5K59E

Crystal structure of lukgh from staphylococcus aureus in complex with a neutralising antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
210
Chain Sequence
ELQLQESGPGLVKPSETLSLTCTVSGGSISSGSYYWDWIRQPPGKGLEWIGNIYKSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARERGMHYMDVWGKGTTVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Uncharacterized leukocidin-like protein 2
publication title Context matters: The importance of dimerization-induced conformation of the LukGH leukocidin of Staphylococcus aureus for the generation of neutralizing antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus (strain usa300)
total genus 39
structure length 210
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k59E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k59E01
4XVJL 1A1NA 3HAEH 4S1QL 1QSEA 4Y5XB 4GAYB 4LLDA 4PJCA 1QFWH 5M95B 5CFHA 1ZA6B 3S9DB 3TNNA 1I8MA 1A7RL 5D7KE 3F65A 8FABA 1MHCA 3MGTB 4KRMB 5FKAA 3H9HB 5C09E 3C8KB 3EIFA 4RSVA 5FGBA 3BPOB 4H25B 4EJ1C 4PJFA 4P23A 2F19H 1BVKB 5TQ2H 4FQXA 2DQCL 3C2AL 1X5KA 3Q6FA 1IM3B 4PJAB 1U92A 1JYVA 4CRPA 3GI9H 1I3VA 4Y4FA 4PLOB 3R0NA 1MWAH 1BQSA 2ICES 5D9SB 5AWNL 5GRVL 3QULA 4DTGH 3CLEL 4P5MA 1YYLL 5LG1A 3RBGA 1TETL 2DIJA 4O9HH 4BSWA 5JXAH 4MX7A 2V7HB 2MPAH 1FGNL 4ZXBD 5D1XA 4ZPTB 4YBLC 3L9RA 4HKXB 3E6HA 4FQPA 4NNYB 4FXKA 1U8PA 3P0YH 3E3QC 4X9IA 2YPVL 3SKJH 1RZ8B 4B53A 3KYKL 1YZZA 3ULVL 1IEAB 3WKML 4O4YH 4ZD3L 3MV01 3PWLB 1YEEL 4MAYC 1BX2A 1RVFL 2Q8AH 5J06A 4YUEL 3BMVA 4D0CB 5F8QC 3QPQC 1VB9A 5GGQH 1XF5B 5HYJB 5JA8B 4WW1B 1LEIB 4L8SB 1BECA 1I7ZA 3HC4H 4TUJA 2R1XB 3F5WB 3R0MA 3U1SL 1UKQA 1MAJA 4WHYH 3LKSB 4N1CA 2BY1A 2VLJD 4ZUSB 4G9FA 4R9HA 1GGUA 4QTIH 4MQ7A 4XPTH 1ZMYA 1W72B 2GJJA 4XCYB 2C3XA 2VISA 2Q7YB 1WBYA 2D31A 3MXWL 3NCEB 5ACLA 1WTGT 2XZQL 4E41B 4HFUL 4P46A 4LRNL 3O9WA 3LD8C 1CDGA 4Y5VA 5CZXD 5GGVH 3RWDB 4NN5B 1KIQA 3V5HA 1A9EA 3C5JA 4H5SA 1YEIH 2W9EH 1ADQA 5JHDD 5DHXB 1REIA 2EDXA 3VG0H 3F7YA 1HDMA 5EO0B 2VUYA 1ZT1A 1I7TA 5FHBH 2BC4A 4ZUVB 4U1KA 1KBGL 2PW1B 4M62L 4OZGB 1M05A 2UZYB 5JTWA 4FZ8H 5J3HD 3OHXA 1MJUL 5HDQH 3CZFA 1CD0A 1V7NL 1WIPA 3EO1A 4HPOH 4BQ9A 2GITB 4O2CA 1IAIH 4KQ4H 3WIIL 6CGTA 2HG5A 1U36A 1RZJC 3CVHH 5DXWA 1G7LB 2Q3ZA 1S7UA 1X5JA 2B8OT 1BBJB 1F00I 4F9LA 3EO0A 2HVKA 2FZ3A 1AJ7H 1T83A 3DO7A 4ODTH 1IFHH 3HS0A 4NM8H 4JFQA 4KWUA 5DD6A 5C3LD 3UCRA 1HHKA 3PHSA 3G04B 2H32H 4HHAA 4DEPC 4U1HB 1DBKL 1P4LA 3QDMB 1FAIH 1UZ8B 2YN3A 4JM2D 1P9MA 3FT2B 5IW6A 4HG4J 3GJFK 4Y16D 4KY1L 4OCYL 4S11A 1L7TL 3HR5B 3TN0B 4OCSH 5I19H 5DS8B 5HGHB 1YEJL 1K8DA 4JPWH 3C6LD 4LBEA 5KN5B 4RMSA 2NY1C 4FQIL 5EO9B 1LO4H 4F2MA 3DV6A 3PP3H 3EDJA 3QNZB 4HCRL 3ZLQC 1WT5C 4P4KC 5GISL 1FG9C 1KXQE 5CCKL 3TIDA 5I66A 5C08D 4NKDA 3DHJA 4XNYL 5JIHA 5LGHL 5I17A 3L5WB 3L3DB 5D6DA 3FFDA 3QDJD 5CZKA 3OKDA 4LPVA 5IESL 1MWAB 4KJQD 3STLB 4NJ9L 2VXVH 4GQ9L 5KVMC 3G5YB 4GS7B 1E4KC 4FFVD 5FDYA 5IVXB 1N3NA 1NUNB 3HI5L 4R2GB 3F62A 4OQTA 1SYSA 4OKVB 1JWSB 2CMRH 3TO4B 5C86A 5JXED 3NCFB 3VGAC 5B39B 1IEHA 3ZKND 5DJ2B 4JDVB 4FQCL 1OOAA 3V8OA 3D18A 3ZTJH 4BZ2L 4HBQA 1MVUB 2BSED 2OL3H 3UTZA 3DXAA 2CH8A 1QBLL 4QRPE 3SBWA 1G9MH 4ZTOH 1Z3GL 3EYFB 1JK8B 5AAWA 2PTTA 1CD1B 1CFQA 5HYJE 3OR7A 5CSZB 3U7WH 5FXCH 4R26L 4U33A 3ARGC 4RBPK 2Z93B 3WIHH 2APTA 4HC1L 2R8SL 4FFZL 3SPVA 5I1EH 1FE8L 1IZJA 1R5IB 4MWFA 2YD5A 2IALA 1T7WA 3MLRL 4PV9B 1EUUA 3MLZL 1CGSH 2YS4A 3BZFA 1CBVL 1XGRA 3TV3H 2X70A 1UC6A 4D8PB 3QQNA 4NWUL 1EO5A 4I0PA 3MLUH 2PO6D 3TNMA 4TNVF 3KLDA 1C5DB 4GXUM 2IAMC 1QQDB 3KPRA 5JPMB 3G08B 4MNQB 4Q97A 2PYED 2W0FB 3JV6A 5L2JB 2NXZC 4NKIH 1GIGL 2DI7A 2MCPL 3VWJA 3GSQA 3QEQA 2B2XL 4HXBH 5ECJE 3RGVC 3TT3L 1WIOA 2R29L 2DWDA 4J4PA 4O2FB 1I3GH 1ZHLB 4LSPH 5IJKA 2DTSA 4OSUL 1L6XA 4N0CD 3MO1B 2YEZA 4ZAKB 1FYTD 3HNSL 4CGTA 1CFNA 2CUMA 2DMCA 3CVHB 4IMKC 2GQHA 2WWMD 3WCYA 5IG7B 3OXSA 4IHOB 3O2VL 2D03H 3MBEC 1XGTB 5ID0B 1M7DB 2B1AH 5GJSH 4Z7UF 1Q1JL 4BM7A 5HGGS 4XBEL 1V3MA 5IKCA 2BXZA 1QLEL 2GSGA 3E3QE 1QTYT 3KPOA 3BKYL 1QRKA 2F54B 2H32B 4MDJB 2N56A 5CEZE 4Z7WB 3MRHA 2VDML 3FB7A 1FO0A 1U41A 4YDLB 5D2NC 2AJXL 1JPTL 5C0GA 3KWWA 4PG2A 3L95A 3EJZC 1MRFL 3TBSA 3OX8B 5C07E 4Z7NF 3MREA 5EU6A 3VXRB 5GS0C 5ITBL 2CUHA 3CMGA 3QQ3B 1LP9E 1V7ML 3KPMB 4S10A 3ARVA 2BNQE 2GW5A 4OM0L 2RAMA 4ZFOL 4AJ0A 1JHKL 1UQSA 3RDTD 4MMXC 5C9JB 1I3RA 5I8OH 5FF6B 3MCLH 1S9VA 5EBMB 3H6JA 4NKOB 1ZLVK 1NGYA 1RURL 2BVOA 1MFCH 1NANI 4G5ZH 1YN7A 5D7KD 1T6VN 4Y19D 3MX0A 4HQQL 4KI5F 4L3EB 2QBWA 3OB8A 1AGCB 1QD0A 5FV1L 1PVHA 5AZ2H 3RGVB 1L7IH 2DJUA 4J3WA 4HJGA 3H3BC 4NM4H 4X5XB 3CLFH 3V4VH 4MD0B 1E4XL 4ONOA 3CNKA 1W2KT 4JN1H 1BF2A 5GGUA 2C3WA 3HE6A 5DR5H 1CG9B 3ZYZA 2BVUA 1QPXA 3C09C 4KRPD 1F11B 2OL3B 1FSKC 4YO0B 5HGAB 5HHPA 5C71A 3VFGH 4GRLC 4RISH 4U7MA 4X6BB 3MBEB 1JZ2A 1FGVH 1JVKA 3WD5L 1MIEH 3GSOA 2VABA 2EIDA 5E8NB 4GAGL 1GZQB 1E0OB 3WFEL 3WHE0 3CFCL 4NQDB 1SEQL 5DVKA 3BGFC 4JJ5A 3IF1B 1UADC 5D5MB 3GM8A 5AZEH 5MENA 2XQBH 3SCMC 1UM6L 1RZ7H 2FD6H 4DCQA 1I3UA 5TPWH 1ZANH 5GRXG 5LGJB 5E0QA 1F4WL 5KSBE 3GBLA 3QAZC 3NABH 2F5BL 2C3HA 1JGEA 3WFDL 3ARZA 2XNAA 2VIRB 2CLRB 2ILLA 1MCOH 4OGYL 5DMIL 4NRZA 5DD0H 2A2QT 5K93A 4LCCA 3IDGB 2Y7QB 3WN5C 3S37H 5BMFH 4E5XA 4UT9H 1LQSR 2R4RL 3JTSA 3MRJB 2GK0B 5T3ZE 1FV1B 2B4CH 3K80A 2YPKB 3K4ZA 1EHXA 1BJ1H 3WFCH 1NUDA 4PJEB 3JV0A 3QUXA 4FABH 4JG0L 2Z4QA 2GSIB 1MREH 4XP5H 1OLZA 3MJ6A 5KOMC 1Q8MA 1DLFL 4LSVL 4U49A 5KTEL 4EUPB 1Q0YH 1NCUA 1W72L 1UA6H 5ACMA 2GJ6B 4M7KH 1XF3A 1QYGL 5IMKA 3MRLB 1PEWA 3BQUA 3T77A 1WGOA 4YC2B 3MMEB 4D3CH 4W6XB 5E94B 3BP7B 1JPSH 3U83A 4H88L 3MA9L 5IMOB 3TT1H 3KPSD 5EBWA 4ODHH 3BIKA 4GG6E 2DQEH 2JIXA 2YUVA 5LGKA 1JZ5A 3C08H 5J8OA 2VL5B 3C09B 5ICYA 1LE5A 3GO1H 3ILPA 3FQWB 3WV0A 2BZDA 4GRLB 1MHHA 4YHNA 4LRIC 1CLYL 4OD3H 4EDXB 4OGZA 1YEGH 2IANE 4PJHA 5I71B 3TFKD 3DETD 4Z7WE 1P6AB 3KXFA 1MCDA 2R1WB 1OAUL 3RU8H 4YX2H 3DUUA 3CFDA 3W0WA 1ZS8A 1T0PB 2AXJA 3GSNA 5TF0A 3N0PB 4YHMH 1O5DT 2AEPL 3PIQB 4JFXA 2RHEA 4Y1AE 1CFBA 1U91B 5CKGA 3SCMB 3BEVA 5C0FA 1KEGL 1TXKA 35C8L 4RX4A 5K9OA 1PQZA 5FDWB 4YR6A 3UJIH 1IGIH 4LLMA 2F58H 1IT9L 4GSDH 1UXSB 1A7OL 3QAZB 4PP1C 3MRNA 1AIFA 1KG0A 1A1OB 4P2RA 2AJ3B 3L3HB 1RZKH 1CGXA 3K4AA 5F9OL 1AHWB 3B2UC 1FZMA 4XCEB 2B20A 4KVCH 5IROA 2C7UA 3WDHA 3S5LB 3WN5B 4NQSB 2CRMA 5ILTL 2WK2A 5ERWB 1IL1A 15C8L 3T4YB 2WBKA 3QUZB 5DEGA 3V9FA 3F58H 2CO7B 3CDYA 5K33A 1S3KL 1J1OH 4OCNC 1IZKA 1YMHB 1YUHB 1KNOB 1X44A 1PYWA 1CGTA 3KPPA 4IOFC 4K3EH 4HWBA 4ZYKB 5CP3H 1AGBA 3W5MA 5TQ2L 7FABH 1NBVH 2X4TB 2XZZA 1S9XB 5IB1B 3CX5J 4EVNA 4V2CB 3UAJD 4XAWH 3O3DA 1S9KC 3S8WA 4RAHA 4WEBH 2DWEB 5F7NC 3LSOA 3SQBA 2R9HC 5I1LA 2B1HH 1MWAL 5IV2B 1WWBX 1X7QB 3I85A 4R0LB 4JY6B 5SWZB 4O9HL 1YY9C 4NQEA 2Y06L 2IC2A 1ND0A 5JXAL 4U0QB 5DUPH 3O3EA 3KGRA 1G9EA 5EWIH 2A38A 3WLWD 1I1AC 2EE3A 2PKDA 3HUJE 3SQOL 2ITCA 3WHXB 1UJTA 3WUWG 1B0GB 1YC7A 1T04B 3O0RH 2VH5H 3SKJL 1VFOA 4MQXD 5D2NE 4Y4HD 3RI5K 5DK2A 5F9AC 5DF0A 3R06B 1RZJL 4TPRH 4X6CB 4MCZA 1WAAE 5IR1B 5JW4M 1GRWA 2CXKA 3WNPA 5CS7A 5GGQL 5HYJD 5IHBA 4NQCA 1T80A 3K2UL 1EDQA 5DGRA 4TNWK 3MRMB 4OFYA 4GT7A 2CKBA 4NO0A 2W0KA 5IB4B 4K9EC 2PCPB 2VN7A 2EC9T 1L6ZA 1RAMA 1QP1A 1JRHL 1Z9SA 3QQ9D 1D5XB 4GKSB 1NCWH 4J12A 4QTIL 4XPTL 3S35H 1FNEB 3FB6A 3S88L 2NY5C 4IBLT 3GMQB 4F8TA 4HKBB 5E8EA 4E41D 2BVEA 3PDDA 3B83A 3W9EA 4X5WA 4QRRA 5EUOB 4GW1B 3N06B 3FQUB 1R3HB 3HPJA 4A6YA 3U9UB 3MJ9L 3VXNA 2AJZA 5T3ZL 5KS9F 5DLML 4M93B 5IOPB 4B7LA 3WUWA 3QT2A 5EUKA 3VG0L 4YWGH 2CXGA 4WI8A 1TQBC 2NNAB 3QUYA 5D7LE 1C7TA 4QOKE 3BD4A 4XCFH 4I3SH 4S2SB 3BP6B 4YPJA 3LEYL 5I76A 3WO3B 2W59A 4D9QE 3GSWA 4F7TB 5FOBB 4PUBH 2HKFL 3VGFA 2EDTA 2RFXA 4HPOL 5GGTA 1N26A 4HZLA 3RWEA 4KQ4L 2KQMA 3S34L 4LCWA 4LSUH 5HVGB 4ODBD 1JE6A 1WZKA 1A6UH 3MNWA 4ZFFB 3P9LA 1PX4A 4PP2A 1D6VH 5EOCH 4HK3N 4K3JH 4M6NL 1F3DH 1S7TA 4FP8L 3SKNA 4OBSA 1VPOH 1FCCA 4KGLA 2A6DB 1IILE 5LWYH 2XI9A 4EN3C 4JRXB 4OFPA 3O6KH 1E4WL 3QDMD 4HIIA 4YGAB 1NAKL 4YDKH 1TCMA 1TZIA 4U0RC 1V3LA 5J6GA 1UCBL 5HI5C 4HBCL 3TN0D 3KPNB 1P4BL 2N4IA 4OCSL 1KGCD 5J1TC 1UM4H 2YD4A 2OI9C 2EYSA 1QFUL 1JGUL 4MD4B 4JPWL 2VITA 5GIRB 5T1KB 2N7AA 3ZYOA 1JNHB 3GGWB 1CK0L 5DZNA 3CD4A 3BZ4B 5D1QA 3IAGC 4TSCH 3TP4A 1R5VA 5ID1B 4XWOC 1OD9A 3DUSB 2EXYD 1JJUA 3OG6B 5DK3A 5D93B 4JDZA 4JM4L 3QFDA 2YHGA 3BOVA 5DJXA 3VFPA 3MSPA 3O3BB 4N0UE 3AXLB 3RWGB 1FZOB 2VXVL 2IQ9H 1ED3A 4JKKA 2ZUWA 4NZTH 5CINL 1NBYB 2AJYH 4R2GD 4WFED 3WFBH 4M61B 4JRYB 1ADQH 3FO2B 2MJWA 3VFOA 3FB8A 2FLBT 4YZFF 4HWNA 2ATKB 2B5IB 4FQLL 1SEBB 3H9SE 4OF6A 2V2XB 1KXTB 4OT1H 2BDNH 4D9LL 5SWQA 1V3JA 1ZHKA 3RVVC 1UB6A 4WGWB 1DP0A 2UWEA 5DHYA 4ODSH 1OAKL 4QHLB 4P99A 4C55A 2PN5A 3J7HA 2EDEA 4ZTOL 3MRCA 3DRQA 4I2XE 4NBZB 5IM7B 1T22A 5DC4B 3N1PC 4JPIB 1LDSA 3L5HA 2EXWC 2QSVA 5JMRA 5D71H 1J0IA 4LPTA 1FLTX 5EPMA 2W0LA 2R2BA 4HWZA 5DURB 1T7XA 4X99B 4LQ1A 3PHOA 4GRMA 1FJ1B 3DX6A 2OJZL 3QQ4B 5B22A 3VFUA 4K7FA 3TV3L 4IDJH 4JQIH 4WY7H 4B50A 2XN9A 2VQUA 5KVFL 1VKXA 3RIFF 3NPZB 3OJVC 2DRUA 2OI9B 4M6OL 4U1NA 3DIFB 5SX5H 3AM8A 4PJCB 5JOPE 3BH8A 3MLUL 4BQ8A 4ZTPH 3RJDA 3K0WA 2FRGP 4XC1H 5GS0L 2NY1D 4ZSOB 4FQJH 1HQ4A 5EUOE 5T3ZD 1MCLA 1MHCB 2LVEA 1KN4H 3EDDA 1T2JA 4MNQD 1T1YB 3RIAF 2DLIA 2R1YB 1G6VK 2X5PA 4PJFB 1IKNA 2HLAA 1FZJB 1TZGH 3IKCA 5CJXA 4WNQB 4BH7A 2IBZX 5B8CB 4RZCB 4AEIH 3MYJA 1I7UB 3Q6FB 1U92B 3PNWB 3MV8B 1FYHB 2VDNL 4ZAKD 5F70A 3SDAC 3VU2A 4L8DB 1CDYA 1MCRA 4G6AC 2ZCHL 3O4OC 1JWUB 1EAJA 1CR9H 1SHMA 1U8OA 4JZOB 1BF8A 3CCHA 2QR0B 4P5MB 4NWTH 3B8SA 1UWGL 1QVOA 2X1WL 1UVQA 1HILB 4MX7B 1BZ7A 5TFSH 1TFHA 1UJ3A 2A6JB 2VAAB 2X4RA 3I6LD 3U46A 3L9RB 2F54D 1P5VA 4PGCA 5CJQH 4UV7H 2NY6B 4HG4K 1KPRA 5IEKB 4JRXE 4LEOA 4XMLH 3CFBB 3B9DA 5E4IA 1UH2A 3QCVH 4KMTH 4Y1AD 4YQXH 5DQ9B 3ARGD 1NQBA 1FHGA 7CGTA 3VCLA 5GJTH 1IGMH 4PGZA 2KBGA 2VTFA 5C0BB 2EC9U 3M1BB 3EO9L 3VXRD 2DAVA 3P40A 2Q76B 2JB6A 3MQIA 1TQCC 4G9FB 4KJPC 1P1ZA 1UGNA 2JCCA 5I74C 1A14H 1B9ZA 3VE0B 1IAKB 3TBVB 3ULSA 2FJHB 5EC2A 5I8OL 3CXHJ 4YGVB 3LN4B 1CGYA 3ABZA 5ANMA 5CBAB 3N9GL 1CXHA 1OP9A 1D3CA 4YHIA 3O9WB 1YEFH 1MFCL 5DJ0B 4G5ZL 4Y5VB 1QFOA 4XPFL 4XAKD 4L3ED 1UKSA 2VRAA 3ZYJA 4U1LB 4LGRB 3VI3F 4QXTA 3C5JB 3SDXA 4H5SB 4MZ2A 4PJ8A 4V1DE 1JMXA 2DI9A 3RGVD 1KJMB 1HDMB 4NM4L 3V4VL 2FR4B 4M4PA 4JN1L 4MD5B 1QBMH 4LKCA 1GH7A 3MV7E 5TQ0H 1RZFL 2K7PA 3EZ8A 3SDAB 2AQ1A 3O4OB 1IEBB 4AM0B 2YD6A 2VDRH 4DFIA 3MBED 3E8UL 3O2DH 4YDJA 2XKUA 2BHYA 3ETBF 4WUUA 1GL4B 1LO0H 4NQDD 1S7UB 3JWNC 1I8LC 3AS2A 3D3VB 4IS6A 4JFYA 2HVKB 4P9HC 4ZUTB 5I1CH 2FZ3B 5F7FA 3DO7B 4KI1A 1NDMB 1WZ1H 4WFFE 2P24A 4JANA 1A5FL 1IM9A 4S1RH 3SJVA 4XVSL 2KKQA 3D9AL 1ZANL 1HHKB 4RQQA 5C0AA 4HHAB 4TVSa 3EJZD 3WYRA 4HJJL 2LAGB 5IGXL 3NABL 2A0LC 1JN6A 3PP4H 5GGRA 1R24A 5D2LB 3GIZH 1MCOL 1FO0H 3QDGE 5IW6B 2B7DT 5GS0D 3BWAB 3PGFH 4ISVA 4OJFH 2X05A 4U6VH 3RY6C 3S37L 1RUQL 4PJXB 4WIQA 4N0RA 5F9DC 1RIHL 1TQCB 4JFHD 1ZHNB 1F4AA 3TC9A 3LQAC 4LBEB 2DMBA 3P0VH 1SY6H 4BUGA 1U58A 5T5FH 4G6ML 3V95A 4K94H 2IGFL 3RUGE 3TIDB 2XTLA 2ZG3A 4YXKH 3U7YH 4XVTH 5FYKU 1WFOA 3EFFB 5KW9L 1YY8A 1U95B 2GJ6D 2H9GB 1BJ8A 4M7KL 3RKPA 2OP4H 5JW4R 4JFPA 1FFOB 3FFDB 1LK3L 3FT3A 2VDKL 3B2VH 3VA2C 2R0KH 3BKCL 4RAUA 3MV8E 5TE7H 5BOPA 1Q94A 4CVXA 4Y2DA 3BP5B 3RPKA 1PJ9A 4P5TA 3STBA 1UH4A 2BJMH 5DJYA 4OV5A 2XTJB 3NCYP 2OTUB 1OW0A 1OF2B 1S7XB 1HQRA 1N5YH 4HUKB 5CJOL 4GRLD 2JLLA 3D18B 4OD3L 4MJ5A 1YEGL 3AGVA 3DVFA 3IGAB 3QWRA 1FIGH 4RAVA 2ADFH 4YHML 3OGCA 3MRIA 3RHWF 4JFFE 3SCMD 4OGXL 3BEWB 3VRIA 2D0HA 3DPBA 5DMGC 4I0KA 2WWKT 2LV4A 5C0BE 5DI8B 3UJIL 4N5ED 5GSVB 2J88H 5HHOE 2NY3C 3T3ME 5IEHB 3KJ4B 2Y5EA 1NC4A 2R2EB 5IT2L 4XB7A 2JELL 3MUJA 1WEJH 3QIBA 2NZIA 4XP9H 2X70B 2AK1L 1WICA 3CX2A 3VXSB 5E24E 2AV1B 5DJCA 3QG6B 3IFNH 2YD1A 2XQYK 3RWJA 3TNMB 2FBOJ 4C83B 3QUZD 1BAFH 4EQ3A 3F58L 3L7EA 1JGLH 4UOJA 1N0XH 1PY4A 4MXWH 5E2VH 3T0BA 1HKLH 4R4BB 4PY8I 4RGNB 5HHMB 5F7DB 3P77A 3TJHC 1CFVH 4YHOH 2EKSA 2NY5L 2R2HB 4PRIB 5DJ6A 4WV1C 2Y6SD 5KSAC 4X6DE 1MHEB 3MV9B 2FH6A 4LLUA 1KENH 2NTFA 5ACZB 1RPQA 3FOLA 2O5YL 2DWDB 1CFTA 2HT3C 4XAWL 3ILQC 1FDLH 3MRDA 3VXMA 4X6EA 3UBXG 1RK1A 4WEBL 2A9NL 3MGOB 1G6RA 4JFEB 5J1SC 5ESAB 4F57L 2APXA 5ESQA 2GY5A 4JDTH 5C1MB 4M1GH 4MYWB 5B3JF 2KQNA 3D3VE 5J89A 5GHWL 5SWZD 1H5BC 3SO3C 1QOKA 1VENA 2GTZB 2X4OA 4PG9A 3GRWA 5SWSE 1CE1H 5CHNA 4JG1H 1LEKB 5EWIL 1RUKL 1BZ9B 3ZTNH 2UVFA 1NKRA 2O61A 1C5BH 3D25B 2BFVH 1A6TB 2RCSL 3G5ZA 4QY8B 2X4PB 4NUJB 5FECB 1FAKT 1FO0B 3HZYA 3U0TB 2DTMH 2Z92A 3DV4A 2DJSA 4XP6H 4DQOH 3CXDL 1SJEA 1P7QB 4PP1D 4BFIA 1T7VA 4G6JH 1LWRA 4K7PH 4QRQA 1XGQA 2BMKA 4K23H 2DDQH 4NQVA 3B2UD 4LU5H 2OK0H 5F9JB 1Q9WB 4ODXB 5F89B 4FS0A 1NMCC 2HP4A 5I8KL 3UBXA 1VA9A 4U1GB 3HMXH 1OD7A 4ODWA 5CEYA 1I9JH 3T0EC 3IFPA 2JE8A 1KTKE 4AG4L 1UFUA 3GEWB 1TTGA 3FMGH 1AO7E 1S9VB 2AJUH 4PY8J 3U0PA 2R0LH 1P4IL 2I9LB 4GRWF 4XMKH 4U6XA 3AREC 2VSDA 4OZHA 1OAYH 2XG5A 4IOFD 3RP1A 2D7QA 3H0TB 5HY9B 1RD6A 4L4VB 3KLHC 4PS4L 1U3JA 4KGJA 5I16A 4FZEH 4BSVB 3C5ZA 5DDHA 5GGSB 3OF6A 3VXQB 1NANH 5L8KB 1X4ZA 4M4RA 4XCFL 3HE6B 4PJGA 1SMAA 3V0AC 2QHRL 3BP4A 4NPYA 3QDHA 1X6LA 1G7QA 2ZSWA 5HHPB 2VLLA 2R9HD 4P3DB 2X40A 3SE9H 4HFWA 4LPXA 1TMCB 3UX9B 3PWPE 3O4LB 4HIXH 4PJBE 3HI6H 1ZVSA 5HHQB 1N59A 5AG8A 2BSSB 4LOUD 5KBNC 4OB5L 3CH1B 4F7EA 1K2DA 3FO1A 1ZT4A 5TJWK 3V6ZB 4JO3H 5ISZE 4UT6H 5C0DB 4L8BB 2BXYA 1H3GA 1HH9A 1JFQH 4JRXD 1F8TL 1WQVT 1TLKA 1UACL 3A0OA 5D8JH 4FNLH 3UTTB 2V7NB 3HE7B 1MY5A 4YDKL 5DHVA 5C6TH 1TVBB 4YFLF 4MA3A 2CLVA 3RRQA 2HMIC 4JKPL 5JR1H 3C6SB 3RWHA 5FGCE 3TBWB 5T1KD 1NMCB 2YPLE 4NZJA 3ZDXE 3PWJA 2XKNB 2Z91A 4GUPA 3OMZA 3CMOL 1P7KA 2Z4QB 3RL1B 3STZB 3DBXB 3VFMB 1TZHA 4PRIE 4ZXBA 3VXTA 2MKWA 3CSGA 3F7VB 3NPSB 3AREB 3TO2A 3B9KC 4KUCD 3BQUB 2J5LB 3LDBC 1JZ6A 3RTQC 2DQJH 5ALBH 3KJ6L 4ETQB 4U7KA 2IQ9L 1XCQA 3EKCA 4V1DD 2I25N 2AJYL 2JIXB 5C7XH 4K07A 2YXMA 4JRYD 1JZ7A 5ICYB 4XP1L 3ILPB 4HX1A 5ITFB 1YEDB 1AFVH 4F7PB 3V0WH 3RWCA 1CD8A 3CK0L 4TRPL 2BDNL 5EOQH 2VLJA 4OI7A 2V2TA 4PJHB 1CLOH 4BQCA 4IMLA 4I5BB 3KG5A 3KXFB 2JCCF 4WW2C 1XR8A 2ZSVA 4EI5C 3F7PC 3DUUB 1FZKB 1CIDA 4HH9B 4XZUB 3O41A 3W0WB 4PRBB 5GGTH 4UT7H 4Z5RA 1U3HC 4P3WA 3FZUC 5BS0B 3PGDA 3UDWA 2QQLL 3LB6D 4LLMB 4MGXA 3ZL4H 4Z76B 1MLCA 5FYLE 2BVYA 5BVPL 5JHDA 1KG0B 1S7SB 3O11B 5DURD 2RGSA 1YYML 2GUOB 1A3LH 4NHUA 5C0IB 3AMLA 1BQHG 2NPLX 1FZMB 2R0ZL 5JO5B 4JQIL 5HI5D 4DGVH 3LN5A 1MCEA 5JLZB 2DLFH 1VEOA 1J0YA 3RX5A 1MCPH 4M02A 1N5AA 5FGSA 3G6JB 4FTVB 1MCQA 2E9JA 4HMDA 4KU1A 2V17H 2P5EB 3LVEA 1BBDH 1NKOA 2LVCA 2P5WE 1URLA 1KN4L 4YXLH 4U3CA 2F74A 2WLZA 3IFOB 4XCCH 1JPFB 1LHZA 2FJGA 2WMPA 4OAWA 5GZOD 3NCYS 2G2RB 4XNQA 2R4SL 3V6OA 4M5ZL 1JNNH 1TZGL 1GC1C 1QSFA 4RA0C 5T1LA 2VDQL 1FVCB 5IIEA 3LEVH 3MRPB 3U4BH 2D7TH 3CFKA 1BM3L 3MOBH 4P2YA 5SV4A 3EUUA 3MV8D 3ZE1E 2IPTH 2FO4B 1FBIH 3RPIB 4JM2A 1K4DA 4ZQKA 3PHQB 3QO0B 5I1LB 1BREA 2CDEA 1YC8A 2FX7L 1BOGA 3CFJB 4Y16A 3LMJH 3ZHLA 1LO3L 5B4MD 2C1OB 2DQFA 4Q9RH 2B0SH 1BQHA 3PQYE 4RGMB 4NQEB 1MCWM 4XNMB 3RVVD 1F4YH 3C6LA 1JL8A 2B39A 3O3EB 1HSAA 4EI5B 5F1IB 4OF8A 1XGPA 5DT1H 4HXAH 4YK4C 2NY6D 4LARL 4UV7L 3NN8A 1U8JA 1FN4A 1MI5B 2X4QA 3P9MB 3EYUH 4ZFGL 4XMLL 3SE3A 4KK5C 5HGBB 1WFUA 1J11A 2ARJA 1S5HA 5F3BA 3QCVL 4KMTL 4MCZB 3GMRB 1VEPA 4JQXA 1UB5A 3QDJA 3RAJH 3REVB 4P9HL 1G0DA 1HINL 4NQCB 4G3YL 5GJTL 5C0BD 2X41A 4OF7A 1S7RA 4G8GE 1A6ZA 3WJJC 1MIMH 4NO0B 3RVUC 4WU5A 5CIPH 3BSZH 3KYMA 1Z5LA 3T0EE 5JXEA 5DD5L 5TDNB 1A14L 2OMBA 1MEXL 2C4FT 3BPLB 1TCRA 3KVQA 1YMME 2AK4B 1MJ7H 4CW1B 2CIIB 4LCUA 2BOCB 1R5WA 2NR6C 2WM0A 5GGRY 2Q8BH 4KAQH 1QLRB 3LQAL 2G5BB 1GYAA 1C16B 3GSUA 1NFDA 5IMMA 3HPJB 1I8IA 1LO2H 4QRTB 1KCVL 2BNRB 1N7ML 2EDFA 3HLAB 2LFGA 4N0FB 1RULL 1E27A 3G6AB 4Z77B 2XWTA 1MRDH 1NDGA 4CN1A 4AH2B 2HVJB 5D7IE 1O7VA 5I1GH 4R90H 2P8LB 3SDAD 3GSWB 4K71B 1WIUA 4G6AD 1Y18B 4KPHH 2VUOA 4XC3L 4NQXA 1Y0LA 5I9QC 4TNVK 2VDRL 3QCUH 5KVEL 4LLAA 3O2DL 5C0CA 4HZLB 2I27N 2W65A 2YUZA 3M17A 5F7LB 1NCDH 3NIGF 1OAXL 2PO6A 2V6HA 4JHWL 1G1CA 3BRGC 3CSYB 2EDHA 5J6HB 3MNWB 4KZDH 4MNGA 3D3VD 4HD9A 1A1MA 5BVJA 4C58B 5BS0E 3G9AB 1ZT7B 1WBZA 5CD3A 1WZ1L 2PYEA 4XPAH 4OLYH 2ZOLA 2AJVL 2WBWB 3GSRA 4FFYL 2DOCA 3FL7A 1J1XH 5EFIA 1FCGA 4LIQH 3GMOA 4F8QA 3GIZL 3A67H 2HFFB 1GPOH 1PKQA 3MOAH 3K8KA 3H42H 4L3CA 4OJFL 1EEZA 1J10A 3G6JE 4FTVE 5D70H 1MFEL 1FYTA 5FYJH 1AD0B 1A4JA 3OZ9H 3L3GA 4TSAH 2P5EE 3BPNB 2VITB 3X14A 4L4TB 5JHLH 5EORL 1SY6L 1IGYA 5FYLL 2BOBB 4NZUL 3V5KA 5F93C 4U05A 32C2B 2G9HA 1R5VB 4YXKL 3HZMA 4XVTL 4U2ZA 1T4KB 3LIZH 2BNUA 4MJIE 4XH2B 2AGJL 3QFDB 3AS3A 3BPCA 4BZ1H 2WP3O 4PJ7A 4G7VL 4AK1A 5F1KC 1MFAL 2HT2C 2Z31C 2XTJD 3FJTA 3HZVA 1T3FA 1N5YL 3VFOB 1VGEH 3FB8B 4QRSB 4TQEH 4PGDB 5I9QB 2FECL 4AT6A 2GY7B 4ONHB 3NOIA 2C3GA 5JDJA 1KCUL 4LP5A 1AXSB 1MAKA 1FIEA 1CXFA 2IF7A 2UWEB 3EYQC 4OUUA 2GAZB 2A9ML 3IVKA 5EO1A 3IDMA 2FWOA 2DS4A 3LKPA 3HRZB 1OAZL 4Z8FH 1IQWH 1T22B 3RY4A 4HLZH 5CIPB 5E1AA 4Z0XA 4Y19A 1KV3A 2ESVB 1DBAL 2J88L 5DRXB 5ISZD 2AERT 5HYFA 5DTFB 1T5WB 1Q72L 1Y6KR 2AABH 1I1FA 5FM5M 2GTWB 3WLBA 2VZ1A 4CU8A 3DX6B 4XP9L 4K7FB 5IBLD 3G6DL 3OTTA 1BGXH 1T66C 3QFJE 3VXSD 3MJ7B 2AK4E 1JTOA 1KPVB 2CDFB 3VDAA 1HQ4B 3TIEA 1T5XA 2XOTA 3OKNB 1N0XL 2K9UA 4HUUA 5HHMD 1HKLL 4B0MM 5TDPB 1A7BA 3E2HC 2BNRE 4UINH 4NDMA 5EN2A 2HLAB 4HC1A 3MTRA 4PRID 3MV9D 1DFBH 4KKCC 1KENL 1YPZB 4OZFG 1OTSC 5F96L 3P30H 2E5EA 1FDLL 4NSKB 4XGZA 5INCA 5CZVH 3O45B 4JFED 5JNYB 4LSRH 5JW3L 1IQDB 3TPKA 2IPUK 2Y36H 4JDTL 2VDLH 3MNVB 2J8UB 4ELMB 3CCHB 4ODUA 4X80H 4Y7MA 1XH3B 4O00A 1TVHA 3MROB 3RVTD 1GVIA 1U8QA 5I1KH 3BKML 1UVQB 1ZA3B 3FB5A 4QWWC 1T2XA 1GCFA 1CE1L 1UJ3B 5IBUG 3U46B 4E0RA 2X10A 4WENB 3ZTNL 5FM4A 1P84J 1C5BL 3T8XA 4HJ0C 4OLZL 2NY4C 3KYOB 4XP6L 3LAFA 1QSVA 1P7QD 1JF1B 4DKFH 3WXWH 3K1KC 4G6JL 3CFEA 4HIEB 3KPSA 4Q9QL 1WLHA 4KI5C 4K23L 5GSRA 4GKNA 3PWUB 3IDYB 5FYLD 3PDGA 1ZWIA 4L4TE 4OZFA 3DSFL 4KKLC 2C4FU 2OR7A 3L3IA 4U1SB 2OZ4A 4KQ3H 4JO4H 3OR6B 5DFVC 1QZ1A 3HMXL 3BN9C 5LBSL 2UYLB 1I9JL 1NJ9A 1PSKL 1DANT 4ESKA 3I84A 4CJ0A 5IBTH 3TJHD 2R23A 1B2WH 3OXRA 3O8XB 3GHBH 4XCNB 2P5WD 2O5ZL 3SDYL 4NC0B 3SDXB 4L4VD 1ZHBA 3MNZA 4PTUB 5CP7B 5FO9A 1FC2D 3BGMA 1Q0XL 3EYOB 4FZEL 3QH3B 2BVPA 5DYOB 2JJSA 5EU3B 3DYPA 3ILQD 4EI6A 5EZIL 5FGBC 4NKMB 4PJDA 4BH8A 4ZFOA 2J1KA 4ONGH 2EH8L 3FQRB 5DJ8B 1ZTXL 4UDTB 1BLNB 3O4LD 2O26U 5FYKH 1HXMB 4GAYA 1IC5H 5E8PB 1T7YA 5E70A 3IXTB 1ZA6A 3NZ8B 1EJOH 4IS6B 3PQYD 4WWKC 1ITBB 4JFYB 5EH1A 1F58H 4BSJA 3KHQA 4Y4FC 3MGTA 3PGCA 3H9HA 2EICA 3C8KA 1EIBA 4HKZA 1ZE3C 2Q6WB 1EVUA 1DQMH 4JY4B 4H25A 4LCYA 4XB8A 2VXSH 3VW3L 3C60C 3UTTD 4I77L 1I1YA 4GFTB 3HE7D 5GGRB 3LKQB 4LPUA 5EBLB 1WFNA 4G8FB 3GUTA 4KDVA 2E7LA 4PJAA 4UU9A 3JVGA 1LDPH 3LZFH 1UM5H 3V52L 5EG6C 3ARQA 3EOBA 4JM2F 4JE4B 4XRCB 4RA3A 1LMKA 4LK4A 1NCBH 4X4YB 1F2QA 5FAAA 1CICA 4N0YL 3SGKC 2J6EH 1K3ZA 2V7HA 5GXBB 3HKFA 2Q86B 5CAYB 2F5AH 3UP1A 5JPNB 3I75A 4HKXA 3N1QC 2I60L 4FQQA 4NNYA 3ARED 4MMZC 3ULUF 2MOVA 1RZ8A 1QUNA 2DQDH 4Y4HA 1IEAA 4LVOC 3O6MH 2ED7A 3BQUD 4JFPB 4YDIH 1WF5A 3TYGL 2DQJL 3PWLA 1D9KC 3HFML 5C2BH 1A7NH 2AV7B 2XRAL 4P5TB 1TITA 1EK3A 4NT6B 3UO1H 1XF5A 5HYJA 4RDQF 1JRHI 4WW1A 4JCLA 4L8SA 1QBBA 1GC1L 3MODH 5DMKB 5JIIA 3CIQA 2VB5A 3LKSA 4UUJA 1FFRA 1PEZA 3KXFD 2ZJSH 1RHHB 3ALPA 2FIRT 3D85B 1W72A 1CZ8H 4CADB 1EUTA 4XCYA 2OYPA 2Q7YA 3W0WD 4EKXA 1EPFA 3AS0A 1HYSC 3WSQL 2YRLA 4E41A 4JY5H 4JGMA 5I73C 2O5XL 1FNAA 1GGBL 5BS0D 1CVRA 2HJKB 3QHFL 3RWDA 3BYYA 4XWGH 3HB3C 1NFDF 4GOSA 2HFEB 4PLKD 3I3DA 3Q6GL 1IC4L 1KCSH 2IH3B 4ZUVA 1VACB 4DGVL 3B8YA 4Y88A 2PW1A 3D0VB 4OZGA 2H45A 2AJSH 3QIWC 1MCPL 4FTVD 3HRPA 3J8F7 4LF3B 1UWEL 2V17L 3L7EB 3W2DH 2P5ED 5MI0C 3UTSE 4Z7UE 4X7CC 5FUCC 3ZKMC 4TTDC 4XCCL 1UEMA 4RFNC 5F9WC 4LASH 1H3VA 1CD9B 4U6TA 1BBJA 1SM3H 5FA4B 4PY7B 1EO8L 4R4FH 2DD8H 2IG2L 5DJ6B 1JNNL 1I9IH 2J7LA 3QUKA 4XXCC 1KB5H 1OSPH 2D7TL 2FATH 4ZS7L 4MAYA 1D9KB 5IHUH 4MXQC 1YN6B 1EHAA 4X6EB 4W6WB 1N8ZB 2UUDK 3CSPA 5B39G 4U1HA 3QDMA 1A3RH 1F4HA 1YJDC 4M6AA 1UZ8A 4NZRH 3NTCH 3FT2A 4XPGH 3U82B 4Z7NE 1OGAB 5D6DC 3P9WB 4W4OA 2XPGA 3LPGA 4JZNB 4NQED 5HGHA 1HHIB 1JWMB 3TCXA 1F4YL 5KN5A 2NY2B 3EYSH 4X8XA 5EO9A 4EI5D 1BZQK 3QNZA 5IVNA 1KULA 3MC0A 3X11B 5CSGA 2PTUA 1X4YA 1MI5D 3G5ZB 4WHYG 5T3XE 1U3HD 2DLEA 3AY4C 3FZUD 4O51A 4O58H 1NBZB 2JJUA 1OARL 5I73B 1D7FA 3L5WA 3WJLC 2EDJA 2VDOH 1BIIB 2W1NA 1ZXQA 4KI5E 3DJ9A 1MWAA 3STLA 4QRQB 3UZVB 3G5YA 4I13B 4PJ7F 5I1JL 3A6CH 5IVXA 5DVNA 4ZOAA 2PR4H 3BSZL 4OKVA 4WHDA 5B39A 3MLSL 1MPAH 2I5YL 5DJ2A 4JDVA 1DANU 2GJZA 4ODWB 2IBZY 3KS0J 2AK4D 4KHXL 5M94B 1MJ7L 3VJ6A 1CGVA 1QSEE 4M9OA 5B21A 4BK4A 3E6FB 1XF1A 4UNUA 4U3XA 4RFNB 1WISA 4KAQL 4WI5A 1QSZA 4OZHB 5D7SH 2YWYA 4G8IB 4OTXL 4LHQB 5C0EB 1ETZB 1RIUH 3EYFA 4NRYB 1JK8A 4U1JA 1J12A 2BNRD 4NUGL 3ZKSD 2IPKB 3X3GH 1CD1A 4HAFA 1I9RH 5CD5C 5CSZA 4PGEB 1DQDL 4K8RC 2DQIH 2BX5A 3I9GH 1MRDL 2Z93A 3BN3B 3D39B 4PJGB 3TPUB 2DIAA 3BP4B 5BCAA 3ZYIA 4AENA 3EJYC 1FP5A 1R5IA 3RIFK 1G7QB 4KTDH 3X12A 4PV9A 3VWJC 2D9CA 2VLLB 1CVSC 4KJWC 2MQCA 3WE6A 4LSQL 3QCUL 2GEEA 4XVJH 4S1QH 1NCDL 2C3VB 5IJKC 1EHLH 2NW3B 4I18C 1C5DA 2WUBH 4MCYB 5I15L 3MJ9A 3M8OL 1QQDA 3FO1B 1WT5A 2JJVA 2VZ3A 3OAZH 4P4KA 5F72S 4MNQA 4Y5YC 1K9TA 2W0FA 4XPAL 5L2JA 4KK5D 2FEDC 2HTKD 1U93B 1C08B 2CLZB 1EJ6A 1G7MB 2DQCH 5FV2A 3C2AH 1H3PH 2D0GA 3A67L 4O2FA 1E4KA 1ZHLA 3MOAL 4MA3B 3H42L 4NO5B 1RIVH 4P2CG 4N8CL 3MO1A 4M7ZB 3DX8B 3QHZH 3QI9C 4ZAKA 1OTUD 1X5AA 4JFDB 3RWHB 1XEDA 3PJSB 4ZOCA 5IG7A 3L6FA 3P3YA 4L4TD 5AAMA 2VQTA 4IHOA 1XGTA 3CLEH 5ID0A 1VFBB 1QHOA 5DEFB 4X6FB 1TETH 1RU9L 4UAOB 2Y25A 3MUY1 1BVLB 4A2MA 1C1EL 1KB5B 1T1WB 1HH6B 2C1PA 1OP5H 2F54A 3L7FB 4DUWA 4Z7WA 3ARXA 1KELL 2YPVH 3KYKH 3ULVH 3EOAB 3WKMH 1MCKA 2MKLC 4X8JB 3ZTJG 4ZD3H 4KH2A 4I8DA 4BZ1L 1U8HB 5BW7A 1VHPA 1RVFH 3BESR 1RJZB 2R0WH 4Y1AA 3ARGA 3HMWL 4AL8L 1CDJA 3TF7C 4QLRA 3VXRA 3QQ3A 3WXVL 2EDBA 3U1SH 3PG2A 1ZV5A 3KPMA 3RWCB 2E6JA 1T1ZB 5C9JA 3QPXL 1ES0B 4PRHB 3MXWH 4OCXH 5FF6A 2E7HA 4Y8AA 1OWRM 4JLRB 1RK0B 5EBMA 4NKOA 3GJFA 5GS2D 4HFUH 3MUHL 4FQ2H 4LRNH 4Y5YB 5MEOB 1IQWL 3SGDI 3ARBB 4L3EA 5JORA 2ESVD 1MLCB 1AGCA 4AEHL 5JHDB 5KZCB 2P8PB 3RGVA 4X5XA 4MVBC 1IAOB 3CPLB 2DM2A 1CG9A 4W81A 4LGSB 1KBGH 5T3XL 3QI9B 4PJDF 4PB9H 3D1MC 2AKRB 2IFGA 4IMKA 5HD8D 5HGAA 1MCJA 1MJUH 4LVNC 1I8KB 2CIKB 4X6BA 4PR5B 5FUCE 3MBEA 4QRUB 5CILL 4PRPB 1JGVL 1V5JA 4X98A 4EUPG 4DGYL 5E8NA 3L3OB 4NQDA 4OIAA 4OZ4B 4OAWB 1RUPL 4XNQB 5BRZB 3IF1A 4W6YB 5D5MA 2P45B 4R8WL 1NFIA 1DFBL 1QSFB 4F33B 3D39E 5T1LB 4EZMA 3T04D 1W0WB 5IIEB 1DBML 1HXYA 2ZUQC 4YBQD 2CSPA 3P30L 3VMPA 2D3VA 3BE1L 1DBKH 2J8HA 5BV7C 2VIRA 4H8WC 1WBXA 3MUGB 2HH0L 1WAAA 1BOGB 2YA2A 4KY1H 3IDGA 3L5XL 1L7TH 4PJAF 1R0AH 1BQUA 1BQHB 1PGRB 1YEJH 3MRJA 1LE9B 2GK0A 5I1KL 1EFQA 3GI8H 1R3JB 3C6LB 2F8VA 3EHBC 5FGRA 3VI4F 1EMTL 3EYQD 5ALCH 1G7IB 4PJEA 1JMZA 3ARUA 2X1PA 4HCRH 3VRLF 5GISH 4N9OB 2X4QB 5CCKH 4XNYH 4EUPA 1S5HB 3G5XA 5F3BB 2YK1H 4AQOA 2GJ6A 5FYJD 3MRLA 3MMEA 3NZHL 5KS9E 3BP7A 4PBXA 2WBJB 3S5LG 5IMOA 4F9PC 1S7RB 3SN6N 3V2AR 4WU5B 4FA8A 4P48A 4APQC 1J0KA 3DYOA 4FHBD 1UKTA 1WFTA 5FB8B 1T66D 1YNLL 3RVXC 3FQWA 5H35B 4YE4L 4M3JA 4LVNB 4FQCH 4GRLA 1TDQA 3TBYB 4GW4A 4EDXA 4D2NA 4BZ2H 4YHZL 5BQ7B 5A16A 5E6YA 3JV4B 1UWXK 4L9DA 3RHWK 2R1WA 1C12A 5IROC 1SYVB 1KEMH 1QBLH 3O8XD 1WVZA 4KK6D 43C9B 1Z3GH 2FO1A 3PIQA 1U91A 5ETUA 3SCMA 3KPRE 4KKCD 4F15C 1NCCH 5D7JC 5FDWA 1OTSD 4R26H 2ZUQB 4L29B 3QXWA 1UXSA 4HMEA 3QEQE 4JPKH 2NCMA 4HC1H 5MEQB 2R8SH 4FFZH 2HWZL 1FE8H 3QNXB 5BV7B 2AJ3A 3MLRH 3L3HA 4RCAA 3EOTL 3ROOB 4TUOB 2VDPL 3UJTL 4NQXB 1Y0LB 4YDVB 4JZJB 4UOW1 4G42B 2XA8L 1QR1A 3S5LA 3WN5A 5C0CB 5FYKL 5IW1B 1HEZA 1YQVL 3M17B 5ERWA 4OZGF 4PRHE 2DYPB 1IC5L 3T4YA 4QWWD 4HKJA 5CJ8A 5JOFB 1A1MB 1EJOL 5BVJB 1MCWW 3AFLA 4WJ5A 1F58L 5HJ3B 2V5MA 1YMHA 1YUHA 5GRJL 5F7HA 1DQML 3S3SA 4ZYKA 2B2XH 5T3XD 1ROWA 3JWOC 4XXDB 5HPMB 4X4ME 3TT3H 1S9XA 1PG7L 1T2QH 1AGDB 2R29H 5IB1A 3LKRA 2NTSP 1RFDL 4POYA 1WWWX 4KI5D 4WUKH 1UH3A 3LZFL 2NMSA 2DWEA 3HNSH 4KKLD 4APQB 1PZ5B 3L3GB 3P73A 5EZOH 2GFBB 3X14B 3O2VH 1PW3A 5EU6E 5IV2A 2EDRA 4YZFE 1X7QA 5HDBF 4LDLB 4LRIA 4OZFH 1KN2L 5BRZE 1E6JL 4LLWB 2J6EL 4GMTL 4XBEH 3ARFC 1QLEH 1MOEA 2YA0A 2HFTA 5GS1B 1CXKA 4YJZL 2F5AL 4NO2A 1MUJB 1H9VA 2APFA 4PJ5B 4KRNA 3K74B 2P1YA 1T04A 3FCTB 2VDMH 3HZKB 1V8HA 5BZWA 4YDIL 1F90L 2NZ9C 3ELAT 2H2SC 4P2OC 3R06A 3SOBL 3AMKA 5C2BL 1MFDL 2AJXH 1JPTH 3NACL 1ERNA 3KR3L 1MRFH 4N8VB 4QXGH 3QCTL 3HZVB 3UO1L 1XIWC 1QLFB 2VR9A 3IDXL 3QP3A 4GMSL 5ITBH 2VLKE 3MRMA 1KIRB 4JQVC 5IVXF 1M6OB 1V7MH 3ZKXC 1FQ9C 2EDYA 1PFCA 4Z7VF 4OM0H 2VLRE 4UI2A 3QUYC 4GXUN 1JHKH 1YJDL 1IGCH 2EDNA 1D5XA 4GKSA 3FN0L 3QUMB 3D85D 2IWGA 3OG4B 5DQJB 3GMQA 3VA6A 1HN1A 4WWKD 3V4PH 3VXOA 5HYSB 5K59F 4HKBA 2ADIA 3QXVA 3IDMB 2FWOB 1RURH 4ERSH 1A6WL 5EUOA 5E1AB 4HQQH 4XWGL 4KC3B 3FQUA 5C09B 4CN6A 1X5FA 3U9UA 5EZJB 1CDUA 2YBRA 5MENE 1CYGA 5IOPA 3C60D 4WGVB 5C9KA 3TH2T 1A2YA 4HIJB 4S2SA 4F7MB 3BP6A 2L7JA 5IVOA 5DVOA 5EOTA 5IW3A 4F7TA 2X1QA 3P4OB 5K9JL 3WD5H 1A6AB 4PJIF 2WV3A 3W2DL 1AI1L 1LK2B 5LCVL 1FORH 4P59H 4GAGH 4HUUB 2EE6A 1FNFA 3ARFB 3CFCH 1XZ0B 4LASL 4U1IB 1SEQH 5L88L 1WZLA 1EGJH 4RMRA 4PB0L 1VEMA 4PJ9B 1UM6H 2A6DA 2YMXL 4P2OB 1EV2E 2CR3A 1KB5L 1D9KD 2XACC 5IHUL 1F4WH 4MJ6B 4JRXA 4QYOB 2X1XR 4XGZB 5FYKD 3U48A 4OLEA 1AY1L 2F5BH 3OGOE 5INCB 1XIWB 1D5MB 4NZRL 4OGYH 5IQ9B 2VZTA 2DJ4A 1OGAD 1OTTD 5DQDH 3KPNA 4PLNC 4K8RL 1IKFL 3DI3B 1IC7H 1U8QB 5DC0A 4MD4A 5GIRA 5T1KA 2R56H 2M1KA 2NY2D 1JNHA 3EYSL 3GGWA 4WFGE 4EDWL 4DN4L 1TTUA 4FG6C 5CP3A 1KCLA 3O6FC 4KTEH 3PL6C 3PDOB 3BZ4A 3TZVC 1NCTA 5TH2B 3VXUE 3T8XB 3UEZA 3OAUL 5ID1A 2BERA 1DLFH 5KTEH 3AROA 2EDDA 2H1PL 4ZUUB 4JFZH 1TNMA 4Y8DC 3INUL 3QNYA 1MFNA 1ZVYA 3DUSA 5F1NB 1QYGH 2VDOL 4JHBA 3DWTA 3BHBA 1FLRL 3VI3E 4R7DA 4AEFA 1VADB 3B5HA 3TVMB 5FHAH 3MA9H 1FZOA 5C0JB 1XCTB 5GSRB 3A6CL 1CF8H 1NBYA 3FRUB 3QRFM 4NP4L 4V1DA 3QA3B 2ADJB 3L3IB 4JRYA 4M61A 2ZNWA 2W0PA 3FO2A 3F6IA 4AIXA 4P2RE 4G6FB 3QIWD 2ATKA 2X4UB 1SEBA 3MV7A 3BUYB 2V2XA 1CLYH 3B43A 5CJ5A 3X3FL 3GSXB 4O2EA 4PJ5E 2D7NA 1CCZA 4M7LH 4H1LH 3ZKMD 1OAUH 5I8EA 4TTDD 4QHLA 3P4MB 1N2RB 5D7SL 2QADC 1OHQA 1B6UA 2AEPH 3AM8C 1KACB 2DN7A 1ZHBB 3MNZB 5FO9B 5KANI 5IM7A 1KEGH 1N6UA 35C8H 3X3GL 4E42B 3OF6D 4JPIA 1DLHA 4CVUA 4Q0XL 4KHTL 3D39D 1A7OH 4NOFA 5DWUL 3MZGB 5BO1H 1B4RA 4X99A 2D4FA 4NBXB 4KTDL 2W91A 1FJ1A 5F9OH 5CEZH 4RMUA 3QQ4A 5E6IB 3W11D 2GCYA 4ELKB 5ILTH 2R15A 3AU1B 15C8H 3DIFA 3SDDC 1EHLL 1R6VA 3BAEH 4ZSOA 1DN0B 2WUBL 4EXPX 4JHAH 1S3KH 4YFEA 3PGCB 3O6FB 3PL6B 2Y4SA 4M1DL 4HKZB 4RWYL 5C0RL 1T1YA 5E9DE 2R1YA 2K7QA 4LVHB 3OKOB 1SVCP 2OM5A 1VGKB 1FZJA 4LCYB 5D5MF 1EEYA 4QF1B 1S7WB 2FGWH 4WNQA 4LSTL 3OKKB 1I1YB 4KMQA 4GRWB 5B8CA 1FVDB 1H3PL 2A1WL 4RZCA 1I7UA 3QEUB 3GUTB 2PF6A 2VR4A 4GG8A 1XF2B 1IGJB 4UU9B 1RIVL 1D5IL 5TE6L 3PNWA 3MV8A 3QHZL 2E7BA 6FABL 5I30H 1HZHL 4I4WA 4L8DA 3EOBB 4JFDD 1JWUA 3MBXL 1CQKA 4JZOA 3OJDA 2DM7A 2QR0A 5H2BB 1CICB 2WINB 5FK9B 4P3CH 4I3RL 4EIGB 3VDCA 2Y06H 1HILA 4WO4C 1NGPH 1WSST 2A6JA 2VAAA 1P53A 5SV3A 3I75B 3Q5OA 4R97B 3RVWC 3SQOH 4FQQB 1XF4B 4PJEF 4PBWD 4JCMA 4JGJA 2QADB 5IEKA 1WJ3A 4Y4HB 4LEXL 4ZO9A 1FL6B 3Q48A 5GRUH 5F6IC 4QRPB 1RZJH 3CFBA 2A6KB 5CD5D 4QRRE 4KJYA 4EIZC 2R0WL 4K8RD 5DQ9A 1HCFX 3ECBB 1EH9A 1JTTA 1IAIM 3U79A 3EJYD 1MJJA 3K2UH 4HUWB 5C0BA 1KCRL 4GBXC 3M1BA 2E7MA 3T1FB 1BPVA 3GB7B 4KJWD 5HHVL 4QKXB 1DEEB 2Q76A 4UUJB 2OR9L 3C9NA 1JRHH 5BV7L 3S88H 3T2QA 3WS3B 4H8WL 3SDDB 3VE0A 1IAKA 3TBVA 2FJHA 5KANG 4YGVA 3C8DA 4PRHD 3KHOA 3LN4A 2C4XA 4HS3B 4OCXL 4LSSL 5CBAA 5HGDA 1Y6NR 4OFDA 4FQ2L 4L9LC 3LV3B 5DJ0A 2F53B 3CDFA 3ARBD 4J3VA 4U1LA 3TH3T 3MJ9H 5T3ZH 5TE4L 5DLMH 5KZCD 1GHFH 1K8IA 1KJMA 1HNGA 4XTRD 2FR4A 4MD5A 1UXWB 3R1GH 3QI9D 4M5YL 3LEYH 4PB9L 3SDAA 4C56E 4H1LB 1H8OA 3W39B 1WWCA 2DBLL 1IEBA 4AM0A 2HKFH 3GSNL 2CGRL 5EZLB 3X13A 2Q7NA 3CZJA 4PRPD 1J0ZA 5B3JE 3S34H 3DOSA 1J1PL 4FQ1L 3RZWA 1TJHL 25C8H 4YBLB 3D3VA 5BRZD 4IRZL 4NBYB 4ZUTA 3KS0H 4M6NH 5SWSA 4DUXA 1UZ6F 4FP8H 1TVDA 1NDMA 2ZNXA 1QSFD 5T1LD 2FX8H 4OZIF 3QUKB 5JW4N 1K5NB 3GBNL 4MAYB 1C7SA 5DC9B 1E4WH 4POZC 4UQ3A 1OB1A 1NAKH 2CPCA 4RWHA 4QGYA 5D2LA 1WITA 3DURB 4GBXB 1A4KB 3BWAA 5I8CB 1UCBH 4HBCH 1R0AL 1KPUA 1A7QL 1P4BH 2XPGB 5C07B 4PJXA 1N4XL 1PY9A 2XKSA 4NFBA 2VLKD 1QFUH 1JGUH 1ZHNA 4Y2DC 3GMMB 3GI8L 1LP9B 2J4WL 3QSKB 5ALCL 2BNQB 1CK0H 3IB4A 3D0LB 2VLME 5HDOA 4TVPE 4FRWA 4P49A 5F7YC 2L7UA 5DD1H 3SE4C 2FHBA 5C3TA 4O51B 2LQRA 3QUML 1OVZA 1RUML 3EFFA 3LD8B 1JPGB 4GRWE 1U95A 2YK1L 2H9GA 3OKEB 1CT8A 1FFOA 4JM4H 4Y89A 4Z7OF 3MRFB 5DRZB 1S78C 3HCVB 3GJFH 2WBJD 5K9KB 1G9NH 1ONQB 1BD2B 4MVBD 5CINH 3BP5A 4X6CF 1MNUH 2FECI 3HN3A 5MERB 2K1MA 4UZGA 2BP3A 3GJEB 4DOHE 1T1XA 2OTUA 1LNUA 1OF2A 1S7XA 1U8MB 4P2QE 3JWOL 5A43C 3QXDB 4FQLH 2GJZB 1VFMA 5I6XC 4DKEL 3ULVD 4D9LH 1VFAB 2XN9E 3I2CL 4N1EA 3VJ6B 3IGAA 3DVGB 4LVEA 1S5IL 4C59B 1OAKH 1KEML 2F8XC 5IJVB 1KJ2H 3GMNB 1KJ3L 4U1JB 3BEWA 2ZUTA 4XPBL 1NCCL 3O3AB 4J3SA 4MLSA 3C5SB 4UTAL 3DX9B 4WWID 5DI8A 4Z95H 5GSVA 4Z9KB 2XWBB 5ISZA 4JPKL 1B90A 4DEPB 5IEHA 1Z6JT 4AENB 2EZ0C 1ZSDA 2R2EA 3RNQB 5C0NC 1I4FB 2BSTB 3H2WA 3X12B 1MQKL 2OJZH 4M6ML 4TSBH 1QKZL 4Y4KC 5KSBB 2DQTH 2QQKL 2J3SA 3WE6B 5KVFH 5C0CD 4XBGA 4ODVL 3RY6A 3VXSA 2AV1A 4M6OH 3QG6A 2PXYC 2DYPD 2ADGB 2WW8A 4C83A 4MAUL 3EHBD 2EKJA 2AS5M 5GS0H 3DRTB 2NY1B 4J6RL 4YPGB 4ZNEE 1JUFB 2F53E 1XFPA 2WWKO 4ZODA 4R4BA 1JI2A 4P4KB 5F7DA 3X17A 4WFGD 2YUXA 1G9NC 4B41A 1MY7A 4RBPH 4MB4A 1WCBB 2R2HA 4PRIA 3AB0C 1MHEA 2KL6A 3Q2CA 3MV9A 5ACZA 3F8UB 1ZLWK 5J57B 4XMPL 1T2QL 1TPXC 2VSCA 4DK6A 4EUPH 3LPFA 3S3PA 4NCDA 5B38B 3GIVB 2OQJB 2X9YA 4WUKL 3O2DA 1MCHA 3MGOA 1MHPH 1F4XL 2VDNH 3NA9L 4APQD 3S4SB 4JFEA 2ZCHH 5ESAA 4GG6B 1HKFA 5EZOL 3RVXD 3L6FB 3VGAB 1CGWA 3ZDZF 3TJEL 1UWGH 3RWFB 2PYFB 5L8JB 5IQ7H 2GTZA 2VKXA 4MHHI 5KJRL 3SGEI 3S3JA 2C1PB 2JCCE 1DZBA 1LEKA 2AI0L 1BZ9A 3ARTA 4PJ5D 2IANB 1JNLL 2HT4C 1NGWB 1U8LB 3D25A 4OQ1A 1A6TA 4QY8A 5ANME 4A2LA 2X4PA 4NUJA 5FECA 4CMMA 4MA8L 5D7JD 3U0TA 1CE6A 1BEYH 4Y1AB 2VO5A 3ARGB 4KUCF 1ZEAH 5CKAA 4QXGL 1P7QA 4URTB 3MLTB 2RJMA 4PGBB 3EO9H 5EIIA 2LABA 1FRGL 4TOYL 1SY6A 3CGTA 3DNKA 5F9JA 1Q9WA 5IP4A 1I1CA 4PYGA 3K46A 4J3OC 3C5ZC 4ODXA 1NEUA 5F89A 3IKKA 2PXYB 4UMGA 1IGCL 3KLSA 3UJJL 5I18H 1LD9B 1Z0MA 1JZ4A 4CDHA 3V4PL 4P4RA 3N9GH 2IAMB 3GJFB 1FNGB 5F1OB 2EYTA 2I9LA 3MACL 4ERSL 2I07B 2NXZB 3OPZH 3BT2L 2YD8A 4XPFH 5LQBL 2P5WA 5C09D 1QHPA 5JORB 1BD2E 3H0TA 2ZOKB 5HY9A 2JJTC 4L4VA 5GPRA 1LGVA 3VFTA 3VMNA 4BSVA 5GGSA 4WFHE 3VXQA 1NAMB 3QJHB 4TVPL 3SGDH 4MDIB 5C0AE 3L1OL 1RZFH 1OGTA 3VG9C 3UYRH 4K2UL 4OD2B 2UVEA 2ZUUA 4P3DA 4LFHD 3E8UH 5A2LH 1JV5B 4IIQC 3O4LA 4HEME 4X98B 1KJ2B 2XXCB 5F7MC 1ZLVH 4UBDD 2YWZA 1FORL 4IRSC 4P59L 3UYOD 4LKXB 3ARFD 4PJCF 4ZUWB 5KVGH 2XQYG 5HHQA 3MRQA 2BSSA 3NCMA 2OXGA 3OQ3B 3PQYA 3RWIB 1EGJL 3CH1A 4LMQE 2DLHA 1EFXA 4PJ9D 1NFIB 3V6ZA 2NZ9D 1ZGLB 4UOW0 5JA9A 3HUJB 1A5FH 5C0DA 1HXYB 4L8BA 2H2SD 4P2OD 4XVSH 4HUXA 2KZ1B 3D9AH 4PJFF 1GAFH 5D2NB 3JV5A 2IEPA 3EZJB 4HJJH 5DO2C 5IGXH 4ZXBC 3UTTA 3PXHA 2V7NA 3HE7A 1XIWD 3I6GB 1CXIA 3BDBA 1X5YA 1CU4L 1WBXB 1TVBA 5L8LB 2ARWA 2HFGL 5DQDL 4MHHG 2VZOA 1RUQH 1YECH 3P2TA 1IC7L 4BJLA 1RIHH 3C6SA 3TBWA 1NH6A 2Z8RA 2R56L 5E5RB 3UTQB 4M9PA 2XKNA 4CVWA 4G6MH 4KTEL 4M8QB 3RL1A 2IFFH 3DBXA 3STZA 3VFMA 4FQHA 2IGFH 2V2WB 3C87A 4JFOB 4JFZL 3F7VA 3G5XB 1PG7X 5KW9H 2FHCA 3AREA 1LK3H 3VGDA 2VDKH 2J8OA 2V9TA 3BKCH 3TVMD 1JPST 4NJAH 4ETQA 2E6QA 4UILL 5FHAL 4RRPG 2CD0A 5GRVK 5IVZB 1CF8L 1FFPA 1G7HB 4J3UA 2Q20A 1JF6A 3HNTL 5T33H 3VG9B 1D5BB 2E8ZA 3UDWC 5D7LB 1GGIL 1QO3B 4QOKB 4RGOL 3LY6A 12E8L 4G6FD 5ITFA 1FSKB 1YEDA 2BVTA 5CJOH 5D7IA 3SY0B 4F7PA 5MHSE 2DKSA 4G80A 3M07A 4GW4B 4KKNA 5A16B 4IIQB 3F6LA 4I5BA 3ZMRA 3BWUC 3NIGE 3PABB 4M7LL 3RQ3A 1C12B 1KLGB 1N6QH 4OI8A 3T3PF 3BDYH 1FZKA 1OL0A 4HH9A 4XZUA 1TIUA 4PRBA 3BGFB 3I02A 4DZ8B 4LPYA 4KXZI 2KZWA 5ETUB 4NN7C 3JZ7A 4OGXH 3QXAB 3LQZB 5BS0A 3RNKB 2IADB 1TJGH 2ICWJ 3TYFB 3V7MA 4Z76A 3CAFA 3K81A 3UZQA 1S7SA 3O11A 5IT2H 2W07A 4MA1C 5BO1L 2JELH 2GUOA 5C0IA 3HMXA 3RZCC 5CEZL 2EO1A 5E6ID 5JO5A 1NMAH 4H20H 1YEKH 2AK1H 2GT9A 3VXME 1P2CA 5F7WC 1QR1B 3OJ2C 4KUZL 4RRPA 1HK6A 1HEZB 4IRJC 3T0WA 5EU5B 2YD7A 5JLZA 2SEBA 2Y5TB 5BZDB 3D6GA 3G6JA 4FTVA 4HKJB 3BAEL 1OM3L 2M2DA 4FG6D 5F88B 1B0RB 4JM2C 4WJ5B 4JHAL 2P5EA 2R69L 4ETYA 3O6FD 4K9EH 3PL6D 1DUZB 3IFOA 4Y16C 1JPFA 3N85L 4WTXA 1PLGL 2KPNA 2G2RA 3QEGL 4CL7A 2NY5H 1EXUB 2VQ1B 2FGWL 5D6CB 1FVCA 2QV2A 3BFOA 2O5YH 3LEXA 3MRPA 3RTQA 3LKRB 2MCG1 1O7SA 5J1AA 3ULUC 4QNPF 2A9NH 3PWNA 2E6PA 2FO4A 4N0UB 3RPIA 5I30L 3P73B 2ZKHH 3GZKA 4F57H 5D2LF 3PHQA 2JB5L 3QO0A 2CRIA 3CFJA 1CDHA 5HI4C 3VH8B 3CVIL 3SE8L 2C1OA 1CICD 4PJXF 5GHWH 4P3CL 4XNMA 3U7AA 4WW2A 5A1AA 1JYWA 3H9SB 1NGPL 1RUKH 4EI5A 2WIIB 2UY7A 4NO2B 5F1IA 3TGXA 3ARPA 4ALAL 4P9MH 2QADD 1EERB 5BZWB 5BOZG 2RCSH 1MI5A 1U3HA 3P9MA 5GRUL 2V5SA 4LCIL 4QRPD 5HGBA 1OPGL 1DSFL 4LQFL 4ORZC 3GMRA 1VSCA 3CXDH 4I2XB 3N1MC 3BO8B 3REVA 2EDOA 3D69B 3NCJH 4MA1B 1CDBA 3HC3H 4RMTA 3QISA 1N64L 4JO2L 4CNIB 3RZCB 1YQ2A 1KFAH 3MRRB 5E2UL 3ZO0A 1GGCH 4IRJB 5I8KH 2LU4A 5F7EL 5TDNA 4PREB 3FQNB 3SDDD 1HIML 1OLLA 4AMKL 3CH8A 3QFJA 2UZIH 4AG4H 2AK4A 3VXOB 4F7CB 1XMWA 5JQHC 4CW1A 2ADIB 2CIIA 4BK5A 2ARJQ 4XPHH 2BOCA 1P4IH 1KOAA 3T65B 1QLRA 2F53D 2G5BA 2H6PB 1C16A 3QBTB 2ZCKL 2YBRB 1U8KB 4QRTA 2BNRA 1GHFL 4PS4H 1KF9B 3JWDC 3HLAA 2BY3A 4N0FA 1I85C 3G6AA 5M7QA 4Z77A 4IJ3C 1A2YB 4AH2A 2HVJA 1J8HB 2QHRH 3R1GL 2P8LA 1FC1A 4MJ2A 5EOTB 1E4JA 1Y18A 4XI5C 4E9LA 4V2BA 3NGBC 2EEDA 1L9NA 2BRRH 3KDMB 2A77L 3CSYA 2VZSA 3T0AA 5J6HA 3T1WA 25C8L 1I1AB 3RVWD 4X0KB 3RX8A 5D1ZC 5ICZB 4OB5H 3NFNB 1ZT7A 2WWMC 2VYRE 1EAPA 1BQLL 2L0DA 2FX8L 4AYFA 5CEZD 5I75C 4F58L 4R6UA 4MAYD 3RX7A 3IDIA 1F8TH 1UACH 2I24N 3QPQD 4I1NB 4KROC 4C4KT 1M7IA 4GBXD 4LAJH 1QA9A 2HFFA 3MCKB 5E03A 1DE4A 3WJJA 1X5HA 5C07D 1AD0A 4JKPH 2XWJB 3IU3B 5L6YH 2W38A 4NO3B 5IK3B 3BISA 4L4TA 1FFNB 2BNQD 5FUOL 2BOBA 1K4CB 3QWOB 3CMOH 3GNMH 2RB8A 32C2A 5DD1L 1BJ1J 3N1GC 4X4XB 1PDKA 1ORQB 1T4KA 3QNYB 3NBNA 2X4SA 2YKLL 4XH2A 3RDTC 3BHBB 5MEPB 2A73B 4S1DC 1Z9LA 4R7DB 3KJ6H 4NOBA 4QXWA 3WO4C 1Q9KA 1TQBB 1BD2D 1G9NL 4RNRB 1MNUL 5T1MB 3V6FB 4V1DB 2H2PC 5CUSL 5E7BA 4XP1H 3GRWL 3T4AB 4QRSA 5IB2B 3EBAA 5FKPB 4PGDA 3NGBB 3MV7B 1NAML 4L1DA 4ONHA 3CK0H 4TRPH 2CK0H 1PBYA 3AUVA 4DAGL 4O2EB 3QZWB 1AXSA 1DN2A 5I8EB 1DVFC 1SQ2N 2Y72A 5DA0B 2GAZA 4KRPC 3I3EA 2VMFA 3R4DA 1A6VL 5T5NG 1KJ2L 1S7QB 3HRZA 2NLJB 4P57B 2QQLH 5CIPA 5AYUL 3U0WH 3IFLL 1DLHB 2DQGH 4Z95L 4EN3B 2ESVA 5DRXA 3QO1B 5BVPH 3ZZ1A 5A2IH 4KROB 2FLRT 1YYMH 5ADOL 5DTFA 1T5WA 4NN6C 2GTWA 4YIQA 4U0RB 4TSBL 2OTWA 3AAZB 2DQTL 2R0ZH 1CL7L 1A02N 4D0DB 2GCYB 3VFRB 3QDGB 3MJ7A 4NC2B 3ROLB 3FT4B 2BSRB 5ENWB 1KPVA 4RFOL 2CDFA 4OD1L 3O6LL 5FIEA 1LEGA 1RZIA 3OKNA 4P4KD 3BVNA 1NGQL 5TDPA 4MSWB 3V7AG 2R4SH 3ARDC 5F6HI 3B5GA 2ENSA 4IOIB 4M5ZH 3RUGB 1EEYB 3W9DB 3ULUE 3NA4A 1BFTA 1U8NB 2VDQH 4LP4A 1J8HE 1YPZA 3A6BH 5HTSA 2FEEL 3D48R 5A2FA 2CR6A 1BM3H 5C08E 2DMKA 3WUZA 4GG8B 2HJLB 4NSKA 1MHPL 1HI6A 4I4WB 3O45A 5JNYA 2P7TB 1IQDA 2ZUSA 5C8JB 2FX7H 3BZEB 3LH2H 4K7PX 3MNVA 2J8UA 4ELMA 3OJDB 1HSBB 4PFEA 1LO3H 1XH3A 2BY2A 3MROA 3DECA 2WIMA 5KSUA 1ZA3A 3T2NL 5IQ7L 1RUAL 1EVTC 5GGSY 1INDL 1DVFB 2IAND 4LARH 4QEGA 5GS3A 2OX5A 3MRKB 2EC8A 1ITCA 5HVHC 2APWA 1DL7L 1SJHB 4ZFGH 4MZ3A 2BVQA 3FHQA 1CXLA 1FL3B 3JXAA 3KYOA 4KJYB 1BEYL 4JFFB 1ZEAL 1NFDE 4P9HH 1JF1A 1HINH 1SBSL 2EZ0D 4G3YH 1MJJB 1HHGB 5C0ND 4HIEA 5HHOB 3PWUA 1A22B 5E08L 3F7RA 4Y4KD 5FM5O 4YXHL 4U1SA 4HLZG 1U3ZA 5HYIA 5A3IC 1JNJA 3FAWA 2JJSC 2PXYD 3C9NB 5DD5H 3OR6A 3LS4L 1MEXH 5I18L 2UYLA 3GHEL 1NC2B 3DVIA 4QHKI 4Z7QF 4PJHF 4FFWC 4NZDA 2W9DL 1DBBH 2IAMD 5HGDB 4G6KL 3HC0B 2CUIA 2DM3A 2IMMA 3LQAH 3NIFF 2NXZD 3O8XA 1RQ5A 2I26N 3ARDB 3OPZL 4MNGE 4XCNA 1OAQL 4Z7UA 5F6HJ 3R8QA 5JMOC 4Y5XC 1HCVA 1NL0L 4UV4L 4PTUA 1KCVH 5CP7A 3U4EB 1N7MH 4QTHB 5H37H 1K8IB 3EYOA 4KV5F 3QH3A 1RULH 5DYOA 5EU3A 4X6DB 3V4UH 5DUML 1DBJL 4R7NB 4NKMA 3BPOC 1ZLSL 4HIHA 3UYRL 4XC3H 5I1IH 3FQRA 1XR9B 3SDCC 1PKQE 2DQUL 5DJ8A 1MELA 3X13B 4UDTA 1BLNA 3MLYL 5KVEH 1FNSL 1NMBL 4GW5A 5AYQA 4JO1L 1HXMA 1FYTE 1OAXH 1CLZL 1KYOK 4JHWH 2V9QA 5E8PA 3V0VB 2VERN 4ZPVB 3JVGC 3IXTA 5KVGL 3NZ8A 4LDEB 1S9WB 4O02L 1FG2A 5SWSB 2HT4D 4WRLA 1CWVA 5HVHB 4S0TD 2Q6WA 1GOHA 3G5VB 3OB0K 4JY4A 1UENA 2AJVH 5DMJB 1GAFL 1U6AL 1F3DJ 1Q9OB 4NHCL 1EHNA 3FQTA 4FFYH 1AGEB 4UQ3B 1OB1B 1G7PB 2Y07L 3WLWC 4D0BB 4OLXL 3LKQA 1PZUB 1QRNB 5EBLA 4G8FA 3FFCB 4MQXC 4PJ7E 8CGTA 1KPUB 4ENEC 1DR9A 1MFEH 4NCC1 1LO5B 1YECL 2OCFD 4XRCA 3EJJX 2FJFB 4OCRL 4Y2OA 4UTBL 4KMLB 1U8IB 2X4NB 5I74B 3LN9A 4J8RB 2IPUG 5EORH 4X4YA 1MCBA 5FYLH 43CAB 4NZUH 5GRWA 4L8SC 4KDWA 4QHKJ 2IFFL 1N6VA 1XGUA 5HHXH 2Q86A 1X5LA 5JPNA 1NEZB 1AO7B 2XY2A 1IARB 1CT8B 3QQ9C 4NYLB 3ZT5A 3PV7A 1JHLH 2I9TB 2AGJH 3ET9F 5DJZB 4X7SH 1SJVA 3O2WL 4NJAL 3GMLB 4G7VH 1QG3A 5F3HA 2AV7A 1BOYA 3GK8L 5D72L 1MFAH 3MV11 4Y19E 4NT6A 4HULB 4EOWH 1T1XB 2VC2L 5JDSA 1LNUB 2DL2A 5T33L 5D7LD 5CWSB 5DMKA 4QOKD 2EYRB 4NN5C 2CO6B 1S7VA 1FH5L 3SDCB 3ULUL 3ES6B 4D9QD 1KCUH 3ZSSA 2DM4A 4IRSD 3MFFB 3Q3GB 3BW9B 1RHHA 5DVMA 1N6QL 3D85A 5IF0B 1C5CL 4CADA 3PWPB 3BDYL 4RMQA 4WDIB 2A9MH 4WWKA 1AQKL 4PJBB 1ACYH 5ESVB 2QSQA 4K3GA 1OAZH 5E00B 2HJKA 5AUMB 5DJDA 1AXIB 1TJGL 1A7PL 1DBAH 1TTFA 4WCYL 3VGGA 5ISZB 2HFEA 4GXVL 5DO2D 3S36X 1IGFH 1ZSDB 3C60A 1Q72H 1G0YR 4LLQB 2IH3A 4PYHA 3G6DH 2FCBA 3DMMC 1GJIA 1NMAL 1VACA 1YEKL 2QJDA 4H20L 2IMNA 1P6FA 4K55A 4XBGB 1BHGA 3D0VA 3UC0L 4DUVA 3OL2A 1W0YT 3OSKA 1DDHB 4LF3A 2IH1B 5FO7B 4LSDA 4WVRA 4L5FL 5FGCB 1RHFA 3SGKA 2YPLB 4K9EL 1ZLUK 2AXGB 3TN0C 4OLWH 2X44D 4KDTA 3ZSTA 1RJYA 4W4OC 2W9LA 1SMOA 5FA4A 5JW5B 4PY7A 4UIKL 1RMFH 3PF2A 2Z9TA 3ZDYF 2HTLC 4M43L 2FIKB 5IFAH 2YD9A 3V5DA 4UB0L 4KVNH 3IJHB 1D9KA 5F96H 1YN6A 1N8ZA 2H8PB 3RL2A 3DTXB 1KTDB 3BRDA 2VZUA 5JW3H 2OJEB 2ZKHL 4F80A 2EXYC 3JWDL 3KPSE 2VXQL 1OGAA 1Z2KA 3TESA 4JZNA 4JAMB 1ZLUH 3IU4L 4GS7C 1ZOXA 1HHIA 2E8YA 3BKMH 4M7JL 5E8OB 4F3FB 1JWMA 3H9SD 2HA1A 1KXVC 4R2GC 3G9VA 3VD9A 3B3IB 2NX5B 3F7QA 5I0ZA 4P9ML 3TO4C 3X11A 3TCLB 4JRWA 4HH8A 4ZO8A 3S6CA 2FL5B 5FO8B 1T20B 3W82A 5JIKA 4CMMB 1G1YA 4OLZH 1NBZA 3LRSB 3SGEH 1MVFA 1CE6B 1E6OH 5MP6H 2QQNH 1BIIA 1QRNE 4MJ4A 3FFCE 3MJGX 2NY3B 4C54A 2AEWA 3NCJL 3HC3L 5EIIB 4Q9QH 2H26B 3RZCD 3DSFH 3FTGB 3DMMB 3PP3K 1OSZB 2J6EA 1KFAL 5H94B 3EGSB 4PJDE 4IRJD 1GGCL 4LDOB 3QIWA 5LBSH 3HAEB 2UZIL 3KPTA 1PSKH 4P4RB 5JOPD 4H26A 3REWB 1DJSA 1D5ZA 4XPHL 1WC7A 5I1HL 4WI9A 2VXTL 4D9RE 2UWEF 3E6FA 2EYTB 5ABDE 3MXVL 4G8IA 2P5WB 2QL1A 3MLXL 1YEHH 1ETZA 2O5ZH 3SDYH 5C0EA 1MF2H 4WV1B 5KSAB 4NRYA 3VFTB 3VRJA 5HYQA 2IPKA 1OWWA 1Q0XH 3LKOB 5J12C 4XXCA 2QLVB 4PGEA 1B0WA 2NY7H 4YHLL 3ULUD 4P5KB 3D39A 1KTLA 1J8HD 2ZCLL 3TPUA 5EZIH 1U2CA 4MA7H 1OGTB 2CKNA 3BYTA 5T1DL 3SEPA 1B4JH 2EH8H 4H0GA 1F5WA 3QIUC 3WS6C 5HI4D 1ZTXH 3EAKA 4PJAE 2BRRL 1AP2B 5ADPH 5EA0L 1JTPA 4R96B 2DIBA 3GM0A 1YY9D 1VFUA 1H5BB 2C3VA 3SO3B 5JQ6H 2NW3A 4XHQA 1HOCB 3MRQB 1I1AD 4ZAKC 4MCYA 3HI1B 3PQYB 4Z7VB 3VI4E 4DGIL 2NQCA 4XP4H 3VRLE 1EFXB 2PTVA 1NCAH 3IS1X 4YHPB 3AY4A 3H3KA 1KB9K 4HUXB 2YSSA 3GMPB 1H15B 3RA7L 1U93A 5FCUH 1C08A 3WJLA 2CLZA 3VW3H 4LLVB 1X4XA 4I77H 1YPZF 4Z78A 1G7MA 1AKJB 4U6YB 2ID5A 3MLWH 4U31A 5T5NF 3DLQR 4NO5A 3DX8A 3V52H 5KS9A 3IAPA 1MFBH 4G8GB 5BW7C 4JFDA 5L6YL 4YDLC 3PJSA 4N1HB 2Q3AA 5CMAB 2J8UF 4ELMF 5E99L 2WQRA 2E27L 5CSBA 1VFBA 5DEFA 4N0YH 4X6FA 1FVEB 1GOFA 4X7FC 3T0EB 3VFVB 4HGMA 3GNML 1BVLA 3QHTC 4FQHB 3Q1SH 4ZFZA 1KB5A 1T1WA 1HH6A 3IDJB 1YMMB 2I60H 4PJIB 3L7FA 3WDIA 4NKQB 3EOAA 3TYGH 2Q87A 4X8JA 4E41E 1U8HA 3HFMH 4DZBB 5J12B 1RJZA 2XRAH 4OCLC 1FFPB 4X7DC 2M8XA 4X9HA 3U2SB 3NAAL 3SKMA 1CN4A 1GC1H 1KT2B 5CGMA 2H3NB 5FA3A 5C70A 4XI5D 5D7IB 2YN5A 3QIUB 3MV7D 4G80B 2CK0L 4QXUL 2NX5E 2W60B 1DQJB 4L3AA 5DFTA 3WNNA 4OZGE 2EE9A 1T1ZA 1K85A 2ORBL 2PW2B 3EDEA 3BH9B 3SGJA 3V6BR 1BP3B 1CI5A 4I18A 1JI1A 2JF1A 5C6PB 1ES0A 4PRHA 1YDPB 3I02B 5D1ZD 3D2UB 3WSQH 4JLRA 1RK0A 1WTLA 2O5XH 4Y5YA 5MEOA 1G9MC 4PD4K 1GGBH 4RFEA 4G7YL 1Y6MR 3FKUS 3IAQA 3QHFH 3ARBA 4UIMB 3U0WL 2DQGL 4EN3D 5AEAA 2PUQT 4WFFD 2V5TA 4ZO7A 2OZ4L 5EU7C 3SDXF 4CJ1A 2G5RA 4MQTB 4KXZH 4KROD 1DQQB 2P8PA 2FB4L 3VGEA 3Q6GH 1AE6L 2IBGA 1IC4H 1IAOA 3CPLA 3VFNB 4X4MA 3BIAX 2GT9B 2KH2B 1P2CB 2A74B 3QI9A 1T21A 3UROR 2APVA 3QDME 3QDGD 3BZDA 2AKRA 2SEBB 3VXPB 3T0XA 3KLAB 5I2IA 2GHWB 3MUZ1 1I8KA 2G75B 2CIKA 3SKOB 5DZLA 5IWLA 4PR5A 4QRUA 4GKZA 4PRPA 1FPTL 1UWEH 4K3DL 5HDBE 3CU1A 2C26A 1KGCE 1GZPA 1JYNA 3GKWH 3L3OA 2PETA 3IRPX 4OZ4A 4XWOD 4U1MA 4HGKC 5BRZA 2G60L 1EO8H 2IG2H 9CGTA 4ORGA 5KSVB 1CIUA 3B9KB 4F33A 3L3KA 3E0GA 4MB5A 1W0WA 3A6BL 3LDBB 3LEXB 4M48L 4S1DD 3RTQB 4ZS7H 3OV6A 4MJIB 5J1AB 2P47B 5E8DL 2MMXA 5E2WL 2YR3A 3EYVB 5CBEB 3QDAA 3PWNB 3BKJL 3BXNB 2H2PD 3HG1B 1M71B 5B3NA 3WBDA 3IDNA 4Q6IC 3MUGA 3LOWA 4YNYB 4ZO6A 3UYPA 3LH2L 5IVXE 1M4KA 4YC2C 1LVEA 4DVBB 1TJIH 4WFEE 1F02I 4Z7VE 2VLKA 4J1UB 4HS8H 3V8CA 1LE9A 1R3JA 4WW2B 1T03L 1J9CT 4GLRI 1DVFD 1G7IA 2ED9A 5DEZA 2VLRA 4PGJA 2V5YA 1OT1A 5K59E 1NLBH 1U3HB 1RZGB 1OARH 5BJTB 2ICWB 3P4NB 5I71C 4JFFD 2EXWD 5DRWB 4NFDA 4F37F 5GS2H 4HF5L 2WBJA 3FOMB 3H9YA 5I1JH 3PV6B 2HAZA 5HHOD 1ORSB 2IBBA 1IVLA 3KYNB 1HHJB 5FB8A 4JB9L 1MAML 5H35A 1R3IH 5HPOA 3MLSH 4N5EC 2I5YH 4Q2ZB 3H9ZA 3TBYA 2P8MB 3QFJB 1NC2D 4KHXH 3RY5A 5BQ7A 3JV4A 2MHAB 4PJIE 1AHWC 1DBBL 2EDKA 5EIVA 5F97E 1SYVA 5JZ7C 3ARDD 3CUPB 5ICXB 2YXFA 4OTXH 2HKHL 43C9A 1S9YB 2CJUL 4NUGH 3QUZC 3U36B