA 3QQ9D 3LKNB 4F57H 5E03A 5DRXA 5F9WB 5CP3H 4ZSOB 5LCVL 2RCSH 4J7RA 4D8PB 2ZUYA 4ETYA 3O3EA 2A1WL 1CFNA 2P49B 4DOHB 4QOKE 4J3OC 5FK9A 3M1BA 1G6RL 4Y4HD 4KI5E 4FNLL 3S36L 1KTDA 4Z77A 2B1AL 3N06B 4HC1H 3O3BA 4JO2H 4XCCH 1JGLL 2FH8A 4MNGE 4OGAC 2XXCB 2ORBH 3ZKNC 1U8MA 2W07A 5E2VL 2VABA 3BMVA 5J89A 1N3NA 5CJXA 4G8GA 1QKZH 3DVGB 3L3DA 5IK3B 1ZHBB 4OCWL 2DQIH 1I1CA 4F9LC 4A6YB 4CW1B 1S7QB 5IFJA 1CGVA 4IDJH 2W9LA 5IFHH 1NCNA 4Y19D 4PJXA 3QWOA 1NC4A 1CXFA 1JGEB 4R2GB 4U1NA 3AB0C 3PHOA 5DD6B 5BJTA 1BEYL 3S34L 2MFNA 3GHBL 1J87A 2DWDB 2OL3B 3OHXB 2FR4B 1NUFA 2BSSA 3F7YB 4AZ8A 2BERA 3G08A 4LSUL 1BQSA 4KH2A 1INEH 1P9MA 1VADA 1XF5A 2EDFA 1T03L 1ZHKA 2D4FA 4TN9A 3LIZL 4YPGA 1JIBA 3S5LA 1A5FL 5HHVH 1ZOXA 1E27A 2FB4H 5AUMA 1GC1C 4Z78A 3RKPA 3VFGH 3HFML 3G9VA 2ZUWA 3RX5A 4F7PA 2EDBA 4LPXA 3MX0A 2AQ3A 3BH9A 4H0IA 4KK6C 3WFCH 4NNYA 5F7YC 4GAGH 1NCDL 3ZT7A 2LAAA 5E6IC 1QNZL 3OPZH 1DN0A 4XVSH 4M8QA 3CVHA 4P3DB 4PUBH 1EHLH 3QPXH 2IANA 3UTQB 4QY8A 4MQ7A 4M61B 1I1YA 3PGFL 1OD7A 3VXRD 3O3DA 4MJID 2AEQL 5E00B 4OLZL 5M7QA 4EI5B 4DUWA 4R8WH 1T1YA 4LHUG 3QULB 5JR1L 1J7VR 4OZ4A 5HVWA 5MEPA 3GSXA 1WCQA 2CDGA 5IIEA 4GRWF 4TSAH 3DRTA 2NY3D 2P8LA 3L3GA 2Z92A 2DMKA 1IAIH 2VTFA 5DD1H 3ZHDA 2EYSA 3GIVA 3OXSA 4IIQB 3O6KL 4KK8D 2NY5H 4JJ5A 5EU6A 4OZIB 4GG6A 3H0TB 5K93A 1BBDL 5GQBA 3U0WL 5L2JA 1Z2KA 5GS0H 1MCIA 3LAFA 3D25B 4M7LL 1GGCH 3OKMA 1RZ7L 4KJYB 5I1AA 3DSFL 1QLRA 5F88B 1G6VK 1L4IA 3PP4H 4GLRH 4ZUUA 3VRLF 2E3VA 4YHLH 1A4KB 4PRPE 4JCMA 1F4AA 3Q5OA 2F54B 3GSVA 1HI6A 1S9XA 1KBGH 4H8WL 4QRTB 4ERSH 3DROB 4PRHD 3P3YA 4Y4HA 4LBEB 4XRCB 3ARZA 2EXYC 3FN0L 2ICWB 4DN3L 3ECBA 3VWKC 4Z7OF 4D9LL 3LKQB 3VXMB 4PJEB 5IFAH 4PJHF 4KV5F 2AXHA 4YBQD 3EO0A 4BQCA 1PKOA 5FHAL 4UDUB 2L0DA 4L3EB 4F8QA 5C2BL 3OJMB 4FP8L 4WNQA 4OM1L 4JFQB 1XGYL 3QSKB 5J3HD 3O41A 2DQDH 5IMOA 1Q0XL 1TQBB 4YHNA 2VZSA 2OTPA 2CDFB 3IVKB 4ZPVB 1HNFA 2MWCA 3KPSE 4XXCA 3V6FA 1Z9OA 4HKBB 3QUYC 1PX3A 3L7EA 1RIHH 2JTDA 5DSCA 3SKMB 3ESUF 1ZE3C 1L0YA 3BIAX 3IFPA 5KAQF 3WNNA 1NPUA 1AD0B 3U82B 1K5NB 3BQUB 4FQQA 3MV11 2BOBB 2DJSA 5HI3C 3CSYB 1NGWA 1T4KA 1MLBA 4WUUB 1MCDA 3QG7H 3ARFC 3ALPA 3UP1A 2Q1EA 3DXAE 5I1CH 4V2BA 1MELA 4X9GA 5I6XC 3MJ8B 3IXTA 5T3ZH 2V5TA 3ARXA 1GYAA 3HTLX 1OOAA 3AUVA 1CIDA 5C0IB 1NJ9B 4QRQA 1FL6B 4U1IB 2X6MA 2R1YA 1CDYA 2X1QA 5TQ0L 5FAAA 4PIRF 4KKNA 1AXTH 4MJIA 4RGOL 2VB5A 4X9FA 3V0VA 5AWNL 4P59L 3GMNB 1T2QH 4LLWB 2GJZB 3BN9C 4N5UA 1ETZA 1H8NA 3NZ8B 3ZKXB 2MSPA 5BV7B 3MR9A 4GMTH 5HDQL 3LZFH 2FATH 1DTUA 2G9HB 4U6VL 4KK9D 5JOFA 3OB0H 4ZS7H 3QEUA 3MLWH 1AGBA 4JY6B 5KVGH 5EIVA 1BBJA 3C6SA 3MRDB 4X6CA 2R4RL 5ESQA 3LN4A 5HHQA 3RX7A 2EYTA 1A8JH 3RWIA 3QP3A 4N8PA 4PGBA 3H9SB 1R3JB 3MMEA 4QRSB 4YQXL 3WD5H 1RUML 4ELME 1N7MH 3IDMA 1NCWL 1RULL 2I25N 1AFVH 4M6NL 2FO4A 3P9WB 5F9DC 1Q9WB 2EO1A 3P0YH 1JN6A 1IC4L 4WEBH 3BGFC 1N5AB 4M6AA 4NQCD 4R4ND 3VFSA 1NAMA 4PRHA 1XIWB 4GXUM 3N1QC 1MJ7L 4J3WA 2RHEA 3ESVF 2AJUH 3S8WA 5IG7B 4LU5L 4MWFB 4HEPG 1J0IA 3MJ9A 3ZYIA 5I1EL 3O3AA 5FOJA 1R5WB 5AEAA 4G9FE 2K1MA 2Q6WA 2JK5B 4DFHA 4OFKA 1HHJB 1YMHB 1WZLA 3GSNA 3C09B 1XF2B 5FUOH 4XVUD 4M5YH 3GMPA 1FNLA 3WIIL 43C9B 1X4YA 5JDSA 1CICB 2VITA 2W60B 3RUGE 2EDOA 3ZDZF 1UQSB 5T3XE 4JFPB 4JM2C 4OIBA 4TPRH 3NGBB 4Y16C 5LVEA 4JFDE 1QQDB 4L8SC 2F74A 3FZUD 5I8OH 4YBLB 3FONB 4LSPH 5IOPB 5LGKA 1ITBB 5FUZH 1JRHI 3PDOB 4N90E 2Q7YA 4EN3C 5EO0A 4KRNA 3IDNA 1BP3B 4P2OA 3TH4T 4LCWD 4JDTL 2I07A 5TE4L 1KFAL 3GO1L 4DZ8A 3U6RA 2Z31B 1GVIA 3ZKSD 5ACZA 5B38A 1G1YA 4UDTA 1FLRH 5TQ2H 3MROA 2AXFA 4P2QE 1G7IA 5SV3A 3WCYA 2Z91B 1I7ZB 4ZFOB 2P5WE 3HMWH 1MRFH 3MBXL 1CTOA 1IGYA 5GRJL 2VYRE 4OD3L 1OAXH 5KVFH 2J6EL 1WWAX 4RWYL 2CIIA 3B5HA 1KV3A 1P7KB 4PRAA 5EZOH 1NGPH 2R56H 3ZTJG 3SKUD 4XHJC 1FFOA 1NAKL 2VIRB 4ALAL 4RX4D 1OQXA 3CUPA 3TESA 4PY7A 3RU8H 4LCCC 2KDGA 5TE6H 1MEXL 4QF1A 5T5FL 1A14L 4HCRA 1NLBH 1RJZB 4PS4H 3CD4A 3UROR 1MVUA 2AW2A 3HPLA 3LRSA 1XGQB 5IROA 3SDXA 1AE6H 4KJWC 1FVCA 4MXQD 2XQYK 4MNQB 4LLVA 1CLYL 1LHZA 1DDHA 3V79C 3D18A 4J3SA 5JA9A 4NO2A 1X44A 3AROA 4G8FA 4M00A 4P23B 2FZ3A 2R2BB 2A6KB 3I2CH 5DK2A 3T0EC 4EOWH 1KJVB 3GJFB 1YMME 1ORSB 4HPYL 3O8XB 1FRGL 4PJAA 3QO1B 3SQOH 4LLYB 1VFAA 4LLDB 1C7SA 1I4FB 1MPAH 2DIJA 3KLHD 4DVBB 2QHRL 2DQGL 1I1RA 4NQCA 3MO1B 1WIOA 2NY1B 3PWPD 3EYOA 3FOMB 4POZD 1MFBH 2YBRA 4RGNB 3TCXA 3QHFL 4NJ9H 4F33A 5AZEL 4KQ3H 2HH0H 2ATKA 2VLLB 1MJUH 4XNZC 4AT6A 1A9BA 1KJ2H 4HUWA 5F6HI 1EZVX 4DAGH 5LXGL 4KZEH 2WK2A 5EDXA 1IC1A 1CD8A 2R0ZH 3STZB 2DQEH 2IMMA 4FXKB 4HUMB 1UWEH 1XCTA 1CXEA 3RWEB 3QIBA 4H1LG 4PLKD 2BSED 4JPWL 2MCG1 1JUFA 5DMJB 2DBJA 4M1CC 3LMJH 2V9RA 3QUXA 3MLPA 4UB0H 5SWQA 5EUOB 3BGMA 1OARL 3DI2B 1CT8B 3LCYA 4A6YH 1HCVA 2AGJL 2C3VB 2ENSA 1EMTL 3MA9L 2G75A 4FZEL 4LCWA 3INUL 1ZLWK 1KNOA 3W9DB 5LQBL 3MLUH 4DQOH 2ADFH 2PCPB 3SGDH 4HLZH 3CFBA 4ZSOE 5GS0C 2FJHB 1Z5LA 4AIZA 3VFUA 3BP4B 3HC4L 4WI6A 3RGVD 4JY5L 5FM8A 4ELKB 2OSLB 3K74B 4M8VA 4DOHE 5INCB 1L9MA 4OZFA 2QSCH 1UACH 1OW0A 4N0YH 2HJLA 4HGWB 5BW7A 5I66B 3O6LH 4Y5VC 5E8OA 1S7SA 4DGYH 1LO2L 1FNSH 4HFWB 3VA2C 3S37H 4RX4A 5EO1B 5LWYH 1VGEL 3UBXB 2YR3A 4JPKH 3QIUD 2R2HA 4MA1C 1EBAA 2EEBA 3O8XD 5D9SA 1UYWL 5JPMA 3T1FA 4N0CC 3EO1A 3U46B 3WN5A 4UT6H 2FD6H 2HFGH 1TZHA 1P7QB 1DVFB 4OV5A 4OGYL 4YDJA 1RMFL 1TCMA 5TFSL 3TYGL 5DMKA 3ZE0E 4G8EA 2AJ3A 5HGHB 4OZGB 4YDIL 2MCPL 3QB7C 3MUGA 4XNQB 1ZT1A 3ALXA 2OP4L 4XP4L 5DS8B 3SKNB 5FYJL 5CUSH 4CVZB 2WNGA 1AGCA 4NZTH 5KN5B 3EOBA 4XAKE 2FL5B 3IGAB 5ANMA 4LKXB 2P48B 2F53E 4IJ3C 1RZJH 2NXYC 4H20H 5GRUL 5HYQB 3WO4B 5DQ9A 1QO3A 1U92A 1I1FB 2K7PA 5E2TL 4M1GH 3DBXB 3KJ6H 2GCYA 1EVUA 4JHWH 4O00A 4NM4L 3IKCA 1INQB 1CFBA 2HTKC 4FQXD 2VWEC 1JHTA 2WINA 3BT2L 3B2VH 3PWPA 3NIFE 1KPVA 3OJVC 3GM0A 4BUGA 1AR2A 2AJZB 4JDVA 5D5ME 4JVUA 1Y18B 3WNOA 5CJXC 1RURL 2VR9A 3QUMB 3G6JA 5IB3B 4LOUC 4LVNC 3VRJB 4PB0H 2HVKA 3TNNA 1T20A 4EXPX 3RJQB 1XR8A 1KELL 1VGKB 1W72A 3T09A 5DUMH 4J8RB 4F3FA 1TJHL 2YD5A 1D5XB 3D69B 3VFVB 2BSRB 2I60L 4HUKB 2BNQD 3U0TB 5CBAA 1MCOH 2HLAB 3FO0H 3X3FH 1HK6A 2IPUK 3SGEI 2JJTA 4X7CC 4HJGB 1ZLVH 3TT1L 4YWGH 4OZIE 1P9MC 3EDFA 3O11B 3HB3C 2JB5H 3ILPB 5K9JH 2E27H 5GGSB 4NQEE 1KPRA 1A1MB 1R3LA 5HI5D 3P9MA 4PJ8C 1T1ZB 2HT3D 3VXNA 3W0WA 3NPSC 1YY8B 4YHYB 1ZLUH 3STBA 4GW1A 1M7DB 2BP3A 1G6RA 3BAEH 1K85A 2FEDD 1IRAY 3QHTC 2F54E 3RGVA 2FJGB 5KSBF 4EEEA 4ZYKA 4GRLB 3SGJC 2J8UB 3U0PB 3SPVA 5C0GB 4JHZA 4HIXH 1NEZG 1QUNA 5DWUH 2DBLH 5DQJB 3HS0B 2YS4A 3SDAB 3V6ZA 2R9HC 1Q1JH 5GPRA 1R24A 4J2XA 5FA4A 7FABH 4JZOB 5JW5A 4WTZG 5DJ0B 4PGDB 4MDJA 3QIUA 4JQVA 3QIWC 2A6IA 4K23H 3EFFB 3P9LA 2YA0A 4WO4D 4JQXC 3UTSD 1WTLA 1UCBL 5EORL 1E4KA 4FG6C 5J7CC 3X3GL 3HMXL 3ARDA 1ZVSB 5D8JL 1DE4B 1A7BA 4E42B 4Q9CA 4MCYA 4U1HB 2A74B 1FV1B 5FYJU 1SYSA 3PWLB 4U2ZA 4R26L 5MENB 4B7LA 3NA4A 1I1AB 3WNKA 2HMID 4QTHB 3BVNB 5HPOA 1MY5A 4YK4B 4O02H 1XGRA 4OQTL 3WE6A 5IVZA 1B0GB 4GO6B 3QQ9C 3TZVD 1BPVA 4L8DB 3MRKB 3OKNB 5DDHB 3T65A 3X11B 3S97C 4XAWL 3VXTA 4QTIL 4NUJB 4MAYB 3ZE1E 1CFVL 4FQXA 2AEPH 2DQHL 4ENED 1J12A 1B0WA 4OCRH 4OKDA 5C7XL 3ULVE 5ICXA 2Q76A 1CI5A 2Q86B 4E0RA 1MI5E 2X4RB 4NQSA 4UIKH 3NACH 1IGFL 4UINL 4C4KO 5BRZA 1YYMH 2VN7A 1E0OB 1NCTA 4I3RH 4MHHI 2IBZX 4TSBL 1H15B 4KTEH 3WS6A 3CXHK 2Q3AA 5ALCH 1Q72L 3M07A 4P2YA 1W0VA 1CGUA 3BEVA 3OGCA 4YX2H 1F58H 2YPKA 5D7JD 3GBNH 5GSVB 4S1QL 3MYJB 2Z8VC 4OF0A 4WW2F 3MRQB 5C3TA 4M93C 2YD7A 5FA3A 4PR5B 4OF6A 2BNQA 4HIIA 2WIMA 4UILL 4JZJA 2VR5A 1LO0H 3GMRA 5MERB 4L5FL 4XNYL 2JB6B 2VDLL 4OLUH 1LO3H 3CDGA 3NCYP 3H9SE 3LD8B 1CZ8L 2FWOA 5EOQH 5BS0A 3E1F1 4ZQKA 2KPNA 4PREA 4R0LA 3ARWA 3JTSB 4UV7L 2X9YA 3DMMD 2BSTA 4Z6AT 4QXWA 2AI0L 1GPOH 1QACA 4IS6A 4K7PL 3BD5A 4GW4B 1E6OH 1UH2A 4Q0XH 3PP3H 2Y07H 1WV7T 1NFDF 4JKLA 5FGRA 2EDWA 2NXZD 1JGUH 5TE7H 2VLKB 1I7RB 1HHKA 5SWZD 1G7HA 1PQZA 3B8YA 4Q9QL 1FSKB 1U95B 4CL7A 1SEBB 1UXSB 2A77H 4BK4A 4LHQB 2OK0L 4KTDL 4Y0GA 1I1AD 1T7WA 3WHE1 2GJJA 3RWHA 2DQCH 1DBJL 1IGCL 2ZPKL 2AJVH 3KXFB 3O3BB 5KSAD 2KKQA 4UTBH 4ZXBD 2IGFL 2D0FA 1FYTD 2X70A 5F9WC 3NFPB 4WO4A 2O5YL 3I6KA 4TOYL 4O2EB 4L29B 1T66D 4N5ED 2B7DT 5IWLA 4WHTB 2X10A 4LPVA 4PJ9D 4NQVA 1OAKL 4M9OA 5DVLA 1H3PL 1UB5B 2VXQL 2NY3C 3CX2A 4KUZL 1F02I 2YXMA 4JPVH 3V5DA 1N6QL 1NBQA 1M71B 4KK8C 1X5AA 1A6AA 5HHXL 5D2NB 1T89A 3QDJB 1FNFA 1IC7L 1KEML 1A6VH 2AABL 2YD6A 2D9CA 2YEZB 4K8RL 4Z7UB 4L9LA 2NY7H 2ESVE 3GMMA 4S1SH 5ADOL 5JPNA 4KGJA 3TZVA 3U9PL 3O4LD 3QXUA 5BZDB 4NC0B 4ONHA 4M62L 1PKQB 1RU9L 4OSUH 4GJTB 3BYTA 4ODWB 2W38A 2UZYB 1O0VA 4O58H 3L3KA 3CLEL 2CLVB 2V2XB 1FCGA 5FO9B 5CMAB 4MXWH 2QBWA 4XMPH 4HZLB 3ZKQD 2X4OA 4FQ2H 4RFEA 2ERJB 5JO5B 3CIQA 3SKJL 1TLKA 1MCRA 3GJFH 2IJ0C 1CBVH 4X6EA 4C54A 5SX5H 1KTLB 3BIKA 4PJHA 3TVMD 1SJEA 3SJVE 1CDUA 3WS3A 1MCPL 1ONQB 1JYXA 3AVEA 4YIQB 4YBQC 3MREA 3QNZA 1F4YL 1IAOB 1NMAL 1NUGA 4XCEB 5F7EL 4HBQA 4LQFL 4CBPA 3NCCB 1TETL 1RFDL 4X5LA 5J3HC 3MJ6A 2EDEA 2RB8A 1FFQA 4HHAA 4PY8I 3RDTB 3V4PH 1B6DA 3W81A 4HS6B 4HJJL 3MTRA 4XI5D 1LNUA 3QEGL 3OZ9H 4F7TA 4QXUH 3GSXB 3P11L 2VKXA 3K3QA 4DTGL 3B3IA 4OTXL 5IT2L 3ARBD 3VJ6A 4PJFF 4HEME 3S36X 2V6HA 2C1OB 2PUQT 4DK3A 1QFWL 1I3UA 5GHWL 5ID1A 3DMMA 4QRUA 3QXVA 4DN4L 1RZJC 4HKXA 2VH5L 2XRAH 5DJZA 5I75B 3HZYB 1S7VA 1OAUH 1NDGB 1QSED 2GSIB 3DX7A 3QPQD 3HE7B 4JFFD 1BFOA 4NHUB 2XTJD 5GRWA 5CJQH 4AQ1B 5IQ9B 5GGUA 5IHZB 4JKWA 5F9JB 5SWZA 3C2AH 4Q7DA 1N0XH 5ERWA 5I19H 1QZ1A 4UT7H 1CGSL 1B9ZA 2AEIT 3JV5A 2WIIB 4XP5L 5EOTB 4WFED 4XPBL 3DX6B 1HQRB 5BMFL 4G7YL 2VXVL 1KSRA 1A6PA 3WYRA 5KSAA 2G5RA 1I9RH 4HIHA 1CG9A 4ZXBA 1JPST 1WSST 1KC5H 3DX9A 1FYTA 3FMGL 4PYGA 1KCUH 1HH9B 5FOBB 3OAYK 2XOTA 3U36A 2ZCHL 1YEKL 2XKNA 5DD5H 4PJ9A 5IVXA 1P4IH 5IROC 4KK9C 5JUEH 1T3FA 1KIQB 1WISA 3OKKA 4B7IA 4HWEH 5FF6B 3DHMA 4XNUH 1JNHB 5IB5B 5F7DB 1I7UA 2B0SH 1AIFA 1S7WB 3ZSTA 5SX4I 4YHNB 4PJIB 5C07D 3VG0L 1CVRA 5E1AB 1XF4A 2FX9H 1GSMA 3DLQR 3QJHA 3SY0A 3O4LA 4O5LL 2JJSA 2UVEA 1RIUL 4UQ2A 5JW3L 3CLFL 2VL4A 3OJ2C 4L1DA 5CD5D 1MQKL 5IV2A 3STLB 2E9WA 3S9DB 5IQ7H 4WU5A 5J57B 4HXBH 4TNWK 5T1MA 5L0QB 3ZSSA 1BLNA 1MLBB 4YO0B 1P4LB 1REIA 2VDNH 1KB5L 1BQLL 1U8QA 3CFCL 3TVMA 2BNRE 1WZMA 4XVUC 3Q6GL 1J5OL 1YEJL 1PG7W 5D4QA 1B3JA 4G7VL 5SV4A 5EBMA 3BQUC 1UA6L 1LGVA 2PF6A 3L5WA 1CXKA 1GIGL 5D1ZD 3LV3A 3P4NB 1VFMA 2BVTA 3LHPH 3UTTE 3U1SL 5HYJB 1U2HA 3FZUC 1KT2A 3K8LA 4JRXB 4HG4J 5FO7A 3L1OH 2ED7A 3QUKA 3QBTB 4Q6IB 3QUMH 2FSEA 4D9RD 1PAMA 2W9DH 5JOFB 1KIRB 4MX7B 4ZO6A 2H6PA 3MV9E 2VKWA 5JXAH 1IT9H 2EYRA 5T3XL 1KIPB 2D7OA 4X6DF 4ZUVA 4ETQB 3D2UD 5DMGD 2FX8H 4LNRA 3RWIB 2DI8A 3H42L 2XN9E 4FQIL 4K7FA 5DT1L 5BZWA 1VFOA 4I1NB 5FYKL 2V7HA 4JFFA 4Z7NF 1YY9D 4NYLA 2EIZA 4N9GA 5D1QD 2FO4B 1OW0C 4C56E 1MFAL 5AYUH 4DKEH 1G7LA 4OLEA 4RAUB 5BW7C 1ND0B 4XPFL 5E9DB 2XV6B 1NAMB 3ABZA 4MA8H 2FIRT 5DFWH 3V0WL 3QUZA 1NBYA 3VI4E 1X5FA 4LARL 1J0YA 3LKSB 2VR4A 4YHPA 1YECL 3WN5C 1ZV5A 2DKMA 2DLTA 1FVEB 3EYFA 3QAZC 5HYSA 1N26A 3MZGB 4MXQC 5ADPH 1M7IA 3CMOL 4K3GA 3LDBC 1BVZA 4S2SA 3PQYB 4N8VB 3HA0A 4X6BA 1MRCL 4OFYD 5J12C 4XP9L 2P8MB 3LKPA 4ODTL 4F9PA 3ZL4L 1NDMB 3GNML 4XNMA 1H3GA 3C09C 3MRMA 4NN6B 2EXWD 3WIHL 4FQ1L 2QL1A 5C07A 1TCRA 1HSAA 3VW3L 4KK5D 1FYHB 5GZND 2I5YL 3UTPE 3S4SB 1UB6A 1TPXC 3DO7A 1OSPL 5E94A 5D70L 3HZKA 3I02B 3UYRL 4XPTH 1CICC 3KLHC 3IDNB 4P2OB 2MHAB 3TN0B 3ROOB 4FABL 1ZA3B 2VL5B 3DSNA 1MLCA 2RQ8A 4NNPL 4JRWA 4X98A 2DLEA 3VXUD 4POZC 4AMKL 3CFJB 4YBLC 4XPAH 1RHHB 1G7IB 1MFCH 2HRLA 3DETD 1A9EA 1G0XA 1MREL 3QEQE 2E9IA 4NN7B 3N1FC 4UU9B 1DFBL 2XZQH 1Q9OB 1K8IA 2AK4E 3JXAA 4YFEA 3G6DL 4H5SA 4U6YA 5BXFB 3IJYA 1ZSDB 3IU3A 3BZEB 4BFBD 1HSBB 2AK1H 1KLUA 1T0MA 3DI3B 4JB9L 4NCDA 5D1ZA 3CFDA 1K3ZA 3QDGB 4K3EH 1Q9LA 1BJ1H 1MAMH 4FXLA 5FUCE 4PLKC 2ILLA 5KW9H 3O0RH 5IHUH 5IR1B 1H5BB 1J88A 5KSVA 3MRFB 5MENE 4HF5H 3V6OA 4WU7A 5I30H 1BQHA 4PG9B 4LCIH 1A7QH 5E9DD 2FIKB 3QISA 4G5ZL 1FDLH 3LKOA 1T1WB 1IM9B 2UV3A 2OXHA 1C12A 4EBQH 2EDYA 3CH8A 1U91B 3D2UA 1OM3H 4MB5A 4D0CA 2FZ3B 1PX4A 3TA3B 1YEIL 5FYKU 3RGVC 1D9KB 2DI7A 4EVNA 3OV6A 3F7VA 3D3VA 2B1HL 1WCBA 4EUPG 3O9WD 4N0FB 5D1QA 5C86A 3GGWB 2KL6A 4R4BA 1CIUA 3U2SB 4YHKH 2VDKL 4P23C 5EUKA 4NIKB 4MD0A 4KXZH 1WBYA 4OD2B 1I9IL 5FGBA 1RV6X 5K59F 3RA7L 3QIUC 1EH9A 4XMLL 3O8XC 4IRSD 4OIIL 1GL4B 1U58A 4PP1C 5EIIA 2FJFB 1ZT4B 2XZCL 1N8ZA 1HXMB 3BP5B 3E6HA 4HS8L 1BZ7B 1DBMH 5C09B 2NY1C 1FIGL 3C2SA 1FO0A 2OR9L 4X8JB 2VRAA 2W1NA 4RGNC 4XPHL 1KCVH 1B90A 1YC8A 1CL7I 1CXIA 1XGPB 3QIBB 5D6DA 4WI3A 4KQ4H 1JUFB 2FECL 3QUXB 3NABL 3QZWB 4MD5B 4QEGA 4AEHL 1KJ3L 1JHLL 3EUUA 3W11D 1FG2A 2RR3A 4WDIA 4V1DD 3QDAA 1R5IB 1BF8A 1G9MH 3QDGD 4FQXC 1PG7L 2IADA 2WMPA 2VLKE 2AAVA 3KYOB 5EA0L 2YRPA 5E5MB 3VXUA 1LO5A 1ZLSL 5EIQA 6FABH 4HQQL 5JNYA 3QNXB 2VWEE 3BEWB 4GSDL 4UT9L 4Z5RA 1BOGB 1I9EA 3TLRA 1P84J 3PJSB 1KXVC 1CDBA 2NLJA 4TSCL 3C6LB 3WS6C 4GKOA 3V5KA 3KS0J 2P5ED 3OAUL 1LEKB 1S5IH 1DJSA 4JE4B 5JTWA 2R0WH 4JG0L 3TA3D 2IBGA 4G8GE 1U8NA 1JPTH 3NPZB 1A4JB 3MLXL 3SBWA 3WL9B 5DJDB 5SWSD 4YXKL 5ITFA 2C26A 1D9KD 2BRRH 5J1AA 4NQTA 4KZDH 3KYNB 5JPMB 3K1KC 1Z9LA 2IH3B 3THMH 1RJCA 4PJXE 3OR7A 2ADJA 4LKCB 1QVOA 5J9PA 3MV7B 2WBWB 4YHOH 4QRPB 3VH8G 4LRIA 5DTFB 4TVPL 1U8JB 1IM3A 5D2NE 4XWGH 2NY0B 4PTUA 4BZ2L 5DMKB 4PGCB 3EHBD 4HH8A 2XZAL 1I9JH 3BWAA 4I4WA 4DKFL 4R0LC 5HI5C 4EXKA 2HT3C 2JELL 5EZIH 1PZUB 3TBYA 4AG4L 1PKQE 2BXZA 4R96B 1WBXB 3W9EB 2EE2A 2D7TH 2IAMD 4RFNC 4P2RB 2FEDC 2VLJA 4JGUA 5GRXG 1DVFC 1IGML 4BH7A 1NCBH 5DQ9B 1QO3B 1A7PL 5F3BA 5KSBA 4LL9A 4EDXB 3EJYD 2GFBB 3K2UL 4C55A 1A7OL 3KYAA 3GHEL 1TQCC 2RGSA 1X4XA 3O9WA 3HNTH 1P84K 2AEWA 1J0HA 4NO3A 1JHTB 2V2WA 3BZFA 4YAQA 1V05A 1U8KA 2WINB 1TJIH 1H8SA 4K9EL 2HRPL 3TPKA 1KPVB 1YEFH 2EC9T 2LFGA 4OFIA 3L5HA 3UBXG 2OTWA 3WO4C 2LVEA 1QSFD 3RIAF 4IRSA 2ICEB 3KPRD 3TH3T 2VLRA 4PV8B 3T4AA 2IANE 3O6MH 4KRPD 4GG8B 1D5ZB 4R7NA 4WO4C 1CQYA 4ZFFA 5IKCA 5B8CB 3NCMA 3FQRB 4M6OH 2ZSWA 4MA7H 1RUKH 3KLDA 3TNNB 5IEHA 4PD4J 3S98A 1WBZB 1W72B 4P9HH 3L3OA 1MCBA 3DVNA 4P48A 2HJKA 2L7JA 4PRIA 5C70A 5E8PA 1N2RB 1T89C 2HMIC 3WFDL 5D72L 3VXOB 4DK6A 3QH3A 1BD2D 3C5JB 1H3VA 1HEZA 1M05A 5CWSA 4L9LC 4Y5XA 3V7AE 5TH2A 4U1KA 3CVIH 1J1OH 3CSPA 4YLQT 4V1DA 4MJ4A 3FB7A 4ENEC 4KMTH 3P9MB 1LE5B 4L4TD 3BUYB 3H9ZA 1IFHH 3D87B 3LB6D 1TMCB 4HBCL 3SDCD 4S0SD 2X40A 5EN2A 5L9DL 5GGQL 4P46B 5C0CD 1LK3H 5CP7B 2CKBL 1DLHB 1NCCL 4ODHH 1HIML 2P5EA 1T1XA 1AGDA 3BOVA 4YNYA 1IJ9A 2QQKH 4XZUB 3HKFA 1A6WH 2Y6SC 3I9GH 3BDYH 5D7JC 4WW2A 3V6ZB 4LCYA 2YZ1A 1P2CA 4HUUA 1J1PH 2PW2A 3V8CA 2J8HA 2IPTH 3B8SA 3QQNA 4G80B 3REVB 5CEZL 2YPVL 2FBOJ 3BDXA 2A6IB 2WWMD 1IKFL 4LK4A 1NMCC 4UNVA 5H2BB 5C0DA 2NY2D 3FQWA 1CD1A 4NBYB 3TPUB 3I3BA 1MWAA 2IEPA 4MA3A 3ARDB 3PV6B 4HUXB 3SDAC 2AXJA 4GRMA 4MAUH 4NSKA 1FH5H 5DMIH 1J05B 1WK0A 4I3SH 2PXYD 1EEUA 4W68A 4FFZH 5FHBL 3DMMC 1Y6KR 4F7MA 3IF1B 4R6UA 2A9NL 3C5ZB 3E2HB 2IAMA 1NFDA 1B4RA 5ALBH 3GIZL 3HRZB 2OJEA 3JWNC 1XGRB 2NXZC 1JPFB 2A38A 2AXGB 3NH7H 4LSQH 2FBJL 1DLFH 2H26A 1RY7B 2CGRH 1FJ1B 1ZT7A 1K2DB 5MI0B 2YUVA 4JN1L 4YGVB 1I1AC 2DM3A 2QLVB 1WQVT 3FB8B 1IL1A 3PHSA 4E0RB 4NQDA 2HG5A 1GC1L 4I48A 4QRRB 4RAHA 5BQ7A 5DO2C 2CRYA 3P0VH 2E9JA 4I3GA 4YK4C 5D7IB 3EFDL 1QSFA 5DC4B 5KSAC 3KPRA 3VE0B 4H0GA 1KTRL 1KJMB 4ZXBC 5I1IH 1BAFH 4N0UB 5KZCD 1EHAA 4JGMA 1OGAD 2CLRA 2NW2A 1CTNA 4F37K 3MGTA 5GGRA 1IZJA 4MAYC 1T66C 4N5EC 4MJIE 3BPOB 4LFHD 4PJ9C 4KHXL 2F5AL 3VU2A 4X5WA 4UV4H 4WFFE 1DZBA 3DNKA 1DBKH 4C58B 1ZA6B 1KOAA 4CKVX 5FA3B 3FQTA 1DQQB 3MJGX 5IP4A 1RK0A 4P46D 3IXAB 4HIJB 3OX8B 4ONFH 5DJXA 5DZNA 1UVQB 1BD2A 4R4FL 4JKPL 2V5RA 4X6CE 4UAOC 1OLZA 5CZKA 3MGOB 3ALWA 1FZKB 1T80A 4AM0B 2KQNA 5GJTH 4XNXH 1U42A 1OAQH 4F7CB 5BS0B 5FCUH 3ZDXE 3MA7B 4NN5B 2IQ9H 1NQBA 3G5ZB 4L4TA 2NZ9D 3BPCB 5F7WC 3VD3A 1A6TA 3RWGA 3WSQH 1NFKA 1D5MA 3A6BH 3SDCA 1F6FB 4XMKH 2D0HA 1DEEA 2FRGP 1D6EA 3LD8C 2GUOA 1U3ZA 3VGGA 3DUHA 3TVMC 5IVNA 3KWWB 3D5OF 2M8XA 5EZJA 3Q6FB 4NUGH 5KS9F 4WEUD 2QR0B 5EU3B 3UO1L 5KSUB 1MCEA 2HKHH 5DD0H 4IHOB 4KVNH 2OTUB 4OB5L 5TDOB 5F7LB 4Z7WF 5F89A 1FGVL 4GMSH 3D39A 3F58H 3WMSA 3GSOB 1FSKC 4NDMB 5I8EA 3PWJA 3MXWL 1S9VA 4JGJA 3L9RA 3EGSB 4K2UL 4GRWB 1T2XA 2ZG1A 8FABA 2X4SA 3ARBC 4OT1H 3QT2A 1ITCA 4PJFA 4QGTA 2PXYA 2L4OA 4MS8D 3P4OB 3S96B 1J8KA 1W0WA 4HD9A 1WGOA 4LASH 1CLCA 3MLZL 1G0YR 2V7NB 2D7MA 3C60D 3EYUL 1Q8MA 4RMWA 4GS7C 3RWJA 3ZO0A 3QPQC 1ZLWH 1X7QA 4OZHB 5GSRA 1NSNH 2XTJC 1JNNL 1G9MC 1KB5A 3HC3H 3VGBA 5DK0B 1BVKA 1CE6A 1E4JA 3W39B 3DRQA 2AP2A 4NKDA 3D1MC 2VDML 4G3YL 3OKLB 2NY4D 2XACC 1U3JA 4ZAKD 2W9EL 3VA6A 1FPTL 2JKXA 1SM3H 4UOJA 2XWTB 4P4KB 3LN5B 5AG9A 2CXKA 4OCXL 4X6EB 4ZFGL 2H1PL 3O6FD 5A2KH 1OGAA 1OAZL 1YEEL 3QJFA 1LD9B 1JHKH 3ULUD 4YGAB 3HZMA 3U9UB 3B9KD 1FZOA 1MWAH 1OCWH 3P4MA 5KOMC 5D6CB 4Y4FB 4QNPE 2RFXA 3AM8A 3BI9X 5KOVC 1EFXB 3SDXE 5ETUB 3E3QC 1QRND 4LSVL 3TBWB 3DJ9A 3MOBL 4ZDHB 1IAMA 2I26N 3LEVL 3BP6A 3KPPB 4CU7A 2R29L 4RISL 1BM3H 4RQQB 4JM2F 3IJHB 2G2RA 5AAMA 5K9QG 3X14A 1X6NA 4QCIB 3U4EA 2JCCF 3RHWF 1F11B 4Z7VF 5LBSL 1R3IH 1O5DT 2AJSH 2E8YA 4NT6B 4XTRC 4KTYA 5CIPH 1MQ8A 4PJ7F 5CD5C 5ID1B 2X1OA 1HHGA 4O2CB 5ILTH 4RZCB 1FNGA 4AL8H 3UBXI 3QRGL 4NGHL 2VAJA 2X9WA 3GMOA 5F9OL 4ACPA 5L2KD 1TVBA 1ZHNA 1EHXA 4NQCE 4R7DB 3WV0A 2ADIA 4XBEL 1U0QA 5GGUB 5CCKL 4JO3H 4O51A 4MNHA 4YHIA 1GGBL 1NH6A 2FGWH 1ZEAL 2P8PB 5E99L 1YPZB 4HH9A 5J8OA 1OVZA 1U3HD 4W81A 1OWRM 1JJUA 1I8IA 3G5YB 5EC2A 3JV4A 3M8OH 1CDGA 35C8H 1ACYL 5TJWK 3VGDA 5DXWA 1MHPL 2E7MA 1KCSH 3AS3A 1WUNT 3KNBB 5AYQA 3DX9B 5CBEA 2OZ4L 2Y5TA 1R0AL 2PYFB 3O2DA 5MEQA 3CK0H 3H9HB 1NKRA 5I15L 4JR9H 1BFSA 3RNKB 3V6OC 2XA8H 4NKMB 3MXVH 4HWBL 3RTQB 3CC5B 2GTZB 2IWGA 3RL1A 1BGXL 4D9QD 2UY7A 2G60H 1U93A 1FGNH 4X6DA 5J6HB 2I9TA 1NEUA 3V7AG 5ICZB 3NCYS 4LLQA 5DMGC 2RIKA 2CSPA 2XZZA 5GGVY 3C60A 1CF8L 3HNSH 3IDUA 1AIFB 3GMLB 4LCWE 4XGZB 1JK8A 1XF4B 1YY9C 5GXBB 1F6LL 3QJHB 5I18H 4YEEA 4WENB 3FB6A 5EWIL 4MCZA 4LIQL 1U2CA 2IC2A 3G6AA 3WUWB 2JJUA 1JPSL 1INDL 4OF3A 3IDIA 5D1XD 3L5XL 5C6TL 2JJVA 1MNUH 4LLMB 1DSFL 1BLNB 3DIFA 3WXWL 2APFA 4OV6F 4G6FD 4F57L 3O6FA 3KAAA 1WITA 2RCSL 4NRZB 1U8LB 1T04B 3PL6B 5DJCB 5DRNB 3U79A 1J8HD 5DEFB 3SCMD 3HI5H 5F21B 3B9KA 3Q3GB 2VSDA 2A6JA 1MF2H 4E5XA 1WIPA 4HKJA 2MOVA 4JO2L 4XCCL 4WUKH 3KDMA 4PJDF 1QRNA 1N59A 4WY7H 3QQ3B 2IPKB 4PGJA 1QKZL 1URLA 3RWDB 4LP5A 1KT2B 2E7LA 2DQIL 3IT8D 2EDNA 3R06A 4KK5C 4ZTOH 1OGTB 5GZNC 5CLTA 5FDWB 4HAGA 5DHVB 1YN7A 2YN3A 3H6JA 3HR5A 3MRLB 5ANME 3SE4A 3FT3B 4XH2B 4BH8A 4JZNB 5DJ6A 2D0GA 4LNRB 2C1PA 2FDBP 5E2WH 5L2KA 1EZVY 2ZUXA 4RDQF 3PWPE 1INEL 5J1TC 5FYLD 4N9GB 3VFNB 3DYMA 4HKZB 2XTLA 2ITCB 4UUJB 5HHVL 3UPRB 3VWJA 3O2VH 1X5KA 2D31A 3E8UH 4CDHA 4C57C 2FB4L 3TBSA 1G7LB 1RZKL 4NC2B 4QHUA 1AHWA 1U3HA 3BD3A 3VFGL 3SQBA 1YN6B 4XC3H 3SBWC 1F4HA 3CH1A 3ZMRA 3QUZB 1DUYB 1LK2A 3FOLA 4WWKD 5DHYB 5HVGB 5MEOA 3TJHD 3WFCL 1HH6A 2X1XR 4QHMA 4FNLH 4GAGL 2YHGA 4E41A 5HHMB 1HILB 3OPZL 1JGLH 4XVSL 4LRIC 2D9QB 3P73A 2YC1A 3CCHA 4DFIA 4PUBL 4M7JH 1T6WA 5IM7B 1EHLL 3QPXL 1M7IB 3SO3B 3DOSA 2AQ2A 3T0VA 3D85B 3ZE2F 1ORQB 5C08A 2LE9A 3GMQB 3MJ7B 1MFEH 5EPMA 3VGAB 2PYED 1BEYH 1AGEB 3GHBH 5AD0B 1M1SA 1K4DA 2UYLB 3W0WE 1E4XH 2A0LD 3P77B 2D2OA 2J5LB 1H0DB 4X83A 1UB6B 1DR9A 4OM0H 1TVDA 3O9WC 1QR4A 5DD1L 1JMXA 1IAIL 2CLZA 3CZFB 3MOQA 5JOPD 2AJYH 3LIZH 1A5FH 1YEGH 4BJLA 2BX5A 3OAZH 3BKYL 5D1XA 4U0RC 5IESH 3MNWB 4G43B 5JQ6H 3IYLW 3ROLB 3VG9B 3ORJA 5GS0L 3D0VA 4IRSC 1GGCL 4PJ5D 3QFJD 3OJDA 3PP4L 3MYZA 3RQ3A 1GZPA 5FECB 3MV8B 4GAYB 4YFLI 2IH1A 4H5SB 4U6YB 2B4CH 1MCWW 3LY6A 1J8HA 3SCMA 3O2DH 1KBGL 4U1MA 4ERSL 4N8VG 1CS6A 3CSBA 5DJ2A 2Z4QB 2CXGA 4U05A 3F7RA 5IBLD 2DB8A 1F6AB 1P1ZB 2COQA 2H41A 5CHNA 3LPFA 5IFAL 2GT9B 2X4QA 4OLZH 4Y5XC 5I73B 1AC0A 4L4VD 5CKGA 1NBZB 1HDMA 1EPFA 3W11C 2Z0BA 4LPTA 2R15A 2I24N 4ODSL 1OY3B 5JR1H 2GJ6B 1G7MA 5H35B 5I9QC 5HGBA 3MRNB 2J88L 3OL2A 2X44D 5GIRA 1RUAH 5B38G 2BVOB 3BP7A 1H5BC 4ISVB 3MFFA 3L3JA 5T5NG 3O6KH 3MLTB 3WKNA 2X41A 1R3HA 2NTFB 3MRIB 1F4WL 2F8XC 4QRRE 4ZFZB 5DUBB 5F7UA 1RIHL 4LHUD 4APQB 3FFCD 3BO8B 3JWDH 4P5TD 5BRZE 1SYVA 2VC2L 1JPGA 3CU1A 4N0UE 3OF6D 5B21A 4UOW1 3T2NH 3TA3C 4Y5YA 3AXLB 3ULUH 5ENWA 2W65A 2ADGA 2W0PA 3KPQA 4LGSB 5JLZA 3BD4A 4RMRA 4WWKA 1D9KC 3D9AH 1GGTA 1C08A 1RK1A 1OSZB 4L8BA 5I1CL 4KMQA 1XZ0A 3I75A 3QXDB 4WI8A 2BCKB 3E6HB 3UEZA 1UGNA 2BNQE 3Q5TA 3GB7A 1V3JA 3BPNC 1MHEB 5FDYA 3EHBC 3VXSB 1IGTB 4K3DH 1U3YA 2ICWJ 4ODUB 1QA9A 4I0PD 3T0XA 1NCAH 3QHZH 4CMMA 4DUXA 1AXTL 4BFIB 4OUUB 3DVFA 1T2QL 3HAEA 5BS0E 2IAMC 1FNEA 3TBTB 1XGYH 3AU1B 4JAMA 2ZUQB 4AH2B 4H88L 4GMTL 3LZFL 4GG6F 2FATL 1RIVH 3AREB 3EJYC 4Y2DD 1QEWA 2MNUA 2XI9A 4ZS7L 1B0RA 4YHML 5HYEA 2Z8SA 3MLWL 1U8OA 1VFBB 4I9WE 2V2TB 3QWQB 4RMQA 1XH3B 4WCYH 3MNVA 4RMSA 3BJ91 1LO4H 4JN2A 2ARJA 3WD5L 4FXGA 1N7ML 2YA1A 5HHOA 1C5DA 1TITA 4PJ5A 2EXYD 3QFJA 1AFVL 4OFDA 2IG2H 4KRPC 3EJJX 4JKMA 2R0LH 3P0YL 4WEBL 5LAXB 5FO8B 4S0TD 3RVXD 4BFGA 1MCHA 1U8HA 2AKRA 5HY9B 3CVHL 5CGTA 1MHCB 2BHUA 1NLDL 3OAYH 4JHAH 3G04B 3PWNB 4GRWE 4Z9KB 3VFRB 1XGTA 1JWSA 3A67L 1OPGH 3MV01 1XFPA 5FUOL 3QZWG 1FZJA 4M5YL 4OKVA 4P59H 1T22A 4L4VA 4PTUB 4UQ3A 4JVWA 4JY4B 5C9JA 1MHHB 2UWEB 3Q1SH 5GS3A 1EXUB 5HDQH 2CDEB 3BWAB 1YNTA 4I4WB 1JWUA 4KKBD 2FEEI 2ZOLA 3VRLE 5D2LA 3W2DH 1CFQA 2WANA 2R4RH 3LB6C 1ZANH 5I8OL 4LSPL 3TWCH 5M95B 4K3HA 4JO4H 2NY0C 5DURD 3O81A 1DP0A 5FUZL 1M6OA 4OZFG 4X7FC 3UTZB 5IF0A 3MRPB 4LHUA 4BQ9A 3FFCA 3ARFD 4Z7OE 1TZGH 2VE6A 4GKZA 1NGZA 5DJYA 1WZ1L 3OF6A 2AV7B 43CAB 2BC4A 2H9GA 4PJHE 1FLRL 1I8KB 4KV5E 4MNGB 3X13B 4L3CA 1CR9H 2WWMC 4ZO7A 3HMWL 1MRFL 2NY2C 1X3DA 2P24A 4NWUH 5LJYH 3DV6B 5I1EH 3PXJA 4NKIH 4WJ5A 1RPQA 4W70A 3EBAA 2YPLD 5I8CA 3FT4A 1UEMA 5DRWA 5EZOL 5F8QC 1NGPL 2QQQA 2R56L 2VQ1A 2PTTB 2NW3A 2Z93A 3LQZA 4I0PA 2PXYC 2P42B 2F8OA 4PRIB 1AO7D 3WIIH 3RU8L 5E4EB 3MOAH 4KDTC 5TE6L 4HWUA 3UJIH 4GKSB 4CVUA 1FN4B 4PS4L 2X9XA 4NO0B 1S7XA 4G8IA 3ARTA 3MRGA 4Y2DA 3C5SA 1XF3A 2YRLA 4TTDD 4HPOH 3HI6H 4IBLT 1BIIB 2CK2A 5FYLH 3Q5YA 2DD8L 3FB7B 3WEXA 3PGCA 5SWZE 5EC1B 1MSPA 4X7DC 3VD9A 3T3MF 5TE4H 3UPAA 5J11B 1SJXA 2PO6D 3CU7A 4I2XA 3SQOL 2DQTH 3IFOA 1HHIA 4LVHB 1W0YT 4F58L 2X4PA 5I1DB 4H25A 4Y4KB 1X5HA 4G6MH 3TIDB 5CGYD 3OKOA 2IALB 2VUOA 4NBZB 1KGCD 3AS2A 3UPCA 3VFOA 5GRJH 2DQJL 1FYTE 3NCFB 1MFBL 2J6EH 4UIMA 1JRHH 2NNAA 3AM8C 3EDEA 4KQ3L 3JSSA 2HH0L 4P46C 1HZHH 4ALAH 5F9AC 1MJUL 5C0FA 4OLVL 1UM6H 3HR6A 3QDHA 2PR4H 4YDVA 1KJ2L 3PWUA 4GBXD 3TO2A 5C0AA 1MEXH 2ZOKA 4QOKD 3LN9A 5T5FH 1FE8H 4M7KH 3QFDA 2X89A 2L7UA 2YMXH 3GBML 5GS1B 2R0ZL 5E08H 3TM6A 1LDSA 5B39A 1UWEL 4X99B 3EYVB 2NZ9C 4OI9A 5FB8B 3WJJC 4JREB 4TUOA 4JFOA 4WI4A 1JI1A 1Q0YH 1BZQK 3LMJL 4UB0L 2GHWB 4LCUA 4PRPB 2CO6B 1AKJD 3BKJH 4Z8FH 1DBBH 3HCVA 1FRGH 3ARFA 5DHVH 5KS9A 4X4YA 1FBIH 3MLUL 3FCTB 4DQOL 2ADFL 4GXVL 3AY4A 4LLUA 1JYVA 4IRJD 2V17L 2WWKO 3FKUS 3DUSB 4FQJH 4U1GC 4PV9A 4NQDB 3E2HC 3SE8H 4OBSA 4Z7WA 4RAVB 2QADD 2DQFB 4FFYH 3NZHL 4JRYD 2B4CC 2QSCL 2XFXA 1UACL 3RWFA 2MJWA 4KUCD 5MI0C 1JTPA 3OMZA 3ZDZE 3H9YA 3GSNL 3BHBB 2EDQA 2EKSA 2PTUA 2YPLA 3O6LL 4DGYL 1FNSL 3ZHKA 1AQKL 5INDA 1F45A 1KTKE 3S37L 4PB9H 3RPIB 5LXGH 4MS8C 5LWYL 4NM8H 4JPKL 3NFNA 1AO7A 3FQTB 5BVJB 4EI6B 4U1LB 1ZWIB 2ZSVA 1LEGA 4UT6L 4X4MA 2FD6L 2HFGL 3ZTNL 4DJMA 1AC6A 2EC9U 3JV6A 3V4VH 3KPSB 2M2DA 1S5HA 3ULSB 5ESVA 4X6FA 3QI9D 4XHQA 3MRJA 1JNJA 4U6XB 4U7MA 4PJAF 1YEDB 4JFFE 4JFZH 4ORGB 5CUSL 3B5GA 1N4XH 4QLRA 3MA9H 3TT3H 4FZEH 2D7NA 2NY4C 2WBJB 4HV8B 3LRHA 4H20L 4ZAKC 2X4UA 4Q6YA 1W2KT 3HE6D 2PO6A 1QFUH 4E9LA 3DXAB 5F3HB 5TDNB 3PG2A 1DQMH 4M1GL 1S8DA 2P7TA 3JWDC 4JHWL 3O6FC 2FO1A 5TF1L 3HC4H 4LF3A 4NN5C 2SEBB 2C3XA 2LQRA 4NKOA 3ULUC 1KG0B 5T1LD 3B9KC 1MAJA 2Q20A 4YEFA 3GSRB 3W5MA 3V5HA 5HHME 4EQ2A 1JF1B 3IS0X 3GI8H 3GUTA 3MNZA 1EK3A 3QNYB 5A16B 5C0JA 4F15C 3SO5A 2G5BB 1P6AB 3DURA 4MJ5A 1AY1L 5M94B 3QCUH 1VPOH 3FB5A 4JM2A 4GBXA 3G9AB 5I8EB 4Y16A 4PB0L 1KPUA 1S9VB 2K7QA 3ARRA 4QOKA 2CH8A 3WLBA 2X4NA 1FG9C 2X4SB 3BFOA 3H7LA 5DUML 2BOCA 1AQDB 4PJFB 4Z7VA 2W0KA 3SE4C 5C07E 5KTEH 2Y06H 1EO5A 1RMFH 2C7UB 1MIEH 2GSGB 4NPYB 1SHMA 2WZPD 1VKXB 1VA9A 2APTA 2MCPH 4EN3A 5ID0A 1UWXK 1RUQH 1MCOL 2NMSA 3FO0L 4KJQD 3UAJC 2O61B 5C8JB 3X3FL 5E8NB 4ELMB 1OT2A 2ZKHH 3RWJB 3ARGB 2JB5L 1YYLH 1KB5B 4PRNA 4DW2H 2E27L 1AKJA 5CP3A 1A1NB 4PRDB 5HGGS 4TRPH 3CXDH 1T0NA 1AHWC 1U3HC 1O7SA 2W92A 2GITB 3AMKA 4HWZB 4FQHB 3MLSH 2VAAB 3MV8E 3PABA 4M4PA 5CSZB 5C1MB 3BAEL 1NEZB 5J6GB 4J1UA 4N0RA 3VDCA 3NBNA 1HXYB 4HC1A 2JIXB 1F2QA 4JRYA 3GZKA 4OLXH 1NGYA 2HFEA 3U4BH 4LPWA 4HIXL 4BKLA 3HPJB 4LNVA 1D3CA 5TDPB 1CFTA 4PBXA 5EU5A 3TF7C 1Q1JL 4ZUTA 2IMNA 4FTVB 7FABL 3KJ4B 1TZIB 1P53A 2J3SA 5IUSA 3DXAD 1QR1A 4K23L 4Y1AA 2F9BT 4WIQA 1TJHH 2ZZUT 3MRBA 4LSSH 3VFWB 4RMVA 4G6KL 2I60H 5HHPA 3E6FA 1F13A 3U4EB 3QI9A 4YHZH 3KR3H 4Y4FC 2ZJSH 3U30C 3KPNB 3TT1H 4NO5A 4Q74A 1LEIA 3D3VE 3T4YA 5D1XC 1AP2A 1A22B 1UZ8B 2R2EB 4GQ9L 3HE6A 4O02L 2P5WB 3GI9H 3T77A 2ADIB 2C3WA 2WQ8A 4NJAL 5GRYA 5J0BA 4I18B 2H32B 4KPHH 5HDBE 1C5BL 5T3ZD 3SGEH 4PJBF 2BDNH 2CMRL 4JG1H 4OCRL 3OXRB 3SCMC 5T1LA 2X09A 5IB1A 5IW6A 1P4BH 1DBAL 3G6JF 3RIFF 4ZO9A 1HOCA 4UIKL 3NACL 4D3CL 5EO9A 4WHYG 1YYML 4XBPA 4I0KA 4PJDA 4I3RL 4P2CG 4HDIB 2WW8A 5JHDB 4X4XB 5EU7C 3N9GH 4R3SB 4KTEL 5DVOA 2Y5TB 1JGDA 5ALCL 1GZQA 3NN8A 4PRBA 5MEQB 4YX2L 4GW5A 1FFNA 1F58L 1J9CT 5F8RC 3GBNL 3CFEA 5D7KE 3L7FB 5KAQG 3HMXH 1AGFB 4X6DB 2XIDA 2XG5A 4G9FD 2JIXD 5HGAA 2LTQB 3QQ4A 3LEXB 2WP3O 3JWOH 5FXCH 1LO0L 4U6HB 1U8PA 5K9OB 1MIML 5C0BB 3P30L 4WHDA 4OLUL 1LO3L 3TYFA 2CPCA 3RTQC 3VD5A 4LVOB 5E7FA 1LP9A 5EOQL 1OF2B 1X5GA 5F7HA 1RAMA 2D7PA 5IMKA 5IW1A 2OI9C 2CJUL 4JFDD 1GPOL 4CMHB 1CFVH 4Q0XL 2Y07L 2DN7A 3CDFA 2Z8WC 4O4YL 4Y5VA 5C7XH 4WWKC 2R9HD 1PLGL 3DIFB 1JGUL 3TJHC 4TULH 2XWBA 4JFHE 3L95B 2R1WA 5TE7L 1EDQA 2YKLH 1IGFH 4MZ3A 4UINH 5C0RL 2EZ0D 2A77L 3F12A 3R4DA 3G5VA 2GK0A 2A6JB 1RZIB 2DQCL 3QG6A