1WG3A

Structural analysis of yeast nucleosome-assembly factor cia1p
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
166
structure length
166
Chain Sequence
b'ASGSSGMSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-silencing protein 1
publication title Structural Similarity between Histone Chaperone Cia1p/Asf1p and DNA-Binding Protein NF-{kappa}B
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 23
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1wg3A00
5C3IA 5BO0D 2YGVA 5EIIG 2HUEA 2IIJA 2IDCA 2IO5A 2I32A 2Z34A 4ZBJA 2DZEA 3AADB 1TEYA 2Z3FA 1WG3A 4RRPM 1ROCA 4EO5A 5BNXD 2CU9A
chains in the Genus database with same CATH superfamily
1L5GA 1SJVA 3OG6B 3PXJA 2Y06H 5F7HA 3FHQA 2XWZA 3EYVB 1FZKB 3LZNA 2NYYC 1X7QB 5IBLD 3CLFH 1SDDB 2XA8H 4MMXC 4QF1A 4YUEH 3RBGA 4I0PA 4GIPD 4N86A 4A7VA 3PWNA 4JZOA 3UC2A 1SBSH 4RMTA 1HYSC 1NUNB 1RIUL 3SZ6A 4L4VD 4LBEA 3PDOA 5F21B 4NQQA 5L2KB 3G9VA 2QGDA 4XCYA 4ZI8A 2FB4L 3SE3A 3L5XL 4FABL 2LU7A 1XX9C 2WYTA 4C83B 5AWNH 3CK0H 1XCQB 2EIEA 5IROC 1WK0A 5I73B 1D5ZB 1NMBL 1L9SA 2UZXA 5KSBF 4JKWA 1HL8A 4QRUB 1XGPB 2FO4B 3Q2LA 2W07B 4IU3A 3EYUL 5INCB 4UQBA 4IRSA 3OJ2C 5HXMA 5GGRB 4LFHG 2DMCA 4XOAA 4ZSOB 1E3ZA 3TYGL 1AJ7L 3UJJH 3UFIA 1Q90A 3RGVD 4XNUL 2FCBA 1YZZA 1JV5B 1L0XA 4KZ0A 4FNUA 5ID0A 4JO4H 4G6KL 4X4ME 3ARPA 4L3EB 5EZOH 3RZCC 2Q7YB 3SYPA 1DFBL 2DJUA 4EO5A 3T65B 4A67A 4FFTA 5CINL 2COVD 1A2YB 1JPSH 1KYOK 4NAMA 5SX4I 5D93B 2X6MA 3H0TB 2E27L 3ARBB 3SO3C 1G6RL 1BDYA 3DV6A 1GR7A 4U05A 4AWJC 1X4XA 3OAYH 1DBBL 2WD0A 3VMOA 2WBJB 2WYHA 1JPGA 2V7HB 1FFTB 5GRZA 4AQEB 1S7UA 2HG5A 2PF6A 5DZLA 4BE6A 3E3QE 3O4LE 5MI0C 4OUUB 4JRLA 2GJZA 3BCDA 5TQ2L 4H1LB 2IF7A 5J89A 5KJRH 2X0VA 4DKDC 1KJ3H 1P2CA 1BIHA 4J3OH 2FJHB 3PHAA 5EIIG 5SWSA 1HCFX 1KBGL 1N9PA 3KM1A 3OKNA 4JY6A 1FZJB 3APCA 3K4DA 4JO5A 4MMZB 7CGTA 3UYOD 4NAJA 1I9JL 3N6YA 1QW9A 3Q8CA 4F20A 2OQJB 1EJFA 1Q1JL 3QNFA 3T2NL 1Q9OB 1SHWA 1WA1X 3Q9QA 3Q2WA 5BS0E 1K8IA 3MYJB 1UWGL 1PVHA 3WI9A 1TF4A 2DQIL 4WKZA 2P45B 3HC3L 4X6CF 5GJSL 1CTNA 1PYWA 3SZKC 1M1XB 4XX5A 4HQQL 4ZDHB 5EORL 2ETWA 5J6HA 4HIQA 3U7WH 1O6SA 4YNYA 3WUWA 5CFAA 4Z7WB 2AJXH 5DD3H 4MAZA 2DKMA 1F2XK 5D8JL 1YDPA 5ECGA 2APSA 3TJHC 4Y5XA 3C5JA 4CKQA 3DSNB 4TUUA 3QI9D 5I0ZA 4FG4A 4G83A 4TPRH 3MV11 5F7YC 4WO4A 4HCRA 4TULL 3WO4B 1JJUA 1XGRB 4DH2A 4NYLA 1WBYB 4PJBF 4UDUB 2VZVA 3QWNA 1P4LB 4NEHB 4Q89A 4G6AC 3P73B 4XVSL 2WBKA 3G5ZA 4MSWB 4RCAA 1KXQE 1L3WA 2K9UA 3NFNA 1F8TL 2CO4A 3ME0B 4ECNA 2O4EA 3GI9H 4M1GH 4JFDB 3V7MA 3INOA 3VFGL 3A47A 3L2MA 4FYTA 2Z34A 4UV4L 2ICWA 2LGNA 1RK0B 5DD1H 4FQCL 4PJHB 4JZJA 4Z6AT 1DSWA 1H5BA 1SLVA 3MRHB 3ARDD 1ZHNB 1H3PL 4DZ8A 1QR1A 4NZFA 4GG6E 4IRJB 2IG2H 4FFWD 4DNLA 2VAAB 4OIAA 3FQ4A 3BPNC 4HSQA 2XZAH 3IGAB 3GXDA 4XAKD 4ENEC 1U8OB 1Y0LA 3T2OA 2CJSA 2XZCL 3QIWC 3RTQD 2COQA 4NQDD 5FOBA 2P28B 4DKFH 4WV1C 1ZT4A 5HI3C 3ZT7A 1UG9A 2EILB 3DA0A 2V2XB 3QAQA 3NACL 3RVVC 5IVXB 1HHIA 2YEVB 4NC1E 4OT1L 1UCBH 3I2CH 4GRMA 4OCWH 3CSBA 2ZX8A 2ZWNA 3WAKA 4XPBH 1WD9A 3POHA 3QQ4B 4ZFZB 3QJOA 5EU4A 1NKRA 2X4RB 4LHUG 4KNSA 5IY5B 5D7KE 1FZMA 3J07A 4ZXBB 5HHOB 4MZ3A 4CL7A 3C5ZB 2WWKO 5HJBA 3VXSE 2X2IA 3S3JA 1F3RB 5ALBH 4DK5A 5IFJA 4HCRH 1ROWA 2PYFA 1BD2D 1AYRA 1K8DA 4M5YL 1AR1C 5TE6L 1G7MB 2NW2A 3MBWB 2HKHH 4M1DL 5BRQA 3SKUD 1TEYA 1W9XA 2VGLM 2VUKA 3B5GA 3QDJA 5KTEH 2L7QA 3UBFA 2NY2C 3V9FA 4YHMH 3VWJA 3MV8E 5GGVL 3N91A 3PS6A 4FXGB 3AT8A 2J6EH 3HZVA 2ARJQ 3GUTB 3GHEH 1AGBB 1L0QA 5E9NA 4WWKC 5E7FA 4TSCH 4I77H 3VXRE 1T5XA 4MLIA 3UJTH 1D7FA 4C47A 5E1AB 2F5BL 4Y4HD 1NCBL 3IXAA 5CP7A 4Y19E 2H26A 3P9WB 4KTEL 3U1SL 1R3JA 2CGZA 1E43A 2QVKA 3D69A 3K8KA 3VD9A 1AGCA 3MGOA 1TUPA 2DI8A 3VD0A 1ZHLB 1SYSA 2EADA 2OMVA 2E6JA 4P5TD 4HYTB 3BPCB 3FC8A 5C0BB 3ZIMA 1Z3GL 4XI5C 3WJMA 4XPAH 1IBGL 3IDGB 1IEBA 4OB5L 3C6LA 3WS6A 1U8IB 2MQ0A 3TIEB 4F7KA 4AY0A 2J21A 5DMGC 1D5XA 1ETB1 4TSAH 2ZOUA 4ZUWA 32C2A 2F1AA 2KS0A 2YQBA 1SFDA 1PSKL 1OAQL 1X7TA 4ONOA 1H6UA 3RX9A 4ZTOH 2JQZA 4F37F 3EO1A 1OF0A 1YQ2A 2BS8A 5FF6A 1UWEL 4JKMA 5DJ6A 3PGFH 4HJ0D 3VFMA 2ZOWA 3L3IA 1K9TA 4GXVH 4OGYH 2RBLA 3N1PC 4U6VH 1NAKH 3H7LA 1L4IA 4QI3A 3ILPA 5TDOB 3CUPB 4ATWA 3SDDC 1RZ7L 4FFYL 1MI5A 5J9PA 1J5IA 4Z77B 1GGBL 1DVTA 1UD5A 2O5ZL 4WJG3 5FYJU 1I75A 4H8QA 1MNNA 1HL5A 3SDAA 4BZ2L 1T5WB 3CVHL 3QJFA 4WEEA 3G5XB 4XNDA 2Q76A 5CBEB 5D5MF 2I25N 2VN3A 1PCXA 1U8LA 2ZWSA 4RGNE 3MLWL 3KPSD 3D87B 4UZGA 4BD4A 2CBPA 2EYSB 4P4KB 3QNZB 1YPZF 3DETC 1QG3A 4J27A 5ECJE 1Z6JT 2VDLB 5E99H 4LRNH 1UT1A 3UZEC 1QQDA 3X12B 4NP4H 3EFDL 3QUYB 3MNZB 4XVJL 5LGJB 2K78A 4LCCA 3QFJA 3A5VA 2B2XH 2DI9A 2HT2D 3EFFA 1P84K 3LYRA 4K7FB 5E2TL 4G8IA 1RSYA 5EOCL 1FGVL 5LB1A 5JIDA 2ZCKL 1CIUA 1MFCH 3KL0A 2NY4C 3ZLQC 2Y1VA 4ANXA 3WCYA 5FPIA 4FA6A 2BSSA 2NXYC 3ZL4L 3WIHL 5I9QB 5I8OL 4ODVH 4OQTL 3U79A 4POZD 4PJGF 4B9GA 3QK0A 1IUZA 4B9PA 3OKEA 1E5ZA 4LP8A 3QPQD 1AOHA 3MJ7A 4Y4KC 1CXFA 1OSZB 5E8EA 4M93B 2X4OB 3D2TA 2FATH 1NAML 3HBGA 1MFMA 3P3UA 5DUBB 1FG9C 1Z7JA 1VACA 2ZKHH 1A25A 2ZD0A 3PFUA 3V0VB 3IK2A 2XICA 2QADC 4AZ8B 2VQ4A 4UQCA 4WNQB 2QHLA 4UQ9A 4G8AC 5EC1B 1IV8A 4PJDA 4I0CC 4A7TA 1TJGL 3N40F 4JB9L 3ARQA 4MS6A 4XHJD 5C07A 3PABA 3ETTA 1VGEH 1GC1L 2BVUA 3S37X 1D9KD 4F7PB 1QP1A 1HHGA 2ZXEB 1G9ML 1OCOB 4JDZA 4ALAC 4QRSB 1L9TA 1REIA 3ZTEA 2A9MH 1NIBA 2R4SL 2NY5L 3FU9A 3WNOA 3ZMEA 3QP3A 2AS5M 2R23A 4HIHB 3JV5A 2WNKA 4UNTA 1M05B 5B21A 4G71B 4X6DF 4HSCX 1M9WA 1TTBA 3S34L 4D9QE 1J9SA 2HJFA 5AW6B 2AQTA 3HG0A 2DTMH 4HW6A 5C7XL 4KOBA 4HWZA 2WINA 3LS4L 5A43C 1AZVA 4O02H 3TCLA 4C8XA 1OSPL 1T7XA 3GMOB 3LNFA 4R9HA 3ILDA 3JZYA 3UROR 1IAMA 3QFGA 3HNVL 4X99A 2CGRL 3DPDA 3ERXA 4LCWE 1ZLVH 3DX9A 4HP5A 1BFVH 4FFVD 4KTYA 3FFCE 3X14B 1OOAA 3JWNG 4OZGA 1UKQA 5DHYA 1X5HA 1FIGH 2VLRA 2C1OA 2UY7A 5DS8B 1KB9J 5ITFB 1B2WL 2B1HH 3ZPDA 3TH2T 4FGMA 5GPRA 4L3AA 4ZMXA 1LNUB 2W5PA 5DFVD 3L3OC 4K8RC 1S78C 2P49B 2UYLB 3LZFH 3PL6A 3FT4A 2Y07H 2JKSA 1RIHL 4P2QE 4QXVA 3FO1B 2IOIA 3RYMA 3F7RA 4WCYL 1NMCC 2R2BA 1Z9MA 2QT6A 4NXSA 1UACL 3H9ZA 2PPEA 2B59B 1W0WB 3X1NA 4H2CA 5I19L 1EVTC 1FYTA 4O2EA 3RJDA 2C26A 3UZVB 3LKRA 1KUMA 1IRAY 2L4OA 2MCPH 2GSIA 3DVFA 1U42A 3ML9A 4DPCX 2LTQC 3GMQB 4JO8A 3H1ZA 4CRPA 1EERB 1YO4A 1QSFB 4KJYA 4TXVB 3DOHA 3MRNB 3O4LD 5D1XB 3U6RA 4P9MH 4UYQA 4CSSA 1E3XA 4PGZA 4F80A 3FU7B 4GW5B 5FO7A 4W4OC 6TAAA 4B60A 2VW7A 2YSSB 5IBLC 5J7CC 3TXAA 4NGHL 2Y3NA 1CI3M 4K3HA 3H85A 3ZE1F 4GAYA 1IM3D 3MRMA 1GGCH 4U7KA 1QVOB 2V0AA 1DVFA 3EH5B 1A6VL 2E75C 2HLAB 4JS7A 3L4UA 3EYFA 1EDQA 1AH1A 3FQTA 1EEQA 2X4SB 1WP6A 5I17B 1DDHA 4NI6A 1KEML 4ZNCD 4EI6B 1OGTA 3FO0H 2ED9A 5TDNA 1RZ8A 4LEEA 3T4YB 4AJYV 4ZNEA 2WJ7A 1NLDL 5D1ZD 1M42A 5BS0D 3GSNA 2XRAL 2G2RA 4JO3H 1P5VA 4DZBB 5ACZA 4IOSA 4DUWA 3FOLB 4L8CA 2YMXL 5ACLA 1U8QB 2R0ZH 1QLFB 4LFHD 3ZJAA 2FUQA 2D7OA 5I6XC 3RGVC 2WKOA 5AVZB 3O3BB 3TYFB 3LIZA 1MKFA 3L1EA 3P9MB 2OMYB 4OCXH 2Q20A 3WLWD 4M7KH 2EEAA 3AM8C 3ARYA 4PLKD 2H6PA 8FABA 5EULV 3F7KA 3GKWL 4XPFH 5DEZA 5B1JA 1KT2A 3VFOA 3DRQB 2YPLB 4RX4D 12E8L 4EVNB 4XXCA 1H3GA 2VXVH 1FLRL 3OAYK 2BLFA 35C8H 3KXFE 1MVUB 1S3KH 3HRZA 3M07A 4PV8B 5T3XL 3BAWA 4G9FD 1UWXH 1JNHB 3FN9A 3VCLA 2N01B 3BXNB 4IK7A 4LSQL 4W70A 4JFYB 5JHLL 4W9IC 4KNTA 4M43H 5DC0A 5EHFA 2ICES 4RMUA 4NQXB 4HX1A 1S3RA 1ZVSA 4UOZA 4OD2B 2Y72A 3ZR5A 3QWOA 4G3YH 4QMEA 1FSKB 3ECQA 1JZ5A 4UYPA 4D8PB 1BWMA 3DUSA 2QFPA 3NIGB 4Q9QL 2DBLH 2B15A 5KZCD 4R96A 2ZYHA 5GZOD 2PABA 3L2LA 4XXWC 2Q6WA 3I75B 3BP5B 2ODHA 2HRGA 4C54A 5HHME 4JFEB 2G9KA 3QCUL 5K39A 1KIUB 4CC4C 1PKQA 5ANHA 2OP4H 2CR3A 4M48H 4ELMA 2B1AH 3L2NA 4M29A 5H35B 2KHAA 3GSNH 4UT9L 3W11D 1M2VB 3ETSA 4IMKC 5HDQL 1E5CA 3I3BA 5IB1A 1JPEA 4APXA 2VR6A 3DYMA 2F18A 4ZYKB 3ZYZA 2AJZA 2FEDD 2F7OA 6PAZA 1KJMA 4BHUA 1MFDL 1WFIA 3LIZH 5GS2H 1OGAD 2AVFA 1KLGA 1KDJA 4OLUL 5D7KD 4Y4FD 3K7UA 4MB5A 1GJIA 1DBKH 3MV01 3V0WH 4D3CL 2VT0A 3QI9C 1BLNA 4BSVA 4Z0XB 2HX8A 5HYSB 4U1MA 2ENSA 3D39A 3G08A 1NBZB 1TQCC 4ONHB 5LWYL 5CGTA 1AC6A 2NCMA 2FEJA 3RJQB 1E4WL 4JHWH 1NGQH 3GIZH 3QEGH 1EZSA 3UTQB 5I75B 3DX8B 1KFGA 1T6BX 2AEPH 1XIWA 3RHWK 4NRYA 3MV8D 1XZ0B 4J5VA 1R5VB 1DVSA 2JTYA 4HCIA 4QRRE 4MJIA 2XQYK 3FRPB 3KS0J 2CJUL 4NM4L 4FQQA 4NJAH 3VXRD 5FYKH 1IZJA 3BWZA 3O3AA 4WWID 3F6JA 3SJVA 3HZ3A 3O6FD 3BKML 4Y19D 1L9OA 5GSRA 5JIQA 3W57A 2MNUA 3Q5TA 1F4XH 3T0DA 5IW1B 3QEUB 3ARDC 4KO9A 5IBUG 4HIPA 3TZVB 5AEAA 3L13A 5F7WC 1YEJH 1CG9B 3VYPA 4FMKA 4RAUA 1JHTB 4FFWC 2VE6A 3LN4A 4AMKL 2AITA 2ALAA 3COOA 3T0VA 5EFIB 2DEXX 1E4KC 2ARWA 3B6SB 3NIDE 4OTXL 3RFRA 2JXMA 2QEJA 2CDEA 3N43F 3RTQC 3BDXA 2VNCA 5BUGA 3LEYL 4JN2A 5DGQA 2V5TA 5FUCC 3GT6A 4YDKL 2X05A 3K71A 4LPCA 2ED6A 3SDXA 5EO0A 1BFTA 5AOIA 3U4BL 3BKJH 3CFBB 1TCRB 2K6YA 1CD8A 1NFIB 1TITA 1S7WB 3FULA 2YMTA 2EXYD 3MROA 4LHUD 4JO1H 3UC0H 4OI8A 1YSOA 3HI1A 2NYZA 1QATA 4PBVC 4RWHA 3D4CA 4Y16A 5KBLA 4P99A 3MDJA 1NCWL 3HZKA 1FG2B 2ZCLH 3QIUD 5I8EB 3FRUB 3LQAC 3NCYP 3OGOE 2WLLA 3HMXH 4L2LA 5IK3B 4MCZB 4ABVA 2D7TL 3FTXA 4APQA 3TWCH 4WO0A 1WA0X 2DWYA 5ELIA 4R5XA 3OWEA 4CADA 3LV3B 3UABA 4XAWH 3GSRB 5CKGA 4KDTA 3WTVA 1FORH 2D73A 2YGNA 1KIRA 1MRFH 2XKSA 4WTZA 3BZ4B 4J1UB 3JWOH 3QH3B 1NGWA 4KY1H 5DUPH 2J7LA 4Y4HC 3CSYA 1E8YA 3O8XD 4Z8FL 3FK3A 3D85A 2P5WD 2L7UA 3U30C 4IU2B 5EU6E 2ZUTA 1ZLUH 3KHQA 3FUIA 4PRIB 3IJEA 3WGVB 4AQ1B 4AW7A 2IH8A 3L08A 2C3VA 2IH3B 3LKNB 3GXFA 4P5TC 3REWB 5BJTA 5F3BB 3L48A 1RUKL 3T0EB 1KTDB 3L3HB 3B4NA 1LJMA 4K3DL 4F7TB 2EQDA 3C08H 4FKEA 4RISH 4AH2B 4OFYD 4DKTA 2IPTH 3ECWA 2Y7QA 3UERA 5JIIA 2ZIDA 3VQ1C 2YO3A 3L3JB 5GJTL 3V5DA 4JRYA 2R1YB 1IAOB 2CMRL 4N3UA 1F11B 1UASA 1ZS8A 4Z7OE 2N7AA 5KYWB 3TBWA 1ZSDB 1FO0L 1GMEA 5JIMA 4Q56A 3U0WL 2ICCA 1XF2B 3C6EA 3B9DA 4U2ZA 1N0XL 3UXFA 4C57C 1IEAA 3ARGB 2DJMA 3DTDA 5E56A 4PJCA 1EGJL 2WQRA 2WSKA 2CQVA 1XL4A 4FLRA 5LCVL 3WYRA 2H32B 2HKAA 1DR9A 3HA0A 4HJ0C 2APTA 2NW3A 1NC2B 2Q7AA 3S5LA 3MLPA 2FX7L 4NOBA 3DUUA 4GKZA 1TMCB 2AV7B 2X89A 4HVBA 6FABH 4N0YL 1AKJB 1S7SB 5I1KL 1WTLA 3A21A 3E6FA 4YXKL 2DKSA 3AG3B 3T2QA 4EZJA 2AHIA 1IU1A 3ESPA 4L1LA 1SOQA 1XB8A 2R15A 3S2CA 4PGBB 4PPTA 2K6WA 1W0VA 5H2BA 2WXGA 3U4KA 3GIVB 4GO8A 3PNRB 4TNFA 3NYKA 2OL3A 1B4RA 3FH7A 1HH9B 2YIHA 3BHBB 1QO3A 3D33A 1FL3A 4JPWH 2ZAIA 1SJHB 3S88H 4BKLB 4D9QD 1CGUA 3QISA 4LL9A 3BWSA 4RNRA 5I74B 3ARZA 2PWDA 2HT2C 1HL4A 1YNLL 2X9ZA 3MLYL 5DJ8B 1NGPL 1P4UA 1SEBA 4MVBD 2VKWA 2Z1PA 3ELQA 4A7GA 2IQAA 3RIFF 1ACZA 2DN7A 4N5UA 4N1CA 1S8DA 5I15H 3AY2A 4HUNB 4MCYA 1RUAL 3OAUL 4POZC 4QYOA 4LCWD 1M7IB 5E1QA 4W9GC 1H15A 4H7VA 3QPQC 5HYQA 2HN7A 3C2AH 1T0MB 4RETB 3ESOA 4PR5A 4XE5B 1T7WA 4FNQA 3LRSA 3LZOA 1MIML 3TC9A 4HETA 3B9VA 4OJFL 2KZWA 4OJAA 2KZ1B 5BRZB 1IL1B 5EIQA 4WZ9A 4NM8L 5L4JA 4R26L 4YDNA 3X3FH 5C0CA 1YLBB 3VDCA 2E0PA 4HA1A 2FX9H 3QQDA 1ILUA 1QLEL 1XBDA 2PTUA 3GI8H 4G7YL 1NC4B 1ZS2A 2EC8A 1J9RA 2X6BA 2HJKB 2BVQB 4U1HA 4XHJC 5IQ9A 3PHOB 4LVNC 4PJ9D 2Y6TE 1D9KC 5D2NA 3UTOA 4NQSB 1HINH 4J6RH 4QEGA 4PWHA 2CLVB 4Y5VB 2X7LB 4P23A 1LE5B 4HKJB 3KLAA 4NO3B 5ABDE 2OL3H 3MRBB 5AYQA 4NPYB 4NZUL 4EPSA 5HJGA 4BFIB 2K45A 5E8NA 4B97A 3Q2VA 5HHPB 1ZTXE 1G94A 3GXTA 2WVVA 1WZAA 5IHHA 1EJOL 2E56A 1R46A 3HR5B 1CVSC 1QZNA 2P42B 3GFUA 3ZHFA 1T7VA 4F1SA 1TU2A 3FAXA 1EO7A 3WY3A 3EO9L 4AV5A 3D0LB 3MPCA 3OLGA 4AJWA 3P4MA 4GO9A 4LPTA 3VXMB 1YUKB 4HH9B 2PCFA 5AVUB 2VM4A 3NZUA 4DPBX 4QYAA 2W95A 3CFMA 1E9OB 3TA3D 4BCXA 5DSCB 2W0FA 4MCNA 1OARL 4YZWA 2WIMA 4BQ9A 2PXYD 4F7EA 3F58H 2WNXA 1MCCA 4ORGB 2FZ3A 3FTUA 1KB5B 3ET9F 4FFVC 1SRDA 3Q8EA 4YHZH 3WUWG 4JM2A 1P0SE 5IJKC 5FKPB 1SGKA 1WCBA 3NG5A 3TOPA 3TIDB 2R1WB 1VFAA 4P3WA 2R27A 4IKJA 4OSUH 4ZUSA 5DFVC 3MMEB 2WPGA 5IHZB 3D0AA 1KFAL 1BVKA 1YEKH 4ERSH 1DFXA 2WSDA 2YA2A 4A39A 2Z3FA 1EO8H 4HS3A 5CN1A 2DDQL 1MW1A 9PCYA 4LEBA 1QW8A 3IJSB 5AW0B 2CLRA 4JFPB 1K6QL 2ZWLT 3OGCA 4V11A 1KY6A 1JWUA 3O6KH 1KXTA 2XN1A 3STBA 5MERB 2OI9C 1NKGA 3FQXB 1PLCA 4GFTB 4LQFH 4OZHB 3UBXA 1WFNA 5BZDA 3JUZA 5I18L 4NQTA 3BGMA 5DYOA 3CQFA 3D2UD 1ICTA 2HTLD 5F9JA 4Z3HA 4AYFA 1CK0L 1GZPB 3E1F1 5JPNB 1B0RB 4F2EA 1WQVT 1MFAL 3KWVA 4N2KA 3NJMA 4RAVA 1O6VA 2ADIA 3HI6L 4MXWH 4NO5B 4N2FA 3E8UH 8CGTA 3MUGA 4A2MA 1HAWA 2D0HA 5FGBA 1QASA 3NEXA 1EZVY 3GXPA 1NBVL 1Q72L 1FLTX 3UJIL 1GHFL 2MRYA 5DMKA 1M56B 5FYLL 5HHMD 3S37L 3V4PL 3P30L 3RDJA 4JFFE 1UT9A 1J05B 2DQGH 3TPKA 2PR4L 1LILA 2VR9A 5T1LB 1UJ3A 5D1ZC 2OJZH 3CHXA 2WYIA 3X1BA 4LP4A 2R0KH 3CVIH 1PLBA 3UYRL 1BYPA 2XG5A 4C56A 1BIIB 2ZOOA 1ORQB 4X5XA 3VXNA 1KCSH 4DFIA 4CSPA 1QA9B 4Z3JA 1A7NL 3VDBA 1L9QA 3ZTDC 4K3JL 5D7HA 1GIGL 4I0KA 2IIJA 4QXUL 3TEUA 2WXRA 3WLWC 1R3KB 2VL5B 4TLUA 1GC1C 1YMMA 1EFXD 1D5MB 3K8LA 1XCXA 3NA9L 3THML 4ZMVA 4HUVB 4JDTH 2YQ2A 1WF5A 3IB4A 4FQXA 1G9MC 3NN8B 4AIZA 5AVWB 4DETA 5KVDE 4OLZH 2A9DA 1ZDQA 1JTOA 2NY5C 4F8PA 3C8KA 3KLHD 4ZOCA 3AUVA 3SQBB 5GGSY 4H20H 2Q3ZA 5DCCA 3Q8BA 4NO0A 5E4AA 1QUNA 1PX3A 1J11A 1IAKA 1RZFL 4Z5RA 4UI2A 1O9ZA 5F0JB 4JKKA 3IJHA 3MNVB 4HBQA 4W9DC 4WDIB 3MJ9L 2ID5A 3VACA 3OMAB 4LT7A 3ZSSA 2X10A 4BQ8A 1IMHC 5T3ZE 2YEZA 1A8ZA 2HH0H 3FSWA 1VZGA 4FNPA 3VMPA 4FI7A 2F8OA 2BXYA 4XO5A 1KN2H 1NFDE 1E0OB 1ZSHA 1TZGH 4IIQC 4R2GB 5GZOC 3DKHA 2CHZA 3EJQA 3MODL 3C2SA 4HGWB 3P69A 3VFPA 1RZJC 1LGVA 4PJ7B 1XXDC 2NNFA 4PREA 4CN4A 3H42L 1LDPL 3ATDA 2VXSL 5TE4H 3W11C 1AO7B 3B5TA 4WI0B 5HVFB 5BVJB 3O4OC 5E2WH 4NC1C 1DBMH 3L45A 4FXKA 4KMLB 1LO2H 3H55A 4OZ4B 2H9GA 1TMQA 3WFBL 2FEDC 2EVFA 3DPBA 3Q8FA 1I1RA 3PWPA 4D0CA 2AJ3B 1FVCA 3LMJL 2OZ4L 2DYPB 2WM0A 3HE7A 4Y4FC 5FYJL 2X4PB 1XZWA 4KQ4H 1M6UA 2K9FB 4URKA 1U3HD 2XHNA 1I1FB 1GPOH 4KXAA 3JXAA 3VX1A 1ES0B 3UAEA 3A23A 3WEMA 4KK8D 4DKEL 1WJ3A 3IDMA 5AOJA 4DPRA 5F7BA 3QDGA 1WSST 4GQQA 1QHPA 4L9LC 3V6ZA 4AUJA 3Q0HA 2NQDA 5C2BH 1KXVA 1WH0A 1HDMA 5CJOL 2IAMB 4AV0A 5LN8A 1JUFB 5ADOL 1JRHL 3MO1B 3H4FA 3WHXB 5AZ2H 2IFFH 5IIEA 4TL4A 3HG5A 3U4EA 4MB1A 3HAEB 3RPKA 3U83A 3QIBD 5FGSA 4R7VA 4HC1L 3PQYB 3QVAA 3QXUA 3O6FC 1SYVB 4GKNB 2A9CA 3D25B 5EU6D 3ISRA 4LOUD 1SVZA 4LKXB 3K91A 4MD0B 4M9PA 4O4YH 4YHKH 2P8LA 5E4IA 5GZND 4JR9H 1X4YA 4IW4C 4GUQA 1AZCA 2YKKA 4UCFA 2IADB 1MJJB 3AQXA 1C16B 2XKNB 4QRBA 1RURL 3UPCA 3CFCH 5D7EA 1DO5A 2FSEA 3H9SB 3MRIA 4H0GA 3DIDA 2OX5A 2XV6B 3ARTA 4QO1A 5BVPL 1V55B 3BEWB 5IB4A 4X2UA 1J8KA 4O2FB 4LCUA 5DVOA 2AXFB 4K9JA 5DGRA 2X70A 1G43A 2ED7A 1R6VA 5HVGB 2BWDA 4JFZH 1NUFA 2DWEA 2CCLA 1HAUA 1KGUA 5E4OA 1ED3A 3KPMA 3ZYIA 5BUAA 4MAYD 2NUPB 5B3JE 2BWIA 1IC7L 2J1YA 3CDCA 3HR6A 1HNYA 4MAUH 5IGXH 3L17A 2EXYC 1KYAA 3RPIA 5LGYA 5IMOA 2QGCA 2WANA 2ZG2A 1CDIA 5C09B 1GCFA 1S9YA 4RLDA 2OTUB 2LHAA 5F1IB 4KU1A 4HIIA 3GBLA 5EF3A 3QIUC 2GEEA 3CFNA 1DQMH 1V10A 3KPOA 2BY1A 3NH7L 1YEHH 1ZK9A 4J23A 2J3SA 3KJ4C 2D4DA 4GRWE 5DTFB 5ESQA 4ZFGH 5ISZE 1FVDA 1BJ8A 3VXPB 1ETZB 1UB5A 4DO6A 3O2WL 2AJVH 1EHXA 1KBPA 4XMLL 1GKEA 4OW6A 4OGAD 1MHCA 4ZFOA 4AG4L 3EO1B 3B7YA 1O5PA 3MACL 2I24N 1AQHA 4JGJA 3LD8C 4U6YB 1NSNL 3PPEA 3O8XC 3IFNH 3IPBA 4NZJA 4AM0B 2E6QA 3QYMA 2HFEA 3GEFA 1N4XL 3GDBA 3UIYA 4JFQA 4DKAA 5EOQL 5C0RL 5TK4A 1IGMH 1DQLL 1BECA 1UUNA 4XP9L 3SCMB 1UD6A 2AERT 3AS0A 3GO1L 2OSWA 2EE3A 5LBSA 2UVEA 2CO6A 2JB5L 2X1WL 2VDRH 5JW4M 3B43A 3TEXA 3VRIB 3OKMB 5B1AB 3NZ8B 4UDTB 2FAUA 5D7IB 4PS7A 5E8PA 1SLWA 2BIQA 3APFA 5E6IA 3GRBA 4HJJL 3RP1A 3WFDL 4ZMYA 4LLDA 3PJSB 4L48A 2C9PA 4MA1C 4QTIH 4XMPL 3WN5A 4X7FC 3SBPA 1JGLH 1T6WA 2DKUA 3QFJB 1XQ4A 1NIAA 3HUJB 1MJUL 1PZ3A 1YEWA 4ZAKD 3V4VA 1LP9A 4LLYB 4O02B 1F5WA 1KPRB 1MWAA 4HKXA 5DI8B 5HHVH 3CQPA 2V5SA 2ARJA 1ZAGA 3NFPB 3OB8A 4PJDE 3B83A 5I66A 4KRPB 1CICA 1QHQA 3QRGH 5ERWB 5IEHA 1OQXA 2XZZA 1GGIL 1NA8A 2A6IB 1F56A 2C9XA 2ZXBA 3SOBH 3QZNA 5BV7B 3Q6GL 3SKOA 3MOAH 4LVOB 3RG1C 4GAJH 4LARL 5IUCA 4HD9A 2CRIA 2JH2A 2YRBA 3MLUL 4G42A 2Z6FA 1T6VN 1N0LB 3GPSA 1CTMA 1HHJA 3C60B 5HHXL 4Z7VA 3IE9A 4ENZA 3NIDF 5ANMB 1S7RA 1I8IA 1AHWA 4BIKA 4KKZA 1V5JA 4Q52A 4EZMA 5CBAA 1HOCB 4CC0A 3PAYA 4I0PD 3W9DB 2TRHA 2FT8A 5GGQL 5A2KH 3QT2A 4E41B 1JGEA 3L9RB 3O6LH 4F9LA 1XR8A 2J88H 1BF5A 4K9EL 4U1JA 4UT6A 3KPQB 4U4BA 3KS0H 5GS0H 2ZSVA 2VW6A 2XN9D 3AREA 3FXIC 4MVBC 2FBJL 3MLXL 4HK0A 4JQIL 5DRWA 5LBSH 5HY9A 4JNXA 5LNDA 1CU4L 2G5BB 2GPZA 4U0RB 3NCFB 4PWEA 4V2CB 5F6HI 3JVGC 5ID1B 4J2XA 1CLVA 1NDMA 3GD1C 1JK9B 1VERA 3OKYA 4IRSD 2J8HA 5EU5B 3L3DB 1KF9B 2VL4A 3AB0B 5AKTA 2OTWA 1U8JA 3CFEB 1N59B 1BG1A 3IDXL 1IKOP 3NZHL 5EOTB 2EH7H 1I8LC 2CBMA 3TT3L 4K7PY 4DAGH 4ZMTA 5F1NA 1T1ZA 3F5WB 4WW2B 4CVWA 3OQ3B 5I2IB 3V4VH 1XTLA 2WXMA 4JO2L 3TLRA 2PO6A 3C09B 3SGDH 5F7AA 1HE7A 3N44F 4KDVA 4U4IA 3V0EA 4JRXA 1QI3A 5TJWK 3AGWA 4PH8A 4XC3L 5K9JH 2BVPB 1G7LA 3HPLB 5LXVA 3FCTA 2B14A 1KIPB 4LCVA 5IW6B 4P59H 1I1AD 1K3IA 4PJ9C 2J73A 1RUPH 2H1PH 3VI3B 4HKBB 5IQ7L 4OCRH 4OH2A 3WS3A 2CKNA 1OAXL 4LO9A 4B9ZA 5CUSL 2DL9A 4I3RL 3KR3H 1LWJA 1UATA 1M7DA 2GSGB 4FZ8H 1L7TL 3WFHB 1I3RB 3EOTH 3MVSA 4ONGL 4HHAA 3NEOA 4GKSA 3VJ6A 4FP8H 1SOKA 1LWRA 4QTHA 4ZZFA 5LHDA 2Q7NA 1ET7A 4JUTA 4PJHE 3MKGA 5CEYB 1WHPA 3BKCH 3TN0A 4U6XB 3EDFA 3RWCA 4U49A 1S7QA 2GTZB 3IDNB 4GQPH 2A74C 3D9AH 2FGWH 2EZ0D 4HIXH 5AAMA 4UUJA 5JOPE 2F5AH 2YC1A 1ZK5A 3TA3C 2HWZL 2BVYA 2CAKA 4JFFD 3NCJL 2YN5A 2W88A 4LB8A 4Q4IA 4CA4A 2V17H 1CE6B 1IAII 4FJ6A 4QJ4B 1A7OH 3ABGA 4S1SH 2PXYC 3CPLB 1CDYA 1J7VR 2PN5A 1CD9B 3G6AB 3FSZA 2OMXA 5D72H 1D5BB 4OLWH 4WW1B 4YH6A 3HE6D 4BZ1H 3A6CL 5DEFA 2BP5M 3D4GA 4M6NH 1A9BA 1N8OE 2O5XL 4ODXB 4UIKL 4BGDA 4PTTA 5IFHH 2VWEE 5BO1H 2DLFH 3CZGA 1EHAA 2JCCB 4MMXA 1ITBB 1WC7B 3RWJA 3HS8A 3PXLA 2HFGL 3INUH 1DUYA 1RU9L 4QHKJ 5T33H 3QORB 3OHXB 4Y5YB 2DPKA 5HHOE 3PYCA 4JAMA 4ATTA 3FB6B 3FQWA 4AK2A 3L5WB 4GXUM 2M26A 4N26A 5GGSA 4F15C 2DM7A 1T03L 1E5BA 1CD1A 5E8OA 4R5TA 3OLIA 3VB9A 1KNOB 5IROA 3KYNB 3EUDA 3QUZB 3IGKA 1E4XI 3RVWD 4LQ1A 4ZK8A 2HX7A 4E0RA 3DROB 4JN1L 3BPOC 4IOIB 2BFGA 5FYKE 4XCFH 4N2DA 2HTLC 2EIZB 1HEJC 4NUGL 1QHOA 5TH2B 4HOWA 1H8SA 5C92A 5I8KL 3LDBB 1FVEB 1LK3L 4P46D 1OHQA 3V5HA 4PD4J 4Q6IC 1FV1B 1ZLSH 5AAPA 3F83A 4QT5A 4B96A 4XNZC 1MPAL 4LU5H 2HLFD 1QSZA 3E2HC 1TSHA 4YX2L 3B2MA 4UV7L 3RZCA 4UOQA 4U1IB 2N56A 4KKAD 4YDVB 4E9SA 1YYLH 3PP3H 4XWGL 1NBYA 1U8NB 2DQHL 5C0BE 3DVGA 3V9CA 2Q2EB 3B9KB 3MUHL 4R7DB 3K6OA 3L95B 4U6HB 3HS0B 2B8OT 4KWUA 3QO0B 1NJ9A 2R1XB 1F1AA 2RALA 5CCKH 3OKOB 4WU7B 4X5WB 5SV3A 5CJXC 5FA3B 5SWZB 1QFWL 3MKKA 3N42B 2GHZA 3ZQXA 1OWRM 1MFBH 3AUWB 4Y1TA 1D6EB 3BPLB 3EBIA 4HFWA 4NSKB 2D7NA 5B39A 2Y2WA 3FFDB 4PWFA 3HCVA 2R56L 4WI5A 3D39E 2W91A 2PPCA 2ADYA 3GSVB 1WG3A 2XIDA 2ATKB 4RGMC 2VN4A 1P5UC 2WUCH 4X0KA 1PKQB 1PBYA 1A6AA 1H3XA 4N2CA 2L3BA 5L8LB 1G9HA 1OV8A 3ZIYA 3QGVA 4ELMB 3KLHC 2KT6A 2W1NA 1D7DA 3O11B 2YEQA 4G9DA 1UGKA 3SYQA 1B0WA 3HI5H 4YSUA 5K9OA 1U92B 2DQCL 1A3RH 4KY2A 1PZCA 3GSOB 2VLKA 1VEOA 4WTZG 2Z0BA 3EGSA 1XBRA 4AEFA 4ZUVB 3O81A 4MJIE 1RSFA 1UJTA 4FL4C 5IT2H 1MXGA 3R19A 1FC1A 5IQMA 2ZWKA 3F64A 1F4YL 3BD5A 4PIRF 5E94A 1HCVA 3RI5F 3D30A 2A4ZA 5IMMA 1WITA 2KC0A 1TNNA 2WHVA 3SPVB 2B4CL 2BDNH 3OHMB 2V33A 5I1JL 2FLBT 4CILA 1SVCP 3BLPX 4DGUA 3FF7A 3RWDA 1O0VA 3WN6A 3VNZA 2HRPL 3EZ8A 3MLSL 4UMGA 1JXJA 1KPVA 1CLZH 1TQVA 4OZIA 5DURB 3DSFH 3U7AA 4HJSA 1KXHA 4IHOB 3D3VA 4IKLA 1LO0H 4Y0GA 3NAAL 3WIFB 1OCCB 1DL7L 4L5FH 3IU4L 4LOEA 4JCWA 3RHWF 3TBSB 2BK8A 5CJQL 2QPFA 4PIBA 2I7OA 4MMYA 5T5NG 4F27A 1KYFA 1GYWA 3KPLB 3MV9B 3O2VH 3HC4H 1CI5A 1MNUL 3ALXA 2DIBA 4DVBB 3WKQA 1ZGLP 4U3HA 2JLPA 4FQPA 2XPGB 3S5LG 3N41F 1KB9K 2X1OA 4WHTB 3H54A 1U3HC 3PJNA 1IGIL 1TR7A 4JL2A 4IEFB 3ILEA 4EBQL 4KK8C 4L05A 1WGOA 1BM7A 4FQ2H 1RFDL 1XF5A 2B7DT 2H3KA 3N5AA 3JWDH 4OZFA 5C0AB 5EEWA 4GLRI 4OLYH 2PYEB 5ISZD 3CDZA 2EDXA 2N7SA 2WQWA 3OLDA 4XT1C 4EUPH 4PRHB 1EMTH 3QIWA 3DX6A 4X7SH 3HNTH 3RX5A 2AV1B 4MJ6B 5E70A 4YXLL 4WV1A 1DP0A 2AI0H 4YGVB 1CFVL 4EI5D 3L1OL 2O30A 2DOCA 2C1PA 4UAHA 2YPVA 2J12B 1TDQA 1P6FA 4PCTA 3L81A 3OXSB 3QIBC 4V1DA 4XC1H 2D31A 4XP5L 4Y7MA 2OMWB 4ZMNA 4HIJB 3BRDA 4JFXA 2DMBA 2NY0B 2WB1A 1NGZB 4RIRB 3LNHA 4LOUC 1IC4L 3CG8A 1HE8A 2OJEA 5GZNC 2Q3AA 3LSOA 2VLJB 1S5HB 2NY6B 4EZLA 1IKFL 4YHYC 5L2KD 3CFJB 2D9QB 1PLGH 3P11H 5DC4B 1AE6H 3LZQA 2OK0L 4G1EA 4FXTA 1IQWH 5K33A 2E5EA 4Q9CA 1BM3H 3FMGH 5FO9B 3ULSB 4DUXA 1QRNA 3MRJB 5TK2A 3BH4A 2DQTH 4JRYE 3MI6A 1YECL 3F8UB 4G59C 5DRNB 5DQJA 5F9OL 4D9RE 2VMJA 4GY4A 2XQBL 4GW1B 5FR3A 1KPUA 2YN3A 2X3AA 1MCOL 4PJCE 5FHBL 4WWKA 2VDOB 4MAYC 2EABA 3ARWA 3DIFB 2OXHB 3QULB 3VXQB 1CYGA 2NNXA 5IOPB 3DYPA 5E7BA 5ICZB 1C7TA 3KM2A 5FFGA 4N9GB 1W72L 1J0YA 1A7QH 1ADQH 2BMKA 2E76C 3IDJB 4CMMB 2PP7A 5J1TC 3UO1L 3KNBA 1K2DA 3ULUE 4ZQKA 2FH6A 1NFDF 1FHGA 3HG1B 1KENH 4XTRD 5ETUA 1R3IL 4B9IA 3E6HA 3ARBD 4ZW5A 2CA4A 1AIZA 2EDOA 4UTAA 3GF8A 2WBJD 1WWWX 1U8CA 2EE2A 3SE9H 4OGAC 2MQCA 2H3NA 4XE0A 1QSFE 2EDYA 3X11B 2YPVH 3QJTB 2AK1H 4FTVA 4MHHG 2OYLA 4H5SA 5DD6A 2Y3AA 3TO2A 4YPGB 1S4IA 1T0PB 1A64A 1HQRA 4OD1L 1YYCA 1JD7A 4X6FB 4A55A 2BH0A 4XCEB 3VGEA 1B4JL 3WD5L 1SJEB 1ZANL 2FEEL 4UM8B 2ISDA 5ENWB 1N3NB 1QKZL 3SDDA 1FE8H 1EH9A 1BJMA 3CSFA 3QCTL 3QJRB 1DYZA 2VQ1A 4RSYA 5B7EA 4KZDL 3F7VA 4FFZL 3NP3A 4LF3B 4JREB 4NIYE 1T20A 2FECI 2QQKH 3FFOA 3MCKB 4M5ZH 1FH5L 1IBDA 3TS8A 1OE1A 3ZK0A 3F7YA 4PW3A 5DMIH 2QKIC 3BD3A 1D7BA 1O9VA 4KKCD 1BA9A 1JK8A 3UTZB 4YHPA 1CGTA 3R18A 1KMGA 3QG6B 3UZEA 2DD8H 2FX8L 4ZAKC 3MBEA 4BFRA 1R0AH 1THCA 2RJMA 5CN2A 2WTOA 4XZUA 3GNML 1ACYL 5H8DA 3QZWA 3WIIL 3B1TA 4PUBL 5CLXA 3FQUB 1U8KA 2A9NL 2WQUA 4X5RA 3HFFA 3LRMA 3OB0K 5HYSG 2AABL 3QO1B 1CT8A 2GJJA 3RKPA 4S1QH 1A6WL 3I84A 1AGFB 2R0LH 3N40P 3F85A 1MJ8H 3U0TB 4HF5L 2YBRA 3SGKC 1P1ZA 3OJDA 4YFLI 3F12B 4MB3A 4UTAH 4FG2A 4MNHA 5CWSB 2WQSA 1IO4C 1TVBB 1BZ7A 1VKXB 4JY4B 3OM3B 2IXQA 2PCXA 3NABH 1A5FH 4Y4KA 3L7EA 4I0PC 3BUQA 4JFDD 4NENB 5F8QC 4BSWA 2FO1A 4LLVA 4NT6B 4U33A 3SE8L 3UGEA 4BJLA 3WG7B 2EYTA 4L3CA 4PLNC 1DVFD 5SV4A 3GC3A 1PG7W 3I02A 2V2WB 3GMRA 1Z66A 3LXAA 4OCYL 5F71A 4NFCA 5T1JA 4GG8B 2VH5L 3HJ0A 3NIGE 2QFRA 4Z1PA 2G3XA 3V6BR 1XCTB 1Z9SA 3RLSA 2J72A 4W9JC 2UWEB 4IRJD 4X4KA 1J0KA 3JBG7 3JV6B 2VDLL 3TO4B 2VR7A 3FL7A 4GMTH 3K72B 1ID2A 2VR3A 2PCYA 2DZEA 3DXAB 4ZO9A 1VZIA 3STZB 2R0WH 5EOCJ 2EKSB 1BVNP 3IM1A 3BFQG 1SM3H 3JVFC 3X2QB 4TRPL 2QR0B 5LDSA 4GRWF 4ACPA 3ES6B 2IH1A 3CZFA 2E9IA 1UM4H 4K7PH 1BSIA 2J43A 2R2HA 2X0UA 5AL0A 4MCMA 4DERA 1F6AB 3DVNA 3R8QA 3RURA 4PRAB 2YFNA 3IBOA 1XB6A 3S96B 3IXTB 5BOJA 4ZD3H 1YN7A 3S5YA 1II4E 2KZBA 2QQNH 5BQ7A 4ZXBD 2NNRA 5HHOD 4AITA 3C5ZD 1MAMH 2AQQA 3FB8B 5KJ4A 1IGYA 3PE9A 3K2UL 1S2EA 1Z2KA 4W9ZA 1IARB 4XP4H 1F2QA 5GGUB 2FUTA 2BCKB 4B27A 4PW9A 4PTUB 3GYRA 2X38A 3EYQD 1I1AC 1S5IL 2BY3A 4M6OL 5K9QG 5LVEA 3FCSB 2P5EB 1JTTA 1JCKA 1E9PA 2YZ8A 5I71B 1WCBB 4XNQA 1E40A 5FXCH 2X42A 1WAPA 3WLBB 2I69A 5E1HB 4HXBL 4OV6F 1U93B 5EN2A 1PY9A 2UY6B 1VSCA 2EVHA 4AW4A 1F4HA 4O51A 4XBEH 3SBWC 5GIRB 1TFPA 3FOMB 1MAKA 1I7RB 5FCSH 3CVBA 4QHMA 3AQZA 3L3OA 5C08B 3DURB 4OQ1A 5HHNA 5CCJA 1MH5A 2O5YH 3MN8A 3M8OH 4NZTH 1NGYA 4AK1A 1U8MA 2EZ0C 5FUZH 1HZLA 3DX0A 4GT0A 5E8DL 1DEDA 2IWKA 2QSVA 2WO2B 2XFXB 4AL8H 4PJDF 5C0BD 5E2UL 1NL0H 2VDPL 3P0GB 5HP5A 2IANA 1EBPA 2F53A 2W60A 3VXTA 5IVZB 3WHE0 2R7EB 3VYOA 4C56E 3W39B 1QOKA 4W6XB 4YSCA 1SJMA 3T3PF 1DTUA 4J3BA 4OFQA 2OPCA 3G04B 4ALAH 1G84A 3HE6C 1PAZA 1VFBB 1NOAA 3PNWA 4LPYA 1BHGA 3IU3B 4Z7UA 5FWRA 3MLRH 3RL1B 4Y2LA 4Y5XC 3V0HA 3PAVA 1F4AA 2A6KB 3MUGB 4BK4A 1A4AA 1FPTL 4HWEL 4W4OA 4CVZB 2ZWYA 1YMME 3DTXB 1THAA 4XN2A 2V5MA 3DX3A 2Y5QA 5C0DA 4EXPX 2QHRH 3KG5A 5JMOC 1RIVL 3VD1A 1MELA 3KGSA 1E30A 4GP8B 2R4RH 4JQVC 2DICA 2IGFH 4B7LA 4LLMA 2FE0A 1A7BA 1CGSH 1Y1DA 3F00A 3CXHJ 2E86A 1SEQL 5DJAB 2EVJA 1BXVA 4X9HA 1XIWD 3RWIA 3B7RL 1CJYA 4JHVA 1OANA 5FK9A 2J4WL 1KDIA 2CALA 2EEDA 1KJ2A 3GXNA 3RVWC 3T4AB 3TEWA 4MJID 3QS2A 4FDWA 1JERA 5JW3L 4K9EC 3ULUL 2XJLA 4NCDA 3QDMB 4PJAA 5GS1A 1IFHL 4JZJC 3ZVVA 2KMWA 4HV8B 1SJXA 1VGKB 4OZGF 4LOVA 1C5CH 2ZAGA 4QNPE 1BVZA 5AL8A 4P46C 3RAJH 3ULVE 4LESA 1TQWA 3RGVA 3WAJA 5E6RB 1MHHA 1A7PL 1NEZB 2HLFC 3KYMB 3QUYD 4K8RH 3ZDYE 3KYKL 3DX7B 3DV4A 3A3YB 3AM8A 3D48R 4PRIE 5DVNA 1JGVH 1OAZL 4UWQB 4KKAC 3UEZA 3ZHNA 4NQEB 3SHSA 4CBZA 4K5OA 4L8SB 2E9GA 3A0OA 3AS1A 2ZPKH 2OS7A 1X5MA 1JZEA 4DN4H 3T0EE 4ES8A 4MTMA 4M4RA 1YG9A 2B0SH 3QUMA 5EC2B 4GMSL 4I87A 3LNGA 2YRZA 3GWJA 4TKWA 3VH8B 2QMJA 1FL6A 1VADA 3DJTA 3ARFB 3B1UA 5DK0B 4Q9RL 3UYPA 5CLWA 5JQ6L 2JIXB 5KVFH 2VXUH 4O2CB 5AZEH 1TJMA 3SYOA 3EHBB 3GJFH 1AG0A 3HLKA 3GSWA 5HYJB 2WIIB 3CV5A 2WUBL 3ESMA 3UTPE 4KVNH 2LLGA 1EXGA 3QRFM 4ZX4A 4JBSA 5JXAH 5KS9B 3T0XA 2D3VA 4TQIA 4YBLB 4PJ8B 1WAEA 2F15A 3RWHB 1PEWA 5T5FA 1WFJA 1OWWA 5HTSA 3NIFE 1TQUA 4MNGB 4X8CA 3SEPA 3Q3GB 4G8GB 4XXWA 4RGOH 4APQD 3DC0A 4L1SA 3IFPA 5C0JB 1KWGA 1A6UL 1CQYA 1XGTB 2A73A 2N3JA 3NTCH 1DSFL 5KG9A 2DEWX 4CC4A 4B7IA 2YSTA 5DQDH 1BYNA 3LZRA 4OAWA 2VABA 4ZUTA 4AXWA 3DBXA 1F86A 1N7ML 1B0IA 1C5BH 1WAAA 1M53A 3AADB 3S98A 5KVGH 1OQOA 1YNTA 4UQAA 4IMKA 3IDIB 4WFFE 1BAFH 1SN5A 3OZ9L 4GI6A 4G43A 3HE7B 3GPEA 3ENEA 1EEZA 1JGUH 1IGCH 2WKOF 1Q0YH 3D4YA 2JQAA 3S3CB 3Q01A 1J1XL 3NSCA 3AWFA 5FEBA 4GSDH 4AC4A 1HKLH 3UDWA 3VFVB 1BQLH 2I32A 4C4UA 4N0UB 3WMQA 4LVEA 3VXOB 2Y36H 3GXIA 4U1NB 3WS6C 3VFWA 3FN0L 2CXKA 5IB2A 5IVNA 3PGDB 3ZDXB 4UINH 3TNMB 5TF1H 1DJHA 3G5YA 1MDAA 1B0GB 1R3LA 4FLOA 4JRYD 3QUMH 4JJHA 5EUOB 4X9IA 4D9RD 5IWLC 1OF2B 4HFUH 5IV2A 1A21A 3OX8B 2E7CA 4NUMA 5I82A 2M8XA 4UMSA 3SY6A 1FCCA 5J3HD 2GTWA 2Q8BL 3QUXB 4PHXA 2W65A 4ODSH 1V7NL 1I8KA 3C8HA 3FTVA 1PZ5A 3UTSB 4YWGH 1INEL 1J5OL 4I18C 2NSQA 4HJUA 5T5FH 2CBOA 3ARDA 4N5ED 1PD6A 2CUIA 3LEXB 1TZOA 4XNMA 1WFUA 5I1IL 1KN4H 3WHE1 1H9VA 3ULUD 1WDAA 4A7SA 1CXEA 4JDEA 1IQDB 4QO1B 3AJ7A 4JM4L 4QHPA 1NAMB 2MPVA 1E4KA 4J28A 1ET8A 4HXAH 1OTSD 4QJ3B 1BGXH 1J5HA 4N2LA 2RD0A 4FLSA 3MHZA 1TTUA 4Q8BA 3RTQA 2WTRA 1U91A 3EDJA 4JY5L 4PJ5B 3NJLA 3QHTC 3HZMB 5L4MA 1BQSA 3AXLB 4NQDA 1BQ5A 4X6DA 2VDQH 2XNAA 4GUOA 3GMNA 3WL9B 1Y7VA 3K4AA 1C12B 4X7TA 2I7SA 1WZ1H 1QSFD 5E51A 4BWUA 3O3DB 4EI5C 1N6QL 3MJWA 5D1XD 3DTUB 1PD1A 4N1HB 3HPJA 1A3LH 4TQHA 3ZUCA 5JOFA 1MCPH 3TP4A 2G60H 4MWFA 4RZCA 4Y2NA 1G6RA 4IBUA 1OSEA 1I82A 3ATFA 3UMTA 1G7HA 3IS1X 3QEHA 4P57B 1JWSA 2GI0A 1OAYH 5F1KC 1WBZA 5L9DL 1BD2A 2CDGB 5IJVA 1FN4A 4WEMB 2BSRB 4HBCL 3ZMNA 2CO7B 4W9KC 5I73C 1TTGA 3HLAA 2XFGB 4ZPTB 3SPIA 2NR6A 4I13B 1ONQB 2B08A 1GJWA 4PGCA 5F93C 3LXCA 1UXMA 2MKLC 4KH9A 5ICYA 3ESUF 3ZGIA 1CFSA 1LP9E 4LSTL 5DVLA 3STLA 4Y4HA 2ZOKB 2E59A 4FABH 3GBNL 3SYAA 2DIJA 4R4BB 2AQ3A 4KROB 5IKCA 1YN6B 5D7SH 4BUQA 3QYNA 5CR1A 4MD4A 4MB4A 4FZEH 3QUHA 3MZGB 1MJ7L 5C0FA 1QSVA 3EJRA 1GYUA 5DWPA 2OKMA 2YPLD 4H26B 3MLVL 5D93C 4XTRC 1ZWIA 2JJUA 3ARBC 4JJOA 5FDWB 3V4UL 4P4RB 4Z7VE 4CGTA 3MXVL 2Q8AL 4H88L 4AYSA 4WLCA 3UADA 4WFHD 1CLOL 2WBJC 3MV7B 4BYHA 2K7PA 2H7WA 1G1OA 2IDTA 3MBXH 4HS6A 2IDUA 1KB3A 3NJVA 3TA4D 4OZHE 2B4CC 3VD2A 1DEEA 5KSVB 4WSGA 3HZYA 4G6KH 5C9KA 1JZIA 4A7QA 5JIPA 1GY1A 4TLKA 2O61B 1EHLL 4R3SB 4ZFFA 2RHEA 3MUJA 5TD4A 4WNJA 4CNIA 4ZOBA 1DLFH 3O3EB 4K0OA 3TPUA 3HN5A 1I9RL 1JNLH 1MCSA 2E27H 5C8JA 3NFSL 1ORSA 1JOIA 4J39A 1NIEA 3LHPL 4IMLA 5ABAA 1H6EA 1JIBA 4MMZC 1U8HB 3PP4L 3PLYA 3LQAH 1XH1A 5FV2A 3BW9A 3U46B 1G9NH 3AQDA 1BBDL 3FO9A 1K5NA 2OMZB 2G5UA 2ZG3A 5KVEE 2Y9RT 4P2YA 2OYPA 1OD7A 5D7JB 3I6GA 4DCQA 3MA9H 4URTB 3TH4T 2P52A 4UT7H 4PJXA 5KW9L 2VMFA 5EIVA 4HPOL 3PWLA 2ERJB 3KPSA 1BZQK 3ZKND 5E1IA 1UT2A 4P2CG 4HK3J 4KKCC 3GS4A 1TVHA 3GZPA 1GOHA 1BQHA 4IRZH 5I0XA 4A6YH 2Z64C 3H9HA 3ZX1A 5CMAB 1I9JH 1KZQA 1QEXA 1N8ZA 4YPJA 3QNYA 2XU9A 4M7JL 3T2NH 3II1A 5FM5M 3EJYD 1XB3A 1CZ8H 3GB7B 1KCUL 1MCNA 2ENYA 3W82A 2DQDH 2F7RA 2XG4A 3RX7A 2AANA 3KAAA 1DZ0A 1MCBA 3WO4C 5GJSH 3MRPB 1UH4A 3DHMA 1N2RB 3L16A 1R3HB 2WZPA 1LO3H 4HQQH 5EORH 1AAJA 5B1CA 1RMFH 5MHSE 2MOGA 1M1SA 3C5XA 5CFHA 1EHKB 2WO3B 4HHWA 5DEJA 4JFWA 5I6PA 3PF2A 2AGJH 1KCRL 1H6FA 2ZONA 1A3ZA 4NBXB 4J12A 2JI2A 2NNCA 2WXFA 3BUBA 3JTSB 2CCWA 4LLUA 1DVFC 5A2FA 5T5NF 1RJZA 4AT6B 4HPHA 5JORA 4PJCF 1T1WA 5DYFA 1TTFA 3KW8A 1GW0A 4XVSH 4IRJC 5EBWB 1WWCA 4ANUA 4PWJA 43CAB 2MNWA 3QJHA 2EICA 1LQBC 3APMA 1U21A 3PCYA 5AYUH 4X4YB 4DK6A 3U9UA 4KTDH 5CEZL 1HILA 2B5IB 5LNEA 4ETQA 2E8YA 4UV4H 4QHUA 3CNKA 1D9KA 4NWTL 4P5MB 4A63A 4M62L 4FQCH 2F7IA 1A6TA 3U2IA 3VM7A 2ITDB 3AW5A 2WBWB 2G3NA 2WLIA 5GRWA 1GKOA 4EIUA 4KUZL 5B39G 5HPMB 2XTJB 2J5LC 4RMBA 2RAMA 1A1OA 2IEPA 3EGXB 4ZUUA 4S10A 3WU1A 2XVGA 4UILL 4R4FL 2X6CA 3NDZE 2VLME 1E5AA 2BNQB 3MLTB 4PVLA 5MEPA 2Y06L 4GINA 3B7UX 5EO1A 5TFSH 4EMZA 2GEQA 1NOFA 1UGNA 3NRFA 5E2JA 4ZXBC 3C5ZC 5CD3B 2GFBA 3BP6A 2XZCH 3CLFL 2XA8L 4HMCA 4YUEL 1GY2A 3MGAA 3GKZA 1G7QA 1UB6B 1SBSL 1ZT7B 3UGXA 1L9MA 1RZIB 4F33A 4W9FC 5DA0B 4A7GF 4BA0A 4WIQA 3NACH 3EYQC 5AOLA 2ATAA 3ATBA 4P3DB 3MA7A 4X8JB 1YY8A 1J1OL 3BUIA 4BFKA 3VQ2C 3S3BB 4G8EB 3FQYA 2VDKB 1Y1UA 3CK0L 1XGUB 3TBTB 1H0DA 3OSKA 4B9CA 3VFNB 3EYOB 4NKQB 1KIQB 4X9GA 3RWGA 1A14H 5IJKA 2OMTB 1SXAA 3BEVB 5B1KA 3MXWH 3ULVD 4XN9A 1NGXB 2ODIA 2GUOB 5ACMA 4FFYA 1YUHB 1PGRB 3GM0A 3LRLA 4BUHA 3PQYE 5IHUH 1NUDA 5TE6H 4X4MA 3U9WA 1O7SA 4IJ3B 2DYRB 4PRID 4BZ2A 2Y0SA 3CVHA 4PBWD 1YEEL 4ILDA 4HUXB 2CDFB 4JO4L 3VWKB 2F08A 5EZIH 5EZOL 3Q6FA 4N4YB 1XF3B 2AF2A 3WUZA 2Y4SA 1OCZB 5CJBA 5D4IA 3T0ED 3CFKA 4TUOB 4GIOA 3QXWA 3KCPA 5LAXB 1V3MA 3BUDA 3L54A 3H9SE 4ICXA 4N90D 3QHFH 1NCBH 3DDGA 5DC9B 2N0MA 1CFNB 2R29L 1A47A 1WRFA 3BVTA 1BQRA 4QRFA 3R4DA 2Z93A 2R59A 4F8LA 4GH7B 1ND0A 3O4LA 5I1GH 1FNGA 4KJQD 4YHLH 3IS0X 2PPAA 3ZL1A 3TCTA 3QFDB 4WUUB 3QQ9D 1A6ZB 1WO2A 3I6SA 4Y8DC 2XDHA 3ARGD 1KB5L 2V6HA 1XTMA 1Z3GH 2Z4QA 1XH3B 4LMQI 3WE6A 4OZFG 4GBXB 1HQ4A 4OQTA 4LSSH 1IM3A 1T4KA 4OB5H 5B8CB 3ZXAC 8PAZA 1NC2D 2G75A 1DDTA 2HJLA 4Y1AB 3L5HA 3SO3B 2MHAB 2YBGA 1KJ3L 4D7PA 1AKJD 1XIWC 3KLDA 2BFVH 2D0FA 3NIGF 4LSDA 1AXSB 2BC4B 3IKCB 3G6JB 3TFBA 4FEMA 2AJUH 2VXTH 4Q0XL 4J3VA 1RJYA 3VX0A 3WEXA 4PG9A 1SHMA 5D1ZA 5BS0A 2NTFA 1LMKA 4E42B 5AUMB 1PTZA 4ZG1A 1CFQB 4JM2F 5CCHE 2BSTA 4WFFD 4JVUA 1S9KC 2BP0A 4HKZB 1WD8A 2P44B 3BIBX 2IDSA 3MQIA 4MJ5A 5SWQB 1SVBA 1TTRA 3KGUA 4I5BA 2GAZB 1AS8A 2YGOA 4UAOB 1CURA 3ZKQD 3QUYC 3RIKA 2O5ZH 1FGNH 1KEGH 4IJTA 2AJXL 5DD3L 5FB8B 3CVHH 4QXGH 4OZIE 3CZKA 4YSOA 1ZXKA 5E2VH 3TF7C 4RX4A 4OJCA 4EUPB 1Q9WB 1W8OA 3EH3B 3MLWH 4M00A 3QG7H 3GGWB 3K6DA 4TPRL 5I9QC 3LKSA 2Y5TB 4G9FA 3W9EB 1JPTH 4KX7A 4YL9A 4MLSA 2QVTA 1JXFA 3UZQB 2ESVB 1KXQA 4GPVA 4BUGA 1UM6H 5AD0A 2QSTA 3WMPA 5J1SC 4L8BA 5EOCH 1JZJA 2Y7NA 4M3HA 1H8OA 2TAAA 5J1AB 1B2YA 4BKTC 4M93C 5E5UB 2K4AA 3EOBA 2EYRA 5BRZD 4ODHH 3GI9L 5E5RB 4C59B 1MHPH 4K07A 5FA4A 5F6IB 3ZL4H 5DD1L 1JV2A 5F70A 4IIQA 5GZOA 4JKPH 5CEXB 2X3CA 2VN5A 4ZMAT 4GG6A 1HESA 1A4KB 2XVBA 4Z76B 2V3FA 3RWEB 1NC4D 5GISH 5J11B 4NDMA 5ADPL 2APWA 1KTJA 1UD8A 2UZIL 1L7IH 2AMGA 2IWFA 2IG2L 2YK1H 4Y2OB 4FI8A 2WQ8A 3UX9B 5I8CB 5BCAA 3OF6D 2XZAL 3E7JA 1J48A 4MQSB 1F3DJ 1VZHA 5BUPA 1HH6A 1FFPB 2VJ8A 4V1DE 3KPPB 3MTXA 1VPOH 1G7PB 3NPSB 5ANME 1A0QH 3BUPA 2NLJB 3AMLA 4HMEA 4XO3A 4DKFL 4ZMZA 1BVLB 4GT7A 1XSIA 3V6FB 3LQMA 2W81C 3GMPB 4KX8A 4M02A 2BVOA 1OGAA 2B1OA 4OCWL 4Y4FA 1IGTA 2CH8A 3KDMB 4XPBL 1Z9OA 1N19A 2N7BA 3WNKA 1GTFA 1ZRUA 2YQGA 3VXMD 5HJDA 5F3FA 2Y25A 3T0BA 3Q9PA 2X4NB 4IKNA 5FFOA 2VKXA 3BT2H 5G5DB 2RCSL 4Z78A 1Q94A 5I1EH 4JFOA 5ALBL 5F96H 3MRKB 5B38B 1JF6A 1NDGA 4L9LA 4BH8B 2YAEA 1I7ZB 4F2MB 3JTBA 2X4UA 2HKHL 5HGAB 5C0IA 4LSUH 1J8SA 4LLQA 5JTWA 2BW5A 4FLQA 3VI4B 2YD6A 3UL4A 1KTLB 1CF1A 2KLRA 2Z31B 2OR9H 4LKCA 4ZOAA 5FS5A 3LS4H 3QEQB 3VXRA 5DHVA 3ESNA 5J3HC 3QZWG 1GL4B 1OSPH 3VGFA 2J6EL 1O5DT 3GHEL 3O6FA 4Y19A 1RAMA 1A9EA 4I2XB 3EJZD 4NLHA 2WYZA 3IPFA 4QNPF 2DQEH 3GQFA 4I77L 3QZMA 4TSCL 3ULVF 3DGGB 2ZICA 1YRKA 4N5EC 1E27B 2D0GA 1T1XB 2PR9A 2FBOJ 3QQ3B 1IIIA 3ZDYF 3ULUC 3W5MA 3FQNB 3MREA 3N2JA 4ZTPL 1HSAB 2PCPB 3EO0B 3ZL2A 1RZJH 2X9YA 1OTSC 3MRCB 2VMDA 1XH0A 4PV9A 3VI3E 3D4ZA 4KNQA 1QLEB 1TQTA 1KYDA 2A99A 2C5DC 4OF6A 2GIXA 3IVKB 4XPAL 5AKSA 3CZLA 2VERA 1QLRB 2HMID 1BZDA 3FW6A 5D1XC 2DQJL 2UXFA 4WCYH 4ZMPA 4PRPA 2APBA 1ZV5A 4TSAL 2H0EA 3U9PL 1E28B 2BRQA 4P5KA 4FKKA 3BP4A 4LHUA 4YFDB 4PD4K 4J3WA 2YUZA 3DOSB 4AUYA 1ZA6A 1CDCA 5IR1A 4ZTOL 5F9DC 5DMYA 1QFHA 4ZPVB 3TBYA 15C8H 2OR8A 3KPRB 2P3YA 3QR0A 2D7MA 3ZYOA 3QIUA 4GXVL 4OGYL 3NIFF 1UFUA 1VESA 1MEXL 1NAKL 3GSXA 4Q74A 4P9HL 4U6VL 4B5ZA 2AXHA 5MEQA 1LM8V 4QY8A 1FWXA 2GK2A 4L4TB 4H25A 1QZ1A 5T1LD 5A2AA 3UG4A 1XF4A 2GJ6B 4DPAX 1D7CA 3RBSA 5D96C 4DSYA 3OLEA 2A6JB 2J2ZA 4EXKA 1QNIA 4PB0L 2P80D 4TNEA 2J5WA 5DHVH 4LGPB 3HW7A 3PWUA 1KJVB 3CBJB 3O8XA 4XR8C 4FQ1L 3X13B 2F6AA 4AYMC 3DGDA 2P5WA 4H40A 2JCCE 2NZ9D 4PBXA 4CSZA 5KSBB 5E99L 3VRLF 3QXAB 1E90A 3ZO0A 2HVJA 3I74A 4G7QB 1UA6H 4K3GA 4UT9A 3WFEH 3N85H 4Q6KA 4AQAB 4Q6YA 2B2XL 1TNMA 4PP2A 5EZLA 3ORJA 4FQHB 2A6DB 3DECA 4HIEA 3RNKB 4LVHB 1YEDB 3P4OA 5MHSD 4OFYA 1AQ8A 1BFSA 3FONB 1K4DB 5DJXA 2AEQL 2Z7UA 2WSPA 4ODVL 4CW1A 3FSOA 5DJDA 5JDSB 2IVFC 4XRCB 3LPWA 1ASPA 1KCVL 2HRLA 3RDTB 1S7VB 3TN0D 1H6TA 3TX4A 2EIBA 1RJLB 2PW1A 3Q7JA 3QARA 5D7LB 3A4FA 1FSKC 4PJFA 1T1YB 4WTQA 1LEIB 1KGCE 3KWWB 3CFIC 2WZ0A 1C08B 5DK3A 5DRZA 5GQBA 4R2GD 2PW2B 2ZKHL 2A38A 4AQZA 2JKTM 4ZS7H 3V5KA 1LTXA 1G0DA 1S7XB 4TLTA 5T1KB 2FWOB 3DX2A 5G2NA 1NPUA 3KPNB 2QV2A 3SY0A 1U30A 3MRDB 4WK4B 1LK2A 3W0WB 3IETB 1HXMB 1HSBA 4NO2A 1AD0A 1IGFH 4U3XA 1AO7D 1VGEL 3ZE2B 4TUJB 1IAIL 3SB3A 4K94H 3ZKNC 2EYTB 2XYCA 3NSYA 3TBVB 2V7NA 5E9DB 2ORBH 3BJ91 2A9ML 2XN0A 4LPXA 4M5SA 5DZOA 5JNYA 3OQRA 2QADB 2CJTA 2ZCZA 2DYPD 3R8BB 1TT6A 3CMOH 4J8RB 3EJYC 3DJRA 1UH2A 1QFUL 5I6MA 2DTML 4X6CB 2KYIA 1J1PH 2ADGB 1E42A 1A4JA 3CU1A 3EDEA 5MENB 2MKWA 3JVGA 4NKOB 4O02L 3BSZA 5I23A 3JZ7A 3KVPA 1A22B 5I75C 5K5YA 3ROOA 4NRXB 4Y9GA 3ZRCC 2IAMD 2G9HB 2CKBA 3H3KA 3BIKB 5I1AA 1GZHC 3IRZA 4D3CH 5BV7L 3D18A 3VRJB 2ZP8A 1BZ9A 4PN6A 5A2LH 1I8LA 4WNSA 2C3WA 2F74A 4XODA 5AOZA 1YNKL 4PJBB 3PQYD 2SEBA 4U1SA 3FB7A 1FIGL 2JTDA 1OAKL 1LP9F 1F0LA 1S9VB 2QL1A 1SFHA 4XN8A 3KWTA 2Q10A 4R97C 4IBVA 3OKDA 3IN0A 1EIBA 2DWDA 2Y07L 1F42A 1BG9A 3AS2A 3BQUB 3PWVA 1I7TB 1BZ8A 1TJXA 2WMPB 2IANE 3IFOA 3LKPB 5I28A 1DE4A 4HDIB 5IFAH 5JW5B 2VQTA 5C3TA 3MRRA 4PJ9A 3H9SD 4YDJA 25C8L 1ML0A 3HFMH 3VFSA 3HTLX 5DEGB 2VIRA 4PJEA 3VE0B 4UOJA 3OG4B 4Z7VF 3GLEA 2HUHA 2MCPL 4QRQB 1KBBA 1EZLA 1Z9LA 5K9KA 4Y8AA 5HI4D 4P9ML 1PDKB 3CE1A 4D0BB 3K80A 5G4NA 2Z91B 1JZ2A 2WXHA 1MCHA 3PUUA 1HEZB 3WFCL 2FBRA 1T66D 5D71H 5C09D 3OJMB 4YHOH 2A74A 1XR9A 3R4RA 3MUY1 4JE4B 4A2LA 3OTTA 3L3GB 3LEYH 4JGNA 1ETJA 3FUNA 3GSQB 1BPLB 1GGCL 3TA3A 1RUQL 5C0AE 4YDKH 2IH9A 4XWOD 3FDWA 3BSZH 1MCEA 3I6LE 4QCIA 5A16A 2PXYA 4PJAE 1ZGLB 4WWPA 1CS6A 1FUNA 1YCSA 5HJ3B 3KEHA 3FAWA 1K72A 3GJFB 3FO0L 2H2SC 1EGJA 2CKBH 5EO9A 2EDEA 4HCFA 1Z3RA 4JMXA 5T1MB 1MCRA 3ULVC 4RSVA 4FOMA 4LCYB 3P77B 4L4VB 1NCWH 1JZ8A 4X6BB 3E80A 1VA9A 2R0ZL 5EWIH 4NKIL 2BZ7A 1IC0A 1UUSA 2D7TH 3PGCB 1VEMA 3ARVA 1CDUA 2IBBA 4NKMB 4AQ1C 4XMTA 2XVKA 3BUYA 1INQB 3FU5A 4OCXL 4UQ3A 2XV2A 4B6ZA 4M7KL 1HXYB 5JW4N 3SQOH 4XPFL 5CZRA 3T0EC 4LEOA 5KYUA 2XWTA 1MLBA 4LIQE 2VXVL 4PEEA 3GMMA 3QW9A 2I9TB 3G5VB 3WJLC 35C8L 5JDJA 1JYNA 2W0PA 1JF1A 3UTTB 2IALA 4NN6C 4KJQC 1OXYA 5L88H 3GJEA 3QQ9C 4M43L 4POUB 5D4QA 5EA0H 3MRGA 1M6OA 4Q6IA 4TM9A 5IMKB 3QDHA 5TQ0L 3ARGC 5F0LB 1EEYA 4DF9A 1OB1A 1RUKH 3AG4B 3R7RA 3VO0A 1JZGA 3LKOB 1T7ZA 3HHSB 4K3DH 4MA3A 5ESAB 4G3YL 2OA9A 3D06A 3BP7B 1UXSB 4KRPD 1P7HL 2Z35B 4DP5X 2QSCH 3CH1A 2CMRH 1BBJA 1AZBA 2YD5A 3D52A 4CVXB 3VFUA 1WAAE 1NMAH 2R69H 2A7BA 2ZUSA 3SE4A 4XVTL 2ZSWA 4UTBH 1N0XH 4PWGA 4L9DA 3C60D 5D9SA 4YDIL 2OP4L 5KN5B 3V6OC 4M48L 2B1AL 5B1BB 5CJXA 3IF1B 4Y2DA 3GMLA 2A83B 3TL5A 4EI0A 2GC7C 3Q5YA 1MCWM 4NZRH 5I1KH 3FBKA 5CJ5A 4E41D 4Z23A 3OXRA 2ZXGA 3D6GA 3L4WA 1E9QB 4KKQA 5DQ9B 4LSRL 4RBPK 4X6EA 4AENB 5HHQB 5I74C 4X4XA 1J9QA 1EFXA 4PCKA 3ZDZF 4TVPE 5D5MB 3HN8A 1P5UA 1TTCA 1DBKL 3V0WL 2VISB 1O7DE 3QB7C 1YPZB 4ODBD 2VDQB 4CSTA 1FL5B 4BV1A 1AVAA 3X3GH 1KLFB 3DO7A 4PRNB 4JHWL 3MRLB 2AKRA 1TEGA 3QEGL 3VB8A 2IMNA 1EEZB 2E9BA 1C8PA 4IKKA 2AEPL 4N0FB 1YNLH 4KX9A 2NX5B 1W16A 4DK3A 2ZP9A 4JFVA 3BZFB 1KTCA 1QSEA 2OSXA 3WNJA 3QI9B 4YBQD 3IDYB 2HT3D 1U3JA 4NJAL 1SQ2N 3L7FB 4NFBA 1RZGA 1MFNA 4PJGB 4LL4A 4NNYA 2V4LA 4ODUA 3TU6A 4NRZA 1CYXA 2WV3A 4HT1H 2OFQA 1F4XL 1R19A 2EDLA 1DSYA 1YEJL 2EUZA 3VD5A 4YZFE 1Q4NX 4K3EH 1XF1A 4NWUH 2XA3A 4OJFH 3FCUB 4HJEA 1T7YA 2AEOA 3APDA 2FIKB 3EJTA 3OVUB 4G6JL 4NM8H 3IBEA 4Y5VC 1NH6A 4NQCB 4XCNB 4R26H 3SDCB 2AXGA 2YAMA 3OC8A 5DRXA 3FQRB 4BXVA 3CDGB 1DCEA 3RB7A 1PY0A 1XGQA 5E5MB 3TEYA 1ZY9A 4GQRA 3QWQB 4WI8A 3TEZA 1ODUA 3FCBA 4KKRA 4NN7C 1U3HA 4H0HB 1JRHI 2JB6A 3WY2A 4W4NA 1R75A 3ZKXC 4Q2ZB 1EXUA 4P2RB 1QTSA 4NUJB 5DZPA 4BQBA 2CUMA 1MIEH 1XT5A 4MNQB 3DXAE 1AS6A 3K0WA 2ZXWB 2ZCLL 5FKAB 2ITCB 3HMXL 4IKIA 4AGOA 2FJFA 1QBLL 2IQ9H 1BP3B 3EG9B 3TWCL 1BQHG 3FT3B 4NHUA 2BOCB 3MBED 5D4HA 3QIBA 2A9BA 3SGEI 2CXGA 4XAWL 1KC5L 1MW2A 3AC0A 4WTWA 1TPXB 4J3OC 3VD7A 1EAPA 1MRFL 1H9DA 3V4PA 2FECL 1T2XA 3EJZC 3JWOL 1HHHB 1S9WB 3OR6A 1PKOA 5JHDE 4EQ2A 5C9JA 5GZNA 1MRCH 3IJYB 5DUPL 43C9B 3QORD 3DHPA 5L2JB 1DQQB 1UZ8A 4GXUN 4GNKB 2P8PB 2ZNWA 2Z8RA 1UXWA 5IB3B 3BAKA 1Y6MR 1I8MA 3CXHK 4OZIF 5ESVB 4F8QA 3LPPA 1PG7X 5C0GA 3T6ZA 3QUZD 5DJZB 3ECBA 3AAZB 1X44A 3C08L 4ZW3A 5IQLA 4A6YB 5HD8C 2HMIC 2OAAA 2IPTL 5HGHB 3S7GA 1VLXA 5GS2D 2V3EA 5JPNC 2CO1A 4PY7B 1TIUA 4KTGA 4MAYA 4DEPC 4X80H 1K6QH 4UU9A 1DVUA 1NEZG 4OV5B 1KGCD 3LRGA 5C08E 2E7BA 2XETA 4P5TB 5DK2A 4ORZC 3SD2A 4YQXH 1UA3A 3DBSA 4TS6A 3GRWL 2NUTB 1HI6A 4NHCL 1SF3A 4N24A 3WKPA 1F45A 3KLQA 5I5JA 4P49A 3MJ9A 6FABL 4TF4A 5F89A 4KRNA 1CK0H 1NCDH 2D8KA 4PJXE 4G6ML 4DGIL 4PGEA 5EF2A 3B9KD 5KYXA 5IQNA 1U8PB 3A4AA 3HI6H 3ZE1B 4N8VB 2OSLA 3LOWA 4DN3H 1SY6H 2OZNA 4LLWA 1EDYA 4YK4B 1R24B 1P7KA 2N4IA 2LU3A 1K4CB 3I6KA 1JN6B 1GSMA 4A2GA 3S37H 4XBGB 1U33A 4JPWL 1YMHB 2NZ9C 3QRBA 5CD5D 1Q9KA 2P7TA 2D3LA 2PR4H 3S88L 4LZKA 1HS6A 4ELKA 1PJWA 2R39A 1NANH 2VDOL 3KYOB 4U7MA 1BX2A 4U1KB 3RKDD 4LHJB 1G7IB 1SMOA 4D0DB 5IMLA 1Y07A 1T4WA 2HVKB 5CAYB 3S3PA 4AZUA 4HUKB 1OLZA 2OZ4A 4K3JH 4EIZC 5I15L 3UPRA 3TJPA 3AWGA 3PHQB 3O9WB 2D2CC 3N1QC 2GITA 3DOIA 1I1YB 3NA9H 2BX5A 4KOCA 3L3KB 1MCKA 2QKIA 3CZEA 3TN0C 2YFOA 2NY3B 4MQ7B 3B5HA 1IBHA 1NCGA 3HEIB 1G7JA 5GSVA 4ZAKA 4HUWB 2NQ3A 2WOBA 4KQ3L 2UZYB 5DXWA 3BE1L 4YE0A 4R2GC 3T3MF 3OC5A 4YN3A 1RZFH 4KXZI 4TMPA 3B2PA 1EZVX 2FX9L 5AB0A 1RHHB 1CWVA 3GI8L 1E7VA 3B3IA 5DURD 2E7MA 1S7TA 5FO2A 4HH8A 1P4IH 3OKKA 4HC1A 4PRDA 4Z3EA 5EZJB 3EFOB 3L6FA 1LO5B 3H7BA 4BSJA 4CJ0A 4XCCL 2I07B 3VG0H 2R2EB 5AW8B 1RZKC 2EIJB 1R1CA 1HINL 2X1QA 4G6FB 3HS9A 2FJUB 3MV9D 2OL3L 1IBBA 2DH2A 1RQ5A 2YWYA 4G7RB 4NKDA 4E5XB 4Z7QE 2YUWA 5I1CH 5IREA 1M71A 2VXSH 2XN9A 2W94A 4LL1A 1BREA 4MNGE 5LXGH 2GYSA 4WWOA 2EDKA 3BVNA 5C0AD 3VGDA 1AP2A 1KLUA 4WKXA 1ULVA 2PYED 4Q14A 1A6TB 3FNKA 3GRGA 3MX0B 3CZUB 2GJRA 3I6LD 4L29A 5HGGS 4TVUA 1A02N 2XX1A 2VZTA 1CFTA 3MNWA 1A1MB 2IAMC 4PRHD 3LKQA 1I7UA 1M9SA 1BJ1J 3RNQB 3C9NB 2OZ4H 1MF2H 2NOYA 1AGEB 3ARRA 1IM9B 5DJCB 3SBRA 4MDRA 4MD5B 2JELH 1CXHA 1G1YA 3S4SB 3OZKA 4YHZL 1PQZB 2P46B 4Z7NE 3S35L 5J4MA 1TLKA 2NY0D 4P9HC 1FFNB 1A4BA 2MIZA 3TONA 4YXHH 5M94B 1R5WB 1GZQB 1AIFB 3AG2B 4BH7A 1GGTA 1ZT1A 2YRLA 5LUMA 2XWBB 4LNRA 4MS8D 3R06A 2NY6D 2YAPA 3UOAB 5DJ0B 1YEKL 3LRKA 2JKWA 4H8VA 3Q5OA 4ERSL 3KGRA 2YMOA 5DDHB 1EO8L 4XN7A 3U0PB 4JCLA 4TOYH 1OP9A 3QAZB 1I1AA 4WGWB 3ZDXE 1KTBA 2DJSA 2A1WL 5HGDA 2OTPA 2K8MA 5AVVB 1MQ8A 2I9LA 5IBTH 1LEKA 4AUUA 5EUOE 4UQ2B 3VD3A 2XQYA 3L4ZA 3PJLA 4LQFL 1CE1L 1TZIA 1FNEA 2GKIA 1ZTXH 3TNNB 2OJ1A 3O0RH 2F54A 5J13B 5HI4C 3SBWA 3D0VA 3BH9A 2Y5EA 3EGDB 5E9AA 3U6XS 1RURH 1HIMH 4AIXA 1OPGH 3O45A 3PY9A 1Z9PA 1T66C 4L1DA 3FJTA 4MXWL 1AD9B 3E8UL 4MA8H 3QXDA 4QXTB 3REVB 4JZNB 1O6TA 2E4FA 1KBWA 1W80A 3L4VA 2X6UA 4JFFA 5HPOA 1I4FA 3HG1D 4XWOC 4OF7A 2NY1B 2VN7A 1TG8A 4I9XA 4JX0A 1CGXA 1HEHC 3QBTB 4L37B 4CUCA 2PTTB 1D5RA 5KSAA 1DJYA 1NCAH 1IC7H 5HGBA 2DQGL 1L6XA 4PJ5E 3VD4A 3WXVH 2F8XC 4HZLA 3A67L 1WA2X 3HE6A 4YDMA 4OIIL 5MEOA 2EC9T 4WRLA 2A9AA 3RL2B 2GBVA 2R0KL 3CVIL 4HUUB 4I88A 5GRXG 1UWYA 3FTGA 1J9TA 4DO4A 3KBEA 1UZ6E 2H8PB 2HJLB 3FT2B 4UF7C 1KCSL 2NDFA 1I3UA 5E00B 5C1MB 2L7EA 4JCMA 4TVPD 4JQVA 3T09A 2VOTA 1ASOA 1X3DA 5FECA 3HC0B 1KV7A 1DUZB 2GY5A 3CSGA 2FJGB 3SKNA 2JK5A 2P5PA 4G9FE 5I1LB 2DWSA 4XH2A 4JDTL 4LPWA 4QR7A 4AG4H 1P53A 2J8UA 1S9XB 4G1MA 1ZHBB 1NCNA 4HJGA 2X88A 3CFDB 5JO5B 4JLRA 5PCYA 3U36A 3MRQA 3UMNA 4F3FA 3A6BH 1CQKA 3NCCB 4P46A 4BK8A 5INDA 2FYYA 3BH8A 1SNRA 3M1BB 1C5DB 4Q0XH 3BJLA 1B9ZA 1ZV9A 4H8HA 1V7ML 3ATAA 2CIIA 1NZRA 2JJTC 2HH0L 1NFDA 4D2NA 4KRPC 4YR6B 4TUKH 2APVA 4TLSA 5CILL 1QFWI 1KN2L 5KBDA 3RUGA 2VLLB 4I48A 2CM5A 3OPUA 2WXKA 4N6RA 5BV7C 1SHXA 4IGBB 4E2OA 4CAGA 2HRHA 4LVOC 3L1FA 1J86A 2GK0B 3BAXA 3K74B 1W72B 3UCQA 4QRTB 3ARSA 3JTTA 1JZ7A 3P4NA 4AOFA 3C60C 4PVNA 3MV7E 4FTDA 5EF1A 1A1NA 3NJHA 3QNXB 5EU3A 4ODWB 4NUPA 3OR7B 4PRBB 3EBGA 1OGAE 4Q9BA 4Z7UF 4BWWA 4QGYA 4CJ1A 2IBZY 1BVNT 3QA3A 5ITBH 1X9UA 1XSOA 5FM4A 4XO4A 5EIIB 2TSBA 5TDPB 1LO2L 3Q6GH 4MDJB 5BZWB 3VGHA 3VUAA 3FBQA 3CSTA 1XEDA 3MJ8A 1T0OA 4R90L 1LEGB 3FB5A 1GAFH 1JPFA 1F00I 1N12A 4KQ4L 1PL3A 1V05A 5KVDH 3T6WA 1KCBA 1A9VA 4AVHA 1GPOL 1IGJA 4MGXA 4O9HH 4U0RC 2NR6D 3DXAD 4GSUA 2C34A 3BYTA 2YS4A 3O4OB 2IWGA 3EOAA 1FNHA 3AB0C 3O6MH 3H53A 1RK7A 4XNXH 5DJ2B 2W9LA 2P24B 2ZKYA 4FNRA 5IEKA 2WLMA 3CC1A 4QRPB 3CTTA 3CN1A 4PJAF 1OIOA 3M7FB 4JDVB 1JNNH 4XOBA 3MLXH 3QJUB 5AZ2L 4N1EA 5T3ZH 3Q1EA 3L1GA 3VXSB 3CXDL