2VQ1A

Anti trimeric lewis x fab54-5c10-a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
b'DVVMTQTPLSLSVSLGDQASISCRSSQSLVHSNGNTFLQWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRMEAEDLGIYFCSQTTHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGKV1-117 PROTEIN
molecule tags Immune system
publication title Characterization of a Diagnostic Fab Fragment Binding Trimeric Lewis X.
pubmed doi rcsb
total genus 46
structure length 216
sequence length 216
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1A01
3GIZL 3MBXH 5CKGA 5JIHA 4I4WB 4BQBA 5C0GB 3S88L 3WUZA 1VB9A 4HMDA 5HDQL 4HWZB 2XT1B 5IVNA 1UZ6F 1MCOL 3DYOA 1RUAL 5I2IB 3V0WH 4JRWA 5D8JH 2V17L 5DJZA 3C5ZA 3D39D 3PABB 4NO0A 3RUGF 3THMH 1T1ZB 2FJGB 3WXVL 2F19L 3ARBD 3HPJA 4HJ0C 2XZAH 4HDIB 3FO9A 3JTTB 4LF3A 4F7EA 4HT1L 5LWYH 3G5YA 2QBWA 1G9MH 5GIRA 5HPMB 1EV2E 1ZS8A 1FN4B 1K8IB 3PDOB 4FG6C 1JRHH 1JMXA 1QA9A 4G7YL 4OLXH 2HP4A 4RGOH 3JTSB 5I73C 3IDIA 4LOUD 4NZUL 3RFZC 1MJJA 2W0FA 2Z9TA 1IQDB 4Z7OF 4HGWA 2YRPA 1YY9D 1CU4L 1OAQL 2GKIA 4IHOB 3D6GA 2C1OA 4QF1A 5DJ6A 1T66D 2YK1L 4U6HB 4Z78A 3EZ8A 5DJYA 1KXTB 4F9PC 2CKNA 1JHLH 1X4XA 4OZGE 4XC3H 4WUKH 5HVFB 5E2VL 3MJGX 3WIFA 1X5FA 4F7PA 1VACB 3VWJC 2EDXA 5IGXH 4ZS6D 4H8WH 1QRND 1S9YB 1BF8A 3WYRA 4PJFE 3U9PH 2R0ZH 2YS4A 1WSST 1E28A 4XZUB 5TFSL 2F8OA 3IU3A 4JFFD 1JZ3A 3VH8A 2ZSVA 4PRPE 2JK5B 1RZ8B 4JANB 3RUGE 1I7UA 1BREA 4FFZH 4NKDA 1F42A 5KVDL 4G6JH 1OP3H 2VLKA 3O6LL 1M1SA 4P9ML 1OAYL 4PGBB 5D2LB 5HYJA 1MWAH 3L3JA 5FGCE 3TEUA 2JJSA 3IDUA 1HOCA 3D48R 2HN7B 1N4XH 1NLBL 4H20L 4WFHD 5HHOD 1U93A 3OJDB 1OLZA 1SYVA 4QRSB 1UACL 1A1OB 4LPCA 1EPFA 4FZEH 5C7XH 3RVUC 2AJXH 2B4CH 3RIFF 1B3JA 3OGCA 2LU4A 3VDBA 3BPLB 3V6FA 4RGNB 2HTKD 4I3SL 2V7HA 1KPUA 3OKDA 5D7SL 3RAJH 5L6YL 3VXQB 4U6TA 4WFGD 5L0QB 3LIZL 4NQVA 5HVHC 2BP3A 4RGND 1N3NA 3F8UB 4KRPC 1S7XB 2VDPL 3FQWB 5DJDA 3TH3T 2BSTA 2EYRB 4EI5C 4YDKH 3DVNB 3H8NA 3IB4A 5FDWA 2RQ8A 1R24B 1C08A 1REIA 5ESAA 5C08D 1NCAL 4MD0B 4KK6D 2UV3A 5B21A 2DTMH 1V3MA 2RR3A 4U1KA 5T5FH 1WWBX 1RAMA 1T04B 2XTJC 3B83A 3MLTA 5D1QA 4H5SB 2VISB 2A6DA 3S3PA 4Y8AA 4PP2B 2NY7L 3T1FB 1MHEB 3T77A 2NNAB 3JV5A 3QEGL 2FX8H 4P9HC 2OQJA 3QZWB 4D9RD 5GJTL 4KTYA 3NZHL 4I77H 4O9HH 5D1XD 4IOIB 3RZCC 4MAYB 4RMRA 2CGRH 4D94A 1UB5A 3QXAB 1FDLH 2P8LB 4UDTB 1QLEL 2W07A 4HGWB 1VDGA 1GHFH 2RCSL 4AL8H 4KJWC 4PY8I 1CFQA 4L4TA 4FQHA 5KSVA 5D7JD 5ALCH 4QRTB 5HXMA 5T3ZH 1QA9B 5J12B 1BPVA 4P5KA 1U8IA 35C8L 3HG1B 4GRWE 1HSAA 2A9NL 3RPKA 5BJTA 2PW2A 1OB1B 4QOKB 4ZQKA 1EAPB 3DX8B 3D5OF 5MEQA 4HUXA 4R90L 3LZFL 2OQJB 5FYJH 3N1QC 1N5AA 2ZUWA 5CEXB 3UJIL 5I6XB 1NUFA 5EZJA 3Q6GL 4JFEE 2YRLA 3ZHLA 4AIZA 1OSZB 2ZP0T 1I3RA 3SOBL 3BYYA 3G6DH 5CEZH 5D5MB 4GMTH 3GMMA 3LRSB 1YZZA 4I48B 4P4KB 1S7UB 4NZUH 1ZGLM 4KPHL 2PYFA 4PJFA 1H8OA 3VCLB 1V7NL 2BVEA 4RAUA 5CKAA 1CDHA 4WI5A 5CLWA 5D5ME 3RX8A 2A38A 4NRXA 4HG4J 3DMMA 1JNNL 3MLZH 1B2WL 2J2ZA 1U92B 2FGWL 4ZD3L 5GRJH 3T09A 5MEPB 4TULH 3L6FB 4RGMC 3L9RA 1FFOB 1IBGL 1MJ7L 5TE4H 3QHZH 4GBXD 5FKPA 1HHGB 2VO5A 3KJ4C 1FNGA 3HE7B 3UC0L 3N06B 3BPNC 2JELL 1KXQE 1NCNA 1AXTL 3TCLB 1J5OL 3IFNL 4AEHH 2R0ZL 4V1DA 1IGML 2BNRB 2A6DB 2QKIB 4LVNC 1FCGA 1HNFA 3QUYB 4P46A 3OAUL 3RVTC 1CFSA 3VXMD 4HIJB 4KVCH 2YN5A 3VD5A 1X7QA 2UZYB 3JV4A 4M48L 4RWHA 4X7EC 4CADB 1I8LA 1CBVL 4YPJA 3L5WA 5CJQH 1HSBA 1J8HD 1VFAA 3RZCA 1NCTA 3SKJL 2DIBA 3P77B 5LGHH 3BQUC 1CXKA 3AROA 5EOCL 2NY0C 2Z4QA 1CGUA 3KPSB 1OGAE 1KB9K 2CIIB 3ESUF 4AQOA 1Q9KB 1N5AB 4ZFOB 4CL7A 1W8NA 1GJIA 5A1AA 2MSPA 4UBDD 1ND0A 4LLQA 5DA4A 3DGCR 2WIIB 3QDMA 5DC9B 5T33L 3STZB 2R8SL 4RQQA 2R23B 15C8H 2KUTA 1X5AA 1YNLH 4L4VE 4JVPA 2LE9A 2XKNB 4OZFB 3OX8A 3VI3E 4R2GD 3X13B 5LCVH 4QOKE 1CLZL 4LPVA 3V9FA 1T22B 5CIPH 4E41A 4WO4C 1INQA 1T21B 4HQQL 3DVGB 1DEEB 4O58H 3SDAC 1H3WM 3SKUD 4GXUN 3U0PA 3MRJB 3L5JA 4JQXC 4YBHA 5E8OB 1BF2A 4PJ9D 4U1MA 5C09D 4ZPVB 1EMTL 5CILH 4JZOB 3EW3B 4XCNB 5DJ8B 5I74C 1BFOA 3SGDH 4CU6A 4W4OA 1TQBB 3TO2A 1QKZH 4W68A 4OV6F 3EOTH 1F13A 2YSSA 2BNQA 4CBPA 1U8KA 3UTSA 1QUNA 1OT1A 1G7LB 1CQKA 4Q58C 1F4AA 4XBGB 5DMKB 3NVQA 1A9EA 3S3JA 2GK2A 3ALWA 4QHUB 4Y88A 3HI5L 4I2XE 4PJ7F 5EA0H 3U30B 4MA3A 4FQIL 2V6HA 3L5IA 2NW3A 3FB7A 4MNQD 5D7IF 4JRXD 2GFBA 4Y1AD 5J1SC 1GHFL 4DN4H 2MHAA 3AS2A 1K3IA 3V6OE 3ZKSD 4A6YH 3D87B 1HEZB 4WUUE 4DN4L 1KTLB 5TFSH 4KZDL 3O4LD 1QSEE 5I1LA 1CLOH 1ZS8B 1ZANL 3QUXA 4RWYH 3AAZB 4H1LG 5GGQH 3K2MC 3QUZC 4FQ2L 2ZG3A 5IGXL 3HN3A 5BO1L 1N59B 3L3OB 2VLJA 1KLGB 3QDGB 1FE8L 4YX2L 3NCEB 4XNYH 4FQQA 4K7FB 1WFOA 4TVSa 1P6FA 5DK3A 3C5ZB 3CFEB 1IM3A 3VXUE 1NCUA 3X3GH 1QBML 2P5WD 1I8IA 2KKQA 1FGVL 2VABB 3GSXB 3HNSH 2VZ3A 4ETYA 5IMMA 2X10A 2YPVL 4P2QE 1S5IH 3W11D 4G9DA 4M00A 2WM0A 4WW1B 4JFDE 2YC1B 5DS8A 1O7SA 4J3XA 1YMMB 2BFVH 4ONFH 4UTAH 4OI7A 1D5BA 5DD5L 3KPOA 5JHDA 4ODTL 3GJEA 5C0AA 4CDGC 5DK2B 1P4LB 1MOEA 2BVPA 3PHOA 2FIRT 3KNBA 1JGVL 4NQDB 4K8RH 3PV6A 2HH0L 5D71H 4GAJL 1T21A 2FDBP 2P5EE 5CSZB 5F6HJ 5CJBA 1XFPA 1KIUA 1S9XB 2XICA 3ZDZE 4X6DF 2CDEA 3VU2A 4YBQC 5HYQA 3Q6FB 4GO6B 4MX7A 2HG5B 4KUCD 3KJ4B 1MCWM 5J1AA 1ND0B 4RFNC 2B7DT 5F7FA 3O6FC 4K3JL 5E2WL 3U7YL 1V8HA 5IQ7H 1ZHBA 3U0TB 3VXUA 2P5EB 4JFZH 3L3IA 1ZGLA 1MCEA 3H9SE 4MDJA 4Y5VB 1GOFA 3JV0A 1OCWH 3BKJH 4PPTA 5I1KH 4HKBB 4GH7B 3MJ8A 3S35H 1WAAE 3BWAB 5IVXB 1R5IA 3V6FB 1GYAA 4XI5C 1ZSDB 1MWAA 2IGFH 3LB6C 1UEYA 3JVGC 3OZ9L 5JW4Q 3LPFA 4JE4B 5LAXB 3SGEH 1YEFL 1MJ8H 3LS5H 4DGIH 3HE7D 3VRIB 2YD8A 3WHE0 4KXZI 4TOYL 4C4KO 1YNLL 3RWJB 4QHNB 4GBXA 1LVEA 2G75B 2GJ6D 3V6OC 3QDMD 4O2FB 3ARVA 3WSQL 5GJSL 5DDHA 2GTWA 4JM2D 2IH3B 3G6AA 4E0RA 2BMKA 2KZ1B 4LNVA 1CICC 1ZA3A 2GCYB 1MCBA 3VXSB 4MDIB 2J4WH 5FAAA 1G7QB 2E9WA 1CYGA 3FZUD 2AKRB 5I66A 2HFGH 4GXVL 2F54E 2JIXA 2Z8RA 5IB2A 4RGOL 2R56H 1XGUA 3OR6B 4DEPB 5T1LA 1S9KC 3SE8L 3CLFH 4K7PH 1ZTXH 1QEWB 3D9AH 5C86A 2G9HB 1NMAL 4PIRF 3LAFA 3BEWA 2X5PA 1IQWH 2B20A 1OSPL 5KVGL 3HZMB 2WBJC 3PNWB 3MV7B 4APQC 1QTYT 5I1JH 2FX9L 1OARL 1WZMA 3RP1A 4IRJD 5GSRA 5LJYH 1IQWL 2ZCKL 4PGDB 3I2CH 3KLSA 4JCLA 4YGVB 5C0AB 5SWSB 3KYKH 1TZGH 3DX7B 1M05B 1FH5L 1WF5A 3WFDH 1CQYA 3MBEA 1T4KB 3CGTA 4PGCB 3SE3A 4U6YA 5I16A 5CJOL 2R69H 3DXAB 3LKOA 3MGOB 3SE4C 1BQLL 1PX4A 1KFAL 4A2LA 2VABA 3GSXA 4DQOH 4DZBA 3SDCD 1A2YA 2EDRA 3MACH 1HCVA 5C0CE 1WC7A 4MMXC 1RJZB 4ODWB 4U1NA 1MWAL 1G7MA 1PVHA 4WJ5A 3A6CL 3BSZH 2UZXB 4YXKH 2Y06H 5I8KL 1UB6B 3DMMC 1IC4L 2OX5A 3MA9L 3IDGB 3QZWA 3T2NL 2R1YB 3GBNL 4YHOL 5D7JC 3JVGA 5JPNA 1MPAL 2GT9B 1UA6H 1IARB 1OPGH 1PD6A 2HFTA 4XNMA 1YMMA 3H7LA 4L3CA 2VLRD 5I8OL 5DRZA 3K4AA 3EO9H 3FO1A 4LSVL 1HHKA 1K4CB 1LHZA 2ITDB 4X6DE 5JQHC 4NHUB 1X5LA 2K9UA 4HUMB 4NNYB 1HINL 3LEXA 4ZXBC 2JJVA 2ZUQC 4TPRL 1J05B 3MV9B 4JPVL 2Z31D 1I8MA 2R2HB 3PP4L 3EO1B 1A3QA 4HWEH 3UX9B 1YQ2A 3SDXE 4NZRL 3UO1H 5FK9A 1WAAA 3OB0K 3MLUH 4PGZA 2BY0A 1H9VA 1QG3A 4HGMA 4XPFL 4G8GB 1ZKAA 2X4OB 5E2UH 3WD5L 1OTTC 5E70A 1L0QA 3ETBF 4JFOA 1MAML 3RTQD 5KG9A 3SPVB 5AAMA 5IQ7L 1MFDH 4PJGA 3SKMA 4R9HA 4LRIA 4XCEA 3VGBA 1N8ZA 3GIVA 1MFEH 4FQIH 3GMOB 1U91A 4MD4A 2EIEA 4YR6A 4CVUA 5A2JH 3GKZA 5JIIA 4U1GB 3QULA 1FZMB 1LE9A 2VLKB 4QRQA 4C56A 4A6YL 2XA8L 4XNXH 2ENSA 3MR9B 3C6SB 3OG4B 2VLJD 4ZUTB 3UJJL 1OGAB 4DVBA 2H8PB 5CGYC 4LLQB 1TCMA 5DF0A 1PBYA 3U30C 4YHIA 1RFDL 3UCRA 1YN6B 4MJ4A 5D1XB 3UTTA 1MRFH 5IUSA 1CLYL 3UBXA 2FBJL 2QQLL 1TXKA 4MNHA 3WFBH 1HIML 5D6CB 3GK8L 1QVOA 2JCCF 2P24A 4XC1L 1QLRB 2D9CA 1C5CH 1OGAA 3IKCA 3VW3H 3DARA 3THML 5CEZD 3WLWC 1NLBH 4H20H 4IDJL 3BXNA 3AY4A 1EO7A 3WFBL 3DVNA 1PYWB 2CD0A 4L8BA 2R2EA 3TBYB 1GGIL 4HT1H 1KB5H 1XGQB 4IDJH 5AYUL 3V4PH 4D3CH 5TF1L 2KZWA 3MR9A 4DKEL 4XWGL 1O7VA 4WU5B 4P2RE 1OTSD 1M7XA 4OSUL 3WLBA 2VXUL 1YYML 3MLZL 4R8WL 5LGJB 5F9WC 4XPBL 1KEGH 1IC5L 1JL8A 4Y2DC 4TUKL 5T3ZD 2R4SH 4P4KC 1NAMA 1BVKB 1NBYB 3BGAA 3CFCL 3I3BA 4XVJL 4PJEF 3MJ7A 1TZGL 4JPKH 4HV8B 2BERA 4WI4A 5H35B 2EH8L 3T8XA 2XN9A 3GHBH 2OS7A 3EJJX 1HILA 2AK4D 3AXLB 4R0LA 4XVJH 5DMIH 5IVZB 5E5UB 5EO1B 1MHPL 3N9GH 4M9OA 1BQHB 1L6XA 3I6LE 3K2UL 2NY7H 5F9DC 2C7UB 3MCKB 4HXAH 2KQMA 3GBML 2NX5B 4HIHA 4GW5B 5EDXA 4I2XA 2Q3ZA 2B2XH 3QEQA 3TFKD 3VFMB 4LIQE 3BH8A 1CCZA 4LCCA 1JZ5A 1C8PA 3P9LB 3GMNB 1VADB 1J0JA 3GM0A 4M48H 1JPST 1YEGH 3KHOA 4LCYB 4NQXB 1I75A 3MLRL 4NZJA 5JPNB 4PJDA 3CIQA 1Z3GL 4JFPB 4KDWA 3GJFB 4PJAB 4EDWH 3FO1B 3MA9H 2F15A 3O8XD 4FQ1H 1MF2L 2CDEB 4JQIL 4OTXH 4F8TA 4OIIH 1XCQA 5EBMB 3O2DA 1AIFB 5DJCA 4DGIL 4R4BA 5JNYA 2YN3A 4PJBA 4NC0B 1D6EA 5DHYB 1FIGH 2R1XB 1CL7H 3C5ZD 4ZFFB 3O3EB 4P3WA 3CLEL 3P4OA 1DEEA 4NQDA 4U1HA 4JM2A 2Q87A 2FNBA 5ICXA 8FABA 3OPZH 1FCCA 2IH1A 4FXKA 5C0DA 4JPWL 4AT6A 4NT6B 5E99H 4YJZL 2CKBB 3IU4H 3RDTB 3TIDB 5EU6E 1Z5LB 5KVEL 1H0DA 1BAFL 3F7PC 1NBQA 3O11A 3TA3C 3PGFL 3MOBH 4TQEL 2ICWB 1IAIL 5E2UL 4PB9H 4XX1G 1RVFL 3TBTB 5JR1H 4ODUA 3O3AB 4B41A 1G7PB 5EC1B 4K3EH 3V6ZB 1IAOA 3OTTA 2GHWB 4Q6YA 2AAVA 1KN4H 5I2IA 3TYFA 2XNAB 2EZ0D 2J12B 4RMTA 3TZVB 4Q6IB 3QUZB 5F9WB 1NAKH 4OCXH 1QR4A 4WRLA 3T4YA 5I75B 2G2RA 5FYKH 4EI6B 5L88H 3BVNB 3HPLA 1FL6B 4C59B 2VDLL 3GI8H 4I77L 5ELIA 2DOCA 4YWGH 1LP9B 2YEZA 4O2EA 3QI9A 5D2NA 1S9VA 3HR6A 2M1KA 1K8DB 4S1SH 1T83C 4Y16B 5TDNB 5IB2B 4FMFA 3QWRD 1HYRC 1KCUH 3H3PH 4AL8L 1G9NL 4J8RB 4ELKA 1KCLA 2XOTA 1I1FB 1YUHA 4RFNB 4UILH 3HC4L 5C0CB 1FHGA 4EIGB 1BZQK 5CEYB 5I76A 3EJYC 4DOHE 2FL5A 2ZSWB 5J1TC 4OLVH 4LLMA 4ACPA 3C5JB 3ES6B 1SYSB 5C07B 1S7QB 1F3DJ 3WE6A 5JTWA 4G42B 5E8EB 4MQTB 2DJSA 3O8XA 5IW3A 5KSUA 5I9QC 3WS3B 2O5YH 5DEGA 1N6VA 3SKNB 1A7NH 4QY8A 1D5ZB 5IM7A 3QJHB 3EFFB 5DR5H 4C58B 1NGXA 5T33H 5JDJA 3KPNA 1AHWC 3U6RB 5EZIH 4POZC 5KSAD 2C4FU 4ZAKA 1CXLA 4OZFH 1GIGH 2ICWJ 3VXPB 2X9YA 1TQBC 1A7OH 1U58B 1H5BA 4MJ5B 2N1KA 5K9OB 4XTRD 5DJXB 4F7CB 3BESR 3LSOB 3RBSA 5JXAH 1RZFL 2HVKB 4BKLB 3GMRB 2AGJL 4IHOA 1P6AB 2DYPA 1T0MB 1KELH 4AMKL 3KPNB 4AYFA 3FZUC 2H26A 1AQKH 4HEPG 2CK0H 3VH8B 3GO1H 3I75A 3Q0HA 1X5YA 3P77A 3GB7A 3ZDXE 2OR9L 5IOPA 3M07A 3I9GH 1MELA 3NBNA 1PG7X 3ET9F 4XPHL 5D1XC 3MNVB 3DGGB 1RHHB 4NO2A 1WLHA 1DQML 5IHBA 5IMLA 3V2AR 1H3VA 2DQCL 4ZUUB 4LASL 4TUJB 4PRHB 1UENA 1GPOL 2NY0B 1T0NB 4JQIH 3RVVD 3VGFA 4XPGH 4D8PB 4WEMB 4XCFL 4HSQA 3W9EA 3CFEA 3WNPA 4Z5RB 5BVPL 5DUPL 4MXQD 1BFSA 5C09A 2ZUVA 2GSIB 3E6HA 2WK2A 3QG6A 4KJPD 4Z0BL 3W5MA 4JGUA 1AKJB 4I0PB 4YE4L 5F71A 4ONHB 4YDVB 3D69A 3IJSA 4HC1L 3BD4A 4G5ZH 1KJMB 2EYRA 2GT9A 2Z8VC 3INUH 5E6IB 3MRHB 4DN3H 1OL0A 2DQIH 3BP5B 1N3NB 2OXGA 4JKPH 1SJVA 4LSQL 5EIVA 4EI6A 2BRQA 4FZ8H 1KLGA 3MNZB 5DHVH 2X9XA 4AENA 5KW9H 3F7YA 5ESVA 3VXSE 5DA0B 2V7HB 1LP9A 3L5XH 4EKXA 5IVOA 2GK0A 4KDTC 4G6FD 1BBJA 2WQ8A 3BPCB 5EIQA 1FFPA 5DQDL 3UMTA 4ZO9A 4OZIF 5HGAB 4DVRH 2BFVL 3L5XL 4ONFL 4WW2C 3CU1A 3MRBB 2F9BT 4K7PL 4YXLH 3IFOB 1KLUB 5FYKL 1FZOB 1OB1A 3OXSA 1U0QA 3G6JF 1F58H 3CFCH 3DX9A 3TO4A 4MJ5A 4Y1AE 3TA3D 4PLJC 5IJKC 5ERWB 2XTJE 3CFBA 5D7IB 1HKLH 1KT2B 3WS6C 2ICCA 4P4RB 4X6CE 3CK0L 3DRQB 5JO5B 1FLRH 2EEBA 1XIWB 5CFHA 1LO2H 4B7IA 3CFJA 5I8EB 4QRRB 3HC3L 5I30H 2FATH 3NABL 1FL3A 4PFEA 1S8DB 1DUZA 3D1MC 4QLRA 1F4XH 4UILL 4NHCH 4YHPB 3Q3GB 1CK0H 1T2JA 3LMJH 3NCJH 2FR4B 2EXYD 1C16B 1LD9A 1DFBH 3FONA 1XR9B 1HHIB 3VWJA 2VDML 4ZTPH 4HFUL 2D31B 3REVA 1SVCP 3MYZA 3CVIL 4BUGA 3KS0J 1DQJA 2WUBH 5KSBF 4BH7B 1WISA 3S35L 2Z4QB 2BMKB 4XXCC 1P7KA 1H3PL 2X6MA 1ZT7B 3O4OB 4N8VG 5CWSB 1NCWL 1V3LA 5DFWH 1U58A 2EH7H 4NM8L 2RFXB 1XGRA 1IEBB 3HA0A 3WHE1 4JFEA 4MXVE 1DLHB 2YPKB 2VR5A 1FP5A 4KGJA 5I19L 1EHLH 5C0ND 4YIQB 1KB5A 2ZNXA 5EH1A 4CVZB 1ZAGA 1AD9B 1H3UA 2YD3A 3QCUL 2GUOB 1Y18A 4J23A 4JQVA 5IFJB 1TZHB 4XHJD 4Q0XL 5D7JB 3MV9D 1TFHA 3N1FC 3PV7A 1BZ9B 1F4YH 3MOAL 4LSUH 2BZDA 2IALB 3MREA 5I1AB 1X4YA 2WV3A 3GMQB 4LLWB 3UYRH 2D7PA 4JRYD 2FJHB 2ADGA 1DCLA 4J3TA 1WQVT 4I4WA 3MRIB 4OUOA 2V2WA 2HTLD 1BVKA 1LK2B 1Q94A 3KYOB 2R2CA 3QDGE 4FQXC 4LAQH 3V5KA 5C8JA 3TCLA 4JRYB 1L7TL 43CAB 2J8UB 1DLFL 4KTDL 5EFIA 1QFWM 1J7VR 3FB6A 4BZ1L 5IK3B 5ACLA 5K59F 1RVFH 1P84J 2VXSH 5KSAB 4JY6A 3SDAA 5KN5A 4RFEB 5IB4A 4JREC 4R26H 5C9KA 2ADFH 2WIMA 4WFFD 1B0RB 2MQ3A 3BPNB 4QGTA 3ZT6A 4OFDA 5H2BB 3Q48A 5FV2A 4R26L 3MRRB 5HGGS 5F6IB 2QADB 2Z31C 4QT5A 2DN7A 3G6JB 5DJYB 3TVMD 4R4BB 1TTGA 3BISA 5C0RL 2DD8H 1ZLVK 1MQ8A 3A0OA 1G7PA 2C1OB 5GGQL 2QQKH 1KCVH 3K1KC 4HWUA 3QO0B 1W72A 3DURA 4JO1H 4NKOB 1HWHB 3BO8B 3SDYL 1KEML 2FIKB 3EZJB 4C4KT 1JMZA 2A9NH 2XFXA 4JGJA 2ZWLT 4QNPF 4KTEH 3DI3B 4ZDHB 1ZWIB 3S4SB 4NWUH 2AK1L 3FQUA 1MLCA 3VA2C 5SWZD 5D7KE 1MAJA 1FGVH 1OAKL 4N1HB 5E8NB 4Q9BA 2W91A 3QNXB 4LSRH 1J10A 4GSDH 5HYJD 1OHQA 4YDIH 4GMTL 4DKDC 2R56L 4YDJA 4WV1C 4OV5B 2H1PL 4BSVB 3RWHB 2H2PC 4Y5XA 3ARED 1GOHA 5DT1L 3NFPB 4ZUWA 1UADC 4YNYA 5DLML 2AJZB 2NW3B 3NOIA 3TWCH 3WFZA 3UTTD 1RUKL 1NFIA 2P5WB 3F5WB 4RAVB 1G1YA 2YD9A 3OKEA 3ZZ1A 1NCDH 5FGSA 3CXDL 2K1MA 4OGAD 1BIIA 3UTZA 3C8DA 4PJBE 3QIWA 3W39A 2C3XA 3LH2H 1LEIB 1EA9C 5CHNB 1X3DA 2GTZB 5D7LA 2Y7QB 4MAUH 4XNZB 5KTEL 5E95B 3UDWC 2BNRE 3MLRH 4K07A 4LPYA 2YMXH 3FQXB 2RB8A 1YPZE 4LLYA 1G1CA 4LKCB 3NA4A 5EIIA 4Y7MA 1FAIL 4FFVD 4K3GA 5DYOB 1UB6A 1YY9C 4GQPH 2ADGB 2EO9A 3OXRA 5BV7H 5LGKA 4KI5C 4EXPX 3OJVC 3CH1B 1I8LC 5E2JA 2CJUH 4JY6B 1JGDB 2EC9T 1NKOA 3QZWG 2ARWA 2IAMC 4TVPD 2HFFB 2H8PA 3NA9L 1C5DB 4HIIA 5F7DA 4S1QH 4XX1E 5EFIB 3WCYA 1U8PA 1HIMH 2GAZB 2NY6D 3DUUB 2BCKA 2E3VA 1VFMA 5F21B 3GRWA 3QFJA 5GRUH 1IFHL 1HXYB 4HS8L 5L8JB 4YPGB 3VXNA 4HX1B 1IVLA 3OKOA 4ZPTB 2AJYH 4EUPG 3MA7A 1U3ZA 3IXTA 1IGCH 5H2BA 2DQUL 3B2VL 4Z6AT 1BJMA 2NXYC 1YA5A 2CIKA 3MODH 4S0SD 3OKYA 4KMLB 4LU5H 5SWQB 5CZVH 5IB4B 4RISL 4R6UA 5B22A 1F45A 3ESVF 5ALBH 3FB8B 2Z91B 1M71A 1BIIB 3K80A 5EUKB 1S7VB 5DGQA 4CW1B 1BD2A 2IFFL 1DE4A 4IRZH 1NMAH 2ZNWA 1UKQA 1GAFH 5GRVK 5GIRB 5DJ0B 4P3DB 2FGWH 4YNYB 5FKPB 4MDIA 5E4IA 3I84A 3LN4A 5FO8B 1ONQB 5AEAA 4IRSA 3T0AA 5MHSE 4JHWL 3RIAK 4KKAD 1GAFL 5B3JF 4K3DH 3QNYA 2DQFB 4XVUC 1LO3L 5C9JB 1HZHH 3UJJH 1OP9A 4E9LA 2NY2C 3WKMH 5C0EB 1ZSDA 2MCPH 3AREA 4M7JH 5E8NA 2DF3A 2R69L 1ZHKA 3SJVD 1YPZF 3WIHA 4FQLH 1GRWA 4XMPL 4KZDH 2V9QA 1AFVH 4A6YA 5ID1A 5FYJL 3DUSA 1KSRA 3KYMA 4C83B 1KBGH 1FO0H 2YA0A 3N1MC 3W0WB 2GK0B 3UAJD 4CDHA 2WSKA 3AM8A 3VFUB 4KVNL 1U8QB 5IBLD 1TDQA 3F7YB 3LKRB 1A4JA 2CO7B 5E2TH 4D0BB 5C0GA 1A6TB 2ZJSH 1ADQH 3BIKB 4X5WB 1CGSH 1N6UA 4H25A 1KJ3H 3QCUH 2IAMA 2ESVB 3QDAA 3KLDA 2ORBL 4QTIH 5HI5D 5EU7C 4QRTA 1P7QB 1T66C 1FG2A 4LL9A 4BUHA 3D0VB 4P46D 5DZLA 4M93C 4RGNE 2ZOKA 3CX5K 3VDCA 4HBCL 4JDZB 2IANB 3BEWB 4Y4KC 2DWDA 3GSNL 3AC0A 3T0EA 3MOBL 3IDYB 4QRRA 2BHYA 5F9JA 4HQQH 4FRWA 2XTJB 3EJYD 1JPGB 1KTRL 3OJMB 4F3FA 4XBEH 4YDKL 1UQSA 5ADOH 2J88L 3ABZA 4O51B 2IAND 1BOGB 2MNUA 3NFNA 5IIEB 3DV6B 2I07A 2BSRB 5DO2D 5EUOA 5DZOA 4P23C 5E1AA 1QRKA 1EXUB 1D3CA 3MFGB 3BEVA 4JPIB 4ZSOA 4F37K 4YGVA 3ULVF 3Q5TA 1OD7A 4HMCA 5B3JE 2DQTL 1CDJA 4UV7H 2D03H 3S37X 1IGJB 2XQBH 4WW2F 3E1F1 4BJLA 5DVKA 3HE6A 4ZOEA 5HHOA 1T7YA 1EAJA 5B39A 4X7DC 1BWWA 4OFIA 2W60A 4V2CB 5BVPH 1NC4B 4XTRC 3O2VL 1IGYB 2NXYB 5F8QC 1G6RL 1I9IH 4YHMH 4HD9A 3QA3B 1G9NH 1GSMA 4FTVB 1AD9A 4NRYB 2X41A 5GRYA 2PTUA 3PP3K 1RFDH 4YDLB 4Z18A 3ROLA 5TDOA 2Y07H 3EJZD 4NQDE 3SDCB 1UYWL 4M7ZB 1S7WA 4NC2B 4EI5D 1ACYL 3LD8B 1NMCC 3QHFH 1HEZA 1GC1C 1IFHH 4HEME 4JY4B 5DMGC 2LTQB 3FRPG 4YDLC 2AK4B 1VGKA 4F58L 4MXVF 5TQ2H 4G8IA 2NX5D 5C6PB 5EU3B 2IPTL 5BOZG 1YDPB 3V6OA 3ZTNH 1A5FH 4LARL 1OW0A 1PZUB 1I7UB 1BQSA 1H5BB 4AY0A 2F74B 4LPUA 3BEVB 1RZIB 4M6ML 1QSFE 5FYLD 2J7LA 1U8MA 5EA0L 4PLNC 3H9ZA 3EYFB 3U6RA 4EIZC 2PNDA 1INQB 1KF9B 4KJYB 2YPLA 1XIWA 4F7PB 4H88L 3L3HB 3VXTB 4PJCB 4NC1C 4IOSD 1FNEB 2RAMA 1CWVA 2CRZA 4JLRB 3ZSTA 3ALPA 4J3UA 1QLFB 1C7SA 1B0GB 3RTQA 3QDJE 4G3YH 5JHDB 2XWBB 1PG7L 3MRLA 1HWGB 1K5NA 1B6UA 2VXVL 1ZHBB 3B5TA 3BPLC 3U0TA 4RGNC 1MI5B 3GMLB 3LH2L 4WWKD 3FOMB 4UT7H 2P49B 2Q76A 4HUWA 4WW1A 1Y0LA 1MLBA 1SBBA 2W9DH 3C87A 3E3QE 5EB9A 1KOAA 4OI8A 3MTRA 2DMBA 4XPHH 4U1SA 2ITCA 1VPOH 5F96H 3NFSH 3UZVB 3UZEA 3N0PB 3O6LH 5CSZA 5D5MF 3RVWD 4RDQF 1HHHB 2VLJB 3PWVB 4JZJB 1R5WB 1W72H 3CSYB 3PE9A 3S4SG 1J1PL 3NAAH 3SHSA 1W2KT 1M6OB 3VFUA 5KTEH 4BQ9A 4FZEL 3LV3B 1QO3B 2VKXA 1JPGA 2E27L 4F3FB 4Z7OE 1IZKA 4J4PC 3UTOA 4M7KL 1SYSA 5C07A 4BZ2H 1YJDH 5HVHB 3MO1B 2ZZUT 3HLAA 3ZE1F 5CMAB 3CD4A 3TVMB 1CXHA 1MJUH 4ELME 1EXUA 5ILTH 3ZHDA 2F58H 3ZKMD 5EZOH 4QOKD 2R8SH 5EO0A 1W0VA 3NFNB 5E99L 2FHFA 1K3ZA 1EEYB 2D0GA 4ODSL 2BY3A 4K7PX 5C2BL 3BOVA 3VWKD 4RRPA 1NBZA 4IJ3B 1P2CA 2BOBA 1A14L 4U6XB 3X12A 3CUPA 3MODL 3UPAA 4HG4K 1AXSA 3O6KL 2P8MA 2HH0H 4LHUD 2CLZB 3IDMB 2ZCLH 4JQXA 1I3GL 3CX2A 4JM2B 4KK5D 2VDRL 2P5WA 3F5WA 4X7SH 4UU9B 3CZFB 1FNSL 2H26B 3NPSC 1DBMH 3U2SB 2DM3A 1RD6A 3DVGA 3TV3L 3BZFB 1A7QH 2PO6A 2DQTH 3TT3L 2BOCB 3VRJA 5GZNC 1IC1A 5DD6A 5M95B 2D03L 3ARDA 4F37F 2NXZC 3REWB 2D7OA 2YD7A 5HHMD 4PJIA 4K3DL 2FWOA 5F1IB 4OFVA 3ARQA 3O2VH 1U6AL 4WWKB 3E6FB 3VXNB 5GS0D 1KN2L 5JW5A 4YHKH 4UT9H 2VN7A 2DLEA 3QFJB 2DLGA 5DO2C 1U8LB 3CFDA 3H3PL 4NQXA 3MXWL 2WQRA 5CSBA 4EI5A 5A16A 5CJ5A 3HB3C 1BFOB 1DQQA 2CQVA 4PRID 3VJ6A 5FUOH 4YBQD 3LKPB 3T0BA 4HIIB 2CRMA 1MHCA 2ARJQ 4ZXBA 4KRLB 3TN0B 5GGTA 3E3QC 3FHQA 3B8SA 4P2RA 4PRNB 4YC2C 5EU4A 4FFVC 3EGSA 4OLYH 3LD8C 1ZVYA 5IP4A 1F11A 5GS1A 4P9HL 1QSZA 1A47A 4Y19D 3H9YA 4JHAL 1JWMA 1NSNH 4IRSB 4N1CA 5CD3A 2WBKA 1RJLA 3H42H 2NY1C 4JVWA 1OAYH 3NN8A 1V7NH 1H8SA 1RSFA 2VE6A 3AY4C 4FQPA 3BQUD 1UEMA 3QXVA 2NY0D 4JKMA 3DUUA 5F3BB 5DJ2A 2H45A 1OY3B 5B3NA 1PEZA 5D2LF 4EN3C 1FFQA 1CS6A 3QHZL 1MAKA 1T2QH 4WWID 4CVXA 4LMQI 4MNQA 4AEIL 4X80L 2F8XC 1WT5C 4UDUB 5HD8D 3RWFB 2C26A 3BJ91 2NXYD 4J3VA 3RBGA 5E94B 1MVUB 1EIBA 1K4DB 1RK0B 4PR5B 1A7PL 4J3OC 4WO4D 4OD2B 4QRSA 1SYVB 3IFLH 4LKCA 5D9SB 3H9HB 1WWCA 3SGEI 3OWEA 1RQ5A 1AGDA 4R0LC 1KPUB 3V4UH 1A6WH 4EUPH 2IADB 5C0FB 5LKNA 4QO1A 3NCYP 2NZIA 1GOGA 4KQ3H 4UDUA 3BSZL 1T5XB 4JAMA 5HI3D 2NXZB 5J06A 3H9SD 4OFYA 1CGTA 5E2WH 1MFEL 1TMCB 4MXQC 3UPCA 2IQ9H 2FO4A 4JJ5A 3GKWH 1FNHA 2PXYC 4LVOB 1N4XL 3RL2A 4HJJL 1EDQA 5EORH 2AVGA 4Y19A 5DUPH 4LCWD 1QFHA 3D25A 3IT8D 4LVHB 4NCDA 4U3XA 1MNUL 2HMID 3OKLB 4NIKB 2NY5H 2IMMA 1DEDA 3MNWA 3O2DH 4OZGF 2CR6A 1OSZA 3MJ9L 4JN2B 4JO1L 1NGYB 3WL9A 4MAYA 1A0QL 4GKNA 3BKCH 1UCBL 4AK1A 2XWTA 2BOCA 4HS8H 4PJHF 4GBXC 3QIWB 5AYQA 4HKJB 1RZJH 3QIUA 4ZQKB 3WJLA 1IGCL 3CCHB 1AGEB 3PL6D 2JCCB 3VG0L 5FFLA 1MIEH 2LQRA 2WWMC 3MNWB 4DZ8B 2DQDL 1ZVSB 2BK8A 3VFGL 3ZKNC 5IKCA 1FZMA 1LE9B 4EI5B 1OTUC 2VYRE 1MFBH 5DMJB 4FQHB 4DCQB 4PJBF 1HILB 5I18L 3IDNB 5JW5B 4EDXA 2WUCH 4NKQB 4KZEH 4X9BA 4OSUH 4PJGB 3ARFB 4BSWB 2P4AB 4M1GH 1DANU 4UB0L 4AZ8A 4FTVD 4AM0B 3OB8A 1N5YL 1D5MB 2ZPKL 2OR8A 2PF6A 4PGJA 3MROA 5HHXH 1N6QH 2I9TA 3C9NA 2HJKB 5HI4D 4Z7QE 4G8GA 3RDTC 4Z7VA 5IFHL 5LGJA 4PJXF 1MRCL 5HDOA 4S1RL 3JV6A 3TBVB 1AE6H 1CR9H 2Q8AL 5D70L 2ED7A 4ZDHA 4AIXA 1DL7H 4NWTL 3TT1H 5CP7B 5GS3A 5DRXB 1GZPB 3O2WL 12E8H 3E2HC 3K4ZA 2NY4C 3QCTH 4MAUL 3B3IB 35C8H 1T83A 3DXAA 4L8BB 4WHDA 1BECA 3ZDXF 1HDMB 1IGFH 2Z35A 3BGMB 1JPTH 6CGTA 1CFBA 4W6YB 5I1HH 5C0CD 1MQKH 1SY6A 2WANA 4H8WL 4LEXL 4P9MH 2VH5L 4U6VL 2ZUXA 4P9HH 5IWLC 2C1PA 3FB5A 1E4XH 4LIQL 1OP5H 2Q6WA 3X3FL 3W2DH 2XQYK 5CJ8A 2CJUL 1CLCA 4G43A 4U7KA 3PWPA 4QXUH 2EDJA 3C60C 3E6HB 1NLDL 2GSIA 1JV5B 1R3JA 1RPQA 4JCMA 1QHPA 4M8QA 5ITBH 4M1DH 4J7RA 2OMBA 1KEGL 2VLRE 1U2CA 2VL5A 5D7JA 1JBJA 5FF6A 4ALAH 2DI9A 1BJ1H 4QKXB 5DJ6B 1WWWX 4XWGH 3CSPA 3PUCA 5HY9A 1AHWA 4JO3H 4WO4B 5SWSE 2YPLB 1N0LA 4PGBA 5D2LA 4PRAA 3PHQA 3HNVH 3QUXC 5JUEL 4G7VL 1T4KA 4OGYH 1NUNB 4X9IA 3MC0A 2NQCA 1BQHG 3AU1A 2NY1D 3D18B 4YFLI 5DUML 3MFFB 4K2UL 3FT4A 5CZXC 3X14B 2BVQA 4HWEL 1ZLWH 3M17B 3MRFB 1EFXB 1RZGA 1MI5E 3DX9B 3V8OA 1UJTA 4P2QA 4LSPL 1Y0LB 4EVNA 5INDA 1D5IH 1ZLVH 3U4BH 3IFOA 5MENB 4UMGA 1N64H 4XPAL 1B88A 3ZYZA 1KGCD 4LKXB 5EU6A 4EDWL 4ZFGH 3CVHA 4QRUB 4F8QA 1OM3H 1LEGA 3DX6B 4WI3A 4X7CC 2O93L 4TN9A 1QSFB 2CUIA 2X4SA 4UQ3B 4Q9CA 5TDOB 3B9KC 1XGPA 1PEWA 3GJFK 1NBVL 1GC1H 1HQRA 2VLJE 2A1WL 3VDAA 3KR3L 3NACH 3BP7A 1XEDA 2Q6WB 4E0RB 4GUPB 5T3ZL 2X7LA 2Y5TB 4KROC 3U83A 5E6IC 2HJFA 3HKFA 4OZIA 4QTHB 4KKBC 5C92A 3BUTA 1KJVB 2QHLA 4WJ5B 3HLAB 4U31A 1JN6A 4WFEE 3RNQA 3QXDA 4BYHA 4Z7WE 5D1ZB 4M93B 1AP2A 4M6NH 5E00A 4K3HA 5IB3B 4DJMA 4LARH 4LNRB 2A73A 3GNML 3QI9D 2IC2A 2APXA 1KCSL 5GJSH 3G08B 1G9ML 2F53E 4QTIL 1L9MA 2SEBB 5ANME 3PWVA 1JNLL 2ADIA 2HJKA 3JWNC 1BZ7B 4LSRL 3VFTB 5L2KA 3SJVB 4PB9L 1A1MB 1GGIH 1BD2E 3S96B 1A9BB 1YEJH 5K93A 4Y4FB 2W60B 2OTUB 4U2ZA 3C5SB 3K8KA 2QSVA 3AUVA 4HCRH 3VXMA 3GSUA 2ADJB 5BMFH 1F58L 1EZVX 3CNKA 2W9EH 4S1SL 2YK1H 2EXWD 5E7BA 4MGXA 4XNQB 4ELMA 4K7FA 1HKLL 1IAOB 3P73A 4G8GD 4WU7A 3SJVA 2HT3D 2AK4E 1HK6A 4N8VA 3ULUD 1EJOL 4MNQE 1N59A 3SE4A 1ZXQA 5DD0L 4U0RC 4KKCC 5I30L 4RIRB 2BHZA 2O5XH 5GPRA 5E24E 3MPCA 1U8KB 3CSBA 5K9KA 4U3HA 4HZLB 3QFJD 3PWLA 4XVSH 2H2SC 2BXZA 1Z9LA 4WUUD 4OZGA 3O4LE 4ERSL 1CBVH 3IJHB 3I3DA 3LRGA 5HYIA 5CINH 1R3KB 1UH4A 2IBGA 4X6BA 1MCNA 5GGTH 5D6DA 3P9MB 4FXGB 2HLAA 1TIUA 4OLUL 1WJ3A 5F7EL 2DLTA 2EEAA 3V95A 2D2OA 2AXHA 3U9UB 1T0NA 3T0DA 1X5IA 2BRRH 1YEEL 3OHXA 4KWUA 4TUOB 1WT5A 2YXMA 4LP4A 1R3IL 1IGIL 5FYKU 25C8H 4HJJH 3T3PE 3BKCL 3OKMA 4PJ7A 5CGYD 3BWAA 4X99B 4F58H 1DBBL 1NUDA 3SE3C 1TJHH 1WWAX 4ZYKB 1WIPA 4M61B 4LSQH 1WITA 4X7FC 2AK4A 3HAEA 3L3IB 3QFDA 4N5EC 1ZGLB 4MD5A 5JORA 3WIIL 1CD1B 4N0FB 3VE0A 4HIHB 2IANE 2FZ3B 1D6VH 4DTGL 5L0QC 1CZ8L 1KIPA 3K4DA 5KSUB 3OBAA 3TFKC 3QDHA 4ZOBA 4A2MA 5MENE 2P5ED 4IRSD 1JTPA 1I7ZB 4M5ZL 5ID0A 3V0AC 1G0XA 2R23A 4GAGL 1HH9B 5GGSB 2Z93A 4ZSOB 5DK0B 3TYFB 5IW6B 1RJYB 1RV6X 4M5ZH 5SX4I 3FFDA 2EE9A 1Q9OA 1Q9KA 1BLNA 5A2LH 1MCPL 3PGDA 3ZT7A 3DYMA 4XVUD 5EPMA 5DJAB 1IMHC 5FGBC 4KRNA 2AI0H 2XA8H 4XNXL 2PYEB 4Z7WA 3ROOA 1TENA 4WCYL 2D7TL 1R0AH 1PSKH 5C0BA 5EO9A 5EN2B 3CK0H 3MLWL 4NSKB 4JN1L 4N0UE 2J1KA 1JPFA 2P48B 1KV3A 2C3HA 3EHBD 2AV7A 3RVWC 3RGVA 3VFSA 1FZKA 4OCSH 2F53A 2ZCHL 4IBLT 1A6ZA 3IS1X 3VXRA 4P2OA 3B8YA 3BXNB 2VOTA 3HZKB 2VUYA 5TE6L 3P4NA 3WNKA 2XKNA 4Q7DA 5DC4B 3LOWA 4WGWB 5I1HL 5GXBB 3DHMA 5D93C 4DWHA 3TNNA 3FFCD 4WEBH 4PRDB 1YECH 5ENWB 1WCBB 3B43A 2OTWB 4RZCA 5J6HA 4EQ2A 2GJ6E 4XAWL 4UOW1 4NN7C 4HBQA 2VNCA 2IQAB 4TYUA 5ETUB 5C6TH 1YN7A 2VN4A 4KVNH 1YQVL 3QPQC 3VD4A 3TN0C 4NKMA 2ICES 4NJAL 1MQKL 1S7RA 1YJDL 1QSFD 5DK0A 4KFZC 3SO5A 4EOWL 1Q0YL 4M5YH 4ODXA 1LO4H 3EYOA 2ENYA 1U3HB 2MTPA 1UGNA 2FWOB 3GMNA 4L8SA 1JGDA 4KKBD 1OD9A 4NJAH 1ORQA 1C7TA 2P7TB 4MS8D 1VESA 4L8DA 5F9OH 2P1YA 4OF6A 5AAWA 4I48A 1KNOB 4P4KA 1T6VN 2WP3O 1BQHA 4MA3B 5C7XL 2DS4A 3VFOA 4L4VB 2OJEA 5A2IH 1MRDL 5GS2H 1A14H 1DUYB 4KK5C 5J11B 1A6VL 3LQZA 5D7SH 3ZT5A 1F4XL 3FT2A 3QNYB 5HHVL 3QRGL 4ODBD 1TZIB 2ZCLL 5E8PB 2V2XA 4L8CA 5ETUA 5F6IC 3RWGA 4LCUA 3EYUH 1XF2B 3HI1B 1EHXA 1NGZA 4BSWA 2DQJH 2UUDH 3FRUA 4S11A 1BFTA 2IPUG 1AGEA 3KPRA 4X4MA 3MLSH 5KVFL 4P59L 3U0PB 4NHCL 4RX4A 5F88B 2YHGA 3QIBA 2FX7H 2AQ1A 3P4NB 3LHPL 3AS0A 5HI4C 1EH9A 4P57A 3EFDL 4N0RA 1WEJL 3GKWL 2EZ0C 1PZ5B 3ULSB 1FYHB 1G84A 4O02H 1FPTL 3K74B 4FG6D 4HIEA 3U0WL 1QLEH 4GOSA 1FIGL 5KSAC 5A43C 2WAHA 2NCMA 1QVOB 4F57H 1R3IH 5C0JA 3SGKC 3S34H 5MENA 4RNRA 5TGBA 1URLA 5J11C 3QH3A 1RZJC 1OCWL 2AJXL 2ZUYA 3EDEA 3TJEL 1RJYA 5BZDA 2XG4A 3TESA 1I1AB 1VSCA 4G6FB 4QGYA 4OLWH 3KLAA 5IK3A 2PTVA 3WFHB 3S8WA 2MKWA 1IAIH 2A77L 5DRWB 2BSED 2HKHH 3QULB 1N0XH 5L7XL 3MLUL 1JPSL 5E9DD 2VLME 2EDDA 3D39E 3G6DL 5CEZL 3QIWC 5FHBL 4UIMA 1MSPA 1D5XA 4PR5A 3U4EA 1H15A 3QWOB 3P4MA 4PGEB 1JVKA 5JXEC 4J2XA 5HHME 1HHGA 1YC8A 4NO3B 4LHUG 3PWPB 4CN1A 2HMIC 1TZHA 2H1PH 4PP1D 5HHXL 2Y25A 4POZD 2OZ4L 4BQ6A 4BZ1H 4QHKI 5ACMA 3CVHH 1VGEH 1JZ8A 3TBYA 4RBPH 1FAKT 2VXVH 4DKFH 4ONGL 3LCYA 5IMKA 4N9OB 3BHBA 2EO1A 4JHWH 1SJHA 2FLBT 4PTUA 2QQKL 1FZJB 5TE6H 2WBJB 1A6UL 2EH8H 3WN5B 3RWHA 5GGRB 1WZ1L 5AWNL 2FATL 4S0TD 5F96L 2J8OA 1EBPA 1UH2A 1OTUD 3GBMH 4HXAL 1GGCH 1XGTA 5L9DL 1XF2A 1P4IH 3GSWA 1XF3A 4P5TD 3HUJB 2IBZY 5GGVH 3X3FH 1FO0L 4R2GB 1ORSB 3TNMA 1EX0A 2A6IA 4MAYC 4GSDL 1IGYA 5E4EB 3I02B 5LAXA 5CEZE 4ELMB 5GGTL 3IYLW 2Q20A 1IE5A 4OB5H 1OP5K 1CIUA 1UWXK 3BO8A 5I8OH 5BRZD 1CFTA 3FQNB 5JW4N 4I3SH 3Q5YA 3GSUB 1P7QD 3KYNA 4IEFB 4WFHE 5HHOE 2XI9A 2NTFA 1R3KA 3B2UD 5LQBH 4P2RD 5DR5L 5ICYA 3E8UL 4CMMB 3P0VL 3VFTA 5L2KB 2YRZA 3JTTA 1CF8H 3QPQD 4Z7NE 4ZSOE 4K9EH 1G0DA 3BFOA 4UT6L 1VACA 1W0WB 4MB4A 1KULA 2GYSA 4J4PA 4HWBL 4TSBL 3R8QA 5IFAL 4PUBH 2G60L 3O9WD 2DQDH 3P0VH 2YUXA 4GKNB 5J0BA 3O6KH 5C0AE 1AGBA 3N9GL 4KRPB 4Y4KA 3UPRA 5GRVL 5IB5B 4KUZL 3WXWL 1PKQB 4WU7B 1CD9B 1PZ5A 5D1ZA 5I18H 1M4KA 2DBJA 2YMXL 4JVUA 5FYKE 5J3HC 4KH2A 5E4EC 5FYLH 4WDIB 3CH8A 3IDIB 1D9KD 3BX7C 4XP5L 1IL1A 4GS7B 3QQ3B 2C9AA 5HPMA 4N5UA 4LCWE 2NY4D 5BW7A 1NGWA 4TNVF 4MLIA 3IETB 1KIQB 3FB6B 3O41A 3PL6B 3GI8L 2R9HC 3SQOH 4O2FA 1T1ZA 1UJ3C 3V5HB 5CP7A 3KPQB 3FCTA 3NGBB 1GCFA 2KBGA 1M6OA 2Y07L 2E7HA 2I5YH 1QSEA 1JIBA 4OCSL 4LSSL 4YHLL 4L3EA 3RA7H 3MRMB 3B9VA 4OKVA 4DW2H 2AV1A 1JNHA 3T2QA 5D7KD 3VGAC 4I1NB 4Y1AB 1ZT1B 5CD5D 1FFNB 2X4RA 1ZA3B 2Y23A 2AK1H 1KB5B 3BGFC 1RY7B 3LKQA 2YR3A 1DQJB 2IFFH 4XC1H 2HFGL 4GXVH 3S5LA 4KI5D 4HXBH 5D1QD 3PHQB 3HC0B 3HZMA 4WTXA 4BA8A 1JZ4A 2NY3B 2D31A 1ZVSA 4NNPH 4C54A 1UXWB 4FTVE 2UYLA 4QCIA 3IDJB 4N9GB 1I7TB 1SJEA 3MLVL 5CZVL 2C3GA 4AH2A 4MHHG 4PRPA 5EZLA 5F3HA 5CZXD 3GI9H 4LP5A 4NOFA 4KKNA 3K0WA 3U36B 1JK8B 3OHXB 1F11B 4OF7A 4WV1A 4IRZL 4J3SA 4OD3L 4QXWA 2AV7B 2WLZA 1ZLSL 3UP1A 1J87A 4KJPC 3QCVH 4E5XB 4JZNB 1MHPH 5HYEA 4U4BA 5C0BB 1FH5H 1T2XA 4X0KA 2IJ0C 4OD3H 4X8XA 3WFDL 1X5ZA 3HUJF 4GRLB 4X7TA 3ROOB 4GKSA 1FZJA 1NCDL 2X40A 3C5JA 3G5VB 1U36A 1X5JA 3PGDB 3MRMA 4WI7A 4LLMB 3LHPH 5C3TA 4L29B 3RY6A 3GGWB 3P11L 1NEUA 3UYOD 4JJ5B 3K2UH 1ZV5A 4PV8B 5DJXA 1NH6A 4Z7UB 3NTCH 4DFHA 4GJTB 5BS0D 2DKMA 1AJ7H 3W2DL 3ZE0F 4D0DA 1UM5L 3BZFA 3OZ9H 3PL6A 4WIQA 3X3GL 3PXHA 3GBNH 4YHOH 1A1NB 1T1YA 1TVDA 1UC6A 1D5ZA 4L4JA 3GM8A 4LVEA 4F7TB 4X4XA 3NGBC 4HFWB 4W4OC 3ULUC 2Q7YA 2R0WH 1MCJA 4R96A 4M6OH 1V3KA 1T1WA 3S5LG 4Z76B 5IB1A 4MX7B 4NKIL 2IGFL 3TA3B 2WWMD 3L95B 4UAOB 5SWZB 2QSTA 1ZLUH 2D3VA 1Y6KR 4R4NC 3GSOA 4XP4L 4LCWA 5ACZB 1N26A 2PETA 4MHHI 4FQXA 1TCRB 5DJ2B 2CK0L 4LLDA 2NYYD 3K1DA 3EBAA 4ODVH 3VFGH 3RNQB 5IJVA 4Z9KB 4TUJA 2VE6B 1FNGB 2X4UB 1BFVH 3QG6B 5BXFB 1IKFH 3W5NA 1WBZA 3IETA 3IJYB 1P4BH 1R5VA 4Y5XB 3KPOB 1VFBB 3W9EB 1LILA 1LE5B 5D2NC 5MP6L 1J0HA 5E5RB 2C3VB 4HPOH 4NRXB 32C2B 4Y4HC 1CGWA 1LDSA 1UWGL 3BPOC 2AJ3B 2BSSA 2QR0A 1S7UA 3PQYE 4HIXL 3BE1L 2P8PA 2R2BB 1I1AA 1KNOA 3BKJL 3FQTA 4WI9A 3U7AA 3F7VB 1A6UH 1QSFA 3BKML 3F6IA 4G8FB 3WDJA 4DOHB 2IPUK 1VGEL 3L3DB 3BDBA 4JREB 1RZ7H 1FGNH 1MFCH 3OKNB 4JRXE 4G5ZL 4PJAA 5CEXA 2E7LA 4MMZC 4OGAC 1MLBB 4GKZB 1N2RA 3FT2B 1WTGT 3IDXH 4YC2B 1UJ3B 4NZTH 5C1MB 3RDTA 2CKBA 4XMPH 3KPSA 4OIBA 1Z2KA 4KHXH 4CJ0A 3BP4A 3MRCA 3VFRB 3MUY1 3P0YH 2J5LB 2CLVA 3MOQA 5D8JL 4KUCF 4E5XA 2CXKA 1LQSR 1X5KA 1FYTA 4NGHL 1BD2D 2AP2A 3JWOH 5GGVL 2XN9B 4DGYL 4CKVX 3KYMB 4C83A 4QHUA 1NCWH 3KXFA 4XGZA 3X13A 3EO9L 4HULB 3QT2A 4EN3B 2YSSB 3C6LA 4P2QD 4AH2B 3EJZC 4IIQC 5EOTA 2DDQL 2ZKHL 4KKAC 2UVEA 4JFDD 2H32B 4PJ8A 3ZDYE 4HWBA 5CD5C 1JP5A 3H7BA 3ULUE 4G43B 1TJIH 2VDQL 1K8DA 1AO7A 1DDHB 5C2BH 3HE7C 2FD6L 4BH8A 4EQ3A 3BP6A 3AB0B 2EDNA 1U92A 5HHQB 1GZQB 1MCKA 2E6JA 3KYKL 3T3PF 4OCRH 1JGUL 1R6VA 2VZTA 2QL1A 3RWDA 1JHKL 3OX8B 3QPXL 3AXLA 4R0LB 5JXED 1WBYA 2GQHA 2VQ1B 2W9DL 3UAJC 3P0GB 1F2QA 4R96B 2Q7YB 4F80A 3QXUA 3EDFA 4RAHA 4C56E 4LAQL 3S9DB 3VFRA 1S7RB 4HKXA 2VDNL 3RQ3A 4P23A 4GMSH 3UBXB 5DVLA 5L2JB 3O3AA 3BZDA 5GJTH 1IGJA 4UUJB 1U8PB 4XP9L 1J1OH 2Y72A 4PGEA 3BAEH 4D9QD 1AR2A 5JW3L 1J11A 4Y4FD 3KXFE 2D7NA 1QFUH 3QUML 5CWSA 3UBXI 2V7NB 4NDMB 1AR1C 3ZYIA 4LLUB 5KS9E 3B9KB 1G6VK 3L3DA 3STLB 3DJ9A 2VR9A 5TQ0L 5FKAA 2I07B 3CLEH 1T3FB 4OKDA 4WEBL 4DAGH 2R2BA 3FQTB 4FS0A 1ED3B 4NKIH 3WFCH 3UEZA 3EOAA 3V6BR 2DJ4A 3P4OB 1CFQB 4L4TB 4KDTA 1Q0XH 4K94L 2R0LH 3JWDH 4M6NL 4L8SC 3S6CA 1K9TA 5IB5A 4Y4KB 1NDGA 2QSCH 4MS8C 4RSVA 5E03A 1CDCA 3X11A 3VFVA 2H32H 3QAZB 3WUWA 4NJ9L 2AQ2A 4L5FH 4CUCA 1QBLH 1A5FL 4HUXB 4OLZH 1P7QA 3E6FA 5FYLE 1DVFB 5SV4A 3TO4C 5IBLC 3RWCA 2EDYA 3OKEB 1PW3A 3UTPD 1AY1H 4IDLA 1AI1L 2CO6B 3P30H 1XT5A 2XIDA 1I7ZA 3HG1A 4WI2A 1MREH 3QEQB 4G8FA 2E8ZA 2VDRH 2F54D 3VRJB 4G6AC 5ESAB 4N0FA 4NP4H 1FLRL 2X4RB 2HVJB 2APBA 3CJJA 3FRUB 2BSTB 3C09B 3F12A 2AV1B 5I9QB 1UB5B 3QXAA 4PY7B 3FAXA 2X4NA 2CUMA 3EO0A 5HHNB 3MRQA 4QXTA 3LN5A 2IPKA 4ZUWB 4R3SA 2V2XB 2JELH 3P3YA 3L3KB 4ORGA 5JMOC 1ZHNB 4YLQT 5E2VH 4ZTPL 3BP5A 5I1CH 5I1EH 4LDLB 1XGYH 2OTWA 4P5TB 4LGSB 3O0RL 3T2PA 4HJGB 4KHXL 1NMCB 3V5HA 1DVFC 1QOKA 1AP2B 4NKOA 5E00B 1W0YT 4C57C 1RK0A 3RHWK 4XB7A 6FABH 1YPZA 3KGRA 1LO0L 4ZUVB 4JPIA 5C09B 3KPRE 4X4ME 3FQUB 3GMLA 2A6JB 2X9WA 4OD1L 5D7LE 3LPGA 5SWZE 1A3RL 3KHQA 1T20B 1FVEA 4Y5YB 4X0KB 3UJIH 3SGJC 3HMXL 5A2FA 3FT3A 1E4XI 1S5HA 4OD1H 3H42L 1G9EA 5KBNC 4BFEA 4LSVH 1L6ZA 3NIGF 3MNVA 1WAAF 2AEPL 1HN1A 1PKQA 2W0LA 1N0XL 5TH2B 5LCVL 1QBBA 3HNVL 3IAPA 2VLRA 5GS1B 1ZEAH 1WIUA 1VEMA 4LPWA 1KENL 1IKFL 2BVUA 3C5SA 5MERB 4HUUA 4G8IB 1G9NC 2W65B 1YNKL 1M05A 2BVTA 4XBEL 3QSKB 4YUEL 2PW1B 3I85A 2IADA 4UZGA 4P99A 5I1AA 4P59H 4JFYA 4TTDD 5T1LD 1HHJA 1S9YA 2NR6C 1Z9MA 4YUEH 5BV7B 5T1DL 4KV5F 3EYFA 4EN3D 3CPLB 4K7PY 2BHUA 3MRIA 5EIIB 3QIUD 1HI6B 3X17A 3KYAA 5ID1B 4O02L 5MP6H 3DSNA 5ITFA 5GISL 5T1DH 3QQ9D 3DVFA 3SDDD 4JDVA 1DBKL 1F5WA 3GSWB 4U6HA 3NACL 4Q2ZB 1QFWI 5IFJA 2VZSA 1X5GA 3IU3B 1ZT7A 2B0SL 3SDXF 1K2DA 3BH9B 3WKML 3FAWA 5FGBA 3RWEB 3QUKA 5B8CC 2H6PB 3VI4E 1CD8A 3ZTNL 3P0YL 4FQ2H 1FL5B 4FZ8L 4TRPH 5TDPA 5E9DE 1A7RH 1ES0A 1G7HA 4RIRA 4Y0GA 1J8KA 2QHRH 4WDIA 3SY0A 2FR4A 4Y16A 1KJ2B 1XF4B 5ICZB 3GNMH 1JPSH 2V17H 1M71B 3B3IA 4PJDE 1JRHL 4R90H 2JIXD 4XXDB 5AG9A 4HKZA 3LDBB 4XMKH 1NUGA 3U82B 5I8EA 2WP3T 1A2YB 5E2TL 1MREL 5JLZA 1JNLH 3DBXA 4M1DL 5A3ID 3O4LB 1GL4B 3T4YB 4P4RA 1RUML 3V0VA 4I5BB 2VTFA 3KJ6H 2HT2D 1C1EL 3EDDA 1RURL 4TSAL 4X6EB 3MMEB 4POUB 1FIEA 3MGAA 1KC5L 3MO1A 4PGCA 4HX1A 2P43B 2BNUB 2XKUA 5D7IE 3KPQA 5A16B 3QO1A 1KYOK 1JWUB 4J1UB 4XB8A 4HCRA 1AQDB 4PJ7E 4ZUVA 1OARH 4WHTA 1X4ZA 5DT1H 3BYTA 5IMMB 5HGBB 3O41B 4LCIL 4JJHA 2MCPL 5HYQB 4NO5B 4E41D 2XZCL 2DLFH 4NC1E 1XGYL 5I15H 3LB6D 1A7PH 5DWUH 1WZ1H 5SWSA 4MCYB 3WEXB 2JJWA 1A4KA 2F54A 1KELL 1Q9WA 4AMKH 3TNNB 1N64L 2X4QB 1U8JA 4I0PC 2NY2B 1IKNA 1MCFA 3SJVE 4XMLH 5H37H 5E08L 1A6WL 2M8XA 3PV6B 4NQSA 5I1GL 2EKJA 1JNJA 1PGRB 1CGYA 1YMME 1VPOL 5DQ9A 2F53B 1FZKB 1PKQE 1AH1A 2IBZX 4GAFB 4M02A 3UTSD 2IAMB 5J8OA 2EDHA 1OAZL 4OAWA 5DRNA 1SQ2N 2A6JA 3PWPD 4MA8H 3QP3A 2CDFB 3WN5A 3AMKA 3HMXH 1T5WA 3MXVH 2LU7A 1YYLL 4OB5L 5HYSG 3GSQB 3F65A 4WHTB 4OIAA 4Y5YA 2VIRA 2IF7A 5CJXC 1CGXA 3F58H 2VERN 3ELAT 5BS0B 3MXVL 4CMMA 1VCAA 1BMGA 3PWJA 4QRUA 5HD8C 3RL2B 4WW2B 5IEHB 5DEZA 1PJ9A 2Z92B 4ZNEE 4PRHA 1CVSC 5FUCE 2J3SA 1JFQH 2HLFD 3RWGB 2E7CA 5C0AD 4V1DD 1ETZA 4WTWA 3UXFA 1RMFH 3EYVB 4OF5A 1V5JA 5ADOL 1AGDB 3ARDD 5I1LB 4PJ8D 2DIJA 1KCSH 2GW5A 5IOPB 5FYKD 5ANMA 4K23H 5AZ2H 4ZUUA 3IVKA 3HG1D 1UWXH 3MV8B 2PO6C 3GO1L 3RKPA 3SCMC 2JCCE 1IC7L 2ERJB 1FV1B 4Y2OA 1NANI 3NZHH 2NMSA 3WLBB 4TNWF 1BVLB 4M6MH 3STLA 1LP9E 4YZFE 4XT1C 4XH2B 4RISH 5KAQG 4U1SB 4G7YH 3VXUB 1ZHLA 2NZ9C 1L7IL 4K3JH 4ZS7L 1NCBH 1MFNA 1XZ0A 3QUXD 4GG6A 3HE6B 1XH3A 3O8XC 5K9QG 2ZCKH 2YBRA 1HHIA 3VWJB 3WNMA 4FABL 2E5EA 4NNXB 4WNQB 3WL9B 3PWNA 1V7ML 5AUMA 3M17A 3MRFA 4QHLA 3BIAX 1MIML 3IKCB 1YJDC 1AE6L 1CR9L 4J6RH 4YFDB 3N1GC 2WINA 4NM4L 5BQ7A 4YAQB 4HH8A 5E94A 2NYYC 5I74B 2E9JA 2YZ8A 5SV3A 4HIEB 4U0QB 3LEYL 4OF3A 2JB6B 1X7QB 1VEPA 2AJSL 4HZLA 1MEXH 5DVOA 4NBZB 2UWEB 3MGTB 3L7EB 5HBBA 4ZAKD 2QKIA 2W0KA 3O0RH 2AJSH 3J7HA 4MNGE 2FEEI 3IGAB 2DQHH 5F1NA 4Z7WF 2VLLA 1J1PH 2H32A 4ISVB 3MRBA 4O5LH 2G5RA 3L3OA 3C60A 1RIVL 5B39G 1ITBB 4R4ND 2FB4L 3QQ4A 5DYOA 2NY4B 1BHGA 5HHNA 3LQAL 4Q0XH 1NFDE 4AEIH 2EH7L 2OTUA 2DKUA 5DVNA 3UBXG 4ZFOL 2IEPA 4FP8H 5KG9B 3LQAH 3LQAC 3HI6H 1EHLL 2F58L 2FD6H 3KPTA 2IPKB 3QI9B 4HZAA 4UT7L 3TF7C 1OSPH 5KVGH 3VFPA 3QFDB 3RGVC 2A6KB 3MV8D 4GRMB 3ZE1E 4HH9B 4L4TE 5TE4L 3HFMH 1OF2A 5DMIL 1CICA 1YNTB 5DMKA 4YBLC 2LTQC 3D3VD 1KGCE 5GHWH 1NMBH 3QEUB 4KV5E 4M62H 4G6AD 3U4BL 2CDFA 5L2KD 5C0EA 1M7IA 2PXYA 5DJ8A 1NCCL 4OCWH 5T1KB 4APQB 3KXFB 2V9RA 1EHNA 4F7MA 3BE1H 4HIXH 4EDXB 5JW3H 5FA4A 3BDYH 4MA8L 3REVB 3KPPB 5BV7L 5JA8B 2VLKE 1FPTH 2EC8A 3CZFA 3M1BA 2BJMH 3ILQD 1A6ZB 1MF2H 4XCNA 4I0PD 1QP1A 1U95A 2Y06L 4YHKL 5I8KH 3IDXL 1M7IB 2PXYB 4LVOC 1EEQA 4CNIB 2KQNA 3QWRA 4MVBD 3MRJA 2ICWI 5IQ9B 1CL7L 1EHAA 1TVHB 1NBZB 4D9LH 3EYSL 5DHVA 4LSSH 5DHYA 1CICB 1YNTA 2X1QA 2PW2B 1YEDB 4BKLA 2A9MH 3MBEB 1XF5A 2FEEL 5E7FA 1A6TA 3D85B 2HRPL 3HNTH 3OJ2C 1KCVL 3VXRE 1UJ3A 4GAGH 5JW4R 2F53D 4DGYH 4DK3A 3VXPA 3ZLQC 1XIWC 4PTTA 3VXSD 1IC7H 2Y9RT 3JUYA 4JHAH 1T1WB 3BGFB 3D3VA 1T7ZA 3ARGC 4Y4FA 3VG9B 2VLLB 2ZUSA 1WCBA 3V79C 5CILL 4RBPK 4KRPD 3H2WA 4KDVA 1R5VB 4FQXD 1F8TH 2AJ3A 2BSSB 1BP3B 3SY0B 4ZYKA 2BOBB 3MGTA 2UWEA 2Q8AH 2PYEA 4OLXL 2EKSA 5B8CA 4TSCH 4XXCA 3IGAA 5FA3A 1KJMA 2I60H 1MCCA 1VEOA 5HHVH 5EWIH 5MEOA 3BP6B 2XTJD 1NBYA 1E4WH 3LPWA 1PSKL 4GRWB 5D1QB 1CU4H 5FUOL 3BUYB 2FCBA 2EDTA 1Q1JL 5I1DB 1IM9A 4R97B 4Q2ZA 4H8WC 4NYLB 5F1NB 5BOPA 5EU3A 4OJFL 2JLLA 4M4PA 2GI7A 2MOVA 3VRIA 1L0XA 3AS1A 2MQCA 2FBJH 1QFUL 3QUMH 1NSNL 1Z3GH 4TTGA 1EK3A 3CFDB 1R5IB 5CGTA 4OUUA 3HMWL 2OL3L 4KMTL 4I3RL 3ROLB 4NN5C 4Y19E 4FNLH 4PJAF 5CD3B 1B4JL 5HHPB 4OQTA 4AEFA 3QXWA 4X6FA 5I1IL 1P5UA 1LO4L 3OAYH 5ISZB 4HUWB 1ZT4B 1Q0XL 4K94H 4IJ3C 4QWWC 3TIDA 4LQFL 4FXGA 3U79A 3JWDC 1SEQL 4UDTA 3ULVL 4TPRH 4XZUA 4K23L 5EBLB 3CH1A 4FXKB 3OB0H 1D7FA 4LOUC 1PFCA 3VXTA 1MCLA 2DM4A 5CBAA 5IBUG 5IT2L 3PGFH 3CFJB 4OZGB 2HWZL 1NMBL 3O3EA 5I71C 5JPMA 5IG7A 3QPXH 4GKSB 4NO0B 3CFBB 5D7IA 3T0VA 1CE1H 5JQ6H 5EO0B 1EMTH 2O61B 4LEOA 3QDGD 4JN2A 1S78C 2DL9A 2XY1A 1WZKA 1NPUA 4KKLD 2VIRB 3DLQR 3MLSL 5KVFH 3MV7E 5CJXA 1CD0A 5JDSA 5F7UA 1IAMA 3HC0A 1MJJB 2WWKO 1GGBL 2VAJA 4RFOH 3TYGH 1FYTD 4MQSB 2EDQA 3MZTA 3T3MF 1N6QL 5F1SA 4PRPB 5FA3B 2E7BA 4NM4H 4BELD 1PG7W 5IBTH 1DVFD 5IFHH 5FHAH 3RJQB 3OG6B 4XNQA 4NNYA 1L4IA 1C12A 3NH7L 4F7EB 4X4YB 5TQ0H 5IJKA 3HHRB 3O3BA 1A0QH 4M43H 3MV8A 5DEFB 4H1LA 1U8QA 3ECBA 5JHDE 1EEYA 1EVUA 2LVCA 4LVHC 4OLEA 3PP3H 1N7MH 2HKFH 3DSFH 1X6NA 2VDKL 1FL6A 4X9FA 4LBEA 4M43L 3SGJA 4YHLH 4OZHA 4JKPL 1EBAA 1WK0A 5ESQA 2R4RL 3LKSB 4I0CC 1FG2B 4X5XA 2X2YA 1LDPL 4L29A 4XMKL 4XNYL 3L3GA 4I18B 4NQED 4HK0A 2AW2A 3OJDA 1SBSL 1B0GA 3ZL4L 2X70B 4NQCB 3GSOB 1A22B 1B9ZA 3ZO0A 5GGUB 4DKFL 2XTLA 3F7RA 3B9KD 5HYJE 3TP4A 1A6PA 1CTNA 1AHWB 3EHBC 1IBGH 4WO4A 4UIKH 4OT1L 4BFIB 2IANA 5GGRY 3EIFA 4HFWA 1X5XA 4KI1A 5HGHB 2XKSA 4GRLC 3QUKB 1CDUA 1HNGA 4K8RL 3UTTB 3FO0H 1RULL 4PS4L 4YZFF 5F89B 2NY6C 1XGPB 1R3JB 1JV5A 5C0BE 2VZOA 2BNQD 4IIQA 1I1AD 3UPRB 4P48A 4LRNL 5ICZA 1K2DB 1YUHB 2YWZA 2BVQB 1RUQH 4GAYB 4IRJC 1DUZB 5AZEL 4GMSL 2N7BA 3K81A 5DJ0A 4Z95H 2B2XL 3KYNB 4ESKA 4XP5H 5JPMB 4CRPA 3OF6D 3WO4C 4MJIA 3HC4H 5IMOB 2DMKA 4LASH 3RY6C 2BNRD 2A6KA 4GRMA 3RIFK 4OCNC 1LEKA 3BH9A 1N8ZB 2AEWA 1LNUB 1NC4A 2NY5L 5D72H 4JKWA 3FCTB 4OTXL 1PX3A 5GRWA 4P2QB 3SGKA 3FOLB 1EO5A 3MUZ1 2E6PA 4MQXD 5HDQH 3RJDA 5IVXE 4HUNB 3GRWH 5K9QI 4OZIE 3QDJA 4Z7VF 3TGXA 3C08L 3JBG7 5HI5C 4YH6A 5EZLB 3WBDA 3HUJA 2QHRL 1MVUA 4QXGL 5SWSD 4K2UH 5A3IC 2J8HA 2Q7NA 3GFUA 2VLMD 3ECBB 3FMGH 3FTGA 1RUPH 4PJEE 2Y7QA 5DTFB 5I0DA 4I9WD 3VD9A 2I9LA 4G80A 4CVXB 1CE6B 3GUTB 1S9XA 1MFDL 1TJGL 4Y1AA 1A3LH 4MXWL 4NT6A 1J88A 4HUUB 5HHOB 2NY5C 3ZKQD 5JIPA 1F8TL 5F89A 3MLXL 4I3GA 1F6FB 1WGOA 2D0HA 4AQ1B 5J12C 2D7TH 4ODHL 3ARWA 4YHNA 3I6KB 4RGMB 5D96C 4HW6A 1AO7E 1H15B 3VWJD 5TF0A 1QD0A 4OZHB 5BMFL 5EC1A 1D9KA 5J6GA 4J3WA 1SM3L 1YMHA 3ZDYF 4G9FD 2GTZA 5D7LB 5LBSL 3LV3A 1FRGL 4OQ1A 1BX2A 3AFLA 1I9IL 3BKMH 3ZYOA 3RIAF 5MHSD 1MY7A 1TVHA 1YECL 4G3YL 4GW4B 4HK0B 2X89D 3O6FD 5SX4H 5ADPL 4X4YA 1VKXA 2HFFA 1D5MA 1N7ML 2HKFL 3DSFL 2R39A 3GK8H 2XPGA 1DBJL 1ZGLP 1YPZB 1G6RA 1W72L 4JG0H 5CJOH 2C7UA 3CCHA 1EGJL 1YY8B 4WFED 3EO0B 4LLYB 4FNLL 4OZ4A 3MACL 2BC4A 3RPIB 1G7IB 4DUXA 3SDDA 3CC5A 3MRLB 1OVZA 1KXVC 4WUUB 1KJ2A 1XF4A 1QLFA 3RTQB 4X8JB 1KTDB 2NLJB 1T7VA 4P3DA 2GFBB 4QHMA 2K7PA 4QXUL 5IJVB 3RWFA 4YFLF 2R4SL 5CBEB 3KJ6L 2P45B 3X11B 2FHBA 2W38A 5KZCD 5IMKB 1B4JH 4Y19B 4LCYA 2APVA 3OR7B 5EBGA 4P2OC 5ICYB 3SKNA 2OJZH 4I2XB 3OKKB 1E6OL 1MUJA 3GHBL 5IEKB 4Q9RH 1GH7A 2HWZH 3EYUL 3TA3A 3VFVB 2AXFA 1NDGB 4HWBH 4TSBH 3O9WA 1OTSC 1MCHA 4LLVA 2O5XL 5DMGD 5TPWH 5J13C 1A6VH 2MFNA 1L9NA 3DUHA 1DQLL 4U1MB 5EUOF 4LRNH 5DFVD 5IW1B 2VJXA 5I15L 5JA9A 4DKAA 1T1YB 4NQVB 5FV1L 3FHAA 1GGYA 3KVQA 3NFSL 3TBWA 1G7MB 1I7RB 5GSVB 3RL1B 1GGBH 2X4NB 5C0FA 2X05A 3UTSE 4ZO8A 5BZWB 3P4MB 3P11H 3OGCB 3PWPE 3DI2B 3I75B 1E4JA 5D2NB 4WVRA 4FABH 1YEGL 1KCKA 2W65A 3WJLC 5GISH 4E41B 1IGTB 4KROB 5INDB 4W6WB 2E8YA 2K3TA 3B2UC 2IQAA 3NIGE 5J1AB 4X98B 4NKDB 5KOVC 4F7CA 2HFEA 2X89A 4CU8A 5TH2A 2Z93B 3RGVD 5GGSA 2CMRH 4J4PD 2ZCHH 4ZNCD 4ENEC 3IFPB 4OLYL 4QHLB 3VGAB 3W11C 1INDH 1NDMB 3VXRB 3HCVA 3AREC 4PY8J 5GRUL 3QIBC 3SO3B 4ZO6A 4HKZB 1CD1A 3OPZL 2Y6SD 1QEWA 3BN9D 1U3HC 3DETC 5J3HD 4CVZA 4FMKA 5EN2A 4PLOB 5CLTA 2Q8BL 2V5SA 3R1GL 5F9JB 3MQIA 2WW8A 2RGSA 4CN4A 1QFWL 1IEBA 3ZE2E 4PYHA 3V5KB 43C9A 5EPMB 5C8JB 2FRGP 2JF1A 4PG2A 5I76B 2WUCL 1U3JA 2YA1A 2V9TA 4DGVL 5KAQF 4NNPL 5MEOB 1KC5H 5JOFB 3H7BB 2C4XA 2I27N 3BP4B 3MRCB 1JHTA 1I9JL 5HVWA 5DC0A 2X42A 3MREB 1BIHA 3QDGA 2VMFA 2VZVA 4H26B 1U8LA 4Y89A 3BZEB 5I17A 5ITFB 3ARFD 3QDJD 3ZYJA 1XCTB 4W6XB 1HH9A 2XYCA 1IT9H 3NZ8A 4HH9A 1NKRA 1K85A 5DJZB 3T0EC 5IVXA 1S78D 5F6HI 2GJZB 3VFPB 2R0KH 1NC4D 3N50A 5D5MA 3D2UD 4QOKA 2A0LD 3NCFB 4PBVC 5DD1L 4L8SB 1II4E 1U8IB 2WLYA 3CSGA 4XRCA 1OAXH 4MVBC 5B39B 2PYEE 2P8PB 4X6DB 3TPUB 1NLDH 1T1XB 2AXFB 1EAPA 5CINL 25C8L 4ONHA 4YDVA 5EZIL 5E8PA 4L8CB 5ITBL 1RK1A 4XCCH 3S36X 4R2GC 2X4QA 3U1SL 3QWQB 5I1IH 2WNGA 2Z92A 2GSGB 3QNZB 2FB4H 4Z5RA 3S34L 3SKJH 1IC4H 5J56B 2EDOA 5GS0C 4L3EE 4PV9B 1I9RH 1IEAB 5IIEA 3UJTH 4UNVA 1I8KB 5GZOD 3ARDC 4YDIL 2A2QT 3TJEH 4W4NA 5IG7B 5LXGH 1CXEA 2FJFB 1GIGL 1AQDA 3MV8E 2M26A 4L4TD 4FQXB 3B9KA 1U3HA 3QNZA 4UT6H 2X1PA 3KAAA 5D6CA 3OKOB 1QBLL 2WBJD 1KLUA 2A74B 2X4UA 3K3QA 2DTML 1CLZH 3H6JA 2VXQL 3T04D 2ADJA 1M7DB 4B50A 2EICA 1BBJB 2VXTL 1JF5A 3ILPB 3BH8B 4P4KD 4XRCB 3LKNB 2AERT 2OP4H 4GW1A 4KQ3L 4NUJA 4K8RD 3BP7B 4PJIF 3VFNA 2DQGH 1OAQH 2VLKD 4NO5A 3L5WB 1WFNA 3C6LD 5FYLL 2ADIB 4R4FH 1HKFA 5MI0C 3O3BB 1W8OA 5EWIL 3JV4B 4KZEL 1PAMA 4HHAA 5HI3C 3OXRB 1J1XH 5DFVC 3D85D 3VI4F 5HHQA 4R4FL 5ADPH 2FEDD 4FFWC 3VXSA 5KOMC 1MHHB 1MCWW 2OBGA 2JJTC 4LCCC 1WBZB 4PJCE 5D4QA 3CU7A 1PQZA 3OAZH 4LAJH 1FRGH 2KH2B 1DTUA 2E9BA 1KCUL 1CVRA 3FFCA 3EYVA 1KG0A 4DFIA 4NUGL 3H3BC 1QYGL 5BO1H 5F72S 4KK8C 4PRIE 4F2MA 1KCRL 4JO2L 1U93B 1LNUA 2ZUUA 2YOCA 3T0EE 3QXDB 3OQ3B 1K6QH 4ORZC 3VMPA 3VWKC 2D4FA 3L1OL 1KJ2L 3K7UA 2PYFB 3FTGB 2FH8A 4PJFB 5KW9L 4D2NA 5HY9B 1NEZG 1RU9H 4QY8B 4AEEA 4UINH 1D9KC 4ENED 1P7KB 3T2OA 4Y4HD 1TNNA 3KG5A 5E5MA 5EUKA 4XAKD 1QBMH 4WI8A 4P23D 1C1EH 5H94A 4Q9RL 3D3VB 5DRWA 2EC9U 1CFVH 1JRHI 5IHUH 5TF1H 4ZFZA 5EOQL 3DX6A 1QNZL 5DUMH 5LQBL 3WNOA 1UKTA 1NEZB 3E8UH 3MA7B 1G6RB 4U1NB 4RMSA 1RJZA 4ODWA 1EZVY 3BIBX 1BVLA 3SDXA 3K8MA 4S1RH 5TE7L 3G5ZA 5IFAH 2VAAB 3MUJA 5JOPD 1EVTC 1QBAA 2QR0B 1VERA 2B5IC 2F5AH 1T03H 3TBSB 3MV01 3TM6A 4C56D 3JTSA 3QCTL 4FTVA 3CVIH 3V8CA 5C07E 2FO1A 1UQSB 3HAEG 3EFDH 2GY5A 1Z0MA 4YBLB 1VFOA 1UT9A 3REWA 3T0EB 5FO7A 4CGTA 2GSGA 2YC1A 2YKLH 2FJFA 4OCLC 3A6CH 3KXFD 1A21A 4LHQB 5KVDH 1JZ2A 1V05A 1KIQA 1FQ9C 2NNAA 1OM3L 4MSWA 4BK4A 5HGDB 4JFXA 1LO5A 4HJGA 3QQ3A 3KPRB 4YQXH 1SVZA 3PF2A 4LCWB 1IL1B 4LHJB 4LLVB 1IM9D 4GRLD 1HQ4A 4XXDA 4JDZA 2NXZD 3O11B 4FQJL 3HMXA 3LQMA 3QBTB 3ZTJG 5TDNA 4XNMB 5I19H 5IEKA 3FB5B 1KENH 2ILLA 1BQUA 3FQWA 2H9GA 4ZPVA 5IESL 4NN7B 2CMRL 3VGHA 3R1GH 2H6PA 2Q8BH 1A9BA 3JUZA 5J7CC 1VADA 1P1ZB 1BWMA 1G7JB 1JF1B 1OP3K 1AKJA 4G6MH 1RMFL 3HS0B 5IR1B 2DAVA 3MOAH 3C2AL 1L7TH 2XN9D 3LKRA 3MCKA 4XPFH 1QSEB 4PRHE 3PJSB 2L7UA 4XHJC 2A77H 5HDLA 4OV5A 3H9SA 3SO3C 1A02N 5EU6B 4OZ4B 2WMPA 3SQBA 2DQGL 1NL0H 3SCMA 5DEFA 2ARJA 3MRPA 3MRDA 3ZSSA 3OSKA 5CBAB 3MJ8B 3A67H 4HKBA 4K9EC 4D0CB 2BNUA 3DV4B 4RFOL 4TSCL 4U33A 4U1LA 1WFTA 3MRGA 5ISZE 4GUPA 2XQBL 3MCG1 1I85C 1DL7L 4NWTH 4KQ4L 3M1BB 4AEHL 4JAMB 3JZ7A 3ORJA 3QRFM 7CGTA 4JFHE 2DBLL 4GRWF 2R2EB 1T0MA 3FOMA 3BT2H 3CDFA 5L9DH 1SY6H 2YUVA 2HAZA 1LEGB 1NJ9B 3BT2L 3ULUF 5AWNH 5CP3A 4PJGE 4XHQA 1G7HB 3PXJA 5F97E 3TO4D 1RI8A 4OFYD 3PIQB 4K71C 4XWOC 4JG1L 4HF5L 4JFQA 1P4IL 3VD3A 1AJ7L 3BJLA 1FVEB 4NQCA 2F74A 3OKLA 3GUTA 4BZ2L 2DDQH 2ZKHH 1OGTB 4YHZL 3TO4B 4GS7C 3TPKA 1MCSA 2LU3A 1J86A 4I18A 3T65B 3G5YB 2G75A 5T1MA 1YDPA 1HCFX 1GGUA 1E27A 3T8XB 5GS2D 4XPBH 1H8NA 5DURB 5FKAB 5ABDE 2E7LC 3QWOA 1MRDH 3GMMB 3LRSA 4QNPE 3M8OL 2RHEA 2I9TB 1UM4L 1A6AB 1MFAL 3R4DA 5D1ZC 4ZG1A 4O2CB 5HYSB 4NO3A 4GLRI 3JV6B 3DXAD 4OCYH 2BNQE 4D0DB 4KHTH 1J0KA 1TVBB 1I7RA 3S36H 2XQYG 4PS4H 1NCAH 3OKMB 2VXTH 3EOBA 4LSPH 3MROB 2H2PD 4O2EB 1S7SB 5E0QA 2EIBA 1CE1L 3TJHD 5E6IA 5JQ6L 4WI6A 2BX5A 5GHWL 3U9UA 3CDCA 3IAGC 5T3XH 1OAZH 4U1HB 1X9QA 1OOAA 4ERSH 5BS0A 3T65A 4HWNA 3WS6A 1F3DH 1RZ8A 4JANA 3BUYA 1O0VA 4X5LA 4R7NA 1UZ8A 1EFXD 3SQOL 5E56A 2P8LA 2NY3C 5DVMA 5DRNB 1G7IA 2X4OA 3JWOC 3DO7A 2N4IA 3TBVA 1DR9A 1YEHH 3BAEL 1XH3B 3C2SA 3KNBB 4WCYH 3GJFH 1MH5A 1I8KA 1MNUH 4Z7VB 2V5MA 3CMGA 3RA7L 4R3SB