2VQ1A

Anti trimeric lewis x fab54-5c10-a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPLSLSVSLGDQASISCRSSQSLVHSNGNTFLQWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRMEAEDLGIYFCSQTTHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of a Diagnostic Fab Fragment Binding Trimeric Lewis X.
pubmed doi rcsb
molecule tags Immune system
molecule keywords IGKV1-117 PROTEIN
total genus 46
structure length 216
sequence length 216
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vq1A01
4PJDB 2DWEA 5E2TH 3SPVB 1PFCA 3UYRL 4Z5RB 1HH9B 1PQZB 2F53B 1H15A 1NGWA 4K9EL 3VWJC 2NR6C 2X1PA 1FG2B 4YE4H 4PRHB 5E2VH 1YEFL 4LSUH 1FH5H 3B2VL 4PTUB 3SE9H 3OL2A 4XZUA 4N90E 2YD1A 1UCBH 2AK4B 2YXFA 5E56A 2HT4D 3DX7B 1TTGA 5BV7B 3HUJB 3MLTB 4M03A 2QTEA 1XGYL 2VLJE 2W65B 3RWJA 1GAFL 5J3HC 2DQEH 4OZIB 1BGXH 4NZJA 1MCEA 5GHWL 3MUY1 1S7RB 2E7CA 5HHVL 2JJSC 4EOWL 1ZA6B 4NPYA 4G6FB 2APTA 4P46C 1G7MB 3E6FB 5EU6A 2BVOA 3PP3K 5A2LH 1FE8L 2EDEA 4HQQH 4J3OC 4U49A 5L7XH 3IJSB 4LHUD 4YGAB 1YMHB 5F89B 4WFFE 4YNYA 2BMKA 1DBBL 3TP4A 4RFOL 1FAKT 1ZANL 3KLAB 1WZ1H 4CVZA 4MCZB 3JV5A 1BQUA 3MJ9L 1MJ7H 5CIPB 2JE8A 3ZKQD 4DWHA 1ACYL 4XP6H 4MNGB 2E9WA 5F44A 5DJYB 3FT3B 3ARGD 1LK3H 2HTLC 2R1YA 4LLYA 1YNTB 1CI5A 5B3NA 3GMQA 3QEQE 3O2WH 5I8EB 4R26H 2VLKA 3B3IB 4N0RA 1E4JA 5IFAL 1YPZB 3OKLB 1EZVY 4K07A 5D7KD 1DUZA 2H32A 1QPPA 4GOSA 3GUTB 4PJ7A 1FZMB 2R39A 4P3CH 1SQ2N 4QGYA 4KXZI 2AERT 4G6AD 3TM6A 4YHLH 3TA3C 4PP1C 5DURB 1AC6A 2AJSH 5CINH 5T1KD 5D7IA 2OTUA 5EUOA 3V6ZB 2FR4A 1QTYT 1WC7A 5FGRA 4OGXL 4HKBB 1SY6A 5EZLB 4LCWB 2MCPL 4WI7A 2FJGA 5J4MA 5I1IH 1UH3A 1A1OA 1F3JA 1FZOA 2DIAA 1R5WA 2NX5E 4PJ9B 1E4XH 4K71B 3S88H 4XXCC 1MCJA 2VR5A 3MO1B 1JRHI 3RZCC 5HYQA 4IS6B 5ENWA 4AYFA 3TBTA 2FX9L 1K5NA 3V5HB 4UBDD 4IRSB 1RK1A 3F7RA 1UJ3C 4KKCC 1A7QH 3VXRA 3CFEA 1OD9A 4Y4KB 5D1QB 1MFBL 1BIHA 4HWUA 4WFED 3RL1B 3LHPL 2KDGA 1NQBA 1I9IL 1KN2L 3MODL 3VMOA 1G6VK 3MCG1 2FDBP 2ICEA 4Z7UF 4HXBH 3G5XB 5E6IB 1OTTC 1INQA 3VXNA 1C8PA 1INEH 3WHE1 1FNHA 4L4TD 3QQ9C 3VH8B 2JIXA 3UPRB 4QXUH 3X14B 1NUGA 1JF1B 2EE2A 5D9SB 5D96B 3MLVH 3UMTA 4ETYA 5DF0A 3SY0A 1U95A 4HGKC 3EFDL 4G6MH 2QSQA 2WIIA 5J6GB 4QHNA 5E4IA 5FHBL 1G7HA 1GGIL 2FHBA 2CIIA 2GY7B 2YPKB 3CNKA 2OLDA 1QSFD 1GGCL 2BCKB 5JOEA 3X3GH 5I19L 1AY1H 3NIGF 5F9OL 3O81A 3RWDA 3RPIA 3LN5A 4HAFA 4JM2A 4ODHH 3NACH 1U9KA 5IB5A 5DD3H 4RZCB 1YMMB 4NQXB 4HS3A 4HPYH 4S2SB 2VL4A 1PSKL 1AJ7L 3WFDL 2ZUSA 2VDRL 3DETD 4Y5VA 2XQYK 5D1ZA 3SEPA 1CICA 3SE8H 3O41A 5T3ZH 3CMGA 4F33A 4GKNB 2P5EE 1BAFL 1WEJL 3QRGL 5IB3A 3O3BA 4NIKB 5HGAA 1XGTB 2EE6A 3ARFD 4X5XA 3AU1B 4B41A 1QBAA 2DQTL 2FX7L 2X6MA 3GIVB 1N59A 1JWMB 5I76B 2DRUA 4BFEA 1ZS8A 4XGZB 5AG8A 4MJ5B 2YD4A 2VISB 3IDMA 3QCTL 4XPTH 3O4LA 1I1FA 2HN7A 4HIHA 2X1XR 4P49A 1RZ8B 3BZEB 2LVCA 4ZXBA 2Q8AH 4NQEA 4Y8AA 1OCWL 2DQCH 1AGBB 4J3SA 3NTCH 5E94B 4KJPD 1QRKA 1PEWA 1XGRA 5FKPA 2FZ3B 3KJ4B 4OIIL 4X9FA 3ARDA 5DJ0B 1MAMH 1FAIH 4LCIH 1DN2A 1VFAA 1JTTA 4M6MH 4U7MA 3KPSD 4HS8H 3JBG7 2EIEA 1KTLA 3MRJA 3FQXA 3V7AE 5IB4A 4LARH 4H20H 2JKXA 5TF1H 2NY2D 1KTDA 3CZJA 2UYLB 3L3KA 1KNOA 4XPAH 1DUYA 3T0AA 3VGBA 3FFCB 3MV7B 3QA3B 3BSZL 1FFPB 4OF5A 1T03L 2MMXA 3D85A 4HBCH 2IADA 2ZUUA 25C8H 3IKKA 4ODBD 4Y16D 4WCYH 1T21A 4P23B 5GRYA 3FQUA 4Y2DA 5JPMA 5HD8C 5ADOH 2BNQE 4FNLL 3P73A 4PJAB 4V1DA 3SE9L 5CWSA 2PO6D 4R0LC 3NFPB 1WISA 3PUCA 3IF1B 3OKKA 4NKDB 3MJ8B 4PJ8C 2FBOJ 3B9EA 3MJ7B 3P11L 2YC1A 1GZQB 3X3FL 4I8DA 4JM2F 4M48H 3U7AA 3QIUC 1BFVL 1JGVH 2Y72A 4JAMB 4N0FB 2QSVA 3V8OA 3VG0L 4OM1L 1RZGA 5EIVA 2C7UA 4FQ1H 4FN0A 5FYJU 1EK3A 5FCUH 2K1MA 1MFDH 3QUYA 4HBQA 2I9LB 4ONHB 1ZLVH 4JO2L 2HG5A 1B3JA 2ZCHH 1SBBA 3I6LE 3MNWB 3RQ3A 2NY5C 4XNZC 1JNHA 5HI4C 4HUMB 2P47B 3PHSA 1ZHNA 3MJ9H 3FO9B 1G7JB 1UZ6F 4OGAD 2FBJL 3IJHA 2EXWC 5JZ7D 1PVHA 3CFJB 4MCYA 2FL5B 4OKVA 3HE7B 5DVMA 5INCA 3OPZH 2QADC 1U58A 1VFBB 2LTQC 5E8PB 2GJ6A 1NFDE 1P9MC 1T0NB 2A9NL 3O2VL 4Y19D 4ZOEA 1I8LC 3S5LB 1J0HA 3CCHA 2XWTB 5ILTL 3LN4A 1FYTD 2A83B 5I8OL 1X5GA 1SEBA 5JW4Q 1X6LA 2DLIA 5IEKB 5FK9B 4IRSC 1RZ7H 4M7ZC 5FO7B 2H3NA 3LKSB 4U6HB 3BJLA 4UUJA 4XRCB 1PLGH 1XFPA 3KXFE 4RAVA 5C0CE 1CK0L 4XNMA 3L7EA 3BESR 1SYSB 4PJIA 5B21A 1E4KC 3MYJB 2JB6A 3N1QC 4JFPB 1C5CL 4XCFL 3BYTA 2X4UB 3WFEL 3WIFA 4L4TA 5DHVA 1LQSR 3JV0A 2NY7H 5SWZD 2DLFL 1ZT4A 3SN6N 3UBXA 3MRQA 1E4XL 4OZFB 3S4SG 1IM3A 5FCSH 3QH3A 4PY8J 4JFHE 4RQQA 1BOYA 1RZIB 4PJFF 2O61A 5HGBA 4P2OC 3O9WB 5JO5A 5D7LE 4IOIA 4G80B 2EDLA 3IFNL 3T2NL 1NC4B 1P5UA 3BX7C 3MRHA 1BJMA 3V4UL 4JCLA 4FQQB 2IPKB 4QRSB 3W0WA 4IIQA 2C3HA 3UP1A 3UTSA 2JJUA 5HI5D 1Y0LB 1FC2D 2QR0B 1AD9A 3P2TA 2R69H 4XPFL 3RBGA 1XR9B 2M8XA 2VABB 1D9KA 3MC0A 4HXBL 1J8KA 3O6FB 3P0GB 4QXGL 5MEOB 1UXWA 5CEYB 3SE3A 1INEL 1PBYA 3C6LB 3HE6C 1U91A 4QT5B 4ZD3L 5FKAA 3D2UA 4TSAL 2ZG1A 4KWUA 2ICWI 4R97C 4FA8A 2ED7A 1WWWX 1CE6B 4HG4J 2WANA 3U46B 4LCUB 1WF5A 3RVTD 2F5BH 5F1IB 5L9DH 1JPSH 2ED8A 4X6BA 4JZJC 3WLWC 5KOVC 5I16B 1FNEB 3KPRD 1HHIA 1T0PB 3QNYB 3UYRH 1CBVH 4P5MA 4G9FE 5C9KA 1GZPA 4LMQE 1FL3B 5EC2A 3OGCA 5T5FL 4PLNC 4NQUA 1ZE3C 1NAMB 3A6CL 4WI2A 3RY6A 3TNNA 2GTZB 2WBWB 3WFDH 5C0AE 5CEXA 3WKML 1I8IB 3GBNH 1DQLH 1PG7W 2LU3A 4MJ6B 4D94A 2VE6B 5ANME 1KCVH 1UM4H 1FNFA 1Z2KA 3S34H 3BD5A 3OKEA 3G5YB 3BZFA 5E9DE 1FJ1B 2AXGA 3TYFA 4JGJA 4OCMC 2YPVH 4S0SD 4I18B 4L8SA 2XFXB 5F88B 4EIGB 4DUVA 1JFQL 5L0QC 4JO3L 5HHVH 2C9AA 1RZKC 1T1ZA 2A1WH 1T7XA 3CLFL 3DYMA 1KJVB 1ZKAA 3G5VB 4LLAA 4OF6A 1JZ8A 3IETB 4EI6B 4G6JH 1DVFB 3E3QC 3GKZA 4L8BA 4TUOA 3RA7H 4NSKB 3T2PA 2R0ZH 3VXQA 5IEHA 4L8CA 2X4QA 4S0TD 3FB6A 3HE6B 3ARQA 4I0KA 4JFXA 1G7IB 1K8IB 4X98A 3WO4B 1X4ZA 3RX5A 4ZSOA 3GSNA 1CDGA 4M6ML 2VQUA 1GC1L 1XF4B 3DUSB 1KJ2L 3V6FB 1I9JH 4YPJA 4ZMAT 1ND0B 1IFHH 4WWKB 2EH7H 3DHMA 1UACL 4E0RA 3GSUB 4YHKL 3BD3A 4P23D 2PR4H 5IF0A 2E8YA 4BH7A 2EZ0C 4RX4D 3E2HB 4YHZH 1DEDA 4H0GA 1U3JA 4WU7B 4PTTB 4WTZG 5BO1L 4LOUD 2X10A 3L5XL 3DRQB 4YXLH 5CAYB 4IDJH 3MSPA 1CFSA 4GRWH 2XZQL 3WFHA 1QKZH 2NX5B 1YC7A 4FNLH 3ZTNL 4KUZH 4NQSA 1CXEA 3KPTA 2NY1B 1DLFH 4YHLL 3HRPA 2PCPB 2VLKE 3UTZA 4K8RH 3ARBB 1UM6H 5J57B 1CDIA 4PRPE 3P11H 9CGTA 1EA9C 3MRRB 1KPVA 1A4JB 1QBMH 4OV6F 1URLA 4PB9L 1K6QL 1RURH 5GJSL 5JLZB 3LOWA 3EYQC 1NFDF 4WW2F 4ZO8A 2ZOLB 2LU4A 1MFNA 3EYOA 4P57A 3GMNB 1U92A 2P5WD 2ADJA 2EDYA 2Q7YB 1FL5A 3MV8B 5HI5C 3NCMA 3RX8A 2O5YL 3QUZA 1A1NA 4P99A 1JPTH 2IQ9H 2YK1H 4WJ5B 4FP8L 1LEKB 4ONOA 1IT9L 3BQUA 2W9EL 1FO0L 2CXKA 2P7TA 3BP5B 2G75B 4DKFH 5I1HL 1MCWW 5IHLB 4M02A 1FSKB 1B2WL 4DKEH 4M6OL 2FX8L 3REWB 1I9IH 2GAZB 1DBML 3AROA 4OLZH 3MPCA 1RUMH 1R0AH 5DFVD 4L9DA 5DJ6B 3STLB 2E3VA 4O58L 3H9SE 3BMVA 3MJGX 1QR1B 5IBUG 1FYTB 1GGUA 5L88H 2E7LC 4YBQC 4QOKE 2IPUG 3V0AC 2Y36L 5EZOL 5IWLC 2Z31B 4ZTOL 4YPGB 3G9AB 4O5LL 3I3DA 3RWCB 5I18H 1ITBB 1X5JA 2IAMD 1N6UA 4KY1H 5FUCE 1T2QH 4YX2H 1A3LH 3V0WH 3DOSA 2P46B 1QA9B 1CDBA 4GG6B 1OQXA 1BVKA 3GB7B 4ZSOE 1E4XI 5F7NC 4MNHB 1T1XA 4CMMB 3R06B 3MACL 4Q2ZB 4KVNL 5FEBA 4AEIL 5IKCB 3LRSA 3SDDC 3VCLB 2OTWA 2QQLL 3UTTB 3MZGB 4RFNB 3LKOB 1BIIA 1MHCA 2NY6D 4HPYL 5DJAB 3GM0A 1NL0H 3QDGB 4PP2A 5HDLA 3VD5A 3S36X 1J0YA 1S78C 1IZKA 5IW1B 1P7QA 3KYNB 2VZ3A 1MWAB 4KRNA 5IBTH 1EHXA 4BZ1H 1HIML 5F1KC 3RU8H 3BGMB 4CJ1A 3ARFA 1I7UA 1RHFA 3CLEH 4KHXH 1WBZA 5I73B 4GBXD 3TN0B 5EIIA 1YN7A 2AJXH 3KPOB 5EOTB 4DKAA 2FX7H 4AZ8A 3AAZA 4FMFA 4XB7A 2F54E 1C1EL 1U6AH 5J12B 1X44A 2BZDA 1DBKL 4L4VB 3ZDZF 4QRQA 4Y4HA 5HDBE 3RGVB 4BZYA 5T5NG 1U8PB 4RDQG 1G0XA 4TNWF 2FNBA 4ZD3H 3EYUL 1MIEL 2GJZB 3VFNA 1L7IL 2AEPL 1RJZB 1FAIL 5ALCL 2BSTB 4TSBH 2CIKA 2FEDD 5DFTA 1FHGA 4NN5C 1QO3A 4P2QB 4FQLL 4KC3B 4GXUM 4OLEA 4EVNA 5E2TL 2EDFA 4M7LT 3UZVB 1J9CT 4MA3A 3CSPA 3BZDA 4JRXA 5EBMB 1M71B 5DT1H 5HJ3B 4NJ9L 3GMOB 2WAHA 2VDML 5GGSA 2QHRH 4BSWB 1H8OA 4DGIH 4XXDB 3TEUA 4KGLA 4UQ3A 4BQ9A 4YGVA 3QAZB 3ILQC 3FT2B 3B5GA 3U0PA 5AD0A 5KN5B 4HD9A 5DZLA 1VENA 3KPPA 4ZPVB 5JHDB 4UTAL 2V5MA 2IFFH 1NMBH 3O3DA 4FTVE 2I24N 2VO5A 4KDVA 4KJWC 5GHWH 5GSVA 2R0KH 2WBKA 4F15B 2CKBL 2MHAB 1XF3A 3I6GA 2NYYC 3OKOB 4EOWH 5DRZB 5F9JA 4XWGH 3VWJD 1F4WH 3TT1H 1G6RA 1LO4L 1TETH 5DRZA 4F57H 1MFDL 3MROA 1U8JB 4NQDE 3GSNL 3I6GB 5GQBA 2VN4A 4PRNB 4R4FL 5C07A 4NM8L 3Q3GA 3FB7A 4LRIA 3TJHC 2DTSA 3O3DB 4HF5H 3QEUA 4JJ5B 4L3CB 3C5JA 4OB5H 3QXAA 5F96L 5EPMA 2ARJB 4XAWL 4XP6L 2FBJH 4N1CA 4MD5B 2AABL 1MHPH 3DNKA 1FVCB 3F5WA 4IRJB 3FT2A 3DXAA 3U0PB 5ICZA 2BNUA 4QHUA 1WFOA 4RNRB 4UQ3B 4LLQB 4QRUA 5DWUL 1WICA 2AJYH 4J3WA 2AXHA 1P1ZA 5TDOB 4F9PC 1QBLH 4H8WC 5GGSB 2QQNH 3VGEA 2XWJB 3IU3B 3JVGA 4N5UA 5FO8A 3L5XH 2PXYC 4MA3B 2UZXB 2VL5B 3VDAA 3ULUF 3BKYH 4G6FD 43CAA 3CFBA 5TE4H 5DURD 4IBLT 1WTLA 4EI5A 5GISH 1PLGL 1TQCB 1CF8H 1OAKL 2BSTA 2NY6C 3NABH 1MCDA 4FQ2H 3TWCH 1OHQA 3DTXA 2X9YA 3L5JA 1VPOL 3AY4C 4PY8I 1S5IH 3G04A 5JR1L 1EXUA 2GJZA 4OGXH 3JV6B 1T7ZA 4E5XB 1Z0MA 3HC3H 1KULA 2NY7L 3AVEA 3MV8D 5IESL 4JN2A 1NC2D 2HTKC 4FFVD 3S8WA 4GW5A 3HE7C 3T3PE 4X7CC 4QRQB 3QQ3B 2AK1L 2XZAH 1J1OL 5ACMA 5J13B 1YMME 2D9CA 2J12B 5TDPB 3VFGL 4P2CG 4JPWH 2XA8L 3RJQB 1IAIL 2WZPD 3RDTC 1EEYB 1U8KB 4RAUA 2HWZL 4FQHB 1JPTL 3AAZB 3DPBA 3HFMH 1HKLL 2BRRH 4IOFC 4X6CE 5F7WC 2VXTH 3A6BH 4KKBD 3IFNH 3VG9B 5DYOA 3VFSB 4YBHA 1AGFB 1ODAA 4OD2B 4WFEE 4HC1H 5KSBB 4QO1A 1WBZB 3C9NB 4XCEB 3BGMA 1WCQA 1TITA 4WHDA 4UT7L 4FTVA 4PGCB 3GBMH 1MWAA 2A6IA 3KYNA 4C58B 3K4DA 1DBMH 4KMLB 1JV5B 4DCQA 1KCSL 4PP2B 3ILPA 3U4AA 5TPWH 4JKMA 4ESKA 5T1MB 1QFHA 2LU7A 3SJVD 1D5IL 3SE4C 5CBEB 2P43B 3NBNA 4NOBA 5H2BA 1A6UL 3UTTA 3HZKB 3MV9D 5DHVH 3VCLA 3ROLA 4H26A 1U8IB 4HEPG 2C3VA 3OG4B 4UBDC 2ENSA 1T1XB 4CMMA 1TQBC 2XXCB 1PW3A 3T4AA 1QA9A 1R5IB 2HKHH 3C87A 1RJYA 5D5MF 2IANB 3KPSB 4HUUB 3PHQB 3TN0C 4XAKD 1W72L 4HHAA 2YRLA 1A7PL 2VR4A 4FHBD 4WTWA 4OFKA 1MLCA 4TOYL 3PP4L 4I0PD 4OV5B 5LGHH 2H41A 4OT1L 4P2RE 5DTFB 2VZTA 1M7XA 4NZRL 3CVIH 4HUVB 4EBQL 4P2QE 1AD0A 4UU9B 4YDVA 3X12B 1ZT7A 1E6JL 5GGVY 4WUUD 4NP4L 1AJ7H 1NL0L 3STLA 1NFIA 1DLHB 3DJ9A 1U41A 4U1SB 2VZ1A 1GVIA 5DVKA 1IGML 5I1EL 4YC2C 4JPKH 1Q38A 4LCWE 3MCKB 4PRIA 5JA9A 2XKSA 5DR5H 4BK5A 1JWSA 3P4NA 4ODUB 4YHPA 2EYSA 3ES6A 2P7TB 1G6RL 4YH6A 3OF6D 2AQ3A 5GGQH 4WJ5A 4MLIA 1KTRL 3WIIH 5IQ7L 2BY2A 1U6AL 5HDOA 3MV8A 1FL5B 4OCNC 3GGWB 3K8KA 3W11C 3WS3A 2Q7YA 2ADJB 3P77A 5EZIL 4A6YH 4P57B 5I73C 3VDBA 3QPQD 1NBVH 3EYOB 5F72S 4L4JA 3R1GL 1A4JA 1MIEH 4XC1L 3VGAC 5E2JA 3DROB 1N7ML 4QHMB 3SCMC 1S9WB 4X7SL 1EVTC 1I8MB 3ZO0A 5MHSE 1IAIM 1F8TL 1WK0A 2NX5A 3N85L 5TF1L 3O11A 1D5XB 1IFHL 3CDFA 3TBWA 3LS4H 1JYWA 5EO9B 4B7IA 2BDNH 4N0UA 4U1MB 3BN9C 4NJ9H 4GG6E 2ZKHL 3OR6A 2K3TA 4W68A 1CDJA 4YXLL 1O5DT 4IDJL 5D2LB 3KPNA 2Q86A 5AEAA 4IMKA 4H25A 3ZTNH 2ZUQC 2AJSL 1DVFC 1KEGH 3GSNB 1K8IA 4X98B 2VLJB 3RVUD 4UTBH 2IFFL 2EYTA 1JMXA 1AQKL 4YDIL 4KZDL 4TUOB 1YECL 2R0KL 4OZ4B 4PLJD 5IJVA 2VDLH 1KJVA 2HLAB 1HSBA 4YR6A 3GHEH 5JXEA 1TCRB 1U8HA 2OYPA 4Z95H 2NY2B 1RZFH 4QY8A 3CH1B 2ZCHL 1YEKL 4W4NA 3PWJA 4NM8H 5HHOD 2YD2A 1M05B 1YNLH 3SGDI 4Y16B 2XWBA 3BZFB 1BX2B 3NA4A 3MNVA 2JK5B 2GHWB 5LAXA 1FNSL 3EOBA 3OKEB 2I07B 2FX8H 1RUAH 4CBPA 5BVPH 5CFHA 1ZGLM 1HINL 5DJ8A 4MJ6A 5C0EB 4I3RL 1BVLA 3VJ6A 5D96C 2QQKL 3BPOC 3IDNB 5CEXB 3SDDD 5DSCA 5B39G 4NRXA 4G8GB 1PX3A 2PO6B 5C0BB 4O58H 1JK8A 2R2BA 2R23B 1NDGB 2VZOA 2AJYL 4X7EC 4AQOA 4QXUL 3OGCB 4JLRB 4NM4H 3NA9H 3CVHH 2VWEE 4HGWB 4WUKL 1G84A 4OLVH 3ARSA 5A16A 1FZJA 1HHIB 1FNEA 4KPHL 5HGHA 1BZ9A 1QSED 5D7JB 3BIKA 3L95B 4GBXC 4CU7A 3GJFB 4N8VB 1QRNA 1OAKH 1OAYL 1CE6A 4BFGA 4R7DA 3U7YH 4JQVC 3SO3B 4P2RB 4M6NL 4X7FC 3IJYB 2HFFA 3MACH 5D1ZC 2X09A 1FN4A 5IG7A 2DJ4A 1RULH 4NQEE 1EHAA 5IFHH 1ZHLB 4QT5A 4M9PA 2F54D 1IC7H 2MPAH 1CIUA 3SBWC 2PYFB 4RISH 3DVGB 5CEYA 4LP5A 1VCAA 2R0WH 4J3UA 5DLMH 2EXYD 1J1OH 1CXFA 3U4BL 5FYKH 4ZTPL 5D7LD 5D5ME 2QR0A 1Q0YL 2V2XA 3F6IA 4UT9H 3HB3C 3HMXL 2WNGA 4FQQA 4PLOB 4QRSA 1WFNA 1EJOH 1NC4A 1GJIA 3QPQC 4OBRA 4LF3A 1D6EA 1WLHA 3EYFB 4C59B 4G80A 1NEZG 3KVQA 5BW7A 3CPLA 3O9WA 4R90L 5HGBB 4N9OB 4QF1A 4XPTL 3REVA 2HMID 1A8JH 2O61B 1MCOH 1RZIA 1CU4H 3FOMB 1IM3B 2HFEB 2WINB 2HP4A 4XPBH 5ANMB 1S5HA 3G5ZB 4OD1L 3EJZD 4P2OD 3MYJA 3PABB 5ACZA 4U1LB 5CJOL 4ENEC 2BX5A 4NNXA 4W70A 2H6PB 3DARA 3GKWL 1Q9WB 4NQCD 2D7OA 4I0PB 3QXUA 4LCYA 1NEUA 4UUJB 3LKSA 1JZ5A 1W72H 4FQLH 4DUXA 4UOW0 5C0BE 5JXEC 3FAXA 1CBVL 4HWBL 1SEBB 5C0AA 4ELMF 1AR1C 2EC9T 2DQJL 3KLHD 3DSFH 3LN4B 3SDAC 4YO0A 5B4MD 3CCHB 5K33A 1Q72L 4QRRB 5EIQA 1T0NA 2GJ6B 1VFBA 1U58B 3BVNB 1S9VB 4UDTB 4PGJA 4PJHB 3QT2A 4K9EC 3KYOB 5EG6C 4IEFB 4ONFL 2FGWH 4YHNB 3CFJA 2IALB 4BYHA 3SDXA 3QR2A 3E8UH 1L6XA 3VFOA 3EDDA 4EDWH 3HNSL 2XTJB 4OGZA 3TA3A 1CL7L 4L1DA 5FGSA 3QNXA 4M48L 2PUQT 4IIQC 2B2XL 4NHUA 1JFQH 1MY5A 1NCBL 2I9LA 1M7DB 5DMGC 4U3HA 5F7LB 2HJKA 3MUGA 3QUYB 2V5YA 3HS0A 3RIFF 4FQ1L 3D1MC 1IC4L 2P8LB 4JO1H 2C7UB 4NBXB 2AI0H 2W1NA 5DMKA 4JAMA 4Y4FB 2OK0H 3GSNH 2DQGL 5MI0C 4KKLD 3U4EA 1NFKA 1CQYA 2VKWA 1FBIH 4JFZH 1NMAL 4P5TD 5GZOC 3U9UB 1IAOA 4OKDA 2YC1B 2ZCLH 3B6SB 1LEGA 4QRPD 3OKKB 3EHBC 3IF1A 1I1AB 3C6LC 4EI5D 3N1GC 5F96H 4KVCH 4L4TE 5L8KB 3VXMB 2MNUA 3VXSD 5HBBA 4K3HA 4WV1B 4X6CF 4W6XB 3ETBF 4Z6AT 5JPMB 3QIWC 4Y2DB 5KAQG 4JQXA 4KGJA 3B6SA 4FFVC 4YHZL 1QHPA 1IAOB 2IADB 3D85B 5C0CB 1FFPA 4OIBA 3QA3A 3FFCA 3MV7A 1KNOB 2VDPH 4MAUL 4Y4FA 5IHZA 4HZAA 2P8LA 2AXJA 4F37K 1CYGA 2DYPD 5CKAA 4PGBA 2UWEE 3ARDB 1C5CH 3Q48A 2OL3A 4G3YL 2FZ3A 2GUOA 3D2UD 1XGRB 2WQRA 4HV8A 5DQ9B 4LGPB 5C9JB 1X7QB 4MAYD 1YECH 4G8EA 3VFOB 4KK5C 5IESH 4OJFH 2E9JA 5BV7H 2IALA 1EUUA 4YHNA 4HIHB 3DSNA 2JCCE 3O4LB 3TVMD 4PJHA 2DM3A 2VISA 3IDMB 2G2RA 5CHNB 3D9AL 1HK6A 1S9VA 4HJ0D 4ZO7A 4NO5B 1IT9H 4QTHA 3GIVA 1JNLL 1QQDB 1HKLH 3AU1A 1TVDA 4X5XB 1XGTA 4HT1L 4PLKC 4XTRC 3BPCB 4Z7NE 2J6EH 3O3BB 5IB3B 3BW9A 5BVJA 3C8DA 4EJ1C 4YDJA 4GKNA 4YZFE 1FNLA 1FNSH 4F33B 4J8RA 4LPWA 1CICB 3F6LA 1PKOA 1S9KC 2DQIH 3K8LA 4LCYB 1M4KA 4I0PA 1YC8A 4NNXB 3TIDB 1KCSH 1KIRA 5HI4D 1CXHA 3ARBD 4R8WH 3O8XC 3KPSE 4RZCA 5HTSA 2BY1A 1JZ3A 1I9RL 3LN5B 4FS0A 1F11A 1ZHKB 4U2YA 3RWDB 2AJVH 4PJAE 1GHFH 4HW6A 2WWMD 1P6FA 1E4WH 2WINA 2BCKA 4DAGL 3K3QA 4GMSL 2QLVB 1JPSL 1VGEH 3FOMA 4RIRB 4KPHH 4Y7MA 3V0WL 3OXRA 4YLQT 4EQ2A 4RIRA 3Q5OA 2ZUXA 4QHNB 3PP4H 1U95B 3I84A 5LGHL 3AGVA 4W4OA 3SY0B 1F11B 1ZHKA 3MLSH 3KG5A 1L6ZA 1XIWA 5D9SA 3GEWB 5DQDL 5F6IC 4BJLA 4NZRH 5T5FH 3UPRA 2JIXB 4LVHB 4XMPH 4HWEL 3VH8A 4JHBA 1OT1A 1T66D 2V2XB 3VD7A 2FWOB 4M6AA 3C5SA 3TIDA 2CJUH 4Q0XL 5B3JF 5AZ2L 2XY1A 4GS7B 3BPLC 4FZEH 4KH2A 1J11A 1IGMH 3UYPA 5I1EH 5FYKL 4J8RB 2PYFA 1NCCH 4XP5H 1Q0YH 4YEEA 3TCXA 2A2QT 4YDJB 1EPFA 3BPCA 1QQDA 1ES0B 4NO5A 4QTHB 4NCC1 1K5NB 1QRNB 2G2RB 5CHNA 5KOMC 3GJFA 1C1EH 2DN7A 4N8VA 4IS6A 4JKWA 4ZNEA 2FLRT 2BOBA 4HH8A 2XTJE 4BA8A 2HFGL 5HGHB 2OTPA 3NZHH 3MO1A 1KFAL 3WNNA 1FZJB 1EX0A 2GSIA 1FZOB 2JLLA 1T1YA 1X7QA 4XPBL 3WXWH 1JZ6A 4HV8B 4HGWA 2R4RH 4JLRA 2OL3B 1XT5A 2XZZA 5JORB 1V3KA 4J23A 2HTLD 4OF7A 3S7GA 2EDXA 2R23A 4PGBB 4QRRE 3ULVH 5L8LB 2DLEA 4OCRL 4RGOL 1U36A 1J10A 3DMMD 3JTSA 4U3CA 3VJ6B 4HXAH 1IM9D 3PNWA 2I07A 2V5RA 1DUZB 1YPZA 3MNVB 3B3IA 2XWBB 1NGZA 1M05A 3RX7A 1A02N 2K7QA 4GRWE 1NLDH 5F7EL 2ZKHH 4DOHB 1MCNA 5TFSH 4QY8B 4XVUD 1YNTA 4GAYA 3G08B 3S35H 1TCRA 1L0QA 2CMRH 1U3HD 1BEYL 3IFPB 1GGYA 4JKPH 1UFUA 1KEGL 2XNAA 1P4IL 2AKRA 5CIPA 4CKVX 1KB9J 3P40A 4EDWL 4NCDA 1LEGB 3KPRE 4DKDC 3MJ6A 3U9UA 4NZUH 3QUYD 2CO6B 5HVHC 2I26N 1KF9B 4F8QA 1FORH 3BDXA 4OZGE 2CK2A 2J1KA 3I6KB 3LKPA 5DMKB 2BVOB 4H25B 4YJZL 1MCLA 1ZA6A 2HJKB 3OZ9H 1M7DA 3CGTA 1CFVL 1P2CB 4L3EB 5DUMH 3CDYA 3OR6B 1HHGB 1MIML 4E41D 5HYIA 1YNLL 3LPGA 3RWJB 5EO9A 4M6OH 2W65A 4KKAC 3TBWB 3SGKA 2AEQH 4ZO9A 1OAUL 4G7VL 4YHOH 3DX7A 5LG1A 1WAAE 1JGLH 3SDXB 2EIBA 3CFCL 1JL8A 1R0AL 4GXVH 4G9FA 2H9GA 1UCTA 3IDXL 3KYOA 4Y4HC 1NANH 3SGJC 1JPFB 2EEAA 4TUKL 4UDTA 2DI9A 3H6JA 3FAWA 3BVNA 5L88L 4QHMA 4K7PH 3QCUL 3C09C 4YO0B 4AG4L 3CVHL 4WUKH 4YBLC 4MXQD 5HDQH 4Z5RA 3NH7L 1BZQK 2DWEB 3WXVH 4RMUA 1T2JA 1Q9LA 3NIDF 3PL6A 3VW3L 4AMKH 3VI4E 3MRBA 3WS3B 1GGBH 5E8DL 1NC2B 1Q9WA 2H6PA 4HMDA 3HLAA 1A47A 2DQHL 5TE7L 4F8TA 4G8GE 3PABA 3DO7A 4OFDA 1G1YA 1QPXA 3G5ZA 1S5HB 3W0WD 2JIXD 3MLXL 3LDBB 5IT2H 3P4NB 4ODUA 4YHPB 1YPZE 4CAGA 5FFLA 4DVBB 4RISL 2HFEA 3PWPA 2XZAL 4YDLC 4U1SA 1CE1L 2AJZB 1DLHA 3VFGH 5L8JB 1IAIH 2EC8A 1MPAL 4JDZB 3REVB 3B9KD 5CJXC 3LSOA 4BZ1L 3RU8L 1F2XK 5KTEL 1DBAL 4WFGD 1TVHB 3WHXB 1D6EB 1OWRM 1CGYA 4LF3B 5EOCH 3PDGA 1EJOL 4P3DA 2DIJA 2EDJA 2XG4A 1FLTX 2VDKH 4OV5A 3ZT7A 3RVXC 2JF1A 1E6OL 4R90H 1MQ8A 2GK0A 2OI9C 1FGNL 5DHXB 3PHQA 3KLHC 2DQIL 3OHXB 1RJYB 3ECBA 2OXHA 1II4E 1H3PL 5ESVA 2IAMA 2C3VB 1ZHLA 3WFZA 2VR9A 1PAMA 2D4DA 1T04B 4MX7A 4X4MA 1FN4B 5H2BB 3IJYA 4P2RA 1DQQA 4R7DB 5GRUL 2E27H 1GHFL 4WFHE 5T1MA 3WJJC 3BHBB 1T6WA 1F42A 1UA6H 1JV5A 4DCQB 3L95A 1TFHA 3GKWH 1QLRA 5E00A 3QUZC 1LWRA 1BZ9B 4AY0A 2A6IB 4S1DC 1KEML 3MFGB 1WAAA 4PGCA 5IJKC 1IGCL 1UM5L 4L5FL 5A16B 4C4KO 3CX2A 3QBTB 4O4YL 3FMGH 2BVUA 4TNVF 4HEME 1AIFA 5DYOB 1OSZA 5FYJL 4E41A 2ZJSL 1NDGA 1U8KA 1OL0A 1EEYA 2YMXL 1RIVL 5C0BA 4KKLC 2P4AB 5TDPA 5DSCB 1TZIB 3IDNA 4HS6B 2RIKA 1N64L 1BVLB 1EFXD 1G7PB 4FZEL 4GW5B 4NNPL 4PRBB 5C0EA 2P8PB 3L6FA 5C09E 5DJ8B 4JN2B 4UTAH 1A21A 1UXSB 3EOBB 5LAXB 3U0TA 3RBSA 2COQA 4JKKA 5B3JE 5MEND 1EH9A 3EO0B 3LV3B 3GNMH 5GGQL 1EXUB 2FLBT 3CH1A 1N6VA 2CPCA 3DTXB 4KRPB 2VSDA 3ARGC 1U8HB 5F9WC 1F02I 4OIAA 1HSBB 4YR6B 1IC4H 2HLAA 5D1XB 5DUPL 43CAB 5IVXF 3VMNA 4B5EA 5DD0H 3NZHL 4U6YB 1I3GH 5IJVB 4OZ4A 5DEZA 2RQ8A 1NCTA 1FBIL 2BRQA 1A7BA 2EYTB 4EN3D 4YXKH 5TDOA 4DW2L 1P1ZB 4HF5L 1T20A 4PJ7F 1N7MH 3EO1A 3B83A 4LDEB 3I85A 1M1SA 4MD0B 4N0CC 4TVPD 4LLQA 1SYVB 4QRUB 1WZKA 2P5WE 4RX4A 1RI8A 4QHUB 5B22A 1F58H 2BNUB 3FQTA 4PRDA 1MHPL 7CGTA 2I5YL 1NSNH 4TULH 4MD5A 4K8RD 1CIDA 3MRFA 1B0GB 2C5DC 5HVHB 3BYYA 1U8OA 2CK0L 2Q86B 4G8GD 5EPMB 3HI6H 3C5JB 3KPNB 4UOW1 4L3CA 4JJ5A 1N3NB 1SHMA 3QO1A 1OARH 1ZTXL 4LNVA 2IH1B 3FB7B 3PJSA 4N0UB 4WWKC 3OX8B 3QQ4B 5F70A 4U1GC 2VDPL 1D5XA 4X4ME 1RFDH 3M1BA 1G6RB 2J4WL 2AK4D 1BOGA 5GISL 5MEPB 4RMVA 2JELH 3HZMB 5I15L 3OKOA 1XF3B 2ZPKL 1CGSL 1I8MA 5JR1H 3DROA 4UTBL 5GSVB 3LRGA 4G3YH 4PJAF 3SKUD 3EJYD 4WO4B 1V7NL 3RKDD 1PZUB 2NW3B 3VXUB 1J87A 1S3KH 5AD0B 1RQ5A 3P77B 4X6CB 5MERB 3GGWA 3GHEL 2NY5L 4KQ3H 3P9LB 2NY0B 1QNZH 2HWZH 1P84J 5J11B 4HZLA 4Q58C 1W8OA 4BSWA 4R0LB 1Q9KA 3GMOA 4JRWA 4HT1H 1NAMH 5HJ3A 3ES6B 2AEIT 1M71A 3MLYH 3V6OC 4GKZB 4JRXB 1A7RL 5I6XC 4UIKL 1RMFH 3RIAK 3MCKA 1PG7H 4FQIH 4OI8A 5C71A 1OOAA 2VH5H 2OJZH 1QOKA 3T0DA 2P45B 1MCRA 3CD4A 5A2IH 5GRWA 1RU9H 1L7TH 1WAAF 5DD5L 4YDVB 3X12A 5HYJE 1ZEAL 1I9EA 2X4OB 2OS7A 1TZGH 4H1LA 3JV4B 5DTFA 3QI9A 1X3DA 5HDQL 1MLCB 5CEZD 1NCAL 2D2OA 3KYKL 4HHAB 4L4VA 4HUUA 3FO1B 1JPGB 3KPSA 2IANA 1ITCA 5FYKD 1ACZA 3HNTH 4B53A 5ECJE 4ZUUB 4YDKH 3JWOC 3C6SB 2FO1A 5E24E 3EUUA 3VFUB 3MRDA 5EOTA 1LO5B 1U8IA 4XBPB 1WSST 4H26B 5HGDB 4NQDB 2Q7NA 4HX1B 1UKSA 1AGCB 3U36B 1I7UB 3ARFB 1E6JH 4NQED 3B9VA 4J3XA 1SBSL 4HFUL 2GQHA 5CBEA 3DV4B 5IW1A 5GS0H 1IMHC 3UROR 2CJUL 4Q0XH 4NC1C 4TVSa 5D7LB 3ZE0E 1NMCB 3GHBH 5EZJA 5DR5L 3C08L 4FTVB 5JW4M 1BIIB 4X6DE 3BPNC 1HZHH 2EDQA 3IS1X 1BM3L 1D6VL 2CH8A 4HX1A 5JHDE 2CKNA 4WTZA 2OTWB 4XX1E 3LRSB 1LO5A 3H9ZA 4XBPA 5HGDA 3MRDB 1MCQA 4CADA 5IKCA 1HYSD 4Q2ZA 5KVDH 4N0UE 2BXYA 3C6SA 3MZTA 4D8PB 4ZUUA 2V2TA 1S7SA 3CC5A 5C09D 4NC1E 3QSKB 4ZFGH 3ARXA 2PW2B 3BKCH 1Y18B 1VERA 5KSVB 3FJTA 3JV4A 5T5NF 3FFCD 3MV7D 1ZVHA 4H1LB 4QRTA 5GS1C 4KHTL 1LO2H 2R4RL 2QBWA 4S1SL 4XP9H 1UB6A 3VGFA 3FRUA 3FHQA 4NKMB 2GJ6D 4EI5B 2NXYC 3BI9X 3CFBB 2YWZA 4JM4L 1Z9LA 2GAZA 3QUYC 5A40E 5EBGA 2VL5A 1AFVL 2BDNL 3D39D 4GKZA 2WIMA 2VXQH 3CX5K 5FO8B 3BRDA 3ESVF 1JIBA 3LQAL 4R2GB 5E6IC 1DFBH 4P5TA 4HZLB 3D3VE 1GL4B 3F7PC 1CXKA 3UJIH 4N5ED 5C0RL 2YMXH 3P9LA 4Q6IC 2VLRD 5K59F 3DXAB 3F5WB 1FVCA 3QFJD 4IRJA 4ONFH 4X6CA 1KN4L 4OCWH 5D2LF 1N64H 1AXTL 1XGQB 1KC5H 4BSJA 3QXAB 4M1DH 2NW3A 3ARRA 2UZYB 4FQJL 4ELMB 2AP2A 3TFKC 2V17L 1JRHH 2EXWD 4EIZC 1EBPA 1AQKH 1UJ3B 1MJUL 4LBEA 4JFDB 4MAYB 1U8JA 3MROB 2B1AL 3VFRB 3HZMA 3C8KA 1BOGB 5F9JB 1N4XH 4OGYL 4XBEH 5HVFB 3QQ4A 4OLYL 4X5LA 3JWDL 4FQXC 2IBZX 4RGNE 1JI2A 4DTGL 2XICA 4PTTA 2ITDA 5HVGB 3QDGE 2IH1A 4HC1A 5JA8B 5F9WB 4BH7B 4YXKL 2LV4A 1N3NA 3GSUA 4GO6B 1U8OB 3KPPB 4ZPVA 3D85D 5I1JL 5JHDA 3MRFB 2QQKH 2QSCH 5I1GL 4GXVL 5GJTL 2I5YH 4PRDB 4JREB 1XF4A 3DUSA 3KHQA 2EDOA 3NCBB 4K71C 4ZSOB 5DMGD 4MD0A 4ZNCD 2WV3A 1EZVX 1K4DB 4LCCA 1G7IA 2IAMC 1T20B 4NM4L 5IEHB 4L8CB 3VXQB 1H5BC 3H9SB 4U05A 3DWTA 1P7KB 1XEDA 1MAJA 2R9HD 1DVFA 4EI6A 3IETA 1Y6KR 1X6NA 4JPVL 4JVPA 3Q0HA 4EVNB 1WWBX 1QO3B 4XI5D 3EKCA 1Q1JL 5D1XA 1T1ZB 5IVNA 1HNGA 1C5BH 1MJ7L 3QP3A 1EEUA 1CLCA 1ZLVK 1RJZA 5F88A 3G9VA 4R3SB 3VFNB 2FATL 1RULL 3TYFB 2Q8BH 3EO0A 3U83A 4CN4A 5CJXA 1UKQA 3MLXH 4ZFZA 3U0TB 5GGRB 3U82B 5I8KL 3S36H 1NGXB 2VE6A 1DQDL 1R3IL 4Y4HB 2Y06L 5FYKE 3ROOA 1I8IA 1TZIA 4HS6A 3VH8G 3TNNB 4NJAH 4XVJL 1C12A 2BNRD 5ACLA 4P3CL 3QHZL 5CD5C 5AYUL 3HMXH 3FCTB 1EHNA 1OSZB 4P2YA 3LIZL 3UC0L 1YN7B 3KPOA 3K7UA 5IBLC 3MJ9A 2Z8RA 1AIFB 2J6EL 3O4OB 1NAML 5CP3A 1UKTA 1FRGH 3OKNA 2VDKL 5I16A 3PV7A 3I50L 2W92A 3P0YL 1P7QB 3WV0A 5E00B 3NIDE 5FUCC 3VDCA 2PYED 5F1IA 4WHCA 3BHBA 3V9FA 4LCUA 3U46A 3LH2H 3ELAT 4TTGA 5DJAA 1F4XL 2NLJA 4HDIA 1H3PH 4L3EE 15C8L 5CJBA 5DD5H 4M5YH 2W9LA 1T04A 5EA0L 2VZVA 1JZ2A 3D2UB 2FX9H 3GM8A 5FKAB 5A2JH 4TQEH 5ESVB 3R06A 1JN6B 4MNHA 4DAGH 5C8JB 1NAKH 1MFEH 2VDOH 3KR3L 3OHXA 4Y19E 3ZTJH 1IJ9A 1D9KB 3BE1L 2VABA 4NKIH 1XR9A 3HAEB 1AD9B 4NQTA 1Y0LA 3SDCD 4YPGA 3UTSB 5F7MC 2BFVH 4IIQB 4GAGH 2IPKA 1KENH 3W81A 1UWGH 3C60C 5BV7C 4LSSH 1JP5A 3TBSA 1A6VL 5SX5K 5JO5B 1RD6A 3QHFH 5DJ6A 2AJZA 2VJXA 3QDMD 5KSBE 3ZKXC 4BH8B 3MOAL 3NFSH 3HNVH 1VESA 2WWMC 4DVBA 5D6DA 4XP5L 1JF5A 3REWA 1NKRA 4E41E 5CZVL 4DVRH 1FGVH 2LE9A 2G75A 2DM2A 1GGCH 3AMLA 2JB6B 4JFPA 3O0RH 5TQ2L 2EXYC 1LEKA 4PJXF 4Z7UB 4GRWB 1A1NB 4K55A 3HLAB 1BECA 3L7EB 4XNMB 5JIIA 4RAVB 1NC2A 3IYLW 4XRCA 3ZYOA 3GMNA 2H3NB 5I74C 3PL6B 1Q9LB 1IKNA 3O2DH 2F54A 1U8MA 5FV1L 5E99L 1QZ1A 2PYEE 1PSKH 2BJMH 2MQCA 3WXWL 5DC0A 2VDRH 1NMAH 4XT1C 2FSEA 3MRRA 1M7IA 3KYAA 4ZS7H 3RHWK 4NN7B 5E8PA 1L4IA 5T3ZL 4MB5A 2IBZY 2NPLX 4M43H 1CTNA 3OB0K 1QRND 5KVFH 2ORBL 4J6RL 3MR9A 1X5KA 5INCB 3ARBA 2UVEA 3HE7A 1JPFA 2PCPA 4KVCL 2YR3A 5CILL 2H9GB 1A3RL 4G9FB 4NQSB 1QACA 2VB5A 4K94L 3WFHB 2CK0H 1G7JA 1KGCE 1CFSB 5B8CC 2VOTA 5BQ7B 4MA1C 3UZEA 1ZSDB 2B5IC 1HHGA 4LGRB 5LKNA 4LU5H 4L3EA 1P2CA 1XR8B 4PRHD 4ONHA 4WWKA 4LVEA 4HJJL 2PXYA 1YPZF 3V6FA 4OCWL 3LKPB 3I6KA 3V52H 2X9XA 4N0FA 5ISZD 4WI6A 2NZ9D 2F15A 5HHOA 2X4QB 4KDTC 7FABH 4NSKA 3MJ7A 5D2LE 1IQWL 4FG6D 2QADB 1FORL 2YN3A 1TIUA 6CGTA 4EXPX 1WTGT 1FC1A 2AKRB 2DF3A 3G5VA 2XNAB 3NFPA 3IFPA 3WNPA 2XOTA 4RGNB 4PJAA 4V1DB 2ARJQ 2ZZUT 3BRGC 2X70B 3G08A 1A9EB 4Z7OF 4L3ED 4GAYB 4LRIC 4OGYH 3U7WH 1T80A 1UGNA 1JNLH 2I27N 2XFXA 4HIXL 4I18A 2IG2L 2EKJA 2EC9U 2AXGB 1NGZB 1UWXH 2F8OA 1K85A 1CVSC 4BQCA 2UYLA 3PNWB 1KTDB 1UYWL 4UIKH 2O26U 2O5ZL 2Z8WC 3JTSB 2QSCL 1KTLB 3MRJB 5HI3C 4OSUL 1CLZH 1FL6B 1NAMA 2GSGA 1VFAB 1HE7A 1CR9H 2F53D 4HWBA 5DJ0A 3HZYA 5JORA 2X4NA 4OQTL 4RSVA 1FL3A 5EC2B 3MTRA 2A6DA 1OM3H 3O2DA 1ED3A 2AJVL 1T1YB 4I0PC 4WFHD 2GSIB 3QNYA 3WXVL 2LVEA 4M4PA 1OAXH 1RZ8A 5F7YC 3MQIA 2BOBB 3G6DH 4X6BB 4QHLB 4I18C 1MCKA 4MJ5A 3KLSA 3A0OA 1B88A 2WUBH 4D9QD 4ZNEE 1N59B 1ES0A 3TO4D 3HC4L 4LPTA 4XMPL 4KTDH 1U91B 1IBGL 2ZSWB 3PWLA 3O2VH 2CXGA 1A7NL 4HUNB 2RCSH 3QB7C 1TJGL 1T2XA 4GRLD 2UUDK 3C5SB 2FWOA 3GHBL 1MREL 1Z3GH 4F7PA 5KTEH 3RFZC 4N0YL 3GSOA 3QIBD 4YIQA 3MRHB 1XIWB 1P7QD 4Z8FH 2UVFA 3RPIB 35C8L 5KVDL 3EYQD 3P9WB 4DFIA 1I1CA 4HJ0C 1L9MA 1Y6MR 2YPKA 2J6EA 3OXRB 4RQQB 1TDQA 2N1KA 3QH3B 1HQ4B 5D1XD 1T83C 4R96B 1I4FB 2WIIB 4JFFA 5B8CA 4V1DE 3FFCE 3MV7E 4JQXC 5D7SH 3BFOA 4L4TB 4LHJB 5AAMA 2X4UA 3X14A 2CLZA 4YHMH 5DK2B 3LEYL 3P0VH 2F19L 5D2NC 4PJIB 1SYSA 1KIRB 4QGTA 4POZC 2EDBA 2VZSA 1OP3K 1QD0A 2ICEB 4LQ1A 5IEKA 5GS2D 3RL1A 4O4YH 2BFVL 3BW9B 5BVJB 2A83A 4ODTH 1KENL 2XWTA 3VXRB 3Q5TA 3AREC 2CR3A 1CD9B 3BXNA 2GT9A 4KAQL 2ZJSH 8FABA 1UZ6E 1REIA 3S35L 3TBTB 5ENWB 1YYLH 2HH0L 5C0RH 4GG8B 1LEIB 2FL5A 4OKVB 2EYRA 1DL7L 4JKPL 3IJHB 2J88L 3WIHL 4H88L 3ZSSA 4I5BA 4G8EB 3FO9A 3DO3A 5C9JA 4FQJH 5DQ9A 2E7LA 2FJGB 1JNHB 2BSED 2GUOB 4D3CL 3ULUL 5EZLA 2W91A 2A38A 3EOTL 2CGRH 5EUOB 2HG5B 3V6ZA 3ULVE 3A67L 4G42B 4EEEA 1INDL 4MD4A 1DR9A 4Z7VE 1UEYA 4KV5F 1RZGB 2Y07H 1CFVH 4PJ7B 5IHZB 5D8JL 1CD0A 2H32B 4XBEL 1BQHG 1T7YA 2G60H 2X41A 5C0CA 1UCBL 5DC4B 2VLKB 3L1OL 1GZQA 4UNUA 3S34L 2AEQL 1IVLA 3MJ8A 4G7VH 4M43L 1BQSA 4NKDA 4YHOL 3UTOA 4ZAKC 4P9ML 4WV1A 4QTIH 1DANT 3L3DB 5ALBL 3U0WH 3CMOH 2N7AA 5CWSB 1WBXA 4TULL 3VXMA 1SVZA 3P73B 3BT2H 1I1AA 4C57C 1RUKH 5K9QG 2B1HL 3NCYP 1T21B 4P23A 2XIDA 2DICA 1TPXB 4JFFE 1GSMA 5HYEA 3U4EB 3VD9A 1DUYB 3L3KB 1YMHA 2NY2C 2LQRA 3IJSA 3VW3H 4UV4L 4WU5B 3O9WC 5IB4B 1U2CA 2FEDC 1G7MA 3VXUD 1AHWA 3HS0B 1NGPH 1U8NA 1BJ1H 3MUGB 3BWAB 1JCKA 2XQBL 2EEBA 4NHUB 5J7CC 1S7RA 1JHKL 5FUOL 4TTDD 3N50A 4GRLC 4OZIA 4KRMB 3QNXB 1BD2D 3TA3B 1MY7A 1QG3A 4FQPA 4NQEB 3TH3T 3QUML 5DC9B 4ZXBB 3ZHLA 3MLUH 1I1FB 4PRID 1CLYH 5GGTL 4QEGA 1FG9C 1MWAL 1ZS8B 3ALXA 4X4ZA 4YK4B 1JWMA 5I76A 4QRRA 3V7AG 3UXFA 1OWWA 1OAZH 4JVWA 3MLYL 5D1XC 1HH9A 2UZIL 1A7RH 2CUIA 4O00A 5C0AB 4YFLI 2WLYA 5IMLA 1EFQA 3ARWA 3W82A 2K7PA 5E2UL 4PJDA 3O41B 3P0YH 2HLFD 4M1GH 4Y5VB 1K6QH 5GGSY 5IVZB 3KJ6H 3RGHA 1L7TL 2BVQA 4ENED 3O6LH 4U1LA 2A73B 5FGBC 5ACZB 3WEXA 3BOVA 5DZNA 1A1MA 2YD7A 4M5YL 5IB5B 4JM2B 5D4QA 3EAKA 5ANMA 4JRXD 4WO4D 3X13A 4HULB 1OM3L 3ZKMC 3TGXA 3D0LA 3UTQB 5CGTA 4NQDD 4GG6F 3RY6C 1V7ML 4I2XE 3EBAA 1Z5LB 2CIIB 2B4CL 4HLZH 4QF1B 3V95A 1YNKH 2VDNH 1NH6A 4L5FH 3CPLB 1X5IA 4QHKI 5GRJL 3ZKND 3EYFA 4MNGE 4ZOAA 1CFQB 1JF1A 1UWGL 5ETUB 3G6AA 4U6VL 4U0QB 2PXYD 5CJ8A 1N0XH 1INQB 3VXNB 4G5ZH 1V3LA 4KUCD 1YYML 3G5XA 1AR2A 2P5WA 3DVGA 1QLFA 4UAOC 4UQ2A 4LK4A 5EBWA 4P46D 3H8NA 5CZVH 3BH9A 1HZHL 1H3GA 1UH4A 1A3LL 4DVRL 5D1QA 4HFWA 4Y4KA 5SWSD 5IG7B 5D5MA 3RIFK 1T7VA 2HFFB 1RK1B 3DGCR 1D9KC 3V5HA 3RAJH 4OZIE 1BF2A 4P5TC 2X4TA 4KROB 3BIKB 3HE7D 4ZPTB 5D7JA 1MCSA 5ISZE 1FYTE 1WIUA 2KQMA 2J5LB 3O6FD 5CP3H 3RUGA 3O2DL 3DBXB 4PJ9A 1R5WB 2VXSL 2OMBA 3E0GA 2YOCA 3V4VL 1PZ5B 1A1OB 3NZ8B 3T2OA 5I1DB 2B20A 5ICXA 3BDYL 4PJFA 4KHTH 2F8XC 2BOCA 5KVGL 3VGDA 4PRHE 2FIRT 3GSRB 4PPTA 2FR4B 1G1CA 2AGJL 1GXEA 5DQJA 5D7IB 4J6RH 3BISA 5CIPH 1JK8B 2R2BB 3P0VL 1WJ3A 3ZHKA 1A5FH 2PO6A 2AV1A 4G8GA 4NRXB 5EUOF 3GSVA 4X4YB 2XZCH 2F58H 1P4BH 3KPMB 5FAAA 4RBPH 5D7KE 1AFVH 5JQ6L 3R8QA 4YZFF 2JK5A 2VXQL 4ODWB 4WI5A 1BX2A 1NEZB 4Y16A 5DRWB 1PYWA 1HHJB 4HH9A 3PWJB 5I8EA 3MBXH 4DFHA 2XN9E 1GH7A 2GTWA 1OAQH 3MREB 2R1YB 4LLYB 4NRZB 3FT3A 1EAPB 5TDNA 5BRZA 4OTXL 2BNRA 2ID5A 4FFZH 3VFMA 4CW1A 3QUXA 4X8JB 4EUPH 3H7LA 4YUEH 2L7UA 3IKCA 1JNJA 4P59H 1K4CB 1WV7T 4CVZB 3ZE1F 1Q94A 4D3CH 3ULUH 5FV2A 4OFPA 4NWUH 3EOTH 4MQXD 3BSZH 2VLJA 3WD5H 5F89A 4MZ2A 2VXUH 4WCYL 3ISWA 1BJ1J 2QHRL 4AIOA 1F4AA 3E6FA 5EU6B 4M7KH 1QNZL 4QOKD 3OKDB 4UZGA 4KROC 5D2LA 4N5EC 5A3ID 2EKSA 4PP1D 1H3TA 3ILQD 4HIEA 2K9UA 4XPGH 1KOAA 3F7YA 4PUBL 2VN7A 3CFDA 2YD6A 4U1MA 5I66B 2D3VA 1I85C 4WGWB 4XCYB 1PG7L 3HUJA 4FQIL 3O11B 2AK4A 4X7DC 1GPOH 2IPTH 4D9LH 2OJZL 1CDYA 4XZUB 1HEZB 1HN1A 3TPUA 2EH8L 3CK0H 2D4FA 2YEZB 3W39B 1S9WA 5EOCJ 1FG2A 3UZQA 4X80H 4JM2D 4OQTH 5FIEA 3LKNB 3C5ZD 1PQZA 3C2AH 4LLWA 2D0FA 4NWTL 3U2SB 3BO8B 3FRPA 4PJFE 5E2WL 3SPVA 2BY0A 1OAXL 3GK8L 1LDSA 2EZ0D 4OZHA 5DXWA 5FUZH 4YE4L 2NY4D 3HNTL 1OD7A 4XNUH 4RMWA 1I1AC 5FO9A 2X5PA 4Z7OE 4HCRL 4HUXA 1IC5L 4BSVB 1C08B 5AZEL 3JZ7A 4NYLB 2ADGA 2R0LL 2EYSB 5GGTA 3MRPA 2EDHA 4U7KA 2CRYA 1JWSB 3IDIB 3FONB 3PWNB 1AKJD 4PRIB 5ILTH 1GCFA 3QUMH 1BGXL 4ZQKB 5CSGA 1J1XH 1SMOA 1G7LA 1WFTA 5C0BD 4HWNA 2VRAA 1NFIB 1YEEH 1RJCA 1S8DA 3ARUA 3IVKB 2OCFD 1CVRA 3IDYB 3AXLB 2L7JA 5D1QD 1MREH 2BNRE 3STBA 1MUJA 1ZT7B 3LIZH 1AD0B 1CK0H 4UU9A 1D6VH 1NCWL 4HUVA 5F7FA 1LP9B 3DUUB 3Q1SL 3QG7H 3MCLL 5ABDE 1RZJL 4JRXE 2AJUL 4NRYB 1GRWA 3HR6A 1DBJL 3I75A 4H0HB 4LRNH 3K0WA 5E5MB 1DDHB 4N8CL 1ZANH 4M1GL 4KDWA 2DBJA 4JFQA 2DLFH 1R5IA 3RP1A 3T4AB 1WZMA 3OAZH 1DE4B 1ACYH 5E8EB 2KBGA 15C8H 4IJ3C 3QZWA 2QKIA 2OI9B 3DMMC 3ROLB 3HZKA 2XA8H 5FM5O 3RUGF 4YC2B 4KK8C 1UG9A 1BMGA 4Y5XA 4XP4H 3R4DA 2Z31D 3WDIA 1B6UA 5TQ0L 3ILPB 1MFEL 2VDOL 3HKFA 2VAJA 3BE1H 1PEZA 4NKIL 3VE0B 4JM4H 4R97B 3DYOA 3ZKSD 1FPTH 2IH3B 4P2RD 3T3ME 2MJWA 4IMLB 1UENA 5EO0B 4Y89A 4XCEA 1KPRB 3C9NA 5GRJH 4QXGH 5KSBA 2R29H 1AGFA 1IGYA 4OD2A 3VFSA 5ID1A 1IGFL 1KV3A 4ODSH 3ARTA 4FQHA 4RAUB 3KDMA 2VLRA 2MCPH 1U0QA 3H42H 4G5ZL 1BPVA 1KN4H 3D6GA 4MQXC 3QQ3A 3QUXC 5FGCB 3ZDYE 3W2DH 2DQDH 5EUKA 2JCCF 1SJXA 5DJDA 3VXTA 5CZXD 1MRDL 2IF7A 4E5XA 5L2KB 2Y6SD 5GRVK 3MA9H 3JV6A 1CXIA 2V5SA 3OKYA 3PP3H 1U8QB 2Y5TA 1MJUH 3TVMA 3G04B 3UYOD 5A3IC 1A7QL 4Y16C 1DJSA 1H8NA 3RAJL 1HDMB 1V8HA 3PDDA 1INDH 2DJUA 1GYAA 4XVTH 1MFBH 5JQHC 1YZZA 4M9OA 4U1JA 1IEHA 1SJHB 3IFLL 2B7DT 3WKMH 2PO6C 3IU3A 2XWJA 5DHYB 1J88A 3HG1B 4CU8A 5K9KB 2E9BA 1N8ZB 5DGQA 3TCLA 4U6XA 4RNRA 5I1JH 3NCJH 3S3JA 3MLVL 5ALBH 4PJ9C 1JTOA 1GGTA 2UWEB 4HK3N 5ICZB 3PGDB 3SKOA 4K94H 4JVUA 1P4BL 2ARJA 4P2QD 4X99B 5ESQA 4K23L 3U30C 5EFIA 3MLZH 5IQ7H 4YFLF 3QEUB 4HG4K 3SKNA 4K2UH 3BGFB 3HPLA 1FNGA 3BKML 3ARDD 2NY6B 4P4KC 1TXKA 3Q3GB 4LU5L 4PRNA 5C07B 5HDBF 1AI1H 5LBSH 2R2HA 1MSPA 3NAAH 3VXSB 2ZOKA 4G9FD 4GKOA 5DD3L 1C5BL 2NY4B 1TTUA 2YA0A 3Q6GL 2D7TL 1JZ7A 5CLWA 1ERNA 1X5ZA 2VDQH 2Y5EA 4NBZB 3UJTH 4PV8B 3LMJH 2ZCKH 2MHAA 3ZYIA 4YUEL 5HYJD 1KJ2H 4BUGA 4DUWA 4U1HB 3NPZB 1XGUA 4ZYKB 3IS0X 1F8TH 2IFGA 3K4ZA 5D72L 4D9RD 1UACH 2BNQB 1LO3H 4OF8A 4P9HC 3E3QE 4MWFA 3VRIB 4OI7A 4PJEB 3T0VA 2NY1C 4NZTL 1NLBL 5A1AA 1QFWM 3LS4L 4B7LA 5GRZA 5EDXA 1S7XA 1DQDH 3UTTE 5KN5A 4PJCE 3RTQD 4XBGB 3EOYG 4JGMA 4YGVB 2G5BB 1QHOA 1CLYL 1AE6H 3ZKMD 3HAEG 4X0KA 1MI5D 3FTGA 4XXDA 4PGEB 5H37H 3AB0C 5GS0D 1Q0XH 1FRGL 5EBMA 5FOBA 1U93A 3LY6A 3PQYE 2NZ9C 2DWDA 4QLRA 3U9PH 1X5AA 5C86A 3DX8B 1I7ZA 1QLEH 5E6YA 1U3HA 4P2QA 2IPTL 1UEMA 4YDIH 4M61A 5F6HJ 1MRFL 4PJ5B 2CIKB 2VLLB 3TIEB 3KJ6L 1EEQA 2F53E 2Z0BA 5EWIH 2DKMA 1F4XH 3CK0L 3O6LL 5CP7B 3L9RA 1UC6A 5IVOA 1Z9SA 4MDJA 3V8CA 3LAFA 4DN4L 4PR5A 2IQ9L 2YK1L 1IKFH 2OXGA 4Z95L 3JUYA 4PJGF 1RZFL 2R1XA 2GJ6E 3BGFC 1U8PA 2HYMA 3RGVA 3MRNA 1V7MH 3TZVA 2R4SL 4MJID 1UWEH 5HHPA 1X4XA 5SWZE 2DYPB 4GAFB 3VFVB 3RVWC 3VA2C 5GSRA 5JW3L 3TNMB 4M8QA 3DGGB 5DRXA 1RUML 5AUMA 1ONQB 4P48A 1QSZA 2EIZB 1JGEB 2X9WA 4L9LB 2Q6WB 4I48A 3KXFA 3EW3B 5KS9F 2X40A 5EIIB 3TN0A 1U3YA 1VEPA 2GCYB 4P9HH 4Y5YA 1IBGH 3IRPX 3MGTB 4JHWL 2UY7A 5HPOA 3VRLF 3N0PB 4LLMB 1EFXA 1F90H 3NFSL 3QDGA 2DBLL 3FN0L 4UILL 1Z3GL 1J05B 3UDWC 1MHCB 1AH1A 1VACB 3LKOA 2FD6L 1A3QA 3D18B 4X9IA 5FYJD 5DJCA 1ROWA 3HHRB 4JQIL 5F9DC 1NCWH 4ORZC 3QWOB 4AEIH 3IDGB 3RWGA 4X6EA 1BVKB 3GB7A 4GG6A 4RFNC 1VEMA 3QEGH 3WMSA 5CCKL 3UTSE 1NCUA 3QZWG 1IC7L 2MPAL 3LKRB 3RWCA 2E6PA 1T6VN 2XTLA 5MENE 2Z31A 3MBEB 2R0WL 3V4VH 1EIBA 5DD6A 5I8CA 3OAUH 5IQ9B 3U4BH 3T65B 3DLQR 4LASL 4LLUB 3SKJL 3IAPA 3UX9B 3MV9B 1IAKB 5E4EB 3WN5B 1DEEA 1ZLUH 1EVUA 1FYTA 2FJHB 1QR1A 5E95B 1KCLA 2H8PA 2B5IB 5TQ0H 2YZ8A 1WUNT 3KPRB 3PIQB 3DVIA 5I8OH 1EHLH 3LD8B 3QYCA 4LFHD 1MCOL 3CXDH 3B9AA 1KCKA 1MCPH 4XNXH 3KYMA 3BP5A 2CKBA 5IV2A 5CKGA 3BQUB 5IGXH 5MI0B 2X1OA 2VQ1A 1A0QL 5F7KC 4NNYB 3DX9A 1OAQL 1KJ3L 3QUZB 5EO1B 4OCXH 1QYGH 4HJJH 2DAVA 1VA9A 4F2MB 2JB5L 3NN8B 5AAWA 1U92B 4WEMB 2VAAA 4L8SC 3RKDC 2J88H 3WIHH 5CJOH 2ZOLA 1X5YA 2RFXA 4Z7QF 5E8OB 4Z7VA 4JFOA 5SWZA 5JLZA 5KS9A 1LO0L 5KVMC 2BVYA 3FQWB 1ZVSA 1RZKL 1CGXA 1KPVB 7FABL 3PG2A 4GW1B 5K9OB 4RBPK 4I13B 3DUHA 6FABH 3ZDYF 3A67H 4HWBH 1TZHA 3UTZB 4N68A 4BK4A 4LOUC 1BFOA 4K9EH 4XX1G 4XVTL 2W0FB 3H7BB 4XP1L 3L3JA 3K74B 5IFJB 4YAQA 2R2EA 5BXFB 3VGHA 2X2YA 5IIEA 2VLKD 3DRQA 4PJGA 3EO9H 4J4PC 5T33L 2ARWA 2FGWL 2OJEA 4WU7A 3PV6A 4XPGL 3O8XB 1N5YL 4Y19A 4LLDA 2E7HA 2ITCB 4LDOB 5IF0B 5SWSE 3FO0H 1CL7H 1KG0B 4E0RB 1ND0A 1IGTB 1S7TA 1D5BB 4POYA 1T83A 4U1IB 2B2XH 2GIYA 2N7BA 4X5WA 5F93C 5EU4B 5L6YH 3FOLB 4JFXB 3WDHA 4YXHH 3FB6B 3HE6A 1LO4H 1TETL 4HQQL 3V4PH 3EDFA 3B2UD 4LEOB 1JYVA 4L8BB 3BP7B 2AEWA 1AI1L 4R4FH 4PJXB 2UV3A 3ZSTA 5GZOD 1WZ1L 4WWID 3CDGA 4YWGL 2YBRB 5B39A 4BZ2H 4LCCC 2NQCA 4LSUL 5DJXB 4U1NA 4OLWL 4PBXA 3V6OE 2QSTA 2ZCKL 4L8SB 4HCRH 3SGDH 1FJ1A 5IBLD 3G5YA 5CEZL 1EEZB 1NJ9B 3PWUA 1QBLL 2QQNL 5A43C 2X4SB 3O2WL 1XF2B 1SMAA 1A7NH 3VXOA 1XIWC 3QULB 5C0JB 2GTZA 2NW2B 3I2CH 4PYGA 1T4KA 4CMHB 1MWAH 4OZIF 1LGVA 1NFDB 4WW2B 4YFDB 3MRIB 5EC1B 4WVRA 1OTSD 1TQCC 2A6JB 3T0ED 3F65A 3QISA 1BZ7A 3TA3D 5FHAH 4C83B 5C0AD 3BJ91 1GZPB 4HIIA 2BHUA 2HT2D 1MVFA 4P5MB 2WK2A 1XMWA 4Y4FC 3U9PL 3LS5L 3QIUD 5JPNA 3EIFA 1FZKA 4G6KH 1KB5L 1CFNA 2X7LA 4CL7A 1I8LA 3QUMA 5BV7L 4I2XA 5J13C 4JB9H 3NIFE 3QXWA 5TGBA 1ADQA 4IRJC 4JPWL 2VMFA 1I9JL 1U8LB 2OMNA 3H3PL 5CMAA 4K7FB 2W0PA 3D9AH 3PE9A 3V2AR 1T5WB 1IKFL 4QOKA 2BRRL 5JDSA 3C6LA 2DKUA 3IFOB 1UXWB 1RIUL 5MEOA 2V2WA 2W0LA 3O6FA 2OBGA 5BO1H 3LPWA 1BQHA 4NHCH 1UT9A 3HA0A 4UT7H 5K93A 3LHPH 4QCIB 3SDDA 1BD2E 3P30L 3L3IB 1ZGLA 2XZQH 1YEGL 1HI6B 4KZEH 5I1LA 3W0WB 4XCNB 1YMMD 2J8OA 1WWAX 1R5VB 4RWHA 1ORSB 2CUMA 3MRLB 4IOIB 4G7YH 3LZFL 1EGJA 3FQNB 1N2RB 4WFFD 5E0QA 1EMTL 5D1ZD 4NQVB 4TPRH 1TQBB 2C1OA 3QG6B 5GJSH 5IP4A 1F90L 1KCRH 4H88H 4OZFA 3MRQB 3WJLC 2HKHL 3UBXB 1ZT4B 4P46B 3W2DL 1X5FA 2DQDL 4NO2A 1IKNC 3LQAC 1HYRC 2FD6H 5DHVB 4LNRB 3WIFB 4FQCL 1EJ6A 3MA9L 4LSTH 3TO4A 3RUGE 1K3IA 4AH2B 4IRZH 3ZKXB 1LHZA 4X6DA 2HJLA 1AY1L 4M00A 1X4YA 5F9OH 5GGVL 5C6TH 3MV01 3MV9E 1XF5A 4DKFL 5I1HH 3NACL 5SWQB 3MLWL 3WNKA 4U6HA 3UDWA 1W72A 5FO7A 2KUTA 3MODH 3QDHA 1GOHA 5MENB 2R15A 4YBLB 5FK9A 3D0VA 4JFEB 3B9KC 5HHNA 2Q3ZA 5IHUL 4OBSA 3ORJA 4JFFD 3OAUL 1CGTA 4KRPD 4OF3A 3S5LA 1NMCC 5CD3A 2I25N 5GGUA 4F7TA 5IR1A 5MHSD 4Y5YC 2AGJH 1J8HE 2QL1A 1BAFH 5E1AA 1HOCA 3CX5J 2IBGA 3X11A 3U0WL 4N9GA 3WL9A 4MCYB 1MI5E 4DGVH 3Q6FA 1XGPB 3WIIL 1R3LA 2C4FU 3MRKA 3MLRL 4JG1H 5HHXH 4EN3B 1ZHNB 4KY1L 3STZB 5K9JH 1C16A 5D71H 5LGJB 3TO2B 5JOPE 4NUJB 3BKMH 3MNWA 3PQYD 4NFDA 3ZTJG 3L3GA 4LAQL 4AIXA 2XACC 2AXFB 2J8UA 1NBZA 2IWGA 3C5ZB 1SEQH 4OLUL 3NAAL 2BVPB 4NT6A 1M6OA 4FQXB 2NTSP 3L5WA 4DGYH 4XNZB 3D3VA 4FFZL 3WKNA 4P59L 5DJ2B 1ETZB 5BCAA 4NN5B 2EICA 1IARB 3LVEA 2IQAB 2Y7QB 4QWWC 1LO0H 4LARL 2CSPA 3RWEA 2VWEC 1BD2A 4NWUL 4J1UB 1D7FA 1V3JA 1TLKA 4KQ4H 3C60A 1LD9A 4XPAL 2C4FT 1IGJA 2OR8A 2DD8H 1ZGLP 5GRVL 4HKZA 5IUSA 2AJXL 2CDFA 5I9QC 5IBUB 4XMLH 1NBYA 1J0KA 1G7QA 4XP1H 2AV7B 2WBJB 5C0GA 4JQVA 4P4KB 5T3XL 1BVZA 2X4PA 3FQUB 4WUUA 2EDWA 5J12C 1DBKH 5T33H 4M7LL 2XV6B 5J89A 3SDXF 4RGNC 5EU7C 2J3SA 1EO5A 1N5YH 1P4IH 3DRTB 4KKNA 5IM7B 3GSWA 4QRPB 2PF6A 3FO0L 2XY2A 4Z0XB 4Y1AA 3VGAB 1GPOL 4KZDH 3FQXB 2PETA 1L7IH 4LKCB 4MXVE 4U1KB 2PW1A 3EZ8A 4XNYH 4XHJC 3T0EE 5JIKA 5KSAB 3WNMA 4O9HL 2OQJB 4U7SA 3IDYC 1JZ4A 5KJRH 5D7JC 2P44B 2FECL 3OG6B 5FKPB 1S9XB 4G43A 3S3SA 1AGBA 4JY6A 4LGSB 5E94A 4F7MB 1LP9F 4JDVB 1AGEA 3VRJB 5CBAA 3QIWD 3V5DB 2VDMH 5HY9B 5JW5B 3BZEA 4HCRA 4Y4KC 5HSFA 2HN7B 1J8HA 4IHOB 5B38A 4XGZA 2A0LC 1JGLL 5KW9L 4PRAA 1MJ8L 3IDXH 2I9TA 5HGAB 1DSFL 3LRHA 5KANI 4KI5D 4OF0A 1AKJB 4JY4A 2HVKB 5C08A 4JHWH 2XKUA 2KQNA 5D1ZB 1R6VA 2D03L 3TLRA 3BD4A 4ZS6C 5C09B 3VG0H 5DJZB 4S2SA 1R3HB 4HS3B 4NQXA 4JR9H 3S96A 1YMMA 5LVEA 5E8DH 3RKPA 3ULVD 4PG9B 3SKMB 4EDXA 5FHAL 1MLBA 3U7YL 1P4LB 3TBYB 5FYLH 1ZAGA 5J56B 1ZV5A 1YEJL 2YD5A 4KI1A 4AL8H 3KNBB 2WWKT 3E2HC 5IMOA 3KWWA 1KB5H 1G7HB 2XG5A 5J6GA 5F3BA 4JB9L 5J06A 2AABH 4R6UA 4AK1A 4OFYD 4ZTPH 2NZIA 2OR7A 3OPZL 4YFEA 3MGOA 3AS1A 3LEVH 5INDA 1TCMA 4BELD 2XQYG 4KMTL 1PKQB 2CLVA 5E6IA 1N26A 2F58L 3MGAA 4ISVA 4WEBH 1KBGH 5HVWA 1FFRA 3NPSC 3P30H 3RVXD 5FGCE 3BKYL 4Z77B 3FQRA 4URTB 2NTFB 4KZEL 2ICES 4I3SL 3CFEB 3T0EA 2APVA 1LMKA 1ZT1A 2ATPA 4FQ2L 1IGFH 4KK9C 4ODSL 3TWCL 4PJ8B 3CH8A 4NFBA 1IEAB 5FM5M 5IGXL 3FO2B 4UMGA 4IRSA 4G7YL 3GFUA 4JFDD 1YEHH 3C8HA 4GRLA 2VZUA 3A6OA 3LEXB 2JB5H 5HYQB 4QXTB 2A77H 5D70H 3LDBC 4PLJC 4YHIB 2C3XA 2E27L 2JJVA 1S7QA 4XH2B 4GMTL 2F5BL 1F3JB 4JANB 1CZ8H 3RRQA 1AO7A 3WN5C 4LSVL 1JMZA 4LCWA 4HKBA 1WC7B 5C0FB 3EGSB 3DECA 3KJ4C 1VADB 1KCUH 3QPXL 2OTUB 3T2NH 3LD8C 3FMGL 1L9NA 4LAJH 3C6LD 1N5AA 5I6XB 2DLHA 4HC1L 3BKJH 3ZL4L 4ALAH 5M94B 2FH6A 2AVGA 1FZMA 2ZP0T 1MAKA 3SQBA 5KAQF 3GUTA 1E27A 3MV8E 3OKLA 4XHQA 5IHUH 1HQRA 1Z9MA 3K1DA 3O6ML 5TH2B 4ZODA 4PUBH 1DQLL 5TPWL 5D93C 2PYEA 3GMQB 1YUHA 3H9SD 4M5ZH 4ZAKA 4M3KB 4NOFA 3DXAD 1G9NC 1O7VA 5DJYA 3S35X 2YPVL 4PRPB 3X17A 3O9WD 1MVUB 4PJGE 4MNGA 2VC2L 4U4BA 1W2KT 4M7ZB 2Z35A 3D39B 4LSQL 4JG1L 5HHXL 4JO1L 5L6YL 4NO3B 2IMMA 4MCZA 3KLAA 4GH7B 3U6RA 3PL6C 1F3RB 3VWKC 1EAJA 2BMKB 1JI1A 43C9B 4YNYB 3K8MA 1WGOA 3FB8B 3KAAA 4LAQH 5C3TA 2ESVB 3UJJH 2G5RA 3HMWH 2YPLE 1CFTA 1DCLA 3RWIB 1LDPL 4OZGF 4DW2H 5GS1B 1QEWA 3CFIC 4FXGA 3CSBA 2D7TH 3KHOA 3G6JE 5C6WH 3NIFF 3WJLA 4MGXA 4NPYB 4JDTL 3V0VA 1A9BB 1I3UA 1G9NH 4Z7WE 3QXVA 2ZUTA 5AZEH 3QRFM 1KCVL 3QJFA 1LK3L 5FDWA 1QFUH 4LHUG 1F6LL 1BLNB 3WIHA 2XN9D 3PGFL 1VSCA 1T5XB 4BFIB 3MLTA 4HLJA 4CJ0A 4GKSB 2OZ4A 3V6OA 2APWA 4AEHH 4HKXB 3CAFA 3IDJA 1SM3L 4HUKB 4PTUA 1A6AB 4PRHA 2HMIC 2QQQA 4BQ6A 3CLFH 2JELL 1H15B 1NGQL 1NGWB 4A6YL 3HZVB 3S37H 2F53A 2PN5A 4MJ2A 2YSSB 3D87B 3MCLH 3QCVH 1CWVA 1CGSH 4ELKB 1KLUB 5CLTA 3RA7L 1TJHL 4N8CH 3R1GH 1QLEL 5JW4R 3PDOA 2DKSA 3FKUS 5I1IL 2NX5D 4PB9H 5I2IA 4Z7WB 2ZSVB 1RURL 1MOEA 4HPOH 4H8WL 3S88L 4RDQF 3RZCB 3WFBL 2Z91A 2XN9A 1GOFA 4GT7A 1FFNA 1Q9OB 4DN4H 4WHTA 4O2CB 3TJHD 3QNZB 4O2EA 4P4RA 2BC4A 2DQUL 4D0CA 4FABH 3TBVA 4TNWK 4CDGC 4N1EA 1EO8L 4Y2OA 1ZA3B 3O3AB 5ESAB 3VI3F 2OR9H 4WY7H 1JWUB 3ARED 5JMRA 2ICWB 3QDMB 3CSYA 4O51B 1JE6A 1YEGH 4BKLB 4X9HA 5KW9H 1MCWM 5BS0A 1GIGH 1HHKA 1QRNE 1UM6L 1U42A 2V5TA 2RR3A 4OAWB 4AENA 4Z7QE 1QFWH 2DI8A 2VITA 1CDUA 1P69B 1TJIL 3VGGA 3L3HB 3R8BB 1TZGL 3D69B 4ZDHA 1A6ZB 3OJ2C 3SDCB 4N8PA 2KZWA 5FHBH 3AY4A 3FN0H 4LVHC 2VDLL 1KCRL 2YPLA 3QWRA 3ARGB 3SCMD 4UDUA 4C4KT 1MRDH 4M62H 4TVPL 3QDJA 3EOAA 3EYSH 5DS8A 1J7VR 3KXFD 4FP8H 4EKXA 3FN3A 2W59A 2Z4QA 4TN9A 1WBYA 5GGVH 3HPJB 5FYLL 5ID0B 5D1QC 1KJMA 4CVUA 2FJFA 1VKXB 1LNUB 3MRCB 5DUBA 5CCKH 4MJIB 5T3XE 3ZHDA 4M3JA 4RRPG 5ITBH 1T3FA 3CUPA 4GUPB 3GSQB 2V7NB 4FXKB 2NXZB 1CGWA 4ZFFA 4Q6IB 4RWYL 1K2DB 3F7QA 2HT4C 3SE8L 5J1SC 1A6WH 3QJHA 2CUHA 4KKBC 5IBTL 4FZ8L 4WNQA 1TENA 1HIMH 1JHLL 4XXCA 1I7TB 2D0GA 4L8DB 3WHE0 5KSUB 1BM3H 3BEWA 3NA9L 4KMTH 4PRPD 5KANG 5T1DL 3TYGL 1EHLL 1UVQB 4OZFH 1KBGL 1KPUA 4K23H 3F12A 4PJCA 1T2QL 1KIPB 4OZFG 4PD4J 4YX2L 3UTPE 2IMNA 5EU5A 1PKQE 5D71L 4N8VG 1I3VA 5TJWK 2CQVA 2ESVD 4RFEB 3RDTB 3QUZD 5DRNB 4JRYE 4OIIH 5IMKB 5JNYB 1QYGL 3RNQB 3KPLB 1R3JB 4KDTA 3ALWA 3BN3B 3B9KB 1S9YA 3Q6GH 2Y25A 3PQYA 2AEPH 4S1SH 4XP9L 1MJJB 4RGND 4HS8L 2C1PA 3QQNA 4JZOB 2SEBB 3QDAA 3AB0B 2BSRB 2WLZA 4HIJA 4TSBL 3FFDA 5T1LA 2CDGA 3SQOH 3JTTA 5F1NA 3OXSA 4ODXB 3VFTA 3DIFB 5HI3D 3IB4A 3VXPB 4A6YB 1LE9B 1KCUL 3HI1A 3OB0H 3QPXH 4HK0B 5EORH 1JNNH 1MEXL 3CXHK 1NLDL 1CGVA 1FIGH 1ZHBB 4J3VA 2XA3A 2IEPA 4D9QE 4Z78A 3ALPA 1D5MA 1CTOA 3QFDA 2B4CC 1RPQA 5BZWB 4AIZA 4LVOC 1OGAA 1U3ZA 4WDIA 3ARBC 2P5EA 3VI4F 4PJBB 2P24A 1ADQL 2Q76B 4V1DD 4MXQC 1JRHL 5JDJA 4F58H 1MRFH 4NUGH 3QIUB 2XT1B 4MNQB 3H9HA 3MFFA 4KK5D 3ARYA 2F5AH 5FB8B 5C92A 5HYSB 2VC2H 2X4RA 2KKQA 1J0JA 1AHWC 4LSQH 4O9HH 2ADFL 4HWZA 4YXHL 4XWGL 1RY7B 3M07A 3RVVD 3MNZA 5FCUL 1KUMA 3BZ4A 1BFSA 1BBJB 5IVXE 2VLRE 3FL7A 4PY7A 1HXMB 1UB5A 2E8ZA 2ICWJ 5SX5H 5DT1L 3UJJL 5KZCB 1E28B 4I77L 2FO4B 1TNMA 2FH8A 2XKNA 1S7WB 1HXYA 3HB3D 5EU3B 5FA4A 1SJEA 5I1CL 3BH8A 4XB8A 2PTTA 3QIWA 3HCVB 1ZVYA 3VWKB 1FH5L 1CT8A 3OKMA 2HRPL 3BUYB 1G9NL 1JUFB 1XCQB 3BUYA 3OB8A 4APQC 5DK0A 2ED9A 1CT8B 1A6TA 1W8NA 4F7EA 4I1NB 5JIPA 3E8UL 4NKQB 1QFUL 4Y0GA 5DWUH 3GZKA 1J18A 1NMBL 3C09B 2PTTB 2YUWA 1RHHA 1XGYH 5MP6L 3SGKC 4XWOC 3T1FB 5IB2B 2XKNB 3OJDA 3FT4A 5CUSH 1UB5B 4G8IA 2CKBH 1B4JH 3I2CL 2QJDA 2F74B 4JPVH 1UH2A 3SCMB 4Z76B 4JR9L 3T4YA 2YRPA 3CZFA 4ETQA 1EO7A 2JCCA 3PHOA 4JQIH 4PIRF 5HGGS 4PJHE 2XI9A 2Y9RT 2BHYA 5C08E 3RGVC 2X4RB 3RTQC 2Z8VC 4OQ1A 3H9HB 3DVNA 3WFEH 1YEJH 1NUNB 4JFYB 2P5EB 2RHEA 5FDYA 2X1WL 1ORQA 3EJJX 1OGAB 3OGOE 3S36L 1W0WB 2NXZD 5E5UB 5F97E 1CDCA 4AIZB 4G9DA 3ZLQC 4DEPB 2AK1H 4NJAL 3SKJH 2HKFH 5K9QI 5FA3A 1OB1A 2CDEB 1OTSC 2FYYA 4ZFOL 3F7VA 4A2LA 4LPXA 2VXTL 1YN6B 3A6BL 4R26L 1V3MA 1W0YT 3SDAA 1OGAE 4CN1A 4A6YA 1V05A 1P7HL 1D5ZA 5E8NA 3GBML 3NMEA 5EBLA 2FCBA 5HD8D 1ZWIA 3KS0H 3QEHB 4R4BA 5TE4L 1TVBA 5KG9B 4XNXL 5HHMD 2BSRA 2SEBA 4JZOA 1IL1A 4X6FB 2P8MB 1MJJA 3LB6C 4P0DA 3PQYB 3S98A 2H32H 2ERJB 5FOJA 1KT2B 3QFJA 4IRJD 1HH6A 1DQMH 3DI3B 3GO1L 3L7FB 1ZLWK 3O3EA 1NGYB 2OSLB 4RGMB 3BRFA 2J7LA 3QXDB 3L5HA 5LWYL 3VFPB 4NO0D 5LCVH 4HUWA 1VB9A 1NAKL 5EU5B 2FIKA 12E8H 5TF0A 1FFOB 4LSVH 1A64A 3EYSL 3Q2CA 4GW4A 3FN9A 2Q1EA 5BW7C 4D0DA 4MJ4A 5EH1A 3HAEH 3BEWB 4GQ9H 2WM0A 5KSUA 4L8DA 3MLWH 4XVSL 1H5BA 2IAND 2ZUWA 1I3RA 2YS4A 2YWYA 4WNQB 4ZOBA 1IE5A 3P9MB 1KN2H 1T0MA 1CN4A 3A6CH 3MYZA 1Z9OA 8CGTA 2WBJD 4RWYH 2IJ0C 2XRAH 2BK8A 2YUZA 1UM4L 4HK3J 3T0XA 1MFAL 4HMCA 3SBWA 4R8WL 5ICYA 1Q8MA 3UEZA 1LNUA 3MRCA 5DUBB 1KJMB 3DURA 5E9DB 3W0WE 5DO2D 3I02A 3CU1A 4H5SB 5F7HA 1FV1A 4IDLA 4ZUTA 4PJEF 3BAEL 5DS8B 4GBXA