1WG3A

Structural analysis of yeast nucleosome-assembly factor cia1p
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
166
structure length
166
Chain Sequence
ASGSSGMSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Anti-silencing protein 1
publication title Structural Similarity between Histone Chaperone Cia1p/Asf1p and DNA-Binding Protein NF-{kappa}B
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 1wg3A00
2Z34A 2Z3FA 5BO0D 2IDCA 4EO5A 2IO5A 2HUEA 5EIIG 2I32A 2CU9A 1TEYA 1WG3A 4RRPM 2IIJA 2DZEA 4ZBJA 1ROCA 5BNXD 5C3IA 2YGVA 3AADB
chains in the Genus database with same CATH superfamily
3BGMB 1B3IA 1RZ7H 3QDMD 4K7PH 2DPKA 4ZK8A 1DHKA 1E2WA 1Q0YH 4GAYB 2CHXA 4JRWA 1KGWA 1YYCA 4KPHL 4FA6A 4CBZA 2UWEB 3TF4A 3BIBX 3CDZA 1IC7H 4OJFH 3I2CH 1BVNT 2HWZL 3VGBA 1JPGB 2F54A 3MRFA 4MXQC 4WEMB 4PB9L 4XNYL 3FMGL 3IFLH 1RULH 5DVOA 2XX1A 4FZ8H 4AYSA 5DD0L 1JDCA 2K6WA 4OZGA 4P59H 3JYCA 3FSAA 1C8PA 2BNQD 4OJCA 1LDSA 2VMDA 4PLKC 1FNSL 2LLNA 5DXWA 3LNHA 4PR5A 1OSPL 5F6IC 4QHNB 4PRHD 5L6YL 3EFDL 3QJVB 4L8CA 4K3GA 5F3HB 2F8OA 2IH1B 5D7IF 4L3ED 3H2PA 2DM7A 1MCLA 2Y1AA 5AAWC 4TSCH 4BK5A 2CXKA 2OI9B 4LSPL 2R2EB 3R8BB 2DTML 3RDTD 2BP5M 4JGMA 5FYJD 5BVJA 1V3LA 2WLIA 1MJJB 1ID2A 4N86A 2YOAA 2PYEE 1UB6B 4W9KC 4XVUC 1KWGA 3MNWA 3EIFA 2FT8A 1CLVA 4J6IA 1YJDC 3QEQA 1P1ZB 3V0AC 3A0OA 5HJBA 1TTAA 4Y19B 3Q1EA 3GLAA 5DHEA 1P5VA 1IAIL 4EKJA 2IWEA 1ZSDA 3WFZA 1GZQA 3S36H 1OF0A 5D7EA 4QNPE 4ZAKA 2QTEA 2Q76A 1IJ9A 1DLHA 4HDIB 1YEEH 3FXIC 1OY3B 1T5WB 4D9QE 4FZEL 3M88A 1MHHA 3IE4A 3P2DA 4RMQA 4J1UB 5CJ8A 5B8CA 4WU5B 3WIHH 1X9QA 1Q9WA 1IC4H 3FYIB 4ODTL 4N25A 4M1CD 4ZD3L 2UVEA 4Y4KA 3ARVA 4P5MA 4PRIE 3QDGB 4JFDB 4HLEA 3V0DA 1OAKL 1Z7JA 4H7VA 1XF4A 3LNGA 4IDJH 2YPVL 3BVDB 4PV9B 4XO4A 3WHXB 1YUHB 1QYGH 1GIGH 5D7LB 4JDZA 4LCWB 2ZNXA 1NPJA 3GLDA 3L9RA 4Q6IA 3WNIA 5GZOD 4JKKA 2ARWA 2FJHA 3F01A 1KC5L 5E7BA 3RIKA 2MSPA 4PN6A 3EGDB 4LHQB 4GUOA 4NO0B 3V4LA 2P5WB 3RWFA 2H0JA 1J0JA 4AYBA 3EH4B 2WN2A 3FOMB 3GHPA 1IGIH 3HJEA 1B2WH 1S2EA 3EYOB 1NAMH 1AFVL 4NQDB 1GJWA 2KUTA 2CNZA 2VC2B 3EGXA 3FTUA 4M7ZC 2XNAB 2Z6FA 1VDGA 3EJYD 1MCSA 3FYEB 5DRZA 1KB3A 4UQBA 4G7SB 4N0FA 4JHAL 3F7PC 5CEZL 3NEEA 1T1YA 4LT7A 3ZSSA 3VGAB 3R4RA 4XCCH 4GG6B 1UZ8A 2IALB 2X6AA 4ZMQA 1XX9C 3K8MA 3Q1SH 3PG2A 1YSOA 1R5IA 3JTBA 5EOCL 5IESH 2CMRH 4WWKB 4OZGE 1G9NL 3S4SB 3SE8L 2APTA 2AABH 5IBTH 3L54A 1S9VB 5FW7A 3VXNA 2ZP8A 3IFNL 4JR9L 3QXTA 4HHAA 2Z34A 4KBPA 5FHAH 3HI5L 4Z3JA 4FF9A 4JFFA 4HGWB 5HDBE 3APCA 4PY8I 1NCJA 3Q9PA 2H6PB 1SJXA 3C12A 4FG6D 4PRNB 4MTMA 3BP7B 1O5DT 4KI5D 5BXFB 1PDKA 1UD2A 3GMMA 3FSZA 5DQDH 3EG9A 1FZJB 3BRGC 5T3ZD 1OAQL 3T6QC 3BAIA 1S7SA 4LL9A 1C1EL 3LEYL 1GPOL 1QPKA 2YO3A 4OD3H 5EBLB 1UOKA 2VXSL 2FEDD 3Q9QA 3OHXA 3F12A 2Y22A 1WCQA 3CHPA 4MQXD 3CFIC 2CCLA 5E8EA 1UWXH 1ZSHA 3HE7B 4RGND 3MYJA 2C7FA 2K9UA 3HNVL 3LN9A 4BH8B 1C5BL 4XH2B 5AD0B 4X8CA 4IIQB 1INEL 1DVFC 5D5ME 3FH8A 3VSUA 1WPCA 2VN4A 3KM2A 1B4LA 1W8EA 4WO4D 3MODH 1DVUA 3W1ZA 2ZKMX 2PPEA 5LBVA 2EVIA 5D8JH 4Q9RL 2WOYA 2D03H 4QOKB 1JJUA 1MHEB 1OGAB 1I9IL 2BSSA 4JZNA 3KPQA 1JZIA 3BP5A 1G6RB 4IOFC 4XVTL 4AYID 1P84J 4WI7A 2RCSH 3O11A 4F9PA 1JDAA 1D5MA 5E9DE 3EO1A 4XP4H 5FYJH 2ZF8A 3X11B 5HYEA 3T0EA 4NQEA 3L7FB 2LQRA 1UUNA 2RALA 3LEVH 5EC1A 5BRZB 2P26A 1ACYL 3KHQA 4UM9B 4XBEH 5EDXA 4UOZA 4YXLH 3LZFH 4K23L 5C0DA 1FBIL 4NC1E 2AXFB 2Y07H 3H42H 4MHHI 2F19H 4P2RB 3UTQA 3UCQA 4GUPB 1S3KL 4E9QA 4JG0H 4QKXB 5C08B 4IHBA 4N2MA 2ALAA 3QG6A 1NEPA 2BC4B 3AS3A 1WZAA 3NJVA 1UM6L 3QO1B 3NGBB 1RSFA 3ZUCA 3EDKA 3LKRA 3TONA 3VRIA 4PWHA 2F54B 4AW4A 2RD0A 4OJAA 3WKQA 3TBWA 2K45A 2OP4H 5IG7A 4OLVH 2YSSB 3N1MC 1DJXA 4ADGA 2XCMC 5E4EC 1R0AH 3MROB 3JV6A 1MCOL 5C0RH 4ZODA 3GMRA 2EXYD 3UAJC 4QTHB 2IQAA 3ZL1A 4DVRH 1P4UA 2ZG2A 5FB8A 5EOCJ 3SGKA 5JORA 1SOSA 3Q6GL 4YL4A 4P2QB 1PJWA 4LEEA 4M02A 3AT0A 3RNKA 5IB2A 5IVZA 3PP4H 4YDVB 3L5XH 5F1SA 3BLKA 5E1AA 2R4SL 4Z7QB 5DHYA 4ZXBA 2ZXGA 1K3IA 3BFWA 1MPAL 3ARGC 3D9AH 1AZVA 4ZOAA 1RUAH 2O30A 4E41D 1F58H 4NN6C 2DWSA 5IMKA 2CDGA 3ATFA 3MNWB 3VXPB 2AC0A 3V2AR 1QNZL 1RVFL 5DS8A 3LD8C 1R3JA 2YPLA 2PETA 4QHKI 4U6HB 2XPYA 1MIML 4NSKA 4Y9EA 1URZA 3FKUS 3GB7A 5HPMB 3MJ8B 1AG0A 4R7LA 1IGFH 2HT2D 4YDNA 2IH3B 4PD4J 5EU6D 4GMSH 1CURA 2P24A 4LOUC 1YY9D 4HV8A 1UB5A 5IK3B 3WJJC 4WEBL 3QIWC 1CG9B 1MI5B 4POUB 3AY4A 5L8JB 1JZ8A 2X6MA 5D55A 2YRZA 2X38A 3PGFL 4FMVA 4ZAKB 3UACA 5J4MA 5GSVB 3J2PA 4TQEH 4PG2A 4PPTA 4ELKA 3OL2A 2X44D 3CH8A 4ANKA 5C07A 3B9KA 4RZCA 3OKKB 3ZE0F 3BT2H 4RA0C 1CYXA 1T4KA 5T3ZH 5HYSG 3T0EE 1XF4B 1CFMA 2VDQL 5I1CL 3QAZC 5K9QI 4FNQA 1IBGL 3A21A 1HC1A 2J5LC 2J57A 3HRZC 4EKXA 1KYUA 1SMAA 3S8WA 1NIEA 4Q6IB 1D5IH 4GW4B 4BJLA 2ZX7A 1RZ8A 5KS9A 1NFIA 3ABGA 4MMXB 1HU8A 4Z7IA 3U2SB 3QNYB 2CG9X 4OCXL 5DJYB 5T1LD 2PF6A 3BI9X 4N0UE 2WLLA 5DK0B 4X6CA 4QDGA 3X13B 2GEQA 2X9XA 1T7XA 3GZQA 4YIQB 3EGXB 5LAXB 5IUCA 3PWJA 2WQSA 1YO4A 5J6HA 2P49B 2XTSA 4WK4B 2VITB 2EE6A 5C0IB 4FAAB 2OR9L 2D7MA 4OGYL 1U8PB 2P9RA 1KLGB 4FGMA 5KVFH 1M6UA 2BNRA 4JGUA 1R5IB 1BHGA 4IMKA 3GS4A 3ES6A 2R2CA 3JWDH 3SD2A 4GG8B 1NJ9A 5AB0A 5JNYB 4IEFB 3F5WB 1KTDB 3RUGE 1HXYA 4MJIA 2A6KB 2VIRB 3KJ4C 3T4YA 1XTLA 4G5ZH 1LHZA 2HRPL 3QEHA 1B88A 1E4KC 1R5VA 1SXCA 2CUMA 3BC9A 4G3YL 4LFHD 4G8GB 2PLTA 3NPSB 4WFEE 4WW1B 3LKOB 5DVLA 1T5XB 4M9PA 4ORGB 2DD8H 1QO3A 2A6JA 4MD0A 4PHXA 5AZEH 4OCLC 1JPEA 5AAMC 3VI3F 1HZLA 4QD2E 2QR0B 2UXTA 3OHXB 4QHUA 1B0GB 1GSKA 1I85C 2YPLE 2ICWB 3DX8B 3IJ7A 2JMRA 3H8NA 3OWEA 4WNQA 4PGZA 3MYJB 1ZY9A 2NY0C 2A9NL 2YLKA 3BAJA 4MQSB 1UXMA 3MRIB 3HNTH 4XHJD 1J1XL 1JUFA 4GW5A 3D18B 3DX6A 4UT9A 4UYQA 3JWOH 1DBKH 4PWIA 1CDYA 3QQNA 3OJDB 3APDA 5CJXA 2BSRA 5L0QC 1G7QB 1MJ8L 3CUPA 3BSGA 2WUBL 4G59C 1NDGB 3IMWA 2BM3A 4FHJA 4YLBA 2YBGA 2AMGA 3B9VA 4TN9A 2LTQB 3WELA 4TNWK 1BEXA 1KBWA 4Y88A 4XMZA 4I18B 4IBQA 5I24A 5LNGA 4WU7B 2D7TL 1KFAL 3UTSB 4Y4FB 2NT1A 1FIEA 3HC3H 3KYOA 1GCFA 1Z2KA 2ADFL 3IAPA 1ZHBB 3O8XC 5I8EA 4FQHA 2Y5TB 2X1OA 9CGTA 4PBWD 2ZOKB 2GCYA 5DVNA 3MRMB 4LLMB 5A7BA 3HMWH 3NP4A 4NKIH 1JPTH 2Y69B 5D96B 5B7EA 3CDFA 3NFSH 2XVKA 4MLSA 1TJHH 3GBML 3GBDA 1HWHB 4P9MH 1F4YH 1TPXB 3M1BA 3S37H 2VRKA 3DROA 5E00B 1WH0A 1JV2A 3VGHA 4PRDB 4HS8L 5HHPB 1ZE3C 1DSYA 4K71B 2IH9A 5JXAH 1MCRA 2WV3A 1DSFH 4LLDB 4Y2NA 5AW1B 3O3DA 4MYWB 1KIQA 4L0YA 1KB5B 3TNNB 2NY5L 1OM9A 1YPZE 3W0WA 2OFQA 3FQWA 1PSKL 4MJJA 2ZZUT 4OZHE 3VRIB 4ZO9A 5FUZL 5FGRA 2F7IA 5FDWA 4GMTH 2BINA 4MJIE 1GJIA 4KKRA 2C9SA 3QDJA 1KIRB 1TQCB 3HZMB 5KOVC 4EZLA 2O72A 1SMDA 3AM8C 2GC7C 3CFCL 3TASA 3ZZQA 2YA0A 3JV6B 4Z3GA 5I17A 3WTSA 1UCBL 3WN5B 5JOFB 3MLPA 3K4DA 3CQQA 1OTSC 2Z4QB 2IQAB 4OFPA 4BD4A 4HWUA 4PJDF 2HAZA 4LVHC 5IREA 4NZRH 2H26B 2X4NB 3LQZB 3P4OA 4YDLC 4CMMB 2ERJC 4IK7A 1TDQA 4H8WH 4N8CL 4AIZB 2GHWB 2BMKB 4OCYL 2YPKB 5D1XB 1A25A 4I1NB 4YC2B 4NQVB 5E1AB 5IW6B 1ILSA 5E6ZA 5GS3A 4ZXBB 2OMTB 4LSDA 3KYNA 1WAPA 1LXMA 2FJUB 5HYSA 1C5CL 4PY7B 3WJLC 1EAQA 4BFIA 2YUWA 4AM0A 5CMAB 1FL3A 2AJSH 3TBSB 4KXZI 3SYPA 1N2RB 1KMGA 3O2DH 1R3JB 3WN6A 4JGJA 4BRJA 3O4LA 3P77B 5F2FA 2RQEA 2VAAA 1W0WA 1PZUB 3ZUNC 2J88H 4AQ1B 5AKVA 3GJFA 4L3CA 4M4RA 4OZFH 4ZX6A 1DQML 6CGTA 4S1DD 2FNBA 5GJSL 4ZUWB 1MAMH 4AWJC 2AJXH 2BVTA 3KPPA 3MRBB 1FNHA 2PTVA 1DE4B 3LTVA 1MWAL 3D34A 4XO9A 3SPHA 4DP8X 4OZIF 4ERSH 3CVHA 2OJEA 2R4RL 4RCAA 5AVZB 3D08A 2CDEB 2R8SL 3PWUB 3VWKD 1QFWM 2OL3L 3WLBA 3TO2B 1R3LA 3GIZH 1UWFA 4CGUB 1YRKA 2GKIA 3EYSH 3OR6A 5DZ9A 1CC3A 4HUUB 4ZZKA 4TLSA 4IKLA 2Q6WB 4XMLL 3GMLB 2VM9A 1OWRM 2N01B 3LV3A 4DGVL 1I1RA 1EV2E 4APQD 2BW5A 2NRDA 2L7UA 1KGCD 2QPSA 1MFEH 3T4AC 3JV4B 1HYSD 5DFTA 3QUXC 1FFPB 2Z31D 5IKCA 1KCBA 1HEZB 3DBSA 3E3QE 2BSED 4X6CB 1DUZA 1HSBB 3SCMD 3B7TA 3KDMA 5JQ6L 1PTZA 2C4FU 4MJHA 4OF5A 4BH7A 5J6HB 1QSED 3C9NA 3TZVC 4BKLA 3DARA 1MW2A 1L0QA 1YJDL 5E9NA 1RHHB 1RIHH 4AEFA 1NLBL 4U1LB 1A6PA 4YSCA 1TLMA 2B59A 4UBDC 3BPOB 5FOBB 3SKOB 4QRPA 4BWTA 4OQTA 1OSEA 2WXHA 3FQXB 2PN5A 3LS4L 3BHBB 3HPJA 2JJSC 5JIHA 3BLPX 4HMEA 1N0LA 2NY3D 3CZJA 4FMKA 2BPBA 2Q5BA 4AUJA 2K6ZA 2C3WA 4GXUM 1RJZB 4LVEA 1BQSA 2X4QB 3T4YB 2QQKH 3NIFB 2A9ML 4IGBC 4H2CA 4LKXA 4P5TD 1NSNH 4Y5VC 2EUVA 3WTXA 2BLFA 1NFDA 4X7SH 3B6SA 2DWTA 3FU3A 3BGAA 4X4YA 4AQAB 4M9OA 3P1VA 1VJSA 4CILA 3L48A 2IEPA 1LQBC 4PJAA 3UADA 1T22B 3VXMB 5I1IL 1H3PH 1KTCA 5IQ9A 1XFPA 3RHWK 3ZZ1A 3MV9D 1S7UA 4P2OB 3TA3A 5C3LD 1M2VB 2HG5A 3DETC 4R0LB 1BQLL 3NCWA 3BP4A 3WKYA 3GSOA 3HI1B 4I5BB 4N6RB 3GBNL 3OXSB 1CXLA 4Q9BA 3V6OE 4Z7VA 3AITA 3D0VB 3I3BA 2OCJA 1OAJA 5A2AA 2CHWA 5D7SH 4DT2A 2UXGA 3U30C 1MHPL 1KWKA 2ZTBA 1NQBA 4FFZH 4KKLC 4O02B 5MHSD 2QKIC 4NZUH 1RZIB 4YQXL 4N2GA 1D6EB 1TJXA 2IPKB 3N0PB 3PS6A 3S3BB 4UU9A 4K94H 3DOSA 1XT5A 1LK2B 4JQVC 3EJQA 2O61A 2R2BA 1XF3B 3P0VL 3TO4D 2Z8WC 4GW1B 1LEKA 4L1HA 3PP3H 3K6SB 2DQEL 3DPBA 3QJFB 4ZYKB 1PLGL 4UTBH 1J5IA 3O6ML 2JELH 5C6PB 3LY6A 5ADPH 1BZDA 4GQ9L 4NQCE 3TNMA 1EGJH 1JNHB 4U1MA 3W56A 5C8JA 2HZHA 1DBMH 2R0WL 4LCCC 2MPAH 3C60C 2IAMB 1JGVL 3P4NA 4NQXA 3ARFB 4K3JH 3FT4A 4P46A 5LG1A 1P7HL 4NN5C 1OOAA 5I8KL 1FGVL 1W72L 2NX5B 1QTPA 2E7LA 5HYJE 2CA4A 1KN4H 4I48A 4H20L 4OTXH 2V17L 3CMGA 5D6DA 5L4IA 4PLJD 3CZUB 4RVBA 3W82A 4FLHA 3AS2A 3REVB 2FX7L 3GRWH 3NIDE 3AWEA 5HI4D 2AK4D 4LVOC 2IDSA 2ENSA 4JAMA 4AK2A 4JFPA 5F7BA 3FQWB 4A6YL 5BV7H 1RURH 2L7EA 2DQDH 4AZ8B 4JUSA 4X6EB 2YD7A 4GINA 5J6SA 3CFBA 1A8ZA 1ZJBA 4YVNA 4UT6H 4JPKH 1OAYH 3GEWB 5F88A 1KFGA 4XAKD 1FVDB 3M7FB 2J25A 4K3DH 5KJRH 1MG2C 3N3EA 3VD5A 3N85L 4FNLL 4ANWA 2C9AA 3SDCD 1KDIA 2GBVA 3FTVA 1NFDE 3N42F 4DKEL 1P6AB 2QVKA 3RTQA 4OLXH 4RMBA 2QKSA 1EDHA 4R83A 1TU2B 1NKGA 2EVJA 3QCTH 4PJAE 2CO7B 1A3ZA 2NLJB 1IQDA 4AQEB 4POYA 2JLLA 5EUKB 4M5SA 5FYKU 1VGEL 3HZYA 1AHWA 2Y06H 2CPUA 4UTAL 4W9EC 4ZRGA 3V79C 1QFUL 2FEEL 3LKSB 2WNGA 5F1OB 3G5ZA 4QGTA 4OIBA 3X17A 1KJ2L 1IE4A 2ATPA 4MAYC 3WYRA 4F58H 3GHEL 4U0RB 1LYQA 7FABL 4Z7UB 3VFPA 2YMXH 3MJ7B 3WSQH 3OLEA 3PABB 4YSPA 4G70B 5I5IA 5JO5A 3DMMC 4TL5A 1BD2A 5ESVA 2E4TA 3ULVD 5AG9A 4Y16A 5GGTA 2FX9L 2PCPB 3GSNL 5MEPB 3H4HA 1B4RA 3U0PA 1VZGA 2NY1B 4LE8A 4AMKH 4WVRA 2YK1L 3BZ4B 4ZUSB 3C2SA 4I0PB 4JREC 5BNXD 4XXCA 3K2IA 5F71A 1HHIB 1IV8A 2OMXA 5CJ5A 2B15A 3CVHB 4FLRA 1CBJA 3QS3A 3WS6A 4JLRB 3CHRA 4ZUTB 3X2QB 2WZPA 5I15H 4Y4HA 2F53A 3VFOB 1Z9PA 5ICYA 2VRAA 1BEYH 1ZOXA 5BOPA 3OR6B 3H9SD 2Q10A 1E8WA 4Y5XB 1OPGH 3O45B 4ISVA 3MLRH 4HQQL 2IWKA 1USQA 2YAFA 5LBSH 5TQ0H 2JKLA 4IRSA 5FM4A 4GUQA 5FKPA 4NZJA 4FXLA 3F3HA 4HJTA 4UCFA 5D6CA 5CO1A 2HH0L 2WZ6A 4RQQA 4RISH 3UBXG 2D73A 3RVWD 2YAPA 5HGHA 4MQ7B 5E24E 4XN5A 4YFLF 3V52H 4CC4A 2KKQA 5L8KB 1I1FA 4LDOB 1C12A 1LE5B 3EJCA 1QBLL 4WUUA 4CU8A 1J86A 3PUCA 3H7BA 1A6UH 5C0BE 1O75A 4MB3A 5TE7H 1KIPA 1FPTH 3RDTC 1EXUA 1F11B 2A0LD 3W2DL 2C5DC 3H6JA 1OAZL 5K33A 5J12B 5KANG 4Q6KA 3UZVB 4POZD 1CFSB 3I6KA 2QBWA 4ZMXA 5L2JA 4R9HA 4GI6A 2Z8RA 4R7NA 3CFJA 1OGSA 2VZOA 2ZWSA 3GI8L 3HCVA 3FT2B 2CKNA 3BKJH 1G7PA 2WQUA 4JCLA 1F2QA 5INDA 5HDQL 3GKWL 1KCLA 4IBZA 4ZFFB 4ZMVA 4JG5A 1CXKA 4TUOA 1LO5B 2FQGA 2D31B 3OKNA 4LL4A 5T3XL 3B6SB 3R18A 4U3XA 5E1QA 1DBJL 4OQ1A 1G84A 2R83A 2AI0H 5ETUA 4U3CA 1HNYA 5DT1H 2O5YH 1KIUA 3VD7A 1T89C 3F05A 4LLAA 4M1CC 4ZNEA 2ADJB 2W59A 3QR0A 4YDIL 4N4YB 2Q3AA 4XXDA 1J9SA 4JPWH 3QVAA 1T2XA 3V7AG 1GYCA 4Z76B 4KV5E 4C56D 1OSZA 1U8HB 5K9JH 3GSOB 1BD2E 2WQRA 3C5ZA 3MUZ1 4PJCB 4Z7VB 2Y5EA 4K5OA 1N8ZA 4OKDA 4JFEA 5GZOC 5L4FA 3OJVC 1INQB 3FCSA 3BAXA 2BVQB 2EYTA 2RIKA 4KAQH 3CSFA 2R0ZL 2PXYA 3P3SA 5HGDB 4UU9B 3VI4F 1AR1C 3FZUC 1EK3A 4PYGA 1BJ8A 1IVLA 1OB0A 4AEEA 4NRXB 4M48H 4AMXA 3EF4A 5A3IC 1BZ9A 4UIMA 1HS6A 2F53E 4NQUA 3EJYC 5DF0A 3ECUA 4B9KC 3QAQA 2WANA 4J8RB 4XVJL 3O4OC 4LSRL 2VLME 2EDBA 3VXSA 2YPVA 5ABAA 4PJHF 2PPFA 2MJWA 2J43A 5I1JL 5TK2A 4WV1A 4PJBA 4KITB 2PTTB 3SE3A 2YQ3A 3AY2A 1FWXA 1LDPH 1M6OB 3FQ4A 1QA9A 2DKUA 1ZT1B 2Z92A 3P4NB 4KGLA 3QCUL 4NRZA 1AIZA 3K7UA 4KRMB 4RBPH 1IKFH 3S5LG 5IGXL 1V7ML 4J3OD 2FLMA 3ARPA 4XVSH 1U9KA 2WQ8A 3ULVH 4J6RH 4S2SA 4Z7OB 4OIIL 2NR6D 2A9BA 2EE0A 3SO5A 3KR3L 1CTNA 4FG6C 4IDLA 3H0TA 4OF0A 4R4BB 4OUUA 1BQHG 2EIBA 4KI5C 5ADOL 1ZEAL 5FGBA 4MNQB 3ZW3A 1JHTA 3FO2B 5DTFA 1PLCA 2CR6A 2WZAA 2CO2A 5CHNA 1XCXA 4OCMC 5DMJB 1UXWB 5EZLB 2FEDC 4HKBA 1F86A 5F1KC 1IUZA 3KXFB 4MQXC 3FTSA 1V10A 2WAHA 4B95C 4RGNC 5E6YA 2WMPB 1BP3B 2DQIL 3T1WA 1SM3L 2JCCE 2YD0A 1GGBL 2G60H 2GBAA 4C54A 3D4ZA 2Z35A 4MAUL 1SJMA 5I1LA 1RERA 5BS0D 3QFGA 2MCMA 4WO4C 1D5BB 1PKQE 3T0DA 2X3CA 3FFOA 1R3HB 1MJUL 1MFDL 2TRYA 4LOFA 1IQDB 1AJ7H 3GSQA 4MD4A 3KCPB 3BGFC 2D2CC 2FO8A 4L9DA 2X4SA 3BUYA 1B0WA 3QDGD 4JFDD 1F42A 3ML8A 3RL1B 2X9WA 3JWDC 4R3SB 2VLLA 3KLAB 2AERT 1FN4B 3VFPB 1T03H 4QYOA 4LCWD 3CZSA 3O3UN 1V3MA 4XAWL 1EO8H 1F2XK 2EEXA 4NKOA 2ZWYA 3N5AA 4W9LC 4J7RA 5E23A 4YEFA 3ESMA 2P5WD 4FJ6A 3UBXA 3QK0A 3ZZLA 3FNKA 3U0PB 3W9EA 3DXAE 3VD0A 2OW7A 2HB0A 3TTSA 5ABDE 1SGKA 3PHQA 4NQDD 5HYJA 2DRUA 2QGEA 3MRNA 5GZND 1F3DH 1JXGA 2KLTA 5BMFL 5JA9A 1EEZA 1JGIA 4QXGL 2AXJA 4KRPB 4JY6B 1N7MH 4YDJB 4D0BA 5ICYB 5D1ZC 1K8IB 1TCMA 4ZSOE 3L5HA 4PJBE 4A2EA 2PWEA 3OF6A 4LLVA 1E9QA 4YWGL 3HZKB 4ISVB 3QXWA 3K6DA 1QSFA 1H9DA 3CX2A 2WBWB 3CFNA 2NW3A 1SXNA 1T1ZB 3I02A 5CGMA 5KYNA 1MXDA 3JWOC 1J18A 3QXDB 5D7IB 1DDHA 3UYRH 4AJYV 5ECGA 4PI0A 5IQNA 2I24N 2EINB 2ZIDA 3NJMA 4G6AC 5B3SB 3ZDXE 4RQQB 2KS0A 1AOHA 2EXYC 2ICEA 3D69B 3RPBA 5JW3L 2XBTA 1PAMA 4MDJA 1DYZA 3ULUD 5I76B 2IADB 1AO7B 2HVJB 4G9FA 5IROA 4UILH 1A1NB 3BUTA 1EHXA 5CEZE 3G6DH 3IGFA 2CO6A 2AQTA 1HZKA 1CZ8H 1JD7A 3HMXH 2X2UA 2WXKA 1R24A 1EHLL 1YHPA 3VXQA 3IS0X 5FYLE 5HSFA 1KNOA 4U3SB 3CN1A 5DZVA 3D0LB 3DYPA 3RWGB 4HJSA 4HXAH 4AIXA 3VFGH 5LGJB 4E9VA 3B37A 2YN3A 3C8KA 3HE7D 2EIJB 5L9DH 1FJ1A 4QRSA 1MY5A 3WO3B 1Q72H 1WYJA 3C2AH 3KGTA 4XP5L 1UEMA 2HT2C 1A6ZA 1G7PB 1V55B 2I25N 5DD3H 5F7FA 1YY9C 3GGWA 2E56A 4J3OH 3R0NA 2HFFB 4FQCL 2RGSA 4TUOB 4KHXH 2WYZA 3HHRB 4AQ8A 4WY7H 3HKZA 1MFCH 2Y1ZA 4RETB 3OQRA 1FYTB 1X7QA 4NJAH 1BQ5A 1JF6A 4H88H 1MFBH 3W3BA 1WHPA 1ZDSA 2C3XA 3BJLA 4XXDB 1KGXA 3RRQA 2XJLA 2XVLA 4MB5A 5F7AA 5I9QB 4GAGH 4P0DA 1BMWA 1KYDA 2ALWA 3F7YA 1JXFA 3KYMA 4UM9D 4X7EC 3MNDA 1NANI 1WBXA 3OAYH 4JFOA 5FO9A 3S5LA 2AJZA 4DESA 2EEAA 4PHZA 3D8MA 2Q7YB 4Y1AB 1QKZL 4CVUA 2PXYB 1CL7H 1A7OH 1MH5B 4TNWF 4H8WC 1LEGA 1VHPA 4P2RD 3U9WA 3DDFA 4JKLA 4UIMB 5I30H 1BQHA 1LNUA 3UTPD 4KDVA 1U8QB 4LHUG 3U9UB 3KAAA 4JPIA 3FONB 1MFVA 3BEWA 2DQJH 2F7OA 3ZSTA 2I26N 3WENA 1PNCA 3VXSB 1RZ7L 2H3KA 4GFXA 2GJJA 1QSFE 4K7PL 5I66A 4KZCA 2CBOA 1CI3M 4R6UA 4BK8A 3E2HB 3ZTCC 1Q0YL 5E7FA 5E94B 4WI0B 5T1KA 3L7EB 1E7VA 5B1JC 5MEND 1VFUA 1QLEH 1QA9B 4NRZB 5LAPA 4E9SA 3B8YA 1WHOA 1IC7L 4OJFL 5CIPA 2G30A 1B0IA 3A67H 3I2CL 3VW3H 5LLIC 3NZUA 2HKAA 4HWNA 4RWHA 2H6OA 4I9WE 3IFLL 3L6FA 1RULL 4P2QD 3RVUD 1II4E 4C59B 4OUUB 2CLZB 4FZ8L 3L3HA 2J8UB 3QC5X 3DIFB 4P59L 2VC2H 2E4FA 1GS6X 1FE8H 2C7UB 43CAB 5I6NA 3BYYA 2E6QA 2B9AA 4MJ5A 2A7BA 1HNFA 3PP3K 2WQAA 4PG9B 2ZOOA 4HKBB 2ZUSA 4HALA 2DYSB 1GHFH 4G6ML 4OY9A 1I4FB 4KKCD 5DJDB 1JZ2A 3LZLA 5IB5B 3ATAA 4TSCL 2WUCH 5IHLB 3QI9B 4XHJC 1GH7A 4W1TA 1HXMA 1P1VA 1CFNA 1MI5D 3B2MA 3V0VB 3PLYA 2G5BB 1MAKA 1CT8B 3C87A 1S7XA 1HE8A 2A99A 3ULUH 4HWBA 3VXRE 4JDEB 3TC9A 4L3AA 4ELMA 2Z9TA 1LGVA 3BUYB 4KU1A 1CWVA 4Z3EA 1I8MA 5L2KA 4ZPVA 5IFAH 5KYXB 1LO3H 1WV7T 5ANHA 4KKNA 1D5ZA 4P9HH 3WE6A 4X6BA 1SEBA 1UG9A 2NXYD 4N2BA 2XFXA 1YEEL 3V10A 4PGEA 4E9WA 1VLXA 4JG1H 4ZFQA 4NKOB 4BFEA 1ORQA 3WIHL 2VSDA 2YEQA 4TNFA 2HJKA 1IC4L 4X8XA 2LOEA 5C09A 2CJUH 3IJHB 4D9LH 5D70L 4G7VH 4IDJL 3H2QA 3MRRA 4IKIA 1AS6A 1BIIB 3QJQB 4UQIM 1QYGL 3PHQB 1GIGL 3VXUA 3L9BA 1QR1A 3MRNB 1SFDA 2BWIA 4JM4H 1YN6B 3LN5A 1TCRA 4FNTA 1DFXA 4L8SA 1FI8C 1HVXA 2AV1B 3MX0B 4P5SA 5BPPA 4F15B 2FCBA 1MLCB 1G6RH 4TF4A 4IRJB 2FVNA 1KUMA 5IMMB 4ZFOB 2DMGA 4NIYE 4QCIA 2Z8SA 3EJSA 3GC3A 3IDNB 3IB4A 1IGIL 4PJDA 1B2WL 5HGGS 1NAML 1EFXB 2BHUA 1TYJA 1JK8B 3MOBH 3V5KB 1DDHB 2QQQA 5D7KE 1GS8A 2VLRE 1KTLB 5KBKA 4I9XA 4N68A 2IO5A 4XCCL 1OPOA 1YMMA 3CFKA 4K94C 1JZFA 3Q1SL 3NZ8A 1A4KA 2CMRL 1H15B 2YARA 5ALBH 2OW6A 4RRPM 2KDGA 1A4CA 2AABL 4J3VA 5IBTL 1KJMB 3UJIH 5A2BA 3KPSE 4G8GD 3FFDA 1ODAA 3QQ4B 5G2NA 1TZ8A 4KC3B 2HXAA 2W9DH 1D2PA 3B2VH 5F8QC 1J10A 5FHAL 3CDGA 1NICA 4CVXB 3ISRA 1JVKA 1QEWB 2Y9RT 3TLRA 2E7DA 2JKJA 3LXCA 2V9RA 1MRFH 5IZ7A 2BX5A 3QWRA 3PJLA 2BIPA 5C0NC 1G6VK 3V8CA 4H8VA 3PWNA 4OZIA 2YUXA 2DLTA 5CR1A 4XNZB 2WYTA 1A6ZB 3LPWA 4XE5B 4YZFF 4YHLH 2CBTA 4OD3L 4KKQA 1Z9MA 3IDIA 3ARXA 2WB7A 4S1DC 3TVMB 2CRIA 3JT0A 3QUZC 2ZYIA 1QUNA 4V1DE 5KG9B 4FQJH 3M1CA 1DN0A 1WE5A 1AKJB 2NTSP 4ELME 1V5JA 1S7RB 2GT9A 1L9SA 3IMVA 1YA5A 4KQ3H 3BXNA 4OLYH 3RGVA 2JJTA 3UTSD 4RDQF 5BV7C 3DUHA 5D93B 5F72S 5IHUH 2HLAB 3MODL 3GK8H 5CEXA 2FIKB 4O5LH 5D8JL 4FA7B 3NZHH 2D03L 3BISA 3MV01 2HMID 2HVKA 4TM9A 4APQC 5J13C 1TMQA 1W2KT 2RCSL 3QSKB 1KEMH 4XP4L 3VXUE 5FYJL 1QI5A 2Z31C 1K4CB 2EDKA 4G8FA 3SCMC 3TEYA 5GGRB 1MWAA 5I1DA 3B9EA 2Y6SD 4S1QH 4L1DA 1Z9OA 4Z7NB 3LEVL 3DV6A 2XPGA 2X89D 3BQUB 1CMOA 3QZWG 5T5NF 3QE5A 2OL3A 1RK7A 4XBEL 2IWFA 5GS0D 1MXGA 3OGOE 3LZFL 4DVBA 4YXLL 3KNBA 5DURB 4YOKA 1BJ1J 2CK2A 4AQOA 2V3EA 2R2HA 2Y07L 3H42L 2F19L 3W9DB 4JM2B 4LSTH 4JG0L 2NY3C 3WKNA 2VZ3A 4G7RB 5AAWA 2N1TE 4WF7A 4C4KO 5JHDB 1SN0A 3VI3B 4P5TC 2XXMB 3ECBA 3NMEA 2A74B 2OP4L 4OLVL 4ZUVB 5CBEA 1QBMH 4E2OA 5GGUA 3FB7B 3NTCH 3H9HA 5D1XD 1R0AL 3WY1A 5D2NE 3E0GA 2BOCB 4UZSA 1F4WH 3U0TB 5C0RL 4QRRB 1XCTA 3P4MA 4MJ5B 4DVRL 4JJ5A 2AQNA 4KO7A 1ZWIB 1TIUA 1D5RA 1WZMA 4OBRA 1NC4B 4AV5A 3MFFA 2AGJH 3IDYB 1UZ6F 32C2B 5DWUH 3SE9H 3JTTB 4HIIA 5C92A 2YSTA 3PP4L 1JXJA 3L5XL 3NPZB 1XGQA 3UPAA 4BFOA 3HS8A 2V2XB 1SJEB 3QPQD 3RNQA 1T7WA 3G6JA 3D9AL 1HXMB 4RBPK 1RUAL 3VWJB 3TS8A 1YECH 4J12A 1F58L 2JIXA 4WJKB 2DM2A 4LLUA 2EIDA 4XP6H 2XWBB 5M7QA 3ZE1E 3T0XA 1ONQB 3VFUA 5F1NA 3MGOB 1L6PA 2V7HA 1HOCB 3TO4C 3HI6H 1YQVH 4N28A 5IB3B 3M7OA 1IGFL 2ZG1A 1MFMA 12E8H 4HUVA 4GMSL 1P7KB 2K0RA 3P30H 4RMTA 4XP1H 5F7YC 3TP4A 2QVMA 4P4RB 4GQPH 4LPXA 2BP0B 2ENPA 5E6SB 5EBMB 4QO1A 2X42A 4BDVA 2EVFA 4DZ8A 5EN2A 3WU1A 1N5YH 4EAEA 3SJVA 4TQEL 5CLTA 1S9YB 2DQTH 1JVLA 3E6FA 1G4MA 4D0DA 5DC2A 2R9HD 2IANA 3RBGA 4E0RA 2CIKA 2OR8A 3P69A 3R4DA 3BT2L 4J28A 3N40F 2JE8A 3I3DA 1XAKA 5T3ZL 2EDFA 4YS4A 3OKOA 5BUAA 4AMWA 4NENB 3W39B 5A2CA 1YVLA 1BVKA 5GS2D 4JMXA 1J12A 4PLJC 5DEGB 3QEUA 1A9VA 3K6FA 2N56A 3BD5A 1RJLB 4GIPD 2HFEB 3FO9A 1L9QA 1D5IL 5HI4C 4DKTA 3BP6B 3HBGA 1NL0H 4YE0A 3HVDA 5B1CA 3ULSB 4R96A 2V33A 1AZZC 3KH4A 3VD3A 1C5DA 4F2MA 5HHOA 3Q8BA 3WNNA 2GVYA 5KYWB 4YAQA 1N6UA 5FKAA 5IV2B 5DFWH 3LXBA 2WLMA 4M6MH 4ABVA 1EO7A 5IB4A 1W72A 3J7HA 1H6FA 1JPSH 3GHBH 4NCDA 3N44B 1FG9C 4FNRA 4U2YA 3NIGF 5EUOF 3UGUA 5K9KB 1YMMB 5KVFL 4IMLA 4A2HA 4PBVC 3NZ8B 2FHCA 1MN4A 3VVWA 3JWDL 4QRUA 2YC1A 3VJ6A 4KI5F 2FBOJ 5H37G 3ZIYA 1JNNH 2HN7A 5JLZA 4P49A 4Y89A 2OLDA 3N9GH 5CN2A 1I82A 4LPTA 3VXMD 2K7PA 3AU1B 3CDGB 3CN2A 1XIWA 1DVFA 3H54A 4GRMA 5E4IA 4A6YA 15C8H 4G5ZL 1KB5H 5GS0H 2JI2A 5CU9A 3I9GH 4FTVA 2QZQA 4G8EB 3OLDA 3PREA 4L4TD 3EGSB 4ETQB 1CLCA 4OZIB 3G6JE 2X88A 3B34A 1XSOA 1SVBA 1RH8A 4GBXB 3QUKB 2DV6A 5DZPA 1PFOA 5J56B 3AQYA 2DD8L 3CBKB 3X3GH 4JEGB 3ULVC 1G7HA 5INCA 5AZEL 1ORSB 2VN7A 2CHZA 3ZKSD 3IDIB 2IQ9H 4JHVA 5I2IA 4YR6B 3S35X 2LW3A 1DN0B 2AXWA 2DI9A 3TCLA 4MZ2A 2DLIA 2Y36H 4TNEA 3HNTL 4LHUB 3QZWA 5DC9B 3BXNB 2A4CA 4UTAA 3R06A 3JWOL 4UMSA 3RGVB 5EF1A 1DBKL 3BQVA 4IU2A 3WNPA 1KJ2A 3SJVE 1ZIBA 3AFLA 3TN0B 7TAAA 3MREA 5KSAB 4M61A 3ARFD 4G42A 5KVEL 2QGBA 2X2JA 4B9YA 3AROA 3GSNA 5D5MB 3SBRA 1ZV5A 3HC3L 3U7AA 4HLZG 3RVWC 2EYRB 3GSWA 4HJGA 1WVZA 1YC8A 1HQRB 5ESAA 1OGPA 2E7MA 1EPFA 4HYTB 3IGAA 3HMWL 4FXGC 4NKIL 1G94A 1JPTL 1ED3A 4L4VB 3NFSL 3U2IA 4L48A 1TJHL 2KT6A 3MLVH 2FSDA 3NDZE 4P9ML 4BK4A 5HHOE 3S37L 2A0LC 4DVBB 1V05A 1G0YR 3UAJA 4WI2A 5E9DB 3QISA 4NNXA 4POZC 4Z78B 5F6IB 1MWOA 3D87B 2WIIA 5EO1A 5JXAL 1I1CA 2NSXA 2OSYA 1DSFL 5B21A 3S8GB 4GKNA 4TOYH 3PFQA 4XBPA 1I7RA 3MV11 2LHAA 4KQ4H 4X0KB 3ARGA 5C0GB 4E9RA 3SGDI 3VDBA 3OAYK 3UBXI 2WXPA 1M05A 3JWNE 4KUZH 3KMDA 4GMTL 5C97A 5GS2H 2B7DT 4HPHA 4JNXA 3QRGH 3DTUB 3VFRA 5C2UB 4YZWA 3GLEA 4I7ZC 5I0XA 3RDJA 4X8GA 1U3HB 3AUVA 3WJJA 4M7LT 4EQ2A 1SZNA 3QIWA 5ICXB 5KANI 1IEHA 4NZRL 3IJYB 4AEIH 4HIHA 4H8WL 3TT1H 1U33A 3FTGB 1FV1B 4TV3A 4XC1H 3N43B 1FRGH 1GZPB 1YNLH 2ENQA 5JW4R 2VMJA 1UEYA 4TVPE 1MLBA 3HLAA 5CKGA 4JFQB 4YMPA 1PYWB 2ZYSA 1GC1H 2W65B 4I0PD 1LWJA 2X4TA 2AJSL 3MU3A 3O2VH 1AY1H 1OLZA 2OKMA 4KJYB 4UV7H 4YFEA 5C9KA 3VFUB 3O2DL 4PV1C 3HRZA 5KJ4A 1KTJA 3VFVA 3J8F7 1QRND 3DJZA 1JXDA 4XB8A 1U8LA 1UVQA 2J88L 3RPIB 5SWSA 4FXTA 1NUNB 3DTXA 3QPXH 4MB1A 1MAJA 4JO3H 2Y7QB 1MAML 2O5XH 2AJXL 1E2VA 2EE2A 4TLUA 3N1PC 3E6FB 4ERSL 2IANB 2DIAA 4Y2DB 4GT7A 2C9XA 35C8L 1XGTA 2R7EB 1JZHA 3ME0A 4J3OC 1Q8MA 4EZKA 1RIVH 3GIZL 3OSVA 3QHFH 3EYSL 4O02H 4XRCA 1R19A 1RUKH 4D8PA 4NNPH 1L9MA 2NR6C 2A6DA 3QEUB 4WFHE 5E8OA 3MNZA 1NFKA 2ROXA 4FD0A 1FZKB 1RD6A 5IBUG 1OZUA 3QUYB 3MBEB 2OI9C 2RA1A 1MFEL 4AYFB 2C1PA 2XWJA 3RG1C 3GXPA 1CFQA 1SDDB 2F7PA 3HN8A 3UGEA 1EZUA 1C5DB 3HOGA 4NGHH 3HZVB 4F7MB 4D3CH 1E4KA 1YEDB 3IF1A 3KDPB 2AJ3B 3KPOA 2XWEA 3FCTA 1RIHL 1Q9OA 1W72B 3Q8FA 1R3IH 3ALPA 3HUJF 4M8RA 1J5DA 4HKXA 3PDGA 1TZHA 4JO8A 4G9DA 4N0UB 5AAMA 5IOPB 1LD9B 1PEWA 4GLRH 3OR7B 1I85A 2IFGA 5CCKH 4FFWD 4NDMB 4ENZA 5EEXA 3EZ8A 3EDDA 2E3VA 4DCQA 5F3BA 1UD5A 3PXHA 4ENED 4AXWB 1EZVY 5ESQA 2QQKL 1X5FA 4W9JC 4Z1PA 1NSNL 4X9BA 5HDWA 4IS6B 2IXQA 1JHKH 4X7SL 1P6WA 1E43A 4G8IB 1QTSA 2K3TA 2Z64C 3GDCA 5CFAA 3RUGB 1U92A 1J0HA 3V9EA 1ZIAA 5EU3A 1HI6A 1H3PL 3ETTA 5BZDA 5AL8A 5I2IB 2FBRA 4WI4A 3O8XA 1G7IA 1IGMH 4PMEA 1TR7A 5SX5H 3ZX1A 4H4NA 3TCLB 1K2DA 3LPPA 2D7NA 4MLIA 4B9JA 4JN1H 1EMTH 3JZYA 5K1JA 5GZNC 1J8KA 1RZGB 1UJTA 5D7SL 2ARJQ 4FFZL 4RIRB 4NB7A 3VGAC 4U6YA 4JO1H 4NZUL 4GI9A 1J88A 4IU2B 5DWPA 2Z0BA 4XNUH 5EWIH 4K94L 2AQ1A 3HN3A 3QA3A 4LP4A 3L4VA 2GTWA 4URKA 3BDBA 3ULAB 3P3TA 4DO6A 4K15A 4G42B 4PP2A 2QV2A 2YRBA 4YO0B 3G5VA 5EZOH 3BIKA 3UTTA 2EUZA 5D4IA 4RH4A 1QASA 3FUEA 4UTBL 3L3JA 1AGEB 2JELL 4FI8A 3GSWB 4JRYB 5ADPL 4PJGE 4YNYB 3ULUC 1EGJL 4PVMA 4ZNCD 1DBML 1XXDC 3O6LH 1W6LA 2MPAL 3TIDA 2WYIA 5E4EB 4K3JL 4KFZC 1C08A 2RHEA 3AM8A 5KOMC 3K2UH 3NJNA 4PS7A 4O2CB 2WINA 3EJTA 1KN4L 3ZRFC 2G3ZA 5GGRY 4P9HC 1DUYA 3OGCA 4OTXL 1PCSA 4XN9A 3PQYB 4NJ9H 3B1TA 2WIIB 4GT0A 3RLSA 3HE7C 3GRWL 3KLDA 3RWHB 3F62A 4DZBB 1VA9A 4HETA 4IIQC 2ZUQB 4MNGA 5CP3H 1BMZA 1AE6H 1X5ZA 2OXGA 5T1MB 3VRJA 5HDOA 4KDTC 4AYEC 1VFAB 2DBLH 5BV7L 3NEOA 4HCIA 3W5NA 1RURL 2DQDL 2YJQA 2DMBA 3WJLA 3EJJX 1B2YA 2PMZA 1IAOB 1QP1A 4LPCA 4PUBH 4UNIA 4UQ2B 1HCFX 3ETBF 4A7GA 4UT6L 1N6VA 4JPKL 3LD8B 3CC5B 4GAJH 4F93B 2D3LA 4LSVH 5DJ2B 1OAYL 2WTPA 4K3DL 3KLLA 5KJRL 5ACLA 2IGFH 4AGQA 2BOLA 1NGYB 1A65A 1AXSB 1QRKA 1AS7A 1YPZB 3OKMB 4F3FA 3ZDZE 2ZXAA 1MCJA 1VCAA 3VI4B 4B9IA 1BXXA 2VMCA 4OLXL 1J5OH 1IFGA 3BVNB 1MNNA 2LAGB 3QCTL 3LKPA 4IHOA 4Q4EA 3K74B 3CHXA 3ZDYF 4KXBA 4J3TA 3VMPA 1U8MA 1X5JA 2Y06L 4LBEA 4RDQG 1T7VA 3SSGA 5C0AA 1WWBX 4F58L 4PJHB 1FVCB 3D06A 4OV6F 1PF3A 2YMXL 3HC4H 2A9CA 4XC3H 3WSQL 3H2WA 1SF3A 5ICZB 1QATA 3K1DA 2BJMH 3FJTA 4BWUA 1GZHC 1MFNA 4O2EB 1UVQB 1TTGA 3BT0A 3NGBC 3T4AA 3KE0A 2CO1A 5SWSB 4DFHA 4MDRA 3MMEA 2VDMB 3K2MC 4AMKL 3Q8EA 3QUXA 4XMXA 2E47A 2MPVA 3TF7C 3OKLA 4BSVA 1O6SB 1OF2A 1UATA 3MNVA 3VFSA 5JIQA 3U46A 3TZVA 4XNXH 2YA2A 5T5NG 5I15L 1MUJA 1XGTB 3Q5OA 5DUMH 4Q9CA 2VR4A 4YXKH 2AAVA 2EADA 3LIZH 1BEYL 5EO9B 4XRCB 4XMTA 2X28A 1OPGL 2X41A 1AO7D 3MLRL 5E8OB 3RL2A 5LBSL 1J8HA 5TQ0L 1RPKA 4JY4B 2JJSA 3P11H 2JB6B 3RU8H 3PJSA 1KJVA 3Q2WA 4GIAA 5EIIB 3RWCA 2CHNA 1CD1B 1MW0A 2VAJA 3TIEA 3FS9A 5E95B 4BA0A 1A4JA 1EBAA 2E9WA 4RISL 2WD0A 2YRLA 3FSVA 5EC2B 1KYFA 1KULA 3EAKA 3T71A 1E8XA 3V52L 2BERA 4Y5VA 4NUJB 3IF1B 4FQLH 2W07B 4MNGE 3GZPA 4KKCC 1JYVA 1A6UL 2CD0A 5LJYH 4N1EA 3QH3B 3AWGA 1Q9OB 5TE7L 1Z3GH 1E4JA 1FPTL 2KQNA 4GQRA 3GMPB 3IWUA 2DLHA 3C8DA 1KXQA 3LMJH 2VJ8A 4G9DB 3BZ5A 4KNQA 3NA9H 4I77H 4CNIA 1L6XA 1NAKH 4UDUA 1FYTD 3UYPB 1RK1B 3DX7A 1L5GB 3KM1A 3QYMA 2OQJB 3BKJL 4U1GC 5F0JB 5F7EH 1BOYA 2OMZA 3IK2A 4M00A 1IEBB 1UOLA 3SO3B 1PY9A 4HUWA 2QKIA 3BEVB 2DM3A 3CPLA 4LMQE 1TO4A 2YD6A 4CSZA 3MRQA 3IGLA 2NXYC 4JQVA 4LDEB 4YHIA 1TVHB 1NGZA 2AI0L 2EUWA 1WFNA 4JRLA 5DT1L 2O5YL 5C0AE 3DSNA 2VDPH 1A2YB 2XG4B 4MMXC 2M83A 4Y1AD 3ZQWA 2ZAGA 3JZ7A 2EDDA 1HI6B 4YHNA 1UFUA 5KVGE 4JPWL 1KZQA 2XZQH 1TMCB 2FQFA 1CFVH 5K9JL 4B9PA 4AC4A 5JYMA 5CF3A 5F0MB 4NP4H 5EIVA 4LCCA 3C60A 4HH9B 2ZD0A 2YR3A 3PAZA 2V7NA 1CBVH 3IXTA 5E5UB 4J8QA 2WNWA 4KAQL 2W0PA 3GMNA 3HG5A 5F9JB 1S9XB 3FB6B 2H45A 5JW4M 4TXVB 1F90H 1JZ7A 5CZRA 4M48L 3OB0H 1KPUA 1X4YA 1RJCA 2VH5H 3LB6D 3WIHA 1BDYA 3PWPA 1ODUA 2XYCA 3MJWA 2O5NA 4D8PB 1ECYA 3WGUB 4WKZA 4G2AA 4HAGA 3WY3A 1K5NA 4XI5D 3OXRA 2AKRB 3QXAB 5ITFB 2FJFB 2P52A 2VISB 1LEIB 1Q90A 1YG9A 4AV0A 1LDPL 1IM9B 3NPSC 1LJMA 4MRCA 4N0YH 3PIQB 5HHMB 1IKFL 1U8OA 2EZ0D 2WSPA 2FWOB 2K4AA 3NOIA 4FQXD 4XVSL 4B3EA 3IPBA 4P57B 3F7VB 3ULVL 1AD9A 2CO3A 4J6RL 1U8NA 1YY8A 1KTRL 1JZJA 4KTYA 1NAMA 3POHA 4OF8A 3PYCA 2APFA 4NQCB 2WKOF 2ERJB 1F97A 4L1BA 4M5YH 3Q2CA 1BZEA 2A6IB 1WQVT 5CGTA 5JMRA 3V5HA 1SYVB 1AZRA 1KXQE 1R46A 3C6LD 5MI0C 4E5XB 3V0WH 1S7WA 5HI5D 3MGAA 3U7YH 3FHAA 3QUHA 1CE6B 3KPRA 4MAYA 5DMYA 3BKYH 3D0AA 5E08H 1OP4A 3JTSB 3NIDB 1F45A 4Y9CA 3L3IA 4GNKB 6PAZA 2LTQC 2G60L 3QW9A 3WS3B 3HHSB 3DMMA 3EH3B 4I18C 1UM4H 5CS7A 5DJ6A 4Y2OB 5A6MA 2AQ2A 1IZJA 4U31A 4Y4FC 4GB9A 1KN2H 3OSKA 4BXVA 3C5JB 5DZJA 2VRQA 3ZRCC 1QAWA 2WM0A 2JI3A 3QDMA 2WYHA 2FRGP 3MOAH 1GGCH 4PS3A 4W4NA 2BDNL 3VU1A 4PGCB 1WBYA 4JB9H 5LUMA 4I3SH 2HMIC 1WAEA 5D96C 4IHOB 5E51A 1AJ7L 2P45B 1L7TH 5AKTA 1HIMH 4H25A 1TPXC 2GSGB 3HB3B 2XKSA 5I28A 3QEGH 3FRPG 1F6LL 5TE4H 1L3NA 2YA1A 3FB8B 5AALA 1T03L 2Y6SC 3U9PH 2DH2A 2H2SD 4AGMA 4P06A 2VR8A 5IBUB 4G71B 2D7OA 1BZOA 1V8HA 2BNQA 3A6OA 5GS0C 5SWZE 1Q9LB 1ITCA 2DF3A 1BAGA 5SX4H 1GW6A 2B16A 1EFXD 3MRKA 4PRHA 1KBKA 1ET5A 4D0CB 3LRHA 1TQCC 1X5MA 3VFSB 2X87A 2KDYA 2WW8A 5FUOH 3V8OA 3IWVA 4EIGB 4L3EA 1N7ML 5FWQA 3V6FA 3WN5C 3RDTA 4F8PA 1J9TA 2QHRH 1IFHH 5KBPA 4WHTB 1J5CA 1NGXB 1WITA 5TGBA 3FT0A 4A7VA 4D9RE 5EA0H 1J8HB 5DHVA 3DUSA 4QHPA 3PJSB 3ZTDC 5FAAA 4MGXA 2R1WB 1ZA6B 3UYRL 1INDH 4YHPB 3KLQA 5D1XC 3TIEB 1M1SA 3SPIA 1E4WH 5FOJA 1WS7A 4AT6A 4MWFA 4JPQA 4OKVA 5JHLH 4Z6AT 4ES9A 5IW1A 1PQZA 2FEEI 4FHKA 4IGBB 2BZCA 5JW5A 4X8JB 3S96A 3FOLB 5KEZA 5CU5A 4UILL 1URIA 3FPYA 3G6DL 1E4XI 5I5RA 1T4WA 5K1NA 4KNUA 1CZ8L 3HMXL 5C0EB 2YFOA 1JAEA 2K8QA 4AQ1C 3LNFA 3QPQC 1T89A 3WHE1 3CLWA 4NZDA 4HXAL 1B9ZA 4YBQD 4FNUA 3VFGL 3DSFH 3ZTNH 3E6HB 3V6BR 5CGBA 1AKJD 5L9DL 2G9KA 4ODXA 5EU7C 3DX7B 1Q72L 3BDYH 5EMYA 3C2AL 5C0BB 5GZOA 4G1MB 1SQMA 5DD3L 4HUMB 1TG8A 2Q8BH 1PAZA 1PG7W 3CPLB 4HIEB 3BD3A 3CVDA 4LPUA 3TEZA 4KHXL 1JVOA 2JKNA 4QTFA 4DHLA 1TEGA 1QVOB 3DHUA 4WY7L 5ISZE 5C71A 1MFCL 1E5ZA 2XBDA 5DJ0B 1SRDA 1LM8V 1FO0B 1SHXA 3DBXA 1SY6H 5HD8C 4JFVA 2R9HC 2VLKD 2PW2A 2IDCA 4PSRA 3I9PA 3IFNH 1IKOP 2GK0A 1ZXQA 4NJAL 1CLOH 3PWLA 1OANA 4H88L 2HUEA 3GZKA 1MFBL 2D9QB 1FP5A 1PZ5A 1J05A 5EH1A 4O2FB 4LKCB 3FU0A 3KL3A 4GAGL 4PWFA 1XGRA 3CVCA 1KG0A 1H0DB 4LCCB 1DQJB 2V3DA 2J6EA 2V5RA 2V7NB 2WVVA 2XSKA 3OKYA 1E8YA 4OFDA 5CD3A 3BPOC 5DK2B 3EOYG 3BZEB 4PRHE 3MV8E 1CL7L 4MVBD 4WKXA 4PJ9B 3IGUA 4KJQD 4FYRA 4JM2D 3VFTB 1H3VA 2EECA 2K3HA 4M43H 5I30L 2OYMA 1BECA 1G7JA 2P44B 4LVOB 2NDGA 5EEWA 3VFNA 5IJKC 2M8XA 4H0HB 4HZ1A 2DQJL 4J3OF 4K5NA 4BELD 5DYFA 2NUTA 1GC1C 5AVUB 5JHDD 4NHCH 4PU2A 1JFQH 1UCTA 3UZQB 1A3LH 2X40A 2BIIA 4X5WB 1NCGA 1QLEL 3U1SH 4A2LA 1QQDB 3PWVA 4NQSB 3K81A 1F3DJ 4LEXH 5SX5K 1C8QA 4OZFG 2ZUYA 3A67L 4QRRD 5FR3A 3VW3L 3DRTB 1SYSA 5A2JH 1P7QB 4P2OC 2XN9E 3FCUB 2VERN 1NC4D 4WO4A 4EI6A 3TH4T 4R0LC 4UNUA 3ATBA 4YHOH 4LFHG 1MW3A 3IJSB 2J6WA 3RILA 1DQQA 2VC2L 1MVFA 1QTYT 1TZIA 2UZPA 3UIYA 1IL1B 3VM7A 1N6QH 1FE8L 1VFOA 3L3GA 3D25A 4X98A 5EOQH 3VWJD 1BZ8A 3HJ0A 3IU3B 1PMYA 3CH1A 3T6VA 3G6AA 3WMQA 2ZYHA 3FRPA 3KPRB 1T6BX 3MUGA 3G5YA 4DW2H 2HX7A 1GHFL 2CUIA 3MCLH 1T6WA 2E9JA 1JD9A 4PREB 4W6XB 1JWMA 5A16B 1XB3A 2FO4B 2WUCL 1N3NA 3GT6A 4PRPA 5BZZA 2ZX8A 4P3WA 3U7WH 3S9DB 4XXWC 4UYPA 5DHMC 1A7QH 5CJBA 1UM6H 4ZS7H 1QOKA 3QNFA 1Z9SB 1M71A 5C6TH 1YAZA 4FNPA 3PU7A 3KL0A 5D1QB 1JZEA 3FUDA 4RMRA 3RWDA 2IAMC 4EPSA 3ULUL 3ARFC 4PGDA 4PJXE 5CN3A 2JCCB 4NZTH 1X44A 5FA4B 5TDPA 3U36A 4DK5A 3KWWB 2UYLA 3HS0B 2RB8A 5DC0A 4FG0A 5D1ZA 3TTYA 4TQPA 5IFAL 4TSAH 1PKQB 1LO3L 3ESVF 4G82A 2Z7YA 4P9HL 1OTTC 2ZP0T 4LAJH 5E2VH 4D9QD 4NRYB 2F2HA 3MRLB 4JG1L 2HLEB 3H3BC 4G1EB 4KVPA 2VQ4A 2XU9A 4LF3A 5FFOA 1NCCH 2BNQB 4ADJA 4GG6F 1ZRUA 2F1EA 2CJUL 3MO1B 3MRPA 4PRID 1FNLA 2JVUA 2MCPH 4D9LL 4G7VL 3L4YA 1R5WB 4X4ZA 4XNAA 4JM4L 2JKSA 1P53A 5JOPD 4FS0A 1G6RL 3BH9B 3B56A 1S8DB 2Q2EB 2V8LA 4Z5RB 2ZKHH 2FTAA 4FNSA 4FP8H 4ICXA 3DXAB 2FGZA 1OARH 4RGNE 2N59A 2ZWLT 3ULUF 2CBPA 1UM5H 1A7PH 2RQ8A 5AVTB 3EOTH 1A7NH 1E0OB 3QIUB 3MOBL 4NPYB 1I7ZA 4MDIA 4NKMA 2N0KA 2LV4A 5ENWA 5FUCC 5ANMB 3ZHFA 4OLEA 2HTKD 3VYPA 3MRHB 5EU6A 4NKQB 1XD0A 3HG3A 4I3RH 4JPVL 4ZFZB 3SPVB 5D4HA 4ZSOB 4J23A 1HDMB 2BFGA 2GSIA 4U0RC 5ALBL 1DJYA 5K39A 3UJIL 1EERB 4HUNB 4UDTA 2W9DL 5E2UH 3B2VL 3UXFA 1MCIA 3GXDA 4P07A 5ABZA 4LCVA 1TKWA 3ZR5A 3F8UB 1XF5B 3LOWA 4I0PC 1MRFL 2YD5A 3EFFA 4PRPE 5H8DA 1I1AD 1MCNA 1CIUA 9PCYA 3FUNA 5ALCH 2VMEA 4R4FH 4AEHH 4KKPA 3SKMB 4QXUH 4YHLL 4EXPX 4BSWA 2R23B 3CVIH 1KF9B 5T1LA 2VLJB 3BMVA 4QEGA 4Y5XC 3VCLB 2XWTB 3TN0D 4FQJL 1E27B 4X4XA 1P5UB 3G5XB 3O9WB 4GKZA 2GUYA 5KSAD 2BWQA 4F20A 3INUH 4KQ3L 3D3VE 1EFQA 2BP8B 4OLYL 5DSCB 3D7PA 4BZYA 3PWLB 3IDGB 3S5YA 4NKDB 3TX4A 5IHUL 2DTSA 1XZ0B 3GK8L 5FV1L 4DGUA 1IM3B 1J05B 2ICES 5L8LB 4O5LL 3FHQA 2BRQA 1U93B 1FYHB 2ZXWB 2YJLA 3B1UA 3CIQA 3NZHL 3O2DA 4XPFH 5B1JA 2XWZA 3NABH 3GXIA 5HYQB 4PTTA 3MLXH 2WVVB 1MZYA 4OZFA 5GSRB 1KEML 2HJLA 5EUOB 5J12C 5E9DD 2L8AA 3HUJA 4ZW7A 2WHVA 5I6OA 5F1IB 1MVUA 1VGKA 3CBJB 5JPMB 4P5RA 4S1QL 4BBWA 2BWDA 2QTVA 5GRYA 3UH8A 2DKMA 4XE0A 1MY7A 4LMQI 5M95B 3LRLA 2KL6A 1J1XH 1HAUA 2WP3O 2ZUVA 4IIZA 4B96A 2WBJB 2DWEB 4G43A 3QNXA 3F85A 1C16A 2FSEA 4JANA 4YHKH 3ZQXA 2NXZD 3HEIB 3BPLB 5GS1B 1ZVSA 4FFWC 5DYOA 1THAA 4LSTL 2WUBH 1T80A 2CRYA 4A1RA 3PWVB 5F7DB 4F7CA 4M8QB 4ENEC 1U3HD 4PJFE 4XO5A 5JA8B 3OX8B 4N8UA 5D7JB 4AUUA 3GMOA 1NOAA 4NZ8A 1QBML 2NUPA 1FFNA 3ZKXB 3NTCL 4G5AA 5CBAB 2G3NA 3OB0K 4HA1A 1F4WL 5E8NB 3L4CA 2X4OB 3PF2A 3FTWA 1IBHA 1HWWA 1XGUA 4MMYA 1ETZA 2CSPA 1NM4A 2AGJL 2WOBA 5DWUL 3MBWA 2WXFA 3SE9L 2J3SA 5KVMC 2C34A 3OG6B 1N3NB 4JGNA 2CDFB 3SKUD 1JWSA 1YECL 2Y25A 1ZCRA 2E9GA 4UM8B 1UXSB 4XP6L 3LS5H 4RSVA 3P3UA 1KELH 4JDVA 3Q01A 4Y2DD 3HI6L 1YQVL 4IBWA 2DIJA 1EJ6A 3EH2A 12E8L 3BAWA 1D2OA 1JSYA 1XD1A 3K6IA 3P30L 4XP1L 4CVWA 5I1GH 1P2CA 3CG8A 2OJZH 4OCRH 3KZ8A 2NNAB 4N8VA 3VE0B 1N5YL 4JKWA 3SOTA 2DWDB 3MTXA 3OV6A 2DQTL 3ARUA 1CDBA 5J1AA 4OB5H 4PJ8A 3KBPA 2X05A 3VXRB 1X3DA 1ITBB 1O9WA 3MBED 3QUYD 3IVKA 2AQ3A 2K7QA 2K8MA 4FFZA 4JHZA 4N9OB 3WEMA 4C4BA 5EV7A 3BESR 3ZE2E 1N18A 3I6GB 2I07A 4LLWB 4ZQKB 4PJ7F 4PVNA 1TTUA 4X5QA 1A3QA 1NBZA 1NCDH 4R26H 3WAKA 1F5WA 2GFBB 1MF2H 2V2TB 4GO8A 2P5EE 1NL0L 1JRHH 1KXTA 3L2LA 5E1HB 1A02N 2JTYA 4WFFD 5F7KC 5KVDE 5J8OA 3NK4A 4LGRB 4E41B 4YK4B 2ITFA 1EGJA 4APXB 3HBQA 3S6CA 2OSLB 1QLFB 1O7DE 1MRDH 3Q6FB 4ZUUA 4M6ML 1FH2A 2G5UA 4G7QB 4HGKC 1AGFA 1R4XA 2P8MB 4MZRA 1N67A 4A37A 1JPSL 3GHBL 4LSUH 2O4EA 3GI9H 3WUWG 2GITA 1E9PA 3V95A 3GINA 4C83B 2GSIB 1GVIA 3KPLB 5C7XL 3CQFA 3RFZB 3QUZA 3ZMEA 2YUVA 3GRWA 3BN3B 5IFJB 3K1KC 2EKSB 4DOHB 1BBJB 1JGEB 4LIQH 3BPCB 1JNNL 4HJJH 1RQ5A 1T3FA 3N9GL 1FVEB 15C8L 1KB5L 1SEQH 2UZYB 4ABUA 5GS0L 2Q86A 4D7PA 1YN7A 1ES0B 3I9GL 3CX5K 3P3YA 1HH6A 1E9OA 4N9GB 4G6KH 4UT6A 3KPSB 3DJ9A 1A4AA 5E70A 3T2NH 4WFED 1NMAH 1JV5A 3SY6A 4KRPC 4APQA 3QRFM 3NFPB 4OZ4B 3X3GL 1NLBH 2EVHA 4U1HA 2ITCB 3DVNB 2I9LA 3GTTA 4D7BA 1T0NB 2IQ9L 2VO5A 2XHNA 2OSXA 2Z31A 3BPNB 2BSEA 3SCMA 3PHOA 1ZLVH 2HCZX 2CKBA 2J21A 4YSRA 5HY9A 5JZ7D 2Y36L 1U95B 4M1DH 4P99A 3LRGA 4JBSA 5BJTA 3NFNA 1KGYE 1E3FA 4YDKH 4TNVK 3LRMA 4NNYB 3DNKA 1CYGA 2ZCZA 1MCBA 1YNTB 3DPDA 4V1DB 3Q3GA 4LB8A 3EO9H 1WEJH 4K7PX 1HILB 5IEHB 4FLSA 4GAAA 5CEYA 1CVSC 1LP9E 1TNNA 5EF0A 3FBQA 2ARJA 1YEWA 1FL6A 4KRNA 5F89B 3TCTA 2COQA 3PQYD 2EAEA 2Z93A 2M1KA 4P5TA 3LH9A 5DI8B 2B5IB 4GQZA 4XBGB 3ZT5A 4B3VA 1MOEA 3ZKND 3NSXA 2ICWJ 3PNWA 4HCGA 1RJYA 1I8KA 4ZPTB 4AE0A 3K8KA 1ZA3A 2MNJB 2IMNA 4DSYA 4KXAA 2GYSA 3CGTA 3DVGA 3MLVL 4KHTH 3T77A 5EPMA 3NJLA 3QDHA 1HN1A 2J44A 4PGJA 1TJMA 2X6CA 2OMWA 1OVZA 2EDRA 4YSEA 4LASH 4ZMLA 5SWQA 3H3PH 2X2YA 3SDDB 4BZ1A 3GJEB 4RGMB 3ROOA 5E4OA 1U8CA 2B9BA 5DYOB 3THMH 3U4KA 4ZDHA 1BFOA 1ZHNA 5JQIB 4M62H 4R8WH 1XR8A 4WHYH 4KQ4L 4Z7AA 2W91A 1M1XA 4KUZL 5LBGA 3LKNA 1X4ZA 5HXMA 3GMOB 2I9TA 2IGLA 1WCBB 1DQDH 3QRGL 1FAIH 3ROLB 3TO4A 1Z1WA 3K4ZA 5H4YA 1E7UA 2ZWZA 4NI6A 4IRZH 1VACB 4G80B 3T5WA 1O5PA 1NINA 3PY9A 3RIAK 3E1F1 1HE7A 2OM5A 1FLTX 3A6CH 1E28B 4AUYA 3VYNA 2V17H 2VABA 1XGPA 3DHJA 1JCVA 4AEIL 1AMXA 3TT1L 3SOBH 1XF1A 4XC1L 3S36X 4HUXA 3QQ3A 4PJ6A 4QXTB 3T0BA 4CW1B 1FRGL 3TWCH 1YNLL 5BRQA 4X5LA 4GEJA 2A77H 5D2NB 5J1TC 1GTFA 4HX1A 4RAUB 4YEEA 4WWID 2VJXA 3VYOA 1I1YA 3V6ZB 1GC1L 2GJPA 2ADIB 3B83A 3E2HC 3O2VL 4UV7L 1AY1L 1FGNH 4HIJB 1VF5C 1ZS8A 3E1ZA 3SD5A 3MUY1 5C9JA 1KJ3H 1MIEH 4XMKH 1FSKB 1HHJA 1FZOB 1I31A 4LCUA 1L4IA 4LK4A 4DEUA 1TSRA 1K8DB 2AK4A 2VERA 1NDMB 2OR7A 1UXLA 2W5PA 3FQYA 5IQMA 3D52A 3F64A 2EE3A 2BXZA 2NNCA 5DFVC 3KBFA 3MRDB 3QPXL 2UZXB 1A9BA 3ZMRA 4JO3L 4XI5C 4YSSA 1J9RA 4DK6A 3FFCE 1AQMA 2EP6A 4QJ4B 1JCKA 1BX2A 3ZE1B 2WKOA 1Q9KB 5B38B 2AF2A 2XUWA 3L4UA 3AREB 1W8NA 3UO1H 3FO1B 2YRPA 1KGIA 5FGCB 1K5WA 4S11A 4FQXC 4J3OG 1RIVL 4C47A 3IFOB 3QHFL 3WUWA 4O02L 3CLFH 4F1ZA 1RUKL 2YGPA 4HKZA 5I73B 4NNPL 2FQDA 1QMUA 1S46A 5LHDA 2ESVE 4HOWA 1MREH 1UUSA 5FM8A 1SMOA 3DA0A 2D4FA 2YXFA 3A23A 3IRZA 4TL4A 3QI9C 2YAMA 2YKLH 4XPBH 4ELDA 4Q14A 3C6LC 5I0DA 5HI5C 2H3NB 1PZCA 4NGHL 3RPKA 4MCZA 4WEEA 1S3RA 4MA3B 4D3CL 2BVYA 3O2WH 3FU6A 3ZO0A 5K69A 4X99A 1FFOA 2NSQA 4EUPB 4LNRB 4K3EH 3LXAA 4X42A 2OYLA 2OMYB 3IJEA 4U1NB 4BQ6A 3T3ME 1NEZA 1R3IL 4BUGA 1J11A 4PLOB 2BXYA 3VFWA 5CCKL 1KLUB 1U4EA 3DIVA 4AKPA 5HDLA 2I7OA 5D9SA 4A7QA 3VQLA 3JYBA 3KPMA 2KLRA 5CN1A 4OGXH 3UYOD 1VFMA 3D85B 3MXVH 5C0CA 3VWKB 4PJ5A 3BFQG 3SDXF 5DQ9A 3H9SA 5CNHA 1CGYA 1IX2A 1GRWA 1IEAA 1OK0A 3LN4A 1JHKL 4L9LB 3RTLA 2FZ3A 2DBJA 4X4ME 3QFJE 3ZYOA 3L9EA 3QUGA 4KNTA 2DMHA 4F15C 2NNXA 3NP3A 3O3BB 4JVUA 1DO6A 3DGGA 4QY8B 2FJGA 4GSDH 4AG4H 5BQ7B 4HIPA 4KVCH 3CCHA 3KW7A 4IRJC 2VL5B 1TTFA 3B7UX 2HPOA 1J87A 1IGML 5AW4B 2Z31B 2DJUA 3BVXA 3L1EA 1IGTA 2PPCA 3NRQA 4JN1L 1EMTL 5AVWB 3U4AA 1BFVH 1KCUH 2X9YA 4IBYA 4FXGA 4N6QA 4PVLA 1QSEB 5DQJB 1OKEA 5DUBB 4PV8B 2CR3A 2XIDA 3X12B 2H41A 5EBGA 2V9TA 2FT7A 2J73A 4JO1L 5L7XH 3CFMA 4XNUL 1F4XH 3CFDA 5EOTA 5DVPA 5EWIL 3RJQB 2G9HA 1OB1A 1WSST 2CLVA 3S4SG 4GO6B 4L8DB 1D7FA 1IM9D 1A4BA 1L9RA 2EJ1A 3I84A 4OF3A 1KV3A 3P9WB 5EZOL 5BRPA 4M7KH 4X6DE 3T0VA 1B4JH 1Z5YD 1BBDH 1FL6B 5IF0B 2VQ1A 4HHWA 4UQ3B 1T66C 4BCXA 3Q48A 2VDMH 2CJ3A 1QWNA 1IC0A 1WISA 2XWXA 3L1FA 4HP5A 4NQCD 1QSZA 4PTUA 2X7LB 5FGSA 3O6LL 1AVAA 2AV7B 3T3PF 4XNQB 4L8BA 2UY7B 4ZOBA 4XNZC 4BZ2H 4CVZA 4LNVA 4J3SA 4ZMAT 1BXVA 3K2UL 5JXED 3IJ8A 1S9WB 5HYJD 5JIDA 1BQRA 1NBYA 3TVMC 3BZFA 5DJAB 5D1ZI 1NBQA 4EN3B 1FHGA 3MV9B 4MS8D 2YGOA 2VW4A 1SJHB 4NJ9L 2VDLB 3GMQA 3ROOB 1U8CB 4L29A 2ZYRA 4YHMH 5KYUB 2XV3A 2FYYB 4FEMA 3HPLA 4PJEF 5CWSA 3ULVE 3IFPA 2GIMA 3UTOA 3BMWA 1AE6L 3OJMB 3TM6A 4P4KB 5D93C 3BGMA 1GSMA 2DBLL 3D2UB 3N55A 4L5FE 4H8QA 3I9IA 4Z7UF 4PUBL 4GAYA 4OFKA 1F6AB 3HMXA 3QQ9D 4GAJL 4U7KA 4LSVL 5C0CE 4PJ5E 2UWEA 3ZBMA 3VSVA 2IGFL 1YEJH 4MXVE 3H9SE 3HB3D 1PY0A 4CU6A 1T7ZA 3II1A 3PDOB 1JPGA 1RL1A 2DI7A 1J5OL 4KK9D 3MLWH 5CCJA 3EXJA 5TD4A 3BQUC 1VFBB 2XQYG 2J5WA 4ONGH 1XR9B 5FCSH 4JRXE 3UDWC 4MVBC 4QHNA 4M7LH 1SUHA 4JL1A 4KJQC 2NR6A 4JM2C 3UG4A 4P48A 3G3LA 3HC4L 1J1PH 4IU3B 4XC3L 2IH1A 5F3HA 5MERB 4ABWA 4B7IA 4U2ZA 4MS6A 3KCWA 3U6RB 2NY4D 1NCBH 2BJML 8FABB 4PGBB 2R2EA 4Y8DC 4AVKA 2GIYA 4ZMZA 1FLRH 4XX1E 4U1IB 1MJJA 5DRXB 4X0NA 4NO2B 1G1YA 5G5DA 1Q94B 4I2XB 1UB6A 2A74C 5FWRA 4Z18A 1W6WA 2VKXA 3R0MA 1WIPA 1P1ZA 4XNXL 2VJ0A 5DUML 4N1CA 4PWKA 4YXKL 3LIZL 3A3YB 5BS0A 5JHAA 3SDCB 2H32B 4ZMWA 3DRQB 1K6QH 1FFRA 3IDYC 5AVVB 2Z3FA 3DGDA 4FYSA 3P11L 1T5WA 3RU8L 4J1UA 3QJHA 2X1WL 1OP5H 4WU5A 3F7QA 3TH3T 1CVRA 1ZTXE 4YXHH 1BLNB 1G5AA 2GQHA 3VWJC 3QDGA 1FZMB 3CZFB 4JFDA 5F97E 4X5RA 3WHXA 4RFNB 3FSWA 4PV9A 1YUHA 3HG1E 2MRYA 4XN7A 2ENJA 5PAZA 4FQLL 3QULA 1ID5I 1YC7A 4G7YH 3H53A 2P47B 4JQXC 4ZBJA 5D7LA 4LCWA 1D5XB 1ZV9A 5C0BD 4ZZFA 1XVSA 4WTZG 3DX2A 1Z3GL 3WV0A 4DAGH 2ZSVB 3M6DA 3EGDA 1NDTA 1I7TB 1QFWH 4NO0A 2P5WA 1UT1A 1U6AH 3J27A 3EYFB 3LMJL 3CHQA 1I3UA 3QFDB 3NA9L 4I77L 1PBYA 3DX9B 4FXKB 1NAKL 2UWEE 4NQDA 2XNAA 5GZNA 5D9SB 4DGIH 5ACZB 2ATAA 1RY7B 4LSSH 4NCC2 3B8SA 5F7EL 2ED9A 1USZA 1JTTA 2X5PA 3WL9B 4V33A 3KLKA 4GG6A 1ZPLA 2IALA 3ZTJH 3P3RA 4R2GB 2AXHA 3NVQA 1IEAB 1NMCC 2UX6A 2GTZB 3QHTC 2V5YA 2CLRB 3F65A 1HWGB 3P40A 3S4SA 1CFTB 1S9VA 3F04A 1XH1A 5I6MA 3ZXAC 3CN3A 5CXPA 2VDPL 4E42B 3GSRB 1WD8A 25C8H 4KK5C 2JNZA 4CSSA 5DR5H 2LFEA 2J2ZB 1YYMH 3LPFA 4HGWA 2XZQL 4PJ9D 3U6XA 1WAAE 1CFVL 1KLFB 4GO9A 3N0AA 4NO3B 4PRNA 3GTVA 3BP7A 3HFFA 2GW5A 3CFUA 4NP4L 4XOCA 3WNJA 3HKFA 4FXGB 1ZT7A 1FZJA 4XP5H 3VH8B 1CBVL 3KGUA 1B6UA 1QHOA 3OKEB 5FF6B 3HFMH 5EBLA 4Z7OF 1C7TA 2G9HB 2ZSWB 4GFTB 1F90L 2ZXDA 3S37X 1M3IA 3OTTA 2N7SA 3HE7A 1RXLA 2VH5L 2OS7A 2F53D 4LDCA 4Y19E 2AZUA 3RKDD 4BH8A 1UWEH 3BKCH 3BX7C 3OM3B 5I8CB 5AD0A 5I74B 2HTKC 1BXUA 3D05A 4IIQA 3QXUA 4MSWB 1OL0A 1CCZA 2DMKA 2VLMD 1NPUA 2V8MA 3SBQA 4KDTA 5CKAA 4NC2B 2WQXA 1KOAA 4QIRA 1XF2B 3NSCA 3SKNB 1KGJA 4IRSD 3V0HA 2DDQH 4PTUB 4JFWA 2XRAH 3VG9B 1ZXKA 2VDOL 3N50A 1BREA 4QOKA 3OC5A 1OGAA 4N0YL 4HU8A 3T65B 4GBXC 1G6RA 2OSWA 1ZLVK 4BM7A 4WGKA 5DRWB 5ERWB 4YDMA 3BZFB 4ZI8A 5D7LE 4PJGB 3MBXH 2VSMB 3KYAA 4HH8A 5E6IB 3TEUA 3X11A 4C56B 3SPCA 3L7FA 4OR1A 3TT3H 4M5YL 1I1AC 3GXFA 5DA4A 1WDAA 2XBZA 4UM9A 1AP2B 3WBDA 4ZMYA 3QYNA 1Q1JH 2R0KH 2XV0A 1Q4NX 3V0WL 3U7YL 3L5IA 2GJ6B 5IVOA 4F7EB 4MQTB 4NQDE 4WJ5B 5D1QD 2AXFA 3TN0C 3BKYL 1RUMH 2DH3A 3BH4A 1SN5A 3AGWA 4P2RA 5E08L 5KSAC 1EO5A 4GUPA 1X5IA 5C08A 1KXHA 5DUPH 3MV7B 1UM4L 1GZHA 3JVGC 2BC4A 5DD5H 3QO1A 1BZ7B 1KN2L 5C1MB 4HK0B 4BYHA 2EABA 4NLAA 1PLAA 1RUQH 2Q20A 4RGOH 5BZWA 2ICCA 3MOAL 1GGCL 4PCYA 4JB9L 2YSSA 3OBAA 4I3SL 5EB9A 5JUEH 4KZDH 5E0FA 3P02A 1CK0H 1L7TL 5CSBA 4TUKH 3MROA 2DB8A 1HIML 3D39E 3V4VB 2BSTB 4QTHA 3T04D 4RAVA 3QEGL 1TTRA 3ZDZB 5TE4L 2WWMD 5EFIB 1N59B 3VM5A 3U9PL 4P2QA 1RI8A 1DVYA 4G6MH 3LSOB 3QJUB 4JFZH 4ZOEA 2P7TB 4YDVA 4FQQB 5IVXF 5KBLA 1FO0H 2E46A 4ZX5A 1Y7VA 4U05A 2NYZA 4X9IA 5LCVH 5CD5D 3WTUA 4JCMA 2DAVA 4F24A 2X4UB 3G5WA 1A7BA 5G5DB 3DXAD 8CGTA 2CUAA 4NC1C 3VXPA 1BAFH 1HCZA 2O93L 2RBLA 3MRCB 3QIUD 3QJRB 2ZX5A 5FUOL 1X4XA 1UOVA 3IKCA 4U6HA 4UB0H 4FN0A 4ONOA 4WTZA 4X7FC 5HPMA 1NIDA 2YZ1A 3MJ8A 1S9KC 4BFBD 4U0QB 4EI5D 4ZMOA 4JO5A 2IH3A 4AVIA 1U3HC 1LE9A 5J5EA 4WDIB 2QHRL 5BS0B 5IK3A 1IFHL 1A47A 1CG9A 1DLFH 1DVZA 1MI5A 4QOKE 1DJGA 1OGAE 3B5HA 3OPUA 4TUJB 5KSBF 1CDUA 4HJ1A 4NXKA 1OK8A 5EA0L 5GSVA 2N4IA 2ZUTA 4IJTA 1CGVA 1INDL 3QJHB 1E4WL 1SLVA 1UJ3B 1WWWX 3OKKA 1T1XB 4Q2ZB 1CU4H 5TK4A 5JHLL 3D1MC 4IBUA 3T2OA 1JK9B 4GSXA 2F15A 4E9TA 3E7JA 1NLDH 2ZWKA 5D70H 3DVFA 1MKFA 3NCYS 4TLTA 5DS2A 4YSAA 4WJG3 3QULB 4HS3A 5BRZE 5IQ7H 1QLEB 4Z7WF 1KPVB 5IVNA 4GW4A 1N8OE 3L3OB 2FDBP 1NCOA 3WDIA 1JPST 4ZX4A 5FYLD 4MMXA 3U2SA 5C6WH 3QNYA 5DJYA 2VLJD 5DK0A 3DSFL 4FG4A 3TBTA 3ZTNL 3PE9A 5DJ8B 3CWGA 3O9WD 5C08E 1JL8A 3X13A 4YIQA 2A9AA 5LAXA 3LKQB 2ZKWA 4Y2DC 2WN3A 3BDYL 3TBCA 4ODBD 2PYFB 2EC9T 2VITA 5C0IA 2Q8BL 1CDIA 2F54E 1U8PA 3S2CA 1VB9A 1FUNA 1KLGA 3WTTA 5K59E 1IM3D 2YWZA 4KROB 1QFOA 2J8OA 1P4IH 3OQ3B 4GG8A 3FDWA 1EXGA 4IEFA 5JNYA 3FO0H 3DJRA 2D3VA 2ZUXA 3F5WA 2KQMA 3QRLA 1SY6L 2X9ZA 3LYRA 1KTDA 5DJCB 3VD2A 3PDDA 3QUYC 3MBEC 2A6KA 2VIRA 3O6FB 1CLOL 2MQCA 2ZNWA 2F0CA 3ESPA 3I75B 1L0PA 5EU5B 1DQLH 3UP6A 1OCWH 4HSCX 2VSCA 3NSDA 4IOSD 3STLB 1CGTA 3DTDA 4PFEA 5AKRA 2YQBA 3QORB 1KBPA 4TNVF 3TPUA 4Z7QE 4G8GA 1ZT7B 3LKOA 4WW1A 2CBMA 3OZ9H 2WBJD 1T5XA 2EYSB 3FSOA 1OGTB 4GIOA 4ORGA 1CR9H 1COBA 1J48A 2ZKYA 4DEPC 2KI6A 2QR0A 3GXUB 1B0GA 1M7IB 2ICWA 1GKEA 2QQNH 3DX8A 3QEQE 1DBAH 3C09B 4UZGA 2J8UF 1PL3A 1JP5A 4M43L 4O4YH 1PNDA 1AH1A 3MRIA 4OUOA 3D18A 3FT3B 4DPAX 3DURB 3KLHD 1V27A 4XCFH 3WTYA 5EDSA 1SVCP 4NHCL 1QSFD 1JFQL 3OJDA 3KVPA 5D2LF 5TDNA 1A3LL 5D7JD 1G7QA 1PFCA 1D6VL 4P05A 4JK0D 3L3KB 1NPNA 5HJDA 1NDGA 2XOTA 3U1SL 3FQNB 1ASPA 4LEXL 3AG1B 5DRNB 4K9EH 1BF2A 4I18A 3GEFA 4WU7A 3CX5J 2HT4D 3AUWB 2BZ7A 2QVFB 4Y4FA 5H94B 3UTSA 4I9WD 1ZHBA 4ZFOL 2DQHH 2Y5TA 3GO1H 4F80A 4YHOL 2ZOKA 4FLOA 4LPWA 4DP5X 2P42B 1IBFA 1S7VA 3MRMA 4LLMA 4JVWA 5IM7B 1ZGLB 1N6QL 5JIKA 5AVRB 5EOQL 1PS3A 1WIOA 1TFHA 3WAJA 5E00A 3VG0H 4B53A 4PRDA 4BSJA 4DW2L 4F2FA 1ZLSH 3QUML 3EO0A 5HHPA 3ARYA 3RIAF 3MCLL 1JBJA 4LLDA 1CPUA 4NWUH 5DGQA 5JZ7C 1HL9A 5I1AB 3U7WL 2X89A 1A7QL 3NG5A 4IBLT 4UV4H 3DO3A 4ZS7L 1KB5A 3TNNA 2OCCB 2BHYA 5C6TL 3NYKA 5BZWB 2E75C 3MACH 3MRGB 1Y6KR 3TL5A 5IHWA 2BIOA 3DLQR 4UWQB 3FRUB