2VB5A

Solution structure of w60g mutant of human beta2-microglobulin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDGSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BETA-2-MICROGLOBULIN
publication title The Controlling Roles of Trp60 and Trp95 in Beta2-Microglobulin Function, Folding and Amyloid Aggregation Properties.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vb5A00
1BZQK 1YEFH 5D7JA 5E9DB 3TO4B 2QHRL 2MJWA 4F7CA 4ENEC 1A6ZA 4YHPB 1TQCB 3KPSA 1QBML 5JXEC 2X4NB 1W72H 3F7PC 3MREA 2XG4A 3HC0B 3QAZC 1XCTA 1CL7I 4LLDB 4Z7WB 3RAJH 1YUHA 4WEBH 4F9PC 4KXZI 3HE6D 3LKOA 3BH9B 3RVWC 4JM4H 4P5MB 2CSPA 3UC0L 3UTTB 4ODTL 3CK0L 5JPMB 2CQVA 1REIA 1OM3H 2NX5E 1FBIL 4M6OL 3V7MA 1Q9KA 1U95B 3IXTB 1F97A 4HKZA 4JREB 3UP1A 3RY6C 2XZAL 5B4MC 2XTJD 3Q5OA 4PB9L 1OP5H 4XGZA 3ZDXE 2BSSB 2EDWA 4YPGA 1AQKH 4PJ5B 3VXME 1F6AB 5TE4L 4HCRL 3O6ML 1CL7H 5A40E 4R4NC 4UQ3A 1T7WA 4JFOA 3WBDA 2OQJA 4P48A 3WXWL 4FQ2H 3T1WA 4DW2L 4Y4FA 2UY7A 5BV7C 4OFYD 1T22A 1N6UA 5GJTH 3V5DA 5IM7B 3KPQB 1PDKA 4Y1AD 2AERT 2IPUG 2R9HC 4ODHH 1B0RB 3UPCA 4X5WA 1VA9A 2NY0C 4DUXA 1ZSDB 3BRGC 3QQ9C 2R0WL 2DTSA 3MA9L 5ICZB 2NY2C 5D7IA 6FABH 1CU4H 4M02A 2CRIA 4W4NA 1LEIB 4BFIB 4KJYA 4Z8FL 1CS6A 4G9DB 2PYED 2DWEA 3RPIA 2P8LB 1UZ8A 4FQ1L 5DJCB 1H5BB 1G6RL 4G8FA 3MLTA 2OI9C 1CBVH 4XP4L 4BZ2H 4N5ED 1TJIL 3DI2B 5HYJD 5EUOF 5C0DA 4FZEH 1MFBL 4GMTH 2O61A 3QUYD 4JO1H 1U3YA 4K3DL 1LEKA 1U91A 3ARDD 4GRWF 3W9DB 3QDMD 3DX7B 5EIIB 4X9FA 3BSZL 3F6IA 4LARL 1KT2A 3NZ8A 4W81A 2X89A 4W6XB 1TCRB 2AJVH 4XPBL 5EC1B 3FO1A 1QSFD 4Z18A 4PJXE 5D7KE 5MENE 4HH9A 1VGKA 5DJ2A 1U3HB 5TF0A 5FDWA 1IGTA 3SO3B 1X5ZA 4LSQH 5D2LA 4EN3A 1ZTXH 4L3AA 4I2XE 3U0TB 1EFXD 1DFBL 4XMPH 1YEIH 4Z7OF 1KFAL 3L7FA 1BQUA 1DN0B 3IFPA 1H15A 1B9ZA 5TQ2L 2Q20A 1F42A 1DBKH 3DGGB 4NKIH 4AT6B 4KMLB 4JFDA 1K5NA 2Z35A 1N6QH 1A14H 1OGAB 3VXOA 4NGHL 3QJFB 1CE6A 4M1CC 4MNQD 3MNWA 5DUML 3DX8A 5ETUB 1MLBB 1BEYL 5HGAA 1MFAH 1QNZH 5D72L 3KAAA 3ZKXB 1MRDL 2BSTB 4P46D 1FH5L 1KYOJ 1CXHA 1N59B 3FFCD 1ZLVK 2J5LB 3L5XH 4OQ1A 3VXSB 2ATPA 4LCCB 4YE4H 2PXYD 1A1NB 3MRLA 1FZMB 2Y6SD 4HKJA 4HUXA 3JWDH 3BZ4B 4KDVA 4YR6B 3ZE0E 5FYKU 1GPOL 1M7DA 2CLZB 3B2VH 4G6KH 4IOFD 3WNMA 3ZHLA 1G6VK 2YRPA 5TQ0H 4UQ2A 3MUHL 4MXQD 5MEQA 4QXTA 2P5WB 2VE6B 1MEXL 5JOFA 1L7IL 2JB6B 2I9LA 1KNOB 1RZGB 4ZFZA 5F1OB 4OD3H 3IKCA 4JR9L 1BQHG 1O7SA 4PJHF 4G6JH 2BDNH 1C5DA 1PQZB 1EUTA 3V4PL 3ARED 2VUYA 1FNEB 3SPVA 1JZ4A 3QPXL 2ARJA 2CXKA 3QDGD 2V7NB 1OSPH 4ZOCA 4R7DB 3NCMA 5D5ME 1WZKA 1Q0XH 1J1OH 1ZHKB 5EZOL 4NZRH 1HHIA 3RP1A 5C9JA 4KKCD 4K94L 3T1FB 1AFVL 5IFHL 5FYLE 4JO3L 2A77H 1A6PA 5I8EB 3G6DL 1NDMA 3N85H 4RGOH 3HZVB 5IHUH 4JFYB 2UVEA 3ARBC 2ZCKH 4ZFOB 3V95A 1K4CB 2LTQC 4JO4H 4H88H 1JGEB 4KMTH 2C3VA 1S5HA 1S9YB 1ZLUH 1M7XA 1C08B 3HFMH 3SE4C 4Z7QE 2Q7YA 3GB7B 4HC1A 3B3IA 3QUKB 4RFNC 4IRJA 2AXFA 3WUWG 4FFWC 1Z9OA 3NPZB 3LEYH 4Y4HB 4XC1H 1OB1B 1YN6A 5HBBA 1IAIL 4JKKA 1I1YB 3ECBA 2BC4B 1J8HB 4XAKE 4JFHE 3C60D 5LGHL 4ZPTA 15C8L 2WBKA 3ZT6A 3I9GH 3TBWB 4U31A 2ZOLA 3UTZA 2PW2A 3QPQC 3Q0HA 4M61A 3QWRA 4Q6IC 5IG7A 2JE8A 1NDGA 1CDIA 1HNFA 3GO1L 3VGEA 4JG0H 3H6JA 4F37F 2HP4A 3EFDL 2AJYL 4NQXA 4K07A 1ZLWK 1Q72L 5DRNA 3RUGA 1GZQA 5A3IC 3P4LA 3S4SA 1RULL 4RSVA 4KJWD 2BXZA 3LDBC 5CP3A 5C0BD 2DQIL 4APQB 1ZHLB 5D9SA 3I6KB 4NHUB 3VFWB 4NZJA 3AUVA 3BAEL 3P73A 5LKNA 2EO1A 4WFED 4UIKL 3QIUC 5SWSA 5AD0B 1GOHA 5E1HB 5I30H 2RCSH 4ZYKB 1MIML 3GJEA 4NM4H 1Y6KR 4YQXH 4E0RB 2QR0A 5A1AA 4IIQB 5GHWL 3O3AB 5FF6A 5HHVL 1QYGL 3SY0B 1ZHBA 5JDSA 3WHXA 4E42B 2XFXA 3EOYG 5DI8A 3OQ3B 3ILQC 3OR7A 4Y5YC 1Z5LA 3V2AR 2A74A 3FTGB 3Q1SH 4ONFL 4ZXBD 1SYVA 3OGCA 4FFVC 4FTVA 3VXQB 3TF7C 1GGYA 3I3EA 4HGWA 3BYYA 3FONA 4HK3N 1UM6H 2NR6C 4XH2A 5JA9A 5HJ3A 1TZIA 5JORA 4QRTB 1N3NA 2ZUQB 3GMMA 2EEBA 5FO9A 2EDFA 1S9KC 5HHXH 4MAYA 2A0LC 2Z8WC 4G5ZH 1CFVL 1NMCB 4QRRE 5DJ0B 3MCKB 2AV7A 5TF1H 5ESQB 4PJCB 3U6RA 5GGVH 1Z9SA 3RKDC 4AM0B 4P3CL 3O41A 3Q6GL 4O9HL 3WFHB 5EUOE 2MSPA 2IMMA 1JF1A 5GGRA 2F8VA 1BZ7B 1A7OH 1NGPL 3FFDA 3LQAL 2JIXA 3JTTA 3SGKA 3STLB 1NGXB 4GRWE 3RDTC 5FFLA 35C8H 3RVVC 1JV5A 2DYPA 5H37H 4ETYA 5KANI 3QI9A 3E2HC 3EDEA 3SHSA 2BRQA 2FGWH 4H8WL 2GKIA 4QF1B 1FNSL 3O6KL 1G9NC 1TNMA 2VLKD 1K2DA 1IAOB 4HK0A 3BP5B 5IVOA 4OZIF 4OFIA 3TEUA 1H3XA 5L8LB 2V2WB 3B2UD 4CVZA 5BZWB 3R0NA 3VWJD 3BPLC 2H8PB 3L3JB 1JZ6A 2VZVA 5CEYB 2HT3C 4S1RH 5DZOA 5E6IC 2UYLB 3VXMB 1X5YA 4Z7OE 2R0ZH 2GITA 1NAKL 2COQA 5HTSA 2BHZA 3QCTL 2FO4A 3VFMB 5ALCL 5CZVH 1RUQH 4FFYH 5TFSL 3LKQB 1T5XA 2NXYD 4MAUH 3OKLA 4WIQA 3PDOB 1FO0A 3VFNB 2A6IA 1E6OH 2NTFB 3O8XA 5FA3B 4CADA 4TNWK 2UWEF 1F8TL 1F45A 3ULSA 4YXLH 3LS4H 3RL1A 4MA8L 4NUJB 4PBVC 5KJRL 1SY6A 2E8ZA 2EE9A 1FG9C 4P4RB 3MGOB 5JO5B 5E03A 1T83C 1IM9D 5FECA 3AU1B 2MPAL 4Y5XC 3MYJB 3QNZA 5IT2H 1I9RH 1CI5A 3TLRA 3D85B 5T5NG 2ZCLH 4XPTH 4KVNH 1JYXA 3L5WB 1KXVC 4HV8A 3HMWH 1B4JL 4X9BA 3O6FA 2X09A 2B5IC 3ULVL 4X9GA 2XI9A 4XNZC 4M7KL 1JWUA 3X12A 1DANU 1EVUA 4YWGL 4HGMA 3TCLA 3PIQB 2N56A 1T3FB 2X4QA 4YDVB 1DQDL 5LQBL 2YUXA 4PJHE 4C56E 4F15B 4I18C 1MFCH 4XBEH 3U9PL 1YYML 1KEGH 3W0WD 4XBGB 3N9GL 5TJWK 2FEDD 3STZB 1LO3H 4QHMB 3RU8L 2UZXB 4I2XB 4GAYB 2K1MA 5BVJB 1UXSB 5CBAA 1TFHA 3ALXA 2RBLA 4NZTH 2D03L 1CFBA 1DP0A 5GZOC 4YXHL 1NCWL 1XT5A 3VXRE 4N68A 3RL2A 4FHBD 1ITCA 4KKBC 4OCRL 3IYLW 4JZOA 3GI9H 5IFJB 4PS4H 5B39B 3LY6A 4P4KB 2QQLH 5I1KH 5HVHB 2W38A 3DO7B 4EUPB 3TZVA 4HWBH 4TUOB 5INCA 1OTTD 2W65A 1N8ZB 5EU6E 3RWCB 4JM2D 3W9EA 4TQEH 2LE9A 3RBGA 2A83B 4EQ3A 2YBRB 1TXKA 3NCBB 2R0KL 3L3GB 2VNCA 1MF2H 2YPLE 2CDFA 4LKXA 3RZCD 2NLJB 2NX5D 1U8HB 4POZD 4OCWL 4PRIA 4AIZB 4OGYL 4JQXA 3S37X 3QCVL 3A6BH 1BAFH 3BT2L 5E2VH 5T5NF 5JOEA 5FYLH 4X4ZA 5F3BA 4M7JH 1CXFA 1NPUA 2XWBB 4LIQE 5KOVC 2Q6WA 3NFSL 2E7MA 4DGVH 5LGJA 5KSBF 4CKVX 2YEZA 2DIAA 4QWWD 1ZKAA 5C07E 1A64A 4R8WH 5DK3A 1A5FH 3LPGA 3MXVH 1UH2A 5HGDB 4TSAL 4KZEL 3MRDB 1Q9LA 2GJZA 5FHBL 1NCUA 3MUGB 5EBLA 5EU4A 4PJ9C 2XWTA 3IAPA 1JZ8A 3MX0A 2XY1A 3PGDA 1TJGH 3MJ7A 5D5MB 4ZFFA 4U4BA 5ADPH 2UV3A 4FFZH 3VG9C 1FVEB 3CXHJ 3HRZA 3IDYB 5I71C 4HJJH 2P47B 2X7LB 1EGJA 5D7JC 5HDLA 5FXCH 1ETZB 3OX8B 1ZT4B 3C8KA 1JJUA 3H3PL 3EUUA 5E8EA 2GCYB 4JFZH 5IIEB 2Q86B 4YXKL 4CVUA 5DR5H 1VADB 1Y0LA 1A3QA 2XNAA 5E4IA 4PJEA 1VENA 3RWFA 3WLBB 2DLFL 5E8NB 2K9UA 3GSVA 2R56H 3KJ4C 3D69A 5D1QB 1IBGL 4N8CH 3HPLA 3GJFB 5BMFH 3SE3A 1I9EA 2QKIB 3GIVB 1OWWA 5MEND 5D7KD 1EX0A 4HFUH 2GSIA 4IDLA 1J7VR 5B21A 5EC2A 4OM0L 4O2EA 4IEFB 2BVOA 3EO1B 3C8DA 3RZWA 1S9XA 3PWJA 4GUPA 2VISB 3QUMH 4HUVA 3NIFF 4HIEB 3WIIH 3LEVL 1HKLH 2A9NL 3O3DA 4GXVH 4Y4FC 1RUML 3TWCH 1CLZL 1L7TH 3UO1L 2V5YA 4UTAL 3QNYA 4J2XA 1SBSL 3IT8D 3OKDB 1K6QH 4PREA 3DYMA 3WSQL 3JBG7 2ZPKH 1MVUA 4U6YA 1U6AH 1A4JA 2OSLB 2E9WA 1ES0B 1A2YB 1NGYA 2P4AB 1JL8A 3QULA 4U6TA 1JCKA 4U3XA 2GSGB 3NA9H 5FB8B 4JY4B 2A6DA 4M1DH 4OZIE 3TO2B 2DM7A 5C6WH 5KSAA 1MRFH 1WICA 2I60H 2DTML 5C6TH 3DETD 5ESVA 5ISZE 3MRIB 4RFEB 4XCFL 1NMAL 3WN5A 5F8RC 4XNMA 2Z92B 1A4KB 4HXAL 4LSRL 4ZTOL 3VFPB 3U1SL 3CMOH 3MLVH 4UT7L 4GRWH 4PJAB 3U4EA 1FSKB 2R2HA 3D9AH 3SDAC 5A16B 4JDTH 3TVMB 1KEML 1WBZA 5C08A 2W0PA 2UWEE 2HFFA 1PYWB 5H35B 1OSZB 3QZWB 4NO0A 4O02H 5F72S 5F7LB 3VXPA 2BOCB 2AJSL 4PV9B 5GGRY 3D25A 4NZDA 1V3MA 2ZSWA 3CZFB 5D2NC 4Q0XH 4DKEH 5FYLD 2R4RL 5I19L 3JV5A 4X80H 3QUZD 2NNAB 1XGYH 2FJHA 3EHBD 4I3GA 4Z0XA 4P9ML 4WWKB 3W11C 2ERJB 1X7QB 3T0EC 4E5XA 3SBWA 1AGEB 1WWCA 5INDB 4NRZB 4DTGL 3HZMB 3X3FH 4LQFL 2IF7A 2BERA 2CIIA 1D7FA 2BSRB 2CKBL 3OKMA 1EAPB 2VITA 1HQRB 1RY7B 3HAEH 1NUNB 4O2CB 4X5XB 5F96H 3JV0A 2A6JB 5IBLD 4L4TD 3D2UA 3MGAA 4LIQL 1FL5A 3VD9A 3RGVB 1OY3B 1AHWA 3VI4F 5I1CH 1WQVT 4JVPA 4HZLA 4YFLI 5HI4D 5D7LE 1HHGA 3MACL 4R4BA 1ZGLP 4PJ7B 1JK8A 1IAIM 1GC1C 4OZFA 3S96A 4JB9L 3DV6B 3LEXB 5ITFA 1KIQB 5DF0A 3VH8A 4ODXB 3CSGA 3DOSA 1IVLA 1GZPA 3IDXL 4LLYB 1WC7A 4MVBC 1EFQA 4U6VL 5MERB 1LE9A 4YO0B 1MAKA 3GGWA 4MA7L 5GXBB 3QSKB 4L9LC 5LVEA 3GUTA 3GK8L 1DQTA 4HBCL 5SWQA 3KXFE 5BOZG 3HZKA 5HHPA 1FVCB 4OT1H 2EE6A 3K8MA 4Y4KC 5GJSL 3S34H 5FYKE 4TRPL 2APFA 2VAAB 1J5OL 4QTHA 4HMCA 4HDIA 3QXUA 4HULB 5FYJU 4B5EA 3DIFB 3MLYH 4P23D 3MR9A 2H2SD 3MCLH 4OIBA 2YD1A 1AGFA 4L1HA 1XGTB 4RMSA 1I7RB 4NPYB 2VXVL 3MUZ1 4X4YA 5KSBE 2FL5A 3EJJX 2W0KA 2OTUB 2B1HH 4XPGL 4JFEA 1RJYA 3DUSB 3UYOD 7FABH 1TPXC 5C0AA 1AJ7H 1U93B 4H26A 2F54A 1NCCH 1YNKL 2GAZA 5F88A 3OR6A 1XAUA 4YHKH 5JW4R 1J05A 4K7PX 3KLSA 3C5ZB 2NXZB 3GM0A 4XWGL 3H9YA 3PL6D 2C1OA 3QDJD 1I85A 1LEGA 2MKLC 4U1NB 5D70L 4HXBH 1F02I 4AY0A 3GSNH 1G7JA 4QRRD 4M1GL 1EO5A 1NBZB 4U0RB 5HHNA 1HOCA 3DTXA 4LDEB 3VXRB 2R1YA 1P1ZB 2WP3T 2DMBA 1TVBB 3MLUH 4JRYB 1MJ7L 3PP4H 1GXEA 1IGMH 5GSVB 3TT1L 1GRWA 5GS1B 3I2CH 1MHCB 3SDCA 4FZ8L 1NCTA 1QSEA 3FQRB 3OKOA 4LRIC 3U0PA 4U6XB 2UZIL 4J3XA 2EE3A 4ZFGH 1K8DA 1JFQH 5ABDE 3TA3C 4NCC2 1EHNA 3HMXL 5KW9H 2APWA 5EU6B 4XVSH 4M3KB 3FCTB 1F3DH 5CZKA 1S7RB 2I24N 5E00B 1H8OA 3MJ8B 3MV8E 1A6WH 2F58L 2DJSA 1OLZA 2IBGA 2OL3L 1JNHB 4ZAKA 4MNHB 2CKBB 1T66D 2J3SA 5JNYA 5JLZA 4KH2A 4HD9A 4NC2B 3ORJA 1B4RA 4M8QA 2V2TA 2I5YH 2A6KA 2W9EL 3NIFE 3ZHDA 4L8CB 4PRHD 3HG1D 1T4KA 5C07B 2G9HB 4Z7UE 5E9DA 4GXUM 3CFDB 4I77H 1BQHB 5M94B 3WFCH 1MNUL 2BOBB 2X4NA 5AZ2L 1BQSA 5E7FA 3FOMB 2G60H 4LLDA 5AAMA 4G7VH 4XHJD 1AKJB 1B2WH 3UZEA 4MAYC 5DUPH 3BH9A 3TN0D 4JRWA 4P5MA 1BPVA 4ZOBA 1BBJB 1MCRA 2J8UF 3UTTA 5JW5B 5JPMA 4XMKH 5IBTL 4JZJB 3RI5F 1U95A 3IXTA 1QTYT 3K1DA 1S5IH 5DHXB 4KTDH 3KVQA 4ZOEA 4HF5L 3ZHKA 3RWJB 3WEXA 4RWHA 2AXJA 2FX8L 1H3VA 4GSDH 4PJ5A 4KVCL 3MROB 1F6AA 5IB5B 3QI9C 5EZLB 1RZ8B 4RWYH 4WDIB 3E0GA 1J12A 4C56D 5EOTB 5IEHB 4UBDD 1M4KA 5EIVA 2FEEL 4WUKH 1FFRA 5IB2B 5J13B 3ET9F 1P6FA 4UB0H 4I0PD 3NABL 3R4DA 3WUWB 4LU5H 1JP5A 5IM7A 3KPQA 2KL6A 2ARWA 1KELH 4PFEA 1B0RA 3RAJL 2OZ4H 4WEBL 4V1DE 2RHEA 3NPSC 4Y8AA 5F7YC 3EO9H 4WNQB 2FSEA 1RZ7L 1ZSDA 3CDFA 3OWEA 5ICZA 2YA2A 5I74B 1YQVH 1LEIA 3OAYH 3RTQD 2GK0B 4G9DA 5T33H 2P8LA 1X5KA 1KTLB 5DJCA 4GLRI 1DE4B 1H5BA 4LKCB 4OIIH 3BIBX 1MRCH 5EO9A 3O8XC 4OGXL 5IF0B 2NY3C 3D3VE 3NVQA 4NO5B 5DEGB 5EO1B 3SOBH 4D0CB 2PUQT 4JHBA 1HHJB 3SCMD 1I9JH 3JWOL 4ZUTB 2WWMD 5EIIA 4PJ8D 1I9IH 2YPLD 4FQ2L 3O9WD 1OQXA 2EXWC 4C83A 5IB4B 1MJJB 1CDHA 2GW5A 5DDHB 5EC1A 5GJTL 5KVFL 1TJHH 3O45B 5ISZB 2FEEI 3ARGD 3VI4E 1U3HA 3UJTL 1CGVA 4K7FA 4XVJL 4CNIB 4P2RD 1HXMB 5D93C 3U0TA 3ARFC 4NRYB 2OL3B 3MOBH 5GSRA 2OLDA 4IMKA 1CU4L 1QSFB 4TUKH 1CIDA 3A6OA 4LP4A 1DN0A 1CFNB 2YMXL 1JUFB 4JKPL 3R06B 2CLVB 3SQOH 4AT6A 4CAGA 4HJ0C 3U82B 1TLKA 1TENA 2G75B 1CBVL 1Z2KA 3WLWD 4BZ2L 2BVUA 2L0DA 3QJFA 2FLRT 4FZEL 1MCLA 3F62A 1IM3B 2AABH 2UWEB 5ETUA 1MLBA 4JO1L 5IFAL 3FZUD 5E8PA 2DM2A 3BGMA 1MFNA 2NY1B 5F93C 4N9OB 4BSJA 5JQ6H 1ZANH 1YECL 4LSVH 2AEWA 1OARH 3VXSA 2AJVL 2R1XB 4YDKH 1KF9B 2R29H 4LCCA 4S10A 1A02N 2DWDB 1A1NA 1FZMA 2NYYD 1TZHB 3BZ4A 4LSQL 5J12B 4YR6A 3FFCB 1MAML 2CLZA 3L3IB 4XMPL 2AJXH 2EZ0C 1MREL 5I8KH 1DANT 2P5WA 2VE6A 3MBED 4PGEA 5I0ZA 1WT5A 2D7TH 1FYTD 5D8JH 2DJ4A 1T2JA 1DBKL 4NKIL 1KNOA 1J18A 1RZGA 1U8OB 2E7CA 3K0WA 1QFWM 1N6QL 3K2UH 2CR3A 2IALB 1ND0B 4PIRF 4N0FB 3VE0B 4HCRA 5KZCD 5E2TL 2ZG1A 5DMIH 1PQZA 3OB0H 1MCJA 1MFAL 1QNZL 1JPTH 1D9KD 1FG2B 1FNEA 3QRGH 4WHYH 3VFTB 5L7XL 1AGBB 1HYSC 3AMKA 1FYHB 2GIYA 5D7LB 4R7DA 3CAFA 1C5CH 1M6OB 3ZTJH 3L5XL 2D7PA 4YE4L 1KPVB 3A6CH 3PWPA 4R7NB 5L9DH 3T1FA 1NCAH 5IBUG 1FZJA 3IFOA 1I3GH 3NGBB 1HH6B 5I8EA 4HX1A 1S7WB 1G9MC 1G6RA 1B88A 3OJMB 4G8GD 5D1XB 4J4PC 4IOSD 2ZKHL 2ZUWA 4JFYA 2QJDA 3KXFB 4YPJA 4NSKA 3DMMB 4ZFOA 2W92A 1K4CA 3AS1A 4GBXC 3RWGA 1AP2B 4HWZB 1LDSA 1JGEA 4OD3L 4RGMB 4PP2B 1S9YA 1C08A 2DKMA 4G6JL 4U1HB 5DHVB 4KRNA 5ALBH 2BDNL 3GB7A 1FNAA 3QUKA 1D5XB 2HLFC 4Y4HA 5DMGD 1OB1A 2B4CH 1CQKA 1I1YA 1BM3H 3OXSB 4QTIH 2ADIB 4JQVA 4XXCA 1S7TB 4S0TD 2BC4A 2LU3A 1J8HA 4D3CH 4MB3A 5KSBB 1VEOA 3QFDB 4QHLA 3TBWA 2AJ3B 3IDIB 3DROB 2C4FT 5B8CC 2A77L 2H6PB 2FJFA 1QO3B 4KROD 4DN4L 2IAMC 4IRSD 1T1XB 2ZUSA 1WFOA 4KTEL 1UWGH 1XF5B 4H88L 1WK0A 2J8UE 3B8YA 3VCLB 1ZHLA 4APQA 3HFML 3I6KA 3VFWA 5EIQA 4EVNB 2E6JA 3ES6B 3C5JB 3UMTA 4F58L 4P5TD 5DO2C 3LEYL 4XC1L 2XXMB 4ZYKA 1U8NB 4KQ4H 1UH4A 3QAZB 5C0BB 1JPGB 2X4PB 4IIQA 4C59B 3O3AA 1FLRL 3QH3B 3INUH 5ICXB 3SY0A 3LRSA 4B53A 4E42A 3ZKNC 1KB5L 3V52H 25C8H 1NANH 3FTGA 5FOJA 1YEDB 4LLVB 3MV8B 2FO1A 3L3KB 1T0MA 4JGJA 4F3FA 1QR1B 1BREA 3VGBA 3VXQA 2QADD 2YD5A 1S3KH 4PP1C 5ACZB 3KJ6H 1UG9A 3D1MC 4A2MA 1OP5K 5T3ZE 3OZ9L 3ULUC 8CGTA 1NAMH 4LK4A 1S9WB 1F90H 4YUEH 2X4TA 4QRTA 4AG4L 4P3DB 5JHDB 3L3OB 1ZVSA 3DGCR 3VFUA 1URLA 3K1KC 3V5HB 2YK1H 4HWEH 3MCKA 2B1AL 4QXGH 5ESQA 3S35X 5J9PB 4PJCA 1UENA 4AM0A 4Z7UB 2IQAB 3B6SA 5I30L 4BH7B 3CVIL 5BV7B 3VRIB 4JPWL 4NM4L 5ELIA 3WFHA 4YQXL 5GZND 2R8SH 4PLJD 1BZ7A 3SGEI 1C1EH 5D2LF 4E41B 2VO5A 2NY0B 3STLA 4YDLC 4XC3L 3FT3B 4NQUA 4TUJB 2QQQA 2NY2B 3RBSA 4H25B 5DHYA 1B0WA 2V17L 3G6AA 4F57H 3O2WL 4JZNB 4QF1A 3MODH 2OI9B 4LQ1A 1IAOA 4NBYB 3BP5A 1IAKB 1UM6L 5HI5C 1DBJL 4PLKD 3VMOA 4RA0C 3FRPG 3QCUH 5BZWA 2UY6A 4MA1C 2H8PA 4F9LA 5IMOB 5KSUB 4I3SL 3VWKC 2GYSA 3ZT5A 5CEYA 1K4DB 5HHXL 2UYLA 5D6DA 3SBWC 4CL7A 3KWWB 5E5UB 2X9WA 1CGTA 3FB7B 1X3DA 3QR2A 2FD6L 4NRXB 1UCBH 1JNNH 3ZL4L 3BYTA 3VFMA 2HTKD 1N5AB 4AIXA 2NY4C 1RHFA 2PETA 1RZJC 5FHAH 2AK4A 3PDOA 2QBWA 3VFNA 5A2KH 3OMZA 4NNPH 2NTFA 5FA3A 4DN3H 3WIFB 1P9MA 2ZUVA 5FM5M 3I6GB 4V1DB 4G7YL 2J88H 1KC5L 4NUJA 3GRWH 5IP4A 4P4RA 3MGOA 4D9QE 3HCVB 4LCIL 3MJ6A 3MC0A 2E7LC 3AU1A 3NCEB 2FIRT 3MYJA 3MV7D 1KJ2H 1TTGA 3UJJH 1KIPB 1UQSB 3L5WA 4P3WA 4FG6D 3D3VB 3CD4A 9CGTA 1PG7W 2KZWA 2R69L 4R3SA 3TCXA 2HJFB 5A2LH 2R0ZL 3AS3A 3FO2A 5J06A 3PIQA 4K9EL 1T3FA 5CZVL 3OL2A 5C09E 4UDTB 4MXWH 3HI5L 3LV3B 1KB5B 4H20H 5B4MD 1E6OL 5C2BL 4ZDHB 1IC1A 3LD8C 2XQBH 3CLEH 3HE7C 4QRQA 3L95B 3STZA 4QHMA 2KUTA 4YXLL 4RCAA 3BH8B 3LS4L 4GAYA 4I2XA 5I1DB 3HC3H 4Q2ZB 5BVJA 1HINL 5F44A 4XVUD 3FO9B 3BD3A 3DYPA 4MD5B 1YC7A 4U7SA 4N90D 2OM5A 4MNGA 5IT2L 1YJDH 2ZCLL 3T0AA 1RIHH 1MHPL 4WW2A 4ZMAT 5IFJA 4YHZH 4M7LT 4OGZA 4IRZH 5CILH 2HT2C 1NGWA 4P4KA 1E6JH 4LLMA 1J88A 3THMH 4EUPA 1JE6A 3DO7A 3ZTNH 4KI5D 4XMLH 4FQXA 1I85C 5KAQG 3K74B 4KK5D 5E7BA 1N8ZA 3RWCA 3U0WH 5FYJE 2Y72A 2YBRA 3SKOA 5J0BA 4NP4H 4D2NA 1MFCL 4XBEL 3L3GA 3SDYH 1LO5B 3ZKSD 2VDNH 3O0RH 2NLJA 1KEGL 1U8HA 4Y2DC 3BWAB 4AIZA 4BFGA 1LO3L 1WSST 5ICYB 1CK0H 3RUGF 2H26B 4RQQB 3ARBB 4NZTL 2LTQB 2XWBA 4XB7A 4YDIL 3D18B 1INQB 1E4XL 3WHE0 2EYRB 4UTBH 4OCYL 4RFNB 4PS4L 4UNTA 1DBAH 4N1EA 2QQLL 1ORQB 4OCSH 5TGBB 4DVRH 3R8BB 3IU4L 3MUGA 5BXFA 2LVCA 3PUCA 2IFGA 5GGTH 4D9LH 5D5MA 4YX2H 3SJVE 1A3RL 5BVPH 1FVEA 1PG7X 2Q8BH 3OBAA 1ZGLM 2HJKB 4Q6IB 4X98B 2X7LA 4HUNB 1ETZA 3OX8A 1ZT4A 2DQEH 1LD9B 1O5DT 4UILL 1KPRA 3A6BL 3GNML 2AGJL 5E2VL 5IIEA 4BZ1H 2Q86A 4KHXH 5C0JB 2VIRB 3LPFA 4NUGH 2DDQH 1VADA 1VESA 4LVHB 3LDBB 5GS0H 4GRLC 2YUWA 5DD0H 3OJDB 2F53B 2VWEC 5MI0C 5KAQF 3W2DH 4U1GC 4R8WL 3X11B 1A5FL 2Q7NA 3BN9C 3QIUB 5F1KC 1E4XI 1PLGL 3H42H 2P5ED 4ESKA 2QKIA 3RNQA 3S35L 1QRNB 3GIVA 5E4EB 3EDDA 4OM1H 3CFBB 5CSZB 3T0WA 4M62L 3HA0A 2GY5A 3QG7L 1IKFH 5ADPL 3EO1A 1PFCA 3WL9B 4D8PB 4L5FH 1IC7H 2CUMA 2VISA 4U1KA 4JRXB 4HIEA 1HKFA 5C0EA 5J1AB 1T1YA 4JFZL 1BIIB 1I75A 2ZSVB 3Q5YA 3EYVB 3MLSL 1J1XL 5F7EL 5DR5L 5D2LE 5K33A 1MPAH 2DJUA 3R8QA 2BK8A 1QBBA 4BZYA 1R0AH 2O5XH 2IQ9H 3OKDA 4WUUE 5T3ZH 1NC2B 4ISVB 4RGNC 2Y06H 1V7ML 2OSLA 4PRBA 5EU3B 1ES0A 1T89A 1A2YA 3MV9B 1VKXB 1M05B 2GJ6B 5JQHC 4JFDE 2OMNA 5FB8A 4N8CL 1YEKH 4JANA 4JY4A 4OCLC 5BMFL 5ACMA 2RR3A 5D2NE 3TO2A 3OHXB 2VR9A 4OBSA 3AAZB 3RJDA 3NFPB 3DXAD 1X9QA 1FRGH 3ARZA 3HI6H 3MRIA 5CKGA 3GKZA 4OLUH 4RFEA 1ONQB 3RDTB 3I84A 5BJTB 1A4KA 4MD0A 5TE7H 4OBRA 3E2HB 1YEJH 3QUML 2HMIC 3VFPA 1MCWM 2X4RA 4PJAA 5FUOH 3WIIL 4YJZL 4OIAA 5FKAB 4HKBB 3BKJH 3CU7A 3TWCL 2P8PB 4LF3B 4LLWB 3TVMA 5EWIL 2QSVA 1YEEL 3OSKA 1MOEA 3BPLB 3CSYB 4GAJH 2M8XA 1PYWA 5H35A 5DC4B 5E6IB 1CGUA 3QZWA 2ZPKL 3MLZH 4F8TA 4JN1L 3T09A 3RVUC 2WNGA 3PHQB 3HC4H 4PV9A 5J4MA 4LLUB 3T3MF 2GI7A 1K85A 3RVTD 1HQ4B 4M1DL 4M9OA 1FE8L 2FLBT 4N1CA 1AY1L 3CZFA 2I60L 1YMMD 1XIWD 1VFMA 4M5YH 5C6TL 3Q6FB 3MOQA 4GQPH 3PXJA 3MRRB 4WVRA 2NNAA 3MRKB 3MRFB 3BKYL 1OTSD 4WWKA 1FGNH 1X7QA 3ILPB 1AGEA 1DEEA 2FIKB 5C2UB 1DQLH 5BO1H 5INDA 2X4OB 4NRZA 5F97E 1FAIL 4AYFA 4GRMB 3HZMA 3D9AL 4Y5XB 2WBJD 4JDTL 4ONHB 2BSRA 3QO1B 4FQCH 1A3LH 1EAPA 1UM4H 1HQRA 1RJCA 1P2CB 4NBXB 4O2CA 3UYRL 4ORGB 1RUAL 2A6JA 3GMPB 1JF6A 1L0XA 3C09C 3RGVA 4XNZB 4JFQB 4P2OD 1CD1B 1VPOH 1MQ8A 1U2CA 3PWVB 4PJ7A 2VLRD 5HHOD 4EI5C 3BXNB 1D5MB 2E27H 3L6FB 5CEZH 3DV6A 3LEXA 3UTSE 4DKEL 1KIQA 3SE9H 2VB5A 4Z6AT 4ODXA 4AENB 3WFZA 1KIUA 4LLYA 5GS0D 5MERA 4YO0A 5CINH 4XX1G 3F7VB 4P5KB 1UZ6F 2FYYB 3MJ9H 5LBSH 4XP6H 3PP3K 1FVCA 4M9PA 1XF3A 2V7HB 3UAJC 2R15A 2PF6A 2VAAA 1MCIA 4I1NB 4MS8D 3KLHC 1F11B 3QIWC 2XT1B 2J6EH 2FECI 4ZQKA 3VFRB 4CGTA 1HSAB 3RUGE 3DIFA 1WCBB 5I1CL 3H0TB 5D1ZA 1I7RA 4NPYA 3PHSA 4HG4K 5IEKB 1OPGH 1MCPL 4K55A 4R90L 5DVNA 2CK0H 1FCCA 3I50L 2Y5TB 4MJ6B 2OTUA 1Y6MR 5CIPH 3V4VH 5SWSE 2VDQH 1FIEA 1RIVH 2XZZA 3QUMB 1PG7L 3DUSA 4KAQH 2PW1B 5DJYB 1U93A 1CLOH 1AQDB 5T3ZD 2X5PA 2CXGA 1KXTB 2VXTH 3C5ZA 2ESVD 4XXCC 3RWEB 3CFCL 3M17B 1E4KA 5J7CC 2OTWB 4X9HA 3S34L 1RIUH 5DYOB 1NBZA 4FTVE 3VXRA 2Z91B 1H3TA 1LNUB 1P1ZA 1WVZA 1EMTH 2RIKA 2BRRL 1TVBA 4JRYA 3TV3H 5GSVA 4NC1C 5GS1A 5C92A 1MHCA 3MLYL 3GJFK 1RURL 2QQKL 4NN7B 2VXQH 3FQRA 4L4VA 5F89B 5T1KD 1RZIB 4PJ9B 3F6LA 4U6XA 3PF2A 4BA8A 4WI3A 1KJ3L 1QFUL 4OSUL 1J11A 4UT9L 4E9LA 1QA9B 5IMLB 3VG9B 5I71B 4S0SD 4NQDB 1ORSB 1A1OA 5A43C 4Z77B 3FCTA 1S7RA 5E00A 5D7JB 4EQ2A 2ZG3A 3MJ8A 1UB5A 3FHQA 3T2QA 2VN4A 3ABZA 5JW4N 3UPRB 5CLTA 5FUZH 1G9EA 2EDBA 1KACB 1NCCL 5EO0B 1JNHA 4YHKL 5HHMB 1FNFA 4IIQC 4AEIH 4JN2B 4MNHA 2CKBA 1UACH 4LEOB 5CBEA 4X4XA 4HXBL 4U1MB 3KJ4B 5ILTL 1FFOB 3C2AL 4FP8H 4PRNB 3RX5A 3QHZH 4RA3A 2O5ZH 4L8CA 4C55A 5IOPA 1G7QB 2D4FA 5C07A 2G9HA 1IGML 2DKUA 3I2CL 2QEJA 2NY5C 3CFDA 3BISA 5C0GB 1BQHA 3CJJA 1MQKH 2BOBA 4ODVH 1PAMA 5GGSY 3FOMA 4DK6A 4UNUA 1AKJA 4RISH 4GOSA 4B0MM 2BFVL 1RK1B 3ZDYF 2BJML 2X4SB 4PPTA 3SJVB 3VH8G 3WKML 4JDVB 2ITCB 4ZNEE 2WINB 4KKBD 1BBJA 4RMWA 1X5JA 2HFGH 2X40A 4LSPH 1F5WA 1JRHI 1ZT7A 4JZJA 3V5DB 2VL4A 3HE6A 4L4JA 5IBUB 1NFKA 3RWJA 4K94C 2KBGA 1BFVL 4QO1A 3MROA 5IB5A 1NSNH 4OGAC 5CEZD 4NWTH 1ZA6B 2PNDA 5EZLA 2QV2A 1RZ8A 4WFFE 1A1MB 5AG9A 1H8NA 5C09D 4WDIA 4DEPC 3MNVB 2DLGA 1G84A 2BNQD 5IEHA 1L6XA 3AC0A 5IB2A 1R6VA 1E28A 1X5IA 4XWOD 5HYFA 4G7VL 2K7QA 1D5ZB 2VABB 5DUPL 4WNQA 3L1OH 3VA6A 2BY0A 5DD3H 3T3ME 4OLWH 5D4QA 3IJHB 5HGGS 1UC6A 4X7EC 2HH0H 4LCWB 3SDAB 4XMKL 3VGHA 2GK0A 1DVFC 2X41A 4NHCH 3B9KD 4XP1H 4PBXA 1CXIA 1KTLA 3UBXG 4L29B 1DE4A 1S5IL 4LKCA 3WMSA 4KTDL 1VGKB 5HD8C 5FDWB 3SKUD 1IGTB 1N7MH 2D7QA 1P7KA 5IF0A 1P9MC 1JGUL 3NOIA 5DEGA 5EO1A 4WUUB 1ZS8B 2BVYA 1UEYA 1HHJA 1PX3A 4ZUTA 4J3UA 4CMMB 3HMXA 4WUKL 5FCUL 3VXOB 5D2NB 2DLHA 3MNWB 5IB4A 3BX7C 3DX8B 3KPSD 1QG3A 2XRAL 5TPWL 3O45A 3QDMA 5ISZA 2IANB 5HGAB 1KELL 4UU9B 5FGCE 4UI2A 5C86A 2OZ4L 1DBMH 4CNIA 1KV3A 3T0EB 1HXMA 4NRYA 1OTUC 2OL3A 1EEUA 5K9KB 5I1AA 1JN6B 3QUXD 1LGVA 1QRKA 1UYWL 2IPUK 3FAXA 1QSFA 3HUJB 4S1DC 4WTWA 4UT6L 5CSBA 2VDLH 2ATPB 5T33L 1JYWA 1CFNA 2CLVA 2VR4A 4PRIE 5IJKA 1KCSL 1EFXA 3MRLB 2G75A 4YNYB 4HKJB 3WFDH 1NCBL 5ECJE 4M6ML 3VMNA 1IM3A 4R4FH 5CKAA 1UZ6E 4G6AD 2PO6C 3EGSB 1CLYH 1I9JL 4G6FD 4ZFZB 4FRWA 1H8SA 2FHFA 1T1ZB 4I9WD 2DB8A 5HYIA 4MQXD 2R1XA 2VH5L 4Y4FD 1MHHB 3K80A 5E99H 3X13B 4WW2C 1KGCE 2DWDA 4MJIB 4HC1H 4X6DB 3ZDZF 1V7NH 4OQTL 2DI7A 3FFCA 4L9LB 4R97C 4TULH 1CT8A 4FQXC 3AM8C 3DSFH 3ALWA 2W91A 2XTLA 2PXYA 4TUKL 4LPYA 4NKDA 4Y4KB 3P11H 4KV5F 4FQJL 3RKPA 3SQOL 1U8OA 3TM6A 5SWZE 1ZMYA 2ICEA 3UX9B 3MBXH 3ETBF 4N0FA 3VE0A 4WO4C 4CN6A 3G9AB 3V0WL 5C0NC 2AABL 3H9SE 2VAJA 4H8WC 3TNNB 3OGOE 2IBBA 4L3ED 5FKPB 3L3DA 1FG2A 1F6LL 3VFTA 5GS2H 3OAUH 4LEXH 2DKSA 1QHOA 5JQ6L 1ZANL 1M6OA 5I1HH 3V6OA 2NY6D 4QRPE 5CP3H 1OARL 3QEQB 5EORH 1IGCH 4OZ4A 2X89D 2R29L 5BRZD 1KPVA 1TPXB 3UTSB 1CXLA 1R3KA 4GAGL 4HPOH 1HDMB 1WWAX 4R7NA 1WFUA 1YN6B 5T1LB 1HH6A 3MGTA 5CJBA 5F70A 4IHOB 4EN3D 2VTFA 1BJ1J 2AJXL 2VKXA 1S7WA 2EYSA 5I8KL 5LCVL 4I3RL 2D7TL 5D8JL 3KXFA 4BQBA 4XX1E 4ZPTB 4HUUB 1V8HA 5IGXL 3DMMA 4JHZA 1AP2A 4HWZA 4JFDD 2EC9U 3FO0H 4G42B 4XNYL 3CVHL 4PP2A 4U1HA 3BESR 3SQBA 4NQXB 1D5XA 5I1JL 5I16A 4F37K 1I7ZB 5D7SH 3EJYD 3U7WL 3W11D 3WFEH 2Q76A 3TA3B 3OXSA 2V2XB 3R0MA 2ADIA 2P8MB 3E8UL 2F15A 1S7TA 1C5CL 5B38G 3U4BH 4URTB 5D9SB 3U79A 5KSBA 3ULVC 1BF2A 1TDQA 2QQNH 3QFDA 5HXMA 4Y2OA 3AMLA 3IDIA 4HHAB 4JPKH 4YEFA 3DROA 5L9DL 1NCAL 4XP5L 1I3GL 3GJEB 3LVEA 1FJ1B 4AL8L 2H6PA 2BVQA 3MXWH 1HNGA 4ODSH 1A7RH 1I1AD 3BHBB 3PDDA 1ZHBB 1N0XH 4N0RA 4PY7B 4JHAH 5DSCB 1DUZB 3ZDYE 5ID0A 3NACL 3QJHB 1DDHB 1UA6H 1BBDH 2GT9B 2GY7B 4KJQD 4U3CA 5CGMA 4W4OC 4HGWB 5ALBL 4TTDD 4EVNA 3ES6A 3C5JA 5M95B 5C08E 5EG6C 3VXUB 1RD6A 5GGUB 3PV6B 2CK2A 5HJ3B 3T4AB 2A73B 1U8NA 3REVB 4GKNB 1N3NB 3O3EA 4XI5D 1JPGA 2X4PA 1BM3L 5C0BA 5FO9B 1X6NA 4MAYB 1BD2D 3QH3A 4XTRC 4NOFA 4R0LA 5ICXA 4F9PA 4K2UL 5F6HI 4TYUA 1T89C 4JLRB 5F7KC 1SYSB 5KVEL 2X1WL 1X5AA 1RUKH 5F7WC 1NMBH 1YEDA 3C6LC 4LLVA 4QT5A 3MV8A 1CDCA 3L3KA 4XNXH 1QR1A 3BJLA 5DVKA 1SEQH 5ACZA 5MHSE 1BHGA 1X44A 4NQEE 3B5GA 5HDBF 1JBJA 1S9WA 5HGBB 4ZS6D 5FIEA 1FO0H 5DD5H 4P3DA 5JHDA 3QI9B 2XYCA 4CVXB 3WO4C 3BQUC 3PWUB 3V5HA 1SY6H 3S88H 1FSKC 5J9PA 2JKXA 3M07A 3RX8A 4Z7UA 4IRJD 1BFOB 2IQAA 4BH7A 3AFLA 3RWDA 5EOCH 5ADOL 5DK2B 4KQ4L 4LSTL 2VN7A 1WITA 2YD7A 3JUZA 3WNLA 5L0QB 1J9CT 3INUL 3NPSB 4E41A 3S3PA 4QCIB 5EPMB 3FQWA 3FT3A 4PRPB 3RGHA 2HAZA 4HJGA 3P30L 25C8L 2GQHA 3OAYK 2D2OA 3QWQB 2BX5A 1DSFH 4OJFH 4JZNA 3CDCA 4HLZG 1MCKA 2EICA 1XFPA 1T5XB 1P4LA 4LHQB 3TJEL 4HGKC 1Q94B 1IAKA 4Y16C 2DM4A 2YUVA 3MRPB 1NUFA 2NY3B 4HAGA 4YUEL 3CVHB 5GS2D 3QHFH 4XP9H 1YZZA 5KSUA 3C9NB 2Z8VC 1IQWH 1K4DA 3GHEH 3RRQA 3KWWA 2IFFH 2B2XL 3GKWH 1AXTH 1OAQL 4XCCH 5FGBC 3CLFH 4NRXA 2CJUH 3QNZB 3S36X 5SWSD 1N5AA 5HI3D 3O2DL 4HV8B 3RY4A 3UJIH 3LHPH 5I15H 2DBJA 5D93B 3ARFB 3WIFA 4S1SL 1AXIB 3I6GA 5CZXD 5ENWB 5MEPB 4OUUB 1DQQB 5H94B 4NKOB 4F7EA 3HCVA 4CW1A 4FTVD 4EKXA 5DWUH 3TJHC 3V8OA 3MODL 1CLCA 1ACYH 3MCG1 5C0AE 2VYRE 2VDOH 4LSDA 4XBPB 1BVZA 1OAUH 3HNSH 3LRGA 4AMKL 2Q8AH 1IMHC 5CBAB 3NTCH 2UUDH 2HJFA 1F4WL 1FZKB 5DLMH 1UCBL 4KV5E 4R96B 5IQ7H 3W5MA 5J3HD 3KPPB 4JZOB 1ADQL 4UDTA 4Y5VC 2H1PH 1GHFL 3LV3A 4PJBB 1KB5A 2WLYA 3EOBB 1CZ8L 4PYGA 1IGFH 3GMQB 4R26L 2JIXD 4ZDHA 1G0XA 4DN3L 4KK6C 4U7KA 3L95A 4XAWL 4TNVF 5D1ZC 3KS0H 2DYPD 4M3JA 3BH8A 1E27B 5I1DA 1YY9C 3MV01 4Q2ZA 3GRWL 1FFNB 1G9MH 1Z3GL 5E6YA 5JOPD 2DD8H 3S3JA 5DQDL 3FO9A 4MD5A 3ULUL 3BUYB 2R39A 1CD0A 4GG6F 1KJ2L 4MZ3A 2MTPA 3UJJL 3WCYA 2BNRE 5E08L 3MZGB 3OB0K 1HCVA 4RNRB 1P6AB 3HPJB 4FQIH 2NXZC 3UTQB 3VGFA 5F3BB 3H7LA 1HN1A 3WKNA 5DD6B 5KVGH 2DQDL 1E4KC 5D96B 3BPCB 3P9MB 2FBJL 4DFHA 1T6WA 5E2WH 3RIFF 4MXWL 1IGYB 1I1CA 3GFUA 1LO5A 4H20L 3V0VB 1YPZB 3FB6B 5GS1C 4JG1L 4M43L 2XQBL 4JM2A 3O8XD 2PN5A 5ICYA 2FH6A 1P4IL 4KKAC 2E9BA 4YBLC 3N50A 4TPRL 3KPLB 2H26A 4RQQA 4UZGA 3N1GC 4GBXB 5DRWB 1WAAA 1ZK9A 3D18A 1INQA 3G08A 5SWZB 5A2JH 2EYRA 1QBLL 1O7VA 1JNLH 4PD4K 5C0CB 5CILL 2W9LA 1ORQA 1E6JL 2AK1L 3H9SB 1QHPA 3O6FD 4LOUC 4MHHG 5TGBA 4W70A 3THML 4GJTB 2MCPH 1TTFA 2J4WH 3C08L 3ZKMC 3OKEB 1GAFH 4J6RL 4WENB 3D69B 3U0WL 2G5BB 1TZGL 3DVIA 5C71A 2P44B 4QRPB 1AE6H 3SDYL 1P4BH 2VDNL 5B8CB 2HJKA 4GKSB 4H1LG 4X98A 3MJGX 3EYQD 1LD9A 1HWGB 4UV4H 2EC8A 1PKQA 1NC4D 2GSIB 1CK0L 5C0JA 3VW3L 1MCEA 2VIRA 2IAMB 1F2XK 2VLME 4RGNE 4TVPH 1H3PH 2N7AA 1C16A 1L0QA 5ESAB 1KCLA 5L6YL 4HUVB 2J7LA 1A7NL 5GISH 4HBQA 3OJDA 2F53A 1IZJA 2HRLA 4Q9CA 5HVGB 3X11A 5F9DC 3FQUB 3QIUA 3WXVH 3N1PC 1YY8B 2X1PA 4LHUG 1QRNA 3HE6C 3QXWA 3U7AA 3VFGH 1LVEA 1P84K 3TZVD 3DURB 5FK9A 3BW9B 32C2A 3CFBA 4X6CB 5CSZA 1A4JB 4D9LL 3MNZB 5DGRA 4Z0BH 4YX2L 4RX4A 3WL9A 4D8PA 3MO1B 2XTJC 4YHNA 1WIUA 4JRXA 3JUYA 5GRJH 1WTLA 2DQEL 5J1AA 4PRID 3MRGB 3TBSA 1AR1C 4MB4A 4KHXL 4KTYA 4NYLB 4M5ZH 4NUGL 3GMRB 5EU5B 5GS0L 4FNLH 2IGFL 5DD0L 1NC2A 4ISVA 3HKFA 5EU3A 4F2MB 1OAKH 1KCUL 5I74C 3MV9A 4LCUB 1D6VL 1M05A 2GJ6A 4PB0H 2PCPB 3MRHB 4QRSB 3G04B 4JKMA 3OHXA 3AAZA 1KPUB 3NFPA 3CUPB 4OFVA 3S36L 3DNKA 4OM1L 3P3YA 4HWUA 1LDPH 1YYLH 4YDLB 5HYQB 1ONQA 3L5JA 5BJTA 3NBNA 3HNTH 4GQ9H 4JEGB 1UM5L 3D25B 1IC7L 3MRQB 4M4PA 1RUPH 3FKUS 4N5EC 2VDKL 5IHBA 2VDPH 1X4ZA 4PJIB 4RDQF 5MP6L 5FKAA 4HKBA 3QUYC 4OZFH 4U3HA 2P8PA 1LK2B 3ARDC 4LF3A 2ZUTA 1N6VA 1I8KB 3CSYA 3LKSA 4MA1B 4NQEB 3BD4A 2O5XL 3VWKB 2IQ9L 5E6IA 4E5XB 2CDEA 2P5WE 3RVXD 3T4YA 5I18H 2ILLA 3PHQA 3F8UB 3TH4T 2EH8H 4OB5H 4LLUA 1YEKL 2CGRH 4DK3A 1HQ4A 2NY4B 1FRGL 1PVHA 5FDYA 3HI6L 3FQXA 3GI8H 5IQ9B 4OLUL 3SDDD 2ICES 4BYHA 3MRRA 1AXSA 4PUBH 5BQ7B 1HZHH 1MI5B 3MRFA 4HZLB 1CR9H 5TE7L 3RFZC 3ILPA 4HIXH 1QLEL 2B0SL 3RHWF 4DAGL 4ETQB 5I9QC 2O5YH 4TTGA 3MFGB 2I26N 1T83A 3PWPE 4GRMA 3VH8B 4Y5XA 3BKJL 5F7HA 4ONHA 3F7YB 3QO1A 1WC7B 4P46C 4WW2F 4ZS7L 1P2CA 5T3XH 3B8SA 4M6NH 1LE9B 3GMPA 2YR3A 4N9GB 3MLZL 4MDIB 3MTRA 5SWQB 2E9JA 5CJQH 3HC4L 2PXYC 3V79C 1MFEH 1CD1A 1JGVL 3HZKB 4QXUH 1EEYB 2OR7A 2Y6SC 3U4AA 3VG0H 5F7FA 4L4TA 1FVDA 3PWVA 4GG6E 5KSAD 4IOFC 3KHOA 3BXNA 3L6FA 4IDJH 4QHKI 4M5YL 1BGXH 4HDIB 4MXQC 5SX5H 1Z9MA 5GQBA 4AENA 3LD8B 3HE7B 3O3UN 4TVPD 4X7DC 1AGFB 2CRYA 1IARB 5DRZA 4NJAH 1PZUB 1J8HE 4P59L 4S11A 4X4YB 4CVWA 4DGYH 1FIGL 3F7VA 1G7PA 1DQLL 2FYYA 3ZSTA 3NMEA 5HHQB 5GIRA 3V6OC 4D9RD 2VLJE 2WIMA 3PE9A 1RJYB 2V7HA 3I3BA 1JIBA 3QWOB 2MNUA 2ZJSH 4NC1E 4TOYH 4G43B 3D39B 2DQCH 2EIZB 3UBXB 3VFRA 1HSAA 4NO0D 4OLXH 3QT2A 1MIEL 1IEBA 3H0TA 1CDYA 1LEGB 1R5VA 4KKCC 1OF2B 3QXVA 1VPOL 1K3ZA 5IEKA 1G7JB 4CJ0A 4NKMB 5EU7E 1HOCB 1MCHA 3H9HB 2VZTA 2Y5TA 4MJ6A 2E27L 3LH2L 5B3NA 3SE9L 4Y2DB 3ARSA 3QUMA 3X17A 2PW1A 5MHSD 2IH3B 3U0PB 5DJYA 3FRUA 4O51A 1AQDA 4ZUUB 1CF8H 3UEZA 5CINL 5GS3A 3P9WB 2D4DA 4XNQB 1OW0A 5LBSL 3LAFA 1U8KB 2OTWA 4XP6L 2EDEA 4J3SA 5E8DH 4HMDA 2FHCA 4OF5A 3EDFA 1ZT1B 5DYOA 1MCOL 4QOKD 2NZ9D 2Z91A 4LFHG 1LNUA 1OCWH 5F3HB 2BNRB 1T03H 2J6EL 1KCVL 3OJVC 3D2UD 3S9DB 1Q0YH 3HRPA 3C60C 3MOAH 5IESH 5JLZB 4WI9A 5F89A 3HN3A 1RZIA 5FAAA 3KYKH 4PJ9A 3BJ91 1OPGL 2CK0L 1QA9A 2V2TB 2OX5A 5IMLA 3U9UA 4OTXH 4NQDA 4DZBB 1ORSA 3M1BB 4Z77A 1P69B 1T4KB 3V4VL 1JF5A 2EC9T 1RIVL 3UPRA 1JHTB 3DO3A 3CXDH 3NN8B 4UOW1 5FUCC 4KJWC 1CLOL 1F4YH 4A6YB 4MZ2A 2WUBL 5EO0A 3BWUC 3QISA 1FPTH 3K4AA 4K3GA 1AR2A 1JHKL 2VXTL 4JN2A 3CC5B 1EJOH 4LEOA 2EIBA 1EBPA 3K2MC 4S2SA 4P49A 4DKFH 4R0LC 5AWNH 4GRLB 5JW4M 4U1MA 1G7IB 4YIQB 4RMUA 5MI0B 1FFOA 4MCZB 1HI6A 1RIUL 1QFPA 4U1GB 4PRNA 1LQSR 1QLFB 4HIHA 1EMTL 2I25N 1G7QA 3BKCL 3TV3L 4JGUA 4Q97A 3RI5K 2VXQL 5C0GA 3WEXB 5J11C 3KPNA 1GIGH 3FN0H 3MUY1 4OF3A 4N0UB 4ZXBC 3TP4A 2CDGA 3J8F7 1RK1A 3LRHA 2YD2A 1KBGL 4HS8L 2X4SA 3SJVA 4PJAF 4JDVA 4QHKJ 4WTXA 5EUKB 2ITCA 1IFHH 4JFED 5T3XD 3LOWA 2WINA 5GRYA 4KXZH 5FUZL 1U8JB 5C0AD 4DZ8B 1T1WB 1CICD 2F54D 2OTPA 2AK4E 5GRUL 4KUCF 2JB5H 4DGIH 4AEIL 1UACL 4BH8B 3SO5A 3HAEA 2IEPA 2Z8RA 2FSEB 3T0BA 3JWDC 4RGNB 3NCFB 1A9BA 2VZ1A 1G1YA 1ZA6A 2O5ZL 2JCCB 3MLRL 4AK1A 2KQNA 1A1MA 1MY5A 3MNVA 3SDCD 5BS0B 1U42A 4G3YH 1QSED 5EO9B 3CDGB 4ODVL 3IDGB 2CLRA 1FNGA 2XN9D 3W39B 5CP7B 4LSSH 1TETH 1D5ZA 2VABA 3FN3A 2QHRH 3EOTL 3NCCB 1DQML 5T5FH 3B2UC 4JHWH 5B38B 1HXYB 3F58L 4PGBB 3IJHA 3QIBB 4LSPL 4LCWA 3SDAA 4C83B 2LVEA 3NZHL 5E70A 4M8VA 2BNUB 4L29A 4TVSa 4MA3B 4ZAKD 4K7FB 4R2GD 1F2QA 4NJ9L 3B9AA 3UC0H 5GSRB 3HTLX 3CK0H 1W0VB 4WUUA 4YDJB 2VKWA 1FBIH 5C8JB 1MCSA 2BHYA 4GW4B 4OZGB 1ZS8A 2KH2B 2NXYC 2F5BL 2XZAH 2Y7QB 5CWSB 3J7HA 4MNGE 4PJ7F 5F7UA 4PB9H 5E9DD 3TO4D 4CMMA 2HTLD 3QDHA 5F9WC 2WP3O 5D2NA 1DL7L 2GTZB 3NFNB 4POYA 3T0DA 2EDHA 5ANMB 5TE4H 5DJZB 4HCRH 2FGZA 3O6MH 2IANA 3JZ7A 4UU9A 1W0YT 1JHLH 5E8PB 3BGMB 5KSVB 3T0EA 1RVFL 2HLAA 3WXWH 5K9KA 2WANA 4OLWL 1JN6A 3HUJA 2DIBA 2HH0L 4CDGC 1FFQA 3UTTD 1DLHA 5LGKA 2FR4B 1DLFL 4K23H 2VOTA 3X3GH 4YNYA 1ZA3B 3NIGE 1N7ML 2R0WH 3MA9H 3C09B 2HVKB 4JFFE 4PJ5D 2YPVH 4JO2L 4PGEB 1ZVYA 3EGSA 3D6GA 5K9JL 3BE1H 3JTSA 1I3RB 2C3XA 2NY5L 1TJIH 4AJ0A 2FEDC 3CSBA 2C7UB 4EI5B 2BVEA 1T1ZA 2P42B 3PQYD 1MFBH 4F33B 2PR4L 1MHHA 3GZKA 3X13A 1FZOA 5J6GB 4MJIA 1MFDH 2DQFB 4X6DA 1DBML 4HS3A 4X7CC 4L9LA 2MHAA 5HPOA 3BD5A 4LASH 3QRFM 4KKLD 3VFOA 4YFLF 4PJFE 1CD9B 2R0LL 1TVDA 4Y4KA 3LPWA 1MWAL 3PWPB 3QQNA 1HHKA 4UNVA 4WY7L 3CIQA 2XKUA 1N0LA 1NBVH 2VZOA 2A1WH 1FZJB 2N4IA 1DFBH 3IFOB 1U8MB 1OTTC 3QIWB 3WFDL 2YD4A 4JM2C 4HX1B 1KFAH 3MLXL 2X4UB 3TNNA 1G6RB 5AAWA 4R4FL 2DBLH 5TQ2H 3FRPA 5FKPA 3QDAA 2XPGB 1CLYL 3RZCC 4LSUL 4NSKB 2ZG2A 4G9FB 4POZC 4F80A 4OI7A 2Q3AA 1G7MB 3RWGB 2FZ3B 4MGXA 3ULVE 4YHML 3ELAT 1IL1A 3QA3B 1I7UB 5IKCB 2EECA 5I0DA 4QXWA 4GG6B 1C8PA 3QEQA 1B6UA 1V5JA 3WE6A 3UTSA 4GKZB 5D72H 1HDMA 2BCKB 4HIJB 1U3HD 2BMKB 5CD5D 2W0FB 5T1LA 4NKQB 3DBXA 4IHOA 4TULL 2Y36H 4QWWC 4NBZB 1XF2B 3RVUD 3LKPB 2OCFD 1U36A 2QHLA 3IFNL 1VACB 4HUUA 4FMFA 4QHLB 1XF4B 2VLJB 4LL9A 1GPOH 2ZZUT 3H2WA 1OD9A 3MBXL 4G42A 2H2PD 1OGAD 2FJFB 4G8GA 4X7SL 5TDOB 3NCJH 2EDLA 3SGDI 2VL5B 3BUTA 4LRIA 1L7IH 1KCKA 2VLLA 1I7ZA 4LVHC 3TA3A 2E6PA 2V2XA 2P8MA 3BDYL 5DS8B 5I1HL 4RAHA 4WGWB 3V4PH 5EORL 1JYNA 3VXSD 5FA4A 4HPOL 1A6UH 4HHAA 4K9EC 1FJ1A 3S8WA 5E4EC 3K8LA 5EZOH 3VJ6B 4MHHI 2Z31D 3BHBA 4Z78A 1V3JA 3LRSB 4PY7A 2X42A 4KPHH 5DSCA 1DUZA 1IAII 2P5WD 5LWYH 2AV1A 3QJHA 4MJ2A 1DDHA 2MFNA 5IFHH 2ED7A 2GT9A 4PJAE 4N0YH 3FO0L 1T0MB 3G6DH 4JDZB 4F3FB 1T5WB 1IGJB 4ZUVB 5IR1B 5DFVD 1E4WL 4NQSA 4NQTA 4Y89A 3LQMA 3QP3A 3VXUA 2R23A 5GGUA 4IOIA 3PV6A 5D7SL 2X4TB 3T4AA 2A73A 3REVA 1NGQH 4GKNA 2APVA 3VU2A 1R5WB 1IZKA 4PGCB 1S78D 3OV6A 3T8XB 1ZVSB 3U4BL 4PGJA 3VFUB 1CGSH 5JZ7D 2RJMA 4JLRA 4OQTA 1SYSA 4ERSL 3B6SB 4KJPD 5CCKL 4M48L 3ZO0A 3KLHD 4Z95L 1VB9A 1FFPB 3MXWL 1LO4H 1NFIB 3ZYJA 3AS0A 1MWAB 1EO7A 3CPLA 5LGHH 3U36B 15C8H 5HGBA 1YNTB 3PHOB 5C9KA 5DHYB 4ONGH 4P9HH 2DN7A 1BBDL 4YHOL 3WD5L 3G6AB 4FQHB 3BMWA 1KLFA 4CVXA 3GO1H 3VMPA 3DETC 5DURB 2CO6B 3PWUA 5KS9A 1R3LB 5J56B 1EO8L 2AJYH 4DEPB 3MYZA 1Q72H 2Q87A 1L0YA 4O2FB 4DOHE 1CD8A 1BFOA 1R3IL 4Y4HD 3M45A 5DK2A 4NNXB 1U8LB 4MQ7B 3SN6N 2FB4L 4OD1H 4I13B 4N1HB 4GAFB 1J8HD 4Z76B 4QCIA 5EPMA 3KPRB 4PRPA 4UIKH 2AJUL 4PJ7E 1RUKL 5C0IB 4ZNEA 4XNXL 1DVFB 5HHVH 2YXFA 1QYGH 3ARXA 4H1LB 2AK4B 1Q94A 3MRPA 1HIML 3WJLC 1JGDA 3CVHA 3ESVF 1WV7T 3C9NA 1H9VA 2L7UA 3F65A 4EIZC 3BRDA 1A9EB 1MCNA 4APQD 3OJ2C 1SY6L 5EBMA 3S88L 3OKKB 3I02A 3QUZC 3V4UH 3TC9A 4EI6B 4QGYA 3L9RA 5DA0B 2ZNWA 1QKZH 3EHBC 5EOCL 2XA8H 3KPOB 4KUZL 1UJ3C 2AEQL 1CFVH 5AUMA 4LHUB 4R3SB 1NLDL 3TBYB 1HK6A 3SGJA 3ARFA 4LHJB 3FQTA 4P3CH 2H32B 3FO2B 2WUCH 3O4LE 4EUPH 1GGCH 4O9HH 5ENWA 5MEPA 3TFKD 4OUUA 1KENL 1KTDB 1DQQA 5IBLC 5H94A 4NKOA 1FGVL 1NGPH 3LQAH 5IV2B 3G5ZB 3B5HA 3O6LL 4JFPB 3KPMB 2PTUA 5HI4C 3GSOB 4XBPA 3PNWB 4QRQB 1UT9A 3K4ZA 3QHFL 4KFZC 2DICA 2RAMA 4POUB 5DFWH 1IQWL 1WZ1H 2PO6B 4LPVA 4LBEB 2P45B 3O6KH 1BP3B 3KR3L 1HSBB 1FZKA 3UYPA 2IFFL 3SDXF 2D0HA 1AXTL 1XH3B 1WWWX 3PABA 4R96A 3G5YB 4MNGB 4Y8DC 3PP3H 3KPPA 2FJGB 1OAZL 3GSXB 4JRYE 2DQHH 4WW2B 4PJBA 3EOBA 1NGWB 3LHPL 5I15L 4L4VE 3GMQA 1FNHA 4LLMB 1NAKH 2OYPA 2I9TB 1S9VA 3GSQB 3KYOB 4R97B 3ZYOA 4FQXB 3QQ3B 3QCTH 1Z6JT 1E27A 1VEPA 1QBAA 1JTPA 5TFSH 1KOAA 5IMMB 1FFNA 4LGRB 3SKOB 4BJLA 5DWUL 4P23C 3F5WB 2H2SC 5T1DH 3BUYA 2VDOL 4WO4B 3IDJB 4JCLA 4UDUB 2CUIA 4XNUH 1OAUL 2Q8AL 2XXCB 4RNRA 4JFFB 3HPJA 2NW3A 3UTQA 2DQJH 3VXMD 2MPAH 5DD6A 2YKLL 5DZNA 1OW0C 3DUHA 3QFJE 3FT4B 5DJXB 5IQ7L 3LIZL 4LCYB 3BPCA 3P9MA 1B4JH 2C4FU 1EEZB 4YAQB 4AH2A 2AI0H 2Z4QB 3P4MB 4P2QB 4Y7MA 1IGYA 3PJSB 5C1MB 3PL6C 3V0VA 1YPZA 4M7KH 3FB6A 3FMGL 1ED3B 3GJFH 4NN7C 5JIIA 2ZUXA 5AZEH 4QHNB 1EHXA 1NFDB 4H5SB 5BXFB 1DQDH 2BY2A 2YRLA 4J4PA 3KPLA 2QSTA 3D0LB 2JK5B 1YYMH 2HVJB 4GBXA 4PJFB 4NCDA 5DRWA 3RJQB 3N9GH 2JJSC 4AZ8A 5L88L 1CFSA 3JXAA 5GGSB 3RU8H 5SWZA 1C7SA 3D85D 1KPRB 3ESUF 4G6ML 3VRLF 3I85A 5C0CA 1LO0H 4XPHL 4K3JL 3LMJL 2D03H 5IK3B 1VFUA 3H9SA 3MRBB 5F7DB 3OG4B 5BOPA 5IHLB 4FQIL 4YXHH 1QFWL 3PWLA 1NCWH 4TSBH 1A6VL 3O2DA 3OKEA 3G6JB 4OCRH 1EA9C 3ARWA 3LZFH 2G5BA 3MRCB 1M1SA 1T66C 4QRPA 2RQ8A 4PTUB 5B8CA 4GKSA 4ZTPH 3VD4A 3RNQB 1WCQA 2G5RA 2H9GB 1RSFA 2HT4C 2IAMA 2R0KH 1GH7A 4YEEA 4PYHA 3PGFH 1CFQB 3DX9B 4U1KB 5ESAA 1FL3A 5C0EB 1T1YB 3BEVA 3EYFB 3RWHB 5E5MB 4Z7UF 5CGYD 4O4YL 3FQUA 4P4KD 4O00A 1YY8A 1J86A 4J3OC 4OCXH 3N1MC 3TN0C 2J4WL 4JY5L 1ADQA 2BZDA 2I07B 3DURA 3BW9A 1GAFL 4X6CA 3MFFB 4PRBB 5I17B 3MNZA 3PXHA 1QFWI 5F9JA 3JV4B 4EXKA 4KZEH 3EBAA 5DEZA 3MO1A 4JANB 2XA3A 3C6LB 2V5SA 3GRWA 3MRJA 3NCYP 4UV4L 3MRGA 3QDME 5EOCJ 4GFTB 1BQLH 4NYLA 3GMRA 5EU5A 4WFGE 3IJSB 3BO8B 1PW3A 3K3QA 4MD0B 4TVPL 3H3PH 4FXGB 1QSFE 5GISL 2X4RB 3WO4B 3AGVA 3BQUB 4K8RH 2ZOKB 4F2MA 4I0PC 3R1GH 5HYSG 4LCUA 2XKSA 2QTEA 3VGGA 2PCPA 3MRHA 3O2VL 2JLLA 4QRSA 3WXVL 1WLHA 4FN0A 3G04A 2DLFH 5L2KB 1KPUA 3TNMB 3CUPA 1I1FA 4WI6A 2SEBB 4QY8A 3CFKB 3RTQC 5HYQA 1MCWW 4Z0BL 5CEXB 2DS4A 3EJZD 2ORBH 4FQPA 3MRQA 4MNQE 1CGXA 1GGBL 2XOTA 4GMSH 4EDXB 4BUGA 5GRJL 5I6XC 4L3CB 4Y0GA 3C8HA 3WIHH 1M71A 4PJIA 3RWIB 1S7QB 4NWUH 5SX4I 4Y16B 3DECA 3WDJA 1LK2A 4M5ZL 4BFBD 4ELKB 1BZ9A 3SCMC 4Z7NF 3FFCE 2WWMC 3NAAH 1I8KA 4NQEA 2DLTA 1SJEA 4PJ8C 3VWKA 3VDAA 3O9WC 1DEEB 3LEVH 2EDKA 2A9NH 1PSKL 4X8JB 1WF5A 5D1QD 1CLZH 3CX2A 1NBQA 1WBYA 3N1FC 2E8YA 4PB0L 3ARGC 3IGAB 1IC5L 5JR1L 1SBSH 4DOHB 3TYGH 3WSQH 4ZPVB 1JWMB 4X6EB 4XT1C 3G5VB 5IQ9A 4RMTA 1LDPL 1YYLL 5DVLA 3BZDA 5BQ7A 5E94B 1AO7B 4GQ9L 3SDXE 1MI5A 4FABH 4XAKD 3BZFA 4JFHD 1GSMA 3WLWC 5H37G 1XIWA 1CVRA 4F7MB 2AVGA 4PJGF 3V6OE 4X5LA 4ETQA 5CLWA 2E9IA 2QL1A 2VDPL 3LKRB 5AYUH 3EIFA 2E7LA 1NMAH 4YK4C 3QDGE 2P49B 4U6HB 2ATKB 4EOWL 3A67H 3FZUC 3F7YA 4LVOC 1Q9OA 4Q9QH 4HXAH 2YN5A 3LB6D 3QXAB 3U1SH 2DQTH 4N9GA 2UUDK 1SJXA 3JWNC 5J89A 3S6CA 4MDIA 5I18L 2ZNXA 1X5LA 1S7XA 4R6UA 3MMEB 5I1IL 4OB5L 1KEMH 3EFFA 1EEYA 1XF3B 2NYYC 2C3WA 4Y5VB 1QFOA 3MUJA 1EXUB 4WEUD 1S7VB 4ZQKB 1WZLA 1RZKH 2X10A 1OP3K 3MBEC 4JM2F 3HE7A 4RAVB 4J7RA 4PUBL 1HZHL 1ZEAH 5D1ZB 3BPOC 1CR9L 2VLRA 3LSOB 4UOJA 5DQJB 1LHZA 2BXYA 2YS4A 4HIXL 3O4LB 3TBVB 3SKNB 4DWHA 4U2ZA 2X9YA 1HILB 2O5YL 1WAAF 5D6CA 5JPNA 1E4JA 1U92B 1SM3L 1UVQB 2N7BA 4NQCB 5LXGL 5HHQA 3F12B 3L5HA 2YHGA 5DVOA 3IRZA 4MB5A 5FOBB 1QPXA 1D9KC 4WRLA 3TVMD 3QWOA 1INEL 1WWBX 1VGEH 4G43A 3D39A 1T7XA 2EIZA 4NN5C 1XCQB 3UBXA 4MD4A 4DTGH 4KRPB 1FHGA 5CJQL 1MFEL 2CKBH 1OF2A 4OKVB 1IILE 1NCNA 3VG0L 1J1PH 4NKMA 1IC4L 2QLVB 3H9HA 2FX9L 4LIQH 3BN3B 1NCDL 4IDJL 2ID5A 3EYUL 3VRLE 1BGXL 2J8OA 3S3SA 5FUCE 4Y2DA 4NNYB 3IDMB 3UTOA 3QHTC 2IH3A 4L4VB 4KY1H 5C0BE 5DGQA 4YBLB 4ZUUA 1CTNA 4NJAL 4WWKD 4K8RD 4MX7B 1DEDA 4QGTA 2VQ1B 2I27N 4XNQA 1A1OB 1U8KA 3B43A 1UB5B 1IEHA 1ZT1A 1K3IA 3IB4A 3OPZL 3S37H 5I75C 2ESVA 2DQCL 4TN9A 5F3HA 2BNRA 2UVFA 1XGPB 1VEMA 4DQOH 4P2CG 2MOVA 3RGVD 4NZUH 5KVDH 4WV1C 5GJSH 4OAWB 4QOKB 4X4XB 5JHDE 5CBEB 2WV3A 4Q6YA 1MAJA 2FRGP 1CQYA 2LQRA 3QFJB 1J5OH 2YC1A 3IETB 4DZBA 2JF1A 3GMLB 5IOPB 3M1BA 3IDUA 4KROC 3RNKB 3TJHD 5T1KA 4UAOC 3DLQR 1P7QB 1ULVA 4JPIB 4IRSC 4Y19B 1JHTA 3NN8A 4A6YA 3IU3B 1T0NB 5KTEH 4CU6A 2DF3A 4E41E 2F19H 3RA7L 1INDH 3CC5A 3GIZL 5KVMC 2G2RB 1FDLH 2P7TB 2WWKT 5HDQH 5FO7B 4GRLA 5E8DL 1G7IA 4YIQA 4MCZA 4RAUA 1YNKH 5JMOC 3H9ZA 2VDML 1QLFA 3AROA 1ZT7B 4WI5A 3HE6B 2DRUA 4R9HA 2A38A 2AJZB 3MOAL 5IESL 1LO2H 4JFXB 1SEBA 4N0CD 4O58H 1KB9K 2Q1EA 4N0UA 2VLKE 5A2IH 3C6SB 3N06B 3Q3GB 2AP2A 2QADC 4TSCH 1NL0H 3TT1H 2XTJB 1YEFL 4FZ8H 4YFDB 1MVFA 4EEEA 1T80A 5EUKA 2UZIH 4XXDB 1U8JA 1F4YL 3VFSB 4DZ8A 1T1WA 2ICWB 3HMXH 1E28B 1W72L 3Q48A 1FPTL 2CUHA 1CDUA 4HK3J 3C5ZD 5L0QC 2AEPH 4BH8A 1UADC 1Y18B 4LMQE 2VC2H 5JUEH 8FABB 4JM4L 4C57C 3IKKA 5GZNC 3UTPE 2OL3H 4PLJC 1KN2H 4Y1AB 2JCCA 3CDYA 3VXRD 1OM3L 1B0GB 1TVHB 4XCEA 4JRYD 4Z7NE 3JV6B 5BS0A 1GIGL 3FN0L 4KWUA 1G7LB 1P7KB 3CDGA 4ZSOE 2EEDA 3DARA 1AQKL 3IDGA 1BWWA 2PYEB 5E6ZA 4N5UA 3W39A 5CP7A 5EU6D 4PRAB 1S7UB 1P53A 2BNQA 3GM8A 1CL7L 5HYJB 4PLKC 4C54A 5B38A 1HXYA 4PGBA 1MNUH 3QIBA 2XN9B 2VXSH 3QUYB 3ARDB 4DGIL 3QDMB 2BNUA 2N1KA 4X7TA 4FXKB 4MA3A 4ODHL 4JPVH 4GLRH 2VZ3A 5IWLC 3SGJC 5I1AB 2J6EA 6FABL 1AC6A 5IROC 1W0VA 4PJGE 3B9KA 4YDJA 4ONOA 5C8JA 4GW4A 4OZGA 4LVNB 1F4HA 5CWSA 2Y7QA 2ICWJ 4F7PA 4HF5H 2H41A 5C07D 1EFXB 4Z7VA 5TDNB 2FX8H 2QSQA 2GTZA 3NFNA 1A7QH 5CIPA 1IRAY 5ANMA 4GMTL 5DJZA 1UWEH 1IEAB 1TETL 5ITBH 4G8IB 1AKJD 4IMLB 2LAGB 5KSVA 3HB3D 2B4CC 1EVTC 2IG2H 1OT2A 3QBTB 1MY7A 5I9QB 2X1OA 4MNQB 5T5FL 4JHWL 3NABH 1OQOA 4FG6C 3CX5K 4GW5A 4ELMB 2HKFH 2FR4A 5JW3H 3EYOB 4Q7DA 4P46B 2XV6B 4MMZC 1T7YA 1RZ7H 1ZA3A 4OI8A 1ZTXL 3QUXA 3VXNB 2HVKA 4U1IA 1CT8B 2K3TA 1YEIL 2PXYB 4PJDB 1WAAE 4AEEA 3O4OC 4NKDB 4W6WB 1I3RA 4OLYH 1NH6A 1OAXH 4ZOAA 2ICEB 2C7UA 1A14L 4X0KA 4OGXH 5DUBB 4EI5A 3GBMH 5SX5K 1YA5A 1AR1D 4F33A 3WO3B 1KN4H 4DJMA 1II4E 5FYKH 1AGDA 2FATH 3IAGC 3VDBA 2EXYD 1WFTA 5J6GA 4XVUC 5DHVH 3JWOH 2DQFA 1JHLL 3L3DB 1XMWA 2YA0A 4I0KA 3SDXB 3PQYB 1W72B 5EBWA 1FNLA 5D96C 3BP4B 4WI2A 1ZGLB 1T2QH 5KVFH 4YC2C 3AREB 4OZ4B 2EDJA 1CE1H 4YLQT 1DJSA 3E6HA 3UJTH 2AEIT 4XVJH 1R3KB 4K23L 3QDGB 4KI5C 3X3GL 1F3JB 1JWSB 4PLNC 1PKQE 3JWDL 4KQ3H 1U8MA 2WSKA 4DCQB 3HAEG 3QIWA 2NY7H 4KK5C 3MGTB 5F1SA 3B2VL 4G6KL 1BWMA 3BDBA 1C12B 3DUUB 1RHHB 4QRUB 1N4XH 2X4UA 5TQ0L 2EYSB 2YPVL 3BGFC 2R2EB 1XR9B 2YMXH 4JKPH 4D94A 5JA8B 1EEQA 3IAQA 1VFBA 2XPGA 3BE1L 4G9FA 2F53E 1G7MA 2FZ3A 3ROLB 1FN4B 3QA3A 3QEHB 1I7UA 4ZFOL 4UINH 5IKCA 4F8QA 4GG6A 3L7EB 4L3EA 1RI8A 1RPQA 1QRNE 5IFAH 4GKZA 5ISZD 1MFDL 2BCKA 4HIJA 2HJLB 5I16B 2JJUA 2BMKA 3WV0A 2Q76B 2W0FA 4WFGD 1OSPL 1YECH 1Q0XL 1J1OL 4LASL 1XF2A 2KZ1B 5BRZA 4NZRL 4WU5B 3LKPA 4JRXE 1VACA 1XF4A 3WS3A 2VLJA 1NBVL 4QEGA 2A1WL 1MAMH 1XF1A 5HVFB 2E6QA 1MREH 2BVQB 5TDOA 3NIDF 1CGYA 1XR8B 3C60B 4K7PH 3N85L 1NUGA 2VL5A 4RGOL 2DBLL 5IHUL 4WU7A 2A9MH 2XZCH 1CDJA 5ID0B 1UKTA 4WFHE 5CJ8A 2ZCKL 4U49A 4JO4L 3ISWA 4HPYH 2NY1D 4AEHH 4KMTL 3MV9E 5E2TH 5DS8A 2GJ6E 5T1MB 1ITBB 2HA1A 2ARJQ 4ZD3H 3HR5B 5L7XH 2GHWB 3GBNH 4C4KT 5DT1H 4KHTH 3WJJC 4HIIB 4IJ3C 3O3EB 3OAZH 3VJ6A 2Y36L 5BV7H 1RU9H 3T04D 4R0LB 4P57A 4NO2B 2DAVA 5IW6B 3I9GL 5GGQH 4G8EB 4QT5B 1KUMA 4JDZA 4NN6C 1KYOK 1T5WA 1I1AA 1YDPB 2Z31B 1IGJA 3EO0B 4ZUVA 5IR1A 2AQ2A 1A8JH 4JG0L 3NCJL 2ZKHH 5J11B 1JMXA 4YGVA 3BIAX 1ZLSH 1SJHB 4ZXBB 4LMQI 4LDLB 2WBWB 1R5WA 1ERNA 4PGCA 3T8XA 5D7LD 2BVPB 1S8DB 3B9EA 1KTRL 3S5LG 4OF6A 3L3HB 1MJ8H 3AS2A 1A6UL 3FN9A 3RWDB 2RCSL 3V6BR 1BD2A 2X70B 4EBQH 1LP9E 1FFPA 2DL2A 5DVMA 1NFIA 1MWAA 4U33A 3AB0C 3U36A 4KPHL 5D1XD 3FQWB 1YNTA 3PHOA 3GSWB 43CAB 2EDYA 5LWYL 4HJGB 1CDGA 3KXFD 4EZMA 3DMMD 5I1LB 1PX4A 2DQGH 4FQHA 3Q1SL 3AY4C 4N0YL 4M7ZB 1XGRB 5FYKD 3QEUA 1R3LA 5JXAH 4DN4H 3V6ZB 3CMGA 1P4LB 4O2FA 3QQ4B 4XZUB 1J87A 4HQQH 4HUMB 4KTEH 1NGQL 3S7GA 1YJDC 4NNXA 1U8LA 4MQ7A 4MWFA 1KLGB 2VLKB 1CGSL 4XCYB 4G5ZL 4Z76A 4XPAH 3KPRA 3SGEH 2EYTB 5TF1L 4F58H 1NEZG 4O5LH 3IXAB 4L4TE 5GGVL 3VWJB 3HUJF 5C0IA 1QSVA 5F1NA 3NH7H 2WLZA 1DVFA 5JTWA 3IJYB 1FLRH 1LO4L 1A7OL 4H1LA 2XZQH 1IKNC 2A2QT 3UPAA 1KB5H 1HHHB 2MWCA 35C8L 3RVTC 3FT2B 2EKJA 4KK9C 4ONGL 4MMXC 4P9HL 1VDGA 3DVNB 2NXYB 4KK8D 1XIWC 1QVOB 4MXVF 1A9EA 3N1QC 4WGVB 2FGWL 4F7EB 4CW1B 5EZIH 3OZ9H 3OKKA 5TE6H 4LPTA 5F9WB 4EI6A 4KRMB 4ENED 4AG4H 1OTSC 1VFAB 4HUWB 5JXED 3FL7A 3KPOA 4ZSOB 1I8LC 2ZUYA 4OD1L 4X6DF 4S1RL 4LHUA 1IM9B 2B1AH 3TBYA 2WBJC 2R1WB 5JHLH 3RVWD 2H32A 2GFBB 3CVIH 4JPWH 1KTDA 1RUQL 5J6HB 1XGQA 2IMNA 4FFYL 4OZHB 3BVNB 3MV8D 3QYCA 5IV2A 1CN4A 3HI1B 3G5ZA 4MAUL 4XC3H 4JFPA 4P2OC 3KPMA 4N8VA 3GSOA 4ZO9A 3PNWA 2V17H 5J8OA 3O2WH 4HKXB 5JHDD 2PO6A 5CSGA 4LBEA 4UV7H 4TNVK 1HSBA 2XQYK 3W0WB 4PJGB 4NOBA 4LNVA 3W81A 1XH3A 4R4ND 1DBJH 5FV2A 3V4UL 5EA0H 3U7YH 5GS0C 3G5YA 3UZVB 4NO3B 1I9RL 1QKZL 2FJGA 3QDJE 4XPTL 5HYSB 2XA8L 3GSXA 4I3SH 4KVNL 4X6FB 3HMWL 2R9HD 3C5SB 4I8DA 2FD6H 5JDJA 4QYOA 2I9TA 4E41D 2NY0D 3GSQA 3KYOA 3VRJA 3ZL4H 3QQ3A 3AM8A 4X6BB 4RZCB 3QQ9D 2L4OA 2BY3A 2WUCL 1GGCL 1SHMA 2NY2D 4NM8H 4MLIA 1KCRH 4L8SC 4PG9A 4MS8C 4NQDE 5IMMA 3FB8B 2IBZY 1MH5B 4XRCB 2R2CA 3F5WA 3RIFK 2FCBA 1QUNA 4WO4A 2Y9RT 3IDJA 2ZCHH 4UDUA 4G7YH 4JM2B 4KDWA 3VDCA 1KC5H 5HHME 2F5AH 1WZ1L 4LCIH 3P77B 3CFEB 4JFFA 4BFEA 5I66B 3RZCB 2NX5B 5AYQA 4BKLA 3JVGC 3MLPA 5IB3B 3G08B 3FT4A 1T6VN 3QEGH 1U41A 3OF6A 5DJXA 4LCYA 4WHDA 1FC1A 3GI9L 1EEZA 2DQHL 4YAQA 2Z4QA 3P4MA 4P2QA 2R69H 3WDIA 2BVTA 3NIDE 3PJSA 4KMQA 5I1KL 4FQLH 3C87A 1FQ9C 3V9FA 4CDHA 1D6EB 5HY9B 1ED3A 4HWBL 2D3VA 4U1SB 4K9EH 4PRHE 2W60B 1NFDA 3HG1E 4QHNA 5C70A 4H5SA 4V1DD 1EHLH 5CJXC 5JIKA 4MJ5B 2HG5A 4TQEL 1I1RA 3HI5H 3D0LA 2JK5A 2HVJA 2D7MA 1MF2L 4PJFA 5EZJB 3UTPD 5C2BH 1U8QA 5T1DL 3IDNB 2MQCA 5GGSA 2CRMA 2IPKA 4M1CD 4XNUL 1PKQB 1BAFL 2JELH 4KDTC 1HINH 5FYLL 5IK3A 3D3VD 3MRBA 5F7DA 2XWJB 4ZNCD 4M7JL 2DQJL 4X83A 3VI3F 3X14B 2APXA 1C16B 4WHYG 1CFTB 1RJLB 3G6JA 4DGVL 3TH2T 3TYFB 1MHPH 1I8MB 1VHPA 3ZTJG 1FC2D 2HFEB 5C0RH 2AI0L 3MRCA 1JMZA 3MXVL 1UFUA 1T0PB 4PTUA 5FO8A 2YSSB 3I75B 3VXTB 3RY5A 2C5DC 2H9GA 5FK9B 5AZEL 32C2B 5MEOB 2CR6A 1TJGL 5GPRA 4FFZL 3DHMA 4J8RB 2MQ3A 4HJJL 1CFQA 3DX9A 4YHNB 4PJXB 4Y88A 5MENB 1NC4A 5KS9F 4LCWE 4WI4A 4W4OA 3TBSB 1G0YR 3EYFA 4QKXB