4R26L

Crystal structure of human fab pgt124, a broadly neutralizing and potent hiv-1 neutralizing antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
210
structure length
210
Chain Sequence
YVSPLSVALGETARISCGRQALGSRAVQWYQHKPGQAPILLIYNNQDRPSGIPERFSGTPDINFGTTATLTISGVEVGDEADYYCHMWDSRSGFSWSFGGATRLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PGR124-Light Chain
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Nomascus leucogenys
total genus 43
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26L01
2QADC 1AGBB 2DJUA 1XGTA 1AI1H 2Y4SA 3ALWA 3KPLA 3MV8B 2NY5L 4R4FL 4GKOA 5JW4R 5HDLA 3D2UB 1XF3B 5I6XB 3RA7L 3WO3B 1LO0H 4O51B 4W6WB 5L7XL 4OIIH 3CDCA 4WI3A 3S98A 5JLZA 1NC4B 2NX5D 3BQUD 3EHBC 5D6CA 4HK0B 3GZKA 2AJYH 4TRPL 1A3LH 2HJFA 4XTRD 2B0SH 5E2WL 1KC5H 4LP5A 4K3DL 2J4WH 1JGLH 5IVZB 4NNPL 4Y5XB 4LVNC 3V0VA 4ERSH 2OLDA 4IOIA 2V7HA 4ELMB 1ZANL 4UAOB 3ULVD 2AV7B 3I6KB 4K8RH 4WHDA 2OP4H 1KN2H 4ODUA 3UTTB 3EUUA 5BQ7A 5BZWA 2VXVH 4NO0B 4L29B 3C60D 4XXCC 3Q1SL 5TDNA 2DTML 2IALA 3MRQB 4F2MB 3MRBA 5K93A 4FMFA 2ZUQC 2MHAB 4P2OD 2OTWB 5F9JB 1I9RH 1BEYH 2LV4A 4KMLB 3MRKA 3LV3B 3PE9A 3A6BH 5JZ7D 5H35B 3VFVA 5I75C 5FECB 3GB7B 5EULV 1EIBA 2OQJB 5IBUB 1CR9L 2E7MA 3PWNA 5EZOH 4PS4L 1P1ZB 1TNNA 4FP8H 3TA3A 4U7SA 1SYSB 3FRPG 3OAZH 2JIXB 2CDEA 3V4UL 2IQ9H 4Y5VA 4ONHA 4JHWH 5I1KH 1P7KB 3NZHH 3VJ6B 3AGVA 1NCWL 1IL1B 1BIIA 4QXWA 1DCLA 3DVNA 1IAIM 5CSZB 1G0XA 4LOUD 4G6ML 1RJLB 3LEXB 1F2XK 5E2VL 4HX1B 3VXTA 3IAQA 2NZIA 5ACZB 3F7RA 3VFTB 3WFZA 4HWBH 2BVOA 1W2KT 3BW9A 2LAGB 3ELAT 2DWEB 4HIHB 1J0IA 2ARJA 4PGCA 4L29A 5J89A 1NEZB 5HI3D 2ARJQ 4L8DB 3M8OH 3A6OA 1GGCL 1KJMB 1HKFA 3IJHB 1RZFH 3A0OA 2W59A 3L3JB 3FOMB 5DD5L 2ERJC 3R8QA 3LDBB 5EUOF 1G0YR 2OTWA 1XZ0B 5F9JA 3VWJA 3MLUH 4D9RD 4QRSB 1EHXA 2DKMA 1CF8L 2VRAA 3FRUB 5C3TA 1QBML 1KN4L 4Q2ZB 2VO5A 5SWZA 1O0VA 2Z35A 3JV6B 3PWPA 4GBXC 1P1ZA 1MHPL 1DSFH 3L95B 3U4EB 2XA3A 4MAUH 4OLZH 1MFEH 2AXGA 1A7RL 4N0FB 3IGAA 2CUMA 3BKCH 4NC1E 1PEZA 1G9EA 4QNPF 4DAGL 3MUHL 4UI2A 4K3JH 4YR6A 2D7NA 5IB1B 3NZ8A 1WUNT 5IHZA 2BHYA 1V7NL 4KQ4L 5CSZA 4JRXD 1NC2D 5EC2B 2FX8L 1Q9WB 5DHVA 3QYCA 1KELH 4L5FL 5K9OA 2NY7L 4HX1A 3RNQB 4Y16A 1FZMA 4XVTL 4HDIA 4ZUVA 3MV9E 1LO5B 1WSST 3MRMA 3QEQA 1YNLL 3WL9B 5LGJB 3V5HB 4EVNA 5DJ0A 4I48B 2FIKB 3IS0X 2F8OA 1NEZA 3BO8A 1LNUB 4L8DA 2R4SH 1F8TL 3NIDF 3HC3H 3FQNB 3I3BA 1BM3H 1NAML 1U3ZA 4KRMB 1GPOH 3SKNB 3V9FA 4BKLB 3FRUA 4X6DE 2ADIB 3RDTA 1JNHA 3LQAC 4W70A 2OR9H 1BPVA 3T0ED 2R1WA 4O02H 2NX5B 3BQUB 5L88H 1A7QL 3AVEA 1A7NH 1S5IH 4AJ0A 4NUJB 4YDKL 4L4VE 3L95A 3U4EA 1WFNA 2HRPH 5GGQH 3PP4L 1A2YB 4N0FA 3WS6C 4HPYL 3TNNB 1D5XA 2VXSH 5FYJD 5CGMA 3SOBL 1E6OL 9CGTA 3V6BR 5I1IL 4JKPL 3OX8A 4X5LA 4QYOA 3IVKA 2OTUB 4N1EA 2XQYG 1MJ7L 43C9B 4J4PD 4GW1B 4Y1AE 3QIBD 2BY3A 5I1LB 3C60B 3RVUD 5D4QA 1VFBB 8CGTA 1WWAX 1I7TB 1WC7B 1KCLA 1N4XL 4CVZA 2NY1C 4PJBB 5FYLL 1LO5A 4P2OB 2WWMD 3BRFA 4JPKL 1QHPA 3U36A 3TYFA 5D5MB 5E8DL 1FL6B 4HXBL 2FIKA 4V2CB 5MEND 4G8IA 5EPMB 3BXNB 1XF4B 1M6OA 2AGJH 2EDNA 4LDOB 4F7TA 3THML 1AQDB 4ZTPL 4LARH 4H25B 4R9HA 2Z31A 1L7TH 4EXPX 1KENH 1I1AA 3GJFB 4LSTH 2D9QB 3ABZA 5L2KA 1H15B 2X4SB 4JJHA 1DQJA 3PGCB 2QADD 4BKLA 1BFSA 1NEUA 2ADIA 2F58H 5DYOB 5DEGA 5CEXA 1WBZB 4OAWA 4LIQE 3AMLA 1A6TB 2W0PA 1X5ZA 1DEDA 3KLAA 3C6LC 3QCTH 4KI5C 4ZD3L 3ARBC 3DX7A 1I8MB 1YC8A 3HI6L 5T3ZD 2F19L 2AJXH 1UM5L 2C26A 2BSSB 2ENYA 5E95B 4QLRA 5IMLA 3QNYA 3S5LA 1BP3B 3EHBD 3AREA 1CLZH 4PJ7B 4PUBL 4WI2A 3CZJA 1IILE 3MNVA 3HNTH 4OGYH 5GZND 1AIFB 3ARGC 4EJ1C 2AQ2A 4WI7A 1VFBA 2QV2A 4BUGA 2FECI 1HHHB 3FO2B 1CFTB 4F7MB 1H3UA 2D4DA 1RJCA 3WLBA 1DBAL 4J8RB 5D5MA 4YDVA 3RIAK 1IC5L 4LRNL 2XT1B 1A4KA 1JVKA 3PXHA 2JB5L 5DZLA 1AQDA 1OT1A 3MRIB 4R90L 4JFED 4W81A 4XI5C 5FCUH 3ZDZF 4BUHA 3BGAA 3EDFA 1ONQA 4MQ7B 3HC0A 1L6XA 4C56D 2G5RA 3C8KB 4L9LB 4WHTA 4KZDL 1S7RA 2Q76B 5HHMD 3DRTB 2DQTH 3Q0HA 4LGSB 5HYSA 4OM1H 1A5FH 1NC2B 3VRIA 5TQ2L 3CFIC 5E70A 5IIEA 1Q9KB 3TIDB 3FHQA 3UO1H 2AXJA 5TJWK 2GAZA 1U0QA 4IMKC 1A64A 4NZTL 4I9WE 4HZAA 1NMAL 4NQVB 4IS6B 1T2QH 4YGAB 4MD0A 1SYVA 4MNHA 5LKNA 2BVUA 1X5AA 1FBIH 5T1LA 3FO2A 4ZFOL 2ICCA 2X1WL 4UT7H 5C92A 3T1WA 5GS2H 2VH5H 3EYFB 2IG2H 5FOBB 4YHKL 4PJGB 4F80A 1CFQB 2A2QT 1AC0A 4PJHE 2XV6B 3T0EB 4ZFGH 1JIBA 4R3SA 1WLHA 1FN4A 5FHBL 1UQSB 5ETUA 2P5ED 3S97C 2WINB 4AY0A 5BO1H 3MRIA 2AJUL 3O4OC 2JTDA 4WY7L 3MOQA 1MI5D 4MQ7A 4LBEB 3MMEA 5JXAL 2YD5A 1ODAA 2EDQA 4Z7VE 5AG8A 3L6FA 4DFHA 2Y06L 4F8TA 4PRBB 5ABDE 2C7UB 3O6KL 1OAZL 4GBXD 1EMTL 5FF6A 4NCC2 2HKFH 2HVKB 3QIBB 4DGYL 2F53E 5GRVL 3RAJH 5EIIB 3QXDB 3D85D 3BD4A 2WAHA 1G7IA 3VRLE 3MV11 2QBWA 1L9MA 4LKXB 1LEIB 2CKBA 2BY2A 1I3VA 3KYOA 2N4IA 3RY6A 4KV5F 2YRZA 2BOCB 4FFZH 3CK0H 3CPLB 3O81A 2ATPA 4MB4A 2JJWA 5MENB 4UBDD 3QUYA 1MNUH 2OI9C 5KN5A 2YD1A 4J7RA 3O4LD 2J12B 1YPZA 2A74B 3VXUA 2MCPH 3V6FB 4MNQA 2QADB 1CL7L 3T0EA 2VXUH 4IIQC 1KCSH 3X12A 1NGXA 4Y8DC 1HSBA 4NHUB 1MCBA 3U9UA 3IDXL 1BQUA 3I3DA 3GSUA 3SKUD 5IVXA 3PQYA 2YZ1A 3C87A 1I9IL 2JJTC 4D0CA 2GJ6D 5F21B 3V95A 4G6JL 2FD6L 5DMKB 3P11L 1XEDA 2DLEA 2XIDA 4Y4HC 3PHSA 4P48A 3ZL4H 1BGXH 2HFFB 3HZYA 4FZ8H 4TULH 1EO8H 1YEHH 5F9OL 4U2ZA 1TPXC 4LVNB 2NY3C 2HFTA 1IGMH 3C08L 4TYUA 2Q3AA 3IU4L 4M62H 5K59F 5LJYH 2OZ4H 1GRWA 1D6VL 2QSCH 1RUAL 3V6OA 4LCWD 5E5UB 2BOCA 4G6KL 3LOWA 3CPLA 1CGSH 5I1GL 4JHAH 2YK1H 1AO7E 4KHTL 4DN4H 2NY1D 4GJTB 5LXGL 2ZUQB 1W72H 3SGKA 4NIKB 4JPWL 1QFWL 2P44B 4JFEB 4JQVC 3RWHB 4TNWK 4XBPA 3T4YA 3WXVH 1UM4L 2NY6C 3P0GB 4C56B 3AM8C 3I6LE 4AIZA 4NC1C 3MLWL 1UH4A 3CFDB 5C9JA 4WU7B 5CHNA 1R3JA 5HHMB 5IROA 5HGGS 3ZKMC 2AEPL 3PJSB 1AKJD 5DFTA 1PZ5A 3BKYL 5C6PB 3UTOA 3BH9B 5E7FA 1G7HB 3SKJH 1U8KB 3QI9C 4M03A 1E4XI 4QXUL 1T5XA 2GCYB 2LU4A 1MIEH 1YMMA 2XXCB 3INUL 5DQJB 2FBJL 5HHQB 1T2JA 4BQ6A 5DMKA 1AY1L 1OAXH 3UPCA 1GGBL 2P8MB 4XPHL 1YJDL 3C6LD 4KI5D 5CKGA 2O5YH 2XZZA 3ARBD 4OZFB 5HHVL 2PR4H 3QZWB 3CFJB 4KRNA 5HYJD 1Q9OA 3RU8L 2Z8WC 3GFUA 4XP9L 1UYWH 1Z9SA 1RZJL 4M1DL 3TCXA 4OKDA 2XWBA 4J3SA 4LLWB 2DWDB 2IGFL 2DIAA 4LLDA 3V4VL 3ARGD 1N6QL 4GRLA 2DRUA 3RFZC 3QCVL 2P5EB 1FVCB 2ERJB 4RAUB 1NLDH 3MOBH 4WWID 3UTPD 5DK2A 1MI5B 3GKZA 3DETD 4U6YA 5DGQA 4EOWL 5DHYA 2EH7H 3DSFH 3I02A 4K94C 5EO0B 4N8CH 5EUKB 1NFIB 5ELIA 5DDHA 3C2SA 4BFIA 3KVQA 4GBXB 3VDAA 1OPGL 3OKMB 1FNAA 5FEBA 2GY5A 4XI5D 4OCXL 1EUUA 5DRWB 2FWOB 2WQ8A 3QUXC 5D7JA 3SDXF 3STLA 5D1XC 4R6UA 1T0NA 2RCSL 3D85B 4KAQH 4NGHL 1C5CL 4EKXA 3OKEB 1QSEE 2P8MA 3RWCA 2VXVL 1J5OH 3BJLA 3NIFE 4H26B 5AG9A 4RZCB 2CUIA 3CFCL 1VPOH 5KJRH 3S34H 4D8PA 2R39A 5DA0B 1LP9A 1KEML 3O4LB 2A83A 3QULB 5JPNB 4M5YL 3A6BL 1VADB 1FNSL 2IH1B 2DWDA 2NCMA 3SE4A 1ZA6B 4XNUL 1XGUA 2NTSP 1N0LA 4XMKH 3W9DB 4JZNB 3ILQC 4DVRL 3QJHB 3TH3T 3M17B 4FP8L 3S35L 5KSBF 4MJIE 3G6AB 5E2JA 3ORJA 4L4JA 3S3SA 4FXLA 3UAJC 2GJ6B 1G7MB 4P2RE 5EO0A 4HS6B 4A6YB 3DIFB 5JIHA 4WDIB 1G7QB 3RPIB 4RDQF 4WENB 3OKMA 4PJAA 5D8JL 1QLFA 4PR5B 4BZ2H 2IAMB 1HSAA 3AC0A 5CJBA 4OTXH 3W0WA 2O61A 4TPRL 1UFUA 3VGAC 5CSBA 3OL2A 3MYJB 1LE5B 4I4WB 2CD0A 5ITFA 4HWBL 2R23B 2A6KB 4G8FB 1KYOK 5EZLB 5HHPB 1I7UA 2EZ0C 4ZQKB 3QA3B 1KNOA 4XP5H 4HZLB 5JORB 3VRJA 4R7NB 2E6PA 4RZCA 2NY1B 3D0LA 1UWEH 1FGVH 1P9MC 4Z7QE 3KAAA 5C0GA 5F1NB 1L0XA 2FRGP 2C3XA 1T89A 1S3KH 4OLWL 1TVHA 5EH1A 4KVCL 3B3IA 4NZUH 1MPAL 3MOAH 4RMVA 4GXVH 3T0XA 4CADB 3QJHA 1AKJB 5ILTL 4GG8A 5CLTA 3RVVC 4OLZL 4JO4H 2HFGL 3G6AA 4G6AC 5DJZA 1JF1B 5C0JA 2HJLA 1F90L 2NW2A 1UM6H 5ALCH 1RD6A 2X42A 1AGCB 3JWOC 5ESAB 5C07E 2VDNH 5FYLE 3WNLA 1I7ZB 4MA7H 2XY1A 1KELL 1MLBA 2IAMA 3MRFB 3ULSB 3QDMA 4PTUA 4G42B 5HYJB 3QFJE 4HK3J 2IFGA 5DTFB 1HINH 1X5JA 4Y4HD 5DT1H 2R23A 3U0PB 2A6KA 5D7IF 3H0TB 2HKHH 3E2HC 3WN5A 3ARDC 3IDYC 3RBGA 3ARGB 2NY3D 3PWUB 5DK0A 4HZLA 1W8OA 2Y9RT 1SEQH 1M71A 3QEGL 1JN6B 2RBLA 4R7DB 1MVUA 3FL7A 4KRLB 3V5KB 4OGAC 3CSYA 4D9QE 3H42L 4PJ9C 3SBWA 4RA0C 1M7IA 4NZDA 3D3VA 5TE7H 1A21A 5CGYC 3CIQA 3GMPA 1TIUA 1GAFL 2NY6D 4JAMA 3PHOA 3OAUL 3WD5H 3SGJC 5F72S 2WUBL 3ZKMD 5TPWL 2EYTA 4GW5B 3H3BC 4XCYA 5HGBA 5KAQG 4H8WL 4XBGA 5ADPL 5IVOA 4F7PA 1G9MC 4OCSH 5FAAA 3LH2L 1BQHA 3QI9D 1EHAA 1K8DA 3EYSH 3ULSA 3MLPA 2V7NB 3WXWL 4WWKC 1OVZA 1E27A 1FVEA 4G42A 2APVA 5DTFA 5E9DE 4N8PA 4BFEA 3VGHA 4N1HB 1ZWIB 1IQWL 2GQHA 3JWDL 2A6DA 2DBLH 4XPTH 4GG6F 1ERNA 1WBXA 3RJQB 4PTTA 5KSVB 1K8IB 1OF2B 1RU9L 5ESQB 4P5TC 1VERA 5MERB 2Q6WA 1IBGL 3CSBA 1SJHB 4FQXA 3GSNB 2EDXA 3EDKA 3UYRH 1EAPA 4CJ1A 4P23A 1FZJB 2F5AL 1CDGA 4L4VD 1NGZB 3O4OB 4O5LH 2DIJA 2YSSB 5C6WH 1DVFA 1TJHL 2AJXL 4Y8AA 3EIFA 1A1MB 4XPGH 1HCFX 5FKPA 5HYIA 4JFFE 4P57B 3L7FA 4GRWH 3MX0A 4O4YH 4CVXA 3QUXD 4C57C 5D1XD 1JPSL 1MQKL 5JW4Q 5IEHB 3BDXA 1PY4A 3PWJB 4FZEL 3AY4C 2AJZA 1S9YA 1SY6A 4WTWA 2D7OA 1MEXH 4P4KC 5DRNB 3WSQL 1YDPB 2VWEE 5I9QB 5EU6A 2HMIC 3JZ7A 2XWTB 4HJGB 4NKMA 5IB3A 2J1KA 2JB6A 1U8HA 2OI9B 1GXEA 4ETQB 4PRHD 4KUCF 4AIXA 1ZMYA 2BDNH 2C1PB 3TYGH 4LSRL 4M1GL 4OBRA 4EUPB 1P2CB 3F12B 4NN7C 3D25B 2HN7A 5LG1A 5DVMA 4LDLB 5KSVA 4MB3A 1S7XB 2Z91A 2WBWB 4HFWA 4AEIH 2H45A 3QG7L 4LCCC 4DW2L 5J9PA 5I66A 2K3TA 1XH3A 3ILQD 1ZXQA 4IIQB 3RHWK 2DQTL 5AZ2H 3TN0A 1T20B 3X11A 4HC1A 3OKOB 3UTSE 5F9WC 1OGTB 1FZJA 2GK2A 1BJ1J 2H9GA 4WW2C 2UWEE 4O2FA 4DGIL 1MELA 4HFUL 4NWUL 3UAJD 1CIUA 5ALBH 1A1MA 4P3DB 5CP7B 3H3KA 5BJTB 4KXZI 1RV6X 4GKNA 2GYSA 1A3RL 4Y4HB 3GI9L 3QP3A 5JQ6L 2BNQA 2GUOB 3CXDH 3TLRA 2VZ1A 5C0CA 3X3FH 1E4KC 3PIQA 3CH8A 2H6PB 5C0BE 2OL3A 4X7FC 1NUFA 1WZMA 2FHCA 1I3RA 1NDGB 1F11A 3TWCH 2R56H 3IDIB 5DMIH 2EZ0D 1GOHA 1BZ9A 3BUYA 3KYMA 3O3BB 4Q97A 1QQDB 1F6LL 3LN5B 1U58B 1AH1A 4TUKH 2H8PA 5BW7C 2EEAA 3Q3GB 1P2CA 3UCRA 1IC1A 5DMGC 4WI6A 5T1DH 5GS1A 2PTTA 1KIRB 3TFKC 2NY6B 5TFSL 1DBBH 4X7TB 1QO3B 2BC4A 3QIUC 3LKQB 4QHKI 3WLWC 1FJ1B 1FYTD 4QRPE 3OKOA 5EZJA 4GRMA 2Z8RA 3RVVD 3VWKC 3NFNA 3DGCR 3RZCD 5TDOB 4HF5L 4G6AD 1A6UL 15C8H 1KJVA 2G5BB 2HRLA 3L3OB 1QLRB 3T65A 2D0FA 3MRLA 4JDTH 3J8F7 2ZOLB 3MLXH 1ZHNA 4AL8H 2ZSVB 5T3XH 1JL8A 4R97C 4G8EA 4FFZL 4OV5A 4I9WD 5C2UB 3CK0L 4YHOL 4PGDB 4LRIC 4BH8A 3BEVA 1AE6L 2O5ZL 2GTWB 3O2WH 4NSKB 1K85A 5EUOE 2DQDL 1MNUL 2CJUH 4JDZB 1GGYA 3UTZB 2H32B 3A67H 1TNMA 4XNMA 2W91A 1CL7I 1UA6L 4PV8B 4HBQA 3IFNH 3ESUF 5EZIH 4JPIA 3ARDD 1HHKA 4YHNB 3S36L 1H0DA 3FT4B 4JZJC 4X6DB 3GSXB 3VMPA 1RULL 2Q8AL 1QQDA 1Y6MR 1KEGL 3PF2A 5CJ8A 3CZFB 3LN5A 2RHEA 1HQ4A 1A6PA 2NZ9C 3K1DA 4L4VB 2IQAA 3FFDB 4I0PB 1IM9D 4XCEB 5HI4C 4X7TA 4GAFB 3EKCA 4OGAD 4CW1B 5IQ9B 3L3IA 4PJ9D 4GRWF 2APFA 4TNWF 4X4XB 4XVSH 5F3BA 2XG5A 3TPUB 4NZJA 4NM8H 4ELMF 2R2BA 3TCLA 1RZKH 1D5ZB 4XX1G 4FG6C 5CGYD 4CN1A 1FJ1A 4OCLC 1F6FB 1EO8L 1YEHL 3OKDA 5D1XB 4Y1AB 2F53D 1WTLA 4KUZL 5IEKB 3SJVE 4YBQC 1VHPA 2BFVL 1QLRA 5IGXL 2ZOLA 1T1YA 5C0DB 1F2QA 1FYHB 3MV9A 1Z2KA 3DPBA 3K4DA 4JFZH 1MY7A 4PG9B 1XCQB 1BOGB 3PHQA 1U8LB 3WIFB 3K8MA 1CGSL 4I3SH 1F00I 1B0RB 2D3VA 1QFWI 4WWKD 4I5BA 2FATH 2YK1L 4DN4L 3UTZA 3GUTA 2H32A 1X7QB 1DE4A 5CIPB 4B7IA 2WBJC 5FDYA 1K3IA 3PNWA 3RL2B 1OY3B 1X5FA 5DK3A 4OF7A 4DKFL 3FT4A 4ZUWB 4N5UA 3KYAA 4LMQE 3DYPA 5GRUH 3LPGA 2F5BH 1FE8H 4NHCH 2ADJA 3SKJL 4L4VA 3FFDA 3AB0C 4P5TD 1G9NL 3QDGE 3RWEB 5DWUL 1HKLH 4I0PA 4NM4L 3MJ8B 2MPAL 2CK2A 2K1MA 2W60A 4LFHG 3WUWG 1YEGH 3IXTA 5FUCC 4FQLL 1J1XH 5LWYH 5I1AA 2XZAH 1D5ZA 4UINH 4Y5YC 2YPKA 4DWHA 3MRCB 3VMOA 1ADQL 4K3EL 5D1XA 4UNVA 4Y1AA 3VA6A 2BHUA 3T8XA 1EVUA 3VGAB 3P9MB 2LAAA 3KHOA 3P30H 4Y7MA 4FQJL 4KRPC 4PG9A 4NCDA 1XCQA 1AFVH 1U8LA 1CXEA 5C09A 1BFOB 1CXFA 1U93A 3G5XB 1URLA 4P3WA 4BK4A 1HH9A 3WIHA 1MWAH 3ZKXC 3BN3B 1XGQB 1IGCH 2GFBA 2RR3A 3CGTA 3SY0B 1AO7D 4HUWB 4H20H 3BZ4A 1NLDL 4P4KD 1HHIB 3MOBL 2EIZA 4YHIB 2ICWI 5GJSL 2HMID 5EOCH 1ZA3B 3DSFL 1U6AL 4PJ5A 4EIZC 5I74C 3MLYL 2VLKA 3IXAB 2GTZA 4I18B 1FYTB 5MEPA 4M61B 1QA9B 4MHHI 3GMLB 4D9LH 1MCIA 2ITDA 5D70L 3RZCB 1JGUH 4LMQI 4MXWL 3VH8G 3ZMRA 4K7FB 5IW1B 3WJJA 4LSQH 4JY6A 4NNYA 2Z92B 4NKQB 1MHHA 1OARH 1RUQL 3ZTJG 1FAKT 1Z0MA 3WFCL 4MDIB 1HHGB 3SQBA 1AD0A 3TT1H 1UXWB 3OJDA 1T0MA 1ZHLA 4N8VG 1ZOXA 4FMKA 2CKBH 3F58H 3I84A 3FO0L 5JTWA 3GBNH 2VDPL 4BFGA 5KJRL 3BPCB 2BNRE 1NBYB 3ZKNC 1KJ2B 3GMMB 2HJKB 2P8LB 3GEWB 3E2HB 4JQXA 3ARDB 3IDYB 1MCWM 1P4IH 4LLYB 1IKFH 1CTOA 4PJHB 3G5XA 4PRIE 5LGHH 1S78C 4S1SH 3O6FA 5KS9A 1D9KA 4P3CL 3SY0A 1D5BA 4TOYH 1CZ8H 1T21A 1YN7B 4YHIA 1I85A 4WU5A 2VXQH 1MRDL 1IM9B 4OZHE 4XNQA 3OKLB 3U9PH 1U8JB 3SDDA 3GKWH 1KB5A 3DGGB 4PJ9B 1TJIH 4Z7VB 4I18A 1N6UA 4RWHA 1CN4A 3FFCE 4M61A 4M7JH 5DMGD 5GISH 5JXEC 3TFKD 1MCPH 3RZCA 2F53B 5CCKH 3QIUD 4JPVL 4K7FA 3SQOL 1JHLH 3LS5L 2BSRB 2EKSA 1JTTA 3RL1B 3BWUC 3OV6A 2Z92A 1O7SA 3L9RA 3WLWD 2PXYA 1J88A 1T03L 4U6TA 1SBSL 4HQQL 5DD6A 3VWKD 5FUZH 1HHGA 1QSED 1MAJA 3VFOA 4MSWB 2V2WB 5D5MF 2IBZX 4KDWA 2BXZA 5FM8A 2BX5A 4WWKB 5KW9H 1NBYA 1QVOB 1S7VA 1KJ2A 3GMMA 4PY7B 1S3KL 1W0YT 2PO6A 2ZG2A 4NJ9H 3BP4A 3O2VL 5JIKA 3V7AG 4FNLH 4Y88A 5IB2B 1OL0A 2IPUG 4RNRB 3VCLB 5DJ6A 2ZKHL 4JO4L 3VXPA 3IKKA 4JZOB 4X8XA 3QJFB 4P5TB 2UZYB 3OGCA 3QFDB 3ZT5A 1RZGB 1U8JA 1BJ8A 5ALCL 2GEEA 1LEKB 1LK3L 1DQTA 4KKBC 4HKJA 2FYYA 2NZ9D 5I0DA 1UB6B 2Q87A 4E5XB 2I60L 5I8CA 2ZJSL 1UJTA 4QEGA 5C0FA 5HI4D 3UPRB 4CDGC 3ZTNH 2NR6C 3RWFA 1IKNA 3EO1A 2YBRA 3RL1A 1RIUH 1HIMH 4RQQA 1A6ZA 2VISA 4FG6D 4EN3B 4HCRA 3WHXA 2HTKC 4X4YA 1CLOH 3KPSE 4KMTL 1J8HA 5IQ7H 1EJOL 4H1LB 1AGEB 4MSWA 4B7LA 1D3CA 4YBQD 4YNYB 2HAZA 2A73B 2PCPB 1S8DA 4PJIE 3ZHDA 1AO7B 3L7EB 3TV3L 4P4KB 4KTDH 2FEEL 1QVOA 5C0RL 3OQ3B 4PY7A 3TZVC 3SDAC 3R06A 1JUFB 3PDOA 4WV1B 4YQXH 2EDLA 3LKPA 5GIRB 3WKML 3CLEL 3B5TA 3OF6D 4GAJL 5IB2A 5TF1H 3VCLA 2WBJD 3T2OA 2I9TB 2OM5A 5IKCA 5F7DB 2GSGA 3WD5L 3GGWA 4GMTH 3MNWB 3IRZA 3S37H 4NOBA 2IMMA 5ENWA 1CD9B 3S3PA 5F9WB 1S9XB 3WE6A 5C07D 5FYLD 1ES0A 3OB8A 1NCCH 1UB6A 4WW2B 5K59E 3UPRA 2BERA 4X9FA 3MFGB 3SGDH 2YUVA 3QFJD 1KCVH 4EN3A 1YMHB 4AM0B 1MFAL 1YPZF 4QHMA 2EO1A 2HTLC 3DXAE 3SDCC 1AGEA 4PJGF 4PRPD 3KJ6L 4NFDA 1QRNE 1IE5A 4LLVB 3WHE0 3DO3A 3S8WA 1JZ6A 1IAOA 2VDLL 1CLYH 4YEFA 1T1ZA 1VACB 3OXRB 2E8YA 2EC8A 4X80H 1JUFA 3SCMC 3CU7A 1HXMB 1HEZB 5EO1B 1RZ7H 5IVXF 1N8ZB 4WV1A 1YJDC 2EXWC 4HS8L 2DI9A 4L8SB 3OR7A 4D9QD 1T7ZA 1WBYA 3DMMC 4U6VH 5LBSL 1F4YL 1IAKB 3HC4H 3DX6B 3LKSB 5E5MB 3LSOA 1OAKH 1GC1H 1RZIB 3MXVL 1KIPB 3U7WL 2VKWA 3QIUB 4U3XA 1PKQA 4ALAH 2B4CL 5B38B 2E7BA 1TJGH 3KJ4C 4XPGL 1M7DA 3QXVA 5CJXC 4X6BB 4XVUD 3HR6A 3UJJH 4HUUB 3BAEL 1C12B 3BZFA 2Y7QB 1QSEB 3RHWF 2DQEL 4H0IA 4HLZG 3WHE1 4U6XA 4YIQB 4YHPB 1X5KA 1J8KA 1FG2B 3ZDXE 4OZIE 4D0BA 3JXAA 3T77B 1NFDA 4R97B 1AHWC 4HGWA 1AJ7L 1WZ1L 3TH2T 2XKUA 4BELD 5IMOB 5AUMA 5E8NB 4UNUA 3G08B 2UVFA 2FSEB 1A14H 4RIRA 4FQCH 3ZKND 1XGPB 3KPQB 1YEFH 5D71H 4DOHE 1J11A 2AERT 1VACA 3MRRA 4D0DB 4HMDA 2X4TA 3OXRA 1FV1A 5DO2C 4MJIB 1HXMA 4OLUH 3WO4C 4FABH 2YKLH 5BV7B 2KZWA 1J0JA 4L8SA 3MLRH 1S78D 5FB8B 3SDXE 3CLFL 3UTQB 1S7QA 2NMSA 2QHLA 5MEOA 1NSNH 3B2UC 4ZO7A 1D5IH 1YC7A 1B4RA 2EE3A 5IHLB 1RZIA 3LS4H 5DVKA 4AQOA 5CJQL 1I1RA 2X9YA 4QHKJ 5EORL 3O8XC 1UXSB 4P4RA 1GZQA 5CBAB 1U2HA 4FQQA 4HUUA 2YD3A 4JFFD 1C12A 4OIAA 4Z0BL 2Y7QA 4PRDB 5JQHC 5JXED 1QSEA 32C2A 4WUUA 2AJSH 5HHOE 3LEVH 1J05A 2VLLA 4PB9L 2YPVH 2R1YB 3L5HA 4U1IB 5GGTL 2O93L 1NMBL 3UJIH 3C6SB 2DD8L 1CK0L 5IJVA 3BSZL 2ZPKL 4QY8A 4YDIL 2VKXA 1DZBA 4EI5A 2Q8BH 3QHFL 5FK9B 4MD5B 3JV4A 2ORBL 2FGZA 3BVNB 1QEWB 4YHLH 5KSBE 5D7SH 3S4SB 1J0HA 1XGPA 4O2CA 3DUSB 1CU4L 2LVCA 3CVHH 1YEEL 1F4AA 2VZSA 2WBJB 3HFML 1DBBL 1IGYA 4M00A 2Q86B 4MJIA 1EDQA 2R69L 4CMMA 1GHFL 4HHAB 4Y19E 2UYLB 2KBGA 2I07B 4P2RA 2A9ML 2J6EA 3UTSD 5C07B 1CQKA 1MY5A 1PLGL 4YWGH 3QUMH 3WJLA 3DX8B 3AB0B 5CZVH 2OXGA 4WFFE 4JDTL 3MRDB 4DGVH 4LHUD 3QFJB 4KKBD 5CBAA 5ITBH 1LP9F 1P84K 4ETYA 4JJ5A 3HMXA 1F97A 1MIMH 2ZUSA 3FONB 3QO1B 1NGWA 2NR6D 4ODXA 2CRZA 5KVFH 1EEYA 5C6TH 5EBMB 2A9NH 4OLYH 3GK8L 4LLMB 1QR1B 1MUJB 5IT2L 2HTKD 3C6SA 2VMFA 3V6ZB 4HWEL 1IM3A 3QDAA 5GS0H 1I8LA 1IEAB 1LDPL 3D69B 3BGMB 2MMXA 1INQB 2FH8A 1KJ3H 2H2SC 5FA3B 1I75A 1CG9A 4GQPH 3ZKXB 1JYVA 5IBUG 1G84A 1JGEA 3FHAA 1QEWA 1R0AL 12E8L 3DX9B 3TZVD 2EIDA 2WLYA 1U91B 4PJAF 2WLZA 5CMAA 1L7IL 3F7YB 5I74B 4JFQA 3B9KC 5F1OB 4AT6B 2VLMD 4JN1H 5F3HA 3T4AA 2I07A 5HHNA 4RGMC 5BVPL 2HFEB 4P46C 4PJCE 4QRPD 5EIQA 3MA9H 2HLFC 1EGJA 5FO8B 3ULVL 3TO2B 3DX8A 3DV4B 4P5MA 2IPTH 1CTNA 5IJKC 4GSDH 5D7IE 3E6HB 4U1JA 1WJ3A 1NCBL 2HH0H 1AGFA 4OCNC 2ZUXA 4XPAL 1INEH 3G5VB 3ALXA 4CJ0A 4GS7C 5F96L 2XZQH 4P2QA 4BJLA 3NTCH 4GAYA 1BZQK 1SY6H 3W5MA 1A4JA 3KPRA 5CINL 4M48L 3MGTB 43CAB 3TJEH 1R3IH 3DOSA 5TGBB 1E0OB 3P4OB 1TMCB 1ZT4A 4YE4H 3NH7L 4V1DA 4QT5B 2SEBA 4NRXA 3F7PC 3V5DB 2HTLD 3W5NA 2JELH 5KVGL 3SDCD 2BHZA 2CLZA 4CMHB 1INQA 5GGUA 4YHMH 4XVJH 3MCLL 4S1QL 5FA3A 4HIEB 2JJSC 4LAQH 4L3EE 3U6RA 3DURA 1P7QD 4S0SD 5GRUL 5E94B 4E41D 4HG4J 2VLJE 1G6RH 4KQ3L 4HS3A 4YXKL 2Z93A 3SCMD 4X8JB 5DR5L 1NBVH 4HC1H 3EYUL 2EXWD 3QUZC 2X4PA 3OB0H 3DMMD 1YN6B 2HFEA 4JFFB 2HT2C 3MLZL 3FOLB 3SJVD 3MODH 2B1HH 1GCFA 3E6HA 5FGBA 1ZLSL 4F3FB 2FZ3A 3RNKA 3ARWA 1JZ2A 1PAMA 4OZGE 1B2WL 2ICES 5I8KL 3G5VA 5E9DA 2OL3H 3LN4A 1PSKH 2VSCA 1PVHA 4GG6E 3P73B 5EFIA 5LAXB 2QQKH 3LKOB 4AEEA 4G80B 3SE9H 3WIIL 5GGRA 3O9WC 35C8H 3F8UB 4JY4B 2VABB 3BZEB 3T3MF 1I3GH 3HS0A 1MH5B 3TO4C 2YRLA 1R5IA 4MMXC 1LHZA 5JNYA 5FV1L 1A7PH 5GGSB 3X3GL 5IMKB 1ULVA 1NAKH 2K7PA 3RP1A 4HV8B 3UTSB 4PJDA 4W6YB 3N9GL 3MR9A 5DO2D 1ZHKB 3RWDA 4M8VA 1VFAA 1DQDH 3IB4A 2UWEB 2E9IA 3T0DA 3QDGD 4Z9KB 1T04A 2V9RA 4NNXA 1U92B 4LHUB 1E6JL 4QTHB 4MAYA 2H3NB 1FVDA 5F7EL 4M43H 3B2UD 3WFEH 4GXUM 1FO0H 3MUGB 3HLAB 5HGDB 1E4WH 3NCMA 2V2TA 5I1CH 5D93C 1OGAD 1AC6A 5F7MC 1F45A 3CSGA 4UMGA 3SPVA 3N85H 4P49A 1PQZB 4QRUA 3O8XD 3BI9X 4DTGH 3QXAA 3TBYB 2FNBA 3MGOB 2H26A 5KANG 3MLTB 3BD3A 25C8H 2Y5TA 4OQTA 4U33A 2X4UB 3NCJH 4L8CA 3CXHJ 1WK0A 2BVQB 1A7OH 1U8OA 2Y36H 1CZ8L 3ZZ1A 1NUGA 3TZVB 1B0GB 4BZ1L 1P5VA 2VABA 1F3RB 4XMLH 4JVPA 3VGEA 5CBEB 4X5WA 1OAQL 2OSLB 1HYSC 2DLFL 2X4OB 3GMQB 3LKRA 1XGYL 5GGSA 5IMKA 4KDTA 4XZUB 5EU3B 4NQSB 3GI8L 1N3NB 4QRPB 4UV4L 2PYEE 4RFEA 5FYJL 4E42A 5D96C 1OQXA 4U1LA 4WCYH 1ZHKA 5T1MB 4BK5A 2C3VB 4XMPH 4QOKE 1JHLL 2DQGH 5ESVB 1C1EH 3ZT6A 5HVHC 1IAIH 3LPFA 2R29L 2B20A 5A2JH 1SEBA 1XF5A 1BX2B 1QSFA 3MUZ1 3JVGA 3A6CH 3R1GL 4JO3H 4PLNC 2C3GA 5HGAB 4YAQB 4OD1H 5HGDA 2VL5A 2ZCKL 5EUOB 4IDJL 5C0BA 4AEFA 2BNRD 1RURH 4Z76B 3TBYA 4NJ9L 3I3EA 2QQQA 3MGOA 4NO2B 4WNQA 3SDCB 2APXA 5B8CC 1AGDB 3FB5B 3WFDH 1S9KC 1IEBB 3T2QA 3G04B 1Y18B 4PRID 3V8CA 4IMLB 3IFOB 1P7QB 2W1NA 4E41B 5DZOA 3GM8A 1BWMA 3VG9C 3HRZB 1KBGH 1F3JB 4DKDC 4OGXL 3I75A 3SCMB 1K2DB 3TT3H 1QUNA 2H2SD 5EBWA 1UGNA 3MLSH 4OD2B 3DMMB 5F6IC 1FZKB 4XZUA 5EU3A 5CEYB 1RSFA 2OJZH 4OJFL 4LCIL 3FFCD 2AVGA 3IRPX 5IM7B 2FX9H 3IJSB 3VW3L 3SJVB 2EECA 3B9KD 2P8PB 1PG7L 1RIUL 1GGIL 1KIQB 1UG9A 5FM5M 4P46D 5JIPA 3TBVB 1AQKL 3FQUB 5IQ7L 5HGAA 2W65B 3E8UH 1AXSB 4MJ4A 3UBXI 4YAQA 1JPTH 3MO1B 3NCBB 2QSQA 2FEEI 3L3HB 4MXVF 4MJ2A 3OXSA 3BHBB 2ICWB 5FXCH 2WMPA 2CLRB 5SWSA 1AHWB 4M7LH 3ULUH 3WIHH 4PD4K 1XF2B 4NO2A 4LDEB 3EJYC 1AGDA 3HN3A 2CXKA 4A2LA 2NYYC 4R4ND 3GRWH 3QQ4B 1UEYA 4Q0XL 5AWNH 3DLQR 3WFBH 5IV2B 2H1PL 5E6IB 4NBYB 4GRWE 1UJ3C 4ZXBC 4LCUB 4OUOA 3DO7B 4MZ2A 3QDGB 1YY9C 2EH8H 4YUEL 3MQIA 3JV5A 3OJVC 3WO4B 1RHHA 5B3NA 1JHTA 1N5AB 1ZVHA 5EB9A 3HE7A 1LO3L 2OJEA 2AQ1A 5HBBA 1JYNA 4UOW1 3STZA 5GZOC 4UTBH 5DEFB 1KCRH 5MEQA 5IMMA 1NGYB 1OGAB 1JNLH 1BLNB 1C16A 1VB9A 2W38A 3K74B 1P4BL 3O8XB 3QUZD 4U1MB 3RZWA 3HCVB 1M1SA 4LGPB 4MZ3A 3FN3A 1D6EA 4JR9L 1T6VN 3TBVA 2HT2D 3SE3A 1MJJA 3FQUA 5DJCB 5HYQA 2YA0A 3KPSD 5SWZE 4U49A 5EBLB 1ZK9A 3PWPE 3MO1A 4PB0L 1G9NC 2YEZA 3L3HA 1DQQB 4PP1C 4RMRA 2QQLL 3IAPA 1MREL 1U3HA 3HI1B 2CLRA 3G6DL 1DLHB 4IRJB 2X1QA 4LEOA 1U9KA 5IF0B 4BZYA 4RX4D 2F54A 1HI6A 1RZ7L 2DJ4A 4AEHH 3HTLX 4X6FB 4J3VA 1RJZA 3BP5B 1I1YB 4TVPH 2DL2A 3IJYB 4U6VL 4ZTOH 2WW8A 1W0VA 4HJ0C 4LNRB 2E27H 3O9WD 3T0VA 5DRZA 5E6IA 1OAKL 1WVZA 3QHZL 1DBJL 5ICYA 4AG4L 3TO4D 5JW5B 2I9LA 1YEKL 4UIKH 5JW3H 3O3UN 4MNGE 3DV6B 3QEQE 1QFWM 1UZ6F 1JI2A 3UJJL 2YMXL 5K9KB 5H2BA 5HTSA 1IGTB 3ES6A 1RUPH 3L3DB 3AS2A 1BZ7B 3QO0A 3NGBC 5DEFA 1CFSB 4KK8C 1OP3H 1MF2L 1YA5A 2XKNB 1NGYA 1DTUA 2IPKB 2AABL 4BSVB 4KPHL 1UADC 1OW0A 3E0GA 5D72H 5IWLC 4R8WH 3TVMC 2BNRB 1P4LA 3GMRB 3MV7A 4YK4C 2IFFL 5I19H 1JBJA 3DXAD 5EBLA 2X4NB 2AEQH 4JKKA 1QRND 1EEZB 1WT5C 4PRIB 2F15A 4M9OA 4X6DF 1DQQA 3QXWA 2DQCH 4R0LB 1KACB 4NT6B 5ID0B 5D71L 4X5XA 4BSWB 4IRJA 3EOAA 3MRJA 4MA3B 3CDYA 5IF0A 4UV7H 2VDKH 4WEBL 8FABB 3D6GA 2JE8A 1B90A 2EDRA 5INDB 5SV4A 4LEXH 3QQ9C 2JLLA 3KPPB 1MRCH 3FFCB 1DN0A 3FT2B 5T3XE 3BUTA 3M1BA 1HYSD 2R0WL 1FFOB 3B9KB 1QBAA 3DROB 3N1FC 3VXMA 2OMNA 2P4AB 4RGMB 4P46B 5I0ZA 4GKSA 1MFCH 4PLOB 2XWJB 2YD4A 5CILH 2AJSL 1CFSA 7FABH 3H9HA 4HCRH 4YHZL 4OZFG 3I9GH 5MP6H 3QZWG 4HT1H 3UJIL 5JR1H 5L2KE 5TE6H 3GMRA 4GS7B 5EU5B 1L4IA 1CDUA 2DYPD 4ZAKA 3V52L 4HIIB 3V0WL 2ADGA 4X9BA 5IB5A 1UKQA 3QG6A 4YHLL 1JNNL 2Z4QB 2DKSA 4R0LA 3GNML 3BKML 5J8OA 4R4BA 3HZMB 3WDHA 4BSWA 1SM3H 1B6DA 1JWSA 3P9LA 8FABA 3BN9C 4OZHA 3PDGA 5KSAC 1EXUB 3OR6A 1T7VA 1TVBB 1OM3H 4WHYH 5B4MC 5JO5B 3WS3B 4EZMA 3N0PB 1JP5A 5HGHA 2RFXB 3FFCA 3FT2A 4R26H 1KLGB 4FQHA 5CZKA 3O11B 3C8HA 4X0KA 4D2NA 3QUZB 3Q6GH 1FFOA 5KOMC 4DGVL 4LKCB 3FB8B 3DROA 2X70A 2ADFH 3Q5OA 3E1F1 4ZUSB 1DEEB 3X14B 4ZYKA 1ACYL 3KPSB 5SX5H 2G75A 4NYLA 3O41B 1ZTXL 4QXGH 3MCKB 5C6TL 2AK1L 4PJIB 2A9NL 4QRRE 5FCSH 5KS9F 2W0FB 1JWUA 1QKZH 5KTEL 1JPFB 3H9SA 5GS0L 3P0YH 1K6QH 1DDHA 3CX2A 1U42A 4FFYL 3LKNB 3LRSA 4GH7B 2J88H 2O5XH 3FTGB 4X6CA 3RY4A 4WJ5B 3UX9B 5I1DB 1N0XH 4NQXB 3QNZA 2LE9A 4J3TA 4M6OH 3SDYH 1VEPA 3TO4B 1CVSC 3EJYD 4LSSH 2YPLA 4KWUA 1RUKL 2NYYD 5I1EH 3CCHB 5GRWA 1N5YH 4JN1L 3C2AL 4Y19D 4UT9L 4YXHH 3K2MC 3RWIB 3MA9L 3O6LL 3DHMA 4OZ4A 4TSAL 1JFQH 2P7TB 4ZXBD 1YY9D 5LGKA 3T04D 2UZIH 3BEWB 4KGLA 3FB8A 3RUGE 2ICEA 4KY1H 5GZOD 3NTCL 5EN2A 4DUXA 1YNTA 4J1UA 1SJEB 3DXAB 3JTTA 1BBDL 4NDMA 4LU5L 5I1HL 5D93B 1FNEB 1LILA 2ZNXA 1R3IL 3TJEL 4XCFH 1QRNB 4M6MH 3C9NA 2HWZH 4EBQL 3MCKA 5I8EA 1NBZA 1ZS8A 3GSOB 5ADOH 3GHEH 1JPFA 4WGVB 4G8GD 1M05A 1H5BA 4N9GB 3F5WB 4LSDA 4GMSH 4PP1D 3ARQA 5DJDA 4XC3H 1ZGLB 4Z7VF 3TBTA 2E6QA 1TZGL 4WEUD 3IFPA 3ARTA 5FO9B 1CE6A 1KTDA 1NBVL 5ID1B 4HC1L 3O3EB 4NRZA 4XNZB 1PX3A 4RISH 5E8OB 3U4BL 3CCHA 1FL3A 2V5SA 3BE1L 3VFSA 2AXFA 3VRLF 2CUHA 4HJ0D 1C08B 2Y07H 5DJXB 4P5KB 1ZHBA 5D96B 2VDQL 2FL5A 4OB5H 1JRHH 5E08L 3N1PC 4LLAA 1G7JB 4WTZG 4LPVA 5HVHB 1YPZE 3TA3C 3BEWA 1K4DA 3B5GA 3HUJA 4K9EL 1NGPL 5DC4B 1RUML 1NMCC 4MNQE 4AENA 5I6XC 1QBLL 1TQBC 4Y5VC 2OL3L 2DYPB 4KK8D 2VAAA 5HSFA 4Z7UA 4I8DA 1OAUH 4XCCL 3TNMB 1Z3GL 3DXAA 3P0VH 4XBEL 4YH6A 2B4CC 3C5ZA 4S2SB 3SE9L 3SKMB 3TVMD 5IVXE 35C8L 3PQYE 4PGJA 4PG2A 4DOHB 1WISA 1KPVA 3EO9H 1HILA 4XHJC 2E9WA 5B8CB 1R5VA 4PJ8A 1A7PL 3ME0A 4YPGA 2AAVA 4UQ3B 1IC7H 2NTFB 1DL7H 1NAKL 2CPCA 3SDXB 4L3ED 4O9HL 1ZGLA 4XRCB 3VG9B 2FDBP 2VLJD 1K4CA 3LHPL 1HN1A 5I8OH 3ZSTA 5DUPL 4D3CH 3VFRB 1T4KB 4JKWA 3GHBH 5ID1A 3FO1A 2J6EH 2CR3A 5IFJA 4K23L 5F6IB 3QQ9D 3PXJA 5CUSH 3VWJC 5J1TC 1RQ5A 1C08A 1MCOH 3MBEA 4ZFZA 2VC2H 3OHXB 2NNAA 4HEPG 2P42B 5I1CL 5HHOB 1G7PB 4BA8A 2NLJB 1N26A 2E7CA 3ZYIA 2YHGA 2QR0A 3HMXH 5I76A 4OZIA 3AS1A 2GJZB 3U0WH 4WW1A 3K2UL 5GPRA 2C4XA 4YX2L 1S7WB 4NZRL 3U30C 3NA9H 3I50L 4LPXA 3HAEB 2A77H 5KSBB 4S2SA 1A7OL 1J18A 4HEME 1FZOB 2V9QA 1CD1B 1YMME 4YZFE 1YQVL 2CIIB 1ED3A 4Y16C 1W0WA 4FXKB 4I13B 1ZLVH 4JM4H 1YEDA 3CFEA 4Y19B 3EOBB 1JZ8A 5T3ZH 5DSCA 3EO0B 5CEZH 1OHQA 4K2UL 4KC3B 5EDXA 4DCQA 3HG1A 3WBDA 3VG0H 3IS1X 4ZXBB 4WCYL 2W0KA 3RTQB 3PGFH 4XMPL 3BN9D 3FN0L 3EOTH 1EZVX 2DI8A 2V2XB 5KSAD 5IW6B 3VGGA 1FLRH 3MZTA 4M8QA 1LO2H 2ZUVA 1EGJH 2CMRH 4UU9B 5B4MD 3CX5K 3NOIA 1YYMH 2D2OA 1NFDF 2ZSWA 3KPTA 3OBAA 3RDTC 4AIOA 2G2RA 3KNBB 4F33A 1S9WB 2VE6A 1EEQA 3FRPA 5HHOA 2DOCA 4AH2B 1G7PA 3L3KB 4WEMB 3MXWH 1FFNA 2BSTB 4QRTA 1Q9LB 1HZHH 2RB8A 2FJFB 2BJMH 4G8GB 4KUCD 4QRQB 1AXTH 4OKVA 5EIVA 4Z8FH 1MJ8L 4Y4FA 1ZEAH 4EUPG 1NGQH 1A0QH 1CD1A 3T1FA 1S9VA 5IHUH 3FQRA 3TT3L 4XPFH 3OAYK 1ZKAA 1OP9A 1NCNA 1NPUA 5CWSA 4JO2L 1S7UA 2VJXA 4WFHE 2RAMA 2OJZL 3OAZK 4PJCB 5FA4B 2PYED 4IHOB 1KB9K 1XIWA 4K94L 2OZ4A 1DLFH 4FQ1L 1VDGA 1OD9A 3CU1A 1RJYB 3RTQA 4QOKD 3NIFF 4Y4KB 2AEIT 1U8PB 1LP9E 4UB0L 1MCHA 4ODHH 5D7IB 2Z31C 5JHLL 3PWLA 3VXSD 1I1AC 4E0RB 1A1NA 1W72A 1FHGA 3OKNA 4ISVB 5H37H 3QNXA 1U8IB 3NGBB 3BIKB 1K5NB 1VFMA 2HVJB 4NO5A 4YX2H 1H3TA 4ZNCD 4J6RH 4S10A 3F6LA 2Y23A 4NJAH 3TVMB 2IJ0C 2FR4A 3WIHL 1RZKC 4CN6A 4YK4B 1P6FA 1RI8A 5GSRB 4X99A 1TZIA 1WEJH 5DVLA 4QTIH 4LASL 4YGVB 4HUVA 3AREC 1BAFH 5IESH 4ONFL 2CLVB 2OYPA 5I17A 4PJAE 2R4RL 2YC1B 4L3EB 4NOFA 1XR8B 2VLJB 2B8OT 3ROLA 4MCZA 3W0WE 4LPUA 5D2NE 4Z0XB 1Q94A 1J0YA 3EYVB 5AAWA 4U7KA 4I2XE 4LIQL 4XWGH 3O2DH 2WM0A 3OKKB 2UVEA 4PJCA 2DDQH 5DD1H 3SGDI 5AZEH 5B39B 3IF1B 4Y4KA 1S7SA 5C8JA 3KWWB 1GGUA 3CC5A 4EQ3A 1VGKA 3VMNA 3CFKB 1UVQA 1OTUC 4Z7QF 1ACZA 3KPOB 2E8ZA 4PREA 1U8IA 2QKIA 4GG6B 2W9EL 3GIZH 4PRAA 4RFNC 3NIGE 1QRKA 3IDJB 2P5WE 1BFTA 4HKZA 3TA3D 2P45B 3NCEB 3EZJB 3REWA 4LOUC 4JO1L 4FA8A 1B4JH 3VU2A 3JTSB 4PBVC 4WHCA 2YXMA 2M1KA 4UT6L 2D0GA 4TUJB 1C5BH 4I1NB 2AJ3A 1A9EB 1KB5L 3EDDA 4XHJD 3QDME 1U8QB 4Z0XA 3VI3E 2KQNA 4DQOH 3AU1A 4F9PA 2PYFA 4LVHC 5JW3L 5KVEH 3GSQA 3FO9B 4EI6B 5KSAB 1FC1A 3O3DB 5E5RB 4KHXH 2DAVA 2B2XH 3SKOA 4D94A 1NCUA 3OKKA 4CL7A 4PV9B 3V4PL 5SV3A 4WIQA 4O58L 2Q3ZA 2YS4A 5GRJL 2EDJA 3PGDB 3MSPA 3VWJD 1CFVH 2OK0H 4Q58C 1JPGB 4OF5A 3NMEA 4OZGA 1RK0B 3QWOA 4LSUH 2QTEA 1GOFA 5SWZD 1KJ2L 2AEQL 2QLVB 3ARYA 3DUUB 3PWPD 3LAFA 4HXAH 5J6GB 3K0WA 2D9CA 1ZLUK 4BQCA 5BMFL 2XFXA 3VFPA 5I30L 5FO7B 3VFGL 1XGRB 1F4XH 3BP7B 1RPQA 3GO1L 1IFHH 4AMKL 4JE4B 3RY6C 2NXYC 4IRZH 2J3SA 4MJ6A 5JOFB 2DKUA 4OSUH 3EYOB 1CICB 2PYEB 1KFAH 1U8NA 4QXTB 2DQHL 4Y16D 3QUYC 1U8QA 3QPXL 4JY5H 4OFYD 4QOKB 3C5JA 3GMNB 1FPTH 3OPZL 3RVWC 5IOPB 2QL1A 2Y5EA 3VFWA 3VA2C 5BS0A 4XB7A 1T1WB 2XQBL 1BFVH 3QEQD 1EJ6A 3VI4F 1WZLA 3RPKA 3UBXB 1UWGH 3O45A 5IHBA 2F74A 1NAMA 2A1WH 5CILL 4ZUUA 2NY4C 2BSED 4Z95H 1BOYA 4V2BA 3T0EC 1XGTB 3MNZA 2X1XR 2YN3A 3KPLB 5F7YC 3I9GL 3JSSA 3UJTH 2PW2A 1VGEH 1JPGA 1H8NA 2FEDC 1DQML 3OZ9H 3CUPA 3RDTD 1MCNA 4Q6YA 5JLZB 3NAAH 1FFQA 3P4LA 4XH2A 5EA0H 5D6CB 3DUUA 1C7TA 2HJFB 3ARXA 2QQNH 4PJEE 4K7PH 3LIZL 4N90D 4PJDF 4LSVH 1SM3L 5FO7A 2V7HB 1Q0XL 4JFDA 5JUEL 5F71A 4F58L 4RWYH 2WUCH 4BH7A 3CDGA 5CFHA 1E4XL 5BQ7B 3V6OC 5BZWB 3SN6N 1VFOA 4RGOH 5FOJA 3W2DL 4FQ2H 1CICA 2DQIH 5IK3B 5T3XD 5ACLA 4QXTA 3BESR 3MRGB 2IALB 5IBTL 2X44D 3MRBB 3LD8C 2PKDA 3SGKC 3GMNA 2VNCA 5D2LA 2A0LC 3LQZA 5EU6E 3MRKB 2A38A 1FAIL 2FX7L 5DD0H 1TXKA 4GUPA 2EDEA 5F1IA 3QHTC 4X9IA 1H3VA 5IROC 5GXBB 3PWNB 2X9XA 4JB9H 4JANB 3TA3B 2Z31D 3P3YA 1I1AD 1NMCB 2CDEB 5L2KD 1TQBB 4Y5VB 3TBSB 1I9EA 4ONHB 3RKPA 2YD2A 4R2GB 2R0LH 5ANMA 1YECL 1BIIB 3DVNB 1IEHA 4A2MA 5F9AC 3KPNA 3B2VL 1FH5H 1QFHA 1QBBA 4NKIL 3GSNH 4LHQB 3VXTB 5GZNC 3HR5A 1BVLA 4GRWB 3L5WA 5CJOH 4TSBH 2R8SH 4KDVA 5A2FA 2R0ZH 3FMGH 5EWIL 2UWEF 3ARED 3QQ3A 1HQRA 2BVOB 5FKAB 4YXHL 2BNQE 1IGFL 3BDYH 3BW9B 5F97E 3RRQA 3D9AH 5C0CE 2ARJB 4PGCB 1JGVL 4GRLC 1JFQL 5IK3A 3MRGA 5DVOA 5E99L 5MHSE 4ODTL 1J86A 5E24E 1CE1H 1AD9A 3KYNA 3VWJB 4PFEA 1SVZA 1Y0LB 4MXVE 4MA1C 5C2BL 4XP6H 1Y6KR 5SWZB 1KTRL 3OAYH 2Z35B 3DVFA 4L3CA 4OUUB 4NRYA 3PWPB 4YLQT 4MDJA 4JANA 1EFQA 3MJ9L 3E6FA 2AXGB 2JCCE 4JFPB 3IGAB 5D7JC 1OTUD 3IDUA 2APWA 1CDYA 3TBSA 3B5HA 4YR6B 1V7MH 1OP5K 4EUPH 3LEYL 4JM2A 4OI7A 3NZ8B 3U30B 3LPWA 5F1KC 5FHAH 2ZCLL 3VE0B 5IHZB 5DHVB 4OCWL 2J8HA 5K9OB 1MCDA 5JDSA 5L9DH 3U46B 4M6NH 1TTGA 3MC0A 4Y16B 4WFED 1FZMB 4MA8H 4R96A 1Q72L 3PG2A 4RISL 4HDIB 4ZOCA 4ZUVB 3P40A 2ESVA 2CK0H 3MJ7A 3MRMB 3QEQB 4HWNA 5FKAA 2VITA 1UCBL 4LLUA 1A9BB 5H94A 4EVNB 5DJ0B 2FB4L 3SE4C 2V5YA 1PKOA 3BO8B 3FQWA 1NCDH 4OB5L 4DFIA 3IKCA 5T1LD 1JK8A 1J1OL 2ATKA 1IGIH 4RGNE 4DZBB 5BOPA 1F02I 4HWUA 4K07A 4CU8A 4H5SB 4O00A 1Y0LA 3RDTB 1JNHB 5GJTH 1IZJA 1WAAA 1B6UA 4H1LG 2R1WB 4OUUA 5EOTB 1T3FB 4JFPA 4JRWA 4L4TA 1D5XB 4ONGH 1TETL 4HAFA 1UACH 4DN3L 2HT4D 4KJQC 3OX8B 3ARFA 2KZ1B 4QYOB 1GOGA 1OB1B 4OLVH 5L8JB 2X6MA 3IVKB 3VE0A 4HK3N 3I85A 4KJPC 5I2IB 2Q7YB 3QCUL 2V9TA 5BV7L 4X7SH 5JHDE 1YUHA 4UTAH 4NKDA 3U46A 4D3CL 4UBDC 1UZ6E 3PL6A 4HPOH 4ZFFA 4OFYA 4CVZB 5ICXA 3RWJA 4LSPH 4HIXH 4UDUB 4B53A 4KKNA 1T89C 2NXYD 3PDDA 4MNGA 3U36B 3TYFB 4OM0H 1A9BA 4S0TD 3BH8A 4Q6IA 5FUOH 4XGZA 3U83A 2VC2L 3KR3L 4G8IB 1RFDH 3QUYD 4G7VL 3D18A 1M6OB 1F5WA 2VERN 3RVWD 4F7TB 1YY8A 1TITA 1KXVC 4NN5B 2Z31B 3HMXL 2R9HC 4DZBA 1HOCA 1I1AB 5T5FL 1N59A 3VXUD 5ISZE 5L2KB 2E7LA 4MNQD 3W39A 1DQJB 4H5SA 4DK3A 3H7LA 2NY4D 1MFDL 4NO3A 3BPOC 5DEGB 5CEXB 1EFXA 4OAWB 1W8NA 2APTA 5EOTA 4U1SA 1KG0A 3KLAB 1X5YA 1U36A 3EW3B 3IYLW 3PQYD 1KXQE 1IVLA 4LVOC 2IAMC 3DX7B 2AK4E 1T3FA 2FEDD 1NDMA 4Q9RH 4JN2A 5ERWA 5IMLB 3O0RL 3QNYB 3S5LB 3AREB 4P59H 2XA8H 1OB1A 3MNVB 5L6YL 1PW3A 2B1AH 3WN5C 1X5XA 2Q7YA 5I2IA 5EU4A 1A8JH 1OCWH 1EHLH 4OD3H 3PGFL 2AV1A 4APQA 1KCUH 1UB5A 3GBML 4W68A 4U3HA 3KYKL 3WLBB 5B38G 4UDUA 1H3PH 1ZLUH 4G5ZH 4KZEH 4IRSA 5C09E 1OSZA 1ZSDA 1DP0A 1DUYA 1GL4B 2XQYK 4YDVB 3ULUE 4KJYB 1DFBL 3MLVH 2VDMH 3EOYG 3IDMA 3SBWC 3C5SA 1A4KB 1V3LA 2DQUH 2A0LD 3MXWL 3ISWA 1ONQB 4OCYH 3HC0B 4HW6A 2VLRE 1QOKA 4PJ5E 4WHTB 2X4RA 3I6GA 1S7RB 1J1PL 2VLKE 1ZT7B 4RFNB 5CIPH 5H8DA 3GSWB 4Z8FL 3S88H 1Z9MA 5HYSB 3P9WB 3P2TA 4XHQA 4ZSOA 3VRIB 1MFBL 1H8OA 1UH3A 2D03H 4QCIA 5IIEB 4NWTH 1A0QL 3MZGB 1YMMD 4XPFL 2GAZB 3AXLA 1R3LA 5KG9A 4MD0B 3G6JA 1DLFL 1SYVB 5I15H 1J10A 1NLBH 2P24A 4MNHB 5GS3A 4POYA 5T1LB 4LVHB 1CBVL 2D7PA 2I5YL 5ICZA 5GS0C 4C4KT 4CU7A 5K9JH 4PGEA 5GGRY 1FIGH 3DARA 1MWAB 1FL5A 2X1PA 3GJEB 3HI5L 3MUY1 4M02A 3RUGB 3QUKA 3H3PH 1A6VH 3KDMA 4GRLD 3DETC 3ZHLA 2GT9A 3MTRA 2IADA 4KJYA 3BWAA 4R3SB 4NP4H 1FN4B 5E8PB 4FQXC 5KS9E 5ETUB 3X13A 2L7UA 1LE9A 3ZE0E 4BQ8A 4TVPE 5F7FA 4P23C 4M93C 3PV7A 1GVIA 1I8KA 4DZ8A 4QRRA 1BJ1H 1Q0YH 3MMEB 1DVFC 4K7PX 3DRQA 4PYHA 3AS3A 2B7DT 1ZT7A 3L6FB 4OZHF 3ZHKA 3GSWA 3HNVL 4M5ZH 5FF6B 2FCBA 3GMOB 4NCC1 2ED8A 4OCRH 5C0AE 3WMSA 5D7JD 1SMOA 3S4SG 3SGEH 3S6CA 1G7IB 1E4JA 2LTQC 4XWGL 2CKBB 4QF1A 1MRFH 4KU1A 5AD0B 3CVIH 5JOPE 3KYOB 2NXYB 4FTVA 4JRYA 1NJ9A 2NXZC 4WFHD 1UCTA 4F37K 2ATPB 4X4ZA 1G1CA 3JWOH 3G9AB 3QUYB 5KN5B 3B9VA 1EAJA 1TTFA 4X7EC 4QGTA 3EDJA 2DS4A 3VD7A 1IT9H 3ZE2E 2VR4A 1YPZB 4G7YL 3OKYA 1MWAA 3VFMB 5C7XL 5L8LB 3VXUB 3GJEA 1QYGL 3RUGA 5HD8C 5JPMA 4MNQB 1WITA 3HNSH 4XNYL 2NY4B 3CSPA 1F58H 2N1KA 5FYKH 4Q9QH 4Z6AT 5GGSY 3TN0C 5E8PA 4XC1L 3X12B 1NGXB 4Z5RA 1HSBB 1INDL 3BT2H 4G9FA 3U9UB 3R8BB 3GSUB 4OQTL 4X6CF 3UC0H 1MJUL 5IVXB 3PQYB 5BVJA 2VIRB 5D9SA 7CGTA 4Y2DB 4D0CB 3QWQB 4QGYA 3FT3A 5HY9A 1OLZA 1DBMH 5M7QA 4O2EA 5HI5C 3GMOA 2ZCHH 3HZYB 4H0HB 4K9EC 4J3WA 4IOFC 4LQFL 4M7KL 1QSVA 2D7TH 2XACC 5HVWA 3W0WD 4JFYB 1CT8B 4FQIL 4KJQD 1QTYT 5AD0A 5LQBL 1QNZH 1J8HE 4KJPD 1II4E 3GSVA 5I9QC 1WGOA 4MWFA 1VKXB 2G60L 1OP5H 2BNUA 1F4WH 1VEMA 4QWWC 2DLTA 1OSPH 1G9MH 3LD8B 5L2JB 3LY6A 1I9JH 4YPJA 4YXLL 4RMTA 3QQNA 4H88H 5AEAA 1I1FB 3IFLH 5GS1C 4PJIF 4XBPB 3T4YB 3VFMA 4JG1L 2EYSA 4AIZB 4ELKA 5C9JB 5CHNB 4OT1L 4PJFE 3NACL 1R3JB 2W9LA 1X4YA 1XR9A 3BGFB 5DQDH 3HMWH 1PZ5B 2P5WD 2R9HD 3G5ZA 1KPUA 1RY7B 2EIEA 3MACH 2VIRA 1HDMB 1T5XB 1YMMB 4UILL 4Y2DA 4U2YA 3ARRA 1YEJH 2IF7A 3MBXH 5JA8B 2ITCA 2Y25A 1XCTA 1EPFA 1KFAL 2WV3A 4DKEH 2IAMD 4Z78A 3HB3C 3QDMD 4NQEA 1DBKL 4JY5L 4JFYA 1NCTA 5IR1B 1CT8A 1Q9OB 4OF6A 6FABL 4RFOH 4GKZA 5A16A 4RGNC 3HUJF 2XWBB 3U4AA 4GOSA 3UROR 4S1RH 2PUQT 1KGCD 4LLDB 5IFAL 2FGWL 4GRLB 1VKXA 4PJXA 4HGMA 1FDLL 2DQFB 1EHNA 2NY5H 4R4FH 4Z7UF 1RIVL 4NC2B 5L2JA 3UJTL 1KTKE 1I1FA 4OLXL 4TSCL 5L7XH 2HG5B 4U6YB 4N0YL 5DK2B 3H7BA 5DC0A 4MA1B 5DHYB 3I02B 1EUTA 4ZS7L 5J4MA 2NQCA 3WFHB 2MKWA 3L5JA 5J06A 3D3VD 1ND0A 4TRPH 2ZWLT 5DDHB 1DUZB 1PD6A 4HKXA 4BFIB 3U1SH 5E2WH 4K3DH 4NNPH 3STLB 5I71C 5D7JB 2VL4A 3O6ML 1PKQE 1T0NB 5D1ZA 1MAML 1ZANH 1HDMA 3FB6B 4KVNL 3OTTA 5J57B 3QB7C 2RQ8A 1CQYA 4JREC 3RWCB 4NUGL 3Q1SH 4NQUA 2DTMH 2JF1A 4E9LA 5D1QD 4OFVA 1C7SA 3W9EA 5IR1A 1RK1A 4D8PB 4D9RE 1NFDE 2X4QB 1XMWA 1LP9B 4HUMB 2A83B 5KANI 3C09C 4LHUG 5GRVK 3ZDXF 4OZIF 3LCYA 2Y72A 1YYLL 1CR9H 5E4IA 1XGUB 4WI5A 1QFOA 1H3XA 2DQFA 5GS0D 2BRQA 5C08A 1JZ3A 1AI1L 2Z8SA 3TJHC 2ZG3A 3V4UH 1XFPA 2HYMA 3G5YA 1RIHH 4EEEA 2AKRA 2HG5A 4I0PC 1AR1C 2WZPD 1LO0L 4OIIL 2FLBT 1QZ1A 5E6YA 1NCWH 3WFHA 4FQXD 4JRXE 2X40A 1GGTA 3WEXB 1DUZA 4P23D 2AJYL 2FJHA 3REVA 1A3LL 4PJAB 5E2VH 2B0SL 1QLFB 1KC5L 2J4WL 1JGLL 1HSAB 1DVFD 3W0WB 4ERSL 5D2NB 4DUWA 2O61B 5DRXA 4B50A 4I2XB 3FB6A 4K8RL 3QRFM 2OP4L 5CSGA 1KN2L 5EBGA 5ITFB 3GDBA 3BDYL 4YDLB 4WUUE 1KPRA 1I7UB 1GGCH 5K9QG 1KNOB 5D6DA 3ULUC 5L8KB 5DD5H 2R2CA 3VRJB 2R2EB 3BX7C 3D0LB 3HZVA 5C0GB 2X4QA 1I9RL 1BEYL 2YD6A 3LZFH 5EU6D 2NXZD 1TVHB 1QBMH 1KN4H 4TUOB 3Q6FA 1PEWA 4W4OA 1NUDA 3B3IB 1VFUA 3F7VB 1I7RA 1MHPH 5EZOL 2AQ3A 4GG8B 2P5WB 3ZYJA 1A7RH 2Z0BA 2NW3A 1BVKA 1CXIA 3VD3A 4DAGH 5HD8D 2CIKA 2IQ9L 2OBGA 5DJZB 3EZ8A 5C0JB 2HJLB 3WJJC 2NW2B 4JHWL 1QSZA 2YUXA 3BPOB 5I1KL 3TN0D 3NZHL 1BECA 1V7NH 4P2YA 4KQ4H 2FX8H 3FQTB 1E28A 3WEXA 1ZLWH 4L5FH 5DGRA 3AAZA 2NY7H 4LVOB 1MLBB 2IANA 4XVTH 1OWWA 5DS8A 1PJ9A 3QDMB 4MA8L 5D2NA 4PTUB 2VZOA 4I2XA 3FCTA 2CK0L 5FGCE 1TCRA 1YNLH 5HI5D 4JFXB 1JRHI 5CAYB 3WN5B 2BNQD 4JQXC 5MENE 4IOFD 3TBWA 5C0CD 1DR9A 5DK0B 4RAVB 1F8TH 3M8OL 5BZDB 1RZFL 2R2EA 3O6FC 1M71B 1D9KC 1NAMH 3FQXA 4L3AA 2C1OA 3MLUL 1I85C 1MVUB 3VFNA 4TUOA 3AMKA 3CSYB 3SDDC 4ZO8A 4QWWD 1A7QH 3F7VA 1M7IB 3D3VB 1A47A 4I18C 4OIBA 3TC9A 3H6JA 1CD0A 1BJMA 3DJ9A 3GMPB 1OWRM 2P5WA 1DSFL 3PP4H 4MAUL 3BRGC 5T3ZE 1MFEL 5CEZE 3KLHC 3RZCC 4JAMB 2MOVA 3WUWA 1CGWA 5C9KA 3BKCL 3PHOB 3K4AA 1E6OH 3SOBH 5I16A 3EAKA 4K3JL 5I1IH 1UACL 4JKPH 4F8QA 2V5RA 2IWGA 4WO4A 2EYTB 2PXYC 1MJ7H 1WFUA 4XCYB 5HGBB 3FQTA 4XBGB 1U95A 2EDTA 4MHHG 3WCYA 4F7PB 1NCAH 4HG4K 5TDPA 1BQHB 1KCKA 2DL9A 5DJ2B 1K8DB 2J2ZA 4PJCF 3F6IA 2CR6A 3KPMA 5D1QB 1N4XH 1X44A 4HPOL 4WRLA 1E27B 1FVEB 4JPKH 1JGDA 3VD4A 5E8DH 4P2QE 2PO6C 3ECBB 4HXBH 4JFXA 4RBPH 3KPRE 5J1AA 2V5TA 3HB3D 1T66C 4RAVA 2EIBA 2A6DB 3THMH 3VD9A 5BZDA 4ZTPH 5C0IA 2R4SL 3HC3L 1VESA 3U7YH 1WBXB 4V1DE 5FV2A 4RGND 1BM3L 4PTTB 4PRNA 1GPOL 2YOCA 4GXUN 4JCLA 5KVMC 2Q6WB 1F3DJ 2OR9L 3CVHA 4FQXB 4O02L 5L88L 1EAPB 1A7NL 4P23B 1S5IL 4CAGA 3VH8A 4M93B 2XY2A 4ZD3H 1QLEH 5GGQL 2HRPL 4FXGA 4PJEB 3HI6H 1UM5H 1DVFB 1CS6A 1NQBA 1IKNC 2VXSL 3IDGA 1NL0H 3QUMA 4PUBH 5FKPB 3IU3A 4P59L 3BPLC 4DVBA 2XA8L 4N8VA 3KXFE 3L7FB 4CVXB 2B1AL 2E7HA 3E3QE 1ZVSA 1MAKA 1EHLL 5DJ2A 4OD3L 5D1QA 1GIGH 1S9YB 2AJZB 2LTQB 3VI4E 4WI4A 1DBAH 4Y89A 3MFFB 3MV9D 3T0WA 1YNKH 3JWNC 5EU6B 1WWBX 2NXZB 1FIEA 3ECBA 4LQ1A 4NKMB 5IB3B 4LRNH 1CD8A 1LDSA 4OZGF 2JB6B 1U8HB 5F7UA 2YN5A 2YUZA 1S7TA 5E2UH 5ACMA 3RVTD 2AGJL 4R90H 2PETA 4LARL 2A6IA 2HN7B 1L7TL 1G0DA 3LN9A 1KENL 4LSTL 4KZDH 1ETZA 2Z91B 3ETBF 4HFWB 5J9PB 3NCCB 1G6RB 2I26N 5I66B 5SWQB 4NPYA 2F58L 1XH3B 3TN0B 3X11B 1I3UA 3TJHD 1OAYH 3CXHK 4PJDE 1JMZA 3RIAF 2MWCA 3PP3K 2H9GB 2XNAA 2DLGA 3QCTL 2D03L 4O2FB 1EEUA 4PJEA 2BOBA 4I0PD 1AR1D 1C5DA 4QHNA 3VFUA 4NZTH 1P84J 3P4NA 2LQRA 1U3YA 1CLZL 4GKNB 4FS0A 3VXRA 1I1CA 4EN3C 1NMAH 2BNQB 3HNTL 4KTYA 3C8DA 5C0CB 4OGYL 4Y1AD 3PIQB 1NLBL 3HA0A 3KS0J 4XPBH 2OL3B 2F8XC 3O4LE 3T3PE 1X5GA 2EDWA 2DLHA 3D39A 3MFFA 4YHKH 1I3RB 1F11B 2VZTA 2CO6B 5C09D 4OF3A 1BZ9B 4WV1C 3BUYB 3KYMB 3ULUD 5FHBH 3T2PA 4KFZC 5F6HI 2H8PB 5J1SC 2AJUH 1DN2A 1G7LA 4WY7H 5FCUL 5GS1B 2PTTB 4HIJB 4YEEA 5C0EA 5JXAH 2JCCB 2BC4B 2VLRD 4NQDA 4PJ5D 1G6RA 2CDGB 5SWQA 2Y06H 2VB5A 3O6KH 2VLKD 1OAZH 1EA9C 4LP4A 3VGDA 1EMTH 5BRZA 4ODSH 5J12C 3BDBA 5EZJB 4GRMB 4OM1L 3CNKA 1A5FL 3RY5A 4DGYH 3NFNB 3H8NA 5MI0C 4AYFA 1KJVB 5DFVC 1R3KA 2CXGA 3T65B 3UO1L 4N9OB 3MRLB 1FO0B 4L8BA 4LCWE 4G9DA 4MX7A 1ZHNB 1QSFE 3TIEA 4G8EB 5D2LF 4OV5B 5T1KA 3OJMB 4BH8B 3BEVB 1T2QL 1CI5A 3D87B 3GIVB 1ITBB 1X3DA 3HPLA 1FBIL 5DF0A 3CJJA 4S1DC 4UT7L 4XNMB 2VH5L 4RGNB 1T1XA 2IG2L 4JPIB 3PABB 1HHKB 4LCYB 4M7LT 2H41A 1H0DB 3HNSL 4U1KA 2BVYA 4ZUTA 5FYKL 4ZFGL 4Q9QL 4L8SC 4RMUA 3O6FD 3IDXH 1D9KD 3BT2L 1HQ4B 1VENA 5E7BA 3UC0L 1IC4H 5BO1L 2IQAB 4G43B 1I9IH 1TZHA 4HIJA 2VAJA 2BVEA 2BMKA 2JCCA 1PYWA 3SDDD 4XXDA 2MQ0A 3L3IB 5DMYA 2EEDA 1MVFA 2FD6H 3NABH 2CDGA 4KKAC 5F3BB 2R2BB 3TCLB 1DBML 3WV0A 3D0VB 2ZCHL 2HKFL 4M7ZC 4JFOA 5F9OH 5I71B 2LFGA 3OKDB 3KLHD 5C0AD 4LPWA 3RAJL 3C08H 3RI5K 5HYJE 2QJDA 5F88A 2E6JA 3DSNA 3MA7A 3IU4H 1FO0A 1T1YB 1SQ2N 2PXYD 2AJVH 3MV9B 1LVEA 4JREB 5JOPD 4HGKC 5D7LA 4G6KH 3PHQB 4HKBA 4HUKB 4EI5C 3Q2CA 2P1YA 5LXGH 1HNGA 3GIVA 4I5BB 1OSPL 3QH3B 4JPWH 1I9JL 4RRPG 1QFWH 3GUTB 5SWSE 1DE4B 1UM4H 2PO6D 3IFLL 3C09B 4P0DA 3MLWH 3PABA 3PNWB 2MCPL 5ISZB 4LCYA 3U0TB 1T66D 2UY6A 5BV7C 2AEPH 3ILPA 4NQCA 4JM2F 1ORSA 2VXUL 4U0RC 3BKYH 1KCSL 4MJ5A 2COQA 4Z77A 1SMAA 2ADJB 5LVEA 3L5XH 3WJLC 5F44A 4QXUH 4G43A 4C83A 3INUH 2AK4B 5FM5O 2EXYC 4I0KA 5J7CC 2W60B 3IXTB 4I3RH 5I1AB 2D31A 4XPHH 5FFLA 4PY8I 5F8QC 1YJDH 3D0VA 3HPJA 2YPKB 2EEBA 3ZL4L 1BGXL 5HHVH 4FZ8L 4TULL 4NN6C 5DC9B 4F57H 3HE6A 3T8XB 1UC6A 1IGML 5JHDA 3RU8H 4UUJA 4XP9H 3DI3B 1RZJH 4M1DH 4M62L 1BF2A 1Z0NA 2DLIA 2OZ4L 4NBZB 2QSCL 2IGFH 1N6QH 1NKOA 4S1RL 3I2CH 3V4VH 1J8HD 3PWVA 4UDTA 5C09B 1I8LC 1T5WA 4F9LA 1U93B 1HH9B 2A6JA 3QCVH 4JHAL 1WAAF 2GFBB 5GSVA 3H9YA 2P48B 3QH3A 1W72L 3BZ4B 2EIZB 1D7FA 4EOWH 3RGVA 2F54E 2DM2A 3WXVL 1MCJA 3QIWA 2VLRB 5ISZA 4PJ5B 3U0TA 2VLKB 2GTZB 4N68A 1OPGH 5MEPB 3U1SL 4OCXH 4ZNEE 3ARZA 5IVNA 4MB5A 2ITDB 2RCSH 1TFHA 4NGHH 1C5CH 2CDFB 4JY6B 2AK4A 1DQLH 2EYRA 4NNYB 1MIEL 5J6HA 2WBKA 1MHHB 2EDFA 4PGBB 2VUYA 3WNPA 2ZUTA 3VXNA 1OAXL 1AD0B 3OJDB 5HDQH 5C1MB 1T0MB 1ZHLB 3N1GC 2O5YL 4H0GA 3BMWA 3CFCH 1T2XA 2PR4L 2FJGA 2OS7A 3IDNB 1KEMH 1UYWL 4M5YH 3MV7E 4EN3D 1RZ8A 3RJDA 4HMCA 1FNSH 1LD9A 3EDEA 2X89A 2ZOKA 4XNUH 4XNXH 5FYKU 4B0MM 1AGBA 4X7DC 5EU7E 4M4RA 4DVRH 1J0KA 3MV8A 3O6FB 5KS9B 1D9KB 3SO5A 1D5BB 3D2UA 1V3KA 3S35H 1T21B 5F7LB 1XF3A 4WU5B 3GRWA 1RIHL 3OWEA 4O51A 4KK9C 4XNQB 2EH7L 2VLRA 4JEGB 4Z7WE 1NC4A 3SDDB 3I6LD 1KB5B 4N8CL 3AROA 3QDHA 4HK0A 4ZS6C 4XVUC 5D8JH 5DURD 6CGTA 4KROC 5IVZA 4Y5XA 3HAEG 2QSTA 4UOJA 5C0AB 3ZKQD 4LF3B 1WF5A 3E3QC 4U1HB 4ELMA 4KAQL 2CDFA 4TPRH 3ZO0A 2EKSB 2AV7A 3I6KA 3QPQC 4BQ9A 2GJJA 3L9RB 4K3HA 3UTTA 4PGBA 5FGBC 3VXME 2PXYB 5DUMH 1JMXA 4M3JA 5DD6B 1MCQA 4RDQG 4NO0A 3VFOB 4FFVC 1J5OL 3MRQA 5DFVD 4F2MA 2MCG1 3W81A 1VPOL 2MHAA 3IDNA 3S34L 4PD4J 1WFTA 1S7VB 4OLWH 3LZFL 4YBLC 2CRIA 3PP3H 4M6AA 3LV3A 2PO6B 5H35A 3ARUA 2FBOJ 5FECA 3GB7A 2OQJA 4FOMA 5SX4H 4KVCH 3BP4B 4JGUA 1MPAH 4XMKL 4CMHC 5ILTH 4S1DD 2ENSA 1SYSA 2HFGH 2JIXA 5DJ6B 3VXPB 4CVUA 1F90H 3OGCB 1CDCA 5E1AB 2CGRH 1P7KA 3VJ6A 1IL1A 1T22B 4WVRA 4MAYC 1RJLA 3LEXA 4HKJB 2FYYB 3UDWA 2CO7B 2X41A 4CKVX 4ESKA 5I8CB 1MCLA 4BZ2L 5C0AA 5E2TH 5C0FB 4LF3A 4OTXL 5ACZA 4U1HA 3G6JF 1EH9A 3RWFB 5TQ0H 3EO1B 4KKAD 2YBRB 1F42A 1HWHB 5CLWA 1IRAY 4RQQB 3VFTA 3BPLB 1A6ZB 2VISB 1IARB 3WHXB 5GGTA 4X4YB 3ZT7A 2DWEA 4HIHA 3MCG1 1J8HB 2VWEC 5I18H 4WUUD 4WI9A 4MD4B 1KJMA 2JK5B 4XP5L 3IJHA 5K33A 1S8DB 3L3JA 3FOMA 4LNVA 2ZUUA 4JKLA 1UWEL 1FGVL 3QEGH 1XZ0A 4QRSA 2UV3A 3H9SE 3R06B 3QDJE 3PDOB 4EI5D 3H42H 4Q2ZA 1WIPA 4NZUL 4X6CE 1FP5A 2DTSA 2XTJE 3LKPB 3JV6A 3DVGB 3MOAL 4GXVL 4PJFB 4KDTC 1LK2B 4WI8A 1GAFH 3MPCA 3OAUH 5IKCB 2GSGB 2YPLE 4MJID 5IB1A 3GGWB 5E1AA 1UM6L 2WUBH 4MVBC 3ZLQC 5DI8B 5TPWH 5ENWB 4H8WH 4P2RD 4ZPVB 1T22A 5ADPH 5EC2A 3WE6B 2VDNL 1Q9WA 3JVGC 1ES0B 1A02N 3L5IA 3LH2H 1NCAL 4MA7L 2W92A 5J0BA 4ORGB 3RNQA 1X4XA 2IPUK 3SHSA 3WXWH 2EXYD 3B9EA 4G3YH 2L4OA 1HINL 3WL9A 5LGJA 3V5HA 5DT1L 4QHMB 4I48A 1IQWH 2HKHL 1CXHA 4PRHE 3JWDH 1LNUA 3RUGF 4MD4A 3BMVA 2JK5A 2HP4A 5AYQA 1WZKA 3FQNA 1SEQL 1IAOB 2WSKA 3OB0K 1M7XA 3U7YL 2LVEA 1T1ZB 4J2XA 1RU9H 5B39G 5HXMA 3SKNA 1IBGH 3MJ6A 4BQBA 2YD7A 3J7HA 3OR7B 4GFTB 1WBYB 2NX5A 3BQUA 5KAQF 4PJFA 3DVGA 1KV3A 2F5AH 4NUJA 5TE7L 5J11C 1CWVA 1FNFA 5DURB 1LK2A 3LSOB 4P2CG 1QLEL 4OFIA 4W6XB 1A2YA 4OF8A 2QHRH 1TJHH 5CEZD 3TNNA 1PKQB 1QACA 2J8UE 2I25N 1MCWW 1M7DB 1NL0L 1HXYB 5DI8A 3FAWA 2OTUA 5J12B 4ZPVA 43C9A 3BZFB 4GW1A 3EYQC 1JPSH 1MQKH 5I1LA 3C60A 5JDJA 4OCSL 4LPCA 5MI0B 4ORGA 1I7TA 1WC7A 4U6XB 4FZEH 3EYSL 1GIGL 4PJBA 1TDQA 3MRNB 3HUJE 5F1SA 2DIBA 5CKAA 4P2OA 3WSQH 4D0BB 3ET9F 4LHJB 1NFDB 1O7VA 1YNKL 4HD9A 4HGWB 1L9NA 4P2QD 1FL6A 4Z7UE 3F7QA 3KPRD 5AUMB 5EPMA 2NY0C 3BXNA 1XF4A 1BIHA 4LSRH 4M1GH 5E2UL 2DBLL 4RIRB 4XPTL 4QKXB 1V3MA 4H25A 3H2WA 3GJFA 2N7AA 3MRRB 4V1DD 2X4TB 1H15A 1FV1B 1JV5B 2X4SA 3PGCA 3QG7H 4DW2H 4ZOAA 3LRGA 5DYOA 1FYTE 1WBZA 5F7NC 3HE7C 1A6TA 1OAYL 4GO6B 4JRXB 3UYRL 5F6HJ 2FO4B 1S7QB 5MEOB 1B0WA 1T83A 4DGIH 4O5LL 1I8MA 4HFUH 2XYCA 4KK9D 4NWUH 2IBZY 2BSSA 4ZO6A 5C86A 4P4RB 1HXYA 4PJ7A 1A3RH 1GZQB 1H9VA 3GI9H 4ZS6D 4FQQB 5JQ6H 2V5MA 3FAXA 4M7ZB 2OX5A 4KROD 3KXFD 3SE3C 4O4YL 2CKNA 4IJ3C 1AIFA 4YHYB 4WUUB 32C2B 3MUJA 4C54A 2J5LC 1HHHA 1J05B 1CFTA 4PJXF 4XPBL 4F7MA 3QPQD 2VLLB 1LEGB 3MRNA 5FYKE 3V8OA 1U3HC 1MEXL 4HAGA 1HH6B 4J8RA 5IJVB 5E9DD 4FFVD 4QY8B 4EI5B 1P69B 3UBXG 3JV4B 3HRPA 2BDNL 3TYGL 3LRHA 5D7KE 4O2CB 4K8RC 5E6IC 5TFSH 1BVZA 1F6AB 1JV5A 1IGYB 3C8KA 1PDKA 4L9LA 4AEIL 2E3VA 4I3GA 2M8XA 2Q76A 4CMMB 3DRTA 4U0RB 5AZ2L 4P2RB 4YZFF 1CGXA 3SGEI 4ODSL 4JRXA 1NC2A 2FO4A 3HG1E 3WKNA 3B8SA 5HDOA 4HF5H 1L6ZA 1A6UH 3FB7B 1Q9KA 3TIDA