1OSPL

Crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIQMSQSSSSFSVSLGDRVTITCKASEDIYSRLAWYQQKPGNAPRLLISGATSLETWVPSRFSGSDSGKDYTLSITSLQTEDVATYFCQQYWSPPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/lipoprotein)
molecule keywords FAB 184.1
publication title Crystal structure of Lyme disease antigen outer surface protein A complexed with an Fab.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1996-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ospL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ospL01
1CU4L 2GSIA 1XR9A 3KXFA 3HUJE 5IFAL 1V05A 5E03A 5JXEC 3L1OL 4KJPD 1OP5K 2G2RA 1LO5A 1JJUA 3ARDD 3PHOA 4Q0XL 4W4NA 3S96A 1ZKAA 5DT1L 4G8GA 3UYOD 4L8BA 2AJYL 4MNGB 3NZ8A 3F7YA 1DJSA 2A9ML 3IJYA 2DQEH 5IB3B 1CLYH 5HGBA 4RA0C 3TO2A 1NBYB 3QG6B 2NY4C 2MPAH 1KC5L 2NY0D 3A67H 2IADB 4JRXE 2QSCH 1AO7A 5MHSD 1BFSA 4WHCA 5KANG 2IGFH 4GBXC 3KPTA 5SWSA 3SEPA 2P8LB 4GKZB 3S3SA 5D2LE 4HEPG 2BSTA 1KYOK 3FB8A 4MD0B 3S7GA 1R3HB 1VFAA 4E42B 2APFA 4S0SD 1JPGB 3QFJB 4HFWB 3TP4A 5FGSA 4LLMA 3SDAB 4KUZH 3JTTB 1CDCA 5FK9B 4HC1A 2EC9T 3S5LB 5HDBF 3MLVH 2ORBL 1NGPH 1AY1L 4XNUH 1TQBB 3GKZA 3FQRB 4NJ9L 2DL2A 2EDJA 1LD9B 2K3TA 3PNWB 3RVWC 3BSZL 4NN6C 3LKNB 3G6JB 4KK5C 1BD2D 1X5ZA 3GMNB 5LGKA 2V7HB 3O6FA 2WLYA 4M6ML 2ZCLL 3OXSB 4NQSA 4HIXL 2ZOLA 2J4WL 1UEYA 2CJUH 3GMOB 3O2DA 2V5SA 1CYGA 2FD6L 5IM7B 1TTGA 5T1MA 1BLNA 3D9AL 4UILL 4KWUA 4PRHA 5E6IA 5KJRL 2BNRB 3FQTA 4MJIA 5IKCB 3ARFD 4KK9C 1I8LC 3VXSE 2JKXA 3ARGB 4FZEL 3SHSA 4TNVF 2VLJA 3FHAA 4F7EA 1OTSC 3GK8L 1NBVL 3HNSH 3BT2L 3T0ED 1W8NA 1F5WA 4JM2F 1HHHA 3O3AB 3OJVC 2VR4A 1DVFB 2HLAB 4Y1AD 4OJFH 1LEKA 2AXHA 1CG9A 1UCBL 4YHNB 3NIGE 4Y16A 1PY4A 3PGCA 4ALAL 4AMKH 2EDDA 2IFFL 1MELA 2YUWA 3KDMA 1MF2L 5D93B 5C92A 3OGCB 3KR3H 1YEJL 2QQQA 1ZT1A 1BJ1H 3V0VA 2NY5C 4YBHA 1VEPA 4MA8L 3FB7B 1FGVH 1BJMA 2BOBA 5T33H 4RA3A 1RU9L 3S35X 4CMHC 1U91A 3QXAB 4XP9L 3QRGL 4KPHL 3RNQA 3R0NA 3KPMA 1JK8B 4NQEE 1QSFE 4KDVA 5C0GA 3QI9C 3G5VB 5LG1A 5AUMA 3OAUH 2H41A 4AG4H 3TESA 2OI9B 3BN3B 5L2KB 2ATKA 4GW4B 5B38B 3VRJA 1VDGA 4BYHA 2R0KH 2WIMA 1I8MB 2BCKB 4NO5A 1PZ5A 2EIDA 4HKJA 4QXWA 4M1CD 5CGYC 2BOCA 4QY8A 1NEZA 2NY3B 4U1SB 3MRKA 3V5HA 2IBGA 4L9DA 4P9MH 4RFNC 2F53B 5HI3D 2M2DA 4WV1A 1B0RB 4ZPTA 1HXYB 5FM5M 5BVPL 2EDOA 5F3HA 5FGBC 4PJ7E 7FABH 1RMFH 4XP4H 5DQJA 5E9DD 3B9EA 3MRGA 3CLEH 1F90L 2ZSVB 4CW1A 1FNHA 1PLGH 1IC1A 3CZFB 5D7IA 4WTZG 1VFBB 4IIQB 2X4NA 4J4PA 4A6YL 2GEEA 3TVMA 5KN5B 2IH3A 3U7AA 3VXPA 1ZGLA 2EYTA 3GO1L 3QIWA 4KGJA 4DOHE 2GYSA 1L0XA 1LGVA 4G9FD 4RNRA 3WIHL 5F1KC 1EJOL 3SDXB 1CFBA 4FFWD 3BKCL 4J1UA 3WHXA 3M8OH 3NBNA 5JXED 3UBXI 2KZ1B 2EYSB 2YD2A 1MAJA 4TNWF 2DQDH 3NFSL 4FQ2L 4M7ZC 2VDPH 4GAGH 5CHNA 1FC2D 3TNNB 1NEUA 4NQDD 2D0GA 5EUOB 3HI6H 4F3FB 4PJFA 1H15B 4NFDA 4YDJB 2YK1L 5J1AB 4KDTA 3EDJA 3GSXA 5IP4A 3ULVE 5F93C 4LEOB 1RAMA 5IWLC 4J3UA 1BAFH 4YC2B 4YJZL 1ZLWK 2E7LA 3QZWG 2NTSP 4GW5A 4HJ0C 4WI6A 1DBJL 5ESQB 5DJCA 3J8F7 5F7WC 3LV3A 3CX5J 3LKOB 3QQ3A 5AWNL 3LQZB 5BZDB 2JCCF 5ECJE 2DLFL 5F7DB 1BQUA 2MCPL 2PYEA 3QEUB 4RGNC 5IT2H 4MNHA 1NBZA 4EUPH 4M6NH 4PS4L 1J18A 4FQIL 5DC0A 3GSWA 5ETUA 1JF1B 4JRWA 1P84K 3GBMH 1U8OA 1T5WB 3SDCB 3RVWD 3RTQA 2F58L 1MEXH 4Y88A 5M94B 5JHLL 2DWEB 3SO3B 4BH7A 4P23D 4YHOL 1CFQB 4Y2OA 4HV8B 4OD1L 1OP3K 4XC1H 3WNOA 4L8CB 1T1ZA 5HHOA 4P46B 4YHLH 3TIEA 4P57B 1BBJA 1HYRC 2D7TH 3VFOB 3AREA 3RVTC 5ABDE 3WS6A 3T2NL 3CVIL 5L8JB 4N5EC 2VL4A 2XG4A 4LLVA 4NWUH 3QT2A 1G6VK 2W60B 3MCKB 4NCC1 4IRSB 4OV6F 1JNHB 1WZ1H 1YN6B 1A6ZA 3F7VB 4Z7QF 4CN4A 2WNGA 1OTSD 1MCEA 1GGIH 4HF5H 2FX8L 4P2RE 3K8MA 5SWZB 4WRLA 2DAVA 3AROA 4Y4KD 4U6XA 5CJXA 4ONFL 4UT9L 6FABH 1C7TA 3QXWA 2LVEA 3LRGA 2OZ4H 4G6MH 4NQVB 5ITFB 3TH3T 1ZA6A 5TDNB 2F54B 5E5RB 4I3SL 1DLHA 3FRUB 1MCPL 3C8DA 2B20A 3FT4B 8CGTA 2MWCA 2BFVH 2VDMH 1GCFA 1FSKC 5IBUG 4L3EB 4IOIB 3SGKA 1HKLL 3I50L 4NT6A 2R29L 4OZ4B 2Z31A 4PJ9D 5EIVA 1KV3A 1BZ7B 3AAZA 1JN6A 1IAIH 1GIGL 3ZZ1A 3RWIA 5L2JB 3D39B 2WK2A 3OB0K 5EORL 2DMKA 4U0RB 1IGML 4HWBA 3SGJC 4OD2B 3K8KA 1KGCE 5IOPA 3O6ML 1QZ1A 3RI5K 1VENA 3CH8A 5CGYD 1J86A 2Z93A 1RZKH 2A6KA 3QQ9C 5TE6L 1MFBH 4DK3A 4PB0L 3BRDA 3S34L 1RIHL 5AD0B 1VERA 1DBAL 2BMKA 2F9BT 3GKWL 4K07A 5GRYA 5HGAA 5T3XD 4ESKA 1EMTL 1HH9A 2QQLL 1JTTA 2EC9U 3OJMB 3S97C 5D9SB 1NKRA 3V95A 5AZEL 3VE0B 3MBED 4I0PA 4G6AD 2FL5B 2ZKHH 4I13B 3EGSA 2Q3ZA 4GMSH 4L4TE 2C4FT 4DZBA 4ETYA 3ZMRA 3CMOH 3B6SB 3T4YB 1S7UB 1ZTXH 4FXKB 3VI4E 4UNVA 3PE9A 4K3JH 3UTPE 1AGDA 1KLUB 3MRLB 2EE2A 5T1LA 3STBA 5D5ME 2PCPB 5HJ3A 3RWGB 2EXYC 2W59A 4JM2A 4WU5B 1IQWL 1YDPB 1TJIL 4QXUL 3GMLB 1KB5H 4HX1B 2BVOA 1NLBL 3QBTB 1X5HA 1V3KA 3QEGH 4XGZA 1UACH 3BDBA 2X1XR 3IU3B 3UTQA 3RUGF 2J12B 4APQB 4G7YL 4R2GD 4HJ0D 3FO9B 4XNQB 4IRZL 2EO9A 3GSQB 4RDQG 1D5BA 4PLKC 4UV7L 1SYVB 3PL6A 5J6HA 2XZCH 1N64H 4WUUB 4NUJB 2O5XL 4HXAH 3QFDA 3ZL4L 1LHZA 1BFVL 4QTIH 2JTDA 3OTTA 1VFUA 3TT1L 1VFMA 2Y06L 2DBLH 3VFPB 4HC1L 3HI1A 5C08A 1G7LA 2FJHA 1FFOB 5DLMH 1NSNH 4PJAB 5T3XH 5D70L 1OM3H 4G42B 4S1QL 3I6LD 2LTQB 3IFLL 3LKRB 3QWOA 1KYOJ 3MRNB 1ZLUK 1MRDH 4R4BB 4YNYB 1D9KB 3OKMA 3RVTD 4JEGB 2WSKA 3RX7A 3ARGC 1ACYH 4WO4C 2HJKB 2J6EA 2APXA 3LEVL 3TJHD 3EFDL 2R0LH 1EBAA 2FIKB 4N5ED 4YWGL 1IGCL 1CGSL 2PO6A 1TVDA 2P5EA 3O2DL 1C1EL 3KLDA 2E27L 5J12B 4YDLC 1BQSA 4HS6B 2VL5B 4JQVC 4K7FB 4L5FH 5DYOB 2I9TB 1DFBL 5I71B 2LAAA 3ZTJH 3C6SA 4QYOA 4P4KA 3WSQL 4JO3L 1UH3A 1I8IA 1A7BA 5GGRA 3RX8A 4RWHA 4KK6D 1LDPH 4P2OC 1KCSH 1UM4H 3CSYA 1GGUA 4HS8H 4U6TA 1ED3A 5D2LF 4AEHH 1LNUA 2A6DB 4NN5B 4RGOL 3TO4C 1EJ6A 5AG8A 1JWUB 2XXCB 4WFGE 1KIPA 3UZEA 1CZ8L 1NDGB 5I8KH 1S7WA 2WIIA 3C6LA 4EQ2A 2BSRB 2ZCKH 3VD3A 5HYJD 4N9GB 1G84A 2XQYK 1FNSH 2R0ZH 5TF0A 4PJDB 3V7MA 1D5MB 3LDBC 4UOW0 4BSWB 5BJTA 1LO3L 4K8RL 2JCCA 4LKCA 4XWOC 3B8SA 4LSPH 2EH7H 4X8XA 5IMLB 4NPYB 2E3VA 4JZJB 1CE6A 4XZUB 1U8NA 5CEXA 2AV7A 4TUKH 4NSKB 4ZMAT 5C07B 3HRZA 3E2HC 5D8JL 3UTTD 3T1FA 2CLRB 3CDFA 1JE6A 4GLRH 4CGTA 1HH6A 5BV7L 4BQ9A 3HC4H 3QQ9D 4UT7L 4OCWL 4BUGA 1FLTX 4JO1L 5DJXB 5KSUA 4O9HH 3VXRD 2HVKB 4WWKA 1KBGL 3MFFB 1IC7H 1A4KA 1QNZL 1R3KA 2ICWI 1SQ2N 2IFGA 4OUUB 3BOVA 4B7LA 5C7XH 1XF3B 3TFKC 2M8XA 3MLWH 4JQIH 3GSUB 4QHKJ 3RA7H 5LBSH 2FBOJ 4HIHB 2R4RH 5IV2A 3OAYK 3BZ4A 3SE3C 5ICZB 3LEYL 2P42B 5I1KH 1KTLA 1YEKL 2I25N 3WFCL 2EIEA 3NIGF 5CINL 3OSKA 2VDNH 2HFTA 1JGDA 1BQHA 4N1HB 4G6JL 4FQ1L 5K59E 3CFEB 2EXYD 4N1EA 4YHPA 2ZUTA 2XXMB 2K7PA 1I7ZA 4AEEA 3K2UH 4P99A 1IGTA 4X99B 4JHAL 2DI9A 2XKUA 1ZA3A 4Z76B 1KB9J 4HHAB 2JE8A 2F8OA 3QPQD 1E28A 3WXVH 1INQB 4AL8L 1VKXB 1QFOA 1J8HE 4UMGA 4NHCH 5MEQA 1A1NA 3UZVB 3AU1B 3O41A 2XY2A 3H2WA 4PG9B 4X6DE 5FM4A 4F9LA 3VGBA 1FO0H 1FG2B 2X9XA 3EO0B 3LHPH 3DMMA 4NKIL 3DVIA 4PTUB 3ZSSA 1I8KB 1N0XL 2GQHA 1MLCA 3SJVA 5T5FH 5F7HA 1T0NB 1N7MH 3SDAD 3T1WA 4PLKD 2FGZA 2QEJA 4LGPB 4WGWB 1HILB 4PJEE 4P2QB 5IHLB 2OYPA 5JOFA 3P30H 1ORQA 5FO9B 1B3JA 3FT3B 3OKLB 5D96B 3RKPA 4UAOB 4KJWD 2N7AA 4HAFA 4OM1H 1M4KA 3A6BH 3GM0A 3JTSB 3ZDZE 3GMMA 1G9NL 2J8UB 3WJLC 3BEWA 4IRJA 2GSIB 1XR9B 3DETD 4XVJL 3VH8G 4I0KA 2G2RB 3PHOB 1U6AH 2ZUQB 4KZDH 2FHCA 2VR9A 2XICA 5DJZA 1UQSA 3NA4A 2IBZY 3T0AA 3NZ8B 2OR9L 3RY5A 2BNRD 2OQJA 2HN7A 4JKKA 3IFPA 4QRUB 3IJYB 1KJ3H 4ZO6A 2MHAA 2DF3A 2NY6B 5HGBB 1IBGH 3ILPB 4FP8L 2GJ6D 3ARGD 4WO4D 3TO2B 1FBIH 3VMNA 2XTLA 1ZEAH 4KRNA 5HI4C 1WT5C 4TQEH 1A6WH 4JCMA 2G60L 1VCAA 5B8CA 1FVCB 3DX7A 4M1DL 5C0BE 5KSBA 1DVFD 3TGXA 3QNYA 4F7MB 1E4XH 5SWSB 4ZS7L 4JFZH 4OLEA 3T2QA 2Y36H 1L4IA 4XNZB 5HHXH 4P59H 2BSTB 1W8OA 2OTUB 3F12B 3FB8B 1HXMA 1KXQE 4HMEA 4EXKA 1T5XA 2CDFA 2B4CL 2C4FU 4UT6L 2GI7A 3HG1D 4M6OL 2ZOKB 3PV7A 5IESH 5TDOA 1NLDH 4P2OD 1F4HA 5GJSL 5TPWL 4Z7OE 4PP1D 4DVRH 3H9SE 4Q74A 1Q9OA 2YHGA 4GMTL 4YHKH 1KT2A 1R5VA 1I9JL 2ICWB 1X4YA 5LQBL 2AJ3A 5FGRA 3RUGA 5HI5C 5F6HI 2QHLA 3HZKB 4ZXBA 4CRPA 1CDIA 5JDSA 3RIAF 3IDYB 3O6FB 1J0YA 3QUYB 5L2KD 4NJAL 4NQSB 4UOJA 1U8HA 4LASH 2DQHL 4XWOD 1UH2A 1PQZA 3NCYP 5T1MB 5GRXG 3PWPB 5E6IB 4PRHB 1YA5A 2F53D 1YEIL 1HOCB 4PV9A 2X4QB 4U6YA 3FQTB 3O45A 5TE4L 4KKBD 3F62A 4WHYH 3OF6D 1YJDL 1QBML 3V5KA 1A5FH 2C3XA 2VDOL 2I5YH 4PRIE 1A6UH 2E7CA 4ODVL 1DQDL 4PB9L 3HE7A 4CAGA 4GOSA 4HWBL 1HHHB 5D7SL 5I2IA 1KLGB 5SV4A 3STZA 5IR1A 3QDHA 3QEHB 4LSVL 1R24B 3TFKD 1TETL 1CG9B 3RDTC 4NKMB 4UINH 3KDMB 5E8EA 3HUJA 2HTLC 3VMOA 1J0KA 3V0VB 2AQ1A 3EDKA 5DRWA 3KYNA 3PQYE 5I1DA 4WCYL 5JA8B 2BOBB 4KTYA 4NNYA 3VXNB 3B83A 1LQSR 3QUKA 4KUCD 4JGMA 3RNQB 1B4JL 5IBLD 1Z3GH 3U6RA 3HRPA 3LRSA 5C0GB 3AFLA 4XPTH 1T1YA 4YE4L 4W6WB 3GSNA 5AUMB 1BVKA 4K94L 4P5TC 4LPUA 2FSEA 4JRXA 5IJKA 1KTRL 4GAYB 5JIKA 1A3RH 4L3AA 2ATKB 3I6KA 3VRJB 3HR5A 3NTCL 1G9ML 2AV1B 3P9LB 1NGXB 3AVEA 5D2LA 3GBNH 4Z7UE 4NO5B 4NZJA 4FQQA 1FV1B 4HKJB 1QKZL 2OP4L 3VFWA 1NEZB 1DLFL 1WSST 3D25B 1KIRA 4GRMB 3FQWA 4JDZB 4B5EA 4WV1B 4Y89A 2DJSA 4ZPTB 3RWEA 3CNKA 5T3ZE 5E8DH 3LPGA 4M7KH 3BHBB 3OKKB 4LLQA 1J0IA 4N1CA 3NCMA 3EHBC 5I1CH 4NYLA 1CLOL 3QO1A 3DROA 1M6OA 1EO8L 2X4NB 2PNDA 3TVMB 2IH3B 3VXPB 3VD5A 2EYTB 4X9GA 5B21A 2DQCH 4CMMA 3JWDL 4IOFC 5MI0B 1ZAGA 4ODWA 3U9PL 4X6CE 3WHXB 4WNQA 1ETZB 4PD4K 3PJSA 4P46D 2Q8BH 2YRZA 1MCHA 2IPTH 3FTGA 2CIIA 5HY9B 4FQLH 3DX6B 5CHNB 5KSVA 4XMPL 1YNKH 4PJFB 3D69B 4JREC 2PUQT 3VI4F 1IKNC 4JRYE 1RURH 3VWKC 3DUSA 4C59B 3VXSA 5TFSH 5J12C 4WHDA 3EOBB 5BMFH 4M8QA 4MZ2A 5E8PB 5ADOH 3W0WE 2BZDA 2ZUXA 1A7NH 3KLAA 4JZOA 1A7QH 1OQXA 2AJUL 3P0GB 1ZLVH 2J88L 1GSMA 2J6EL 3LV3B 1U8QA 5EO9A 3SE9H 2R1YB 3U79A 4E9LA 1Q72L 4N0YL 4NN5C 3I2CH 4W70A 1BF8A 3F5WA 5EBLB 3RIFK 4JPKH 2XWBA 3HC3L 3RGVA 4MCYB 1OLZA 5EU5A 5BVJA 1IEHA 1FZKA 5FM5O 1T1WA 1R0AH 4PPTA 3OR6A 3HMXA 1MRCL 2HRPH 3CDCA 4H8WL 2DRUA 2CDEA 3C8KB 2ZG3A 2D7NA 3O11B 2LFGA 3OAZH 2AS5M 4NQEA 1QSFA 3MV7B 1U2HA 1U8OB 3DIFA 5FUOH 3PP3K 3RTQB 2WLZA 2UZIL 2VDKL 1AC0A 1CU4H 5CJQL 4JZJC 4MAUL 3RWDB 2E9IA 4L8DA 3D39D 1OAYL 1T1ZB 5IFAH 3JXAA 3TIEB 3L1OH 1NGQL 3AREB 3SE8L 4R4ND 4Q0XH 2CRMA 1VGKB 5DT1H 4XRCB 3V0AC 5IMOA 5EU7E 2AJYH 3LN4B 5I8OL 1QQDB 1FPTL 4PJ7A 5T5NG 3BQUB 3WN5C 4QRPE 2A9MH 1XZ0A 2VAAB 4NZUH 4EDXA 2D3VA 2ZG2A 1KC5H 3BH9B 4JFPA 4LLYB 3AS0A 4LPCA 1IKFL 3P3YA 4NBYB 1OARL 3HNVL 1RZGA 4EJ1C 2Y7QB 3RDTD 4R97B 1X5IA 2NY2C 3OJDA 5HDLA 2CLVA 3NABL 4QRSB 4XCEB 3AM8A 3RHWF 5D4QA 4N8VB 3MR9A 5FKPA 2YBRA 1ITCA 3ZT5A 4GRWE 4XMKL 5MP6L 1XGUA 2ORBH 1S5HB 5C0JB 3K0WA 5ESVA 1AY1H 1UWXH 3HZVA 4NJ9H 2YUXA 5CLTA 4BJLA 4KVCL 1G1YA 3BSZH 4XH2B 3SKOB 3SGDI 3ZKSD 3RWIB 4JGUA 1LP9E 4JFDE 3VRLF 4ZYKA 1A2YA 4X7EC 5JW4M 2ZCLH 2HFGL 2QADC 4HIXH 5MENE 2EECA 4APQD 3L3KA 2X89A 2IANB 3MLTB 2EDBA 2J4WH 4GKNB 4OCYL 4OI9A 2V2WA 3O8XC 4XWGL 5E5MA 2E7HA 4KI1A 5KW9L 5GS1A 3D9AH 4UILH 3MV8A 5ACMA 4ZTOL 5KJRH 3NCFB 4WUUD 3GJFB 3MBXH 4RDQF 5D96C 2AI0L 1Y6NR 3BPCA 3MGOA 4FZEH 2ED7A 1MH5B 3CD4A 3GK8H 1NBVH 4RFEA 4J6RL 4ODTL 3BT2H 1DBKL 4MNQE 3VFSB 4EOWL 3O6KL 1KN4L 4X6EB 1RK1B 1UCBH 2ZUQC 4XT1C 4ALAH 2IFFH 1MF2H 4P3DA 3T2PA 2ESVE 1YEJH 4KHTH 3VXQA 1N26A 5ANMB 1AGDB 5T1LB 4JFEB 1HIML 3HLAB 1D9KD 4MA8H 2NY6C 5EU6B 2G75A 2CK2A 1LO4L 3WFHA 2P45B 4JM2B 1RU9H 2BHUA 4YK4B 1MFEL 3I02A 4XP9H 3QRGH 5D7KD 5CBAB 1UB6A 3OKNA 4KPHH 4DN3L 5HDQL 5CBEB 4QRRE 5EIQA 4WTZA 3RNKA 5K59F 4M93B 4XXDB 4H1LB 4XGZB 5C0RH 3BEVB 3DLQR 3SDDA 1X5KA 4FG6C 4P2RA 3AUVA 3UTQB 5F97E 4FOMA 1DANT 2PYFA 4W4OA 3E3QC 1KEML 1K4CA 4XP5L 5CD3B 4GSDL 3IDNB 2EDYA 2HFEA 1SEBB 1D5BB 1ZLSL 5J6HB 1BBDL 4H26A 4DW2H 2XTJC 1AGEA 4HCRA 5CKGA 1C5DA 5JLZA 5BVPH 4X6DF 4Y0GA 3O3BA 1EUUA 4Z5RB 2A83B 3NFPA 3BGFC 1F90H 1BF2A 3QFDB 5L7XL 3CDGA 5E7BA 3KS0J 4A6YH 4PJEF 3GO1H 1FIGL 2HLFD 4NC0B 1G7LB 3QZWA 5C08B 3WIHH 2FJHB 4M61B 43CAB 1JZ3A 3WEXB 2OJZL 3BKCH 2CRIA 5E6IC 4PGDB 5C07D 3QWOB 4NO2A 3NFSH 4YHML 4PJBF 1T66C 3OKMB 1YMMB 1G7IA 1P6AB 1C16A 1YYLL 3K4AA 3V6OE 3CVHA 5CZKA 4Z7VF 2PO6B 4AM0A 2YK1H 4JY4A 5FHBL 3OHXB 2V7NA 2L7JA 3D2UA 1FH5L 1NCUA 5CKAA 3IKKA 3T0WA 1T03L 3S9DB 3RZCB 3KPSE 4GQPH 4Y16C 4L4TA 4QYOB 3KJ4C 3PDGA 3WL9A 1N3NB 1WFTA 1WBYA 3AB0B 1I8IB 2VNCA 1TTUA 2LVCA 4PGCA 5GGRB 4NWTL 4BZ2L 4I18C 2W9LA 1MAKA 3CSYB 5AWNH 3L3JA 5IFJA 2DQUL 5K9OA 2NY2D 3IB4A 2DLFH 2Y25A 2P5WE 2NLJB 2YMXL 4HGKC 5D7LE 2MCPH 1CS6A 3H3KA 4IJ3C 3UTSB 5I30L 5J56B 2G5BA 4PS4H 5E95B 2WIIB 3ZT6A 5JTWA 3C6LB 3WHE0 4FQIH 2DICA 2R1XB 2B5IC 4Z7OF 5DJDA 2Q86A 2AEQL 5BV7C 4ZPVA 4ERSL 3GHBH 2E7BA 5JIPA 3KYKL 2F58H 3N9GL 2JCCB 1GHFL 4LKCB 1TDQA 3DRTA 5C9JA 5JHLH 1H0DA 1R6VA 4MVBC 4UIKL 4YHOH 1T6WA 2AEWA 4K3GA 4OD1H 1CE6B 1ONQB 5CEXB 2AV7B 2AAVA 3MRPA 3QUZA 3TZVC 4GT7A 4WV1C 3HRZB 1LEGB 3GSNL 2R23B 4CL7A 1UT9A 1HH6B 5MERB 3T2NH 2H3NA 3CVIH 1IMHC 1GGCL 3QH3B 3NVQA 5ALBL 3FZUD 1IEBA 4J23A 4P2QD 1J10A 5IVZB 1E4JA 2D7MA 4J4PC 3DVGA 1B6DA 4X8JA 3QIWC 3QDMB 3MJ7B 3I75A 4HUUB 5DEGA 2FX8H 5JIHA 3ALXA 5FOJA 3EJZD 2NQCA 3AXLA 1EXUB 3KXFD 3O6LL 4ONFH 4UT9H 2VQ1B 4XBEL 2UUDK 1MCSA 1F3RB 4LFHG 5CP3H 3LB6D 1X3DA 1H8SA 4G8GD 4TYUA 1KPVA 4KMTL 1EEZA 4I3SH 1MCPH 5HHNA 1BQHB 3BZFB 3MLXL 3F7PC 1AIFA 5KSAA 3ARBB 3K1KC 4KDTC 1U92B 2NY6D 3VA2C 1GOGA 4YHPB 5BS0B 3IJHB 4U3CA 3WLWC 1G6RB 2DMCA 1EZVY 2ZUUA 1HKLH 3I50H 1ZA3B 2R29H 1AO7D 4QT5A 5IB5A 2AGJL 2BK8A 3BXNB 5SWSD 1E28B 1GIGH 2NW2B 2IH1A 5E6ZA 5FDYA 4FG6D 5MEQB 1U58B 4JKLA 2AJXH 3O41B 4PGEA 5EORH 2AXGA 1G9NC 4RMRA 3HA0A 1IGMH 1ROWA 4LNRA 3DPBA 3DMMB 3SGEH 1MLCB 3SJVB 5TE6H 3RAJL 4PD4J 4PB0H 3OKEA 4XCFL 3G5XB 3S34H 2XTJD 1DBAH 3GKWH 5GRUL 1EMTH 3ECBA 5F7NC 1IEAB 4L29A 4ZOBA 4CVZA 2NNAB 5AZEH 3GMMB 1K85A 3BEWB 1IT9L 3S4SG 3O6FD 1X5XA 5ESAA 2IALA 1KSRA 5L0QC 5KVDL 3KPRE 4O51A 3HMXL 5FB8A 3BKML 1T89A 4OZFG 4OF7A 3WS6C 2HRLA 5HHMB 4CADA 4WFEE 2EC8A 5C0CE 5E6ID 4PRHD 4ZAKA 4X6CF 1FGNH 3E6HA 4MJ5A 2HN7B 1J05A 4MJID 2VABA 2MHAB 2B4CC 1T66D 2K7QA 3DXAE 5HD8D 3PXHA 2VLMD 3N85L 5LJYH 1IQWH 4FQXC 5INCB 3M17A 1D6VL 1TJIH 1MHEA 1AFVL 4QXUH 4YUEL 4F7TA 2VZOA 3DX7B 1NLBH 3FO1A 2VC2L 4HGWA 3QNYB 5CJXC 3U0TA 5ISZB 3O4LE 4NRYB 2YD5A 4X6FB 5BQ7A 2GW5A 4I2XB 4Y16D 1ZLWH 1T5XB 2CDFB 4GAJL 3UROR 4DKFL 4G7YH 2FYYA 1PG7L 4YZFF 4FFYL 4IRZH 4LSSL 4QCIA 4L4VE 3K74B 4UV7H 1Z5LA 1XF5A 4K8RD 5IROA 5DEFA 1RZ8A 3Q3GB 1KT2B 1R5VB 1MQ8A 4M9OA 2XWTA 2O5XH 4AQ1B 2Z31C 2P7TA 2AJ3B 1MCDA 3ZL4H 1WTGT 3RUGB 1QSEE 1BFVH 1RK0A 4U1JA 1N0LA 1BP3B 1YJDC 2WQ8A 1JGUL 1EFXB 3TT1H 4S10A 1U8HB 1UWEL 4OIAA 4U3HA 4HC1H 2RCSL 2V5TA 3FFCB 3NGBC 3F7RA 1J8HA 4DZ8A 4N8PA 1NANH 4MVBD 5FYKE 1NCWL 4PRNA 1S5IH 1PQZB 1DANU 3GSRB 5DWUL 1NCAL 1OSZA 4X6DA 5DK3A 4S1QH 3ULVL 2W0LA 1JHTA 5IJVA 3B2UC 4U6YB 1INEL 3O45B 5CGMA 1QD0A 4G9DA 1QPPA 2IC2A 3V5KB 3LEVH 3RY6A 3EFDH 2MCG1 4PJEA 4YWGH 2RFXB 2VLRE 1CGSH 3HE7B 4I0PC 2WZPD 3C2AL 3O2DH 1C1EH 4EEEA 4K7PL 1A9BA 2E27H 5I2IB 1KACB 3TVMD 2IG2L 3STZB 3MYJA 3EOTL 3B5HA 1FHGA 1IILE 1DFBH 1CDJA 5E8EB 3ARPA 1UJ3A 3EW3B 3WSQH 3BRGC 4JO3H 3EJJX 4K94C 4PJBA 4JB9L 4TULL 3CC5A 1V7ML 1TCMA 1RJCA 4TPRL 2HTKD 5J6GB 1SBSL 4PJHF 5I1DB 5FUCE 1G9MC 4U05A 4ELMB 4NNYB 4L8SB 1HSBA 2EE3A 4JM2C 4YK4C 5C3LD 1CZ8H 4XAKD 3SKMB 3ARWA 3QJFB 2PTTB 4M48L 2YPLA 3QR2A 2ICEA 3TBYB 3U6RB 2NXYB 3LRSB 4PRAA 1T1YB 4F37K 3GSNB 3WKNA 1BVKB 4GRWF 3X14A 1LWRA 5EC2A 4R6UA 3WLWD 4JG0L 2VLKE 1WQVT 2A6IA 2F74B 4MD5B 5JHDE 2VE6A 5C0BA 5CIPB 1LO3H 3R06A 4M43L 5F7FA 3FT2B 2KDGA 2HVJA 4K8RH 4JANA 5D2LB 3WJJA 3UEZA 2R2EB 4FQQB 2A38A 1TITA 4P9HC 4Z0BH 1PYWA 3OB0H 1KELL 3PL6C 1M7DA 1UYWH 1KIRB 1Q9KA 4UB0H 2UZXB 1Q9LA 1ZWIA 2PYED 2ZUVA 3JWDC 5D8JH 4Z7NF 3DURB 1I7UB 3MGTA 4DQOL 4ZO7A 3H9SA 4OCWH 4U1GB 4F2MA 5ICYA 5F7YC 1M6OB 3ESVF 4JO1H 5F7EL 1ZV5A 1KBGH 3MV7D 1QNZH 2QKIA 2VZVA 2GK0A 3RTQD 3BZEA 3CSGA 4CMMB 4X0KA 3LN5A 1RQ5A 4GW1B 2H9GB 4ODWB 4WW2A 2DQFA 3W11C 5HHOD 3W2DH 3PJSB 1NL0L 4GFTB 3FTGB 3LEYH 2CIIB 3ARED 4ZUTA 1YEKH 4QLRA 2YXMA 4NRXA 4BK4A 1C5BL 1N59A 3WFCH 3BP6A 5CINH 2DTML 1P5VA 5DUPL 2LQRA 4D9RE 3VWJB 4Q9RL 3G08A 4G6JH 4FQ1H 3BQUD 3DUSB 2X4TA 2FRGP 4L9LA 2YA2A 2BVPA 4PRIA 4PJ8B 3L9RA 3HAEG 1CFTA 5T5NF 2X9YA 4JHAH 1VPOL 5IHZA 5E2WL 4H8WC 4P4KC 3DX9A 3KLAB 4G5ZL 3KPQA 2HKHL 3FQXA 3ILQC 4D8PA 4HWZB 1U8PA 5HGHB 2P8PA 5I18L 4JZNA 4AL8H 3CVHL 2BNQE 5GRVK 2VDRL 4BKLA 3VH8A 3BE1L 1VFOA 3WLBA 5IG7A 1W2KT 5BCAA 1WVZA 4Y5XA 4UQ3B 2NW3A 4F80A 4JLRA 3MXVL 4KDWA 5GS3A 3RGVB 1N0XH 1QYGL 1PSKH 3H9ZA 5EU5B 1GOFA 4YHIA 3GGWB 1T1WB 1O7SA 1QHPA 3OR6B 4LCYA 1JTPA 4N9OB 2CDEB 4KROB 2BHZA 2XPGB 4P4RB 2L0DA 4NQEB 1AXSA 1P4IL 2JK5B 4ONHB 3DIFB 3QEQB 2Z31D 2ADJA 1QSZA 2PTUA 2RB8A 4HLZH 4LCWB 4YGVB 3CXHJ 4IM8A 3GJEA 5BRZE 4JR9L 4XVJH 1NAKL 1OAZL 2EKSA 2VLLA 2EH8L 3IKCA 4Y5YA 2IAND 3VFGL 3L5IA 2X70A 4U4BA 2XACC 3VG9B 3MRFB 1HI6A 3ISWA 5IMOB 3L5WA 4NNXB 1PG7W 1DR9A 2OR9H 5CSZB 3ZKNC 3X17A 4WWKC 1QPXA 5HYQA 4ISVA 4HPYH 4EDXB 5D1ZA 4H5SB 4NQXA 4G6FD 3V8CA 1RZIB 4JFPB 3Q2CA 2G60H 4I0PD 1F00I 1G7PA 4M1DH 5EO1A 2MQ3A 5E08L 4DOHB 4ZS7H 2EDNA 3D5OF 3WNKA 3V6FA 1SYSA 4Y4FC 1NMBL 4NC2B 3UYPA 3EOAB 1XAUA 1QR1A 3OJDB 4X6CA 4POUB 2R9HD 1G0YR 2L4OA 4M6OH 1ND0A 1K2DA 2F19L 3MR9B 5FKPB 4TSAL 2BXYA 2YBRB 4L1DA 5T1LD 4H0GA 5GJSH 5EU6D 5JW4N 1NFDE 3BFOA 4JM2D 1NGYA 5IEKB 4AK1A 5HVFB 5ESVB 4JRYA 4WFFD 4NGHL 1I9JH 3HZVB 3Q5TA 1WIPA 4HUVA 2OL3A 1DQQB 1CXKA 1FFQA 5LQBH 3FQUB 2X7LA 1OAUL 5DTFA 2B39A 2VYRE 3W0WA 1T6VN 3TLRA 1B9ZA 3WUZA 3T3ME 4ZYKB 1A2YB 4Y19E 4QTHA 3GUTA 4HPOL 3L3KB 1I3UA 1RJYB 2DQHH 5CZXD 4RMVA 5IVXE 4WU7B 4Z8FL 2GTZA 4ZDHA 3PWUA 5E5MB 3V5DB 5GS1B 4KFZC 3MV8B 4QNPE 4NN7B 1YEIH 1MJJA 4GO6B 5TE4H 1IM3B 4LCCA 4PY7A 2FECL 5C6PB 5E4EC 3JWOL 1YJDH 1I4FA 1QBMH 2EXWC 1J5OL 1PKOA 2VDOH 4HIEB 4NZRL 2XZQL 4RFEB 5H35A 1AI1H 1INDL 4ODVH 1DQDH 4PB9H 1RHFA 4HWBH 4IRJC 4M00A 4UBDC 5D7SH 4JVUA 1SJEA 4ZODA 2YD3A 2HKFH 5F9WC 4LSVH 1TETH 3LQAL 5C08D 3B9KA 5HVWA 4P3DB 2DI8A 5DF0A 1WAAF 4LMQI 4RWYL 5DUBB 3ZTNL 4N8CL 1JRHI 3QI9A 4HFUL 3WNMA 1JVKA 2FLBT 4X6BA 3GSVA 1PG7X 2CLZA 1U8LA 3PABA 4WCYH 4DUXA 3P0YH 2G75B 1YMMD 1Y6MR 3WFHB 3EYOA 3HB3D 4F7PA 3RGHA 5FDWA 4QRPA 1UB6B 3OKNB 2PO6D 2P5ED 5B8CC 2P43B 1CDYA 1B4JH 3ZKXB 4LOUC 4U2ZA 4NC1C 4YE4H 5DURD 1OCWL 4Y1AE 3OKOB 3SDDB 1CN4A 3EFFA 4L3CA 2PKDA 4LF3B 5TF1H 2PYFB 3NTCH 1G9MH 2ARWA 1U95B 4HJJL 4PJHA 5E8NA 1E6JH 3ILQD 5GRVL 1QKZH 2OP4H 1XGYH 3X3FL 5D7JB 2NZ9C 1HZHH 3ARSA 1DLFH 4KV5E 1F2QA 4M4RA 5F1NB 5F9DC 1C5DB 5JLZB 4PJXE 4Z9KB 4AH2A 4H25A 4ZOCA 4MXVF 1BPVA 3C6LD 4K9EL 2DIJA 2O93L 1JFQL 4MCZA 5CMAA 1CLOH 3CDGB 4ZXBC 4AEIH 5CCKL 3GNML 1EO8H 1AE6L 1ZT7A 4PRDB 5EBMB 3N1MC 1GZPB 4O5LL 3B9AA 5DSCB 3QQNA 1IL1A 3LEXB 2FH6A 4ENEC 4K7PX 3QZWB 4JFDA 3QUXA 3S36L 3JWDH 1P4BL 5MENA 4AIZA 2XNAB 1E0OB 1QFHA 3BP5A 3BP4A 2XFXA 5DD1L 5E2VH 2QBWA 2FHBA 1XF1A 4LPXA 4U1LA 3MNWA 3DVNB 5IB4B 4WENB 1D5ZB 2YD6A 4JFHE 3TBVA 4B41A 5I76B 2B7DT 4LQ1A 3HE7C 2XYCA 3ZKND 3KS0H 1RJZA 2YEZB 2V7NB 4WWKD 5I16B 1AHWC 4DKEL 4JFXA 3ELAT 3QDMD 1I3RA 3BN9C 3PWNA 4MNQA 3JV4A 5K33A 1UZ8A 3U36A 5F3BA 3WL9B 2AJUH 2J88H 5DMYA 2J6EH 1A14L 4MJ6B 5T1KB 1QRKA 1W72A 4NCDA 3L3JB 5IFJB 1Q72H 5K9OB 2XRAL 4N0YH 2CIKA 1AJ7H 2ESVA 3LVEA 4NQDE 3E6FA 4S11A 3DUUA 4KMQA 4PRPE 4ZSOB 3EBAA 4LVHC 5H2BA 5EU3B 3ARBD 2G5BB 2RAMA 4LHJB 4YR6A 4TUJB 1MRCH 1QACA 2Z8RA 1BHGA 5BS0D 5I17A 5E4IA 3OG4B 2Q86B 5ENWB 2J8HA 1WWAX 4PIRF 3ARTA 4QRRA 1F3DH 2FH8A 1FNGA 3ARXA 5GQBA 4WDIB 3GBLA 5FA3A 2W65B 3MLZL 5C9JB 2UZIH 2VDKH 3ZSTA 5J9PA 3NFNA 5CJQH 4MAUH 1EEYB 5HSFA 1MHPL 1NUFA 3QUZB 4UDUB 2R69H 32C2B 2PTVA 1NGQH 3RVVC 4FQHA 4X7TA 5JMOC 5K9KB 5F9AC 3DMMD 3SE8H 3SJVD 1UM5L 3C60A 2X4PA 1XGPA 1NCDL 4QHUB 1YY8A 5I8OH 3NCEB 1FPTH 5IBUB 5A2FA 2D03L 3REWA 5DS8B 3DVGB 2PXYC 1URLA 4XAWL 1FYHB 2EXWD 4XNXL 5DJ0A 5AYUL 4O2FB 2YPKA 4HBQA 3D0LA 2OBGA 2IAMA 4JAMB 4RMQA 4IRJD 4U1KA 2BERA 3I9GL 2EZ0D 4DGIL 1OARH 4OFYA 5KTEL 3HNVH 3O2VL 4KKLD 3D0VA 3F58L 4PY8J 5A2LH 5DJAA 5EH1A 3K8LA 5J57B 3VFUA 5IIEA 2R39A 1KPVB 1RUAL 3NABH 2BSED 1EEZB 2W9EL 4HXBH 3S98A 3ZTJG 2MOVA 1AIFB 1UB5B 3MRQA 1X44A 1LE5A 4HK0A 1OOAA 4XMKH 5GSVB 3RWHA 5MP6H 5B3NA 3QDJA 2MKWA 3CFDA 4GG8A 3EZ8A 3JVGA 1A0QL 4N0UB 3FO2A 1FIEA 4QT5B 3QUMA 4WIQA 3OZ9L 5ISZD 3KPSA 5JW4R 2FR4A 3DOSA 35C8L 3QJHA 2HP4A 3QSKB 3OL2A 2HFGH 2NX5E 2VXSL 4PGEB 5BZWB 4YFDB 1UC6A 4LNRB 4OCYH 2MSPA 3MV9E 3RGVC 1DEEA 1G6RH 2QQKL 4XWGH 3KG5A 2P5WA 1T7WA 2NZ9D 3KPNA 5DK0B 3OKEB 4TRPL 3MRDB 5D7LA 4ZTOH 3V9FA 1LILA 4FQCL 5DMIL 1U3ZA 2VO5A 2A0LD 4NQCB 2AI0H 3ECBB 1BECA 5GISL 4ZO8A 1JUFB 4J6RH 4ODTH 4C56E 4XHQA 4KVNH 1P7QB 1DBKH 2I27N 4HUXB 4M02A 4EOWH 2ERJC 4WY7L 4MA1C 1CL7L 1EFXD 3O6KH 4KJQD 1KN4H 1PX4A 4O4YL 5FB8B 3VGHA 3FFCD 1CDBA 1RHHA 4AY0A 1KXVC 3C8HA 5C9KA 3VG9C 4I5BA 4CADB 2ITDA 4NO0A 3FQNB 1OAXH 4Q2ZA 4XVSL 4DGVL 4KGLA 5D1XC 3S6CA 3C09B 1EGJA 3E6HB 3T3PE 1CFNA 1J05B 4TVPE 2P48B 2VABB 2WBJA 4JN1L 2ITCA 3G04A 3VCLA 4LP4A 1K4DA 1LO4H 4K3DL 1YN7A 1MNUL 4Y7MA 4QRQA 1A9EA 1KPRB 1MFEH 3VD4A 1EH9A 2YZ1A 4EI5C 2AKRB 4F57L 4OCSH 3HE7D 5HDQH 4F7TB 4KRPC 4HGWB 2P8MA 3U0TB 1JNNL 1A6TA 1SEQL 3MLSL 5C3TA 2XY1A 5KAQG 1L7IL 1KJMA 3SPVA 4CUCA 5T3ZL 1QUNA 5D6DA 1YMHA 2J8OA 2FYYB 5IK3A 1KEMH 3CFKA 2FB4L 4XP5H 4GSDH 5E1HB 2GT9A 4OLZL 5J13B 3DO7A 3VFVA 1R3IL 1Z5LB 1RZFL 1ZLSH 1BBDH 4JFFB 5DEFB 3QG7L 4LAQL 4LVOB 2O5YL 1RZ8B 1W0VA 1AGCB 2QSQA 3CFCL 4GUPA 3ULVC 5GXBB 4KH2A 2GSGB 1A64A 5DI8A 2NXYD 5L7XH 3Q1SL 3WS3A 5JMRA 2X05A 1JPFA 2WQRA 1RK0B 2IQ9L 5IEHB 2A2QT 3DVFA 1Q0XH 1TVHA 2HT3C 2AK1H 5GGUB 1GAFL 1WWBX 1FIGH 4DZ8B 1KJ2L 4LLAA 2JLLA 4PRNB 4PR5A 2OJZH 4X6DB 3P11H 2OL3L 1T3FB 4JFYA 3MOBL 1ZANL 3PIQA 5D72L 5IJVB 4RRPG 3RVVD 1NH6A 4OKVA 4YHMH 5CEYA 1C5CL 4PJGF 3CLFL 1UM6H 5HGDA 5I66B 3MGAA 4D0DA 1YYLH 4OZGF 2VISB 5GSRA 4PJEB 5EN2B 1IGIL 2NYYC 2ZJSL 5FHBH 1A9BB 3TJEL 1CLZL 1FH5H 1LE9A 5HVGB 3TO4A 3V4PL 3MYJB 5EU4B 4DGYL 1T03H 5INDA 4JKMA 5IBTL 5DD0L 1F42A 1A6VL 1P7KA 5IB1A 1FCCA 3KPRA 3OQ3B 5DJ6B 4PJBB 1I7RA 3CC5B 4NWTH 2EICA 3P9MA 2A74B 3RJDA 1XEDA 1NGWA 1OT1A 2DQUH 2FWOB 2NY5L 3MNZB 2LU7A 4J12A 5K9QG 4Z7VB 1HSBB 4QXGL 5C0CA 5JW5A 1FJ1A 1I1FA 3ZDXF 3NIDE 3QO0B 2HT4D 5I30H 3DXAA 2YPLB 3RX5A 4G7VL 4PRAB 3FB6B 4KMLB 2I07A 5EPMA 1MCNA 3VXOA 4OFVA 4LQFL 3EO1A 3DUHA 4IDJL 4MHHG 2A6IB 2AEQH 1IAII 4ERSH 3BUTA 5LGJA 2XQBL 2V5YA 3A6CL 5I0ZA 1YPZF 2HVJB 3O4LA 3KYKH 3N9GH 4JANB 1TVBA 1GHFH 1H5BA 4PBVC 4UIKH 5FGCB 5ACZB 3T0EB 5GGQH 2NCMA 3LD8B 1PYWB 2ADIA 4OCLC 2B2XH 1M7DB 3HZMB 3S36X 1BEYL 1A7RL 1BOGA 1N8ZA 1Q9KB 3E0GA 3LSOA 1Q9LB 1ZWIB 3RWJA 3GSNH 4L4VA 4RSVA 5F7LB 3RGVD 4RGMC 1A3QA 3QDAA 5IVXF 3B3IB 2GAZB 2R2HA 3I3BA 4YPGB 1GGCH 3H9SB 4NM8L 5CIPH 3IXTA 3OX8A 4ZFFB 1LO2L 5ALBH 3X3GH 4KROD 3G5ZB 4QNPF 2AXJA 4NQED 4O58L 1QSFD 3FOLA 1JL8A 2CUHA 2QKIB 4NO3A 3QEQD 4X4XA 2GK0B 3KPPB 1GZQA 3JV5A 1QSEA 3CFJA 3FJTA 1CTOA 3ZDYF 4R4FL 3STLA 4QF1B 5DHYB 3O6LH 3ZT7A 3D1MC 2WBKA 3UTTE 3B4NA 3QPXL 2YSSB 4G8FA 4XX1E 1B90A 2IPUG 3R8QA 4K71B 4LP5A 4YFEA 1N59B 5A2JH 2DLTA 1PKQE 3BP6B 4OGXH 4KMTH 2F8XC 1KIUA 2PR4L 1YEFL 4QWWC 2CKBA 5E94A 3KYOA 1QFUH 1B0WA 5E2TL 2X4TB 3VXRE 2BVPB 4LRNL 3BKJL 4U1HB 4HWNA 4FRWA 4YX2L 4ZFOB 3L9RB 1BQLL 1EAPB 2VLRA 3HE6A 2DQTL 3V52L 3MV11 4YFLI 3CCHB 5BOPA 4YHYB 5DRXA 5HYEA 3KPQB 2AGJH 3T09A 2X4UA 3FQXB 3S4SA 4D8PB 1TZHA 1U8PB 5C0EA 2P8PB 3RL1A 3W39A 4S2SB 2XKNB 4Z78A 3BI9X 3IYLW 4HMDA 5F72S 4Y5XB 3UXFA 4OIBA 4G9FB 1H3PL 5FA4A 4XHJD 5DJ2B 1NUGA 2O61A 3RAJH 4YAQA 3KNBB 4LCYB 1NUDA 2OK0L 4X5WA 4LKXA 2CUIA 4I9WE 5GRUH 1AXSB 1UEMA 4PJXF 1FAIL 3ULVD 4JCLA 4N0FB 1PDKA 4DEPC 1CXFA 2JB6A 2VLKA 5B38G 5JHDA 3GJEB 2HT3D 3QFJE 2X89D 5D1QA 2B1HL 3HMXH 4LK4A 3BKMH 2NY4B 4F7CB 4JHBA 5C0NC 5FM8A 1HI6B 3D85A 2Q20A 3L5WB 3MV8D 4M6AA 5F1IB 4YXLL 4GBXB 2Z4QA 3KYMA 5C1MB 3WDHA 5HHPA 4ISVB 3N85H 4NRZB 3L95A 5C2BL 3U2SB 1RUPL 2PW2A 5DMKA 1D6VH 5KZCD 3AY4C 4R3SB 4YUEH 5EO1B 4WHTA 1PVHA 3AC0A 1G7JB 2FX7L 3MJ9A 4OLXL 2VZUA 4RBPK 1B6UA 1DE4A 3MROB 4KAQL 2IQAA 5MEOB 4LAJH 4X6CB 4DKFH 4GAJH 5DXWA 5CP7B 3MRHA 1M71A 5DFTA 2ICES 2BVQB 2GFBA 3CFIC 4FFYH 1ND0B 1K2DB 4LGSB 4NN6B 5KOMC 2X40A 1C12B 4LSSH 5DD6B 3VGEA 1DZBA 5KSAC 2X44D 2B8OT 4OIIL 2FO4B 1KJ2B 1NGYB 1IQDA 4W68A 5EBGA 2P4AB 1UA6L 3LKQA 4HUVB 5HYIA 1FRGH 3L3OB 4OZIE 2X7LB 3SDDD 3WYRA 5BO1L 3D3VB 4OCXL 3JWOC 4U1NB 5GRZA 3GI8L 3ROOA 1JGUH 3GUTB 1TZIB 5CD5C 1OWWA 5LKNA 1UWEH 3LKSA 4ZDHB 2BNQA 4HUWB 3PWUB 3TIDB 4PV8B 1NCWH 4J3TA 4PUBH 3CH1A 5DWUH 5DVMA 5DA4A 4GLRI 3ULVH 2FATH 3QUML 3GB7A 4M5YL 3IAQA 3LQAC 1MJJB 4OF5A 1INEH 3WCYA 2HJLA 4LCCB 1QLEL 2K1MA 2VZSA 3W9DA 4GRLA 1I4FB 2D7QA 3GIVA 4M5ZL 3MA7B 1RY7B 3U82B 5H35B 1MCOL 1KG0B 1N5AA 1XH3A 4K7PH 4S1SL 5L2KE 1WFNA 3IDJA 1SJEB 4OD3L 1BVZA 1FZMA 3EOTH 3TBWA 4OTXL 4CMHB 5JQ6H 2Q8AL 1WC7A 3IDGA 5BRZA 1HEZA 4JB9H 3DRQA 4TULH 3DV6A 3NCBB 4ZAKC 2V9TA 3SY0B 2F53E 3C09C 2AQ3A 3QI9B 4OV5A 4GS7C 4TPRH 4BSVA 1SBSH 5C6TL 4OZGA 4NZTL 3GSVB 4P5TA 4X6BB 4POZC 3W9EA 1A3LL 4WI9A 3C5ZA 3CSBA 3EYOB 1J0JA 2NZIA 4F7PB 5FDWB 2RQ8A 4QRPB 4KQ3L 1RULL 5IHBA 4M48H 5ALCL 1H3VA 2QSTA 3BX7C 1HQRA 1SMOA 4P2YA 5DQDL 3U1SL 2HFFB 3QXDA 3D2UD 1PX3A 5J1TC 4FZ8L 1WBXA 4RFNB 3ZHKA 3BUYB 4R0LC 1EGJL 4L3CB 3SQBA 4K9EC 4PJIE 3P4MB 4L4TD 4M43H 4G43A 5JZ7C 4PJHB 5E8NB 5FYJL 3W82A 2WMPA 5T1KD 1JZ8A 1CLCA 2A73B 3UJIL 1IAKB 5I1JL 3MACL 1BIIA 1KELH 1AKJA 5IROC 1DN0B 3ULSB 5EUOE 3HR6A 4X7FC 3UTPD 5JXAL 4DQOH 3ALPA 4AH2B 4ZD3H 1AGBA 3NPZB 4GRWB 4DKAA 1QO3A 2EYRA 1PJ9A 1NFDA 4DUWA 1FL3B 2NTFA 1TIUA 4OSUL 4MCZB 3NIFE 4MDJA 1UWGL 5F96H 5F7EH 3CSPA 2Q87A 4NP4H 3HAEA 4M7ZB 3CU1A 1T21A 5DGQA 4Y5VA 3FMGL 1S9WB 4FTVB 1FFPA 1IL1B 2WWKT 5C0FA 1CFVH 3UBXG 4MA3A 4DN4L 4Y19A 2NY7L 9CGTA 4JG1L 3DX8A 4LBEB 1FL6A 4HG4J 3BP5B 3QUZD 1NL0H 2XFXB 3GMQA 1DL7L 4UV4L 3VFTB 4C58B 3BDXA 5IVXA 4OGAC 3UDWC 1TFHA 3MREB 2GJZB 4U1LB 4B50A 3IFOA 1C5BH 1ACZA 3MNWB 3RI5F 2BNUA 5DUPH 5KVGH 3TBVB 1EFQA 3EDFA 5SX4H 1ZOXA 4PJ5B 4Q9RH 1RJZB 1OF2B 1BZQK 1YY9C 3T3PF 1CVRA 2EIBA 1JYVA 1EO7A 3NN8A 4E0RA 1WJ3A 3H7LA 4X7DC 1VPOH 4RGNB 2AVGA 2V9RA 1UJ3C 5K9QI 2BRQA 3N1QC 5E00A 4G5ZH 2HKHH 4X9HA 4CJ0A 1IGJA 1WISA 5I18H 3BH8A 2VDRH 4LCUB 4NFBA 2BC4A 2CIKB 2GTWA 4OF0A 5D7IF 3DUUB 1MHHA 1QYGH 5H2BB 5A2IH 3ARFA 5KSAD 2UWEE 3K4ZA 4PLJC 1AQDB 3INUL 1OQOA 3F7QA 3IAGC 3PDDA 2CO7B 5I1LA 3G9VA 2UV3A 2XI9A 4NNPL 1MCBA 2UVEA 1T2QL 1P4IH 4EN3A 4YHZL 1ZHKA 5SWZE 4OZHE 1ZVHA 4Y1AA 5IB2A 3QIBC 3WJJC 2YWYA 3VDCA 1N2RA 3PGFL 4OI8A 1RZJC 2X4SB 3NFNB 1REIA 3RHWK 3ABZA 4HBCL 4JR9H 1NAKH 1OAZH 2EDXA 1FFNB 1OB1B 4CDHA 5CD5D 2EH8H 2F54E 5FCUL 4X7TB 3VFGH 1CD1A 4XP1L 1UZ6F 1KENL 4NQUA 4D9QD 3Q6FB 3N0PB 4JDVA 5SX5H 3TBSA 2GITB 1YY8B 2DQGL 1Q1JL 4L3EE 4WFGD 3U7YL 4PJXA 4JPIA 1LEIA 5IQ9A 3REWB 3HZYA 1DEDA 1SJHA 4PTTB 1UADC 3Q48A 5DJ0B 3IS0X 4EUPA 25C8L 5HGGS 2YPKB 2A6JB 4YLQT 4UDTA 4WW2C 3SDYH 2EDLA 5HDOA 5E08H 3D39E 1VEMA 4LSUL 2FEDD 1FSKB 3G6DL 2X9WA 5HYJB 1NPUA 1VADB 2Q76A 3R0MA 4MA7L 3Q5YA 4J8RA 1NMBH 5DJAB 3QDGE 3OGOE 5T1DL 2IPKA 3SKNA 3VFUB 1JF6A 1U8IA 4ZAKD 1HQ4A 2F19H 2EDKA 4YEEA 4TSAH 3MRQB 4L9LC 3ULUE 3PXJA 4POZD 3BD3A 3RWHB 3QDJB 4GG8B 4P48A 3FFDA 4NGHH 5FYKL 4PP2A 3NIDF 5FYJU 3VD7A 4RIRA 3U7WL 3KPSB 1XF2B 1P4LA 1OAUH 2FR4B 2CKBL 5BOZG 3QJHB 4HPOH 3C5SB 4Y5XC 5JZ7D 4R8WL 5KAQF 4Z8FH 5IMKA 2E7MA 2N4IA 4DK6A 2P5WB 4NQDA 3AS2A 1NQBA 4JFFD 2XT1B 2YD9A 4OLVL 4PRPA 4KZEL 4M3JA 2X2YA 5DJ8A 3RWFA 3GIZL 1OPGL 2MQCA 3MLYL 2R0WH 4BQ6A 1DDHA 1MWAA 4OT1L 1J5OH 5DDHB 1RUML 4NZRH 1FNLA 2XZQH 3CPLB 1I1YB 1INDH 4Z95L 1BWWA 4XPAL 4WTXA 3F6IA 1MLBA 3MRJA 2DJ4A 4MS8C 1ADQA 2VB5A 4LL9A 4Y5YC 4LLDA 2QR0A 3L7EA 1J11A 1J8HD 5K93A 2IF7A 3V4VL 3VDAA 4I5BB 4MWFA 5CWSB 3T77A 1U36A 1V3LA 1N6VA 2APVA 4RWYH 2ITDB 4HMCA 1JZ6A 2L7UA 3ZTNH 4UU9B 3N50A 4KJYB 4N8CH 4HFUH 3LZFL 2ITCB 3VCLB 1K4DB 5C6WH 3MMEB 1TPXC 5D1ZC 4BH8A 2NR6C 4UTAL 3EKCA 3L5HA 5GRWA 1T20A 1UXWB 2UY6A 2BSSB 4CN6A 1HHKA 2J1KA 5I8CA 1YEHL 1YY9D 3IRZA 1A6TB 1OCWH 1CI5A 4G8EB 1KJMB 3GHEL 1RFDL 5AYQA 2VQTA 1K8IA 3KHQA 1YMHB 4HJJH 5EUKB 3CFKB 4OF6A 1O0VA 4QOKB 1JGVL 5HYSG 4U6VL 3RVXC 3X13A 3DO7B 2VQUA 5I73C 3HPLB 5ERWA 1KPUA 5E1AA 3T04D 1H3GA 1W0VB 1OL0A 3MJ9L 3WNLA 5D7KE 4D0BA 5E24E 4ODXB 2QJDA 1DQJB 4GUPB 4YO0B 2YRPA 2YPLD 1X7QA 2YD8A 5DI8B 3BAEL 1JHKL 2W92A 3PWVA 4K9EH 5EOQL 4CBPA 4R7DB 4TSCL 2IMNA 1OAQL 3GNMH 4BA8A 1AE6H 5SWQA 5C0BD 3U83A 4O5LH 4Y4KA 2GJ6B 3DO3A 4WO4B 2BY1A 3GMRB 3IXAA 1KB5A 3S36H 2DWDA 1B2WL 4PR5B 1P4BH 5DR5L 1JBJA 2NX5A 2AW2A 4NKDB 3U46A 5GIRA 1D5IL 1XGTA 1EZVX 4JFYB 5JQHC 4YDLB 3BWAA 3PIQB 5ILTL 3MV9A 1Q38A 2D7OA 5IMMB 1T1XA 5EO0B 2YC1B 3SKJH 4ZQKA 4LCCC 5GS0C 2GJJA 2V17L 1K8DA 2QQNL 4TUOB 1RJLA 5GGTA 3H9SD 4D0DB 3HG1B 1BZ9A 2B1AL 3B5GA 2PF6A 5EOTA 5FYLD 3QQ4A 1OAKH 4CNIA 3A67L 4I18A 4P2OB 4PJDE 3RVUD 4DKEH 4PJ9A 1Z2KA 3VXTA 5CEZD 1LE9B 3IDXL 3TO4B 4C56A 3B9KC 5F89A 4EDWL 4ZUVB 1P7KB 5JORA 4MXWL 1KCLA 1QVOB 3KPRB 1I7RB 1A14H 1MFAL 1ZVSB 3QA3A 4HZLB 1Q8MA 4K23L 4JGJA 1NGWB 2R2BA 2XRAH 2YZ8A 4V1DE 5EU7C 3VDBA 3LDBB 1H9VA 1QFWL 1FJ1B 1I1FB 1NGPL 1S9VB 4LSTL 3A6OA 5TJWK 1VACA 4Z0XB 1VEOA 5A16A 2BHYA 5FV1L 4PRID 2I07B 5I1EH 3TZVA 2DLGA 3VXOB 3E2HB 4NQTA 1OT2A 2ZSWA 1L6XA 4U0QB 3BYYA 1TVBB 3MLZH 3LKPB 4RMSA 1L6ZA 4OZIF 2ADIB 1MHPH 3DGGB 3OXRB 2Q7YA 1OTTC 4AEFA 3RWJB 1YNTA 3LS4L 5KOVC 4OCNC 1UM5H 4LRIA 1MCQA 2R2HB 3OX8B 1NCDH 2VIRA 4XPFL 5LAXA 1IM9A 4LVEA 1XCQB 3IJSB 1DTUA 4O00A 4X4XB 4XAWH 2D7PA 2F8VA 1N6UA 2ARJQ 1GZQB 2DQJL 3NAAH 4X9FA 4XNXH 4CVXA 2PETA 5AYUH 1CICA 3CDYA 1D6EA 3QUXC 4QHMA 3KPLA 3QYCA 2W0PA 1N6QL 3I9GH 4Z7WE 4DGIH 4AENB 4MS8D 1SM3L 3O2VH 4F33A 4RAUA 1WUNT 1QLRA 3F58H 2NY4D 5FYLH 4P5MA 2DLHA 1PD6A 3VXUA 4HIJA 4QGTA 5J11C 1RUAH 1YUHB 5CEZH 2WV3A 3V4UH 4ONOA 4GBXD 5T3ZD 3RPKA 3RZWA 3MC0A 1JCKA 1CFSA 1ZMYA 5FO8A 3U4EA 12E8L 4P0DA 1CT8A 2VLRB 2NR6D 5GS2D 2J8UE 1IGYA 3PWJB 1A0QH 1JNLL 4AG4L 2APWA 1MJ7L 4CKVX 3REVB 2BVYA 2X4UB 1R5IA 1TZHB 1R3LA 3OZ9H 5EULV 2YWZA 1U8MB 1DUZA 3MA9L 3MRIB 35C8H 2X4OA 3GMPB 3WNNA 2Y07L 4OZFB 4IMKC 4PJIF 5EC1A 5KG9A 1SHMA 1FN4A 1XGQB 2FIRT 2BY2A 5TGBA 4KK5D 2QQKH 4G8IB 7FABL 5FA4B 1HNGA 2XN9A 4XP4L 4YAQB 2H45A 4TRPH 4FQCH 5DRNA 1TNNA 4JFOB 3K1DA 3VI3F 3OR7B 3VFRB 1TXKA 3P73B 3GSOA 1A7OH 5GISH 1B0GB 3CUPA 3ES6B 5GGSY 4LVNC 1QFWM 3SO5A 5JHDB 3W0WD 3TT3L 5IW6A 4I1NB 3D3VD 4GG6E 1MHCB 4WY7H 1CL7H 4ACPA 4KK9D 3M8OL 4O4YH 2A1WL 1S7TA 4FQXA 1I7TA 3RL2A 4U1MB 1HHJA 1QSVA 3C60C 1NJ9A 3L3IB 3D85B 4XVSH 5FO7A 4DGVH 4LPYA 2OTPA 1WITA 4JN1H 2Y5TA 1NBQA 4K3DH 2AERT 3L95B 4BZ1L 1L0QA 3MYZA 3D48R 4F57H 2IAMC 4OB5L 4RX4A 4BQCA 4S1DC 2ADGA 4Q6IA 3FOMA 2CKNA 1JNNH 1SEQH 3MLSH 3ZO0A 1DE4B 2AP2A 4YGAB 3B9KD 5T3ZH 3P9WB 4P5KB 1ULVA 3M1BB 3MJ8A 5MEPA 1N4XL 3PWPE 2OSLA 2BJML 1GC1L 2GFBB 4OLZH 3QI9D 2ZPKL 1OGTB 5GS2H 4XVUC 1R3IH 1PKQA 1RZFH 4RRPA 5CJBA 1AGFA 4JFQA 2FJGA 3V6OC 3QG7H 4LAQH 2O5YH 1DUYA 5EFIA 3JVGC 4J7RA 1KCKA 4QRPD 1YYML 2JJUA 3CFCH 3RBSA 3VXRA 5F9OL 4JN2A 4LEXH 5DJYA 3ZYIA 2UWEF 3P0VH 3QNZA 5E2UL 5JNYA 1CE1L 2IQ9H 5EB9A 2Q6WB 4FQJL 4GAFB 2CMRH 3L3DA 1GAFH 2YPVL 1KJ2H 4OZHF 1UKQA 2XA8H 4ELKA 3RU8L 3CH1B 3QWRA 3I6GA 2OL3H 3MOBH 1ZANH 3BMWA 1OTTD 4CVUA 5D72H 3RIFF 2HJLB 2V5MA 5KSBF 3RDTB 1C5CH 4Q58C 1MAML 3CLFH 1JWMA 3MRBA 5CJOH 4Y2DC 1IGIH 1TNMA 4IMLB 2ZJSH 1WCBB 1N5AB 2H8PA 2VWEE 4WJ5B 2IMMA 3IDJB 5I1HL 2BDNL 4X7SL 3MRCA 1T4KB 2HA1A 4FTVD 3V4PH 4DGYH 4GKZA 3QCTL 5IBTH 4DWHA 5DD0H 1WC7B 3BO8A 4JFDD 1A6VH 1X5YA 1I1AC 3IDGB 3QUXD 4AZ8A 1R3HA 5BRZB 2R8SL 1HEZB 2E6JA 4E42A 2O5ZL 5MEND 1EBPA 3QULB 1JPGA 3QFJA 4HFWA 3DRQB 1FYTE 3DV6B 3GM8A 1MWAL 4PJGB 4OV5B 2DM4A 2VITA 5LCVL 4BSVB 4OZGB 2BVTA 2WBJC 4P5TB 3SDAA 3W9EB 2NY5H 3JTTA 4QXGH 5FK9A 4NUGL 3S5LA 1ADQL 3EYVB 1AP2B 4PJ5D 1T04A 3FQRA 4A6YB 2Y4SA 4G7VH 1FE8L 3MLRL 3QXDB 4I77L 4UNTA 5F7KC 2X1WL 3JV0A 1XMWA 3LKNA 3VG0L 5IF0A 4LQFH 5C8JB 4IDJH 5TDPA 3GMNA 4HKBB 4MNQD 2V7HA 4RGND 3BGMA 4C83A 2XQBH 5D6DC 3A6CH 3OXSA 4G43B 1LK2A 3BESR 3WUWB 2WANA 4U33A 1P9MA 3GMOA 3FONA 5FECB 3LIZL 4C4KT 5IM7A 4WGVB 1BIIB 8FABB 3SGEI 1AKJB 4N8VG 2ESVD 1BEYH 1A7RH 1Z9OA 3FAXA 4XAKE 2HH0L 3MODL 1QO3B 2NTFB 5H37G 3WIFB 4E41E 4NM8H 1UENA 1LO2H 5IGXL 4MDJB 1QLFB 3MLPA 1YPZB 5L6YL 1IC5L 3HUJF 4O58H 4GMSL 2HLAA 4OZIA 1RI8A 3M45A 1NGZA 3EIFA 3CMOL 4JO4L 4JREB 1TQCC 4Y19B 4N90E 4R4FH 4ZS6C 3VWKB 1ZTXL 3QRFM 4JE4B 4GRWH 3OGCA 4I48B 5TH2A 3GMQB 5IVXB 4K3JL 2DM2A 3WKMH 4UIMA 3QPXH 2H32A 1YNLH 4NZDA 5C0AB 3IFOB 3MJGX 3ROLA 3C60D 2WWMC 4YBLC 2BNUB 2PR4H 4XPHL 3V7AE 4XPBL 3QXAA 1E27B 5E2TH 2XWJB 2VRAA 3MV7E 1S3KL 5JO5B 4YX2H 4YXHH 1IAOA 3G5VA 3WFDL 1BQLH 4FFZL 4LNVA 3V52H 5DQ9B 1F8TL 1IGFL 4IS6B 5JR1L 2IAMD 5L2KA 4HIIB 3IRPX 4S1DD 5B38A 2KPNA 1I9RL 4OFYD 1IGJB 2JJWA 4K2UH 4RQQB 3ARUA 5GGTL 2ENSA 3BH8B 1JGEA 1TZGL 2GTWB 1NCNA 1MUJB 1W0WB 2OM5A 3VA6A 4X4YB 1H3PH 1EAJA 1A4JA 4TOYL 3OF6A 4ZOAA 3MV01 2ZSVA 2OK0H 2ZWLT 3QDJD 1JIBA 3SN6N 4OF3A 3WDJA 5J7CC 2APBA 2JJSA 5I1LB 4HDIA 1KTDB 2DKMA 5SV3A 2P49B 4H1LG 3LMJL 4EN3B 5IFHL 1ZHKB 1FAIH 1UGNA 3P4NA 4FQPA 3N1GC 1IJ9A 1N2RB 4OBSA 1H5BC 3KPSD 4TVPL 4AIOA 4PJIA 3WN5B 1NANI 1S7RB 3KPOB 1HYSC 2B1HH 5JPNA 2EYSA 2XG5A 4M03A 1CD1B 1BFOB 4HKZB 4JDVB 3TNNA 1ACYL 2P5WD 2D2OA 1CIUA 5EUOA 1F3JB 5DHVB 4YXLH 4X83A 4XBGA 3DARA 1H15A 2R0LL 4PJXB 1T83A 1KTKE 3HZYB 1BREA 4M4PA 5J1AA 5AAWA 5IVOA 4Y4FA 2NY1C 4GXUN 2NY2B 5C2BH 3FCTB 1BWMA 1RUPH 4ODSL 4LEOA 4TTDC 4HEME 4XXCC 4ETQA 4UDTB 2VKWA 2FX7H 3GRWA 4OLXH 2IANE 5CZVL 3BVNB 5GGSB 5JDJA 1LDPL 4KHXL 2SEBB 4J8RB 3LQZA 4KAQH 5BZDA 4Z18A 5CUSH 2EO1A 1ZHNB 2IPKB 5HDBE 1P5UA 1HHGB 2EDTA 1U8IB 2FEEL 5F9JB 5AZ2L 1PZUB 5HHQA 1M7IB 4XVTL 4OIIH 5FYJD 3QISA 4MYWB 2QADB 1MRFL 3EYUL 3HE6C 4WI4A 2I26N 2AEPL 1MOEA 3C2SA 3FFDB 4JJ5A 1UA6H 2OTWB 1JF1A 4DVBA 1A02N 5EZOH 3O8XB 4PP2B 3SDCA 4CU6A 5IHUL 4Q9BA 1S7SB 1MCCA 4P49A 4RZCA 5BO1H 4HV8A 3GI8H 3DJ9A 4L8CA 1ZHLB 2Z91B 1IZKA 4PJ7F 4QOKD 2CXGA 5FUCC 5ANME 1FVDA 4JFEE 5EU6E 1RSFA 3NCJL 4U7SA 2IWGA 3KXFB 4UNUA 4M5YH 2C3VA 4PRPB 5E5UB 3UZQA 1LO5B 3MCKA 2UWEA 1QLEH 4IRSA 3ZE2E 1JNHA 2RBLA 1GJIA 1DDHB 3F7VA 3S96B 1HWGB 1IC7L 1MWAB 4X4ZA 4M5ZH 4G8GB 4L8BB 5C7XL 1K3IA 1MCOH 2IPUK 3F7YB 1BOYA 1JF5A 4JHWL 3MRJB 5SWZA 4S1SH 4OZHA 4LIQH 2HAZA 3IT8D 4OD3H 5D1QC 1CXHA 4OTXH 2V6HA 2QR0B 4KRMB 2Q8AH 4HKXA 4MWFB 3T77B 4EIZC 1AO7B 1V3MA 2WUBL 2F54A 3KLSA 2VDNL 4KI5E 1X5LA 4ODUA 3FRUA 1BFTA 4Z7WF 4RAVA 3FT4A 3GFUA 3Q6GL 4NZTH 3ULVF 1P84J 1F6LL 1A3LH 5DA0B 1VFAB 4L3EA 5LVEA 2VUOA 4KQ3H 1RULH 4LGRB 4IOIA 1JPSL 5ALCH 1HHKB 3S35H 4KKAC 4LLMB 1MIEL 2H1PL 5DQDH 4OZ4A 3U1SH 3UPCA 1BZ7A 4FZ8H 3TO4D 1ZGLP 3WXVL 2XTJB 2AABL 2XA3A 1EGJH 1K8IB 3D39A 4G3YL 3UBXA 2D4FA 5FYJH 3KPRD 1M05A 3BGFB 3T0VA 1F6AA 4KU1A 1EHXA 1U3HC 3QDGA 3UJIH 1GVIA 2NXZB 5A3IC 1ZGLM 5I1JH 5EZIL 1YMME 5ERWB 5F1SA 5E1AB 4M7LL 2VDLL 4Y4HC 4KQ4L 3EAKA 3H3BC 3EJYC 5AD0A 2ZOLB 5JXAH 3TNMA 1VGEL 2DN7A 3DXAD 1MREL 2BP3A 1X7QB 1F58L 3PWVB 1BLNB 4OSUH 3A6BL 1UWGH 3DYOA 3VE0A 1MJ8L 1Y18A 4MJIB 2FL5A 15C8H 2XZZA 3FMGH 3O4LD 1MFDH 2VLJB 4F7EB 4U6HA 3IXAB 2DWDB 2X5PA 4DN4H 5FF6A 4KZDL 3T4YA 2BXZA 4LU5H 4JG1H 2GY5A 4FXKA 1QP1A 1AHWA 4GG6F 4LFHD 3BWAB 1DL7H 1X5GA 3MV9B 4UV4H 5H8DA 1LEKB 3MRLA 3N1PC 4L4VD 2E9BA 3UTSE 2YA0A 2PCPA 4GRLC 4Y16B 3RWGA 3PGCB 1IBGL 1UXSA 2EIZA 1KEGL 1RJLB 1X6NA 3KJ4B 2QTEA 1YDPA 1ZT1B 5EOTB 4I18B 4XB8A 3GMLA 3O9WC 5I6XC 3VXTB 3L7FA 3QCUL 5GGVH 4C56B 4D3CL 1ZLVK 1QSED 1U91B 1SJXA 4TTDD 5KVEL 2R2CA 4IJ3B 5ADPL 1BX2A 5JORB 4WEBL 3KPMB 2VXQL 1EHNA 1MQKL 2QLVB 3QA3B 3FO9A 2B5IB 5FYKD 1NKOA 3GSQA 2R2BB 2Z8VC 5BV7B 1SYVA 3C5ZC 1FP5A 1WZLA 1JMXA 4D0CA 43C9A 3QAZB 4UUJA 3OAZK 1PZ5B 1OLLA 1E4KA 3O2WL 4F9PC 2BOCB 4QY8B 1MI5E 1KCUL 4URTB 3MRKB 3KLHC 3V5HB 3TZVB 3QDME 2VLRD 3CX5K 5GZNC 1T2QH 5F3HB 2ZSWB 4BQ8A 4YHZH 2I9LA 2LU4A 5DQJB 4KJPC 3VFPA 3MRGB 4AT6A 5ID0A 3ARDC 2CQVA 4CW1B 3V6BR 5GHWL 4JO2H 5D7IB 1FFOA 3S37L 4FA8A 1OD7A 3MJ6A 2YKLL 2ENYA 4HBCH 4G42A 1TJGL 4P9HL 2PXYA 4KXZH 1ZGLB 1YNTB 3QIWB 5FCUH 3ZE0E 5GGRY 4XP1H 4Z7QE 4RNRB 2YRLA 5HYFA 3IFNL 5JA9A 2HJKA 1R3JA 4Q9QL 1Y6KR 4J1UB 2VIRB 2DQGH 1Q1JH 3U7YH 5LAXB 5BS0E 2FIKA 1IM9B 2BX5A 2NY0C 1T2XA 1GGYA 3WO4C 2DD8L 2MTPA 3WNPA 4XBPA 4Y5VC 4MMZC 4HS6A 4PGBA 2VL5A 4PRBA 25C8H 4K7FA 4QHMB 5JHDD 4E5XA 3D18A 4LSUH 3GSXB 5DHXB 3G6DH 5D5MF 1SVZA 4MA7H 5T1DH 3RKDC 2RJMA 5HI4D 3VXUB 2A6DA 3D85D 4FMKA 1AXTH 4GW5B 3DHJA 4PYHA 5DJCB 3TCLA 3FL7A 3QQ3B 1UWXK 1CFSB 3U4EB 2BSRA 4N9GA 1OW0A 2PYEB 1IGYB 4B7IA 4MNHB 1NBZB 5FYKH 3MOQA 1I85A 2YD4A 3BPNC 4KKAD 3U7WH 1DUZB 1OGAE 5C0IA 2CKBH 1DCLA 2X4OB 3GSWB 4XZUA 5ETUB 1MCJA 5HHME 4R8WH 5JW3L 5EC1B 2VJXA 1FN4B 5TGBB 3ARFC 4V1DA 5HI5D 4BH7B 2XN9B 5E56A 3LCYA 5I74C 5HHOB 5L0QB 4OGZA 4OLVH 4KZEH 5DRNB 3EJYD 1BBJB 3GIZH 1PFCA 4EN3C 3MLYH 3S3JA 3MFFA 3GSOB 1RUMH 4OZFH 1ZXQA 1XF3A 5ISZE 4LLVB 1EVUA 4F37F 4XPAH 5D1XA 5IW6B 4I2XE 3TYFA 4HIHA 4KRLB 1A6ZB 2LU3A 1A1MA 1S7TB 4FQXB 4LSRL 1EHLL 2BNQD 3RL2B 1SJVA 1HHJB 2R1WA 1QBLL 3V4VH 4EI5A 5HYSA 1NJ9B 1P6FA 2J5LC 4NDMA 3FN9A 5FO7B 4QXTA 1DP0A 4U6XB 4MD4A 4S1RL 2J7LA 2AK4E 3B2VL 4MX7A 3TH4T 1S78C 3V0WL 3LZFH 3P40A 4GRLD 5TQ2L 4PLOB 1GC1C 1ZA6B 2HTLD 4R7NA 4UTAH 5BMFL 1DLHB 3ETBF 4S0TD 1J8KA 5FOBA 4Z76A 1YEHH 1V8HA 4L4JA 4HHAA 4AYFA 1A7QL 4V2BA 3FFCE 4M1CC 1VKXA 3GHEH 1RFDH 5BRZD 2VXTL 4Z7WA 4NT6B 3AU1A 4PG9A 5HI3C 2Z31B 2OSLB 1JGVH 4U6VH 5I19L 1FG2A 3AAZB 1JN6B 3EO0A 3BD4A 4PREA 4P5TD 4WUKL 1T0NA 1PKQB 3O4OC 3MUZ1 5DD3L 1AGFB 2D31A 4JFQB 3C5ZD 2FJGB 4M6MH 1DUYB 2FO1A 1HILA 3GRWL 3NGBB 5IW1A 5FO9A 5IOPB 2FD6H 5DEZA 3OKLA 2Z93B 1JHKH 2A6KB 3BAEH 5EOQH 3UPAA 3V79C 3UTZA 3KLHD 4TSCH 3QNZB 2J8UA 5JNYB 1OAQH 3RJQB 4R90L 3SCMA 4FFWC 5GZND 3W5NA 2BMKB 1HINL 2Z8SA 5HGAB 5CLWA 1HH9B 3L3DB 5HPOA 3EHBD 5TQ0L 3HKFA 4G6FB 2KKQA 4DJMA 1B2WH 4ELKB 4J3SA 5DR5H 4K3EL 5ITBL 4I0PB 4ELME 3I6GB 3EGSB 1AKJD 1D5IH 3FO0L 5ILTH 4DZBB 4QRUA 3S88L 2V17H 3ZKMC 2QQNH 3ILPA 4IOFD 5E8OA 1UKSA 1WZKA 4NZUL 1YEEL 1G0DA 1JWMB 2B1AH 3MRBB 4GQ9L 4OBRA 3GEWB 2H8PB 4YDKL 1FVCA 3LPWA 5HJ3B 3I84A 3IDXH 3J7HA 4F7MA 1MY7A 2CDGA 3MRCB 4U2YA 5F7UA 4R26L 1E4WL 1GRWA 2KUTA 3C87A 5C09E 3BO8B 1HKFA 2OTUA 3F12A 4GG6A 4PGZA 4EDWH 2C5DC 4Y19D 3EZJB 4MXWH 1M7XA 2CRZA 3VWKD 2BVOB 3X11A 2F5AL 2ZOKA 2VITB 1MFAH 3OMZA 4K23H 5JOPE 2MKLC 5C0AD 3RKDD 1QFWH 3BJ91 4LSTH 3RBGA 1T04B 1RZKC 2ICWA 3BPOB 1T7ZA 3CGTA 1C08A 4QGYA 1E6OL 3PL6B 2CSPA 5IF0B 2ZZUT 3HZKA 4P23C 5DFWH 5TDPB 1JP5A 3BGMB 4C83B 3QUYA 1P1ZA 1LVEA 1LK2B 2XOTA 3TH2T 5B39G 4YXKL 1QRNE 3HPJA 2VN4A 3FONB 1QEWA 4U7KA 1MCKA 4FNLL 2NXZC 4O02L 2FNBA 3PWPA 1HSAA 2EEBA 3LS4H 3H0TA 1HOCA 5DZLA 1T22A 1XT5A 2X4QA 2FBJL 4OGYL 3HI1B 1EJOH 3MBXL 3V6ZA 3ZDZF 4XPFH 1CD8A 3UO1L 3WFBL 1OP5H 2EDWA 5DC4B 2ZUYA 4FQ2H 4EN3D 2E8ZA 1KLGA 4Y4KC 4OZIB 4BM7A 2DQJH 4XCNA 2CK0L 1NGZB 3ZE2F 3QEHA 1R24A 2OLDA 3MNVA 4NKMA 4JVWA 3ULUL 2P5EB 2AJSL 3AS1A 1N6QH 4KHTL 4HT1L 5TH2B 1SM3H 5DURB 4UIMB 2H32B 3CMGA 1ZS8A 3ROLB 1JYWA 3TCXA 3VXNA 3HAEH 3C6SB 4P4KB 1DBJH 2N7BA 4KI5F 1S78D 4QKXB 4PJ9C 4X7CC 1ED3B 1LNUB 3QEQE 5J06A 12E8H 1IAOB 5C0RL 5HPMA 3SBWA 2DM3A 1KIPB 1FC1A 4GAYA 1JNLH 5D5MA 4LCWE 1MJ7H 1S7WB 1TJHL 2WP3T 2DQIL 5GRJL 2AV1A 3P9LA 1NGXA 1WCQA 3MA9H 3QB7C 1FV1A 3DYMA 3L5XL 5CILL 1JGEB 2Y07H 3EDEA 3BIAX 1FYTA 3T0BA 5BJTB 4DW2L 3D25A 4GRMA 4JDZA 3JV6A 3S37X 3QAZC 2DYPA 1RIVL 3PV6A 4OLWL 1A4JB 3BHBA 3ME0A 3OKKA 3EOYG 1U8NB 1KB9K 4JFHD 4V2CB 3X12A 2QADD 1OP9A 3MBEC 4ORGA 4HDIB 4LHUG 1MJUL 4WW2F 4G6AC 2VMFA 3T1FB 3O8XD 2Z35A 3P4NB 4LPTA 5BXFA 1OY3B 3TT3H 3M07A 4PJIB 5D2NE 1PAMA 5KSUB 4WWKB 1ETZA 1A4KB 1R3KB 5JPNB 2A1WH 3K46A 5HY9A 5B22A 5CSGA 1S9XA 4LRIC 3V8OA 4J2XA 3DX6A 3AY4A 3O3UN 5IV2B 3DI3B 4XBGB 3D69A 3U0WL 3U0PA 3BZ4B 4PRPD 1L9NA 1BGXL 4E41A 1KTLB 4Y4FB 3ZKMD 5CFHA 4BZ1H 1CICC 3EOBA 3Q5OA 1JGDB 4ETQB 5E8PA 1WEJL 4OB5H 5L8LB 4R2GC 4PG2A 1CCZA 1I7ZB 3PWLA 5DHVH 4HUKB 2R1YA 3CK0L 1IGTB 1UKTA 2A77L 1N4XH 5EBLA 3MV8E 1QR4A 2BJMH 1GC1H 1WWCA 2Q7NA 2ZPKH 5HHQB 2FZ3A 2VSCA 4MCYA 4X9IA 2HJFA 1A1NB 2VZTA 3QXUA 3C8KA 3O11A 4JJ5B 1DBML 1YYMH 4DVBB 4JQXC 3MV7A 3GHBL 3O6MH 5F9OH 5L88L 4Z7UF 3O3DA 5CJ5A 3MUJA 3CJJA 5KS9E 1CD9B 5E2UH 1RIHH 2ADFL 4RZCB 1CE1H 2DKUA 4FQJH 4LDOB 3RWDA 5JOFB 1WTLA 1ORQB 1Z9MA 2VKXA 3UMTA 1D7FA 1BVLA 2QQLH 5E4EB 1JI1A 2YPVH 2CPCA 3IF1A 5DGRA 1IC4L 3FKUS 1H3WM 1FVDB 5F21B 3RU8H 1VGKA 2NXZD 4IRJB 4XRCA 3TJHC 3LN4A 1A22B 2P24A 2C3VB 2X1QA 1QQDA 3O0RL 4NIKB 5F9WB 3BQUA 2UWEB 2VR5A 3ZE0F 1MAMH 2OJEA 2VAAA 3LOWA 5DJZB 1UQSB 3BH9A 3BDYL 3H42L 5EWIL 3BP7A 4LLYA 2OQJB 3IFPB 4OZHB 3U4AA 5I1HH 3TA3A 4DFHA 2BDNH 4X7SH 4KK6C 3QCTH 2VLJD 4I3GA 2Y7QA 2XKSA 4HKXB 3MCG1 2R8SH 2O5ZH 2NX5D 4WW1A 5B8CB 4QRSA 5KSBB 4XCEA 4JY6A 1MWAH 4ODUB 4RAHA 3MV9D 4N8VA 5JOEA 5LCVH 4RAVB 4K7PY 4R0LA 1HXMB 4MGXA 4NUGH 1ADQH 3EYSL 1S5HA 5C0JA 5I9QC 1WZMA 5TDOB 4Q6IC 1XCTA 1FE8H 3MLRH 4I77H 4XH2A 3SKOA 3VG0H 5TE7L 3VFNA 4C56D 1Q9OB 3JZ7A 1J0ZA 2AJXL 3UBXB 4WI2A 1M05B 2IANA 3MLTA 1F6AB 5EBWA 4GKNA 3QDGB 3LIZH 3TN0A 1CQYA 5EOCL 4ZXBB 5JDSB 1CXIA 4M7JL 5CGTA 2Y06H 4TVPD 3TNMB 1FG9C 2HH0H 3MODH 3GJFA 1OP3H 2J3SA 3RWCA 2Z9TA 5D70H 1MH5A 3WFEL 5IGXH 4ZFZA 2W07A 3TZVD 1FLRL 5L6YH 1S7VA 2FX9L 3IFLH 1IC5H 4FN0A 2DIBA 4PV9B 1Y18B 3UDWA 3VFSA 4WVRA 2VXUL 4OAWA 4HD9A 4A2LA 4X6EA 1RK1A 1RVFL 2GHWB 4U6HB 5I0DA 4JO4H 1CK0L 4H88L 5FF6B 1IGCH 4HWEL 4OFIA 2D0HA 2VOTA 3I85A 1G7QA 1AHWB 4J4PD 3C9NA 3CFBA 5IR1B 3QIWD 1FGNL 5ANMA 1CDHA 4JFEA 1KN2L 3HLAA 4ZSOE 3AGVA 5EU6A 1CGXA 3FB5A 1UXSB 5KANI 2EIZB 2E9WA 1U42A 3HUJB 4XPHH 1JV5A