5K59E

Crystal structure of lukgh from staphylococcus aureus in complex with a neutralising antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
210
Chain Sequence
b'ELQLQESGPGLVKPSETLSLTCTVSGGSISSGSYYWDWIRQPPGKGLEWIGNIYKSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARERGMHYMDVWGKGTTVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized leukocidin-like protein 2
publication title Context matters: The importance of dimerization-induced conformation of the LukGH leukocidin of Staphylococcus aureus for the generation of neutralizing antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus (strain usa300)
molecule tags Immune system
total genus 39
structure length 210
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k59E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k59E01
3F7PC 5D96B 3TESA 4XC3H 3WKNA 1TCRB 1VADA 1IRAY 4OCYH 5D7JA 1NAMA 2F9BT 2BFVH 2X7LA 5IG7B 2D4FA 1IGCL 3C6LC 4M7ZB 2PKDA 2V5MA 3ARGC 3T1FA 3LDBB 4OLWL 1A9EB 4JE4B 4OZ4B 1KXTB 1MCPL 3ZT6A 2YPLE 1HQRA 2J2ZA 1I8KA 5D2NC 3L3OB 4GKNA 1JNHA 2OZ4H 3WO3B 3EGSA 4YDJA 3BPLB 3FRUA 2E9IA 1G7JA 1CD0A 5FO8A 3G5YA 5LWYH 2AEQH 3TNNA 3LKOA 3CXDH 3L7EA 2E8ZA 4PJXF 1RZKH 5F1OB 3QFJB 3FO2B 4G9FA 4YO0B 1I3GL 3KPLA 3MREA 3R8QA 3HPLA 2GQHA 4W4OA 5E9DA 4HH9A 4LLVB 3CFBB 5D2LF 1UADC 2V7HA 4D0DA 1QLFB 3KG5A 4RBPH 1U6AL 1BAFH 4GFTB 4DKFH 4X7TA 2B8OT 4X0KA 3CSYA 3IDGA 4U3CA 1F2QA 1IEBB 1P53A 5JOEA 1OP9A 5K9JH 4MA8L 2EKSB 1TIUA 4PJAB 5C8JA 4NQDD 1A1MA 3TH3T 2EIEA 4KI5D 4NO0A 5LVEA 5DJ0B 4WW2A 5AAMA 4G3YL 3RX7A 3KLAB 5KANG 1S9XB 2PYED 3FT2B 3O4LA 4JFFD 5E6IC 4MX7B 4QGYA 1FYTE 1TJIL 1X5HA 1CU4H 3OXRA 5DFVD 5EWIL 3SDXF 3ROOB 1QR1B 5EFIB 2XA8L 3FQWA 4DOHB 1T0PB 2OSLA 1GAFH 1RVFL 1AC6A 1HWHB 3WYRA 3UTTE 3QNYB 3QDJD 3NCFB 3QISA 5TH2A 2R2HA 2QL1A 4OKVA 3TBVB 4GQPH 4YE4H 1I1RA 4UIKL 3W9DB 3TNMA 3H7LA 1RAMA 5T1MA 1FGNH 3DMMD 5IUSA 4H0IA 4BSJA 5EORH 3H8NA 1BOGA 3ILQD 3LQAH 5IVXB 1BQLL 4JM2F 3U6RA 1B88A 2ICCA 2DLFH 3JTSA 5DJXB 3AM8C 2APFA 2ITCA 3W2DL 1EVUA 2LVEA 3UTSE 2C7UB 3RAJL 1S5IH 3KDMA 4J7RA 5E5RB 4NQCA 3IDUA 4QHLA 1AGDA 3L9RB 1T4KA 2VKXA 4WFED 4J4PA 4JGMA 4M6NH 5C0CA 4DQOL 4NNYB 4QXTB 2CLVB 4U0RB 4X6CF 1MHEB 4XAWH 4XPHH 3RL1A 1KPVB 1KULA 1JGDA 3ZKMC 4PUBL 5MEQA 4X4YB 3T4YB 2CIKB 4QHMA 2D31A 1CLOH 4G7YL 3RUGA 1AXIB 4GOSA 1YPZE 4Y19A 2ZPKH 5DMGC 1T2QL 4L8DB 3WL9A 1QBMH 5D1ZA 2R2BA 2A2QT 3SGEH 1CTOA 4XXCA 3QPQC 4TYUA 3SDYH 4IRJB 4XP9H 4HC1L 5FXCH 1MIEL 4ELKB 4Z7WA 1B4RA 4PYGA 2D0HA 1WFNA 4JPWL 2OMBA 1ZHNA 1OF2A 1ZA6B 4ONHA 2WINB 5L2JA 2QQLL 3MRQA 1R5VB 3S88L 2BNRB 1SQ2N 5HYJB 1P9MC 4W4NA 2YS4A 4QWWC 1GRWA 4F7MA 4L1DA 1N7MH 3UBXA 5EOQL 4R7DA 4UU9B 3QH3B 5MERB 5JW4R 5I1DA 2BSED 1A7OL 5F3HB 3U4BL 1C08A 4GKOA 5C9KA 2FX8L 1NUNB 1DBMH 5JXED 5KVFH 1S9VA 5ANME 5IOPA 2EIDA 5CD5C 3CH1B 2NY2D 3QUXA 4G8EA 1KTDB 3ZYOA 1C1EH 3NACH 4M6OL 3RUGE 3MZGB 2AAVA 4WCYH 2WIIB 3G5VA 3WXVH 3VXTB 3KPMB 1JPGA 1R24B 4R3SB 3U0PB 4XH2B 1NCCL 1TVBB 4WFFD 5CJ5A 2XKNA 3HC0B 2V9RA 4XX1G 1UJ3B 3QIUC 4FS0A 4X7FC 4JFEA 3B5HA 1MNUL 4MVBC 3G5ZA 5E2JA 2ID5A 5D9SA 1LWRA 3CPLB 1F4YH 1O5DT 4OF6A 1LEIA 4R4ND 4XVJH 5CGMA 1SMOA 1ZVSA 2HJLA 1C5BH 2PO6B 2EH7H 4MA3B 4HIXH 3DWTA 4JHWH 2VDRL 2V2XB 2EYTB 5I2IA 3VCLA 5GGRY 4L8BB 4H20H 1F90H 4BFIA 5CJOH 5I30L 4NO3A 3BFOA 2HFEB 5SWSE 3PF2A 5D7LA 5HPMA 2AV1B 3P4NB 2FX9H 3GMLA 1T1YA 1N64H 1JHLH 4QNPF 1Q9OB 4GMTL 4ZFFA 5CLWA 1J87A 5IT2H 4YFDB 1T0NB 3TBTA 2O5XH 2R56L 1YYMH 3MO1B 4LLWB 5IFJB 3ARDD 4LDOB 1GHFL 1KF9B 4MD5A 4ZTPH 2DWDB 3OB8A 1GGIL 1FZJB 3OAYH 4I9WD 3B2UC 5F7EL 5EC2B 3PV7A 1I9JL 3QDGA 4H8WC 4NCC1 5C86A 4D3CH 1T2JA 3U0WH 1CLYH 2GTZB 4PRHA 3MV7B 5JA9A 5KJRL 2VLRA 5J9PA 3WD5H 4PG9B 4X7SL 1A6TA 5DDHB 2OL3H 3NCJL 1QSFE 5D96C 4YHML 3FT4A 5I1AA 4P46D 3SEPA 4L3CA 5C6WH 1E6OL 5I6XC 1T7VA 5HHQB 4NHCH 4V1DD 4LP4A 3CDCA 4DK6A 1UM6H 5D5MA 1S7QB 1RUQL 4PBVC 1BF2A 3L7FA 3UTQB 2CRYA 4XP4L 1CD1B 5EBWB 2HMIC 2YK1H 3P77B 3HC3L 3HMWL 4EI5A 4ZAKD 2VLJA 1FL5A 3BPLC 4I0PA 4HZAA 1M71B 1TDQA 3IFLH 1DQLL 1FV1B 4L1HA 4ZNEA 3TA3A 3P3YA 4LSPH 1U2CA 5CSZA 5IWLA 3GSQB 4JRYE 4Z0XA 2B1HH 1QLEH 2VR9A 1WZKA 4FQXD 4LIQL 5A16B 3BMWA 2NY6D 4HPYH 3VWKB 3HE7D 3TM6A 4G5ZH 1A3RL 4AMKH 3GSWB 4WFGE 5DRWA 1TTFA 4U1LB 2CRIA 4UV4H 2XWBB 3RNQA 3VXOA 4OCSH 3OJDB 4ZFOB 1NMCB 4OZHE 4IOFD 3D39E 1T5WA 4HIIA 5C0RL 4LGSB 3QUZD 3QIBD 4O2CA 2GYSA 4N0YH 3P30H 4U6HA 2PETA 5DFWH 5FYKU 3HZYB 4IM8A 2R8SH 3MV9E 4LL9A 1T6WA 5MHSE 1GZPA 4XCFL 1SJHA 2PYFB 1U2HA 5IQ9B 3AXLA 2A6DA 4YPGA 3HZVB 4DEPB 4UINL 3RKDD 5FA4A 1Q9WA 3TJEL 2Q3AA 4AIZB 4PTTA 2R4SL 1DTUA 2JJSC 3WLWD 3RVVD 1OAXH 1A6AA 1WC7A 5HVFB 1ZWIB 3WXWL 3V7AG 5EBMA 3W11C 1F2XK 3SDAA 3TO4D 4XMKH 2P8LB 4EN3D 4RGNE 4NFDA 4ZXBB 3HG1D 2H26B 1A3LH 3M17A 2Z92B 4XWOD 3WLBB 5EZLB 5C09E 4BKLA 4QKXB 4P4RB 3GJFA 1A7RH 4FOMA 3BN9C 4KDTA 1WLHA 3QDMB 1LDPH 1UKQA 1YYLL 2R4RH 2YD9A 1UYWL 1ORQB 3D87B 3KPNB 4L3ED 1LEGB 3L5XL 3SE8L 1V7MH 4YWGL 1BMGA 4PJHB 5IGXL 3SDCB 2LU3A 1ED3A 3EDKA 3O6KL 1JWUB 5EO9A 1W0WB 4TULL 3EOYG 1QTYT 1BQUA 2AKRB 3MUGA 1VENA 1R3HB 4J1UA 1W2KT 2EKJA 4EI6A 1DLFH 3QWOA 1JGEA 1R5IA 2VDLH 3EFDL 4OLZL 3MLTB 1JGVH 2AI0H 2BSSB 4DW2L 4MAUL 2H3NA 3NN8A 3TH4T 2X70B 1IC5L 4KK6D 2VDML 4JFPA 2LV4A 3HFMH 3SJVE 2W07A 4G8FA 3GHEH 4MDJA 2AJYH 1QBLH 1RUKH 2JCCE 1YMMD 4H88H 2WLZA 1CFVH 1MLBB 1WBZB 1YA5A 1J0KA 3RY4A 3V0WL 4ZO7A 4AL8H 5JHDD 4P3WA 5B39A 2CLRA 1QKZH 5I66B 2DIJA 1FBIL 3VDCA 4HUVA 3FO9A 5F9AC 4PGEA 1I1YA 5FOBB 2MOVA 3EO1B 1MCDA 1MH5A 3GSVA 4OTXL 3BUYA 3KPRE 4NNXA 5ADOL 5IR1A 3ZZ1A 4Y2DA 5FYJU 2YC1A 1T5XB 5F6HI 4KI1A 4NBYB 4XZUB 1OB1B 1T21B 3S9DB 1IM3A 1IAIM 4XI5D 3SE3A 4KPHH 2MHAA 3VFOB 3SKMA 5DUML 3BAEH 3CSGA 1NBVL 5KOMC 3EOAA 5E8PA 4ONOA 3E6HB 3WFBH 5AEAA 4GXUN 1KT2A 4I2XE 1EEQA 5FGCB 3GSXA 5F93C 5CIPA 3EYOB 1HNGA 1BIIA 2IQAB 6FABH 1MFAL 3D18A 2IPKB 1UJ3C 3MR9A 2PW2B 4M5YL 4XHQA 2HLAB 3QEGH 4NRYA 5EZIL 4KAQL 3QZWB 1Z3GL 1F11B 3C5ZA 3RDTC 2KBGA 3QUML 2PO6C 5FECB 1T20A 3MGTB 2EIZB 3TCLB 2WWMC 1RY7B 5JHLL 1M4KA 1B0RB 4NDMA 4Q0XL 3T2NL 4GKSA 2VSCA 3LZFL 4EOWH 5FO7A 1MFNA 3B9EA 3VWJD 1WAAA 4LHUB 3AC0A 4KY1L 4JY4B 3VU2A 3WDJA 1BLNA 3IF1A 5CBAB 1NAMH 3LEVH 4FFWD 4WU5A 3BE1H 1F8TL 1RZIB 1QBBA 3ZSSA 4CADB 3KPSA 1KEGH 2DB8A 5D1QD 5IMLA 5AAWA 1W8OA 1CE6A 2FH6A 3DV6B 3I6LD 1FL6B 2VQ1B 3NFNA 4P23B 3KJ6L 1CDUA 2FNBA 4Z7QE 3O41A 4NKDB 4KI5F 4P9ML 5LAXA 2OL3B 2EXWD 4OZIA 4I8DA 4GW4A 2HT4D 3O8XA 1FVEB 1S3KH 1N3NA 2YN5A 3WFDL 1NPUA 1ZV5A 3WUWG 1S7VB 5FEBA 1NSNL 3CFDB 4NT6A 5E6YA 5FUOL 1MQKL 4HJJL 3FQXB 1MRFL 3QFDB 4MJIB 4PP1C 4O4YL 4OZGA 4OI9A 3PQYD 5J8OA 4HJGB 3OG6B 4WEUD 4CN4A 3LRHA 1U42A 4RFEA 3H9SA 3KNBA 3HPJB 5IK3B 4BZ1H 2NXYB 1KPUA 2F8XC 4JFHE 5ERWA 5I1CH 3WDIA 5E08L 1PSKL 1CFTA 3F7RA 2R0ZH 4OD3L 1GGBH 3LKQA 2BOCA 1E4WH 5D6CA 5GISH 3MLVH 5CEZE 4KVCL 5GGVY 3G6AA 5IHUH 1SY6L 4EZMA 4LSSL 4FQJH 4AK1A 1FDLL 4DJMA 1X4XA 2V7NB 4WUUE 2FBOJ 5GGUB 2X4RA 4KWUA 3F5WA 4UT7H 3RVUD 3T3MF 2VR4A 1HINH 1DANT 1H8OA 1YEHL 3VWKC 1I9RL 3VD4A 1WCBB 1AI1H 5DC4B 2D0GA 4DZ8A 4HMEA 4WI7A 3LN4B 3U1SH 3QT2A 5IW6B 1OAUH 2DTSA 4OQTL 1WFOA 3ZE2F 2YXFA 5D1XA 4MXVE 4KMQA 5BXFB 3QI9B 1NMCC 1IKNA 2M1KA 4FA8A 5TDOB 3MRBB 1T3FA 3IB4A 1TVHB 4I77H 4LSQL 4JO3H 2YPVH 2FEDD 4GRLD 4M5ZL 1C16B 2FBJH 5ILTH 3OG4B 4YGVA 5FUZL 1JNLL 1URLA 3CFCH 1B0GA 4U1KB 2GK0A 1EZVX 3O6LH 2Y5EA 4E42A 1U8MB 4OT1L 4G6KH 4PJGB 3ZMRA 4DEPC 5B39G 3GIVA 4ODXA 3RL2B 5J13B 1L0YA 3CVIH 4N0CC 1UVQB 4WEBL 4YPJA 5E8DH 5H8DA 3U9UA 1WTGT 1QSEA 1WZ1H 4JREB 1UCTA 3IU4H 4S1QH 1KIUA 3LQAC 4JY6B 4XP1L 4DKAA 5HI5C 2YBRA 2KQMA 1VA9A 3RWEB 1ZT4B 3S8WA 1HKFA 3FZUC 5C0AD 1RJYA 3BPOC 1SEQL 3DXAE 4GRWE 4RA3A 4ZXBC 3JV4B 2ZNWA 5J3HC 1Z5LB 3P73A 3X17A 2UYLB 1N4XH 1ZTXH 3UZQA 2BNQB 4I18A 3FL7A 2MSPA 4HFUH 5E2UH 4WWKB 1KLUB 2HFGL 1ZLUK 3Q5TA 4K2UH 5L2KB 3QJHA 4PB0H 1MELA 1J0YA 2UWEE 3VFGH 4KJWD 3TBSA 1FGVL 2P48B 3SDCC 1NEUA 5DJCB 3FT3B 4N68A 2G5BA 3RVWC 3BO8A 3SCMD 3VXSD 1RULH 4CAGA 3F62A 1KN4L 3L3HA 1F6AB 4ETQB 4KHXL 4C56B 1H3XA 3EOBB 2EDEA 2O5YH 1T04A 4ODSL 1JYVA 4P2CG 4K3DL 3HC4H 5LGJA 3QAZB 2P5EE 2BY1A 3EFFB 4P2QD 4ZYKA 1G7HA 5I15H 1H3UA 1QSEE 2UZYB 4FMFA 1FFNB 1PX3A 4OM1H 4OCNC 2W91A 4Z7OE 5C08D 4DVRL 3MBED 1OSZA 5GS0C 4GSDH 3MOBH 4YDKL 3GO1L 1KIPB 3VXQB 5FKPA 1IZKA 3SDDB 3GBLA 3UYRH 3LS5H 4RZCB 5HY9B 4L8CA 2F8VA 4MHHG 4AEHH 5HYQB 2VDKH 3HI1A 1AFVL 1X44A 1FPTL 4N1CA 1HOCA 1EA9C 1HHJA 1T1ZB 1K3IA 2W9LA 3CFKA 3B9KD 1TPXC 1IAIL 2YPLB 2DQFB 3MRFB 1EEUA 3VFWA 1UQSB 4HWZB 1FC1A 2VISB 2Y9RT 1U8NB 4XBGA 4KKBD 1MCBA 1YZZA 4OF5A 1RURL 4HIHA 3MCLH 1FVDB 3QQ4B 2GAZB 4QF1A 3MLSL 2X41A 4S1DC 4P5TA 4JRXA 4C83B 3VXMD 4WHTB 3P0GB 3K8LA 1P4BL 2DYPD 5C0FB 4XC1H 1X5LA 1NC4A 1A1OA 4O51B 2ZCHL 1JV5B 4NZTH 1RFDL 2E3VA 1CCZA 1IGTA 4Q9CA 1HI6A 2HH0H 3G08A 4G8IA 3RY5A 2ZKHH 3BESR 1WWCA 4Q9QH 5GZNC 5KSUB 1ADQL 1EERB 2RFXA 1G6VK 5FGSA 3VFTA 1KNOB 3D25A 4X9BA 5FM4A 4HIEA 3QUYA 1XZ0B 1JI1A 3MNWB 2APBA 2FJGB 5CEXA 3IETB 1VADB 5D7JB 1NAMB 3C8KB 4ETYA 4R4FL 2YA1A 3LEYL 4V2CB 4P48A 2YKLL 2Z0BA 2MPAH 1FG2A 1I9EA 4EXKA 3F12A 3BKCH 1OP5K 4KGJA 4ZPTA 1HQRB 4NC1C 1NDGA 1I8KB 2EYSA 3AGVA 1FYTB 1E4XI 3LPFA 5DYOA 3PWPD 1OARH 2VNCA 3EGSB 4G8GA 4GBXB 3FRUB 4OB5H 5I18H 3RWJB 3G5YB 4P23C 4DN4L 4Y5YB 3TNNB 3WE6A 3DGCR 4NZRH 3RX8A 3UTTB 3V6FA 3L7EB 5FYLH 1I1AA 1NANI 5JPMB 1JWMA 4GG6E 3WBDA 4AEIL 3KPLB 5HHVL 4CVZB 1X5ZA 3C5SA 3S97C 3JUZA 4YHLH 5E9DB 2SEBB 4XNQA 5I1EL 2WP3O 3L1OH 1A6UL 2JELL 1A5FL 3DRTB 3ZDYF 2OBGA 4G6FD 3ZHKA 2QQQA 1AQKL 5E6ZA 4Z76A 3IDGB 4N1EA 4JB9L 5DT1H 4MMZC 5D6DC 1OLLA 2JB6B 3NCYS 3UTSB 4XBEL 4PJ8D 3RVXD 2NXYC 4P59L 4XCCH 4XNZB 4NN5B 1RJCA 5C8JB 2DQUH 2HVJA 1XGQA 4GAYA 5EA0H 4HBCL 4RFOL 1J10A 5I1HH 1DVFB 2YOCA 4XPFL 1D6VH 2B1AL 1DDHA 2R1WA 4RAUA 3TV3L 4NZUH 2QKIA 3GSRA 5DK3A 2FECI 4MJ2A 2WUBH 4WI2A 3V79C 4PGBA 1K6QL 5HHPA 5IB3A 1YPZB 4H1LA 3WIHH 3OXRB 1OCWL 3CZJA 4G8GE 5EZOH 3U46A 5F9WB 2OSLB 2UZXB 5DWUH 25C8L 1OGTA 4O9HL 5FA3A 2IFFL 4Z8FH 3BKYL 4IBLT 4OZFH 1ZLVH 5K9KB 5IB4B 4S10A 3AS2A 1K3ZA 3EO9L 1KXVC 4YXHH 1MJUL 1CXKA 3QI9C 4YXLH 4OAWA 3GBMH 3PDOB 4MNQA 1BOGB 4KZEL 1MJ7L 3D0VA 3TWCH 1KJ2H 3OHXB 4HCRA 1BFSA 3QIWB 3U9PL 2EEDA 3ARFD 2CO6B 4F9LA 3GMQA 4NCC2 5E95B 1WBYA 3QUKA 4ZUWA 4J6RL 4Z7UF 3GJFH 4NQCB 3VFNA 4QHLB 1AGDB 5ICYA 1T4KB 1IGYA 4NQEA 4TPRH 3PP4H 3M8OH 3TO2A 3JTTB 5C0CB 2ZWLT 4KQ3H 5AWNL 5GQBA 3KYKL 4KHTL 1WJ3A 3RL1B 5J13C 1J0ZA 1JGDB 4HJ0C 1YEGH 1OGAA 4TOYH 1A9BB 5HGGS 4P3CL 5MEQB 1G6RB 5IQ7L 1WEJL 1AY1L 4QHMB 2VITB 4NKIH 2DQHL 1AXSA 4GRMA 1BJ1H 3RUGB 5AG9A 1AKJD 1ZHKB 3H9HA 4M7JL 1AR1C 5D7SH 5CILH 4GJTB 4PJBE 3IFNL 4PD4K 5DQDH 3RZCB 1N5YH 5DXWA 2DS4A 1H5BA 1U8KB 4LSRL 4FQ1L 1JWSB 3T08A 5IROC 4D9QD 2J1KA 2F58H 3QJFA 5LCVH 4WWKC 3MA9L 3EJYC 4L5FL 4WHYH 2NY0B 3CVHL 4B7IA 4Z7WB 3OKEA 5C07D 2YUZA 3EZ8A 3O3AA 4S2SB 3EDEA 1T7YA 5DRNA 5D70L 4MNQE 1ZHNB 1LK2B 5JNYA 3SQBA 4ONHB 2XZAH 4Q6YA 2P8MB 2ZUTA 1U8QA 3MRQB 3ETBF 2AQ2A 3BMVA 1CL7L 5JXAH 2H2SD 2BC4B 5SWSB 3KS0J 2IH1A 1X9QA 3UBXB 4APQD 4LKXA 3PWNA 5E4EB 1KACB 3QP3A 4F7PA 5I1DB 3CX5J 3BDXA 5T33H 3G6JA 1BQHG 3DX8A 5DF0A 3QXDA 1PVHA 1OAKH 4JO2L 2IAMB 4ODVL 3QAZC 5CCKH 4HIJA 1WFTA 2DWEA 1CS6A 5BZWB 1YNKH 2P5WD 5IOPB 4X8JA 3QUXB 3I2CL 3I50H 4G8EB 1I9IL 4JRWA 4RISH 3VG9B 1NCDL 2C4XA 1D5IH 1S9KC 1IMHC 3L3GA 4NWTL 4YC2B 5GS2H 1BD2D 5FHBH 4F15B 1JPGB 5FKAA 2MNUA 4QOKD 5I19H 3X13A 4IIQA 3LH2H 4NNPL 3A67H 1QSFB 3BRGC 5KSBF 4JFEB 4XVTL 3VH8A 1YY9D 1MSPA 3RA7H 1LO3H 2WW8A 3IDMA 1XIWD 3RWHA 1HHIA 5KS9A 3ESUF 3Q5YA 2L0DA 3HLAB 1QNZL 4Y4HD 5BO1L 1M05A 3UTZA 2V17L 1MRDL 5A3IC 1CDJA 4M1DL 4YBQD 4WNQA 4BFIB 4HKJA 3HA0A 4NO3B 4X8XA 1NCWH 3L6FB 5AG8A 3H6JA 4PJ5A 1AE6H 4KROD 4L9LA 4YUEL 1MFBL 5E5MA 2ADIB 1RJLB 4QT5B 1F3DJ 3FAXA 5JW5A 4JQVC 4HHAA 5CEZH 5IB5A 4XX1E 2AJUH 4U1HA 2UZIL 3GIZH 4Y16D 2OP4L 1JP5A 3NPSB 2IC2A 4G80A 2VH5H 3MMEB 4HUWA 4ODUB 1X6LA 1D5XA 3QDGB 2AXFA 1AO7E 1FLRH 1U8LB 1XGRA 2OJZL 3OMZA 4PRHB 1EUUA 3GI9H 4PJXE 4OKDA 1E0OB 1MEXL 2JJUA 2BRQA 3ARED 5MEOB 4NQVB 3GK8H 1S7WA 4LCIL 5D2LE 4OZHB 5I1AB 4H1LG 1OPGL 4OCRH 3D39B 4OFYA 5HI4D 3SE4C 1KUMA 4ONGH 3OPZH 3E8UH 1SEBA 3L7FB 3PV6A 3MV9B 1CWVA 2H45A 2XTJE 2MCG1 4JZJC 2C3HA 4ZUVA 3NH7H 2RB8A 4GBXC 3DVNA 2VZOA 2NY3D 2ATKA 3VFPA 4YEFA 4Y5YC 2VXSH 5DVLA 5JDJA 3GMOA 4E41A 1KPRA 2C1OB 1EAJA 1P7QA 2ILLA 3TA3B 4Q74A 1HZHH 5D72L 4FNLH 4Z0XB 3ZTNL 3T0EA 3KLHC 3OZ9H 1EEYB 4W4OC 5C70A 3IDNB 1OP3K 5DTFA 4FFVD 4WI8A 3LSOA 2GFBA 4LAQL 3VRLF 3SDXE 2MKWA 5FYKH 1CIUA 4XPGL 1A1NB 4GG8A 4FMKA 3L5WB 5MENA 2VXTL 1EX0A 4AENB 5DD0H 5DR5L 4CJ1A 2ZUSA 5C09B 5KVDH 3UZEA 1EJOH 4GRWH 5F7DA 4YAQB 3B43A 1G7MA 3I3BA 4URTB 2DKMA 5KAQF 3VXOB 4XNZC 5DURD 3D0LA 1JE6A 3S34H 2NX5D 3G5XA 4FXKB 4N9GA 5C0IA 1DVFC 3H42H 4ZTOH 5T1LA 4O2CB 3NABH 2IPTL 2FD6H 3KYOA 5DHYA 4U6HB 5E56A 5C6PB 4I13B 1C12B 4K3EH 2C3XA 1LEKB 2WUCH 4KC3B 2PR4H 1G7PA 5I1IH 2EH8L 5I1KH 4TUOB 4RRPA 2F53A 4NO2A 1GZPB 2VC2L 5F96H 1CE1H 2OMNA 3AXLB 4YPGB 3QEHA 1DBAL 1BGXL 4Q2ZA 4OZFB 4O00A 3AMKA 4LCWD 1MF2L 4MXWL 4X6CE 4M7KH 2AQ1A 3JWNC 1I3RA 3MJGX 2L7UA 4FTVD 3FFCE 3RIFK 5A2IH 5EU7E 3V4VH 3WHE1 5CZVH 2N56A 2DQTH 1FAIH 2JCCB 3K2UL 4LQFL 1WC7B 2NYYC 1IC4L 3RQ3A 4YX2H 5HHXH 1KJ2B 4QXWA 3RIFF 5TE7H 4XP5H 1U36A 1NCNA 5C0EB 3O3DA 1M7IA 4TQEL 1JMXA 1NLDH 3MODH 3M17B 3QHZH 3VW3L 1J18A 1UWGH 3QIWC 4BKLB 1YEJH 3S36X 4HBQA 3GJFB 1B2WH 4D0BA 1VEPA 3RWFA 3O2DL 5I74B 4LDEB 4Z77A 3KPRB 3RU8L 3PABA 5ELIA 4PLKD 1CDCA 3QCVH 4U6TA 1RQ5A 2IBZY 5JUEH 5CJ8A 5B21A 3IJYA 2I60H 5EO9B 2BVUA 4OIIL 5LXGL 1GC1L 1LHZA 1UWXH 4X6BA 1N6VA 2Z31C 3MUGB 3DSFL 1GPOL 1X5IA 2AK4D 4ALAL 2VXVH 1TVDA 3V7AE 3FHQA 3F58L 1T2XA 4EI6B 2DM4A 3QWOB 1JGEB 4HS8H 1R5IB 2J4WL 4KRPB 4PJEA 3UMTA 4JO1H 3ZLQC 4ZOCA 5F7NC 2ZG1A 1GGUA 4M61A 4X6DA 2H3NB 5CGYC 5TFSH 3HNTL 1MPAH 3RZCC 2XACC 3EYSL 4G8FB 4Y4KD 5TE4H 1KB5A 3D5OF 2FIKA 3FCTB 5FYJH 1I8LA 3WIFA 3W0WD 4M7LT 4XT1C 1T22A 2NY0C 3SGKA 4LVHC 3BZEB 2XWJB 3TBWA 4JR9L 4YDIL 2DBLL 2MWCA 3PGDA 4A2LA 4OCLC 1LILA 1KJVA 1HXMA 2CLRB 2N7AA 1HDMA 2J6EL 1I85C 4LEXL 4UB0H 3FO9B 5I8OL 1KLFA 4PGEB 1I1YB 5KSAD 4B5EA 4QRRE 4HS6A 2W59A 3WFCL 1MH5B 3GKZA 5AZ2L 2FYYA 4R96B 1RIVL 1OSPH 5T1DL 1QLRB 5E4EC 4Y2DB 2YC1B 3SO5A 2E7LA 1OM3L 1BOYA 1HHGA 3ULVD 4FZ8H 3MV8E 2IAMC 3L3KA 4PRBA 5IMMB 3L5HA 2MHAB 1QFWH 3SKMB 3VFMA 5DD6A 3QUXC 2R69H 3JWOL 5BW7C 1MIMH 5J56B 1G9EA 1FO0A 3VG9C 1RUPL 5HHOA 4ZO9A 4MAYB 1HKLL 1KT2B 2GSIB 4QNPE 4YC2C 2DLEA 4HDIA 1BJMA 3QG7L 5GSRB 4F15C 1FNSH 1S9YA 1UACL 4D9RD 3TP4A 1JYWA 1T89C 5F8RC 4TVSa 1WT5A 1KTLA 2BJML 3VMPA 3DIFA 4UT9L 1NQBA 3F7VA 1RK1B 5MI0B 5F6IB 4XNUH 1T20B 4G6JL 5TQ2L 3LB6C 4KMLB 1MFEL 4NDMB 3WMSA 4GKSB 2EYRA 4UNVA 4P9HH 4HWBL 4R26L 4QRPD 4QTHA 5GGTA 5GZOC 4EXPX 1H15A 1YQVL 2AGJH 1I8IA 4HZLA 3ZE0F 5GGQL 4NJ9H 3VA2C 1SYSA 1BLNB 3IF1B 1DQML 4ZS6D 3CFIC 4QYOA 1IM9A 2UVEA 2OTUA 3KPSB 4YXKL 4BZ2H 2BK8A 4AH2A 4CL7A 1ITBB 3DETC 4NQUA 4ODBD 2ADFH 2VDQH 4LP5A 4TSAL 3NPSC 1CQYA 1I3VA 1CE6B 3WHE0 5KAQG 4IRJD 1OY3B 2W9DL 1IAOA 1UM4H 4OLXL 1UB5B 5E2WH 2DQJL 1JL8A 5LAXB 2ZZUT 4NPYA 4OZIB 2X4OA 1F3RB 5BRZD 4DGYH 2GY5A 3N1GC 4K3JH 1MHCA 2P44B 4F7CA 5GRUL 5HYJD 1QRNA 1JFQH 1BHGA 5A2KH 4GMSL 1FC2D 2P7TA 43CAB 1G9NL 4OZGB 5L0QB 5GRJH 5JQ6L 3H9SB 1TQBB 5L9DH 3R1GL 4G6AD 2AQ3A 1KPUB 1ZA3A 5EUOA 1RZ8B 5ERWB 2PCPA 1CFTB 1F42A 2FJHB 3QQ9D 3SJVD 2BOCB 2VABA 3NIFF 2F5AH 1BBDL 3GNML 2B4CH 5F1KC 1FL3A 1ZE3C 4XTRD 1VFUA 2BCKA 1RIHL 2GJ6A 1UZ8A 1ZXQA 1IGJA 3D2UB 3HKFA 3C6LA 3ARGA 2G75A 2QADB 1FE8H 4OGYL 2X4RB 4EKXA 5J6GA 4KK9D 4M03A 3F5WB 2ESVD 2GJJA 1CR9H 5EU6A 1I4FA 1T1XA 2CLZB 2ICWJ 3BRDA 2YD8A 3DXAB 2C3VA 4GRWB 4RGNC 5D2NA 1MUJA 5SWZA 2DTML 2YD4A 4U1MA 5JZ7C 1XH3A 2A77H 2GCYA 4L4TA 2VDNH 4JPVL 4OD1L 3GGWA 3QYCA 2EDFA 4LPVA 4F7TA 3BI9X 4OCMC 3GRWL 5I17A 1YEFH 3PGFL 5L88L 1BM3H 2GSGA 2A73B 5CJQL 4HX1B 5I73B 5BS0A 1F00I 4DTGL 4OUOA 3Q2CA 4HCRH 1PKQE 1FFOB 4YGVB 1QSZA 2JIXB 2A6IA 1B0GB 2GK0B 2H9GA 2XQBH 4E42B 4O58H 3EAKA 1PZ5A 3NCEB 4FFZL 5IF0B 2ZSVA 3TT3H 4TVPD 1A0QH 4MWFA 3GIVB 4IDJH 3MV7D 5ITBL 2P5EB 5IVNA 2GTWB 3K7UA 4LSUH 3CFEB 3CZFA 3V0VB 3U9UB 4IRSB 4KRNA 1QSEB 5F7YC 4FFYL 1U8HA 3ULVL 4HT1L 4CJ0A 2QSCH 4PREB 1J1XH 4LVNC 1RJYB 3OTTA 1J8HD 4PJ9D 5E6IA 5TDPA 1XR8A 4PRPD 4OF8A 5CEYB 3GSNL 1BX2A 1BZ7A 4J12A 2HJKA 3L3IA 3RKPA 2E7HA 3VI4F 3ARBB 3QJHB 4PY8J 1MCQA 3IAGC 3CK0H 2C9AA 4Y1AA 1KC5L 1T7ZA 4X80H 3JSSA 5HDBE 2VXQH 3BKJH 4XMLL 2F8OA 2G5BB 4N1HB 4PYHA 4YHPA 3BO8B 5DQJA 1DZBA 4K7FA 4C59B 1MCOH 3AM8A 4KRPC 2BNUA 5FGRA 5TPWH 1UM5L 3QRGH 1HYSD 4GW5B 1BVZA 5K59F 1OTSC 5IV2A 5C0BE 3TJHD 1J0JA 1WSST 4Z7VA 1G7HB 4NQDA 2G9HB 4XGZA 3BIKA 2APXA 4X4ME 5JW3L 1OSZB 3LV3A 3KPPA 1RSFA 5ACZB 5B4MD 5I8KL 5FKPB 1XGUA 3S98A 3STZB 3BXNA 4ONFL 4UILL 5IMOA 2QEJA 1AJ7H 1QVOA 4NJAL 4KQ4L 1HOCB 3MRNA 2Z8RA 2Y72A 4WUUD 2J8UA 4LBEB 4Y2DC 5EN2A 5IBUG 3CFKB 1ZT1B 3CXHJ 2BVTA 1JNNL 2I9LB 1U8PA 5EPMA 2XWTA 1IQWL 2A6KA 3VJ6A 4NWUH 1FAKT 3X3FH 1NBQA 1NFIB 5F7FA 5DZOA 3DX9B 1GVIA 4HIHB 4I3RH 3FQRB 4H5SA 5KVGH 3R8BB 4Z7NF 2NW2B 4P5TB 1ZK9A 4QHUA 1ACZA 2BRRL 2EO9A 1NGYA 1P9MA 4MAYC 5FDWB 2LTQB 2HFFB 1JHTB 1MWAL 3FB8A 4RGOH 4NQXA 2QJDA 1LP9A 5B3JF 4JFXA 5D71L 3RGVB 1Q0YL 3G08B 4ZFGL 3P0YH 3QDMD 1A14H 1CGWA 4IMKC 5EBGA 1OAQH 3V0AC 3R0NA 1Z0NA 2HRLA 5IW1B 5MI0C 3VFTB 2XZQL 3R4DA 2HKFL 5F6IC 4UT6H 4HIEB 1NAKH 3EHBD 3UBXI 1TJGL 3LEXB 5BOPA 2PYEE 4JFFE 5CEXB 2LQRA 1A6VH 4HK0B 3D85B 3MRCB 1FZKA 1MCJA 3I3EA 1L6ZA 4WTWA 3BWAB 3QIUA 4WDIA 2BY0A 4LF3B 1AGEA 3ES6B 2NNAB 4M6ML 4Z9KB 4RNRA 1PLGH 1DQQA 3V9FA 3QDJE 1SHMA 4N0FB 1ITCA 3GMMB 5GRYA 1G0XA 3GKWL 4UIMA 2VIRA 4G8GB 1YEIL 4NUGH 5IVZA 4LOUD 3IXAA 1YN6A 3WKMH 5IEHB 3FN3A 1RUAH 2AK1L 5FO9A 2W9EH 1I1AB 4KJPD 3UPRA 1Q9LA 1JWMB 4KXZH 4JQIL 3C5SB 4TVPL 1OAZL 1OT1A 4JPIA 5J7CC 4XXDB 4YFLF 4YR6B 3IDYC 3T3ME 4PRIA 3MSPA 3OR6A 4OCYL 4U1SB 3O9WB 4XNQB 3MJ9L 4Z95L 5HDQH 4WFEE 5L0QC 1W8NA 1JZ6A 3RI5F 2Q7YB 4QHNB 2ZSWB 3QO0B 2DF3A 3DYMA 2WBWB 5B38A 1TQBC 5HGHA 5TGBA 2EZ0C 4CVUA 4LIQE 1EHNA 3ZTJH 4F7EA 3FOMA 4Z78B 2X4PA 3ZE2E 1A4JB 5E8EA 2O61B 3UTPD 1DBJL 4JQXC 3IVKB 4K9EH 3AS0A 1I7ZB 4YLQT 2ATPA 2AEQL 5DJDB 3DUHA 4HPOL 1DDHB 1RZKL 2R1WB 4HGMA 2BOBA 4RAUB 2APVA 3CLFH 2YXMA 3EYQD 1JRHL 5IG7A 2QKIB 1YJDL 2QADC 1ZEAL 4PGBB 2PTUA 5IBLD 5HHPB 3MRLA 5IB3B 1AC0A 5K9QG 4OZ4A 2CH8A 4MS8D 1BECA 1TZHB 3U46B 2R9HD 4PJBB 3VXPA 1KELH 2P45B 5C3LD 1OGTB 5DK0B 4G7VH 4M48H 2HVKA 4EBQH 1D7FA 2DDQH 1T66C 4JGUA 1UC6A 3QFJA 4YO0A 3WNKA 4OM0L 4YDLB 5DJ6A 4MNQB 5DVKA 2A74A 2O26U 4LLVA 3D0VB 3S4SA 3CFBA 3CD4A 4GQ9L 1QLFA 2FGWH 2GHWB 4N8PA 5I73C 1PY4A 4RGMC 3GMQB 1OD7A 3WIIL 1HHHA 4LPUA 3TEUA 1WBYB 3QUKB 1XCQA 1X4YA 5KVEH 3NGBB 5HBBA 3VFNB 4PGDB 5ICYB 1IEBA 2JTDA 1CU4L 3MPCA 2D03H 4K7PH 2X10A 3TO2B 4JN2A 2OR8A 4K71B 2FCBA 1RMFH 3QWRD 4X99A 1GAFL 2FJFB 3G6DH 5IHZA 4CMHB 5CJXC 3W39B 1P7HL 4IRSC 1MAJA 4UNUA 4WFFE 5AYUL 3PL6D 2X4UA 1ETZA 5DJ0A 1KIRB 3G9VA 1FORL 4YE4L 1AXSB 4GRMB 4P5MB 5DS8B 3KLAA 3GBNL 1S9XA 1FRGH 1FGNL 3FT2A 3SQOH 5EORL 4MX7A 3S3PA 4MA1B 1Q1JL 2VR5A 1NMAL 4LGPB 3ULVF 1Q8MA 5EFIA 1H5BB 5I1LB 5C2BH 4NM8H 2N1KA 3OAUL 4PJ7F 4XHJC 4P2OB 4F57L 1TNNA 3QNYA 2A83B 2JJSA 3ARBC 3O3AB 2NCMA 4L4VD 4RWYL 1X4ZA 35C8L 3TBVA 3WO4C 4D0CA 5JNYB 3NCYP 3B8YA 1HEZA 4XAWL 5CSGA 5IVXA 3U7WH 4FQXA 1T80A 4P2RD 3PNWA 4OLVL 2YWZA 4I9WE 3PWNB 5DJXA 4CN1A 2OR7A 3PHOB 3BT2H 3IFOA 2YRLA 3K4AA 1V8HA 3ILPB 4XNXL 3DX8B 3CC5B 3QXDB 1QBML 3L9RA 1KOAA 2DWEB 5A2FA 4Y4FC 3WS6C 3BPCB 2IBGA 4G6MH 1U3HD 4YIQB 4CW1B 2A38A 1MHEA 4P5KA 3SDYL 2HP4A 1AO7B 1IT9L 3WCYA 2MJWA 1JMZA 4E5XA 1NGQL 2X9XA 1DN0B 4PJXB 4V1DE 2Y25A 4X4YA 5BQ7A 2FL5B 2CIKA 4OLWH 5FKAB 1MCPH 4IIQB 4LLAA 1KFAL 3QXUA 2XN9A 5ADPL 2EDWA 1OW0A 3N0PB 3BQUD 1UWEH 3SBWA 1RU9L 1JZ7A 2PTTA 1M05B 3D69A 1I3GH 4OGAD 3TZVB 3DX6A 2JF1A 5EDXA 3IS1X 4HWNA 1DBML 3THML 4XNYH 5MEPB 3UCRA 1UJTA 4PJ5B 4P5TC 3U0TA 5TF0A 1R5VA 2BNRA 5E5MB 2RCSL 2A0LD 2DMBA 4WCYL 2LTQC 3OGOE 2CK0L 1CD9B 2YRZA 2Q86A 1L9MA 1JPTL 4UU9A 4MA8H 4Y8AA 4OV5A 2Q8BL 2D7TL 3RGVC 1IKFH 3FRPA 4XB7A 5F3HA 1D5XB 3HUJF 1F4YL 3C60D 2J3SA 1JPSL 5L2KD 4YZFF 4P9HC 3JXAA 2R0LL 1ZLSL 2NPLX 4R8WH 4G3YH 2EH7L 1NDMB 1L0QA 1OL0A 2XPGB 3C2AL 3JZ7A 1ND0A 4HLZH 5DLML 4ACPA 2F74B 1S7WB 1D9KC 3HAEA 3ECBA 2WIIA 3WN5A 4H20L 1TJIH 4JPKH 1H0DB 3KPMA 1HIMH 4R3SA 5EWIH 3U0PA 4XH2A 3O2WL 1TVBA 3BDYH 1YY8A 1K4CA 1NCUA 3O3UN 3KPQB 4JM2B 3ZDYE 1UJ3A 4C56D 3GM8A 1IZJA 2FX9L 4OQTA 2ZUVA 3UJIH 3PV6B 3CPLA 1SJEB 3RDTA 4IDLA 4Z7UA 2PO6A 3JV5A 4JFDA 3NFPA 4UIKH 4C4KO 2IBZX 2Q76B 3DVNB 2EYTA 3AY4C 2ATKB 3VFVA 4L8BA 1CDGA 5F7LB 1EXUB 4X6CB 4RCAA 3HG1E 1CLYL 3U0WL 5JHDA 1KPRB 3FFCB 1I1AC 1BQLH 3QEQD 1FZOB 1P7QB 2HFEA 3N85H 3W2DH 4U7KA 3SDDD 3P4NA 3HNVL 1MFDH 1YC8A 1Q9OA 5DTFB 2W0LA 2GFBB 3LSOB 1AD9B 4L3EE 1T0NA 1FFRA 3O9WC 1BFVL 2WLYA 5IBTL 5MENB 1K8IB 4LLWA 4K23H 1DFBL 1PZUB 3TGXA 2DWDA 2OCFD 4OIBA 5F7DB 1FZJA 5F70A 2Z8VC 2OS7A 4UOW1 1YECL 4X4ZA 1UA6L 2WBJB 3TCXA 2A9MH 2X89A 3D3VE 4HUNB 5DI8A 2M2DA 1C5CL 4MNGA 1JF5A 1EO8L 4N9GB 4PG9A 2WQ8A 4RMWA 5C0IB 2EDJA 4JG0L 2KQNA 5T1LB 3MRJB 3KYOB 1PD6A 5HHQA 1YEKL 2UV3A 5DGRA 4LCCB 3P9LA 3VGAB 1G7PB 3BZDA 5MP6L 3RTQB 1X5YA 2F53B 1BP3B 1YMME 4HC1H 3WJLC 1MIEH 2OZ4A 3UTQA 2AV7B 4JVUA 1CD1A 1BVKB 2HN7A 3NZ8A 4Q2ZB 3P77A 2H6PB 3MOAL 4HPYL 1CICD 4JPWH 4OQ1A 1W72L 5JHDE 1I3RB 4JANB 4AMKL 3VXUD 2QQLH 4G9DB 1M71A 3ISWA 1U8OB 4H26B 1KLGA 5JDSB 4OCSL 4N0UE 5D7JD 4OBRA 1EEZA 4YDLC 3V6ZA 3GSQA 1GIGH 3O3DB 2VZ1A 1D5ZB 1XF3B 4LK4A 5FUCE 1A7OH 2LAAA 4X4XB 3U4BH 5D1QA 3P30L 3KXFE 2FX8H 4D0BB 5KSBA 4JHAL 3P4OB 4QRRB 2L7JA 3RWFB 3VWKA 1U93A 4AG4L 3NGBC 4U6VL 3GSWA 1A3QA 4M6OH 3CX5K 5GHWH 4U1LA 1INDH 4MNGE 4XCNA 2XWBA 1A22B 4K71C 3MGOA 3MV8B 4ZFOA 1EO5A 4X6BB 5D7IF 4CMHC 3TFKD 1CLZH 3ESVF 1NCCH 4G9FD 4M9PA 3QR2A 2W0FA 2NZ9C 1OQOA 3CH8A 1MNUH 5FV2A 5E9DD 1F58H 4PJEB 3AU1B 4DCQB 4ZUUA 4M61B 4X6DB 4MA1C 5DQ9A 4YFEA 2PYFA 2VDRH 5IQ9A 3TBYA 2KUTA 3ZYJA 3HZVA 3MCG1 4RX4A 4AEEA 3WIFB 5I30H 1JN6A 2WZPD 4P2OC 3UTOA 1FN4A 3MLPA 2R4RL 2NY1B 4U0QB 1P6FA 3W5NA 2BVYA 3IS0X 3C5JA 4NO0D 4GMTH 4TRPL 5K9OB 1HXMB 1HDMB 1MI5A 1AGCB 1GXEA 2R56H 2P8LA 4PJCF 1CFQA 4ZXBA 2CIIA 2H26A 3FMGL 3V5DA 3TVMB 5KSBE 1WVZA 3O4LD 5E8OA 3FAWA 5EZLA 5F7EH 4KJYA 1I9JH 2FYYB 3I9GH 4XAKD 3I6LE 2IQ9L 4XP6L 3IAPA 2AI0L 3RVTD 1FZMA 4C55A 1F5WA 2XRAL 1HHGB 1ORQA 1MY5A 1WCQA 3KPNA 1LEGA 5H2BB 5KJRH 1QHPA 1WICA 4PJHA 5DJ2A 4X7SH 3HFML 3QNXB 3SDCA 3T2QA 4M1GL 1JWUA 3NCJH 5GSVB 1GGYA 1W0WA 3D6GA 3LIZH 3CUPA 2AKRA 3B6SB 3HB3D 4BZYA 5HHOB 1CFVL 3BISA 3PQYE 2MMXA 4TTDD 1CT8A 1RUQH 2DMKA 1VEOA 4JZNA 1UEYA 4AL8L 1S9YB 4XP4H 1UFUA 1FG9C 1FVCA 4U1GB 3MLTA 5CBEB 2BSSA 4IIQC 3HC3H 2DQGL 3HMWH 2X70A 2XFXB 3LMJL 1KTLB 2IJ0C 1JI2A 4WUKL 3VXRA 2ORBL 3DIFB 4NQCD 3F7VB 4RDQG 5I1JL 1DQLH 4J4PD 5DRZB 5C0CD 1FSKB 3S37H 3TZVC 3QB7C 1MLBA 2XTJC 2UWEF 2KKQA 2R29L 3IU3A 4MQXD 5DEZA 3LD8B 4R2GD 3H3BC 3HNSL 4P4KD 4W68A 5I66A 4TN9A 3H3PL 2ZJSH 4HZLB 4LEOA 1MOEA 5DUBB 1SYSB 2E9WA 3J7HA 5FOBA 1EHAA 1NCAL 4Y19D 2JB5L 1A3RH 1EVTC 2OTUB 3O6FC 4Q9RL 4I4WA 2E6QA 4YK4B 5D1ZD 4LCYB 2YD1A 5DEFA 1L6XA 1T5XA 4XZUA 1OB1A 1T21A 2I24N 3QEGL 5EUKB 5B8CB 5C0RH 1IAOB 1TZGL 3HN3A 3GZKA 1DR9A 1G7QA 4EUPG 2DQEL 4NPYB 3QXTA 2X4OB 3JWDC 3E6HA 2I07A 3MOQA 3VDBA 4EOWL 3NCMA 4PY7B 3VRLE 4F7CB 1K4DB 3MUJA 1Z9MA 3EYOA 1H3TA 2IQAA 3V4UH 5DK2B 2IPKA 3RPIB 4JM2C 1VKXA 4UINH 1HWGB 4Q9BA 1NAML 3LEVL 3TJEH 1R3KA 3BE1L 2R4SH 1IGIH 2EICA 5HGAA 1E6JH 2Z91A 5EIQA 5F44A 5EUOB 5ICXB 3PWJB 1DJSA 2EIZA 3WXWH 1YEDA 5IFHL 3S35X 5J1SC 5C0AE 1WF5A 1VB9A 1NGXB 2YA2A 1Q0XL 3OB0K 1FL3B 3MROA 2BCKB 4LHUA 3PJSA 5EU7C 4NSKB 4KGLA 4K8RD 3ZDZF 4JY4A 1IGJB 1ZLUH 3ZL4H 3C6LB 4POZC 2JJWA 3HRPA 4KKCD 4JG1H 2K7QA 3Q48A 1YYLH 4FP8L 5EU6B 1UYWH 4JFED 1NJ9B 3SE8H 1WGOA 3HZKA 2F54D 4YWGH 5DZLA 4P49A 5IGXH 1CZ8H 5SWZB 2W38A 4WI4A 3MA7B 4TULH 4U1MB 3DV6A 2YPKB 2VAJA 1FL6A 2GCYB 1NEZA 4L4TB 4M9OA 4ORGB 4P23A 1I1FA 5E1AB 3GGWB 3AB0B 4NKDA 1IAKA 2WBJC 1J05A 4F7TB 4NFCA 4K9EC 4BZ1L 4WJ5A 4XPBL 3VXSE 2EC9U 3AAZA 1FVEA 3EFDH 5HYFA 3WFEH 4DW2H 2DYPA 2YA0A 4MAUH 3K81A 5D7LD 1U58B 1S7VA 4U1IA 5DEGB 1E4WL 3CFDA 1IC5H 4JKKA 2VDMH 5IHUL 1FNAA 3CVHA 3QFDA 5EBLB 2Q8AH 5CD3B 5J4MA 4LCCC 3VGAC 1OTTC 4P2QE 4HJGA 3RTQC 2B7DT 2MQ3A 4UT7L 1PZ5B 6CGTA 3F7YB 5C08E 3QDGD 2VLKE 1A7PL 3BN3B 2A1WL 4PRHD 5E2TL 3V0WH 3KVQA 1AI1L 1FBIH 1UXWB 4NRXA 4ELMA 3OF6D 2VLRD 4G43B 3LHPH 5KANI 4DUWA 4WVRA 5ADOH 2H2PD 3C08L 1WTLA 2V7NA 4ZQKB 1XR8B 5EB9A 4MQ7B 4N8CL 1H9VA 2E7MA 2YD2A 3HE6D 4MJ6A 1BZ7B 4P57B 3IRZA 3TIDB 5KG9A 2DN7A 1F3JB 3OKDA 4Y5VA 5M95B 5K93A 3L3IB 1EFQA 1WCBA 5DUMH 2FRGP 2VQTA 1NBVH 3F6IA 4IMLB 4EI5D 2X40A 2CMRL 1U41A 2VLJD 5FYLD 3VXME 4I0PD 3O81A 3PDGA 2OQJB 4AYFA 2ICES 2H1PH 4X5LA 3QI9A 1V3MA 3RJQB 3EJZC 5TDOA 3MRBA 2HTLC 5F72S 3TA3D 5HYIA 4HAFA 2Q7NA 1TVHA 4HSQA 2GKIA 3K2MC 3BPNB 4M5YH 3HI6L 5DQJB 3LRSA 3IU4L 1XEDA 1OOAA 4KAQH 3UAJC 1KCSH 4ERSL 5C2UB 2YUVA 2MKLC 4MJ5B 3QUMH 2EDRA 5CSBA 1OD9A 4LLDA 5JHLH 2LVCA 4U1KA 4KJQD 4PJGF 5IV2B 1U8MA 3TPUA 4PJ8A 3DO3A 3LZFH 4HFUL 4KUZL 3CFJA 4NQDB 3GEWB 3RL2A 3BIKB 4KY1H 3ALPA 2FHCA 4J3OC 2NY1C 5E99H 3P11L 2P24B 4PB0L 1OP5H 1NMBH 3KPPB 4JY6A 1DEDA 2PXYC 3RWEA 1ZT4A 3LRGA 4FZEL 4PGJA 5JORA 3BXNB 1HXYB 4LSTH 2FHBA 3DROB 3JV4A 1NFDE 3TVMC 1MCLA 1QVOB 4Z6AT 1DQDL 5IJVA 1Z5LA 3PWPE 3SGJA 1KCLA 3T1WA 4NM4L 1A7QL 2UYLA 4M1CC 2J8UB 5EN2B 2BNQA 5IROA 1XGYL 3WHXB 4WWKA 3S35L 3Q5OA 5EPMB 1TMCB 2XWTB 4J3UA 2W60A 3HC4L 5I1GL 3VJ6B 4WU7B 2IANA 3CNKA 3LCYA 3WFDH 5DD5L 4OFPA 2NZIA 4V2BA 4GAGH 1NSNH 4CU7A 5DJCA 5I15L 5CZXC 3FT3A 5FUOH 3DTXB 1MQKH 3DMMB 3ZE0E 4HJJH 1MRFH 3GSOB 4QHUB 1MHPL 5CUSL 4O4YH 3SDAD 2Y1VA 2D7QA 3MOBL 5CHNB 4TUKL 3QZWG 1F6AA 4Y8DC 5C0GA 4TNWF 4JFXB 5DO2D 3UYRL 3LS5L 2ZCLL 4Y88A 5HD8D 4K8RL 4KTYA 4R90L 5FV1L 1PSKH 2VDKL 4OD3H 3ARSA 4KKAD 1K2DB 4P2YA 5C0DB 1PG7W 3BKMH 4MCYA 4A6YA 1AGFB 2R0WL 4QY8A 4KVCH 3BP5B 4LHUG 2DI8A 3VMOA 1SY6H 1MCWM 1ZAGA 4BH7B 3BDBA 2QHRL 3T0AA 4EVNA 1FJ1B 3DARA 4F37F 3LD8C 1HSBA 4KMTH 2EEBA 1BVLA 3VXQA 1FZKB 4Q6IA 3HAEH 1AKJA 4YHYB 4WDIB 1I9RH 1ONQA 1AGEB 4KTEL 4DGIH 4KK8D 4RNRB 3B3IB 4YK4C 3T65B 4OQTH 3FO0L 2VIRB 1AGBA 1D5MA 2HH0L 2YPLA 3MLYL 4RWHA 2DQFA 3MRFA 5KN5A 1PEZA 4UAOB 1UQSA 3NIFE 4HWZA 2C5DC 1UT9A 1U8NA 5B8CC 5KSVB 3VG0L 1Q9LB 2VWEE 3QQ4A 1U8IA 2GAZA 1IFHH 2C26A 1CN4A 4WHTA 1N59B 3I75A 5FUZH 1JNLH 2AJVH 4JQVA 4PLJD 3OR6B 5BMFH 4O51A 4LRNH 2EO1A 4OT1H 3MV01 2NW3A 4YNYA 1EMTL 1A4KB 2Y7QB 5INCA 2MPAL 1XF5B 1NKRA 4R9HA 1T0MB 3WNMA 4FQQB 1KCUL 5KSUA 4LCUB 2LU4A 4F7EB 3FOMB 1RHHB 2NY2B 2X4PB 2HT3C 2ADGB 5EIVA 5E94B 4XP1H 5E8EB 4PP2A 1KNOA 3MJ8A 1Y18A 3EDJA 5JQHC 5I18L 1SEQH 3OKMB 1ZMYA 2FJGA 3X14A 2ATPB 3IETA 3O2DA 2AXHA 3GI8L 4WO4D 3C8KA 5FYLL 5F1IA 5I6XB 1S7TA 2BOBB 3SE4A 1ERNA 1ULVA 2CKNA 4YHLL 4D9QE 2HFGH 3MRLB 1B9ZA 2BSRA 4NOFA 1D6EA 5C07E 1KGCD 5ACLA 2KZWA 1FGVH 3VXPB 1FYTA 3C5ZD 4U05A 8CGTA 4JZJA 3L1OL 3RWDA 2DQDL 4GBXA 3RWJA 2HVKB 4Y5YA 2OXGA 3UTTA 3AB0C 1KENL 3NCCB 2YD5A 5JPMA 3IRPX 3UXFA 1KN4H 3ZHLA 2EIBA 1QA9B 4KHXH 4CVZA 5DJ6B 3LKNB 2A74B 2SEBA 2X9YA 2WNGA 4ODSH 4U33A 3S4SB 5I1HL 1CXHA 3CX2A 7FABL 5E24E 1HHHB 1R3IH 1XCQB 3ARDB 3KPSD 4IS6A 4RIRA 4X9HA 4KXZI 2P5WE 3VI4E 4B41A 1IBGL 4NZUL 1J8KA 3DRTA 5F21B 2LFGA 2MQCA 1E27A 1XCTA 3SY0B 3K3QA 4PGCB 4DVRH 2JB6A 2J6EA 3UTSA 4OGZA 4JN2B 2EDYA 3O4OC 4YDKH 4ENED 1UG9A 4X99B 1BD2E 4TNVF 5IHZB 1QEWB 4QOKE 3C8DA 2LABA 1NGZA 4WW2F 4Z8FL 3O8XD 1DVFA 2X1PA 2X4UB 1ETZB 5EC1A 1AFVH 3V5HA 1FPTH 4KZDL 2AP2A 12E8L 5EOCJ 4V1DB 1WK0A 4I1NB 3ZYZA 3GBML 2VOTA 1YPZA 1O0VA 2P42B 3TWCL 5K59E 1IGFL 2BVOA 1NGWB 3IAQA 3IKKA 5T1KA 1RURH 3PP3K 4ZAKB 3MLSH 4AIOA 3CXHK 4BQCA 5K9KA 5IB4A 1BFOA 4JJHA 4OSUL 1P84J 1P4BH 4FHBD 2HTKD 4D0CB 4TPRL 3M8OL 4JM4L 4HMCA 4YHKL 1HEZB 2ZCHH 1RFDH 3PDOA 1YEGL 2OI9B 4TOYL 1GOFA 3BPNC 4FQXB 3OHXA 3QUMB 1QPPA 3BP4B 3QIWA 3PNWB 4JN1L 5BCAA 1ADQH 3IFOB 2OLDA 5D7SL 4JFYA 1TZIA 1OTUD 2XOTA 5DQDL 2IMMA 1CBVL 3H2WA 1GOGA 5HGDA 3JTTA 1LO0L 5LQBH 3K46A 4HWUA 4P5KB 4XCEB 2Z31A 4R4FH 3T4AB 4Z7NE 4PRDB 3EDDA 5D1XD 2NX5A 1MFCH 4E5XB 1PG7X 3LEYH 5ANMA 4KI5C 1A9BA 3QUZB 2YKLH 5FK9B 3QIBB 1G6RA 4YGAB 5BQ7B 2VITA 3M07A 1S7UA 2CPCA 5B3JE 2MTPA 4UUJB 1ZHKA 3VFSA 3P0VH 3QNZA 4DN3L 2K1MA 1J7VR 4I0CC 3RWCA 2XN9B 3QHTC 4ISVB 3RZCA 1U8JB 5DFVC 4JLRA 4NKOB 1U8KA 1A47A 2JJTC 1SYVB 4DN4H 4LARL 1JWSA 1X5FA 3BSZL 3S5LB 4W70A 1Q72L 2NY4D 2PTTB 3D69B 2Z35B 4AEIH 1RV6X 1XF2B 5HVGB 3DX6B 5DD1H 5JTWA 5H35B 5HHVH 1OP3H 3INUL 4S2SA 1GGCL 1VEMA 2J8OA 1YNKL 1LK2A 2XNAA 3I50L 1I85A 3DMMC 5GS0H 1QFWM 2L4OA 3U0TB 4LNRA 2P8MA 4EN3B 3R06B 3KWWB 2A9NL 5I1EH 3ILQC 2V2WA 1A6UH 2JELH 3VFUB 1A5FH 2OTWB 4AT6B 2VTFA 2DJSA 4M7LH 2BC4A 5SWSA 1AQKH 2EDOA 2Q86B 4JB9H 4AQOA 2Y36L 5ABDE 1QQDB 4XBEH 4OV5B 1A7NL 1P4LB 4P59H 3PGCB 4QGTA 3LH2L 3S96B 4P3DA 2VQUA 4L3EB 2UY7A 2IAMA 4HBCH 1T83C 4D2NA 4RFOH 5BZWA 3U83A 5M94B 5H37H 2NX5E 3FOLB 1LO3L 3S7GA 4XPFH 5BW7A 4JDZB 2B1AH 4XPTH 2AK4A 1ND0B 3QPXL 2I25N 2NR6D 3HAEB 3ECBB 3WN5B 4HUUB 1EFXA 3KHOA 2ENYA 2XXMB 1OCWH 2CDEB 1LO2H 3DV4A 1YY8B 3NPZB 1K4CB 2H32H 4YHYC 1QSFA 1T89A 1AE6L 4WENB 4O9HH 4LCWE 4LVEA 4RSVA 5T5FL 5FYJD 3BKYH 4FTVE 5GXBB 2ZCKL 2WANA 3K8MA 3RDTB 3MRDB 4Z7UB 4PJIF 4JFDB 3W0WA 2G2RB 1YMMB 3NFPB 3VMNA 3HLAA 3EO9H 5A1AA 1MJUH 3CDYA 4QXUH 1R3LA 4UAOC 5L8LB 4M4PA 3VFVB 3ARXA 1N0XL 1LGVA 2ADJA 1MJ7H 1J0HA 2Z93A 5DJYA 4KZEH 5JHDB 3L6FA 3GI9L 2QSQA 5CWSA 2OK0L 4POUB 3ARRA 2WP3T 2ADIA 1RJLA 3ZT7A 4J6RH 1CFSB 1U92B 3TN0D 4QT5A 2XKSA 1HN1A 4JRYA 2QLVB 4OCRL 4KTDL 5I8EB 3CSBA 1K9TA 4OFIA 1KB9J 3QBTB 5ESAB 4XVUD 1NL0L 5KZCD 3MMEA 3KYKH 3QG6A 4KHTH 4F33A 2B5IB 5AUMA 4ODUA 3OPZL 3BP6A 3E8UL 5DHXB 3I3DA 1LE9A 4ZPVB 1U8LA 3FO1B 4HKXA 5JXEC 1HNFA 2AK4E 3LQZB 1XAUA 2NY2C 1WEJH 3NOIA 2DQHH 3DUUB 4DKDC 5DI8B 5MEOA 5F3BB 4XWGL 4MNGB 4NQVA 3NH7L 4QXGL 4M7JH 4JRXD 5DRXB 4OZHA 3UYOD 1INQB 5A2LH 5CP3A 3D39A 3VD3A 5D5MF 4HUKB 4LSRH 1WUNT 1NC4D 4FQ1H 3P9LB 3DVFA 1I7RA 5EU5A 3MA9H 4L5FH 3W0WE 3CVHH 3F7QA 1P1ZA 4R4NC 1JZ3A 1B90A 2HN7B 3MV9A 3NZ8B 5HDLA 5D70H 1PG7L 1YN7A 3DSNA 3HHRB 4DAGL 4LASL 4F3FA 1EGJA 4WV1B 2IADB 4MB5A 4QRPA 4F9PC 3QUYD 32C2B 3W82A 4BK4A 2C1OA 4YJZL 3RBSA 1KLGB 1L4IA 3W81A 1EEZB 3V6ZB 2I9TA 3MBXL 2PUQT 3MYJA 3WS3A 1EEYA 1C8PA 1YDPA 3IDNA 1YEEH 4JDVA 5E03A 3WFZA 3NABL 4JO2H 3ULVE 5D1QB 4LMQE 4MQTB 5KSBB 4LKCB 3L3JB 1A1NA 3L5WA 4PJ7E 1PEWA 1U93B 3ARDC 4AENA 1UGNA 2WUCL 2R39A 3I2CH 5C09A 3MNZA 1XR9B 3B2VL 4OCWH 1I9IH 4YAQA 1KN2H 4BFGA 1P2CA 4O02L 5F96L 4OLUH 4XCNB 2QQNL 4NWTH 1VGEL 1ZLWK 1EPFA 3DJ9A 2GY7B 3MGOB 1X5GA 4FG6D 4J3VA 3A6CL 3H0TA 3T2OA 4FXKA 4NNPH 2W0FB 4D9RE 5CZVL 2Y6SD 4OD2A 4XVTH 3MNVB 1MJ8H 2XG4A 4P46C 5BV7L 4RMSA 4WGVB 5HHXL 3WIHA 1C12A 2NXZD 4FXLA 3PQYB 5F88A 1LEKA 1YUHA 3MFFB 4ZUUB 4TUOA 1NGPL 4MXQD 2CR3A 1QNZH 3QHZL 3A6BL 5DQ9B 2V17H 3Q6GH 1MRDH 3TBYB 7CGTA 3QRFM 4OZFA 1B2WL 4QRPE 1JN6B 5B3NA 1XT5A 2WMPA 4JKMA 1RHFA 1MCCA 1FN4B 4ZAKC 3SJVA 4PV8A 3T04D 4BYHA 3EYUL 3ELAT 2JCCA 3QCVL 1VFMA 1MFBH 2K7PA 3C5JB 4HGWB 3HTLX 2I60L 3UBXG 1KJ2A 1MI5B 2UZIH 3BPOB 4EJ1C 2OP4H 3RWIA 1CFQB 5C0EA 2CIIB 4LU5L 3V5DB 2H41A 1MVUB 2VXVL 2OI9C 2XQYG 2XT1B 5E8OB 2E7BA 4FQXC 5F7HA 4KKLD 4KJYB 2NY6C 4CMMB 2OJZH 1PKOA 3O6ML 3HE7C 3C6SB 1FZMB 1MEXH 5BJTB 3KPRA 3AUVA 2F15A 1MPAL 5DJ2B 2V9QA 3VD5A 5BRZE 4ZS7H 1ORSA 4XVSL 5FYJL 3V52H 1OPGH 3CUPB 5HYJE 4IOFC 2BHZA 2EDDA 4W6WB 3BEVB 4FQLH 3AS3A 3HZMA 3QUZC 5DC0A 3QIBC 3D3VD 1G0YR 1CT8B 2V5TA 3I6GB 4JZNB 1ZANH 1FVCB 4I2XA 3KPTA 1HK6A 4XBPB 2UUDK 2FATL 1F6LL 5FCSH 1B4JH 2DL9A 3B83A 3HUJE 3VXRB 4AM0A 1OW0C 3SBWC 4MDIA 4YZFE 3FCTA 3X11B 4NQED 3RKDC 2CKBL 3V6OE 3BH8B 3BZEA 2XWJA 3WLWC 4J8RB 4A6YH 5D72H 2MQ0A 5FCUH 3IU3B 2Q20A 3ZTNH 5IFAL 3RVVC 1OGAD 4Z5RB 1QFWL 2IF7A 2ESVE 5HDBF 4UDUA 4MHHI 5C0AB 4JKPH 4LEOB 4UBDD 3U7AA 3TO4C 5HI3D 1MCIA 4OF3A 4PJ9A 4EN3C 2VXTH 5FHAH 2NQCA 3V2AR 4XWOC 4I4WB 1X5JA 3ALWA 4R96A 1QLRA 4EIGB 3AMLA 2FHFA 4PGZA 1TPXB 5DEFB 5E00A 4HK3N 4LFHD 3KXFD 2BXYA 4E0RA 1MCKA 5IMMA 1MREL 2X2YA 3SKNB 2IPTH 1G7QB 1BQSA 4LGRB 5ID1B 4E9LA 2YD3A 2DM2A 2I07B 1S7XA 5C0ND 4MAYA 4JFQB 2EH8H 2GSIA 2H32B 3WN5C 3NIGF 2VC2H 5GSRA 3I6KB 3EW3B 5E4IA 3I02A 43C9B 3PWUA 1DBAH 4KK5D 4RA0C 1FIEA 4NJ9L 2FEEL 1VKXB 1DBBL 1MF2H 4TVPE 1HHKA 4K55A 4KK6C 1R3KB 3GMNB 1LD9B 2R2EB 5ESQB 3MV7E 4PG2C 5HGAB 4IMKA 2Z91B 4P2QB 1RK1A 3STLA 1BWMA 5EO1A 2XZCL 1YEDB 2BVPB 2EE6A 5C08B 4JAMB 2AJ3A 2CO7B 2AJSL 4ZODA 5TF1L 1Q94B 1RIUL 1J8HE 1O7SA 4TQEH 4OFVA 3P4LA 4WEMB 3MROB 3VW3H 1UM4L 3F8UB 5JO5A 3PJSB 2HWZH 4PRPE 4RAVA 3UC0L 1RPQA 3OSKA 4J2XA 4N5ED 3O2DH 3EKCA 4F80A 4GLRH 5DMJB 3RU8H 2YSSA 3U36B 3HZKB 2VUOA 3MRMA 4X5XB 4WUUA 3E2HB 2FWOA 3B9KB 3DECA 5FUCC 4YHZL 1JVKA 5HVWA 1A8JH 4OIIH 2QV2A 5LXGH 5IW3A 1GC1H 1QFUL 1FNGA 3UJJL 5JMRA 5SWQA 1VPOH 2B5IC 3DSFH 1GPOH 1NEZB 4XI5C 1FP5A 4NCDA 4ALAH 4P99A 1I1FB 1JHKL 1IAKB 1UB5A 3F58H 5JPNB 4OZIF 1J05B 1G9ML 4WJ5B 4X5WA 4HK3J 3V8OA 3AAZB 2J4WH 2QBWA 3LKPA 4HXAL 1NBYB 3MLWL 4PJ5D 2DYPB 2F5AL 4U1IB 5JIKA 4JY5L 4X6EB 2B4CL 4OZGF 2RAMA 2UVFA 4XNMA 5D8JL 3EYSH 3CVHB 5CS7A 43CAA 4OZFG 1AHWB 5HTSA 1FE8L 1EH9A 1CR9L 3IYLW 4BQ6A 3MC0A 2X4SB 4JR9H 4YDIH 2DBLH 2D7OA 1KIQB 2AJXL 1RZ8A 1OVZA 3C9NA 1ZHLA 2FJHA 3HMXA 1X6NA 4JQXA 2J6EH 5D7IE 4NRXB 5I8OH 4ELMB 2A77L 2E27L 3SOBH 5BZDA 4JHZA 4WV1C 1H3PL 1HE7A 3DI3B 3VWJC 3WFCH 3N1PC 2NY5L 3N9GL 4M3JA 5AZ2H 3AVEA 4WI3A 1RIVH 2O5ZH 4FQPA 1LNUB 5LBSH 3D2UA 3ARWA 1IEHA 1X7QB 3MRIA 3NAAH 4FFWC 1YEFL 1OM3H 1ZGLA 4LLMA 4CRPA 2CLZA 4MJ6B 3TC9A 2J88H 5KG9B 3LPWA 3DXAA 3OKDB 4Y5VB 5D1QC 1UXSA 2C4FT 4LNVA 3JWOH 4HCRL 2FR4A 3PWPB 1NCBL 4X7CC 3MUHL 1RUPH 4UNTA 2QR0B 5E8NA 1JF1B 1NFKA 1HKLH 3WSQL 4HQQL 1CXIA 3QG7H 2E6PA 2EXWC 1R3JA 2GW5A 2X4TB 2UWEA 2HT4C 4E41D 3FONA 4PJCE 1P7QD 1UACH 2CRMA 4RMVA 4DKEL 1XF4B 3OR7B 3T0ED 2A73A 2EXYD 3LRSB 2BJMH 4HX1A 4WHYG 3QDME 1J1XL 3Q1SL 1N6UA 1FFOA 4G6FB 2JIXA 1V3LA 5DHVA 1KBGL 4G6JH 4LLDB 5TQ2H 1F45A 2WIMA 3DHJA 5GJSH 3TPUB 4PJ8B 4HWBH 5IF0A 2X5PA 1IARB 1IE5A 1JK8A 2VZSA 1YQVH 3CFJB 2P5EA 5ALCL 4L8SA 5CJXA 2GTWA 3CFEA 4FN0A 3V0VA 4IRSA 1DQMH 1I7UB 2AXGA 2AXJA 2E8YA 4PREA 5T1LD 2VXQL 4YXKH 5JORB 1BPVA 1G6RH 2FLRT 4L29B 3FFDA 4PRNA 5IJVB 5CEYA 3RVUC 3QEUB 4ZUTA 4ESKA 2F53D 5IB2A 3O2VL 1MCOL 4OLXH 2HLFD 2DQJH 4BH8B 4MJ4A 5F1SA 1TETL 4ZOEA 2FX7L 2D2OA 2W60B 3ARBA 2HJFB 4D8PB 1BBJB 4MSWB 2IANB 4U6XB 4BK5A 4Y5XC 5M7QA 2OJEA 3B4NA 4JJ5B 1VSCA 3TIEB 5F1NA 5GGRB 1QBAA 2D9CA 2FEDC 4GRLC 4MNHB 3REVA 2RHEA 1WBXB 5C0GB 3LS4L 1KJ3L 2DI7A 4YH6A 4GW5A 3MLXH 3NTCH 4GT7A 3UTPE 4XPAL 1LO5A 2APTA 2YD6A 1Y0LA 1BBDH 3GNMH 4Y4FA 3MUZ1 4MCYB 3WS6A 4A6YB 4CKVX 1VESA 4QY8B 4GKZB 5T5NG 1UKSA 5KTEH 1EHLH 2G9HA 4GS7B 1EAPA 3BX7C 4EVNB 5L8KB 3BRFA 2CDGA 3W9EB 2CQVA 2VLKD 4NWUL 4OGYH 1HSBB 2R1XA 4NQSB 5ACZA 3W5MA 5GJTL 1BVLB 3UJTL 4Q6IB 3STZA 1AKJB 2Y23A 4JCLA 1B0WA 1ONQB 3WDHA 1DQTA 1N26A 3DO7B 3EIFA 2VAAA 1OHQA 1SBSL 4JPVH 5T3ZD 3C09B 4LBEA 1HH9B 4RGOL 1E28B 4UTAL 1ZT1A 3O0RL 4YBLB 4OLYH 2I9LA 1AGBB 1D5MB 1ZSDB 2Z8WC 3GRWH 4KV5F 5KN5B 2ARJQ 1BEYH 3O3BA 4TTGA 4KJWC 4YHNA 1NFIA 2YMXL 3DX9A 3PGFH 5L88H 1OAQL 4HXBL 3FQRA 5CJQH 4OCXL 1U8IB 3KGRA 3ZDZE 2NW2A 2XICA 1FNEB 1S78D 3I75B 2HT2D 3PWLB 5FDWA 4GG6A 3SCMC 2HFFA 1JHTA 4APQB 3CSPA 2I5YH 2X44D 2R23A 3JVGC 4FFZH 1CTNA 2NW3B 5EO0B 4YNYB 1ZGLP 3RGVA 2X9WA 5INCB 1F4HA 5ITBH 1RZ7L 5DJ8B 2KH2B 4FFYH 3V4PL 3ULUD 3ULVH 5IW1A 1QYGH 4HT1H 3GM0A 4PP2B 3MJ8B 1Y18B 2WM0A 1UB6B 4QHKJ 5F9OH 3LEXA 1D9KA 3MBEC 1BD2B 3X14B 3HS0A 4KVNL 4RFNB 5HHOD 1J1OL 4BFBD 4HK0A 3D85A 3GSNH 3MRCA 4QOKB 5F1IB 1S7TB 1CQKA 5EOCL 5GGSA 1CGVA 3SKJL 3BWAA 4LF3A 5CP3H 3GMPA 3VE0A 3ES6A 2NNAA 5DFTA 2BSRB 4R4BB 3BQUA 1D6EB 3H3KA 3CIQA 1TLKA 2YEZB 1Z9OA 4N0FA 1XIWB 3E2HC 4M8VA 4WI6A 4L4VE 3B9KC 1KC5H 3ARYA 1LE5B 1JF6A 3GMMA 4JZJB 4Y4HB 3RWDB 2VZUA 1VHPA 3WNOA 2YUWA 3AY4A 3O3EB 5FF6B 5HXMA 3TT1L 2HFTA 2CXGA 4KKBC 5IEHA 4N5UA 1CK0H 5LG1A 1P6AB 2X6MA 4P2RE 1EGJH 4OF7A 4KROB 1UM5H 5L6YH 15C8H 1B6DA 4XXDA 4YR6A 3QO1B 5E5UB 1IM9D 3RNKA 3FB7B 4U1SA 3O9WA 4Y16B 2X09A 1AHWC 4IS6B 4M62L 4RIRB 4UV7H 4ZSOE 2Q7YA 4QHNA 4IOSD 2ZSWA 2NTFA 2MCPL 1E27B 3QO0A 1XCTB 5JW3H 4Z78A 3SGDI 1A4JA 5FGBC 2O61A 1KELL 5I8KH 3AREB 4BA8A 3Q3GA 1ZHBA 3IVKA 4ONFH 1NGZB 1K5NB 4G7VL 4UILH 1I7ZA 4EBQL 5EC1B 2DDQL 5DJDA 3V5HB 4NJAH 3RPKA 1YNLL 4LSVL 1QRND 4GH7B 1T7WA 3UDWC 1JNNH 1EO7A 2CJUH 2YZ1A 3KLDA 3WJLA 4PJGE 2I27N 3BGFB 2YUXA 2FB4H 1B3JA 1TZHA 2BVOB 4Y5VC 4PJBA 2Y06H 4JZOA 3WNLA 5T1KB 5DK0A 5KVEL 2NY3B 3ZKND 1BFOB 2BRRH 1KEML 5SX4H 1RZJC 3UROR 4L4JA 4O5LL 2GJ6D 3WEXB 3BWUC 2E9JA 4PD4J 1D3CA 1Q0YH 4NFBA 2GUOB 3C6LD 3ARGD 2DQCH 4YDVB 5EU6D 2V5YA 1R0AL 3WFHA 5L2KE 4EDXB 1CI5A 1FRGL 1CGTA 2XZQH 1NC2D 2X4QA 2HKFH 3NMEA 4JFYB 1TZIB 4PGDA 5SWZD 3BIBX 1PJ9A 4NN7C 5T3XD 4OGXH 1ZS8A 4HWEL 3Q0HA 1TJGH 1I7TB 4PJ8C 5HGDB 3AS1A 3RVXC 1DEEB 4L4TD 2XY2A 3D9AL 2DQIL 1XGTB 2FJFA 5DURB 2Z31B 5T3ZL 1R5WA 3W39A 2ARJB 2NX5B 2ICWA 3E1F1 5ANMB 2N7BA 1KB5L 4X83A 5J0BA 3QXAA 1KIRA 4C56E 4M6MH 1OT2A 1ZVYA 1S7UB 4P5MA 5DS8A 4NO5B 3MXVL 3VFSB 3QNZB 2Z4QA 5BS0D 3E6FB 3RWCB 5DMIL 3GKWH 2IPUG 1YEIH 5TE6H 3SGJC 5I1LA 4JLRB 1AD0A 2X4NA 3FQUA 4LCWB 2AK1H 4NIKB 4P2OA 4MB3A 4FTVB 3BT2L 3QEQE 4LPXA 4C58B 2G60L 2A83A 4LVHB 4K94L 3VXUA 3ZDXF 2DMCA 3BEWB 4JQIH 1OAZH 2Q6WA 4FQIL 1L7IH 1QO3B 3RGHA 2XNAB 4OV6F 4G6ML 1GH7A 3ULUL 4LNRB 4Z95H 3MJ9H 1UEMA 2V2WB 4J3TA 3I85A 2H8PB 1OAYL 2VWEC 5E6ID 4EUPH 1FO0L 3ARFC 1WISA 3G6JF 3PHOA 3ILPA 1KV3A 4P3DB 3CC5A 4Z0BH 1DBJH 1KJMB 3B5TA 1TJHL 2NLJA 3T8XB 1NLBH 1UWEL 3BPCA 3FN0L 5I9QB 1J5OH 4YIQA 4OLEA 4Y1AD 5SX5K 4CW1A 1AO7A 4HPOH 4GS7C 5FFLA 4KKNA 2AK4B 3L5JA 1DN0A 1JRHH 4PJXA 1YJDH 3U4EB 1ZEAH 1EFXB 4NP4H 2FL5A 1CLCA 4TSCL 4QLRA 3ORJA 4XNYL 3L3DB 3DV4B 4Q6IC 5D2LA 4L3AA 5GGTL 1RZJL 4MYWB 4RMUA 1H3VA 4ZOBA 3HCVB 4Y4KB 5KS9F 3VXUE 1ACYL 3C09C 5TQ0L 3W0WB 4YBLC 1IGML 1WITA 3MXWH 1IKFL 1R3LB 2FH8A 4OM0H 3TZVA 3DVGA 4GUPB 3D48R 5BOZG 4NUJA 4HKZA 5DJYB 2ADJB 3ZKMD 2Z93B 1VFBA 3GHBL 3QA3A 4UTBL 5MEPA 1RI8A 4GQ9H 3KS0H 4NBZB 4R8WL 1CG9B 2DLTA 3NCBB 5CWSB 3WIIH 3BW9A 5KSAB 2C1PA 4XMPL 4QRQB 5DMGD 2H2SC 3O6FA 1KG0B 5GRZA 4APQC 3MRKB 4JPKL 4JRYB 1HIML 3M1BA 4WY7L 3BDYL 3MLRH 3QPQD 4I5BB 3SDXA 3KR3L 1EK3A 3QG6B 4F33B 5AUMB 5GRXG 3BP6B 1U95B 1H8NA 3OL2A 1LE9B 2IH3B 4PJ7B 2YR3A 4HKXB 3UJIL 1ZOXA 4G9FE 1G7IA 4FABL 5AYUH 4B7LA 4D94A 1FORH 3N1QC 3HI5L 1U3ZA 5E9DE 1IILE 1NDMA 2XPGA 3GSNB 3GBNH 2F74A 3HR6A 1P69B 4RFNC 3ZKXB 1Q1JH 4HEPG 4QWWD 1H0DA 1NMAH 5I16A 2AW2A 3A6OA 1LVEA 3LKRA 3OAUH 3KPQA 1NUFA 4JM2A 3N85L 4F57H 3KYMB 1I7RB 1YY9C 2D9QB 5EU5B 1MFDL 3BZFA 2G5RA 1PGRB 1MHHA 1GC1C 1P1ZB 1SJEA 4RWYH 1XIWC 35C8H 1YN7B 5EZJA 4K23L 3DGGA 3LPGA 4Y4HC 5CD5D 2FO4B 3RP1A 2Q76A 2V2TB 2HRPL 4F3FB 4RQQB 4Q7DA 4YBQC 4QRPB 1EXUA 4X6CA 1JZ4A 3HMXH 5T3XL 1I1CA 3FFCA 4P4KA 3O4LE 2A9ML 1FZOA 1F3DH 3AROA 1P84K 4OLVH 4XAKE 2I9TB 4YQXL 3VFRB 4KROC 1VERA 3MYJB 2EDBA 3WS3B 1YDPB 4JDVB 4NHUA 1CIDA 2XG5A 4XNXH 1P7KB 2R1YA 3QIUD 3S37X 1AD9A 5SV4A 3MJ6A 4MVBD 4RGNB 4J3WA 4Y16C 3BJ91 2YN3A 1K8IA 3MNZB 4KDWA 2CUIA 3VI3E 1IT9H 1N8ZA 1SMAA 1U9KA 1P2CB 4YHOL 1NGQH 1SJXA 2P1YA 1V7NL 2WBJA 3SN6N 2OTPA 2ZUWA 3QQ3B 3AREC 3H0TB 3CJJA 5EOTA 1PYWA 5BRZB 1GYAA 5JR1L 4OD2B 1KFAH 3MRJA 1TENA 5ADPH 3MRRA 2EDQA 2B0SL 2ZOKB 4PRID 5HI4C 4NQCE 5F88B 4LCCA 1YUHB 4LFHG 2IGFH 1GIGL 3RTQA 3UO1H 1MCNA 1RU9H 1MJJA 2F19H 5HHMD 3BGFC 2AV7A 5C0CE 3JWOC 5C71A 2N4IA 2HKHL 3B2UD 1RUML 1BVKA 1KCRL 1TNMA 5DHVH 5J6HA 2H6PA 3THMH 4QO1A 2VL4A 5ISZD 3HUJB 3ARUA 3SJVB 4JANA 1MWAB 4PV8B 2NY3C 4G9DA 1F4XL 1AQDB 5GHWL 1INDL 2RCSH 2OXHA 5EG6C 4D9LH 4Y19E 1U8OA 3DLQR 4H26A 2CK0H 5HGBB 5JDSA 4NN6B 4LLQA 1JPTH 1PAMA 4LVNB 3RWIB 1CLZL 1D5ZA 1XF3A 2Q8BH 4XCYA 2D7TH 2ESVB 4KRMB 4FFVC 1TQCB 4X4XA 3BP7A 5D7KD 5HYSB 3SE9H 1CL7I 1F58L 2F54A 1VACA 4MA7L 3P4OA 4QRRA 1JPSH 4Z7WE 2HMID 2R0LH 1ZLSH 4S1SL 3VRJB 4PJIA 1FNHA 3C2AH 5DLMH 3OX8A 3ZKQD 1YNTA 3OGCA 5CFHA 1ORSB 3MV8A 2BHUA 1SM3H 3QCTL 3QFJD 3O2WH 3V6BR 3R0MA 1N6QL 3LY6A 3HZMB 3VH8G 2E6JA 4PJEF 1DUYA 2BVEA 4CVWA 4M6AA 4S1RL 4X6DF 3ABZA 3AU1A 4I2XB 4DCQA 3MGAA 4BUGA 3TYGL 3OXSA 3V5KB 1P5VA 3OB0H 4AM0B 4U2YA 3I9GL 4MDIB 2DM3A 5ITFB 3EOTL 4GXVL 3OF6A 2C4FU 3HNVH 1G9NC 2RR3A 4ODHH 4GAJL 5K9OA 4UDUB 2PXYA 1AGCA 4I3GA 4JFEE 4PJFF 5TDNA 3LIZL 3T0WA 4EUPB 1BFVH 1J8HB 5IBTH 4PJ9B 2F54E 1IQDA 1A6WL 2WWKT 4HUXA 2B2XL 1DFBH 4A2MA 3TVMA 4YHIB 4PRPB 3HE6A 4M7ZC 2VLME 5IIEB 3LDBC 3B9DA 4ZO6A 4PJIE 1YECH 3GB7A 3NFSL 1UA6H 3ULUF 5E00B 5H2BA 1AXTH 2M8XA 4PLKC 1KB9K 1C5CH 3M45A 4E0RB 5JOPD 1EO8H 3QNXA 4UMGA 3PDDA 3MCKA 1QD0A 4JG0H 5D7LE 5GSVA 5I9QC 1FFPA 4WW1A 5EIIA 3B6SA 3W11D 4PBWD 1YEKH 1S7XB 3S37L 5MP6H 2HG5A 3I02B 5IMKA 3QCUL 3PWUB 4I3SH 5CMAB 5CBEA 2ZJSL 3MOAH 3QDGE 3BN9D 2DM7A 1NFDF 1F13A 1HHKB 1W72H 2XFXA 1JIBA 4PRHE 4C4KT 4BUHA 3T0VA 4Y4KC 5IESL 2EECA 3STLB 3HRZA 2VLRE 1A64A 3PUCA 4UQ2A 5DRZA 5EO1B 1Z0MA 4ZD3L 1HSAB 2AEPL 2AJ3B 5D4QA 4CBPA 4OIAA 3UPCA 4WWID 3OKNA 5D7IB 5KW9L 5JO5B 1RZFH 3OKLA 1LK3L 4RAVB 3GMRB 5D5ME 5H94A 3Q6FA 3ARVA 4JHAH 5DUBA 2OR9H 5KSAC 1MRCH 1SVZA 3ZTJG 4AG4H 4X6FA 2X1OA 2YSSB 4U6VH 3WUWA 2XN9D 1KCVL 3MRMB 1FIGL 4WUUB 3DVIA 4LCYA 5ETUA 2FWOB 5FYLE 2VLJE 1ZKAA 3V4UL 1A02N 1MAML 1KSRA 1FNGB 3ULVC 5SWQB 5EUKA 5B8CA 1IGIL 2EDLA 4ZNEE 1E6JL 5ESVA 1IC7L 3IDXL 3KAAA 1Q9KA 4FQCH 4X5WB 5I8CA 2KZ1B 3LKPB 4H8WL 3BH9A 2ICEB 4JO4L 3SPVA 1P4IL 3S36L 1JZ2A 4RRPG 5IEKA 3TLRA 2BNRD