2VB5A

Solution structure of w60g mutant of human beta2-microglobulin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-2-MICROGLOBULIN
publication title The Controlling Roles of Trp60 and Trp95 in Beta2-Microglobulin Function, Folding and Amyloid Aggregation Properties.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vb5A00
4FQHA 4ZXBB 2W91A 5A1AA 3DHJA 4QY8A 3JWNC 3OJDA 2GJ6A 2R4SL 4TQEL 4W81A 3UTSE 5KVEL 4OJFH 1G6VK 5I66A 1CD1B 4LSUH 1YPZF 3EJYD 4DGYH 3P9MA 4G8IA 4X4XB 3FRPG 2XQBL 1TZGL 3P9WB 4OCSH 1GC1L 3QISA 3E6HB 4OZIE 3LHPL 4PJDE 4OI7A 1T7ZA 5JOFA 3UZEA 3HR5B 5F44A 2H8PA 3T2NH 4XBEH 3VDAA 1F4YL 1FZOA 2P5EE 3B2VH 3QEUB 5FYLE 1P4BL 5JNYA 2WUCL 1RIUL 2MQ0A 5T3XD 1MFEL 4JG0H 4M7KH 4RX4A 2OCFD 2XY2A 4K8RL 1G0DA 1CDUA 1FGNL 3EOBA 3VI4F 4HIJA 3WKNA 1NAKL 4LLYA 3QQNA 3FB5B 4HT1L 5AEAA 4ZFZA 1LO2H 2UV3A 3NCCB 4PREB 1NBYA 2YPVL 3ZT7A 2IPUK 4I3RL 4ZOBA 3EZ8A 4LAQH 5EOTB 4HUUA 4AG4H 4IMKA 4DN4H 1CU4L 2P42B 4QRTB 3QDMD 5EIQA 2BSRA 4F9LC 1IGTA 3MRJA 4DVBB 3SDCB 3RVUC 4JFHE 3MV9B 2XTJC 3P11H 5L7XH 1DBKH 2BERA 3QCVL 2CDGA 4KDTC 3T3ME 4KKAD 5EU3A 4JO4H 4UQ2B 4X5LA 1TQCC 3H7BA 4NN6B 1MREH 1CL7I 1BM3L 3F5WB 5IVXF 2EDJA 3P0VH 4MDIA 5TE6L 5EU5B 2CUMA 5DI8A 2APFA 2UWEA 1HYSC 5C0CB 2C5DC 1SMOA 3GZKA 5I1HH 4N8VG 1BZ9B 5I8OH 4K7PY 1GZPB 5EU7E 2WBWB 4U1GC 4J3UA 4O4YL 2C4XA 2FYYA 3K1DA 4W6XB 2OTPA 2AERT 5H35A 3TT1H 4APQB 1KPRB 1MFNA 4KK9C 2VWEC 5KVFL 1CDJA 2AEIT 2Q7YA 4MD4A 3WMSA 3MRRB 1HXYB 5ITFA 3UPRB 2ZUUA 4NQDD 1KJ2L 4X8XA 3W9DB 4ZUUB 3OGCB 4ZXBC 3H7LA 3T77A 2EXYD 5HI3C 1RIHH 4MXWL 1MCJA 2AKRA 1QA9A 1CGSH 2QSQA 5F3BA 3QQ4B 3CSPA 5T3ZL 2CQVA 3VFTA 1DQJB 1TVHB 4U0RB 3U0PA 3CJJA 3K8KA 1MNUH 3CXDH 5DUML 3T4YA 5J8OA 5DFTA 5CBAB 3NACH 3MRIB 2C7UB 3UP1A 5DC4B 1QBMH 1S9KC 1YEFL 4JFXA 2ICWJ 3HUJF 5TQ2L 5IEKB 1WCBA 1WBYB 3MV7E 2APTA 3IDGA 3N85L 4QRSB 5HVHB 1OTUD 1NCCH 2B2XH 2WBJB 4HMCA 5F1NA 1DBML 5ANMA 3O45A 2EDRA 1G9NH 2JJWA 3QEHA 4JDTL 3C5SB 3BZ4B 1YMHA 4WV1A 1UB5A 1FCGA 5CFHA 2P5WA 4K7PX 1OGTA 2JIXA 2YUWA 4LOUC 4H1LB 3VXNA 4X7SH 2H1PH 5KSAD 3AGVA 3I02B 5DK0A 4TULL 4E0RA 4MJ6A 4U1MA 4FQCH 2XNAA 3EYVA 4GMSL 4CDGC 2WIIB 4UDUA 5I0ZA 4BH8B 1D6VH 4PLJC 4QNPE 3AY4C 4BQCA 3SDCC 1NANH 2NX5E 4CAGA 3MXVH 3UO1L 1X6LA 4QXUL 3PQYE 4NN6C 1MCPL 4LLDB 5EO9B 2VUOA 4KDVA 5DF0A 1A5FH 3FCTA 5HGHA 5I18L 1OSZA 3FOMB 3JXAA 4OV5B 1DVFD 2L4OA 4NC2B 5SWZB 4LSTH 1R24B 1WTLA 1QLRB 2DQFA 2GT9B 3MBEB 5IMMA 2NW2B 3KLHC 1DUYA 5KSUB 1IL1A 3HMXH 4H5SB 1TITA 2D7QA 3QXDA 5CEZH 3JZ7A 2VR5A 4XNYH 3RZCC 1AD0A 3FQTA 4APQC 1AXIB 3CZFA 1A2YB 2HT2D 1PX3A 4BQ8A 2VZSA 4ZTOL 4E41E 2A73B 4MQSB 1X5LA 1ACYH 3EKCA 1WC7B 1GC1C 3RVXD 2IPUG 1CD9B 3MUZ1 4X5XB 3Q3GA 4MMZC 1P4IL 2EEAA 2NY3B 4U0RC 5D7LD 2NY2C 2DIAA 3WIFA 1A0QH 2R1XB 1AJ7H 2ZNWA 3HAEG 1ZT4A 4UB0L 5TE7H 5E2UH 1NC4A 2VLLA 4P2QE 3IKCA 3SO5A 2VRAA 3RL1A 3SDDA 3OAYH 4NFDA 2YC1B 1NAMH 1WZLA 4DVRH 1U9KA 4ZPTB 4M43L 3S5LA 4QTHA 2XZCL 3GSRA 3MJ9H 3G6DH 3HMWH 5HVHC 2WBJC 4ZDHA 2ATPA 3ZO0A 4GT7A 1EX0A 1KB5L 1T0MA 4NQCE 1VFMA 2O5XH 2BC4A 4GAGH 2E9WA 3EYSL 1UEYA 3M07A 1DVFA 4F3FA 2NLJB 4CJ0A 32C2A 2Y36H 5D1QD 5F3HB 1FQ9C 3F6IA 2HJKA 3R1GH 4NWTL 3QDJE 4ZUWA 1LHZA 1X7QB 4GLRI 3LQZB 1I7RA 1QEWB 4WFGD 2IC2A 2Z8RA 5INDA 3LD8B 4GKOA 1DANT 4QRUA 1YMMD 1A3LH 3QR2A 2YD4A 1G7IA 4UT9L 5I1LB 1XH3B 3MV01 4EVNA 2R29L 4C83A 3BSZH 4ALAH 1T5XA 3ARPA 2LQRA 2ZCHL 4FQ2H 5GGVY 1YY9C 5D7LA 3LH2L 1A3QA 5J06A 3TV3L 4PB9H 2IBZY 4JQVA 3ZE0F 3MGOA 5FYKD 5A43C 3EGSA 4R90L 3BEVA 1AFVL 2Z8VC 3ARTA 1BQUA 3EO9H 3ARFD 4OKVB 3OKDA 3MBEC 3O3AB 1FRGL 1QSFB 1BFOB 3ARGB 4U6YB 3EOTH 4LVNB 4PS4L 5KZCB 4M5YH 4MHHG 3V6OA 4C4KO 1G6RH 5DJDA 2H2SD 2AK1L 3MO1A 3WHXB 1NGPH 4I5BB 3WJLC 1M7IA 3MV8E 3LRHA 4ZFFA 3D3VE 2EH8L 1PKOA 2NTFB 3TA3D 1DBBL 1EFXB 1YNTB 2FEDC 25C8H 3I6LE 4ISVA 4U6HB 1G9EA 2XIDA 4HZAA 1OCWL 2IPKA 1AIFA 3W9EA 4HDIB 3VXSE 2Z35B 4ZOAA 1U6AH 2NY3C 4KZEH 4N0CD 2D0GA 5LGHL 4LCIH 1QYGL 1P53A 5HYEA 4I2XB 3S7GA 1XCQB 4GRLB 1FFPA 5C9JA 3OV6A 1KB5B 2D7TH 1IM3B 4X6CE 4HS3A 4KUZL 1OHQA 2EC9U 2HT4D 1NSNH 1TJIL 2OJZH 3SKJL 3VE0A 3L95B 3K7UA 3KYNA 4ZO6A 2O5ZH 4Q97A 3N1GC 5C08A 2R2CA 2IBZX 3K1KC 3O8XB 4MNGA 2Q76A 5J1TC 2AABL 4L8BB 4LQ1A 4U6VL 5JIIA 1CFVL 2APXA 2AP2A 4QYOB 3NCYP 4G8GB 4LPXA 3I50L 2B8OT 3BPNB 2ZG2A 1AO7B 4L8CA 1FH5H 5DVMA 15C8H 4HK0A 1ZLWK 4YHPA 1E6OL 4NKIH 3F65A 5IVZB 4PYHA 4YXHH 3PL6D 5IB5A 4UT7H 1JPSL 4G5ZH 1X3DA 1YYLL 5TDPB 2L0DA 4GAJH 3VWKD 3LD8C 3C8HA 4F58H 2P43B 3LZFL 1G1CA 2ZUVA 4U1IB 2B1AL 1MWAL 4BSVB 1ODAA 2IANB 2OTWA 4B50A 2H2PD 3UTQA 4X5WA 4KK5D 4WI2A 3BP7A 3QFJE 1AR1D 2DRUA 5EA0H 1GSMA 3DURA 1I1CA 4JN2B 4WTXA 1RUAH 1ZANL 3QG6B 5ITBL 2AJZA 2W0FA 1GGYA 1BD2D 3MLWL 5CUSH 3RWEB 3DRTA 3HG1A 1UWXH 2AW2A 3HC0B 3O6FD 1DTUA 1IGFL 4LBEB 5FV2A 3QHTC 5I8EA 3VRIB 3ARGC 4LVNC 1DQML 1FZMA 4MXVF 1ZLUH 3LB6C 4JE4B 3QXUA 4YHOH 4FP8H 1PFCA 1RK1A 2IWGA 1BF2A 1SEQL 1QFPA 4TNVF 3Q6FB 4M6NL 5CKGA 5DQJA 3TBTB 3U9PH 1W8NA 5E6ZA 1N7ML 2AXGA 4JPIB 1JV5B 3R8QA 2X4TB 4PJ7E 4S1DC 3QHZH 4YGVA 4NKOB 4BK4A 2FJGB 2E3VA 3BP5B 3CU7A 4J8RA 3DYOA 3WJJA 4XAWH 5EIIA 3SDXB 2MNUA 3PL6A 4RGOH 3QIWB 4P9MH 1DUZB 2N7AA 3QIBB 2DQJL 1PYWB 4GRLC 5KG9A 5DD0H 3KS0H 3VWKA 3FRPA 2IH1A 4Y5XA 4HIHA 4I4WA 3T0AA 3GNML 4XPGH 3MFFA 4YHZH 4OFVA 1DR9A 2VDRH 5I1GH 4JHAH 3D1MC 2MOVA 1JRHI 4JO1H 1OAUL 1KV3A 4K07A 3O8XC 5L6YL 1HWHB 5D6DC 1KN2L 4OLEA 3RJDA 4X7FC 4FQIL 3LS5L 1RZ7L 4R3SA 1S7WB 1MI5A 5GGTL 4TTGA 1RUML 1E4XL 3JUYA 2GK0B 5FHBL 1Y0LB 2AV7B 3BPNC 2EC8A 3UJIH 4OSUH 2OL3L 1WEJL 1FC2D 1N0LA 1UXWB 3CX5J 4JHWL 2MCPL 1VERA 1LK2A 2V17L 2HJFB 3NFNA 2F8XC 3RVTC 2AK4E 3BN9D 3P73A 4Z76B 1A7PL 2H9GA 1J18A 1YEIL 4HC1A 2FGWH 1U95B 2DKUA 3CDYA 3P4MA 4FABL 3RKPA 1Q1JH 1N4XH 5GRWA 1IM9A 1NFIA 2YUXA 4A6YL 4F7CB 2IBGA 1N5YH 4BZ2H 5I1EH 1MIEL 2A6KA 4TUJA 3PWNA 1DLHA 1NPUA 3C6LD 4ETQA 3BP4A 4MAYA 4IRJA 3CX5K 4QHNA 4Z8FL 2ITCA 2R4SH 3F7VA 5KVEH 2GTZB 1MUJA 1M05B 3X13A 4PJCA 4P3CL 3D25B 4NNXB 4N8VA 1S7SB 4Y1AE 2XQBH 3QUZB 1TZGH 1GC1H 4JRYB 3LHPH 3M1BA 3ULVL 4YHIB 5LXGH 3H9HA 2APBA 4PY8J 4G6AD 1F4YH 4OIBA 1P4BH 2WUCH 1MFEH 4LCUA 4NUJB 3F7YA 5T1KA 4K8RH 4EN3C 4C56E 1FGNH 4HFUL 1CFNA 1NAKH 2NY5H 4XMKL 4Y8AA 3QIWC 3A67L 5E94A 3KVQA 3QIBC 4KAQL 4NO2A 3WV0A 1SJXA 2PO6B 4TVPE 1CZ8L 5FEBA 4I3RH 1M7XA 1IAIM 2WV3A 2EH7L 1I7TB 3VFRA 1F4XH 4I9WD 3ZDXF 1CU4H 4JB9L 1QNZH 3C5ZA 1CT8B 1AR2A 2OL3B 1YNKL 1QSEB 2Z4QA 4M7LH 4YIQA 4H1LH 5D9SB 1OW0A 1K5NB 2C3VA 3NFSL 5B3JE 2V6HA 2BHZA 4Y2DD 3QCVH 2DM7A 2R39A 1K2DB 5IBTL 3ZTJG 5HYSB 1A6AB 1NBVL 4JY4B 4KRLB 1IAII 4C54A 3LCYA 2A6JA 4X9BA 1V05A 4X99B 1BM3H 4HKZA 4M1GL 3DX9A 5TE6H 3VA2C 3NA4A 1R3IH 1A64A 3BPOB 4MS8C 5JO5B 4ZPVA 4A6YB 2NY1B 4JJ5A 1IBGL 3CX2A 4NJAL 2EDLA 4L8SB 5ETUB 4GXUM 1CFSA 5C0AB 1PY4A 4N9OB 4X4MA 5I2IA 4FQ1L 3EW3B 2XFXB 3T65A 4NT6A 2EIZA 1J8HB 4HLJA 2F54E 2BFVL 5GS0L 1BFVL 5AUMA 2BNQA 4O4YH 1HIML 3VW3L 5DO2C 4X6DA 4PJBB 2A77L 2BVPB 2FCBA 3ARXA 3G5XB 3LKPB 4RFEA 4QT5A 5IP4A 4LK4A 5KVFH 1KJ2H 3C6SB 4OCWH 5E2TL 3CVIL 4KJQD 3PWPA 4NO0B 3M45A 4JCMA 3CU1A 4MXWH 3FFCB 3V95A 5T3ZH 1N8ZA 4F8TA 5EC1B 3U46A 2VXQL 3KPRE 3VGGA 4J4PC 5ENWB 4BH7A 5DUMH 1KG0A 1ZHLB 2DL2A 3QUZC 1NKRA 1NLDL 2AQ3A 1RHHA 2D7OA 2H41A 1RUQL 2FHCA 3HB3C 1TXKA 2XZZA 3RWIA 1PZ5A 1YEFH 2CDEA 5F88A 4UNVA 5TQ2H 4HIIB 5DK3A 1I1FB 4Y2DA 4DGIL 4DKFH 5FB8B 2R2EA 5L9DL 3S8WA 1UH3A 1R5WB 5DEZA 3N85H 4LSSL 1S5HB 5D7IA 3MRMB 5GJSL 2HLAB 3STZB 4K3DL 1DBMH 1AKJD 3JWOL 3PDGA 3HI6L 2XRAL 3FQRB 1YC8A 2KDGA 3IDIB 1JPTH 5GSVB 3HAEA 3FKUS 2PYEB 3TO2A 2VH5L 1NMBL 2PO6C 1BAFL 2Y25A 4OZHE 1G7LB 1RJYA 2HMID 2E9JA 3AUVA 3FT3A 2NXZB 5LGJB 5IFJA 4GMSH 1X5HA 5E8OA 1LMKA 4TRPL 4HXAL 4N5UA 1UC6A 3O4OB 1ZHBA 5LGKA 2NZ9D 1IGYB 3UO1H 1L0YA 5AZ2L 4IM8A 4QXUH 3SDXF 5DHXB 1OP5H 4N90E 1MCPH 1VACB 1CXFA 3V4PL 4QXTA 2AV1B 1IZJA 2PN5A 3BPLB 4KQ3L 4ZAKA 3BPOC 4LGPB 2NY1C 1PG7W 5D72L 1UADC 4L8SC 5BZWA 3S3SA 2IH3A 4S1SL 4DWHA 3ARQA 3SGDI 2PKDA 1Q72L 2WINA 3O3EB 4JM2D 2LU4A 2J6EA 4PGDB 1QFWL 4PJIA 3P9LB 5TE4L 1L0XA 2ZCLL 4BELD 4NQUA 3ULVC 2C3XA 3RX8A 3T1WA 4H25A 5HGDA 1UM5L 3L3JA 4UDTA 1P2CA 4U6XB 1ZSDB 2YRLA 5FF6A 5IB3B 4UBDD 5HXMA 4GG6B 5KSVB 3W0WB 5E6IA 1HH6B 4JQIH 1RZKC 4LDEB 5JIPA 4PG2A 3FL7A 1T21B 1UCBL 4QF1B 1ZA6A 1RURL 4KQ4L 2XZCH 5I16B 3WDHA 4AM0A 1GGCL 5ACMA 2G60H 2HT3D 1LNUB 1A7OL 3RBSA 4G6KH 3G5VB 5IMKA 1KB5H 4XXCC 3GSUA 1R3KB 2C26A 3TEUA 3DV4B 1PZUB 2M8XA 4IOFD 1OB1B 3EYSH 1KENL 3RNQB 1JVKA 3PDOB 2R1WB 1U93B 1FO0B 2MMXA 2KL6A 3MYJB 2NXZC 4NWTH 3B9AA 4KPHH 1T6VN 3ZTNL 1MJ7L 4P49A 4QHMB 2IALB 3QXTA 3O4OC 3FTGA 3BRFA 5DVKA 4L4VA 1II4E 3E1F1 3S96B 3G6AB 1Z5LB 4UT9H 4LVOB 4QRQA 2R29H 3F12B 5IB1B 1UZ6F 2HVKB 3B9KA 2BNUB 4LCYB 2A9NL 3MNVB 2FJFB 2ZCHH 1AC6A 1RUPL 1OQOA 4G6FD 2F53E 1HXMB 3LH2H 5IEHA 2D7NA 4OD3L 1OGAD 3EFFA 3BPLC 1W0VB 1ES0B 5FYLL 2BNRE 2K9UA 2Q6WB 3GMMA 4R90H 5L2KE 2V9RA 4HD9A 4MZ3A 1E27B 5H37H 5A40E 4YR6A 3NZHH 2LABA 1FRGH 3MCLH 1J1OH 4HGMA 4PS4H 3A6BL 1VDGA 5EOCL 2IAMD 1LEGA 4WHYG 3MCKA 4NZRL 3Q6GL 5D7KD 1N5AB 1KC5L 3KPOB 4Z7UA 4QCIA 3AVEA 1BJMA 4LKXB 2EH8H 3ULUC 3ROLA 4P2RD 5DJZA 1DBBH 3D39B 4X0KA 4EIZC 1A7NL 1I3RA 3U1SL 1OCWH 2OR9L 3HPJA 1JGUH 4QEGA 2H3NB 5ISZE 1JCKA 3OX8B 4OZ4A 5IR1A 5IBLD 2UZIL 3OWEA 4JFYB 5FM5M 2FDBP 5CZXC 2EE9A 5LGHH 4M7LT 1QYGH 3ELAT 2I07B 4IS6A 1A4JA 2JB6B 2NW3A 1ZLWH 4PJBF 5TDNA 3JWOC 4LHUB 4KUZH 1YEDB 4U1NA 4HS8L 3TZVD 3SKJH 2DYPB 2BP3A 3OHXB 2X4NA 4FNLH 3VGAB 3FQWA 5JDJA 2VLMD 2E7LA 3G9AB 2DTSA 4GMTH 2CKBA 2FLBT 4POUB 3ULVF 4LAJH 4UNTA 1IGIH 4ERSL 2AABH 4NQED 4U6VH 4NDMA 1CFVH 4MA3A 3MROA 4MJ5B 3M17A 3FRUA 3NGBB 3I50H 5FIEA 2EDEA 5IESH 5FV1L 3QPXH 1ZK9A 1IVLA 3CNKA 4LASH 5A2IH 1KELL 3DHMA 2WANA 1E6OH 3C2AL 1LWRA 4P5KB 2FZ3A 3VXRA 3G6JE 4F9PC 3B9EA 1L9NA 1JPSH 2IMMA 1YYLH 5D5MA 1U8JA 3LZFH 3DTXA 4UINL 3ZYJA 4GKNB 1MWAH 4P4KD 3MRBB 4LHQB 3RA7L 2R15A 5FA4B 2BSTB 2PETA 4LVOC 2XA8L 3FN0H 4XBGA 5F89B 2J12B 1Q9LB 2V2WB 3IS0X 5FA3B 1CE6B 4MCYA 4F15B 5ITBH 1VFBA 4ZSOA 3SJVA 1V5JA 3S9DB 1U8OB 1JGEB 3MR9B 4F33B 3O4LA 2IFFH 4PJ5A 3QJHA 4TSAL 5A2FA 1WLHA 3KXFD 3O41A 5EO0A 1NBZA 1BIIB 1HWGB 1DQMH 3UTTE 3DPBA 2X9XA 3AMLA 1KIRB 2BY2A 3U9UB 4PRDA 5BS0A 3BZEA 4KI1A 5B4MC 5DHYB 3EYUL 1SEQH 2HJLB 3RDTA 1DSFL 4S11A 3OJVC 4M6NH 1U3YA 1IFHH 2VXUL 3SGKC 5E9DD 5JW5A 3TVMB 3RKDD 5DC9B 4U1SB 1N7MH 3CLEH 4Z0XB 4I48B 1TDQA 1P7KA 2YK1L 5EFIA 3HRPA 4PY7B 5CEYB 2WQRA 4PRPA 5KVDH 4YHLL 1FV1A 3E6FA 3QDGB 4YO0A 2DLTA 1BGXL 3OKLA 2E27H 2OBGA 1BVLA 3PWVA 2H32A 2HKFH 2RIKA 4NHUB 3ZHKA 3KYAA 2WBKA 5ACZA 1I8IA 4L1DA 3IRZA 2ADGB 4M8VA 3VGAC 3SKMA 1VESA 4G80A 5IHBA 1OAUH 5L6YH 4GW5B 5IG7A 1F8TL 1MCCA 4JFFA 1N6QL 3BJ91 1KN2H 4AQ1B 3OKOB 1YEJL 4NSKB 4FQIH 1CLYL 3LS5H 4XGZA 1RZ7H 3TPUB 1CFTA 1I1YA 1ZHKB 5GGTH 4L9DA 5C0BE 1RUMH 2HH0L 1E4XH 4PRHD 1UACH 3NGBC 5FHBH 3SE3A 4GQPH 4ODWB 4GG6F 4RIRA 1Y18B 5FYKU 1OTTD 4B53A 4WU5B 5FFLA 2OL3H 3MJGX 3GHEL 1EK3A 1WEJH 5DJ2A 1XEDA 4PP2A 1DQQB 4KRMB 3VXPA 2GJZA 2MCPH 4JHWH 4NP4H 3GEWB 5T3XL 1G1YA 4M1CC 4KJWC 2EYTA 1NDMB 2VDPL 4WENB 3QA3B 5ICZB 1A7PH 1YEIH 1QO3A 4M3JA 3IDNA 4U3HA 3RZWA 4R8WH 3BE1H 3MV7B 4FABH 1V3LA 1WGOA 3FB7A 3WLBA 4LEXL 4Z77B 4WJ5B 4F2MB 4G8EB 3WNKA 3HPLA 3MGTB 1JNHA 2DI8A 1MIEH 5D1XD 4CVUA 2YPLD 3BXNA 1RFDH 1KYOJ 2CH8A 4F15C 2XN9B 2WK2A 5JW4N 5FCUH 3RTQD 3KPSD 4Z8FH 3TN0A 1FORL 5CJOL 3T0VA 1INQA 4YBQC 3VXQA 1ZA3A 1MHPL 4V1DB 4MVBD 4XXDB 1Y6KR 1F3JA 5D93B 4JFDD 1A7QL 3DMMB 1I1AB 1H0DB 5E7BA 4C55A 1EEYA 5CD3A 1SJEB 4NYLA 2NY4D 4PJGE 1RIVH 3JBG7 1IC7L 2GSGA 5D4QA 4X6BB 4ODHL 2YD2A 4LLVB 2W60B 4X8JA 4PRHA 3TVMC 1KYOK 2YPKA 4AMKL 1A6WL 1XIWD 4XMPL 4XCEA 1TMCB 3C60D 3MC0A 5JXEA 3WFHA 3AB0B 3X11B 1C12A 2EDHA 3SE9L 5GZND 1QLFB 4XMKH 3G08B 3NH7H 3A67H 5FOBA 4G8FB 4BKLA 3WO4B 4LNVA 4WTZG 2Y6SC 4FZ8L 3GRWA 5TGBA 4TUOB 1JF1B 1CZ8H 1NCWL 1NGWA 2Q86A 4NZTH 2J1KA 4QHUB 2EH7H 4JG1L 2WQ8A 5F7EL 5FYJH 4JB9H 3TYFB 2IQ9H 3LPGA 2CLRB 2CUIA 1YNKH 1R3JA 4XWOC 4CRPA 3QWQB 1WFNA 4RAUA 3NFSH 2G2RB 4TPRL 5IBTH 4B41A 2FL5A 3KPSA 1XGUB 1TCMA 2XWTB 1ZVSB 3H9SE 1MRCL 4Y8DC 2RGSA 1OL0A 2X4PA 1HHHA 3HE7A 1QRNE 4CU7A 4M1GH 5KN5B 2RFXB 4XAKE 4F7EA 4NO5A 1IBGH 3QSKB 3MRNB 4NJAH 3RI5K 3VXMD 3PWLA 2DAVA 1AHWB 5H94A 4U1LA 4R97B 4FQ1H 1FL6B 4P57A 4U33A 3NCMA 3T1FA 5GS0H 1EO8L 3BN3B 1BFVH 1HIMH 3VW3H 2YN3A 4AIZB 4NC1E 4LPYA 1Z2KA 3QDMB 4U1KA 1ZGLB 3MA9L 2DKSA 4MQXC 2A77H 5B8CA 5FUOL 3C60A 2EDOA 1G7HB 4ETYA 4JREB 4UIKL 1U36A 4LPTA 3UTPD 1A14H 4LFHG 3MXWL 3CVIH 5EC2A 3RFZC 4EDWL 3BUYA 4BQ9A 4ZS7H 2CIKA 1S7TA 4YJZL 3U4EA 1JZ7A 4R0LA 1E4WH 4WY7H 1I7ZA 1E6JL 2HG5B 3NCEB 5D93C 3DMMC 1X4ZA 1I1AC 5I1AB 4RA3A 3X14B 1XR9B 1RUQH 5EZJA 4MNQA 4M6OL 5F7KC 4Z5RB 3OB8A 4JQXA 1CBVH 5L9DH 4DGIH 3UTZB 3VFPB 4GW4B 3GSNA 4LSSH 4NQDB 1JPST 4K3DH 3VFUA 4DKDC 3W2DL 4WWKD 1GOFA 1TZIA 3AB0C 3JWOH 3VFWA 2GCYB 3HI6H 2XRAH 4ELKA 4H8WL 4GG8B 1QACA 3D2UD 3NIFF 4HWEL 3WO4C 3TYGL 2EYRA 2VH5H 3SQBA 1D5BA 1NMBH 1BAFH 4O2CA 3DX6B 1JPFA 5E2WL 5KSBE 4V2BA 1MCQA 4QOKD 2DLGA 35C8L 1RK0B 4P3DA 1G7QB 3BZFA 3O81A 4TRPH 4HXAH 3O2WL 4WCYL 2NTSP 2JELH 3QZWB 5IKCA 2YD6A 2UWEE 1WV7T 5MEND 1RAMA 1SBSL 3OG6B 1RUKL 2GQHA 4FS0A 2QBWA 4DZ8B 5BVJA 3V4PH 1KPVA 3IDMB 5CJ8A 4KQ3H 1M1SA 2PCPB 1WT5A 2C4FU 3DOSA 3MLTA 2ESVA 5D72H 1MVFA 5KSAB 1AHWC 5CSZA 2VO5A 1F3DH 5E0QA 4R97C 2FSEB 4CVZB 5KANI 5C0IA 3UYRH 1Q72H 1W72L 5AYUL 2Q8AL 3WN5B 4FZEH 1U8QB 3IJHA 1QSVA 2GI7A 3BVNA 1QFWH 4MLSA 1RZIB 1OP3H 2LAGB 1EGJL 3BT2L 4JREC 2ZCLH 4KKAC 5SWSD 5TDOA 2ITDB 5IFAL 1UM5H 4GRWB 3LKNB 1T5WB 1KGCE 2EICA 3PJSA 4OCYH 2R0ZL 4WUUD 1HQRA 3QUYD 3D0LB 2F8VA 5T1MA 4JZNB 4JKMA 2FNBA 3OKEA 4K7FB 2XA3A 4M9OA 3O11A 1MFDL 3VFVA 3GMRB 5ANME 4PR5A 1UCBH 2R2HA 1LO0L 5IUSA 4OCMC 4KQ4H 3MRDB 1GGCH 2CXGA 1AXSA 2XZAL 4X6FB 2P5WE 1G9ML 4Y88A 1LO4H 4ORZC 1A7OH 2M2DA 4FTVD 5EUKB 4F7TB 4ZYKA 4NUGL 4BUHA 4PG9B 2Y7QA 5DRZA 5ILTL 4GQ9H 2FGZA 2XQYK 3GSXA 3ARED 3VMOA 2EXYC 1FYHB 1MLBB 2X1OA 1DQDL 3V6FB 3WS3A 3HN3A 4YLQT 3O2DL 4CKVX 3T2QA 4DTGL 3O3BA 1I8KB 1EVUA 3OKKA 3QNXA 2W9EL 3F6LA 4LPWA 5HDLA 2OK0L 5C09A 2PW1B 3EOYG 3K8MA 4XCYA 5EBWB 5ESQA 3ZTNH 1MJ7H 3GSVB 4UOW0 4UZGA 3VXUD 4OLUH 3GUTA 2GAZA 5D7JB 4HHAA 3N1FC 2OXHA 3BEWB 1YPZA 4Q7DA 3BGMB 1Q9OB 1OTUC 1BWWA 4CVXA 4RGND 4Y5VA 1A4KA 4JFPA 3MZTA 2A9NH 3IAGC 4G6ML 1RUPH 3UBXB 2BHUA 5IJKA 1ZTXH 5IROA 4OD3H 4M4PA 4GH7B 3BH9A 3QUYA 5FYLH 5DGQA 2Z31A 3KWWB 1KIPB 1HH9A 4IIQB 5D1QB 4DZBA 1B6DA 3RY4A 4M61B 5KSAC 4JFED 3B6SA 1H8OA 1OP9A 2P48B 3L5WA 3H42L 1OM3H 1J0ZA 4ZUVB 3SGJA 3A6BH 3WNOA 5EOCH 2HYMA 5C86A 1NC2A 3Q6GH 1BREA 1AD9B 4KMQA 3WN5C 1KC5H 1J88A 2NNAA 3MLZL 5ERWB 3S4SB 4NRYB 3GMLA 4N0FB 4PRBA 4YHML 1YMMB 4M93B 4TVPL 3P4LA 4Z7OE 1S8DA 2GSIA 4JRXD 4ZD3L 1CXIA 1IGJB 1AGEA 1GVIA 3T3PE 3SKNA 2ADIB 3U1SH 5I6XC 5FUCE 1MCDA 2X4SA 4MA1B 4TTDC 3ZYZA 3KPQB 2UZIH 2O93L 2R9HD 3MRHA 3D85D 3SDAD 2G5BB 3S97C 1FYTA 2OLDA 2UUDH 3HZMB 2PF6A 2F74B 2AK4B 3ARFB 1SYVB 3IXTB 4YFLI 3L7FA 1J86A 5FGCE 4Z7NE 3TO4D 1I4FA 1WISA 4WW1A 3MA7B 4XNUL 4ZUSA 4HQQL 1B4RA 5T5NF 3ZHLA 4HS8H 5KOVC 2J88L 4XPHL 5BV7H 5IVXA 5CCKL 5JORB 2ARJA 2HT2C 3WXWL 2DMKA 3TA3B 4BQ6A 3PWJA 5FM4A 4ERSH 4W68A 1L4IA 5JQHC 3RVXC 1XAUA 1R6VA 5DSCA 1UQSA 3GMQA 5FO7B 1S3KL 5AWNL 7CGTA 3BAEL 3DO7B 3GJEB 2QV2A 4S2SB 4JRWA 1KELH 1MCNA 2IEPA 2R2BB 3C2AH 4Y1AB 4IRSA 2QTEA 1CR9L 5TPWL 3MRGB 2GUOA 3DROB 4M3KB 1GZQA 3C8KA 4LLMA 5DRXA 3ZYIA 5D7JC 4UINH 4UU9B 1FN4A 2W0PA 3RA7H 4K3GA 1I9RH 4YZFE 2XA8H 3I75B 3KHOA 1WBZB 2DF3A 4C56B 1QKZL 5DZLA 2O26U 2E7MA 2HFFB 3V6OE 5IT2L 1BVKA 1RQ5A 2OR7A 3HUJA 2LFGA 4DW2L 1HOCB 3EDKA 3QRFM 5D1QC 5I76B 2XTJD 4IIQC 1MJJA 1UM6L 4EI6B 2BSSA 5CINL 4WUKL 3CSYA 3TBWA 1TCRB 2EIEA 1KSRA 3KJ4B 1UKQA 2HFTA 2XQYG 1AGFA 3EYUH 1P7QB 1DSFH 4M93C 2DQTL 2VQ1A 1HYSD 1CFQA 3S35L 1MQKL 4LGRB 2Y72A 43CAA 5HHME 1IKNC 4XP5L 2Z0BA 4O58L 2FB4H 5EZIH 4MA1C 3D9AL 2X4RB 4NQSB 1MCWW 1JL8A 3SEPA 1BD2B 2ZUWA 1HKFA 5CHNB 5C6PB 3IJSA 3KPLB 1XGRA 4PV9A 4YHLH 5ID1B 3O6FB 1G9MC 1BGXH 4BFEA 3ARFC 3QI9B 5ACLA 4OIAA 5GIRB 4JZJB 2FATL 2Y5EA 5C08E 3RL2B 4YE4L 3DVIA 4FFVD 4P4RA 3S37X 1LEIB 4ZXBD 5C6TL 1H3PL 2F54B 4I0PD 3B8YA 3LKQB 4MNGE 2H2SC 5DQ9B 3IAQA 4DCQB 4GW1A 3O6KL 4L4TD 4OB5L 3FQUA 3TA3C 1F8TH 2A0LD 1YEJH 4GRWF 1CLYH 3OKMA 4F9LA 5CSGA 5DMJB 1QBAA 2HH0H 5I1DB 4XBPA 4MDJB 1I9JH 5H37G 4O51A 4XC3L 4YHNB 1KUMA 4N0CC 3GHEH 2P8MA 4KDTA 3VD3A 5DDHA 3KPRB 3ZE2F 4WTZA 4L1HA 4XPFL 1K9TA 1ITCA 3QXAB 1EAJA 5T3XH 5CWSB 3W5MA 4MA8L 3UC0H 4P46B 3V5KB 4NN7C 3OJMB 2HT4C 1SYSA 5HPOA 1LO3L 5CJBA 3T2OA 1CE1L 1HK6A 1WFUA 1OD9A 4HIXL 3HG1E 1Q9KA 4O9HH 4LEXH 3V7MA 4GUPB 3MRCA 3TIEA 3DI3B 4KI5D 1UG9A 2FIKA 3RWJA 1I85C 4P23B 1R3LA 1GAFL 2VDKL 5SWQA 5SX4H 1U8KB 1FORH 5CJOH 2W07A 5HVWA 4HKJB 4F7PB 2DM2A 3X3GL 5MEOB 1A7QH 3KJ4C 1NCBL 1CD1A 2A38A 4Z18A 1A1NB 4X4XA 2OMNA 1IC7H 1QOKA 5IW3A 2AEQL 5AAWA 3E6HA 4ODHH 2H2PC 2XV6B 4KK5C 3UJJL 5DMKB 1AR1C 3HR5A 2AXFB 3KYMB 1A6WH 1I3UA 4AMKH 2C3WA 3QEUA 4KY1L 4YX2L 4X7DC 3RGVD 1BPVA 3REVA 5HHOD 3C6LB 4OFIA 2DDQL 4NFBA 3SE9H 3O6FC 3IAPA 5I71B 1EFQA 3QI9C 1N59B 4JZJC 4FXKB 5CILL 3V5DB 2DLHA 3FB5A 3IGAB 1HHIB 1SHMA 1M71B 1NCWH 4IHOB 1MI5E 2E6PA 3MLSL 4LLQA 4PREA 5DD1H 5F7EH 4RWYL 1IAKA 2R56L 2BOCB 1IQDB 1SY6L 1B9ZA 5CP7B 5EOTA 2PXYD 4OLZL 4QRTA 4K8RD 3AY4A 5GGQL 4DVBA 3SDCA 3LQMA 4TPRH 3RAJL 1JNNL 4JGJA 3MV9A 1U8IB 3O3DB 4JDVB 4FN0A 1MRCH 3L3HB 4UQ2A 2GTWB 1CLOL 4HMDA 4JZOB 4MJIA 3DXAA 3F5WA 4P46C 4CU6A 4XT1C 5EU5A 1CQYA 5C0CA 4HFWB 2VDQL 1EO8H 2ZG1A 3LN5B 1ADQH 4BZYA 5BOZG 1DEDA 1BZ9A 3MA9H 1GZPA 3HC3L 3BKML 1MCSA 3RZCA 4ZQKB 4PJCE 4APQA 4P23C 1KPRA 3WDIA 3P4NB 3MXWH 3E0GA 3UPRA 3MRRA 1HXYA 4EDWH 5E2VL 3W9DA 1CGTA 2OZ4L 4ZUUA 3ZKXB 3OGCA 4OI8A 5E99L 1FNEB 1U3ZA 4U2YA 3CFEB 1E6JH 2IMNA 3QQ4A 5DJ6A 1DQJA 1TVHA 3LAFA 4HLZH 3ZDZE 2I24N 3NAAL 3L3KB 4G9FE 4D9LL 1EO7A 2DQUH 5CBAA 2IADA 4M6OH 4ORGB 1UGNA 5SWZD 1U8HB 2X70B 1DFBL 3MRIA 2C7UA 4H88L 4MJ4A 3CSBA 2J3SA 4YC2B 2QHRL 3RPKA 5IEKA 1WBYA 3W2DH 2CIIB 4QRSA 3C6LC 2WBJA 3GMOA 3S36L 5M94B 4H8WH 5L2KB 3AAZB 3EFDL 4HWEH 5I71C 5HYSG 2N1KA 3TYGH 3C5SA 3BZ4A 4MZ2A 1AI1L 1BZ7B 4H0HB 1H15B 1KIQB 2F19L 5E2WH 4MWFA 1XF2B 4H1LA 2RCSH 4HS6B 35C8H 3I02A 4JO3L 2XKNA 4X6EB 1MCLA 4G6AC 3QWRA 3E2HB 5EU4A 4DOHB 3O2WH 2WIIA 4BH8A 1KXTB 1J87A 3U36B 4LPVA 4UV4L 2JK5B 3GBML 1IEAA 4JJHA 5ISZB 1AKJB 1SBSH 1FNLA 3PWUB 1AQDB 5IIEB 4YUEL 4X4ME 5HDBF 3LN9A 2BNQE 3BDYL 2WSKA 3LOWA 4LLDA 5EO9A 4X6DE 2XOTA 5C07A 4OLXL 1JGDB 4Y19D 5LQBL 3FOMA 4K55A 3B8SA 4OV5A 1F13A 4JR9L 5SWZA 1R24A 1RMFL 1QG3A 4N0YH 1QLRA 2GT9A 3MBEA 1U41A 2X4OA 1W72H 5AYUH 2NW2A 2DQCL 3PWPE 1ND0B 5KSUA 2BMKB 1QSZA 5T5FH 4LHJB 3RIAK 2LV4A 3O2VL 1B90A 3BT2H 3WJLA 5JHDD 1EHLL 3GJFK 5DEFB 2VIRB 1A2YA 4QRRE 3QIUD 1ZGLM 2DL9A 4RNRB 4LRIC 3ZKXC 2A73A 3ROOB 5IFAH 3VA6A 4YXLL 1WC7A 2V2TB 5J1AB 2R0ZH 4X5XA 4QHKI 2V5MA 3G6JB 3PGDA 5F9OH 1LILA 2Y06L 4U4BA 2R1XA 5D7IE 1MFDH 3DUSB 3LRSB 1PAMA 3JV6B 1LO0H 2A2QT 4KXZI 4JM2B 3MBXL 2YC1A 2XZAH 4DAGL 3G5ZB 1G9MH 3AM8C 1QSFD 4ZPTA 4YC2C 1WAAF 2O5YH 4KKNA 5ILTH 2WP3O 1JJUA 2VOTA 4KJQC 1DQDH 2V5TA 1D9KB 5HY9B 1EFXD 3O2DH 2DICA 4OD2B 4DTGH 3UTTB 5BRZE 2AJVL 2W9EH 2CLVB 2DLIA 2NY0D 2NLJA 2FR4B 2OK0H 5CMAB 3T0WA 3CCHB 2NR6D 1L6ZA 4GKSA 1P5VA 5FM8A 5F3HA 1U8PB 5DMIH 3E2HC 1RZ8B 5E5RB 1X7QA 3LQZA 1QEWA 2VERN 2ZSWB 5DUPL 5GRYA 1PW3A 1VEOA 5C0FA 5I1LA 1XH3A 5DLML 1YDPB 3IRPX 2A1WL 3LKSB 3O8XD 2P8PB 4KZDL 4XP1L 2PW2B 3DV6A 4ONHA 1U8NB 2B7DT 1FL3B 5E24E 1YY8A 2HMIC 3HI5L 3H42H 4G8GD 1ZT1B 4NBXB 4PJIE 1HI6B 2PR4L 3WNNA 1HHKB 4OKVA 4OF5A 3O3AA 3G9VA 4Q9CA 3ARGA 4U6YA 4AENB 5FM5O 4G3YL 3MLZH 4R7DB 5JHLH 4YHMH 2NZ9C 4OF3A 4AH2B 1MEXH 1NLBL 4TVPH 3WHXA 2K7PA 4I5BA 1SJHB 3RIFF 4U6TA 1UZ8B 3LRGA 4KRPD 3MUY1 3S34L 3GGWB 2NTFA 4HAGA 1N0XH 4OZGB 1EFXA 1YNTA 4Y4HD 2I60L 2IAND 1OGAB 3I3DA 4HDIA 5I8KL 2Z35A 1Z9MA 3HS0B 4OIIL 1DEEB 2W38A 4XNUH 4HQQH 2IAMB 2XT1B 4I2XA 4D0DB 4OZFH 5JIHA 1XCQA 4GRLA 1F5WA 3WNLA 4XPHH 4JM2C 5CCKH 5AZEH 1IM3A 2BDNL 4K3EL 3WXWH 3L95A 4P2RB 3VRLE 3WIIL 3CFCL 2XWBB 4LSVL 2Y5TB 3MLXL 3QP3A 5CS7A 3HZKB 5KAQF 3DGGB 3MGAA 5D6DA 4Z0BL 1D9KC 1TLKA 4L8BA 1S3KH 4BK5A 1C8PA 4MB3A 3GK8L 1ZLVH 1T83C 1W0WB 4UBDC 4Y89A 4MD0B 4L4VE 5KS9B 1AO7A 1DBAL 4OM0L 3VFOB 2Q7NA 1CR9H 4LEOB 5GGSB 4PJGB 5IVZA 5TPWH 1K4DA 2E9BA 3TZVB 3T0ED 1UT9A 2HT3C 1ULVA 5TDPA 4YPJA 2YD3A 1PLGL 5D2LA 3L1OL 2ADFH 4U1IA 2B0SH 1A6VL 4BSVA 2IANA 1QVOB 1UA6H 1D7FA 1OY3B 4NQEB 1YEHL 1GGBL 3RWFB 2D4FA 2KZWA 3IU4H 5JA8B 4IOFC 4JDZB 1FNFA 5IT2H 1XZ0B 1A7RL 1S9XB 4YDJB 3GB7B 2L7JA 4JN2A 2C9AA 3BKJH 4CN6A 1YQVH 5C7XL 3RWEA 2VDLL 5CINH 4PRIE 4L29B 4WUKH 4X98B 3HC0A 1REIA 1NDGB 5HBBA 4LBEA 3NZ8B 5ESAB 2V5SA 2CLZB 3BO8B 4HXBL 3VRIA 1IAOB 1QFUL 1RZGB 3LSOA 5HYJE 2DQTH 4LHUG 3RUGE 4P4KB 3S35H 1MQKH 5M7QA 3NIDE 4XP5H 3IXAB 4WEBL 1M6OB 5I74B 5CJQL 4O58H 3Q6FA 3D9AH 4FMKA 3RPIB 2QQQA 4IOIA 1FLTX 1MIML 1NUFA 3TBTA 1QRNB 3LEVL 2X1QA 1JV5A 2X4TA 3QNZB 4EN3A 3KPTA 4NKOA 3KXFB 5CEXB 2FJGA 3BP5A 4Z9KB 1S7XB 2VUYA 4YE4H 3SDXA 4XB7A 2IAMC 1E28B 5C6TH 3QIWA 1H3PH 1DUZA 3QIBA 4GFTB 1BBDH 3MTRA 2CRIA 1PYWA 4WFHE 3MOQA 4R26L 4Z7QE 5IW1A 4UAOB 1V8HA 3P77A 4UT6L 3OJDB 1AP2B 4M62L 4OB5H 2VLJD 2WLYA 2VL5B 1ZT7B 2EIDA 3VXRE 1JF5A 4JVWA 3VJ6B 3G6JF 2ARWA 5IBLC 4MAUL 2CO7B 4OFKA 5HYFA 2OMBA 4XC3H 1S7WA 5D5ME 1GGUA 5CIPB 2GK0A 2BCKB 2AV7A 4XPFH 1J1XL 4MA8H 1TJGL 4JM2F 5DZNA 4R9HA 1UXWA 4JKWA 1CLZL 2JJSC 3NCBB 3TZVC 4GXUN 5FHAH 4HIJB 1CE1H 1Z0NA 2XZQH 2SEBB 3E8UH 1T2QH 1H5BB 4LLYB 5DR5L 4LSUL 4ZSOE 3SJVE 4K23L 4Z76A 4HIXH 3O4LE 4PJ5E 3BD3A 2ZUTA 5I8CA 1U95A 4R7NB 2AJYH 3K3QA 3LDBB 4F7CA 2VAAB 5MEQB 1J11A 1GAFH 5BS0E 1R5VA 3T2NL 4TOYL 3AU1B 2BSRB 1JWMB 1C1EL 3X3GH 2FEEL 5KSBB 3MRPB 1KT2B 4LSPL 4OLWL 1HEZB 3NABH 1NCBH 2GTZA 2HAZA 4JKKA 3C08L 1A6PA 3N9GL 4TNWK 5EO1B 5BXFB 2RAMA 2BXZA 3D25A 5HPMB 1YQ2A 2VSDA 4J4PA 4NNXA 1S7SA 2UZXB 3QUZA 4WFED 1HQ4B 3VD7A 2AEQH 4P4KC 4JRYA 1JGVL 3ZKND 4MDIB 4PRPE 1DQTA 4X9HA 4D9QD 1EEZB 4YHIA 3UJJH 1JYVA 5I74C 5D1XB 1J8HD 2YPLB 3GSWB 3MLUL 4ODTL 4KY1H 5I1CL 4YX2H 3C5JB 4K94H 3L5XH 4NUJA 3ZE1F 2DDQH 3RTQB 1ONQB 4Y2OA 4LDOB 5CILH 1ZMYA 1GYAA 4JO4L 3INUL 4D2NA 3CFDB 4JFFE 4JFDB 4PGJA 4J3OC 3FFCD 4UAOC 1EEUA 2E8YA 2PO6A 3MLSH 3OPZL 4QRPD 4LIQE 1DE4B 2R56H 5CBEB 4OAWB 5GGTA 1SY6H 5F3BB 2DI7A 4OZGF 1I7TA 5I1HL 4XTRD 4OLZH 1CT8A 2OL3A 5GGQH 5J6HB 1XIWB 3BUTA 1QSEA 1JNNH 1BOGB 5D9SA 1KF9B 1K5NA 1D5MB 1N6UA 4I1NB 1K2DA 5HYSA 3SE4C 1A6AA 4JY4A 4YNYA 1NUGA 1CLOH 5JUEL 4X99A 3KGRA 4EI5A 5LG1A 5JDSB 4MNHB 1IQWL 1EVTC 5JO5A 4A6YA 5FYJD 3CFKB 4HMEA 1KJ3L 1CGSL 1NCUA 4XCFL 5BMFL 1UFUA 4L8SA 5ETUA 1H5BC 2P5WB 4HUVB 5C0AA 4I0KA 3QAZB 2XFXA 3FZUC 3KNBB 1J8HA 3HC3H 3BKMH 5CP3A 3PP3H 2NXZD 3LDBC 4PJBA 2BVPA 3G5XA 4UDUB 5KS9F 1OTTC 1OVZA 1PD6A 5E2VH 4NPYB 2OZ4H 3C6SA 5E99H 3I2CL 4NO0A 4PJGF 43C9B 2FWOB 1ROWA 4L9LB 3FFCA 1JZ3A 1G9NL 3L7EB 3SE8L 3VXMB 3TPKA 5GS0D 5EC1A 3CUPB 3MMEB 3NAAH 3PP4L 5ENWA 4D9LH 1ZHLA 3DX7B 3O9WD 4WI7A 4X7SL 8FABB 1DFBH 4H88H 5K9JL 4NRXA 5D1XC 3R0MA 4FQXD 2QHRH 4OD1H 5FCSH 4HIIA 2I27N 1I1FA 5FB8A 4Q9RL 4MA7L 2V9QA 3KG5A 1R5WA 4GS7C 1S5HA 5IBUB 3MRMA 3RTQC 2HLAA 5E8NB 3STZA 3S36H 4XRCB 4XXCA 4DUWA 3QCTL 4MVBC 2D3VA 3FQRA 1AI1H 1LK3H 3IDIA 2F19H 4KH2A 1D6EB 1HHGB 4JHZA 5GSVA 3HA0A 2PYEA 3LEXB 1A5FL 1G7LA 3SN6N 1YZZA 5A2KH 4N8CL 5LGJA 3WIFB 3BD5A 1GH7A 4JN1L 4G43B 1XIWC 4UV4H 3HMXL 1A22B 4Q6YA 1C08A 1B0RB 5T5NG 1IGYA 3FQXB 4BA8A 3GJFH 4YUEH 1Z6JT 4R96B 2EKJA 3D2UB 3BDYH 4S1QH 1BQLH 3NMEA 1VACA 2EE3A 1GJIA 5F9AC 3J7HA 2AV1A 4OLXH 3UZQA 3P30L 2A6IB 1T0MB 4OQTH 4QOKB 3PXJA 4XPTH 4JR9H 1RMFH 4XVJL 5C0ND 3QAZC 1N3NB 3DUUB 4OUOA 4NCDA 4KKBC 2YD5A 5JW4Q 3O3EA 4DGVL 3IDJB 3O2VH 2D31A 1EHLH 5ELIA 1XF4B 3DWTA 4PGDA 5MENB 1TENA 1JI1A 2OTUB 3P9LA 4Z95L 3ZYOA 1TQBB 1AY1L 1TNMA 1XMWA 1LD9B 4MNQE 4J1UB 4N1EA 4L9LC 1JPGB 1EERB 2ZSVB 4U6XA 5IB3A 4GAGL 2Y06H 5B38B 4GG6A 5KSVA 3W0WA 4Y4FB 3ZLQC 2VLRD 1HH6A 5EZOL 2Y4SA 2ZUQB 2Y36L 3MBXH 1T21A 4LGSB 2KKQA 4QF1A 3V8CA 1OAZL 5I16A 4CU8A 3K2MC 2Y9RT 1VKXB 2MPAH 5D8JL 1LNUA 5SWSB 4JM4L 3KLAB 3WS6C 1S9VA 3G5VA 3T09A 5KSBF 3QZWG 4HZLB 1A3LL 3DX8B 2HP4A 5A2JH 2ERJB 1R3KA 3RWCB 3DV4A 2P8LA 3CC5B 3BSZL 1OB1A 2YD7A 3RNQA 2AJVH 2QADB 1K6QH 3PDOA 2R1WA 2BZDA 4ISVB 4HWBL 1U93A 1FO0A 3KDMB 5FAAA 4PB9L 3MYJA 4EUPH 4N0UB 5C8JB 4DUXA 4F9PA 1SQ2N 3WXVL 5DC0A 4L4JA 5HHMB 2WW8A 5H8DA 4QHMA 2IALA 3AROA 4XWGL 12E8L 4NKMB 3U0TB 4FTVB 1G6RL 2ESVE 3S96A 3G6AA 3OZ9H 3AREB 2YZ8A 5DLMH 2BX5A 3F12A 2BHYA 5IB1A 2A1WH 4RMTA 2HVKA 4LCYA 2BNUA 3MNVA 2FJFA 4XP1H 2GW5A 1HXMA 4JVUA 1D5ZB 1J05B 1W0VA 1ES0A 3HI5H 5GISL 2Q6WA 1NAMB 2XG4A 2PR4H 1T7YA 4Y16D 3UTSD 3GI8L 1N6VA 5TF1H 1FGVL 4HV8B 4LCIL 1GXEA 4G3YH 1V7NH 3JV4B 1XF5A 1EBPA 1N5AA 1NLBH 1BEYL 4FQQA 3KPOA 2D7TL 3BFOA 4RA0C 1G9NC 4FQLL 4LKXA 3S34H 4RGNB 1KJVB 1NSNL 2OJZL 3D39A 5DS8B 2P5ED 5FYLD 3I9GL 3SGKA 2I60H 4H20H 4AIXA 1TQBC 4H26B 4U7MA 3CVHH 5FECB 1OTSC 2YMXH 3GO1L 3L5IA 2H3NA 4JY6B 3OX8A 2ICES 1OLLA 3U6RB 4JFYA 3BDXA 2WZPD 4JFEB 2PTTB 2QLVB 3MPCA 4Q0XL 4S1RL 3DURB 4Y4FC 4MHHI 2I07A 3MUGB 4IMLB 3O0RH 2JB6A 2ZUQC 5F9JA 4JQVC 5DXWA 4LHUA 4UUJB 3VDCA 1YEDA 1MFBL 1U8LB 2BDNH 1H3VA 4K3EH 5D96B 2DIBA 2FJHB 2DYPA 3OHXA 1GPOH 4JRXB 3WIIH 3CFCH 4G5ZL 4Q2ZB 4WI3A 3H0TB 1KEML 4EZMA 5C71A 4HJJL 4LSVH 3MLXH 5C09E 4JFHD 4Z0BH 2ERJC 4FFZL 3B5GA 3D85B 3SDAB 3GK8H 2F8OA 2GITB 2R0WL 4MJ5A 3BJLA 3VD9A 1BF8A 3PGFL 2QADC 4ODUB 1PDKA 5K59F 1RUAL 5HHNB 1G6RB 3TO4B 2VKXA 1I1RA 4P5KA 5JW4R 4N68A 4M5ZH 2VAJA 3ZKSD 5CIPH 2BY0A 3K4ZA 3RNKB 4F7MB 1PLGH 1U8MB 1U91B 1MSPA 3L1OH 4GKNA 3S4SG 1A6VH 5CEZE 1HHJB 3MRBA 3T0DA 5FA4A 2DTMH 2BSTA 3AREC 1YEHH 1GGBH 4PRAB 3IT8D 5CZVL 1CWVA 3QWOB 1MAML 4QXGL 4OGYL 1X5ZA 3MLRL 5F89A 3VI4E 1A7RH 4J6RL 4XWOD 1Q9LA 1FFOB 2V2WA 5FA3A 1CE6A 2OR8A 2VXVL 1E4JA 4U0QB 2VISB 2VDLH 2BVQB 4P2OB 1U8OA 1VADB 1JGEA 3MR9A 4PJFA 4F33A 1MI5B 2YA2A 2M26A 4HXBH 4U49A 4ZFGL 3V8OA 3T3PF 1NBQA 1QFUH 1BIIA 4XP6H 1KIRA 3U9UA 1GHFL 2ZOKB 1IEBB 4KK8C 3LEYL 2YUZA 2YN5A 1FYTE 4XPGL 5DHYA 2HJLA 4RGNC 1KPUB 4ZUTB 4WEBH 2AEWA 1T1ZB 1XCTA 3ECBB 1JWUB 3TVMA 3MV7D 3IKKA 4U1SA 4Y0GA 4OGAD 4YBLB 4Z0XA 4I48A 1HILB 4PY7A 5CEYA 5DD6B 5IV2B 3QDGA 4Z7VB 3BGAA 2LU3A 2HTLD 3UJIL 4OSUL 3KAAA 4R26H 4NHUA 4ETQB 1GGIH 4H0IA 1J0KA 4GAFB 1ZAGA 1MVUB 4M62H 5D96C 1A8JH 2ADGA 3F7VB 1BX2B 1RY7B 5DD5L 4G7VL 3OXRA 5BVPH 1UB6B 4PJCB 4IJ3B 3C2SA 4J3XA 4NGHH 3R06B 3GIVA 4GOSA 2NX5D 3OKOA 4NSKA 3M1BB 4MAUH 2R9HC 2PUQT 3N1PC 3TPUA 1A9EB 3SDAC 1N4XL 1ZHKA 4ODWA 1J1XH 1Y18A 2E7HA 2B4CL 2JKXA 3BOVA 3PQYD 1KEGL 4WU5A 1BIHA 1IJ9A 4UOJA 3TO4C 1TJGH 1DQQA 1B88A 1NCNA 3P4OB 4YZFF 4G9FB 4I0PB 3QUXD 5C0RL 1CLZH 1NDMA 2FX9L 1O0VA 3QA3A 2FECI 1R0AH 5DR5H 5DURD 4L4TB 4K23H 3HUJE 4PFEA 2EO9A 1PQZB 3CK0L 4HUWB 3LIZL 4KVCH 3MV7A 2FH6A 2J4WH 3IF1B 3QUML 1ERNA 4Z77A 4WJ5A 4F2MA 2D4DA 5LXGL 4G8EA 3UMTA 3MGTA 3L3GB 1HYRC 1A1OB 2YR3A 4E41D 1LP9B 2XN9A 4TOYH 3Q0HA 5K9OB 1WBXB 4P2OC 1C1EH 4YIQB 1LE5B 2KBGA 4LSPH 4OLWH 4AEIL 4RBPK 4V1DA 1F6AB 3C08H 3N9GH 4XXDA 1YA5A 2NY5L 2WWKO 2VJXA 2A6JB 2FBJL 3DMMA 1TJHH 4P2QD 3D48R 1VSCA 1I1AA 1H0DA 5INCB 5J6GB 4XCNB 1JGVH 1XF3B 3UXFA 1SJEA 3U82B 1CXKA 4CL7A 5IMOA 1KJMB 1KCRL 1UVQB 4X6BA 4ZO9A 3MLUH 4ODTH 1X5IA 4LLVA 1F4XL 2W60A 5I1CH 4ZTPL 1QNZL 1AE6L 2XG5A 3ALPA 3NOIA 3BI9X 4HAFA 4ONOA 4M7LL 5DZOA 4YBLC 4M7ZB 5F7FA 1KACB 2X89D 4BSWB 4NQCD 4AIOA 1FIGL 1C5BL 1OD7A 4LF3B 3X11A 1EAPA 3QDHA 4BJLA 3INUH 5DMGD 3G08A 5BZDB 4G8FA 5IQ7H 1YN6A 2VZOA 2DI9A 4W6YB 4TUOA 1JF1A 3OPZH 2BVOB 5EBMB 1R3IL 1G0XA 2HN7B 3QDJD 2B39A 1CDHA 2CLRA 3CH8A 5DJAA 4IJ3C 4QRRB 3OGOE 1MF2L 3UCRA 2D0HA 5J3HD 3RGVB 5HHOB 2G2RA 4OFYD 3L3IB 1XGUA 2XWTA 3WEXB 4FXGA 2VABB 1ZVSA 5JUEH 4PTTB 4FFVC 4OCWL 3RWHB 5F97E 1IQWH 4I0PC 5KN5A 3QUMB 2RFXA 5C2BH 2EDWA 1KJ3H 4X7CC 4Y5YB 4N5ED 4XCFH 5BMFH 3MRNA 4QLRA 3ZDYF 1AHWA 2VWEE 5ADPH 3TESA 1FL6A 2Q87A 4Z78B 1DJSA 2PXYB 3CLFL 5JR1H 1JHTB 2A0LC 4AIZA 2C3GA 3QDMA 1ZGLA 3MLVH 3MV8D 3D3VD 3GKWH 4WGVB 3FOLB 1G7HA 3F8UB 5HGAB 3I6LD 4LCWE 4DKFL 5BRZB 3I2CH 3VXSD 3KPPB 2JCCB 4ZNCD 1VFUA 2VC2H 3T2PA 3SE8H 2I9TB 1ORSB 1FC1A 5IHLB 1MCBA 1JPTL 2HG5A 3PP4H 3UDWC 1IE5A 5I1AA 1ED3B 3X14A 1ZKAA 3GMNA 1XR9A 3OAUL 5HHVL 3VFSB 5K9JH 4LLUB 2CMRL 5EG6C 4Z5RA 3CGTA 3OAZK 4KI5C 2CDFB 4Q9RH 5FDWB 4MA7H 5IM7B 5E00B 4GW4A 2LU7A 1NEZB 2PYFB 4NQDA 1A6TB 1ORQB 2WINB 4M7ZC 4JFQA 1BLNA 4S0SD 1QP1A 1CD0A 3QCTH 3ZE0E 2GCYA 2ZNXA 4WFFE 2OI9B 3QO0B 4WI8A 4OKDA 4X9FA 3BMWA 4TTDD 4JKPL 3B83A 3TLRA 3NVQA 1FPTL 3DX6A 3MV9E 4HUKB 4N8CH 3HE6D 3UPAA 1JN6B 1RK0A 1G7QA 4JN1H 1KJ2B 3GI9L 3W11D 4EQ3A 3SDYL 2EDQA 1CGWA 4MJIE 3DXAE 3RGVC 1INDL 5EPMB 3QZWA 2UYLB 5C0CE 3BIBX 3QFJD 4Z7VF 4XX1G 4Q9BA 1MCEA 4DZ8A 4MD5A 3IDMA 1S7UB 2PCPA 3LKOB 3P30H 4HBQA 4Y5YC 4UOW1 2W65B 1NJ9B 1BJ1J 5KSAA 4XVJH 4PJCF 2ICWB 3DJ9A 3PGCB 1NFDB 5IJVB 2FSEA 4CVZA 2PXYC 4XZUB 1S7RB 2CKBL 4JQIL 3JTSB 3IFLH 1DQLL 3WN5A 4K8RC 4DGVH 3FO1B 4U7KA 2P7TB 1UKSA 1U8QA 1UWGH 3W5NA 3JSSA 1RZIA 2NY5C 3CSGA 2G60L 5D7JD 4F37F 5AYQA 2J8UB 4Z95H 3ZDZF 1AY1H 1RULL 4G6KL 5IOPB 2OXGA 2ITDA 2DQDL 5FO8A 1MHCB 3LKNA 1T5WA 1I3VA 1OPGH 4GSDL 2P1YA 4Y19B 3QJFA 5EIVA 5IB4B 3K4DA 3D0LA 4M03A 4JZNA 5EZOH 4IRZL 5HVFB 1RSFA 4K7FA 1PG7L 4KVNL 1R3HB 3GMRA 4P9HL 1OAZH 3EO1B 4AJ0A 2NXYD 1RV6X 4KPHL 3MRDA 3K81A 5E56A 1LP9F 5D8JH 5JHDB 5HGGS 4JAMA 1BMGA 4JM4H 3HZYB 3QIUB 5EUKA 3ORJA 4F7TA 2P49B 5J57B 4PG9A 3VG9B 3ZMRA 5E4EB 2G5RA 3QEQE 2OI9C 4PRIB 1MLBA 4HJGB 1CICD 3FB8B 4XC1L 2X40A 3V6FA 1AGCB 5FYJU 1J12A 4HWBH 3H3PH 3TH3T 5GGRB 2YS4A 4S10A 4MXVE 5EU6E 5DJYB 5HYJB 2PW1A 3RUGB 5EBWA 2YWZA 3P3YA 3WXVH 4B5EA 2VXTL 5FDYA 2AK4D 4KI5F 1EA9C 3NZHL 4UMGA 3U48A 4FOMA 3MCLL 1J1OL 3FO2B 1H9VA 1X5XA 12E8H 4XWGH 1MFCL 2MHAB 1ZE3C 4NQVB 2NW3B 5D7JA 2OP4L 1JWSB 4FFYL 5EUOE 3BEWA 4BQBA 3BGMA 5C07E 3BIKB 1Q9OA 2ZJSL 4K3JL 4R2GB 3BPCB 3WNMA 1EIBA 3UBXA 3VXOB 1B3JA 3MOBH 1DN0B 1CL7L 1JGUL 4KDWA 1KLGB 2JJUA 5GISH 2NY0B 2HRPH 5IF0B 3KWWA 1KIPA 5D1QA 4IIQA 3WL9B 5T3ZE 3GI8H 4M61A 1FGVH 1T04B 1EGJA 4HGWB 3TCLB 1NGZB 4ZUVA 5GS1B 1JI2A 1HSAB 5BW7C 3BQUD 4Y1AD 5KJRL 1JNJA 3UYPA 5GGRY 1SBBA 1AD9A 1A6ZB 1BEYH 4JEGB 2FZ3B 2X4QB 2IG2L 2Y1VA 5ERWA 1F97A 3S4SA 4FMFA 4FQLH 4NRYA 4N0FA 5D1ZD 1YMMA 3PHOB 1F2QA 5CLTA 4FNLL 4LP5A 5CJ5A 1IKNA 3I9GH 4WHCA 2MWCA 5B22A 1PVHA 5DYOB 1Z0MA 4GMTL 3GO1H 1UM4H 3D5OF 1WITA 1IGIL 4C56D 4C4KT 2HFEB 1K4CB 2G5BA 3HKFA 4LDLB 4NFCA 4Q0XH 1A47A 5SV3A 4S1RH 4WHTB 2FH8A 3HZMA 2F74A 3ARFA 1SYVA 3ILPB 3IXTA 5IESL 3QPXL 4ZOEA 3MA7A 4LASL 4TVPD 3K80A 3IJYB 4PJ5B 5IVOA 3DUHA 4WW2B 1MFBH 1T22B 4RZCB 3HRZB 4Z7WB 4MSWA 4TYUA 1DBJL 1KEMH 4KRPB 4HJJH 5JORA 3O2DA 3QIUC 2G75B 4XHQA 3TA3A 2UVEA 1EJ6A 4R4BB 4TSBH 1P7QD 4Q6IB 4Y4HB 1VEPA 2JCCF 3VG9C 1UYWL 4FFZH 1MHEB 5E4EC 2R0WH 3VRJB 3HNVH 3FN0L 1TZHB 2XTLA 3EOAB 3PGFH 4DUVA 1U2HA 5FO7A 3V5HB 4G6JL 4WEUD 3DO7A 3GJEA 4S2SA 1EXUB 1U3JA 2R2BA 3H2WA 5HI5C 1NANI 2IFFL 2X41A 4LCCB 1OAKL 2P4AB 3QI9D 4BUGA 1MJ8L 2DMBA 3MRGA 4N9GB 3UPCA 3DROA 2EKSB 2F54D 3PNWB 5F1IB 3MJ6A 5ECJE 4R2GC 4EXKA 2VZ3A 3N1MC 5CZVH 1MAMH 3I75A 4QXGH 4OGYH 1WBZA 1CIUA 3PHSA 3MLRH 4C56A 4J6RH 5JMOC 1IFHL 1J10A 5DHVA 1I85A 2HFFA 2VXVH 4MJ2A 1IC1A 3GRWL 2YSSB 1HOCA 3TWCH 4NQXB 2NY0C 3CLEL 3TIDA 4KTDL 2NR6C 5I76A 4EI6A 4ZFGH 5KVDL 2X44D 3LPFA 3KPRD 1TCRA 5GS1C 2BJML 3T0EB 3ZDXE 1GHFH 2E27L 4AEEA 1FSKB 5HGBB 2HKFL 3LEYH 2MCG1 3VXPB 1FJ1B 4HIEB 4OLYH 4P46D 5L2JA 1NMCB 1P7QA 2JE8A 1F6FB 2A83B 3HFML 2MFNA 1WF5A 3MFGB 2Y23A 4I2XE 3VGDA 1YNLL 2YEZB 1QQDB 2X4RA 4NQSA 4NZJA 3FB7B 1PEWA 4P9HC 4HK3N 4JPWH 1BD2A 1U2CA 5CHNA 3KPLA 1NFDF 5ID1A 3O6FA 4P23D 4EEEA 4QTIL 1UACL 4WI5A 2QKIA 5KTEH 3BH8A 3QI9A 1U3HD 5GIRA 3VFMB 5DEGB 4JZJA 3RL2A 3ZSTA 2CGRH 5GPRA 3WLWD 5L8JB 1MWAB 3VMPA 4NP4L 3SOBL 3JWDH 3LKQA 4WW2C 3TN0B 2Z93B 4D9RE 1IGML 5DQ9A 3PHQB 4DCQA 5E5MB 5DD5H 4G7VH 2Z9TA 2H26B 4KRPC 2J8UF 4LVHB 1AO7E 4E5XB 4QGYA 5GRJH 2NQCA 2X7LB 4K2UL 4Q6IC 4Y4HC 3RVVD 4R8WL 3BE1L 5BQ7B 1X5FA 2HLFD 4XP9L 5JOPE 4RMSA 5I1DA 4MDJA 4N90D 1KEGH 2B4CH 2HKHH 4YHNA 1J0YA 1RFDL 1YEEL 5KVMC 2J8HA 3D0VB 5D2LE 3HLAB 1SVCP 4KK6D 3QXAA 5FCUL 4XCEB 5C0RH 3CDCA 4LCCC 2FX9H 4RBPH 5GRUL 5C70A 1C12B 1QHOA 4G42B 4LMQI 3V5KA 1TPXB 3BYYA 4PGBB 4X4ZA 2ED7A 2JTDA 5EBLB 3HZVB 2APWA 4HCRA 3U4BL 5IHZB 3CK0H 3QCUH 3LIZH 2VLJB 5B39B 3QUMH 2PTVA 2BVYA 1RIVL 3Q48A 1T2JA 4P23A 5LWYH 3HAEH 1K8DB 4MQTB 1YJDL 1PJ9A 1WAAA 1U8KA 2AJXL 2APVA 3RUGF 3EIFA 4OCRL 4HKJA 4AEIH 4F7PA 3SE3C 4RFOL 3I6KB 3T0EC 1P84J 2Z8SA 3UAJD 3BHBB 3NH7L 2FBJH 4M02A 4QWWD 1FSKC 2DJ4A 3EO0B 3MLPA 1G7PB 3OKYA 1NMCC 2WWMD 4NZTL 5LBSL 1VENA 1KCRH 5GSRB 4XNZB 1JZ4A 2H45A 4ZTPH 5FYJL 3SDXE 2DWDB 2EDKA 2IQ9L 2AXFA 3KYMA 1AE6H 1MRDL 1J7VR 1EZVY 2EZ0C 4Z7QF 4UIMB 1MOEA 1CG9B 1CVSC 3C6LA 5I1KL 1FIGH 1FNGB 1C5BH 1CTOA 1OARL 1NFKA 4DKAA 1P84K 4U3CA 1N59A 3V5DA 4FXKA 4ENEC 4GXVL 4E42B 4R4ND 3F7PC 4MXQC 3SCMD 3IGAA 1HHIA 5HJ3B 1M71A 1HINL 4IHOA 4R4FL 5EN2B 2ARJQ 3U4EB 2LVEA 4R0LB 3FONA 1QFHA 3J8F7 3RVWC 5FGSA 2BOCA 1IQDA 4LVHC 3UJTH 4PLKD 5CP7A 1MF2H 4WI9A 3A6CH 5I1JH 3MUHL 3OR6B 2LTQB 3O3DA 1P4LB 2FX8L 4JDVA 3X12B 5EH1A 5ICYB 2F53D 3GDBA 3L3HA 3IB4A 1A14L 2GTWA 4ZG1A 3VFUB 4JZOA 4WW2F 2BNRD 4ZS7L 3RWDB 3ZT6A 5L2KD 2QQKH 4Z7WF 5C1MB 4PJAB 4QRPB 3FAWA 5CGMA 1IKFL 4PJHB 1TPXC 1E4WL 4CMMB 4WY7L 5DMYA 4HFWA 1EZVX 4LSDA 3CLFH 2HVJB 3NFPB 5D71L 4R6UA 4Y4KD 4HULB 3OQ3B 5EOQL 3OAZH 4KKCD 4ZQKA 4O2EB 3BWAB 3P4NA 4UTBL 5B21A 5HD8D 5ISZD 2MJWA 4LRIA 3EYQD 4JRYE 4U05A 4LPCA 4HSQA 1G7MB 1FNEA 2O61B 4TSCL 5TFSL 3B3IA 4P2CG 4NNYB 3FQNB 3QB7C 3OAUH 2VXSH 5HHVH 3L3KA 3KLSA 1ZS8B 3VGHA 3MLTB 2CMRH 3DBXB 2D03L 3MJ8B 4ORGA 4XNZC 1U8HA 2HFGL 2X70A 1UZ6E 3AM8A 4CGTA 1T3FB 4TUKL 1NMAL 3NPSB 2CIIA 2JELL 4OCNC 1NGQL 4L3AA 5E8EB 3DYPA 1U92B 2CRZA 1QZ1A 3U30B 5L2KA 5DA0B 3AAZA 1SY6A 2XWJB 2X4UB 3ZHDA 4JKPH 1CVRA 5GRVL 1BZ7A 2W9DL 1H15A 1QSEE 1KIQA 1FPTH 5TDOB 5TH2B 5JQ6L 1Z3GL 4DFIA 1XF2A 3O9WB 2ORBH 5GRXG 3ZKNC 4O02L 3V7AG 3SHSA 4X6EA 2RJMA 1OLZA 3GI9H 3ESVF 3SDYH 2X9WA 4FQXB 3UYRL 3WFDH 3U36A 4UQ3A 5JW3L 4YAQB 2KH2B 1INDH 4FZEL 2JK5A 3BX7C 5ISZA 2LTQC 1AKJA 3PWUA 4Y7MA 3FMGL 5E1AB 1AQDA 5IIEA 5C0AE 3RRQA 1A6UL 2X6MA 1KTDB 5GRVK 3JTTB 1P9MC 4M00A 1VGEL 2IBBA 2R69L 1D9KD 1ZXQA 4PJBE 3PABA 4OCYL 1RHFA 3OL2A 1JGDA 1ZEAH 3UTTD 4XTRC 2CKBH 4U1JB 4GBXD 3TBYB 1DQLH 1CDCA 1ND0A 4XVTL 2BMKA 3ULVE 4I18B 5F8QC 1T1YB 3QQ3A 2VZVA 4EKXA 1URLA 1LO4L 4PTUB 2VIRA 5DEFA 3GUTB 1RULH 4RNRA 3L5JA 3WUWG 5IBUG 5HI4D 2DQDH 2DWEB 3ROOA 3VH8B 4GQ9L 1V3MA 2V2TA 5J1AA 1PKQB 4CVXB 4GSDH 1T80A 2A9ML 3WO3B 4PLOB 5I30L 4IRZH 3Q1SH 3BH9B 1PG7H 4KVNH 3TBVB 3DUSA 1S9WB 4ZODA 3LRSA 4P9HH 3JV6A 4CBPA 1JHLL 4JM2A 3I85A 1KCSL 3G5ZA 4OLUL 1JP5A 3V6ZB 1NC2B 2PYEE 3NPSC 3FO0L 4PRBB 5C0BD 3U30C 4JY5H 1D9KA 4XC1H 2DJUA 3MRLB 1BJ8A 4MMXC 5HY9A 1VPOL 1F02I 1ZTXL 5GS0C 1T83A 4OD2A 4LSRH 3UTTA 1K3ZA 3WFCL 2X4SB 2CLVA 2VLRB 3E3QC 3KLDA 2FR4A 1HCFX 5CMAA 4AYFA 3VFNB 3L9RB 3O9WC 1ZVYA 3CCHA 4M9PA 2VXTH 1U8PA 1FYTB 1MCFA 1OM3L 4YHKL 1MFCH 4FQXC 5D6CA 1RZ8A 1X4YA 3L7FB 3ARRA 2OP4H 4FFYH 3WE6A 4ZUSB 4MCZB 5C0JB 4I3SL 2ZJSH 4K3JH 3GMPB 4ZS6C 1MQ8A 4PLNC 3T0XA 2I9LA 1L7IL 1YDPA 4POZD 3LKSA 4KMTL 1IAIL 2IGFH 2H32H 1CL7H 4I0CC 2P8PA 3EDFA 2PW2A 1H3UA 1U8NA 5F72S 1FL3A 2P24A 4AT6B 3ULUE 5I17B 1UQSB 1ZT1A 1BHGA 4PJEB 1HI6A 5B38G 5KJRH 1HHKA 3KYOB 4LNRB 3VGEA 4AENA 1CYGA 1VFAB 2IG2H 4R7DA 4I18C 5T1LD 4AH2A 2RHEA 4UTAL 5BV7L 4UV7H 3ARDD 1UZ8A 3QULB 2YRZA 4GG6E 2GUOB 3W0WE 1KTKE 3GGWA 4OFPA 1Q94B 4OZGA 1Q38A 1T0NB 2WM0A 5JPNB 1GIGL 5F71A 1AC0A 1IT9H 1OGAA 4PJAF 1NEUA 4PJHF 3OJ2C 3OR7A 3P0YL 4ZO8A 2AXHA 2AJUL 4K3HA 4Y16B 3S3PA 3HS0A 3UTSB 1IMHC 1DEEA 5C0NC 5SV4A 4KJPD 5MERB 2IAMA 4D0DA 2W9LA 4OZIB 4HGKC 4PJDB 2DJSA 1DBJH 4PJXE 3ZTJH 4HBCH 3QEGL 3ALWA 4J7RA 2UY6A 4P2RA 5AG8A 2XWBA 2P5EB 4XNQA 3KHQA 2Y5TA 1HCVA 1UYWH 1B4JL 3HZKA 3QG7L 1I9RL 3DGGA 1AGFB 4HX1B 1CFQB 5DJXB 2ENYA 3I6GA 3H9SD 1DP0A 4G6JH 3W81A 4MD0A 1QRND 4Q74A 5KS9A 1K3IA 4DFHA 2GFBB 3VFOA 4XAKD 1OAKH 2VITB 2Z92B 4G9DA 5GGSA 4LEOA 1MJ8H 4PJGA 2DLEA 2JJSA 3TZVA 3RX7A 1YC7A 1KBGH 3AXLB 4J3WA 2KZ1B 4QHLB 3KS0J 1F4WL 1ZGLP 5E03A 3MJ7A 4RMUA 5DD3L 2VLKE 3QT2A 4NQEA 3RWFA 1J0JA 4XI5C 4JDZA 1XZ0A 3VI3E 1S9XA 3GRWH 5EZIL 2FB4L 2R0KL 4YDJA 2DQEL 4KV5F 4CMHB 1H8NA 4K7PL 4KTDH 1D5XB 3OKMB 3OF6D 4GKZB 4JANB 4HUXB 2YBRA 3L6FB 5BV7B 4L29A 4X98A 4P3WA 5F9DC 1GGTA 1NDGA 2BJMH 3D39E 4L5FL 3AMKA 3NZ8A 1MCIA 5ESAA 3BO8A 2CLZA 4P5TB 1IAOA 2IF7A 1RZGA 4YBHA 3ARBB 5JLZB 4OQ1A 4RX4D 2GHWB 2I5YL 1W8OA 4P4KA 1D3CA 1HDMB 3HFMH 3IXAA 3WHE0 1M6OA 3IETB 4X80L 1YNLH 5LVEA 3FZUD 3SPVB 3RPIA 3LMJH 5ICXB 4WGWB 1QRNA 4HUNB 4F80A 3QNZA 4QTIH 1I7UB 3AS2A 1I9JL 4Y16C 3KXFA 2FIKB 1H3WM 4WU7B 1S7XA 4JLRB 5SWQB 4IEFB 3SOBH 3C87A 4HH8A 1IGMH 3UC0L 1QHPA 2X9YA 4X7TB 3CMGA 3QFDA 4NKQB 1AP2A 2ZPKL 4OBSA 1JMZA 5CD5C 3PIQB 1F58L 4K2UH 4LCWB 5E9DA 4OM1H 2BRRL 2VL5A 1ZT7A 4O9HL 4XP9H 3WIHA 3G04B 1BQSA 3QDAA 4HEPG 3VJ6A 1YEGH 1QLEL 3OF6A 2P45B 2DOCA 4LP4A 1TVBB 1YEEH 5CIPA 3VG0H 3SE4A 2BCKA 4XCCL 5HHQB 5ESVB 3ME0A 4L3EE 3REVB 3MRFB 2Y07L 5GRUH 2VE6A 3K2UL 3K4AA 2NYYD 5DUBA 2XYCA 1WTGT 1S5IL 4GLRH 5CAYB 3U4BH 1KLUB 1P7HL 2OQJB 3GSNH 5BJTB 2SEBA 1H5BA 1HZHH 4PJFE 1P1ZA 2NX5B 5CKAA 1Y6MR 3ARWA 4R7NA 1QTYT 4LLQB 3AS3A 3LPWA 1IAKB 5JMRA 2VAAA 5MEQA 2DQGL 3NIFE 3DYMA 1YJDH 3PQYB 1N2RB 4WIQA 4CMHC 4EQ2A 2AJXH 3AU1A 2IQAB 4OCRH 1JWMA 1KGCD 5BV7C 4RFOH 3QUXB 3MRPA 5KSBA 1KT2A 1PSKH 1HEZA 4P5TC 4NO3B 5DURB 3ARBC 5EO1A 5BXFA 5HPMA 2KQMA 4X4YB 5EU7C 5LBSH 4MJIB 4YDKL 3DXAB 1HQ4A 1KULA 2G9HB 4YXKH 1JHKL 1FVEB 1T4KB 5M95B 3QDGE 5DD1L 2PTUA 2YKLL 1FVCB 1EEZA 2P5WD 1FLRL 3H9YA 5D1XA 1MRDH 2JIXD 2YPLA 1HSBB 3GSWA 5ALCL 4KKBD 5EORL 4E41B 4M4RA 4JFOB 3ARVA 3C5JA 1PY9A 1FFNB 2F15A 4LLWB 5DFVD 5L8KB 5I1KH 3IVKA 4KTEH 3RTQA 4NRZB 1ONQA 3HC4L 4PJEF 1TNNA 1OARH 3RZCB 1CBVL 4FG6D 4GXVH 4UILL 3TM6A 4K71B 3BP6A 4PBVC 3CFJB 3CFDA 4JFDA 1HINH 1F42A 4P2QB 4XH2B 4BSJA 4Z6AT 3H3KA 4NM4L 4ELME 4R4FH 5E8DL 3EDJA 1DE4A 5CBEA 4OAWA 2HWZL 5IB2B 4O5LL 4HKBB 5DJ6B 1JFQL 2NY2B 4TNVK 5C3LD 1ADQL 1WZ1H 5E1HB 3T8XB 5J6HA 1XIWA 3ES6B 2IADB 1BOGA 4OGAC 2GJ6E 5A3IC 3D69B 2FX8H 5T33L 4NQCB 1D5MA 3EYFA 5HHPB 3NPZB 1GOHA 2HTLC 1J1PL 4WHYH 4D0CB 1QBLL 4OZIF 5JDSA 4MNHA 3GMOB 4PJDF 1IKFH 4L8DB 2VZTA 3CFKA 4XNMB 2EDNA 3QDJB 2XN9E 1WWWX 4HUVA 5GGVL 2DD8L 3KNBA 5D71H 4MWFB 5F7WC 2DQUL 4YFEA 1JBJA 3KYKL 3N50A 5EOQH 5HYQB 4V1DE 2XKNB 3QEQB 5J9PB 2HA1A 5IQ9B 4UTBH 1RZFL 5EU4B 1NC4D 3SDDD 4NPYA 1IEAB 1KLFA 3IDXL 5EU6B 43C9A 2FWOA 2XPGB 3QUXC 4L9LA 4TSCH 4J3SA 5TFSH 3L7EA 4DN3H 3VXMA 2XI9A 3U83A 3CUPA 3MMEA 3PXHA 5MHSE 2EDDA 3DX7A 5EUOB 2C1OB 2D03H 2YUVA 2VSCA 4NKDB 2RCSL 3CPLB 5DJ8B 2ZWLT 5C07B 3S6CA 2W0KA 1XGQB 1BQHB 2HFGH 4U1HB 8FABA 1K85A 3MV8B 2WUBH 1MRFH 3T3MF 3D3VB 5A16B 5BO1L 4TUKH 4KROD 1NMAH 2X4OB 3WUWA 1NGQH 3WS6A 5E8NA 2V2XB 4XRCA 3VXSB 3QNYB 5F1KC 4M7JL 4BM7A 4HPYH 4GAYB 2GY5A 4C57C 4PJ9B 2W9DH 4K71C 1OP5K 3VFGL 3IU3B 1J9CT 3JVGC 1D6EA 1HHGA 5JQ6H 1Z3GH 1OTSD 5LKNA 3K74B 4Q9QL 2F5BL 5T3XE 3LEXA 4W6WB 1SM3L 4O02H 3R4DA 4CNIA 3NCJH 4X6CB 1WFOA 1E4XI 3DECA 4LKCA 4PRNB 3PGDB 4Y4FD 1JRHH 4N0YL 1EEQA 4W4OC 3RY5A 1GL4B 2DM3A 3RX5A 5JW3H 4G43A 3QXWA 1UJ3B 3GKZA 1OT2A 1B0RA 4WWKA 2NY6D 4HH9B 5T5FL 3FQXA 3FMGH 2D9CA 5C92A 2W0LA 3PE9A 4R96A 1A6UH 3QH3A 4LSQH 1JE6A 5DMGC 3D2UA 5DRNA 1VGEH 1C7SA 2H6PA 5F9WB 3QDME 4PV8B 2R69H 1XR8B 4YWGL 4YDVB 3GBNL 5D7SL 2A6IA 2QADD 3FT4B 3HE6B 3PV6B 2YD1A 4QOKA 3ULSB 5F9OL 1N3NA 3DUUA 3EJJX 3L3DB 4XVTH 5HYIA 3C8DA 4H1LG 4GKSB 5J3HC 3THML 1X5AA 4JGUA 3IDJA 6CGTA 5HHMD 3KPNB 4OV6F 1XF4A 2Z91B 5MENA 3QFJB 2E7CA 3OBAA 1UCTA 4X7EC 2OTUA 4XPAL 1NEZG 3WFEL 2O5YL 3DSFL 1IC5H 5JXAH 2AI0H 3N1QC 5JZ7D 1X6NA 1S7VB 2RQ8A 1LD9A 2V7HB 4J1UA 5FGRA 2A9MH 1MCKA 3STLB 3V0VB 1JPGA 4N5EC 5C0FB 1WWBX 4PY8I 2ZSVA 5I30H 4YPGB 5C08D 4QNPF 5B38A 4DJMA 1G7JB 4NQDE 4V2CB 4Y4FA 2DB8A 2UVFA 1DLFH 3DV6B 4ONHB 4P99A 1X5JA 2W59A 4MYWB 2AAVA 1CQKA 1JHLH 2R1YB 1YY8B 5KBNC 3SGEI 1KCSH 3QPQD 4N1CA 1KNOB 2A6DB 5DMIL 5CSBA 1LQSR 1VKXA 4D94A 5CGYD 4KKLD 4KK8D 1T1WB 3FO0H 5SWSA 4RMVA 3KLAA 3ZKMC 4PJ7B 3L5HA 1RVFL 4HZLA 3WBDA 3DX8A 5B3NA 3RWCA 1F2XK 1VPOH 1UXSA 3CC5A 1JZ2A 4PJ9C 1KN4L 1MLCB 4WUUA 5IHUL 3W39B 3WFCH 1W72B 1JYWA 4W4NA 3HMXA 1NCDL 3KDMA 4N0UA 5C8JA 4YHKH 2NXYB 5D2NA 4RFNB 1Q8MA 1B2WL 1SEBB 3QXVA 5F7MC 2PNDA 4NKMA 4I3SH 1UJ3C 3U0TA 5I0DA 3HG1D 4FTVA 3GSQB 2BOBB 3JUZA 5JHLL 3RWGB 1MEXL 2E9IA 4DK6A 2CJUL 3AREA 1L7IH 3EYOB 3NA9L 3MRKB 4KMTH 1IAIH 1CICB 3FT2B 2EO1A 3IS1X 1N0XL 5GZOD 5F9WC 2FD6H 3Q5TA 1D5ZA 1J05A 2VQTA 3MNZB 3GIZL 1NAMA 1C5DB 1PEZA 3LN4B 4YGAB 5IK3B 3HE6C 5E6YA 3MACL 2EDTA 5EZLB 4CN1A 2BXYA 1KXQE 4HV8A 3VXUA 3W11C 3MJ9A 3JV4A 3TF7C 4GRWE 4HF5H 2CK0L 2V7NA 3BGFB 4WVRA 4UTAH 4H8WC 3BW9B 2NY7L 5AZEL 3SO3B 1K4DB 5DVOA 5FGBA 1MCHA 1KJVA 5DS8A 1BZQK 1GIGH 3ZE2E 2BVUA 4H26A 4D8PB 5D2LB 5FECA 4NZUL 3TBSB 4JY6A 3P0YH 5J0BA 3OB0K 2AJUH 1A1MB 3LKRB 2QQLL 3U6RA 4JFEA 2PTTA 5D70L