3G6DH

Crystal structure of the complex between cnto607 fab and il-13
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFNSYWINWVRQAPGKGLEWVSGIAYDSSNTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGAFHWDMQPDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CNTO607 Fab Light chain
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6dH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6dH01
1KLGB 4BQBA 4V1DB 4O58L 1NGYB 5GGQH 3DGCR 1B0WA 4BFIB 5HDLA 5TDPB 5D4QA 2BY0A 3O6ML 2R2EA 1DN0B 2AXJA 3OHXB 2OTWB 2BVOB 3D69A 5I1JH 1DQLH 4WO4C 4Y19A 4GAJH 3V2AR 5TE6H 3CVIH 3HS0B 4KK9D 4Y5VA 4FZ8H 5FYLE 4NO0D 3T8XB 1HKLH 5I15L 3RI5K 1QLRB 4JO4L 2R4RL 1XR8B 3S97C 4NO5B 3SGJC 1SJVA 4M1CC 4MQSB 2WW8A 4GW1A 1FC2D 1MOEA 3HUJB 3ILPA 4LLUA 5GRUH 3VWKC 4ODUA 5ALBH 1T04B 1D3CA 5C08D 5J6HB 1HOCB 1CU4L 4OZGB 1E4WH 4KWUA 4EUPH 1A6ZB 5ITBL 1KUMA 2BCKA 2IG2L 1NEUA 3I75A 2M2DA 1IE5A 1S9XB 4ODVH 5CEYB 4MNGB 3GSUB 3SPVB 5T33H 5CFHA 1KSRA 2YZ8A 3OGCA 6CGTA 2YD1A 1DLFH 1DFBL 5IM7B 4D94A 1AD9A 5E8PB 1I1AA 1FNGB 3ZKND 5HHVH 1AHWA 2D0FA 4JFEE 4Q2ZA 4IOFD 1EHLH 2EECA 4N1EA 2AJUL 3LHPL 3DURA 3GI8H 2IALA 4X98A 2BC4B 3ZTJH 5H35B 3MRDB 1F6AB 4L9LA 4WEMB 5ILTL 4ODSH 4U1IB 4NUGL 3KPQB 3O9WD 5JHDD 3DBXB 1LO4L 1WBZA 2NY1C 4XC3H 2QSCH 1CE6A 3G5XB 4HKJA 3MREA 5CJOH 4OLVH 2FX9H 4LPTA 4ONOA 3RRQA 2LTQB 3EHBC 3AGVA 2GKIA 3GI9L 4MMXC 3RVXC 3QAZB 2DQTL 1I1YA 5TDNB 1FHGA 2QTEA 1UCTA 1BLNB 2IBZY 1N5AB 2V5SA 5L6YL 4AMKL 1KNOB 1PFCA 1SHMA 4FFYL 3VRJB 4OLZH 3MRRB 4CUCA 1AGDB 3EYSL 1VACA 5I1IH 4M6AA 3QEQA 2NXYD 1QKZL 1RIVL 3BIBX 5DYOA 1MWAH 15C8H 3VD4A 2GTWB 4ZQKB 2V9RA 1U9KA 2YHGA 4ZUWB 3MV7A 2XKNB 4PJHE 3N85L 32C2A 4O5LH 1QOKA 3UROR 1IKFL 1NCCL 2VDOH 3NH7H 1DUYA 1OAXH 4ODTH 5KS9F 5FA4A 4HWZB 4I4WA 5E5MB 3MA7A 5DXWA 2EYRA 5JORA 2AABL 3VWJB 3HI5L 3IDJB 3WL9A 1WWWX 1NFIB 1N7MH 2B2XH 2I60H 3IVKA 4U6XA 4EN3B 5C71A 4NQCE 2DTML 2ZUTA 3O4OC 5C0DB 3D87B 1TCMA 2J6EA 4FQ1L 4LLVA 3RVWD 2X4NA 3NCYP 4QEGA 5KSUA 3UPCA 4PV8A 3MNWB 1CT8A 1F4WH 2OM5A 4NKDA 3RIFF 3QIWC 3ARDA 1A7RL 2R39A 4ZUVB 1CF8H 1TQBB 2QQNH 3P4MA 4RFNC 5EIVA 1L6XA 4MJ2A 4QTHA 4KUZL 2CGRH 2B0SL 4LBEA 3ZE2E 1DSFL 4E41B 1I8LC 2IADB 4H88L 3AB0B 2F54B 4JM2B 4UV4H 3QFJA 3NPZB 5EORH 5HHOB 2W60B 4ODBD 2A77L 5EOQL 1E6OH 1YMHB 4LCUB 4BYHA 4LF3A 4YE4H 4MJ5B 2CLZA 3P4OB 3RDTB 3H2WA 5HY9B 5C0JA 5TQ0L 1MI5B 1UB6B 4I18B 3CSYB 4FQLH 4D0DA 4XVUC 3FQRB 4KKBC 4J6RH 3O0RH 5J6GB 3D9AH 4KHXL 5CD3A 1LP9B 4HGWB 1AR1D 1WV7T 5MERB 3OF6D 1Y0LB 3HNSH 3QHFL 4YBHA 3SO3B 3GSNH 1RHFA 1F45A 3CK0H 1IC5L 5D2LB 1NLDH 2AEQL 1K9TA 3PGDB 5K59E 4L8SB 4I0PD 3H9SE 2R0ZH 4K9EL 1KB5H 2NY3B 4FQ2H 3KPTA 2XZQH 1S7UA 1TTUA 4GT7A 5DJ0B 4HPOH 1YNTB 2JJSC 3OXRA 3QG6A 4G3YH 4KMQA 4FTVE 4YIQB 1QBML 3Q6FA 2AEIT 3FTGB 2HN7B 2FHBA 1MCPH 4WW2C 1U8OA 1A6PA 4CVZB 2EDXA 3RBSA 3UPRA 3U30C 1JGUL 4I2XA 3ETBF 4MDIA 4QXGH 1T3FB 5D72H 5CIPH 4OM1L 1KTRL 3SKNB 1FVDB 2X70A 1F4YH 4JG0L 4JRXB 3RL1B 4N1HB 5IW1B 4IRSA 5F96L 1T6WA 3T09A 3V0WH 2HA1A 1F90H 2R2EB 5DD0H 3P73B 3D69B 4QRSA 4NQSA 1LO0L 1IAKA 1Y6KR 3B2UC 4OJFL 3RP1A 5LAXA 3TVMD 4G6MH 4Y5VB 1P9MA 3S34H 3QXUA 1IVLA 1XF4A 3K7UA 2N4IA 1EUTA 4JPIA 3FB5B 3FKUS 1RUAH 3ILPB 4PJFE 4XHJC 1FORH 5AZEL 3MACL 4ZTPH 1RVFH 2R69H 4ODUB 4IMKA 1BQSA 3OKLB 4O51A 1SEQL 4ZPTA 4UUJA 4KUCF 3O9WA 5JHDA 5H2BA 1G6RH 2VLJD 3I75B 5D1XA 1NBVH 4HSQA 4TVSa 1BJ1J 4BK4A 3W11C 2EXWD 3ULUD 3FFDA 4F9LA 3OGCB 3MLYL 2XTJC 3JVGA 2DQHH 3JV6B 1WBXA 2EDKA 4OSUL 4AEFA 2MFNA 5CZVL 3RHWF 2DQJH 2BNUA 1KCKA 3GBMH 3PNWA 4OUOA 2RIKA 4JY6A 1AHWB 4Q2ZB 1NFKA 4LEXH 1G9MH 1OM3L 1KJVA 4FQXD 4H20L 3L5HA 5T5FH 5IGXL 1J8HD 1G7QA 4X98B 3REVA 3BPOB 3PQYD 4OCYH 4L9LB 3A6CH 5I1HH 4XP4H 1FDLH 3BE1L 2HKFL 3OAUH 2HJKB 4NZJA 2AJZB 1WBZB 3MCLH 2IAMC 4NUJB 4D2NA 3DRTB 5C0NC 1CE6B 3MREB 4J8RA 2P5ED 3CAFA 3EYVA 4UV7L 1J18A 4LHJB 4G7VL 3UMTA 1M4KA 4BQ6A 2X7LA 1MAMH 2IGFL 4WFEE 5JIIA 2XWJA 4PJ7F 5DUML 3CFDB 5D7KE 3UJJH 1NCWH 5I76B 2XPGA 3F8UB 3FN0L 1J5OL 2LAAA 3S96B 3K1DA 3QEQB 1AO7E 4XVJL 3C6LB 1P5UA 4DKEH 5IHUL 3EO1A 4NWUL 1EX0A 2HLFC 4HIJB 1CQYA 1WEJH 4KZEH 4EI6A 1CL7I 1RUQL 3IXAA 5I1KL 4S2SB 1DUYB 5GJSH 2K1MA 4KRMB 5FA4B 4I4WB 1E4XI 4PJDA 1RJYA 3L95B 5BXFA 1WCBA 5GRYA 1S7SA 2I5YH 3RVTD 3WL9B 1A6VH 4Z7QE 3IVKB 4U6XB 3PL6D 4UZGA 4LVEA 4OGAC 2X44D 1RZ7L 2BJML 4LLVB 3B9VA 3DLQR 4AIZA 5JO5A 5KSUB 2VIRB 4OCXH 3G6DH 1K6QL 1JZ4A 4NKDB 5E6ID 3ARDB 2C4FU 2A74B 25C8H 5C0EA 4JCLA 3VFWB 4P5TA 3NN8A 3P4MB 4PJ9C 4HX1B 3AS1A 1NMCC 1RSFA 4U0RC 4LBEB 5EBWA 5I0ZA 1HZHL 4R2GC 2IANA 5GJTL 4ETQA 3OAYK 3QWQB 1KJ2L 5J0BA 2OR9L 1ETZB 4M61A 1BAFL 1DQTA 3QFJB 4I0PA 1X4YA 2ADJB 5GSVB 3MJ8A 1CWVA 1QR1B 3S5LG 4PJ5E 2E3VA 5T3XH 4IIQC 4Y8DC 4N0YL 1CD8A 2CLZB 4WY7H 5C0JB 2AGJL 1WAAA 4XGZA 3BKYH 3ARFC 5EFIA 3MYZA 2BY1A 3CNKA 4KI5D 2HT3D 4D0DB 4KU1A 5IESL 1HKFA 1MCIA 1KEML 2HT2C 5CD3B 3QXAA 5DD1H 1IT9H 2AW2A 3O8XC 3DVNA 4LAQL 4OKDA 1JTOA 5HXMA 5E2TH 1T1WA 2W0KA 4ZPVA 2EC8A 3RUGA 4TQEL 5DI8A 3UZEA 3RL2B 3JSSA 2X4PB 2YWZA 4K7PL 4RIRA 4G8IA 1KTLB 4TNVK 3LSOB 3HLAB 4PJIA 5DFVD 1TQCC 3EZJB 1S7UB 1HH9A 4NPYB 2R0KL 5ADPH 1IGTA 5IT2L 5FM4A 3O6FC 1Q38A 4JPWH 3PWNB 2ZNWA 4GXUN 4F2MA 1AE6L 5D96C 5HBBA 4ZDHA 3RZCD 2F53D 3UPRB 4M93B 4I2XB 3IS0X 4MDIB 4ONGL 1KCVH 4WVRA 1QSZA 4GMTL 1UA6H 2J1KA 3WFHA 3ZT5A 3KDMB 1T0NB 2X9XA 5F7EL 1OGAE 5GS3A 1XIWC 4JZNB 4H1LH 2WWKO 1CFVL 3RWIB 4ZS6C 5ACZA 4QRSB 1ZLVH 4NN7B 4NQSB 3RJQB 1FYTD 1IAKB 2XTJE 5LAXB 1UM5L 4OQTL 1T89C 1T5XA 2YUXA 2DKMA 2ESVA 2ITDA 3QEGL 1FNSL 1KIPB 1MPAL 4QLRA 1RUML 4YDVA 3TBYB 1K8IB 4KHTH 4UQ2B 3E8UH 5HVFB 4W4NA 1V05A 4FQXA 1J8HA 3BH9A 1P5VA 2IEPA 5ANMA 3CSPA 4YDKH 2FIRT 1TJHH 4ZPTB 2EIDA 5SX4H 5DMJB 3FO1A 3P0GB 4NM4L 4XVSL 3O9WB 5JHDB 3BGFC 4JFHD 5C09E 1NL0H 2Z31D 2G75B 4NZRH 3VXSD 4YDIL 1DQML 4XMKH 1JWMA 5HDBF 1Z2KA 3FFDB 2C3XA 2G9HA 4JY4B 2WSKA 5DMGD 4B7LA 1KJ3L 2DQFB 3OX8A 8FABA 1Q9OA 3LEVL 3TN0C 2VAJA 4LSTH 1WBXB 4YHLH 2Z4QA 3IDYB 4KQ4H 5F88A 2BNUB 1YEJH 4PG9A 3MA9H 5IJKC 3KXFE 4F58H 4JY6B 1KJVB 5FYKE 2A2QT 1X5JA 4TUOB 4WI6A 2X05A 3U2SA 3X12A 4U1HB 1JRHI 2B1HL 4UINH 3DNKA 2NXYB 4U1JA 3KR3L 2AQ3A 1KT2B 1BHGA 1C7TA 5KVGL 1V7NH 3DTXA 3NCEB 4TNWK 2D4FA 4J8RB 5EZIL 3NFSL 2E7LA 1MF2H 2APXA 2JJTC 4ZS7L 4ZFFB 3FQTA 4TVPD 5JIPA 3GM0A 5AD0A 5BJTA 1J1XH 3GMQB 3M1BA 2XWJB 3ES6A 4QRRA 2CIKA 4FHBD 2XICA 1ROWA 3T0VA 1B6UA 3FB8B 5CGYD 2XPGB 3PL6A 4NJ9L 3I50L 3DRQB 5FIEA 2XN9A 5BV7H 1J8KA 5EPMA 4DGYH 3B8SA 4MJIE 5E6IA 3TIEB 2NCMA 2EDQA 4OZFB 1KCSH 4ZUUA 3N06B 4NKMB 3MLWL 4OLYL 4MDJB 2F58H 1JPST 5K9QG 1WZLA 4EI6B 3VW3L 4FOMA 2F5AH 1AI1L 5KSAD 1OP5K 1MCCA 2EH8L 1XF2A 1ZLWK 3L6FA 4PJDB 4I3RL 1RJYB 1R24B 4L4VA 4AJ0A 2F5BL 3MNZA 3RWCA 4R8WL 5KS9E 1WCBB 3OKDB 3BRDA 3VFSA 4L8BA 5C86A 3OJMB 4U05A 4WHTA 2X4SA 2A9MH 4HS8H 4X8XA 4QCIA 1AGFB 4Q6IA 5GS1C 1XF5A 4AIZB 5DVOA 4RZCA 1VCAA 3FHAA 1JI2A 2VXUH 1QFWL 3G6JE 4ELKA 3L5XL 5ENWA 4ELME 1J0JA 5C2BH 1UH3A 4OZ4A 4PGEA 1G7JB 5IWLC 1BBJB 3IRZA 3WXWL 3INUL 2YA2A 5DD3L 3WBDA 4GRLD 3B2VH 4XI5D 5EBWB 4JZJA 2OJZH 1YNLL 1RK0A 3VD9A 2FWOA 1YPZF 4DVBA 3RWDA 1F00I 3UTSE 4UMGA 5C9JA 4I0PB 4ODXA 1MRCH 4KKLD 3OG4B 2DLHA 4YDLB 1XEDA 3HNVL 2R9HD 3K2UH 4F7CA 3S36L 1OW0A 4MNQE 5TPWH 4WW1A 1BIIB 5FF6A 5HYIA 2W0LA 1P1ZB 4EOWL 1MQ8A 4WFHE 1FG9C 4RQQA 1L7IH 4I5BA 4TSCH 4OCRH 4WI3A 2GJ6E 4Z0BH 4A2MA 3RZCA 4Q9RL 5GHWH 5HYQB 1EBAA 1ZMYA 3RFZC 2WMPA 3QXAB 4MVBD 1U36A 2NTSP 4QRUA 1YECL 3DVNB 5KTEH 4TYUA 4ZPVB 3RUGB 1G7IB 3HC3H 2X10A 1CICA 3DARA 5GS0C 5CBEB 1HHJB 4RWYL 2A6JA 4FMKA 4RIRB 4U1MA 1A7NH 4HC1L 4PJIB 1W8OA 1HH9B 2ZCLL 1IGTB 2ZKHL 1BX2B 1QD0A 4F7EA 3VFMA 3CDYA 4F2MB 4OI7A 3V6OA 1NBQA 1OVZA 4M9PA 1A6TA 2ARJQ 2J6EH 2YPVL 5HYEA 4UTBL 2YR3A 2ICWA 3NAAL 4QHUA 1F3DJ 1KGCD 5HGBA 1ZANL 3WUWG 5E1AA 3BHBA 3L7FA 5B4MD 5JOEA 1RHHA 4IM8A 3BD5A 3WFEH 4RMQA 1T03H 4ZOEA 1EAJA 3UC0H 1MVUB 4NQED 1CE1L 3ARUA 3V5HA 5ACZB 4R26L 3IDIA 1YEEH 3QBTB 2HJFA 4HXAL 3VFRB 1JNJA 1DQDH 3OAZH 5IKCA 3V52H 1AQKL 2X1WL 4JRYE 1D5MA 2AK4E 3SDXE 2ITDB 4UT6L 5ITFA 5F1NA 4K94L 3QAZC 2NTFB 1T7YA 4YDVB 3K4AA 1AKJA 2ZSWB 1OTSD 3GNML 3L3KB 4JPVL 4U1SB 4LIQH 4N8VG 1JWSB 5GGRA 4IMLA 2GI7A 1YC8A 4FQXB 4KJWD 1J8HB 3BH9B 3LKRA 5D1ZC 5FV1L 1UH2A 3PQYB 2KZ1B 3FO1B 3O6KL 3STLB 5DFWH 2R8SL 4XXCC 4XNUL 2ZCHL 5EOTA 3I02A 4HJJL 1F4HA 1YEIL 4F7MA 3WYRA 2G9HB 2P5EB 1CI5A 4G6KL 5T1KD 4QWWC 1E4KA 4JJ5A 2C3GA 3QDMD 2Z4QB 4X0KA 2EZ0D 2E27H 2OYPA 3VWJC 4PG9B 1KJ2A 4K3JH 1HYSD 7CGTA 5CWSA 2ADGB 5D1QC 1ZHNB 3U4BL 4U1JB 3SOBL 1W72L 5I8KL 2Z35A 4H26A 2M8XA 4M6ML 4MCZA 5JDSB 3QWRD 3DTXB 4NWTH 2HLAA 1YY8B 3VFOA 4F15B 1YMMD 3CU1A 4PJXE 4ZSOA 3FQTB 4RRPG 3FRUB 5BJTB 2VOTA 1FL3B 4H8WH 4QRRB 1NQBA 1H3PL 4S1DC 4ZNEE 5LGJA 3MXVL 4NN5C 4YC2B 3PL6B 5EU5A 2VLRE 4JQXC 4OZIF 4QOKA 4DZBB 1MCWW 1U3ZA 2CRIA 2XN9B 1OQOA 3KJ4C 3FOMA 1FNEA 4YHIB 5EPMB 1FPTH 1UB5B 4R0LA 5E6IB 1JPGA 4M4PA 1XH3B 1T66D 4N8CH 4CBPA 1JNHA 1VGKA 3DVFA 1FO0B 4ZOCA 3JV4A 2ZP0T 5I1CL 3VXRD 1EA9C 5IVXE 2GAZA 3W81A 3JWOH 3H6JA 3MNZB 4JM4H 5FA3A 3SO3C 5F1IA 1FH5H 5JOPD 1HH6A 4ZFGL 2X4SB 4GW5B 1PJ9A 2DI8A 1QTYT 4QCIB 4Q6IB 1XF5B 3QDGE 4P2QA 2NY3C 3GK8H 4RZCB 4UBDD 4Y4HD 4DOHE 4QTIL 4PRID 4OQTA 4MSWA 4J3UA 2X1OA 5ENWB 3BGAA 5FYJL 4PGEB 2FX8L 1FJ1B 2OR8A 3VRIB 1QSVA 3EYUH 4FFVC 4MXQC 2FB4H 3EJJX 4M6OL 1ZTXL 4PUBL 3IDXH 2XWBA 4HUNB 4QYOB 5DD6B 1EVUA 3RGHA 1RK0B 4NNPL 4DVBB 4HIXL 3GHEL 3RWDB 3AY4A 3HCVA 1BECA 4WHYG 3SBWA 4ODXB 4QXUH 1D5IH 1KENL 2OI9C 2XXMB 2W0FB 5D70L 4LDLB 5I9QB 4WW1B 1H3TA 2ORBL 4ZTOH 4F33B 5BV7C 4M3KB 1II4E 3WIHA 2NY2D 4RQQB 1A2YA 4I5BB 4HUUA 1U0QA 5L8LB 2JTDA 5DZLA 3RZCB 2F53B 5DEFA 1TJGH 5AYQA 2X1PA 4QRUB 3L5WB 2QHLA 1C5CH 4LSSL 3RTQA 2ZG2A 1CK0L 3BN9C 1CICB 3MLUH 3UYRL 5DK2B 3BSZL 4C4KT 3KLAA 1NGPL 1DUZA 3WDIA 3UCRA 2A6JB 2HRLA 4NQEA 5JZ7D 5I19H 1L0YA 4JO3H 5IFHL 4ETYA 1FYTB 3VGGA 2ZUYA 3VMPA 5T3XE 5GISL 4G5ZL 4NZUL 3VMNA 2NZIA 3IETB 4X5WA 1A9EA 4HMDA 4F7EB 4NKQB 3VFMB 3BDXA 2VR9A 5IVZA 1FFNA 4L29A 2DJSA 5EULV 3O6MH 2VC2H 1U8IA 1I1AC 3T4AB 2GT9A 2Q6WA 4QHUB 1BGXL 1AHWC 5DQJB 3LMJL 3BHBB 3L7FB 2UVFA 3BPCA 3BPOC 5E6ZA 1S9YA 4JO4H 3CC5A 4HMCA 4U4BA 3RIAF 4L9LC 2Y23A 3DPBA 3C09C 3W39B 4FQIL 2R29L 4RMUA 4FRWA 4HK3J 3HZMA 3VXSB 1WT5A 2FATL 2KPNA 3OJVC 1QFOA 2HJFB 4L4TD 2L7UA 1DZBA 3F7QA 2APWA 1FFOA 1HWGB 3TJHD 2EE3A 1JHKL 1D5MB 5T1KA 5E99H 2GYSA 5F1NB 1UGNA 1AFVL 3X14A 1CU4H 2J12B 5BS0D 2IG2H 2GITA 2EIZA 3VXME 3S5LA 4UQ3A 4BZ2L 5HD8C 5GGRB 1KIRB 5TGBA 3MR9A 4CVXB 5DMKA 1MFNA 1VFBA 5KBNC 5FYJU 2HYMA 4KKAD 1PLGL 3L3IB 2C1OB 1GPOL 5EOTB 3I02B 5KSBA 2N1KA 3DO7A 3NIFF 1UXWA 3IAGC 4WNQB 5I18L 4FQQA 3K1KC 5HDBE 4DGVL 5JW4M 4LPWA 4JJ5B 1S8DA 4NUGH 2EDYA 1FLTX 4KK8D 4LQ1A 4X0KB 5HHNA 4DVRH 3KPLA 1KJ2B 4UOW0 2VXTH 2CD0A 1I75A 2M1KA 2YPLA 1DDHB 2Z8VC 3GKZA 5GGTL 2O5ZL 2DQTH 4M43L 1NLBH 5IP4A 4XCEA 1IAMA 5A2LH 4PPTA 4F57L 3ARDC 1CXIA 3PIQB 1CD1A 3BW9B 1P53A 4GMSH 2HLAB 4G42B 1NMBL 1IGIH 1EDQA 2B4CH 4C56D 4ZO9A 1TCRA 1OAUH 3I84A 4TPRH 4K8RD 3REWA 1QKZH 4UTAH 1S7WA 1RIVH 3DUUA 3QNXA 5LGJB 3BEVA 4M6NH 3N85H 2V9TA 1I7RA 1HCVA 1WFUA 3QYCA 2AJVL 1IKFH 1FIGL 5GGSY 1NCCH 4HC1A 2YUZA 1U6AL 3DHJA 1TVDA 3HI1A 1KPRA 1FNEB 4Y4HA 3V6ZA 3NIDF 3QIBA 4PRIA 4ZXBA 3H7BA 1JPGB 2AABH 4J4PD 2AJYH 3HI5H 3OWEA 5FGSA 4X7SH 5E24E 3LN4A 1U92B 4P2OD 2V6HA 1A5FL 2WINA 3MLPA 1JNHB 2YXMA 3IKKA 5J3HC 4FQ1H 5LWYL 1P6FA 3JV4B 4GRLB 3X17A 3EOTL 1EO8L 3HFMH 1EVTC 2GAZB 5JW5B 1OD9A 1FAIH 4KAQH 4P4KA 4PGDB 2AERT 3D25A 1I1RA 5FA3B 3BQUD 1KLUA 1HH6B 1X5YA 4Z8FL 3IDMB 3LV3B 5I1GH 3DSFH 1AQDA 2VISA 4BZ1H 4Y19E 5BZWB 5KZCD 4JKPL 3BH8B 2I07B 4MS8C 4MSWB 4UAOB 5I2IA 2ZCKH 1CDYA 5T1LD 1GC1L 1R5WA 4X5LA 3HAEG 4HS6A 2CDGB 1BFOA 2HVKA 1A22B 5K33A 5E8EA 5EOQH 4OAWA 3A0OA 4M93C 2VLKA 2EIEA 1EH9A 4OZHB 2LU7A 5ICXB 4UIKH 1KPVB 2VXQL 5F9AC 5TQ0H 1AXSA 4IRSC 2EE2A 3IJSB 5IBLD 4W4OA 3C2AH 4I13B 3TYFA 4NN7C 3AM8A 3MUHL 1CVSC 1S7TA 2QR0B 4YHKL 4POZD 2PO6A 1KXQE 2OZ4H 2A9NH 1AY1L 1P9MC 1I8IA 2DYPA 3ELAT 4FMFA 4LMQI 3LRSB 4GRMA 4HUUB 4LLAA 3HZVB 3SDYL 5DEFB 4XTRC 3UTOA 1P6AB 1OSPL 2NY6D 4OTXL 1NC2D 3O2VL 3RTQB 2Q8BH 3GSOA 3MLSL 2F74A 1CG9A 4IMKC 4LPCA 1DANU 1QBMH 2YD9A 3JWOC 4ZAKD 3TCLB 4F37F 3NCJL 1W72A 1B88A 4NQEB 3IFOB 2IPTH 5D1XC 1JGUH 4LOUC 5LQBL 1Q72L 1V3MA 3FZUC 5F9OL 2XA3A 3CFCL 4OM1H 4L4TA 4HS3A 3CXDL 3EIFA 5E8DH 4HWEL 4F9LC 2XZZA 1XMWA 2J2ZA 1N6QL 4HKBB 2NMSA 4X5WB 4NHCL 1A9EB 5CHNB 5F96H 3UAJD 1J05A 1FFNB 2ZJSL 4JRWA 4L29B 4PJ8D 3QEHB 3IDYC 2A6DA 3SDDD 1U8IB 2GT9B 3ORJA 4OLXL 5GRVL 1IGCL 2Q6WB 2X4QA 4CU7A 4U49A 1K5NA 4N0UA 4U31A 1IQWL 1LO0H 4OJFH 1S78C 2BY3A 3QEQE 2JJWA 1ZHBA 3RIFK 3WS6C 2AEPH 3BPCB 4RGOL 4GG6F 2GIYA 1S9YB 3CFBB 4NRXA 5KVDL 5DRXA 4N90E 5BO1L 5TJWK 3MV7E 1X4ZA 3HZMB 1MLCA 1IM9D 4O2FB 4XP6L 2V2TB 4ZNCD 1FCGA 2E6JA 5AZEH 2OSLB 2QSTA 1FFOB 2CK0L 3TEUA 1FFPA 1W0VB 2W65B 5ID1B 4JFZL 5T1KB 4GKNA 3DVGB 3O6LL 1C08A 1MJ7L 1ZGLM 2GITB 4BUGA 2FYYB 1KN4L 3S5LB 4BSJA 5I74B 1LO2H 1RZGA 3LVEA 5GZND 1U8JA 3BP5A 5TGBB 3T65B 1IGYA 3MR9B 1XZ0B 1JGDA 4S11A 3NFPB 1OT1A 3TBWB 4CN6A 1MJJB 3J8F7 4I3SL 1NAML 4OSUH 1MJ8H 5J89A 5DHVA 1LEGA 2GK0B 1ZLUH 1C16B 1T7XA 3DO7B 4ENEC 2EICA 1ZHKA 4H20H 1UXWB 1YMMB 1S8DB 1VGEL 4LPYA 3ZDYE 5C3TA 2HKFH 3U83A 1OT2A 3KPLB 2G5BB 2FEDC 3HR6A 3KWWA 4NBZB 4LIQE 5LBSL 1FN4A 4G7VH 1XGYL 2Q86A 2IGFH 2FRGP 4LP4A 4XCEB 1E0OB 1YQ2A 3JWDL 3O3AA 1CD1B 3Q3GA 3VI4F 4P2OA 4XHQA 2F19H 3TT3H 3WUWA 1ORQA 4P5TC 2FL5A 2P43B 1KG0A 5AG8A 1J5OH 4K3EL 1TCRB 3QO0A 3VXRB 3GMNB 4WI4A 4PP2A 1PAMA 1S7WB 4Z7VF 4AK1A 3ARED 3QNXB 5IHUH 4LLQA 3BEVB 2NQCA 4PRPD 4I0PC 5EZJA 5I1KH 4Y2DD 1ZLSL 3HI1B 4HF5L 5EBMA 4OZIE 1H8SA 1KPRB 4Y4HB 5HYJE 4R6UA 4YDLC 4PRIB 2F8VA 4S1SL 5HPMA 4U1LA 1TETL 1U3HD 3QI9D 3LN4B 1CR9H 4EVNA 3FT4B 2WINB 2AJXL 4N8VA 2VDMH 5K9JL 5GS2H 2CPCA 5I1AA 1QLEL 4JFPA 4PGJA 2XWTB 4JO2H 2IQ9H 2JB5L 4XP5H 4LDEB 5F7DA 2Z0BA 1KLUB 1MFDL 5CP3A 3PWLA 2DJUA 4J7RA 5FYLD 4LPVA 5CILH 5JPMB 1LVEA 1EXUA 4TSAL 1YC7A 2AK1L 4UNVA 5GJTH 4WU5A 5I2IB 2NY2B 2V5RA 4KDTA 2NYYC 2OMNA 3L3GA 2QHRL 2OR9H 1BFOB 3ZYOA 1Q9LA 3MTRA 1AXTH 3ARWA 1H3GA 4RISL 5TQ2L 2B4CC 4N0YH 1MCHA 5K9QI 2AGJH 1GZPA 1AXSB 1N6UA 5DMIH 4IRJD 4XPBL 4S0TD 1L9MA 3NPSB 3ZYJA 5H37G 4YLQT 1NH6A 4RRPA 2BMKB 1A02N 1P2CA 4XAKE 4EBQL 4CKVX 1YEDB 3TYFB 5EH1A 4LAQH 3AMKA 4FXKB 4JFED 3U4AA 3EDDA 5D2NE 1I8IB 3VDCA 4TQEH 2Q3ZA 4GRMB 4JHWL 2JKXA 4DZ8B 4ESKA 1HSBB 2X42A 1DBJL 3MOBL 5ISZA 1CBVL 4WJ5A 3B9DA 2BSRB 1BVLA 2NZ9C 4X9GA 1MCOH 2R0KH 4HJGA 4FQXC 4HGKC 2AVGA 5GGTA 1WC7A 5CSBA 4JG1L 1NGQL 4LSUL 4E42B 4XBEL 5E6YA 1W72B 3FJTA 3QUZD 4YK4C 4O02L 2R1XA 1WLHA 1BVKA 5CINH 4L4TB 1T2QL 4GMTH 1IZKA 1FL6B 2VDRL 1TVBA 5D5MF 1CDJA 1OWWA 1MHPL 3P2TA 3G5YB 4M9OA 3HUJF 5E94B 1RZKH 5BS0B 1YN6B 3GMMB 4P9HH 2BZDA 2A6DB 4RAUA 1R3IH 2CRYA 1CFVH 2A1WL 2X4QB 3ZHKA 1K5NB 5GRXG 1QSEE 3L5JA 1CGSH 3GMLA 1Q0YL 4OQTH 4PJBA 4LKCA 4HG4J 2VUOA 3QEGH 1BZ9B 5JQHC 5DRXB 3M8OL 1MPAH 3QUML 3QG7L 1MLCB 5FO9B 4P46D 4MZ2A 1LEIA 2R4SL 2NXZD 4NQCD 1FFPB 2E7LC 3F58L 4F15C 4K7PX 2ED8A 5F97E 4YBLB 3G5VB 1IJ9A 1S5IL 2P5WE 2CDEA 3T0AA 3PABA 1K2DA 4YDIH 2B7DT 1DQMH 4MYWB 3WNKA 1U8JB 4EDWL 4K9EC 5DWUL 1KJ3H 4CJ1A 5ESVB 1UQSA 3K8KA 3UJTL 3M45A 2IFFL 1RPQA 3QZWG 4DN4H 5E6IC 1RUPL 5DHVB 3G5ZA 3HMXL 5J1TC 1JHLL 3MRCA 2DS4A 4FZEL 3W2DH 2NY4D 4C56B 1ZHKB 4MQXC 1K4DB 2AJ3A 4HG4K 3GJFA 3DVIA 3P9MB 2B1HH 1QSFA 2VN7A 4NQUA 3UJIL 4X6DF 5FHBL 2IANE 3KR3H 3P3YA 3CVHH 2H2SD 5KOVC 3AREA 4JLRA 1XGUA 4RCAA 1I7UB 2C1PB 2XACC 4JKMA 1B3JA 1KYOJ 3WLWD 4NQXA 3QDJA 5EZIH 4Y2DA 1JI1A 1FN4B 2YD6A 4ZS7H 5DJDA 3IAQA 2Q86B 1CQKA 1F4XH 2JIXA 3ROOB 3SDCD 1MREL 4EUPG 1N2RB 4P5MA 5DQ9A 3QR2A 4YUEH 4LCIH 2VITA 3RWHA 4TTGA 4P2OB 4WCYL 3TH3T 2PW2B 2DQDH 4YHOH 1K3IA 3I50H 4YHPA 2FL5B 1XAUA 1A6AA 2VR4A 3H9SD 3QPQD 1TZHA 4WO4D 5EU6E 1BZ7B 4JZJC 3RUGE 1UZ6E 5CJ8A 2WWKT 3BQUB 3MLWH 2CXKA 4G6JL 4OLYH 3B8YA 4FTVD 1ACYL 2XOTA 1AI1H 4HK0A 1JL8A 5EBMB 5KZCB 4M1CD 2EH8H 4NNYB 4RBPH 1MH5A 4I3RH 5FM8A 1OW0C 2F5BH 4KRPD 4I48A 5ELIA 1TVHB 3NIDE 1XGRA 5KVEH 3VWKD 5T1LB 1KYOK 3WS3A 4CGTA 4XRCB 4N8VB 1IAIL 3P77A 3ILQC 4QGYA 3QRGH 3RZCC 4MA1B 1PDKA 4JM2F 2J8UA 4YHYB 3LY6A 1QFWH 3L5XH 1Y18B 3KYOA 1CICC 3PWLB 5E4EB 3SN6N 4IRJA 1BIHA 3BEWA 1B0GA 3WXWH 5DD3H 1ZLVK 2Z91B 3I6LE 1EXUB 4C57C 4EZMA 2ESVE 5CUSL 3SE9L 1DBML 1XGQB 4AG4L 3L3GB 4Z7UB 3V0AC 4JQVC 1F97A 2OLDA 3F62A 3MFFB 4GQ9H 5EIIB 1DP0A 3V6OC 2YKLH 2X4OB 3S88L 2WBWB 2I26N 3HNVH 2NY6B 4J12A 3S36H 1NC2B 5ANME 4NOBA 2XRAH 2GSIB 1GZPB 2GEEA 4EOWH 5FDWA 3EJZC 4OD1H 3BX7C 3EHBD 1NAMA 5EBLA 4ZAKB 5FO8B 3QUZA 3HC0B 3RPKA 5CGMA 2CLVA 5T1DL 1VFAB 3EW3B 3T0EA 1PZ5B 3DETC 1P2CB 5I66A 4K71B 1YECH 1G0DA 3SQOH 3HHRB 3QUYD 3NTCL 2BFVH 5F7YC 4Q9QL 4GKZB 4R90L 1RZFH 4PJGB 1QUNA 1YQVH 3SDDB 4U6VH 4MQ7A 4HC1H 3CZJA 2D03L 5EC1A 4JVWA 2A73B 1JPSL 4O2CB 3VD5A 1GOHA 2ZCLH 4HJGB 1WC7B 1TNNA 5GGUB 2CQVA 4YBQC 3U46A 1UKTA 4RFEA 5K9KA 4WFED 2ARJA 2R1XB 4Z5RA 1IM9B 1KV3A 1BVKB 4P46A 5D7KD 4Z76B 2IQAB 3NAAH 4YZFF 1ZANH 5E2JA 1TVBB 4NQCA 2QQKH 4ODWB 4ISVA 4HT1L 4QRRE 2I9LA 2OTPA 3FO2A 3S36X 4YXKL 3MRKA 2HKHL 3QIWD 1VADA 2BRQA 1AO7D 3VGBA 4MAUL 1UKQA 5KW9H 1X9QA 1KBGL 1A47A 4HXAH 4KPHH 1OOAA 1P7HL 5DVNA 2XN9E 3GMLB 2PR4L 1MLBA 4PB9L 4LKCB 2FEEL 3HAEA 3L5IA 4UT6H 5I1JL 1DQLL 3VGHA 4GG6E 4B50A 3CVIL 5FECA 4FZ8L 4WI5A 1HKLL 3OKEB 4K7FA 1OQXA 3U9UA 5J7CC 4JPVH 4N9OB 1YN7B 1CGWA 5B39G 3T4YA 4DW2H 1ZKAA 3CSBA 4JQIL 4L4VE 3FRPG 1A7QH 1HDMA 5D7IA 3VXUE 3O6KH 2IPKA 2GUOB 5GRUL 3EYQD 3EYOA 2R8SH 4XNUH 5DVLA 5EG6C 4NQVB 2AKRA 2DMCA 1E4WL 2KQMA 4G6KH 4XVUD 4KKBD 3VRLE 1UQSB 4ODVL 4R0LC 5DK0A 1ACZA 4PJEA 1WICA 1YEHL 3WDJA 1QRNA 3MRCB 2Q76A 3ABZA 3GMOB 2AJ3B 5CJ5A 3SY0A 3U4BH 1N26A 2IPUK 2VH5L 3U7YH 1CFNA 2HWZL 4PJ5D 4U6YA 3AREB 3PG2A 1XGUB 5I8KH 1QEWB 3GI8L 4PRPB 1IILE 1JNLH 3QDJB 4Y2DB 1SYSA 3ME0A 2KBGA 5DJDB 1INEH 4BK5A 3MZGB 5EO0B 5CJOL 4P5MB 1U3HB 4OLVL 5DQ9B 3MBXL 3GBLA 2DQUL 4UAOC 3VWKA 2FX9L 1H3PH 2VITB 3QI9B 5GXBB 4OF3A 5DT1L 4A6YL 4YHPB 4JEGB 3SGDH 3ULVH 1BZQK 1A6AB 3EYFB 5F9WB 3DX6A 1TZHB 4MVBC 2ENSA 4IOIA 3L1OL 4Q0XL 3S7GA 1W0WB 2BOBA 1ND0A 3B2UD 4WI8A 3TO4A 5IFJA 4OLZL 3DSNA 3EGSB 2PTVA 5F6HJ 3AY4C 4F7PA 1B9ZA 3MRLB 1Q9WA 2UZYB 2DQIL 4Q58C 5C1MB 3QRFM 1MWAL 15C8L 5E00A 2D9QB 3HNTH 5I1CH 1I8KA 1AGEB 1MH5B 4XHJD 1O7SA 3T1FB 3GZKA 4B41A 4I48B 5IBUG 3NCYS 4PJFA 2VDOL 3QCTL 4ZFGH 4XP1H 2JCCA 4WEBL 4ODTL 3V6OE 1FGNL 3NCCB 2WV3A 3AROA 3ULVF 3P77B 1I85A 1OGAD 5BOPA 1ADQH 1MJUL 2H3NA 3KPNA 1X6LA 1RZIB 2B2XL 2I60L 2J8UB 5C0IA 3LQMA 4QTIH 2EYTA 4Z78B 3ARPA 3KYOB 1A7OH 3RTQC 5FYJH 2O26U 4X6EA 3X13A 2XTJD 2RBLA 3QUMA 4IRJB 3S37H 1B0GB 1F4WL 1XFPA 2QL1A 4KRLB 3RU8H 1ZTXH 4K23L 1CF8L 3OAZK 3CDGA 4XNMB 2EYSB 3QO1A 4JFEB 2QJDA 3QUYA 3GHEH 3T3ME 2VL5A 3CU7A 2CKBB 3TV3L 5FOBA 1J11A 5BZDA 1F42A 2UVEA 4HMEA 4LGSB 5HHXH 5C09D 5E03A 2IAMD 5I17B 5C0ND 3VH8G 2ORBH 5EORL 2V9QA 1NAMB 4LSPL 5EBLB 4NFCA 3QUZB 4YE4L 3HMXA 5IB2A 3DYOA 1JMZA 2VSDA 2P8LA 1JGVL 1WT5C 1OY3B 4OFKA 4W70A 1C7SA 5DC9B 1YYML 3KXFD 3P0VH 2V17L 4LSSH 3GIZH 1CK0H 4J6RL 5FAAA 3UYRH 5FYKD 2VZUA 3D9AL 4JAMA 4HLJA 3HNSL 3QIWA 4FXLA 2DF3A 4Y1AA 4MQ7B 3GSNL 5EC1B 2HLFD 1NLDL 5IFHH 1EZVY 3S37X 4PJHB 4YR6A 5GISH 2R0ZL 3BKJH 4NZUH 4FQ2L 4G6FD 5F89A 4JFOA 2E5EA 2K9UA 2XZQL 3U46B 3GKWH 5CEXA 5JW4R 4LLDB 4RFEB 5K9KB 4Z7OF 2ZG1A 4HPOL 1M6OA 4G3YL 1NBZB 1TITA 1UYWH 3L3OA 4P46B 5A2KH 5E2VH 1BGXH 2HFFA 3QQ4B 3GB7A 1ZGLP 1HEZB 4OGAD 2NXZB 3T2NH 3LMJH 3X11A 1MCPL 4NQCB 2VRAA 3BGMB 4ZSOE 5B8CB 4ISVB 1V5JA 1AP2B 3D85A 5D5ME 4QXGL 2CDFA 2J5LB 2I9LB 3FO2B 2FNBA 3EDKA 4PG2C 1MFEH 3MRKB 3ZSTA 4FQIH 2R29H 1VADB 4MJID 3NFNA 2VABA 3PWVA 3TBVA 4QOKE 2WZPD 5EO9B 4PJ9D 5K93A 5DUPH 1F90L 1JHKH 1QPXA 1R3LA 5HYSG 3MLTA 4BSVA 3ARGA 4HQQL 2H9GB 1AFVH 4ZFZA 4IDLA 5FECB 2R0WL 3S98A 3NABL 4G6ML 1T66C 1NEZB 3OSKA 2NY4B 3UTQA 2BP3A 3H9HA 4OF8A 3VFTA 4MCYA 4JN2A 1HDMB 2RCSL 3T0XA 4Q97A 2IPKB 1PLGH 4ZTPL 5KN5B 1RVFL 3QJFB 3MFGB 2Y5TA 1GPOH 2KKQA 3ARFD 3AXLA 3ZE1F 4PY8J 5F72S 4YFLI 3SCMD 4P2QE 2AKRB 2DWDB 3CH1A 4L3EE 4O2EA 5B3NA 1G6RL 1QBAA 5F3HA 2HT2D 5I75B 1RURL 5C0GB 4Y4HC 4XBGA 4OD3L 4PV9B 3SDCB 3QIBC 5HI5C 3MRHA 3O8XD 4ZXBC 5MP6L 5ESQB 3O81A 5DJ8B 1QRNB 1MEXL 4YHNB 2DQHL 3MLXH 3U4EA 2D7TL 3UTSD 2W59A 1I7ZB 3GBML 3H9SB 3SY0B 1AR2A 3FL7A 1NGZB 4WO4B 1CFNB 1J1PH 4LEXL 2CSPA 1G9ML 1KFAH 1T4KB 4P4KC 2I27N 4X6DE 5E7BA 4MNQD 3O6FD 1CLZH 1T1XA 4KRNA 1REIA 1LILA 4OCYL 4WFHD 4FTVB 2CRZA 3A6CL 5I1HL 3MRGA 3HC4H 1X5XA 2APBA 1SYSB 2GJ6D 4UB0L 4Z7NE 3MCLL 3R8BB 4P3CH 5J57B 4KRPB 3KJ6H 3VWKB 4KDVA 2DKSA 5DVMA 2DL2A 1XIWD 4P3WA 1FIGH 1N5YH 2ZOLA 1U6AH 1NCWL 4P2RE 1HXMB 4ZS6D 1D6VH 5CLTA 3U48A 4R4FH 5IG7A 5IFJB 3TO4B 5HGHB 2DD8L 4R3SB 3CZFA 4BFEA 1A5FH 4HDIB 1Q9WB 3MGOB 2J3SA 5I6XC 5LWYH 5MEOA 4DKEL 3EOTH 4W4OC 3VD7A 1I8KB 3DHMA 4XNXL 3AM8C 3G04B 3V79C 4PJFB 2PO6C 4LCCA 4GFTB 2BVYA 5GJSL 2X89D 3V7MA 1EEYB 2OL3B 4M00A 4IOSD 3PHSA 2H3NB 2I5YL 4AQOA 2B39A 1CCZA 4GBXA 3DMMA 2IAMA 3MYJB 3QZWA 3C8KA 1W0YT 4DQOL 1MFCL 1N3NA 4TN9A 3TN0D 4JANA 4JRYD 3QUMB 1MCFA 2AK4D 25C8L 2J7LA 3GJFH 5I0DA 2X41A 5FXCH 4LEOA 3KXFA 1BFSA 1CFSA 4PLOB 2VXQH 3QUYB 4B0MM 5IMLA 2XV6B 1OLLA 4P48A 1U8QA 3FFCA 4N0FB 1KJMA 1BD2A 4KTDL 1A1OA 3D0LB 5HHPB 1P4BH 4GXUM 3B43A 2J8HA 4EUPA 2LAGB 2NW2B 4YHKH 1ES0B 1AY1H 1LK2B 2BHYA 3C5JA 2YMXH 3WNMA 3VG0L 1F2XK 4GQPH 4OFYD 4LNVA 3HI6L 1HYRC 3SDYH 5KJRL 1FNLA 4WY7L 1T0PB 2YPKB 12E8L 4LRIA 3VD3A 3FMGH 5KSBE 5CMAA 3UXFA 2XQYK 2DQEL 3O4OB 2GSGA 2W07A 2ZUQC 4PRAA 3ZKXC 3UTZB 4YBLC 5DD1L 3K2MC 3PV7A 4YWGH 1P69B 1IT9L 3QIWB 2EKSA 5E2TL 4MA8H 3BYTA 1Q72H 4YGAB 5SV4A 2FJHA 1JV5A 4RFNB 4PJ9A 4HWEH 2MSPA 2YPLE 4JN1L 4YR6B 2C3HA 1NJ9B 1N6QH 2P49B 5F89B 43CAA 4JFOB 3WFCH 4MD5B 5CEXB 3ULUF 2ZJSH 3O2WL 5CD5D 1N0XL 4L4JA 4A6YA 1M6OB 4C59B 5KS9A 4JPWL 2HFFB 3GB7B 1IQWH 3X11B 3F7RA 2VLRD 3QSKB 3U7AA 3PV6A 2HFEA 3D85B 5DDHA 1QNZL 2CDFB 1E28A 1U8MB 5BO1H 1UA6L 3HRZA 4U3HA 5AWNL 1SBSL 1CLYH 5FCSH 2VABB 4DCQB 3PWUA 4XP6H 3TBVB 2R1YA 1MWAA 3SCMA 3P0YL 3K81A 3LKSB 1JYVA 3QCUH 5C2UB 2CK0H 2EEAA 4DKDC 3MLTB 2QV2A 5AZ2L 3O6LH 4JFDE 4CNIA 4PJAF 4HH9B 4YAQA 5GZOC 5MEQA 4OLWL 1KCRL 4MLIA 4W81A 5ICYA 4YX2L 3U6RA 4RNRB 1QACA 3WFBL 2X4TA 3UTSA 1NDGB 3WHE1 5C0CE 5DUBB 4MA3B 3GIVA 2R1WA 4KHTL 4EQ3A 3VFTB 4I3SH 2MQ3A 3TNMA 3HPLA 3E8UL 4PJ5B 3CJJA 4MNQA 2EIBA 3MRNA 2XY2A 1TJHL 3RVUC 5IBTH 3VXQA 3EOYG 3FHQA 4O2EB 2GJ6A 4NZRL 5F3HB 2Y7QA 1U8KA 3O41B 4XBGB 1UG9A 3MRHB 4GW4B 5GIRA 5JNYA 1G6VK 1R5IA 3IXTB 1NGWA 1NAKL 3W9EA 1RMFL 3R06B 4LSTL 1XIWA 1I3UA 1K8DB 1KELL 4KQ4L 3O3DA 2H32A 2VLKE 3OZ9L 3BZEA 1EEQA 3MA9L 2OBGA 5CJXA 4F58L 2VAAB 3GSRA 1PSKH 4F37K 3H3PL 1T89A 3BJ91 4UNTA 4Y5YA 1L7TL 2E8ZA 3MRGB 4JFQA 2ITCB 2ZG3A 5ADOH 5IVOA 1V7NL 7FABL 2ATPA 1CGXA 3VFGL 4MXVE 1A64A 1MF2L 4KDTC 5D93C 2IBZX 4D9QE 1MHCA 1ODAA 1OGAB 3GSNA 1KCUH 1NC4A 3S9DB 5IFAL 4HF5H 5GSRB 4MXWH 4YNYB 3GM8A 4P4RB 5F7WC 3HAEH 1VKXA 4NDMA 4S1SH 5IG7B 1KB5A 4KQ3L 1TETH 5FKAA 2XXCB 2XTJB 5T3XD 3TN0A 5HVHC 3VGEA 2AJXH 3ZYZA 3QNZA 2AK4A 5B39A 4XVTH 5K9JH 1R3KA 4U0QB 3N0PB 3TM6A 1IM3A 1KCSL 1QLEH 2X5PA 3FRPA 5DJXA 4K71C 2JB5H 1Z9LA 4KI5F 3VXNA 5J13B 2YUWA 1Y6NR 5CIPA 5D1ZD 2VZOA 4XCCL 2H8PA 5E8OA 2Y1VA 3DXAA 3ULVE 1UM4H 4N0UE 5C09B 3DMMB 2IAMB 5F6IB 1WZ1H 2AK1H 2VZVA 2F15A 2A9ML 3QZWB 2X2YA 3T3PF 4HS8L 3KNBA 3L9RA 2P8MA 3Q5TA 1N3NB 4CMMB 4QWWD 5D7LE 1KN2H 4AM0A 3N9GL 4F80A 4ZOBA 3VWJD 43C9B 4Y0GA 3TO2A 2CLRA 5C2BL 3VXMD 2ATKA 3KXFB 1OGTA 1CFSB 5D1QD 3DUSA 2EXYD 1WWCA 3MRQB 3B2VL 4FXGB 3D48R 3OG6B 5IMLB 1GHFH 4XPBH 5B21A 1U8QB 4OF6A 1HQ4B 3FFCB 2Y06L 2OJZL 3B5HA 3GMRA 5JIHA 3V5KA 3O4LA 4Y88A 4HHAA 2ICWJ 1A1OB 1H3VA 5CZXC 4E9LA 4EUPB 1G6RA 4NSKA 3TA3C 4G6FB 5MEPB 3JZ7A 3ZZ1A 1B90A 3NCBB 5FYJE 3ULSA 2LE9A 1DBJH 3MOBH 4QT5A 1VFUA 4OGXL 3FCTA 3HB3C 4S1DD 3L3DB 1AIFB 4PJ7A 1ZGLB 4TSCL 3FQWB 2GSGB 2Z92A 2VLRA 2ZOKB 4Y89A 4JG1H 4LSUH 5MI0B 4X99A 4O02H 2A6KA 5KTEL 4L8CB 2EH7H 4U6TA 3ZTNL 4ZUTB 1F02I 1A1NB 2XZCL 2FJHB 3O3BA 4PJ9B 2VDRH 1SQ2N 1NMCB 1U8PB 1ZSDB 5L9DH 1XGTA 4U0RB 1A7NL 2KUTA 2PN5A 5HHME 1FBIH 4G9FE 4CDHA 3F6LA 1WIOA 1YJDL 1OP9A 1X44A 4XC1H 1GC1C 1G0YR 4WUUA 5KS9B 4Z7OE 2A1WH 5TE7L 4I9WE 4M7JL 4HBQA 4AEIH 5F70A 1A6WL 1Q0YH 4P59L 2PYEE 2NY3D 2DLFH 1QZ1A 3PV6B 5FEBA 3QDGA 5C9KA 5IMMB 4IIQB 1V3LA 2VDNH 4HUKB 3M8OH 3U0PB 5CKAA 5IHLB 3HRZB 1VPOL 5GRWA 3AREC 3G6JB 3ARFB 4ELMB 1J0ZA 2R1YB 1MWAB 3SCMB 2F8XC 4MXQD 3ZE0E 2IJ0C 4X7DC 4I0KA 4YXLL 1DLHB 2X6MA 1YEEL 4YAQB 3ARSA 5MEQB 3EUUA 3B9KD 1DQDL 3OR6B 2BNQE 5ICYB 3U6RB 4KMLB 3RNQB 4EDWH 3CMOL 4M7ZB 1NANH 2XA8L 3UTSB 2D31A 5DK3A 1FFRA 1TZGL 3QCVH 3GIVB 5F9WC 4Y19D 2C3WA 2IFFH 4LIQL 1YY9C 3UYOD 3FN3A 4MNQB 3HMXH 3O6FB 3MRNB 2QKIB 4KV5F 4FZEH 1BFTA 3KYKH 4HUVA 5D96B 1CZ8L 2PTUA 1TENA 2GJ6B 5D7JA 1U8KB 3UJIH 1DVFA 2BOCA 4KVCH 3IU3A 2BXZA 1R5IB 3P4NB 1NGWB 3B83A 3W9EB 4ZD3L 5C0BE 1A14H 3BN9D 4TTDC 1JPTH 1XIWB 1DN2A 4X9HA 4L8DA 3PXHA 1NDMB 2W1NA 5LGKA 1V8HA 1HHHA 1GRWA 2BSSA 1IL1A 2E27L 2LU3A 3O3DB 3BZEB 2VQTA 4J3VA 1ZVSA 4K3JL 3E2HC 3WLBA 1BOGA 5TH2A 4WCYH 4Y5YB 4IRJC 4X4ZA 4JFQB 3HR5A 1IMHC 1I1AD 3QULA 2ATPB 4MAYD 4PD4J 1IGMH 3M17B 1ZHLB 4XCFL 1W2KT 4MJ6A 1B2WH 4G6JH 5IMOB 3C8DA 3EO0A 3AU1A 1MHCB 4H8WL 1HNGA 5ISZE 5JPNB 2XQYG 3GSNB 3BGFB 4JY5H 4NFBA 1KF9B 4LCWA 3W82A 5HYSA 3OKMB 1VKXB 4PRBA 4U3XA 1KB5B 3U9PH 1DCLA 1VENA 1I9RH 3MLRH 1FRGH 3LKQA 5FKAB 3MV8E 4MHHG 4N68A 4UDUA 3TN0B 1OCWL 4JRYB 1FPTL 1KACB 2AK4B 3SDXB 5B39B 3FO9B 1IAIH 3QUZC 1IM3B 1CDHA 2NLJA 3VA6A 3T0EC 4NHUA 4UILL 2ZNXA 4N8CL 5HD8D 2WUBH 1GZQA 1WBYB 4LHUG 3VXNB 5D1QA 4D8PA 5CIPB 4BELD 4M8VA 4EI5C 4AENB 3QEQD 4PLJC 4U7MA 3IJHB 2H8PB 4OZHF 5E8OB 3QA3A 5FM5O 4N90D 1FH5L 4WI7A 1FNAA 3MV7D 4PD4K 3QWOB 1K4CA 4PJBE 3KNBB 4LNRA 4OBSA 5IROA 2XZAH 1DBMH 4AG4H 3DI2B 3ZSSA 2UWEF 3JWDC 2GFBA 3TO2B 2CLRB 4P46C 5I1LB 1JUFA 1A7BA 4AL8H 5IHZA 3ZDXE 1GVIA 1JK8A 1FAKT 3MRMB 1ZT1A 4C83B 2FBJL 5C07A 3VI3F 4PGBB 3SQBA 2NNAB 4YHZH 2J5LC 4FS0A 5IHBA 4ORGB 5FCUH 1OP3H 5T1DH 1CLCA 3ARDD 4HHAB 2ED9A 1R0AL 5D9SA 4PR5A 2NY0C 4HKZA 2V2XB 1FCCA 1SBBA 1G6RB 1D5XA 4FQCH 3I9GL 1D5IL 1O0VA 5E5UB 4X7TA 3DV6B 3I6GA 4QT5B 2EC9U 2EEBA 1GGUA 1F6FB 2RFXA 3NIGF 3RA7L 2Q8AH 4DUVA 3R0NA 4QHLA 2NY4C 3P30L 4Y16A 3WHE0 2Z92B 4FQJH 5GS1B 4MX7B 1M71A 2VLRB 1QSFE 4D3CL 1EJOH 4MNHA 2ZUWA 3MMEA 1TJGL 3UTTA 4WU7A 2JB6A 4YH6A 1MELA 3VG9B 1C5CL 5MENA 2E6QA 1I7TA 2ERJB 1FG2B 3TBSA 3MLUL 1UJTA 3PWJB 1FFQA 3O3BB 3RNKA 3QDJE 3WLWC 5DC4B 3Q48A 5J3HD 5IR1A 3LKOB 4NCC2 1XGTB 1BEYH 4RSVA 4HT1H 5JMRA 2GTZA 5I19L 4JO3L 1SJHA 3G9VA 4YXKH 4OLUL 1KOAA 3RI5F 5IVXB 2HKHH 3B9KA 2BSTA 3LS4L 5JXEC 1H3UA 2J88L 1DANT 1KBGH 4ACPA 2P47B 5IEKA 3ZDZE 4KK6C 2PR4H 4Z0XB 4PB9H 4JZOA 2VC2L 3QDGB 1LE9A 3EOBA 3QPQC 3TESA 1NCDH 4MS8D 5HYJD 4DOHB 5J06A 1MCLA 4GAGL 3VXPA 3SO5A 4LDOB 5TE4H 1F8TH 4E0RB 4RBPK 1EK3A 1KPUA 2Y36L 3WJJA 1NPUA 4JQIH 5I8EB 1C5DA 4KRPC 5DJAB 2EDHA 3QFDA 3KHOA 3OQ3B 4PJAE 2ILLA 1Z0NA 5E99L 3QDAA 4IRSD 3VH8B 2ADFH 3CGTA 2D31B 1MUJA 3CX2A 1YPZA 3QEUA 1T5WB 2J8UE 5B22A 2A38A 3JTTA 4ALAL 1X5FA 3BXNB 3TO4C 2MQCA 3C5SA 3OKNA 4BQ8A 1YEHH 5BQ7B 3HZKB 4KJYB 1RIHL 4JDVA 3JTSA 3ARBA 1UXSA 4HUVB 3T1WA 1AXIB 4XTRD 3OMZA 2VH5H 1DVFB 4MAYA 3E3QE 2HWZH 2HT4D 4OV5A 3DX7A 4NM8H 1BJ8A 3S3JA 5CEZH 1YYLL 4L8DB 5DEGA 3MRPA 5BVPH 1JN6A 1QVOB 1I85C 3MUZ1 1IL1B 1UVQA 4DVRL 2AV1A 2L7JA 5D1XD 1NGXA 4LOUD 3WLBB 1IQDA 3FZUD 1S7RA 1N59A 1X3DA 2VXTL 5I1DB 5HJ3A 3H7LA 4XAKD 3MBXH 4MD0B 2DQUH 4NP4L 5DT1H 3RWJA 5JQ6L 3PP4L 5INDA 1I4FA 3ZKSD 4A6YH 4BZYA 5IB4A 1A9BA 3D18A 1NLBL 3T0EE 3HR5B 4PTUB 3I3BA 2ZWLT 5C8JA 4GMSL 2IH3A 3L1OH 3QB7C 4Q0XH 4LCYB 1IGIL 1S78D 2B4CL 4PGCA 5CBAA 5D1ZB 3QUYC 5EN2A 1OAUL 2CR6A 3LKNA 1MIEH 4TPRL 4HIHA 4D9LL 1OSZB 3MBEA 4E5XA 4IHOB 2DQIH 4UTAL 4U2ZA 2QQQA 4TOYL 4M6NL 4M1DL 3BPNB 4PRBB 3A67H 1QFWM 4M03A 4HIIA 5CSGA 5DJZB 3QCTH 4KXZH 5HVGB 4UDUB 4WEBH 1M7XA 3PWPE 1FGNH 4F7TA 3BZFA 5CZKA 1DJSA 5KG9A 1MJUH 4AIXA 2AJYL 4X7SL 4JDTH 4NHUB 5FOJA 3VXMB 4JFFE 1VEMA 5D1QB 1QSED 4NBXB 5BW7C 1JPFB 3QQ9C 3LN5A 3HFML 5SX4I 1LNUA 1FAIL 4KAQL 2YC1A 2NPLX 4K23H 4WHDA 1K4CB 4H1LB 1RULH 3DSFL 4ENED 5I1GL 2BVQB 2NW3A 3E6HA 4BZ1L 5I73B 1MCDA 3TV3H 2HH0H 5E9DA 4R4NC 5EZLA 2FEDD 2ZCKL 4P5KA 4NN5B 1JUFB 2ICCA 2P5WD 2H32H 1P7KB 1LHZA 3RWEB 3KPOA 1JK8B 3LKPA 4NYLB 3KJ4B 1I3RA 5D7IE 4LSPH 2X4UB 3U36B 3QPXL 3EYQC 4UIKL 3V0VA 3F6IA 3ARXA 1PX4A 5D9SB 1JGVH 3DROA 1YYMH 4P5TD 4PBVC 1D5XB 2V17H 4J3TA 1HHKB 2JELL 3C2AL 3B9EA 3QNYB 3ARGC 3V4VL 1BQLH 4PJEE 1G7HA 5EUOF 2IAND 2OZ4L 1QRNE 2A9NL 4UU9A 1KC5H 1TFHA 2FO1A 4QHLB 1OD7A 4X5XB 4MNHB 5DEZA 1IAOA 5F1KC 1X5KA 2Z8WC 3CFJA 3IJYA 4OM0H 4EJ1C 2JB6B 4OZIA 5HYJA 2WBJA 3CFKA 3HE6C 2Q8BL 4M7KL 3HMWL 1JZ8A 3MGTA 2P7TA 2XFXB 2FX7H 3PF2A 2IPTL 3K4DA 4XWOC 4NQDE 1KIQA 3V4UL 1SJHB 5DGRA 3L3JA 5E8DL 3B9KB 1RUKH 2BSTB 5EU6D 3EBAA 1JF5A 1SYVA 3J7HA 4QRQA 3V6BR 5IEKB 2C7UA 4J3WA 4OF0A 5C0AA 2OI9B 4FG6D 2VE6A 5AAWA 4HQQH 4KK5C 4Y19B 1H9VA 1ZT4A 1T1ZA 3KYNA 5BV7B 2D3VA 2R0WH 3NABH 2AEPL 1A1MA 2NYYD 2YRLA 4LHUD 1KPUB 1I9JH 1C5DB 2RCSH 4GW1B 4LLUB 2R15A 3I3DA 5GGRY 5EU4A 2JCCE 4CAGA 2FH6A 1MUJB 3ZT6A 3AUVA 2BCKB 1LK3H 1RURH 3I6LD 1LO2L 4OD3H 4LFHG 1T22A 3JTTB 3ALPA 3EAKA 1BBDL 3O11A 4NRZA 1INDL 3C5SB 3OKNB 4XX1E 5MP6H 3ZKMC 1A3RL 1MEXH 2ESVD 1BJMA 4JDVB 3JTSB 5D2NA 3ARBB 2D7TH 1QFUL 1MJ8L 3BT2H 3W0WA 1AD9B 1PEWA 1I1AB 1CDBA 4P3DA 4RDQF 4MAYB 2NZ9D 4YHML 5J13C 3DURB 4OV5B 2Q87A 4LCCC 1CXLA 2IALB 3WS6A 4WRLA 1L9NA 3EKCA 1JN6B 1Z5LA 3C09B 1UVQB 3N1FC 1NGXB 4UB0H 5EDXA 5IF0A 1EGJL 4GBXC 1S7RB 1N59B 3DMMC 5F6IC 4HWBL 4HKJB 1GCFA 5HJ3B 1PKQE 3BPLC 1N64H 3RWJB 3ARRA 3S3PA 2VTFA 3RX7A 1A9BB 3K8MA 1XGPA 1I1YB 3X3GH 4MQTB 5L7XH 4JR9L 3H3BC 4K3GA 2AQ1A 4RX4A 2F19L 3TT3L 4K7PY 4DN3H 1QSEA 2DD8H 5CBAB 1VACB 5EN2B 3ZYIA 3LKNB 5E8NA 4HCRH 4E5XB 4Y1AE 4YPJA 3OXSA 1U58A 5DYOB 1AGBA 4HUXA 3CFIC 3MV7B 1K85A 4XNXH 32C2B 4WV1A 4HIIB 3CFEA 5LCVH 2Q7NA 2E9BA 3VJ6A 5F6HI 1GGCH 1J12A 3U1SH 4F7TB 3BZFB 3MA7B 2EYRB 5EA0L 4QRRD 5JORB 5KG9B 4LRIC 1FIEA 3H42L 1CR9L 2P5WA 3TP4A 4Z7UF 2VNCA 5F7UA 1BQHG 4PLNC 1H5BA 1E6JL 2VDML 4XCNA 5SWZA 4DQOH 2X4NB 1MFCH 4ZO8A 2XN9D 4DTGL 3LN5B 1L0XA 4PV8B 1GJIA 1IEHA 1CT8B 5MI0C 4JO2L 2IQ9L 1LNUB 4XP5L 2YC1B 5DSCA 3G6AA 4OGZA 3AC0A 3IU4H 1F11A 4MQXD 1UJ3C 2Q20A 3Q1SL 3E6HB 1LD9A 5CILL 5F71A 4QTHB 3KLHC 1CXHA 4R97C 4L4VD 3VXUD 2W0PA 1JWUA 3NZ8A 1CDGA 1F6LL 4KTDH 1B6DA 4P5KB 4AT6A 3LEXA 2DMBA 3WEXA 3KPOB 4OCWL 4PJGF 1EEUA 4APQD 1AXTL 1I3RB 1T2XA 4M4RA 3VG0H 1OAQH 3IKCA 4LF3B 3HI6H 4IRZH 4QNPE 5KJRH 5E08H 3V0VB 1H8OA 12E8H 3RQ3A 3H0TA 1SMAA 3FQUA 1TTFA 3DROB 2DQEH 4TNVF 1HSAA 5DMIL 3SCMC 4Y4FA 2V5YA 4WDIA 3TH4T 2Z93A 1ZVHA 2D4DA 5BOZG 1DBKH 3MO1A 5EU6A 4R4BA 4W6YB 4UU9B 3D3VA 5F1SA 4XPTH 3DYMA 3WKMH 3MUJA 4M7ZC 3K4ZA 5FKPA 4JN1H 1CDUA 1RK1A 3CFJB 3IJYB 4OZIB 4JPKL 5HYJB 2WBJB 1MCOL 3VXTA 3CFKB 3O2WH 1DBBL 1N0XH 3OXRB 3QG6B 3WO3B 3OKYA 4XPFH 3V8CA 3Q6FB 4LHUA 3KVQA 2VERN 3ILQD 3UTPE 3TT1L 1QHOA 1U8OB 1RZJL 4W68A 4WFGE 1QNZH 5CINL 1KIQB 4PREA 1CTOA 4RAVA 3SGKA 2YSSA 2X70B 5AWNH 1SBSH 1FYHB 2I9TA 1CICD 4IRSB 1YA5A 1SYVB 3OR7A 4QRQB 2IH1A 3P0YH 1RZKL 1XCQA 2BERA 1MNUH 4P9HL 2HRPL 5C92A 1R3IL 5JW3H 5CJXC 5AZ2H 1Q1JH 4ZYKA 2EE9A 1Z9MA 1ZT4B 1CGSL 1T1ZB 3KYNB 3B5GA 5L8KB 4OLWH 1KCRH 3D2UA 1X5GA 4YX2H 2UUDH 4Q9BA 4Y5YC 1XF4B 4XNYH 3WFBH 2P1YA 3GO1H 4XT1C 2N7AA 4JPIB 4M5ZH 1X4XA 1QRKA 2PCPA 1F58L 1LEKA 4B53A 5EU4B 3MRBA 3EJZD 1JVKA 4O51B 4MB4A 4UUJB 3CUPA 5DD5L 4PB0L 2PXYA 5AAMA 5H2BB 2D2OA 2VZ1A 5E4IA 5D1XB 2ZUVA 3DETD 3JV5A 4NC0B 1T22B 4WGWB 1H15A 5BRZE 1NAKH 1RMFH 3RY6A 5D2NB 4BFGA 3GJFK 4PY8I 3F12A 5HGAA 1FZOA 4DN4L 4TNWF 1KELH 3OZ9H 1E4JA 4P3DB 3PNWB 1JZ6A 1AKJD 2W92A 1IC4L 5GS2D 1HHGA 3MX0A 1OP5H 4YXHL 3W2DL 3H3PH 1G7QB 4L3CA 3REVB 4GKOA 5EUKA 3WNPA 4O00A 4EXKA 3FFCE 4YBQD 1L7TH 1Z5LB 3CVHL 1BD2E 2VQ1A 1S7XA 1NSNH 7FABH 3BAEH 2UZIL 4QRTA 3VFGH 3FT3A 5LXGL 3EYVB 2YD7A 3EZ8A 4F3FA 2X7LB 1F4XL 1RJLA 2OZ4A 5E56A 3QISA 3LDBC 3WCYA 5IFAH 3KPSE 4YUEL 4LCIL 3TFKC 4U1KA 1QP1A 2DQDL 2N7BA 4YHOL 1QA9A 4KQ3H 1QSEB 2XNAA 5E8NB 3E6FA 3QQ3A 1HINH 5CEZE 3TZVA 1U58B 5IJVA 1MFBH 4GG6A 1AGBB 4DUXA 4HUXB 3EO1B 1Q0XL 4CVUA 4WV1B 2WBKA 4YGVA 3IXAB 3VJ6B 2GK2A 3IS1X 5GRVK 3F5WA 4XCCH 1WWBX 5BXFB 2VLMD 3VXUA 1S7SB 3FQNA 5CD5C 5KVEL 5FUCC 3S4SG 2P5WB 4UOW1 1H5BB 4XCNB 4QOKD 4APQA 4ZUSA 4MB3A 3GSQA 3QRGL 5GQBA 3MV01 1ZXQA 5JO5B 2J4WH 1G9MC 2OS7A 4OFVA 1X7QA 3N9GH 2VWEC 3VG9C 3GJEA 2WAHA 5DSCB 5C0EB 4P23A 2ERJC 5IB3A 4P5TB 3NN8B 1F11B 3ZT7A 3NA9L 3S35L 3V4PH 2XG5A 4GG8A 1R3HA 5EOCH 3GGWA 4L9DA 1HHIA 1EAPA 1NMAL 2HFGH 4XPGH 3I6KA 2Y06H 1N8ZA 2IANB 1ZA3A 4ETQB 3NZ8B 1JWUB 5DJCA 4AT6B 4MHHI 4M61B 3WEXB 4XP9L 1EFQA 4GQ9L 1CFQA 1TPXC 5DURD 5HGGS 2YKLL 4P2QD 3WO4C 3MJ8B 3PE9A 1FNHA 4L3ED 1CGYA 4QF1A 3ALWA 3IKCB 4PJHF 1ZA6A 2XRAL 4OGXH 4XGZB 4XCYA 5EFIB 4OD1L 3BKML 4O9HL 1HSAB 3QJHA 3NACL 3WIFA 4Z7WF 4LSQL 2VDKH 2Z93B 3RVVC 3LRGA 1UFUA 5EU6B 1T1WB 3SQOL 3ZTNH 3D3VB 5EUOE 2XZCH 2BFVL 3E0GA 5DI8B 4Z7VA 5FKPB 1R5VA 4KTEH 1RZFL 1C5BL 1YQVL 1S3KH 4U6VL 1EGJA 2VXSL 4G8IB 1EEZA 3BFOA 5GRZA 5TFSH 4HWBA 5DJ2A 1YJDH 2ZSVA 2R2BA 3VXTB 4OCSL 5TE7H 4JQVA 4X80L 4LHUB 4M7JH 1UM6L 1A3LL 1TJIL 1A6WH 4P59H 3WD5H 4ZDHB 3ZE2F 5D7JC 2D7OA 5B38A 4NCC1 1DVFC 4B7IA 2WQ8A 4P2RD 1PG7W 2ZUXA 3MRIA 1FE8H 1VPOH 3A6BH 3WFHB 2QQKL 3RTQD 2KDGA 1CIUA 3KYAA 2IH1B 5HDOA 5HTSA 5KVFH 4BSWA 1XCQB 1ZK9A 3IF1A 4OUUA 3AAZA 3SJVA 1HCFX 4YXLH 5KW9L 1N4XL 4HJ0C 4KPHL 1QBBA 2LVCA 4N9GA 1T5XB 3FONA 2ESVB 2H41A 5CSZA 3CMOH 4WUKH 2XA8H 1TZGH 1HI6A 3ZMRA 2XY1A 4X4MA 1CIDA 4Q74A 3LB6C 4R7NA 1I1CA 1S7VA 5FHAH 4DW2L 1HILA 3MRBB 5HGDA 1JF1A 5ANMB 3HA0A 1J7VR 5M95B 1RV6X 1A7QL 3CMGA 3CUPB 3R1GH 3DXAE 1CZ8H 4YK4B 2BVTA 4U6HA 3RX5A 4YPGA 4EDXA 5J9PA 3BI9X 4GH7B 3MV11 3DX8A 3MJGX 3BPNC 1JWMB 3V5DA 4ZODA 1H15B 2IFGA 2P42B 3H3KA 2DJ4A 4ZD3H 3OX8B 3K46A 4X83A 8FABB 1Q9OB 4YFLF 3F12B 5HGAB 1FZOB 5F88B 1T2JA 1JF6A 1ERNA 3OV6A 3ROLA 4G80A 4JVPA 3TPKA 3VFNA 1KB9J 1CDIA 3FB6A 1T7WA 4BJLA 1SJXA 4GKSA 1B0RA 2EXYC 3BD4A 4L3CB 4LVHC 3X12B 5CCKL 1ZS8A 3U2SB 4V1DA 1NCUA 5JA8B 4DK6A 3GBNH 3U7YL 2OK0L 2D7PA 3O4LE 5D71H 5TDPA 4XNQA 1L0QA 1JNNH 5E2UH 1OB1A 1JNLL 3HS0A 3BRGC 4XCFH 5IROC 3CLFH 3LIZH 1QLRA 5AD0B 4F3FB 5I73C 1INEL 1XR8A 3M1BB 1RJLB 3ES6B 4NO5A 5D5MA 2CIKB 5FUCE 4KTYA 4OZFG 5KVMC 3DECA 4PJ7E 4NO2A 3HUJA 1E27A 1QA9B 1CL7L 3ULVL 2YPLD 4M1GH 1OCWH 2YN5A 3E6FB 3QQ3B 4GAYA 2VWEE 1HOCA 2Y5EA 3I2CH 4GG6B 2KH2B 1F3RB 5CKGA 4ZUUB 1WFTA 4UILH 3EO9H 2EDFA 1KB9K 4MNGA 4JVUA 2VO5A 4YGVB 1VA9A 3HNTL 1CLOL 1XF2B 3L6FB 5IM7A 3PDOA 3F5WB 4L4VB 5A3IC 4WUUE 3RWCB 5E8PA 1HK6A 3VXUB 1FNGA 3VFSB 4L8BB 4WHTB 4XP1L 3D6GA 3SKUD 4K07A 4Y16C 4APQB 1ADQL 3GSQB 3GSVA 5H35A 4L3EA 4P57A 1GYAA 1F6AA 5C0FA 3QIBD 5HI5D 3KPQA 4ELKB 4QHKI 4ZO7A 4JFDD 2YOCA 3GJEB 4ZXBD 1A7OL 4CJ0A 4OZ4B 2B1AL 5IB3B 2PUQT 3G5XA 4P99A 3S37L 3T04D 3RU8L 4GG8B 3GGWB 2FBJH 4HUWA 5C0CD 2W9DL 3RX8A 3IAPA 5TDNA 3I6KB 4JZJB 1BLNA 4P4KD 3B9KC 1ZA3B 1IC7H 1R0AH 5DRWA 2FWOB 5DJCB 4X6DA 4OBRA 1KNOA 3VRJA 5C9JB 1ZWIA 1CFQB 3KAAA 3MRRA 4OQ1A 5JTWA 1AGDA 3I9GH 4NFDA 4UT7L 4QXTA 1NFDF 4QF1B 5HHXL 4F7CB 3MV9A 2GTWA 4ZQKA 1ZA6B 5FF6B 3C08H 2MOVA 3QP3A 2XKNA 3RA7H 3C9NA 2ICWI 3BKCH 3P30H 3MNVA 3WIFB 5GGVY 4D3CH 2GHWB 4H25A 4J3OC 3WJJC 2VLKD 4P2RA 3E1F1 4D0BA 4Z7QF 1LDPH 3P0VL 3GIZL 4FFZH 3ARVA 5C0DA 1UEYA 2IMMA 3CVHA 3VFPA 4BQ9A 2DIJA 1QG3A 1R5VB 4YJZL 2AI0H 3V95A 4KZDH 4U1MB 3MNWA 1BPVA 5KAQF 2JK5A 3IDGA 3STZA 2ZSVB 4OLUH 2PO6D 3BKJL 4ZUVA 3Q6GH 3LS4H 3OJ2C 2J88H 2DYPD 2BHUA 1BQHA 4G8FA 3C5ZD 2VL4A 2R56H 3GKWL 3ARBC 2BDNH 4D9QD 4KJPC 1A6TB 1UYWL 2ICWB 3AS3A 5E2VL 4MAYC 5HGBB 4XB8A 3MRIB 5E1AB 3T2NL 2IADA 1UWXK 2F54A 4JM2A 4GAGH 1RHHB 1J86A 3BP7A 4BSWB 3IF1B 4HWUA 4LCWE 4XPHL 5HHOA 3RKDC 1MFEL 4OUUB 3AAZB 2Y36H 3V5HB 3SE4A 4RMRA 3IDIB 2CR3A 3QHZL 4PRHE 4MJ5A 4RFOH 1MIMH 3RDTA 3N1QC 1OF2A 4WW2F 5IKCB 5DUPL 4N9GB 3FONB 1UB6A 5ITFB 4ERSH 3WSQL 2BSED 4I18A 5J11C 4W6WB 1F3JA 3CSYA 4ONFL 3FQRA 1GOGA 1HI6B 2VYRE 3UP1A 4BKLA 1AKJB 4UIMA 2F9BT 3ULVD 5MERA 1Y0LA 4ALAH 1S7VB 4IMLB 1HILB 4KJQC 2DM4A 3KPRE 5HGDB 2NX5A 3LKRB 5DHXB 1RIHH 3WN5C 2EDWA 3MBEC 4U6HB 5D7LD 4YPGB 4EDXB 3NCMA 5J9PB 2CO6B 2YA0A 4F7MB 1OAKH 3OBAA 1IRAY 1TXKA 3VFUA 1JRHL 1YJDC 4NC1E 1YYLH 4PG2A 1EMTH 3SKNA 1JP5A 1FVDA 5CWSB 4HLZG 1QBLL 3MLXL 4G80B 5C07E 1ZAGA 4NP4H 2DKUA 4GKSB 3S3SA 1OP3K 5JQ6H 3CIQA 3PP4H 1ZS8B 1CFBA 5SX5H 2C26A 5H8DA 2HTKC 1KULA 5J4MA 2FSEA 1J1PL 4LQFL 1I9IL 1KFAL 3ARTA 5FYJD 1SY6H 3P73A 2Z35B 4H26B 1CLZL 4WWKA 4XNQB 4MCZB 1OB1B 3VFOB 3HC4L 4ZSOB 1FNFA 1M1SA 4D9LH 5D5MB 4P3CL 1IAIM 3FB5A 3KJ6L 3SKJL 4TOYH 4NO2B 2YK1L 4M1DH 5EU5B 4TRPH 2XTLA 5FYKH 1E27B 4QOKB 1BF2A 1N5YL 4DGIH 1J10A 3UTTE 4F8TA 3OKLA 3FOMB 1JZ7A 2LU4A 1MCJA 4GAYB 1D6VL 4R4FL 4R0LB 5MENE 5HHMD 5FGCE 5GZOD 4G9FD 4JFDA 3MLZL 1GGIH 4H0GA 5DMYA 3VU2A 1AH1A 4Q9CA 3V6FA 3VXOA 3DV4A 4HKXA 4I9WD 1VGKB 2XKUA 3PUCA 2CK2A 5C0CA 3JV6A 2PYED 3PP3H 4X9IA 4CDGC 3PDOB 3S6CA 1AJ7L 5F1IB 2E9JA 2UZXB 4JO1H 1QLFA 3RVUD 5DURB 5IW3A 4P2QB 2VZ3A 3GSVB 4L3EB 4P57B 3NZHL 5C0FB 2DIBA 1JHTA 4GRWH 1GGYA 2XYCA 3TNNA 4HD9A 2WBJC 4J3SA 2HJKA 3BDBA 4M5YH 2AJZA 2WUCL 4NUJA 3DRTA 2NR6D 2BNQD 1PY9A 1T7ZA 2AAVA 1GXEA 4HUWB 4GLRI 2XWBB 3CFDA 5L2KE 3QPXH 4WWID 3IDUA 5DRWB 5I76A 4X6DB 1RD6A 4H8WC 3HCVB 1UKSA 1OAZH 5AYUL 1QYGH 1YPZE 5JHLL 1ZWIB 1NBYA 4NT6A 1P4LA 3S96A 2D7NA 3MC0A 4QXTB 2JELH 3VE0A 1P4BL 3V4VH 3MV9B 4GRWF 3OPZH 3C6LA 4LP5A 4NZTL 4LU5H 3DYPA 4HIJA 1CFTA 2YMXL 1A2YB 3C9NB 4MA7L 5C0BD 3C5ZA 2C3VA 3ULUL 4HW6A 3MNVB 4S2SA 4H25B 3QXTA 3FMGL 1IKNA 2QEJA 4Z7WE 3WJLA 4P2RB 4D0BB 3L95A 3QH3A 2DQGH 3T0WA 4G6AC 5ICZA 3HG1E 2HT4C 4Z95H 3RBGA 3LD8C 4M7KH 2DWEA 3HMWH 3CVHB 1BM3H 3VFPB 3KLAB 4LVNB 1DUZB 4HGMA 4YWGL 2OP4L 2FHFA 3G6JF 2VIRA 4MA8L 2JK5B 3IDGB 4ELMF 2DLGA 3V4UH 3AS0A 3STZB 1WQVT 1IBGL 2A74A 2R2HA 3U82B 1J0KA 3S4SA 3VFWA 4NIKB 4H5SA 1BQHB 3WFCL 4G8FB 5D2NC 4HH8A 5IVZB 2BRRH 1OARL 4HX1A 4CADA 4NQTA 2Y6SC 2NY7L 1UEMA 3NMEA 5ISZD 5F9JA 1U8LA 1HE7A 3CX5J 1QFWI 3BUYA 4Y4KC 1ETZA 4RA3A 3MV8D 1BP3B 3BP7B 3CC5B 2VXVH 2ADJA 5D7LA 2CO7B 5GSVA 2D0GA 1QR1A 1CLYL 2R0LL 1MY7A 4JJHA 5D8JH 1GAFL 1OF2B 2VDQH 3QCUL 1OPGH 1UACH 4HZLA 1F3JB 3MJ9H 3B9AA 3X14B 3V7AE 4BKLB 2EIZB 4UQ3B 4UIMB 2COQA 4ZOAA 5CZXD 1ADQA 1G0XA 1BBDH 1INDH 3TA3D 4DFIA 2NX5B 5DMKB 1VFBB 1FGVL 3BWAA 1A3RH 2Y72A 4R9HA 3RL2A 3C6SA 4JFXA 5T5NF 5EU7C 2X4PA 5C7XH 1QFUH 1YEFL 4JB9L 1KTLA 2R2CA 5HI4C 3LSOA 3HLAA 2I25N 3CX5K 3HB3D 3MRFA 3ECBA 4XX1G 4AEHH 5KSBB 5L88L 4MZ3A 4NPYA 3LQZA 3MJ7A 3QDHA 4WV1C 1FV1A 5IBTL 4IBLT 4YHMH 4NO0A 4FQQB 3VFUB 4NGHH 3PWNA 3VGAC 5E9DE 4FABH 2WM0A 2AXHA 1IEBA 5HHNB 1FO0L 1EGJH 1NCBL 4HWBH 4FP8L 1H5BC 3KDMA 3MOAH 4P9MH 1T0NA 2E7BA 5C08A 4P49A 2YPLB 1EIBA 4PJCF 1WVZA 5HPOA 2CUMA 4OLEA 4JZNA 2FSEB 4G9FA 5E0QA 1G84A 1PSKL 2L0DA 4JR9H 1URLA 2GY7B 3RWIA 1U2CA 4WWKB 2VR5A 2QADC 2VDPL 3SDXF 1I9EA 5L0QC 4RGNC 5ADOL 1QSFD 1KIPA 2PYEA 4GJTB 3REWB 3TWCL 3SDAD 5DR5H 3DUUB 3TBYA 1K8IA 4UQ2A 4IDJH 4PTTA 1I7RB 3TPUA 5C3LD 1KCUL 1UWEL 3QDJD 4M7LL 5C0RH 4KY1H 4MXWL 4EKXA 3V6ZB 2BNRE 2GJJA 2JIXD 3QIBB 2W9LA 5EA0H 4ZXBB 4JFDB 3H7BB 2G75A 1G7MA 3H42H 3V6FB 3VXOB 2BNQA 5SWSE 4JY4A 4KKNA 3DV4B 4MMZC 3CCHA 1E6JH 4HKXB 4XVTL 2DQFA 1H3WM 4Y4FC 1G7PA 4BH8A 4ONHA 4DTGH 5C0CB 1YY9D 4P4KB 3D25B 3W5NA 4OT1L 2DBJA 1QLFB 1R6VA 5C0AE 1AQDB 2P44B 4TUOA 3Q1SH 2VISB 4R96A 4U1HA 4WEUD 1UM4L 4V2CB 3N1GC 4FG6C 6FABL 5KOMC 1WZ1L 1JHTB 2JF1A 1IZJA 1KT2A 3TNNB 1GL4B 4DFHA 4LSRH 1CXEA 4TTDD 4C54A 1R5WB 3RHWK 4PJXF 4HS6B 5C0BA 1DBAH 1KN2L 2HVKB 4OCWH 4IJ3C 3V9FA 1PQZA 5E8EB 4ZFFA 4OAWB 3GMQA 4EIGB 2VLKB 2QQLL 3SGKC 4X6CF 5IB5A 2YA1A 3FB8A 1OTUC 2XKSA 3DRQA 1JGLH 5IUSA 1GHFL 1NBYB 5I6XB 3C8HA 4NT6B 1P4LB 3UBXG 5LGHL 3VE0B 1GGBH 1S9VA 3LRHA 3TIEA 4HBCH 1NFDE 4KROB 1S7TB 2ICEA 3QUKA 4OZFA 2PO6B 1WIUA 4L1HA 4NKMA 5FDYA 4MDJA 1CFTB 2DYPB 3THMH 4DKFH 3C5ZB 4KGJA 3W0WE 4X7EC 2C3VB 2C9AA 2P4AB 3SGDI 1X5AA 5IVXF 2CJUH 5GPRA 4K55A 1FQ9C 2FH8A 1A4JA 4HZAA 3RPIA 5GS0H 1R24A 4U7KA 4JPKH 3QH3B 3OKDA 1DBBH 5ICZB 3GSOB 2F74B 1CG9B 1FP5A 3MV8A 2DWEB 2DM3A 2IWGA 1MRFL 1AGFA 1EZVX 2EC9T 2PXYC 3TT1H 1SMOA 1DEDA 1RZJH 2EH7L 3T0ED 3S8WA 2DM7A 4HS3B 2R2HB 1EHAA 5F8QC 5L9DL 3S4SB 3O45A 4XPAH 5EO1A 1G7JA 5IEHA 4H5SB 4EI5D 4BM7A 3RY6C 1FBIL 1J05B 1BBJA 4PLJD 1U41A 2OX5A 4CADB 3OTTA 4XC1L 2HRPH 3EFDH 5F9JB 4OI8A 4TVPL 1U8LB 4N0UB 3OF6A 2RR3A 3BUYB 4AEIL 3TA3A 4OZGF 1EV2E 4FNLL 5EU7E 1ZHBB 1WCQA 2DLFL 4NRXB 2VDNL 5D7LB 3PWPD 4KKCC 4ZO6A 4IS6A 3TF7C 4Z77A 1F58H 2CRMA 1BIIA 4GO6B 2ZUQB 1P1ZA 2V2WA 4JFFD 3ZKXB 3PXJA 4GKNB 4OI9A 1EHNA 4HZLB 5DD5H 5ALCL 1C08B 4PB0H 4DAGH 5HYQA 3BD3A 2NY0D 1RZGB 3BMVA 3BP5B 5DJYA 4TUKH 1I3GH 1IGYB 5SWZE 1XCTA 1C1EL 1JGDB 3DJ9A 1G7IA 5F44A 5C6TL 5D6DA 3BWAB 3QCVL 2P24A 4HAFA 3NGBC 3C6SB 4JFXB 1CXFA 5CBEA 4NKOA 1HHJA 1J9CT 3TZVC 2HMIC 1LEGB 3MRFB 3ECBB 5JLZA 1IC4H 3MJ7B 3LQZB 4RGNE 1D9KC 3CDFA 4YXHH 1QFHA 3TVMA 3KYKL 1FV1B 1BX2A 4NO0B 1IEAA 5FM5M 2AEWA 3NIFE 3D39E 3SDAA 1D5ZA 3P9LA