5K59E

Crystal structure of lukgh from staphylococcus aureus in complex with a neutralising antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
210
Chain Sequence
ELQLQESGPGLVKPSETLSLTCTVSGGSISSGSYYWDWIRQPPGKGLEWIGNIYKSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARERGMHYMDVWGKGTTVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Context matters: The importance of dimerization-induced conformation of the LukGH leukocidin of Staphylococcus aureus for the generation of neutralizing antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus (strain usa300)
molecule tags Immune system
molecule keywords Uncharacterized leukocidin-like protein 2
total genus 39
structure length 210
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k59E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5k59E01
4L29B 2DBLL 2CH8A 3SDCD 4EDWL 5CJXC 4GRWB 4M62H 4NFCA 1J12A 1SHMA 5IG7B 3RWIB 5EZOL 1BGXL 5LQBH 5EBLB 4EN3C 1WGOA 5EO1B 4HEME 3L5WA 1P5VA 3N1QC 3RWIA 4WWKD 1TCRB 5M95B 2M2DA 4HFWB 4HX1A 5C0FA 5FO8B 1T6VN 3QDGA 4K3GA 1DN2A 3GSQB 1N6QH 1NPUA 1MJJB 1T89C 1CL7I 3KYMB 4FQ2L 4YHOL 2ZOKA 2EYTA 3WFHA 2VXQH 5BOZG 1BVLB 1S7XB 3NIGF 1SYSB 1UM6H 3U9PH 3EO0B 2FO4A 4GG6F 5F7UA 4NJAH 1D9KC 5KVGL 4ZTOH 1CE6B 4GW4B 1I3GL 4DGIL 4M7KL 3ILQD 1NBQA 5C0JB 4LL9A 5CEYB 2GT9B 4RSVA 3SE3A 1AHWB 5HI3D 2A6DA 4U6VH 2XPGB 2BNQD 3HC3L 5FOBB 3G6DL 4N1CA 1HH6A 1MCWW 3KPQA 1AQDA 4XPFH 4Y5XA 1LHZA 1P6FA 2F58H 2GCYA 1J1XL 3V6ZA 4NHUA 3HMWH 3O2DL 4Y2DB 1GGCL 4JFDA 3HB3D 4GG8A 2VLLB 4ZTPL 2RHEA 2RIKA 5ALCH 3MRIB 4N0FB 3V2AR 2JCCF 2FGWH 5J6HA 3QIBB 2H1PH 3LRSA 1DBJH 1ZA3A 2VUOA 2VR5A 2PYEA 5EULV 2LFGA 4PFEA 4OV5B 4XP1H 5TE6L 5L8LB 1FZMB 4YHYB 4BKLA 4OV5A 1BREA 1MNUL 5JPMA 1JZ7A 2C1PB 1QBLL 3T0XA 3U7WL 4LPUA 1NJ9B 1T66C 4ZFOB 5B38G 4JN2A 4Y2DA 3L7FB 3T3MF 4EDXA 4OLXH 1IC7L 4LFHG 3P9MA 4OCNC 1N8ZB 4LCWB 4G6KL 5DZLA 1KEML 4R26L 1KACB 2NY6D 4G6FD 4CW1B 4OBSA 4M4PA 1N0LA 4MS8D 4KMTH 1F6AB 4G7VL 1OAQH 1J0HA 2R0KL 2ZUVA 2CKBL 2X4TB 3Q6GH 4LDEB 1MCHA 4MQXC 1RZKH 3UYOD 5ID1B 1U42A 2QSCL 2DKUA 2Q8BH 5CZXD 1CU4H 5I6XC 1RUQL 4P3CL 3OF6A 3WL9A 1U95A 3FJTA 4P57B 1MJJA 5DEZA 4LEOB 3AREB 1XF2B 3PGDB 2D7TL 1RVFL 2WAHA 3O6KH 1HILB 5EPMA 3B4NA 4O51B 4NKDA 1WWBX 4QRUA 3WHE0 3AGVA 2BVQA 2JJSC 3G5YA 1ZHBA 4HUUB 4OUUB 2PO6D 5DUML 3OAUH 4PTTA 1SEQL 2BOBA 5BVJB 4WY7H 1ND0A 2W9EL 4I3RH 2VZ1A 4K23L 1NBVH 4X4XB 1EZVX 3C8DA 3QO1B 2J1KA 5IB1A 1IQWH 2WIIA 1X5KA 2VXUL 4NP4H 4W70A 5HI5D 4JO4L 3BZEB 1FVCA 5CMAA 3PDGA 2BMKA 4EDWH 4BA8A 4AY0A 1Q9WB 4X4YB 2VR9A 4R4ND 5D2NC 5FKAB 3OKMA 4PJCF 3TT3H 1U2CA 5E08H 1WIUA 2VLKB 1T03H 4Q9BA 4C83A 3HNTL 1BQHG 1EEYB 5BXFA 4NQXB 5DJYA 4JG1H 4GMSL 3ARGA 1F4XH 4IHOA 1ZTXL 5DF0A 3B9KA 1KIUA 2RFXA 3F12B 3S88L 3QIWC 5BRZA 1KPUB 2QJDA 5J13C 3BPNB 3MRDB 2BCKB 4JLRB 5E5UB 5A1AA 4Z0BL 3O8XC 4O58L 3NFNB 1U92A 3DX9A 1H9VA 1PSKH 2VN7A 3QIBA 3OJVC 4XPBH 3IU4H 5EN2A 2I9LA 1CGXA 2VLLA 1AC6A 3H0TB 1K8IB 5EU6B 3O2WL 2HTKC 3BZDA 4H1LB 4PB0L 4AK1A 4JE4B 1RK1A 1FCGA 3L3KA 3SKMA 1JMXA 3TJEL 2NW2A 1FYHB 3A6BH 2ARJB 3LEVL 4BELD 4XRCB 4LGRB 1ZVYA 4YEEA 3R8QA 1NUNB 3NPSB 3UTTA 3QUXC 2FEDC 4QHMA 5D1ZD 2X40A 2DQHL 4MLSA 3B3IA 1DVFD 3I3BA 1JUFB 3OZ9L 5DGQA 4LOUC 3IDNA 4Y16C 1E4JA 4HLZG 4F58H 1M7IA 1XIWD 1H8NA 3V0WL 4CVXA 4Y4FB 5JOEA 5I1DB 1QA9A 2LAGB 4X6FB 2NYYD 4JPIB 1G0XA 1P6AB 2DM2A 4QRPD 2XQYK 4JY5H 4YHMH 1TIUA 3CLEL 4RGNE 4WI5A 1FYTB 4MNQA 4FQXD 4LSTH 1M7XA 2HG5A 5F9WB 3GI9H 3GSNB 4ZPTA 2PKDA 1I8LC 4WHTA 5HGAA 2Z92A 3EO9L 4ZS7H 2DQCH 3TZVB 3NABL 5DQDL 2H2SD 1IZKA 1NGZB 5IVXB 5CZKA 1XIWB 2DQUL 5LBSH 4C56D 4IS6B 1OAQL 1PQZA 1TJHH 2G2RB 5IVXA 1OM3L 1NAMH 2BRQA 4F7CA 5GS0H 2ICWI 5IK3B 1K4CB 3LDBC 5D9SB 5GRVK 3WD5L 3DSNA 1KTKE 4OF8A 5IVZB 4G8GD 4Y19B 4TULH 2R2CA 1RHFA 5D93B 3B2VH 3FHQA 4LF3B 5GZND 3VRLE 4G8GE 1MHPH 4OZHF 2FJGA 3QPXL 5DUMH 3WDJA 2R2BA 3VFTB 1AR1C 4PBVC 2NY4D 1LGVA 1T66D 1A2YA 1CTNA 1SM3L 1Z0MA 4FQCH 1CD0A 3MBXL 4K23H 3QEUA 2X1PA 4JRXB 3VE0A 1QVOA 2CIKB 2VH5H 2JCCE 1GZPA 1WUNT 3TBSA 4OLUH 2I60L 2Q76A 4V1DB 1RAMA 4AM0A 4D9QD 2VXUH 3CFDB 4IRSD 4KKCC 4V2BA 4L5FH 1HH9A 4NNXA 1X6NA 1A47A 1RK1B 4NO0A 4QOKB 4ZAKB 5DZOA 3BP4B 5LG1A 3VXUE 4JHAL 4X80H 3GMQB 2QQNH 4YQXL 2X4NA 4PY8I 2ARJQ 4GW1B 3RNQA 3KPRB 3D0LA 3M1BA 5AAWA 4IDJH 1OCWH 2BCKA 2IBGA 2X9YA 3WFEH 1JYXA 4FXGA 5D8JH 5HY9A 5BRZB 3VDAA 5HYJA 4QOKE 3VGAC 3VFVB 2O5ZH 4HZLB 4F3FB 5FYLE 7FABL 4XT1C 2VXQL 1BAFH 2R4RH 1ZHLB 5CHNA 3REVA 3QRGH 3EFFB 2WUCL 3SGDH 4NQXA 3SQOH 3ESUF 5GJTL 1OP5H 2DS4A 4JPWH 3V4VL 4FMKA 1MCSA 4J23A 4ZD3L 3AREC 1QBML 1AD9A 2VR4A 1TITA 3SE4A 2FSEA 5BRZD 2J4WL 2FZ3B 2HT3D 5J6GB 4XXCA 4MWFA 1FJ1B 1EO8L 3LS4H 5KBNC 1B6DA 4XMLH 4XC3L 3QI9C 2DKMA 5MHSE 5JMRA 5EU4B 1NCDH 3UJIL 2BY1A 2BVOA 5D9SA 4DZ8A 4J3XA 1YEHH 4CADB 4L8CA 5GSVB 4X7TB 4BH8B 1DANT 1I8IB 4GG6B 4DGIH 2BFVH 4ZOBA 4DK6A 3LKNB 3QHFL 4YH6A 2UWEA 1JGDA 4QTHB 4K2UH 4ONGH 4QRUB 4F58L 2ZG2A 4X7CC 1KBGL 1QPXA 5JW3H 1EH9A 4GOSA 4H0GA 1DN0B 4EN3B 5HDLA 3O2DH 3KLHD 4NBZB 2IFGA 1K3ZA 2WM0A 1ORSA 4GXUN 2P7TA 5GS1C 4DW2H 1UXWA 1QTYT 3MLWL 5EORH 5I75C 4J3UA 1ZS8B 4U33A 2R0ZH 5FYJE 3I9GL 4JQXC 3QP3A 2YKLH 1H8SA 3K4AA 3MLRH 4IOIB 3RTQA 3ARDA 1BBJB 1CXKA 5BVPL 1U91B 3QO0B 4ZNCD 5TFSL 3V7AE 4XRCA 4Z5RA 1YEDA 3T09A 4XNZB 1S3KH 4EJ1C 3QUYD 3VFPB 1PAMA 4POZD 1OP9A 1VHPA 2XT1B 5DA4A 3QZWA 3VG9C 4MD5B 4LVNB 3QUYC 4M6ML 3WIHL 4Z6AT 2P1YA 4KKBC 2ADFH 3WFDH 4I18C 2DAVA 3LN5A 4P4RB 2DLGA 1MOEA 4KMTL 3QPXH 1Q0XL 4U2ZA 1G7JA 5EBWB 3U1SL 1OSZB 1OSPL 2AXJA 1KJMA 2QSCH 2W9EH 1MFAH 3C6SA 1CFVL 1QSVA 4LLDA 3CPLA 1NCBH 2N7BA 1BWMA 1FO0A 5A2JH 1I4FB 3PDDA 5HDBF 1LO3L 1E4KA 3RGVA 4C4KO 4KJQC 5B4MD 4Q2ZA 1V5JA 1G0YR 1CGWA 5KSBE 4WNQA 5C09D 1PY9A 3CMOL 4TYUA 5C0NC 4Q9RH 4LSPL 4KTDH 4G7YH 2BMKB 1AIFA 2R2HA 1HINL 3LD8C 5IJKC 3RKPA 1D5ZB 2FO1A 4PLOB 2VQUA 3NMEA 3H9YA 1FGNH 2HFTA 5BV7C 3KWWB 1FZKB 2A9NH 2PNDA 3GKWH 1G6RB 4WI8A 4HUVA 3P30L 4LLMA 4XP5L 4UBDD 2AGJL 4HIHA 1EEZA 1J05A 3OJ2C 5IQ9A 5BCAA 4YAQA 2IQAA 5HGDA 1GC1H 4Q6IA 1EO7A 4PJHE 5FECB 4U6HA 4YDVA 4ZOCA 5C2UB 1H15A 3WHXA 2MMXA 2ESVE 2JJUA 4EIGB 5IFAH 3MO1A 5EUOE 2DJ4A 2ZCLH 3TPUA 1T7ZA 3HNTH 2XA8L 3WHXB 2J4WH 2W0FB 4R3SB 1QSFA 5JUEL 3GSVA 4P2RD 3ZTNH 3BSZH 5F9JA 5D7LA 3MRMB 4WFFE 1OLZA 1X3DA 3UJIH 2DQEH 4HCRH 3S4SG 3BQUD 3ZHDA 4I4WB 1FRGL 2IH1A 5E6IC 1Z6JT 3UPCA 1CICB 4MYWB 3FTGA 5JZ7D 3WUWB 5JHDD 4F37F 1B0RA 3I6KA 3IJSA 2M26A 4NWTL 4PJXB 1HCVA 3DX7A 5T1MB 4I0PC 3BRFA 2AJSH 1QYGH 4F9LA 3L3IA 1T22A 1KCVH 3GHBL 3RZWA 5KZCB 3RWFB 2C1OA 4P5TD 5T3XE 4PPTA 1JGVL 3QDMD 5T1KB 4KJWC 4W6YB 3GMRB 3KPOA 3HC0A 4WI4A 2EDDA 5DVOA 1H5BA 3SGJA 4UIMA 2LVEA 1UJTA 3HE7B 4NNPL 4LCUB 2D9QB 4YJZL 1S7UA 3HKFA 4L1DA 3MRLA 5CJOL 5LCVH 1JWMB 4YXHL 2VIRB 2V5MA 4XNQA 5BVPH 2EEAA 5GRUL 2BSSA 3CSYA 4O5LL 3CH1B 2B4CH 4N1HB 4FQJL 4LU5H 2D03L 1MLBA 1KYOK 3GJFB 4NM4H 3QQ3B 1ZLSL 3GDBA 3TNMA 4FNLL 2GK0A 4P2QD 4NSKB 1JN6A 3G6AB 1JGLH 4AQOA 4DKFL 3PGCB 3ARPA 4L3CA 4UB0H 4JFPA 4M00A 3X14A 2ATKA 1KN4L 4KK9D 3NZHH 4EI6B 3BZ4B 3WJJC 1MIML 3STZA 4HZAA 3SDDC 3UMTA 4JKLA 2J6EA 5T1DL 4RMSA 5F96H 1Q0XH 3FTGB 5DSCB 5L9DL 3UBXA 2V9RA 1EXUA 3JV4A 1NAML 2FO4B 5E0QA 3QULA 4BZ1H 4UMGA 4L4TA 4XHJD 5D70L 3QQNA 3HPJB 4C55A 5E4EB 2VLJB 1FSKC 5C0BE 2N1KA 4OLUL 5D7KE 4XVSL 4GMTL 4HFWA 1T04A 3O11A 4R3SA 2Y5TA 4I5BB 4NRYA 3MJ8B 3DXAE 3QT2A 4GS7B 3V8OA 2XTJB 1Z3GH 4YAQB 3KXFE 2BSTB 2P8PB 2NTFB 4PREA 2H9GA 5GGQL 1Z9OA 4ORGB 4POZC 2JELH 1KLUA 1B4RA 2PTUA 1AKJD 1ZLVK 1A4KA 1OW0C 3KXFD 1N5YH 2W0LA 5HYSB 1KELL 1UCTA 4ONFH 4G3YL 3BH8A 3QDJE 1PKQA 3FB6B 1G7MB 3FB8A 4PGEA 5DUPH 1IGYB 4KDTA 3NCYP 1B90A 4WU7A 4X5WA 1WTGT 3OBAA 1J8HD 4G8GA 3ULUD 5IEHA 2A6IA 3C6LA 1T5WA 4ZO8A 5GJTH 2D31B 5E6ZA 2XRAH 3AY4A 4Y8DC 4K9EH 1EFQA 3L3GB 1X5JA 4LVEA 3QXDA 1JGUL 3G08A 5GGTA 3ULUF 5HJ3B 3QNXB 5IROA 2NXZC 1EHNA 2AJXH 4NC1E 1QPPA 1AD0A 1BOGB 3PIQA 2BNQA 1UCBL 3OGCA 1UVQA 3QCTH 3EZJB 2VXSH 4X9FA 4L3EB 1FG9C 5CUSH 1CR9H 1HKLL 5E1AB 4JFHD 1E4XI 1U3HA 4NUGH 5I1IL 2IBZX 1ZT4B 2IADB 1QEWA 1JVKA 3EJZC 4P4RA 1BFTA 3VH8A 2A83A 3QUXD 2O26U 2Z8WC 1AE6H 4HDIA 2CDFB 3OX8B 4WUUA 4F33A 1FSKB 1IC5L 5ANME 3TVMD 3BP6A 4Y5YB 4GH7B 4PLJD 3ULVL 5DC9B 4QOKA 3UJTH 2F53A 3VXRD 1KNOB 2IAMA 4XC3H 1EK3A 1JGVH 3B9AA 3OKOA 1EDQA 1UZ6F 4K94C 1JNNH 1I8KA 4ELMF 3TCLB 1SJHB 4YFLF 3U6RB 5ILTH 3QUXA 4NZTH 2BNRA 2GKIA 5C3LD 1A3LL 2NX5A 3MRPA 3G5ZA 5F8RC 1IARB 3PQYA 1VFBB 4M6OL 4NPYA 5LXGH 3T8XB 4X5XB 3GK8H 5FYJU 2XFXB 1LVEA 1Y6KR 4IRZH 2UY6A 4KKLD 3QWRD 4HGMA 1Y18B 2X05A 3S34L 2FHCA 2J8UF 4JKWA 5I1HL 5D4QA 2J3SA 1NDMB 1T1ZA 2NPLX 4X6BA 5FGBC 3NCJH 5ANMA 4R7NB 4I9WD 5EUOA 1HI6A 1PJ9A 4DZBA 4DK3A 2BDNH 3V52L 2H45A 2Z35A 3OPZH 5IMLA 2AK1H 3EYSH 1NFIB 3ARGC 5I15H 4WTWA 3DTXA 3ZDZF 5JQ6L 2ID5A 1J7VR 1B3JA 4MAYB 3IXAA 1G9NH 4MXVE 3D2UA 3D69A 2AXGB 4YBLB 5FHBL 5BJTA 1RJYB 4HWUA 4PLKD 4W6XB 1NDMA 5D2NA 4JDTH 4GMTH 1KCRL 1RZ8B 1YMHB 1YEGL 4YXLL 4FG6D 3NA9L 3T2OA 4K3DL 2QADD 4PJGE 5GPRA 2NY7L 4X8XA 4HWNA 4WVRA 4WFHD 4FZEL 1EFXB 3TN0D 4LLQA 4OD1H 5KG9B 1J10A 1IL1B 5CINL 2FD6H 4WJ5A 2OL3H 4QHMB 4LEXL 4TTDC 2R1YA 2VITB 3MCKA 2VZ3A 1FZJA 3QG6A 2HLAB 5GIRA 2AW2A 5F72S 3ALXA 1HXYB 4F2MA 32C2B 1T1YA 2PCPA 4ODSL 2VC2L 5CD3B 5C0EB 3TN0B 5H2BB 3WMSA 4MA7H 4LLWA 2NY2D 3C9NA 4Y8AA 4R2GB 1FPTH 4MJIB 5C0EA 3PUCA 2IH3A 5DTFB 5J8OA 4WU5B 3MA7A 2J88H 2WLZA 5I71B 2WBJC 3V0VA 1NGXA 1AGDA 5JUEH 1HYSC 1LO2H 1U3HB 5I8KH 3WXVH 4WHDA 1I1AA 1SJVA 3HZYA 5D72L 1FLRH 4MJ4A 3LOWA 3CFBB 4NBYB 3BGMA 2NY1B 4PRDA 5JXAL 4OF5A 4M7KH 5HJ3A 4MA1B 1MQ8A 2QEJA 3HZKA 1JFQL 1I7RB 1IGIL 2AJVL 1U3HD 4N0CC 1Q9LA 1OAKL 2F15A 4PJBA 4Y19A 5F7FA 4Z7UB 2XOTA 3GHBH 1QQDB 2CRMA 5C0CB 3HFML 3GMPA 5DHYA 1QP1A 1ZKAA 2UYLB 5FYJL 1FIGL 1UZ8B 3B5GA 2BOCB 2R8SH 4JQIL 5DEFA 3VMNA 1CT8A 3AUVA 3EOTL 4MAYA 1MCPH 1JNLH 5J06A 1ZGLB 5DD3H 1YA5A 3O8XD 5FGSA 1F6LL 3P0VL 4LCIH 3PHQA 3V5HB 2Z8SA 2F5AL 4S10A 5TE6H 3WN5C 3FT3A 4FQLL 1ZT1B 1KIQB 1QACA 5BMFH 4U0RC 4TVPH 3QEQE 1EGJH 3MNWA 1T2XA 1CDYA 3ORJA 2P5EA 2QL1A 3NCFB 4JFFB 5MEOB 4Y4HB 4N0YL 5CJ8A 3IDIA 1MCLA 1U8MA 2Q6WB 1X5XA 3LH2H 1LO0L 4HKXB 3LPFA 4HPYL 3L5JA 1EV2E 4B41A 4KUCD 3GMMA 4G6KH 4PRHD 4DKFH 1C08A 5DA0B 5D6CB 4R90L 4GXVH 3MRKA 5FYKH 3LEYL 4PBWD 4X5XA 5C0BB 5CJOH 2R69H 2F74A 2DQGH 5GS3A 4Q0XL 4K7PH 1H3VA 1X5AA 4MNGB 1BPVA 4O5LH 4WWID 1ETZA 2Z31D 3BIBX 3BZ4A 4Y19E 4FQJH 4HAGA 3V6FB 4LSUL 4ACPA 5HGHA 5IBLD 5AWNL 3SKMB 4GO6B 4WWKB 5DJ8B 1ORQB 4PJAF 3MROA 1U8LB 3ZDYF 5CJXA 5ESVB 1BD2B 5KSUB 4OIIL 1RZGA 3K81A 3QUMH 1UWEL 2J6EH 1SJXA 3ARVA 3BDYH 4XWOC 4N68A 5J3HC 4APQA 5T1DH 2M1KA 4TTGA 5L2KD 1L7IH 3GSWB 1DQDL 3C5ZC 3O6MH 4MD4B 2QV2A 4XP6L 5CIPA 2C9AA 4JM4H 4HPOL 3ESVF 1ZEAL 4L9LA 4G80B 4DTGL 2ZSWA 4PYHA 3FL7A 5CIPH 3L3OB 3R4DA 2F53E 1BD2A 4PUBH 3CXHK 5ESVA 4EXKA 4YHLH 1KCUH 2JKXA 5DK3A 1N6UA 2JIXB 3BPCA 4MD0A 1GGYA 3N85H 5C07E 5IFJA 2APTA 1D5IL 2GT9A 3AB0B 4Q7DA 3RU8L 4ZYKB 3MOBH 4DFIA 4ZSOB 4ELMA 1J1PH 2YD5A 4WU7B 3WIIH 4IOFC 1IJ9A 5C0BA 3BH8B 5TE7H 1R5IA 4PJ5A 3ZKSD 1SYSA 4XP4L 4ISVA 3O2DA 5A2FA 5E9DA 5H37H 1A7QH 4M43H 2V2XB 2JIXD 4G5ZH 4MSWA 3T0WA 5A40E 4JFYA 2GTWB 3HPLA 1AR1D 2FLRT 5FYKD 4CKVX 2FYYB 3CU7A 4OUUA 4RA3A 1G1YA 2E7BA 4U1LA 4OCWL 4OF6A 5D7IB 1ZK9A 2A74B 3WFHB 5E8DH 3SOBH 2CSPA 1YUHB 3SDXA 1I1YA 3U9UA 4PJAE 2IQAB 4QRRE 1IFHH 1NLBH 4GT7A 3RWEB 3KPPA 2X4SA 3A67H 2ZJSL 4IIQB 5D5ME 4MVBD 5H35B 4ODTL 1KENL 4JM2B 4PJ7A 1WQVT 2OMNA 4HW6A 1ZLUH 3UBXB 3QR2A 2NXYC 1M7DB 3BKMH 3MRHB 4OD3H 2BHZA 2OJEA 3ARED 2YHGA 3GSOB 3DBXA 3MUY1 5BMFL 1D7FA 2BHUA 5E2JA 4NN6B 1JZ8A 1HHKA 2AP2A 1EGJL 5FO7A 4NKMB 4MJID 4XH2B 5AZEH 3SE4C 4JM2D 4Z7NE 4CRPA 5HDQL 3GB7B 3HS0A 4N8VA 1K4DB 3NTCH 3UO1H 1B4JL 3RVUD 5I9QC 2VL4A 1C7TA 3QHZH 4EN3D 2ZNXA 2X44D 2DMCA 5JZ7C 4PG9B 2DQCL 3RL2A 3IF1A 2DD8L 4Z7WA 1OARH 4HHAA 5DMIH 2HFFA 5JTWA 3S3JA 4Q0XH 1J0JA 1TJHL 4WU5A 5LQBL 4Q9QH 1RSFA 2VDKL 2EXYC 2EDTA 1QSFE 3PV6A 3MJ7B 1T5XB 1KJVB 3QCVL 4M1DL 4UU9B 5F1KC 3RX7A 2V9TA 3QEGH 5E95B 3O3AB 3RWFA 4LKCB 1KB9K 3O9WC 2Z91A 4KVCL 4G8IB 3MACL 4X7SL 4M5ZL 5LWYH 1FG2A 5E4IA 2D3VA 5HHXH 5IF0B 1JBJA 3ZSSA 1CE6A 3QIWD 3C5JB 4MJ6A 1F11A 2B0SL 4LEXH 3U0TB 4H25B 5BS0B 2V5RA 2LE9A 1IBGH 1X4XA 1FL5B 4H0HB 3IGAB 1O0VA 4RAUA 3B9KD 1IC4H 2WSKA 1JHLL 5JO5B 4PJ5D 1WCBA 1RJYA 1NUFA 3L9RA 2XWBB 5GS0C 2QR0B 3QIUA 5EFIA 4ERSL 2JB6B 2Y7QB 2XWJB 3PL6C 5DXWA 3WUWG 1C5BH 3IJHA 3ARBC 4XTRC 3U83A 1A1NB 4PGJA 3IYLW 2PXYD 3TWCL 1LO2L 2NY3B 12E8H 4JAMB 1OWRM 1UZ8A 3AXLA 3ZO0A 2I9TA 3NH7H 3CC5B 3MXWH 2Y1VA 1RMFL 2YMXL 1NEZG 4PJFE 5JXAH 3SE8H 4RFNB 3MV7A 2R23A 3T0BA 4UNTA 3U2SB 1AXSB 3DUUB 1PYWA 2PYFA 1MSPA 4D2NA 4QXUL 2PO6A 4WI3A 5DMGC 2OR9H 4QRPA 3KLAB 3Q5OA 2Z4QB 3EFFA 2YRZA 2FWOB 4LSDA 1BVKA 4RAVB 5ID0B 5EBMA 4F8TA 3E6FB 4LPYA 5J9PB 1A9BB 3FO0L 2R8SL 1FLRL 1YNTA 3GSXA 5GS2H 3KLSA 5F1OB 3MYZA 4M48L 1V3MA 5FUZL 4KMQA 1E27B 5AEAA 3THML 3GRWA 3PHOA 1W72H 4KROB 4U1MB 2VTFA 1QFPA 2BC4A 1UM5H 3DYOA 2B2XL 1JFQH 1WITA 4MA8L 3UTZB 3UYRL 4HDIB 1C1EH 1GPOH 2XACC 4HF5H 3PNWB 4NQCE 4LLYB 5DD5L 5J1AB 1YPZE 4I3RL 4XCNA 3RUGE 3WSQL 2Q3ZA 4KRNA 3QIBC 3VI3F 4RDQF 5HD8D 5L6YL 2DM4A 1U58B 4DFHA 1LO0H 2Q76B 3MODL 4LRIA 4NO5B 4EUPH 1PKQE 1XZ0A 4DW2L 4Y0GA 1O5DT 5FUOH 4I77H 3IRPX 1UA6L 1KPRB 3W9DB 4KY1L 4APQD 1AKJA 4ESKA 3OXRB 5J1TC 1CFNB 3MUGA 1H3PH 1LDPL 3GMLA 1UG9A 5LKNA 2X10A 2IFFH 2P7TB 4O9HL 3MRBA 4HKXA 1WBZA 2EE9A 5CGYD 3QHTC 4X83A 3TNNB 5IEHB 1W72A 3QEHA 4WFGE 1EJOH 3IKCA 5CD5C 4JFDD 4I2XB 4LSQL 3GMOB 3E3QC 1X5GA 2DMKA 5E5MA 1HHIA 3MV9B 3S36H 4WW2A 5I16A 5F7DB 2W0KA 2H9GB 5LWYL 1DVFA 5IMLB 5DJAA 1U2HA 2GI7A 1HI6B 2Y7QA 4ZFGL 2OS7A 2VSDA 1UXSA 4HSQA 1T7YA 2D7OA 4WUKH 1IBGL 3MV9E 1G6RH 1T04B 1A1OB 4U7MA 1RUAH 4GRWH 4NQCD 4QKXB 1WBZB 4RRPA 4E5XB 2BY2A 1A6TA 3V4UL 1I7RA 4MQXD 4FP8H 4PLJC 3Q6FA 1DBJL 4XI5D 3IFNH 1OTTC 1QLFA 4JRXE 4GKSA 4LPVA 2WQ8A 3HE7C 5E4EC 4UOJA 3HE6B 2ED8A 3RVXD 3KPSB 4NN5B 2FR4A 1YN7B 4F3FA 2UY7A 4WGWB 5EU3A 4JREB 1YC8A 3VXOA 1WK0A 5FGCE 4OLXL 4NSKA 1T1XA 3ULVC 2F53B 2WBWB 3GI9L 1WSST 3MXWL 4OSUH 3UZEA 1LNUA 3DRTA 2I9LB 4D9LL 1A7PL 5H2BA 4Y2DC 3OL2A 4ZO7A 1FFNB 1C16A 4L8BB 5E6IB 3EOAB 3VFGH 3WE6A 4X5LA 3TJHD 5F3BA 5TE7L 4KI5D 3TBYA 2YR3A 3S8WA 3QIWB 3MGOB 2RFXB 4KJPC 1VDGA 4RFEB 4MX7A 3X12A 5IMKB 3S9DB 5ERWA 3RWGA 4I0PB 1KENH 3VI4E 3DNKA 5DJDA 2O61A 4K9EC 2NQCA 3CFJB 3KVQA 4HIEB 1OD9A 5EU5A 1MELA 1U8PB 4S1DC 4UV7L 2E9BA 2DLHA 3H9SA 1UACL 4PGCB 3WS3B 1NC2D 1G7QB 3LCYA 4UTBH 4DAGH 3ARWA 1QYGL 2HFEA 2X4OA 4I48B 2OJEB 5GGTH 3JWOH 4P4KB 3SE3C 2UZYB 1A14H 2DWEA 4OZGA 4QHKI 4JKPH 5HYSA 1AY1H 1TNMA 3P73B 5ITBL 4S0TD 2VZVA 4XBGA 1LE9A 4NQDD 1TFHA 1ZA6A 1AGEB 4FFWD 4IRSC 4KKCD 3W39A 2F54D 1YDPA 5GRUH 1H3UA 2EDOA 3NIFF 1BBDL 2CR3A 4PJ7E 4M1GL 2R0LL 5I74C 2OSLA 1D5XA 1DP0A 1N26A 1JWUB 2C26A 5L88H 3FQXA 3QULB 3F7YB 3VWKC 5EDXA 2EICA 2XFXA 5E8OB 1CLCA 2V6HA 2VDNH 1OARL 4X8JB 3QI9D 4XNYL 2CUMA 4F7EA 1SBBA 4LSSL 3D18A 4G8IA 1MHEA 5CKAA 4OCXH 4I9WE 1ONQA 2KL6A 1BX2A 1JHTB 5EOTA 3ES6A 5TDPB 1KJ3H 2IANA 3IDYB 5A3IC 4WTZG 5T5NG 5B8CC 3RGVB 1I4FA 1IC4L 1TVDA 4NC2B 4BFIA 3G6JE 1QSZA 1KIRB 4J3OC 4NZRL 5TDNB 1GAFL 1WT5C 1JK8A 5MEQB 4MLIA 2VIRA 4HUNB 1FZMA 1V7NH 3GSWA 3U46B 1MCEA 1G7IA 2DMBA 3BEWB 2IC2A 2P5EE 4S2SA 3LS5L 5JDSA 5BZWB 2JELL 1RURL 3LKSB 3NAAL 4J3TA 1JTPA 3J7HA 4HBCH 1X6LA 1WWCA 4KMLB 3RAJL 4GG8B 3GMRA 5I1KH 3CX5K 1MJUL 1JHLH 4OGXH 2QTEA 4WWKA 4HH8A 5TGBA 4U1IA 3GJEB 1BX2B 4LDLB 2IEPA 2AAVA 1YEDB 1CXHA 5JXEA 4G6JH 4AEEA 3W5MA 4KI5E 4D3CH 4BUHA 1L0XA 3DIFB 3GEWB 3MLUL 5I74B 1LP9F 4NCC2 1IEAB 4P2CG 2DQFB 4PBXA 4AIOA 1ZGLP 2W92A 4FQ1L 1ZS8A 2BZDA 5C0GA 2MCPL 4JM2A 4PJ7B 4Y1AD 5DRNB 3IFPB 1NC4A 4A6YH 3NOIA 3GRWL 1EERB 1ACYL 3RWEA 2NTFA 2H41A 1NBYB 5FV2A 4ELKB 3I02B 2MJWA 3BN3B 4Y5VB 3SDAC 4HUUA 1IAOA 1UKQA 3REWB 1MAMH 3X3FL 3VFMA 3VD3A 1MJ7H 2RR3A 2YRPA 4PJ9A 3B2VL 1KJ2A 4PB9H 5FM8A 4L3AA 2OK0L 5EOCH 3K46A 1AGEA 1VACA 4OAWA 3HA0A 5T1KD 4IEFB 1J8HE 3ULUE 1MI5B 3PQYD 4HAFA 2YD2A 1U95B 3JTTA 4KRPB 5F7NC 3HE7D 4L8CB 1AGCA 4CADA 2ERJB 3WS6A 4NOFA 3UTTE 1NAMB 1CG9A 1K8DA 2P5WB 4WEMB 4LBEB 2D7PA 5KN5B 4EKXA 2ITCB 2XWTB 2NY2B 4OGYL 4FQXC 4P4KA 3MOQA 4GKNB 1M6OB 2EIZB 3GNML 4X99B 5T3ZH 4PJBB 1CLYH 2ATKB 4JB9L 1K2DA 1O7VA 2AXFA 3LKRA 2X9WA 3MOAL 3BGFC 3VXMB 4KQ3L 5TQ2L 5F7HA 5GS1B 1MVUA 1YNLL 2XKUA 3K74B 2BY3A 3WFEL 3M07A 3SDYH 1U8OA 5L88L 3HNVL 4ODBD 2C1PA 3KXFB 5I73B 5JDSB 5HYJB 3BE1L 4H8WH 2BRRH 1BJ1H 5CIPB 1OSZA 2F5BH 3EDEA 2Y6SC 3S36L 1DJSA 1F02I 2FATL 4GW5B 3ZYOA 2EYRA 3V9FA 2AJYH 5AZ2L 1HWHB 3QH3B 5IMMA 2Y06L 5FYLD 3QWOB 2O93L 4N0FA 4L4JA 1MCDA 3LS4L 2LU7A 5CLWA 2I07B 3W2DL 4D0DB 2DQEL 4HCRL 1A6VH 3TH3T 1UM6L 3TBSB 1V3JA 2R4SH 1FFPA 3HN3A 3ALPA 3ZT5A 4F7EB 1WAAE 1PGRB 4D0BA 5H94B 1CICA 4KJWD 3SDCB 5EU6D 2HYMA 1X4YA 2ADJA 1FDLL 3LEXB 4U7SA 5DJ6B 4UNVA 3WLBA 3FQRB 3QCUL 3SBWC 4IOFD 5EO0A 1FNSH 3SEPA 4C56A 4IRJD 2VZOA 3FO1A 5CILH 1TPXC 1OTSC 5T3XD 3W9EA 1ZHNB 5C2BH 3D2UB 1E4XL 1RULH 2IWGA 1MLCA 4F7CB 2MOVA 1YY8A 1KIPA 4HIHB 4A6YA 2BJML 4JM2F 2AEQL 1QR1B 1B0WA 3X13A 4G9DA 3MV9A 3VFWB 4HUVB 3FOLB 1DQLL 5I73C 5TFSH 3L3JB 4R7NA 5IWLC 2Q7NA 1RHHB 5BV7H 5CWSB 5HI4D 1EJ6A 1A3QA 1C8PA 2GJZA 4W4OC 5EBGA 4WEUD 5E70A 4MCZA 3D85A 1JRHH 1PZ5B 2FZ3A 2IPKB 3MRBB 2I25N 2EE3A 2YA2A 4P23C 4CU8A 3OXRA 5HHOB 2NXZD 5GRZA 1NANH 3OSKA 4OGAD 3MCLH 4DGYH 5E2TL 1AQKH 4PD4J 1OSPH 3JWOL 2O61B 5J7CC 1JNHA 3BDXA 5FYJH 5GISH 3K4ZA 2BNRB 1IKFL 4YR6B 1YJDL 4O2CB 3GUTA 2APBA 2P47B 1VEPA 2GUOA 3IDGA 3TBYB 2FB4H 2G9HA 3FMGL 3L1OL 1AGDB 1E28A 4L8SC 1CF8H 3CCHA 3ZYIA 4M8QA 1N0XH 2QSVA 2Z8VC 3DURA 4KK9C 4DAGL 2I5YH 3ARYA 1J1OH 1R3LA 1XF4B 4BQ6A 5E56A 3NFNA 1FO0L 2OZ4H 3JVGC 5GGTL 2J8UB 1P4BL 1YNLH 4F2MB 5K33A 5GXBB 1FFRA 3RWJA 1J11A 3NPSC 2E9WA 5GSRB 1I9JH 3RNKB 2FIKA 5CGYC 3IDGB 1N5YL 1U91A 5IW3A 3O41B 2F8OA 5DD1H 1MY7A 2H32B 3QFDA 4M8VA 1S9XA 4IOIA 4KK8C 5CGTA 5BW7A 1IRAY 5DYOB 3H3KA 1G9ML 3KPLB 1CS6A 4I0KA 5HHMB 3MV7E 3WNLA 4PRIE 1XF1A 3VXMA 1KTLA 4J12A 3ULUC 2ICEB 3LV3B 4XPBL 3VI3E 2D31A 1DQJB 4UQ2B 1KFAL 4ZFOL 2XI9A 1IILE 2A6JA 1A7NL 3L3DA 3W2DH 1NCCH 1LDSA 5C6TH 2D0FA 3DETC 4ZMAT 1K8DB 1HKLH 2CUHA 3QDMA 3U9PL 5I1IH 4QTHA 5LGKA 3GSUB 4RGNC 3UTSA 4RGOL 1BIIA 1SVCP 1A1NA 2DQHH 3OKDB 5I9QB 1N5AA 3AFLA 3ABZA 3LKOA 2BOBB 5L7XH 1IGJB 1NCUA 1ZVHA 2FLBT 3OZ9H 3CLFL 2OI9B 1MLCB 3I84A 5EUOB 3MRRA 3LY6A 1S7RA 3HC3H 2YUWA 1FIEA 4PB0H 3IAQA 3P9WB 5J12C 5EU4A 4HMDA 3PWNB 2A6JB 3O11B 1XGUB 4KK5D 4U1HB 4ODVL 3VWJD 3QEQA 5I1DA 1QFUL 4HBQA 3GZKA 1R3HA 3FQRA 3C5JA 3VGHA 3ARFB 2W9LA 3F58L 5C08D 1I7TA 4OLYH 5DYOA 3T0ED 1MNUH 3U36A 2AEQH 1YNKH 1MCOH 3DSFH 3KPMA 5GS0L 2NCMA 3I50L 2Q8BL 3UTSE 1UQSA 1CU4L 2Z93B 4X98A 1C12A 3O3DA 4LSTL 4JEGB 2DDQH 4XCNB 2J8UA 4LIQL 1MRCL 4FA8A 3O81A 4Y5YA 3LKQA 2V17L 4Y2OA 3BP6B 1VFAB 1NJ9A 4I3SL 3LKSA 3V52H 4OZIF 3IT8D 5FB8A 4KZEL 2B1AH 5C70A 2Y4SA 2EYRB 4S1DD 2H8PA 4M8QB 3ARDD 4AL8H 4M3KB 2HFFB 4HK3J 1ZT4A 3KYAA 3GHEH 3OMZA 2ZJSH 1A9BA 3N1PC 2WQRA 4YXLH 3L1OH 3MBEA 2ICWA 4L3EE 2FJGB 2R56H 1MFBL 2CLZA 2LTQB 3LKPB 5T3ZL 3WO4C 1EAPB 3ZTJH 1OD7A 5E08L 3OAUL 4EEEA 3MOAH 5GGUB 4FQCL 2AJZA 4JFDE 3PL6B 1NEUA 4IBLT 4K3JL 4D0CB 2E7LC 2AI0H 1MFDH 5KN5A 3WUZA 2WV3A 1GL4B 2PYED 4H1LH 3EJZD 2EEBA 4ETYA 3KPNA 3LQAH 3QHZL 3QFJE 5ENWA 5C0RH 4N0UB 5CZXC 3BE1H 4H8WL 3V79C 4ZFFB 1XIWA 4KRMB 2YSSB 1YUHA 1CLYL 2QR0A 3MO1B 4B5EA 4O51A 4PD4K 2DYPA 4ZUTB 4HLJA 5FO9B 1FYTA 3MRGB 4M1DH 2VDQL 4AT6B 4XGZA 3RZCD 3HPLB 5JW4M 3M45A 3BZFA 3HG1A 4Z7NF 5DGRA 1ED3A 4QCIA 3GIVB 2I27N 4PLNC 1M71A 3DJ9A 5EA0L 4F9PC 2YS4A 3JV4B 4U1KB 1MH5A 3CZFA 5F88A 2R2HB 4RZCB 3DIFA 5F3HB 5IHZA 3FAWA 4XAKD 1MPAH 2AV7A 1ADQH 1F90L 3WNKA 1YZZA 3NZ8A 4JFQA 3GSRA 5JW3L 2DLFH 3MNZA 3PDOB 4Z78A 5HDBE 4P2OB 5INDA 1N8ZA 2GEEA 1FHGA 4LCWA 5DK2B 3TYFA 2ZPKL 4N5EC 2EH8L 2HMID 3VA2C 3WNMA 5CILL 3ARGD 5JHLH 1M05B 2HRPL 3QWOA 3BQUC 3MLWH 3O3EA 4XNQB 4ONHB 3ZE0F 2CGRH 2EDLA 5FIEA 3TO4B 1WZ1L 3MFFB 3O6FB 2P49B 1S9YA 1Y6MR 2JJVA 4JY4A 3LZFL 4LP5A 5A2LH 4IRZL 3TO4A 4NDMB 2KZ1B 2X9XA 5IMOB 4GSDH 4JO3H 4QNPF 5C07D 1QFOA 3BMWA 5SWQB 4KTYA 5I76B 4Y88A 4AENA 4FFVC 5CFHA 4BFEA 3VDBA 3ARZA 3ARXA 4HD9A 4X6CE 4NUJB 1F2QA 5JHDE 2V5TA 2LTQC 3DV6B 3K1KC 4HPYH 4DKEL 4DN4H 3ULUL 3GBLA 1AXTH 5B22A 1YMMB 3ZDXE 2X1OA 3OB0K 4TULL 3FQWA 1PEZA 2FIRT 4KZDH 1M6OA 2EIZA 5CEYA 2YWYA 4U05A 5C0JA 1XGYH 4XP9L 4K7PL 4GBXB 4GW4A 2YN5A 5JW4N 1RZIA 2WIIB 3BVNA 3MUHL 5CP7A 3CDGA 3R1GL 5AWNH 1NCBL 3BIKB 4HH9A 5I66A 4QLRA 3BN9D 4IIQA 1JZ4A 1NGPH 4R2GC 3UDWA 4LVHC 4P48A 4KI5F 5A2IH 3WIHH 2A0LD 2EKJA 3RVWD 4OT1L 4HC1A 4L5FL 2J6EL 3PP3H 1ZLWH 5AAMA 3L5XL 1U8NB 4U4BA 2CLVA 3O2VL 3C5SB 3VXPA 4PJFF 3ZZ1A 4HQQH 3ARFD 3MLYH 4HFUL 5CINH 3SCMC 3ULVD 2VLJD 1OP3H 4XBGB 3T0EB 4N0UA 2AI0L 3RJDA 5D1ZA 5C7XH 2ZWLT 5FUCE 3LQAL 3U30B 1DSFL 4H26B 2BVYA 1I3UA 4AEHH 1NCAH 4U0RB 1IKNC 2CDEA 3BPLB 2ZG3A 4WO4C 2IG2L 4F37K 4P2OC 2YRLA 4QNPE 4X80L 1AD9B 1BGXH 1JL8A 1WZMA 1D5IH 5JW4R 1PKOA 1BQLH 4YZFE 5SWSB 5TGBB 3O6LL 2GSGB 4X7DC 1AKJB 4YDLB 15C8L 5EOCJ 3SHSA 1DCLA 2VE6B 1E4WL 1FGNL 4M9PA 5I8KL 2A9NL 2A1WL 5DMKB 4XP4H 3DUHA 4FQ2H 4YHOH 1NCDL 4HZLA 2ICCA 1Y6NR 3PGFL 5JPMB 4MJIE 1QRNE 1PW3A 2FIKB 8CGTA 3U46A 4LCCB 1NC2B 4XZUA 3R0MA 1UGNA 5KVGH 5C09A 3RWJB 2MPAH 3ZKXB 5DHVH 1T4KB 3EJYC 2X70A 3HLAB 2QKIB 2XA8H 2GW5A 4ZFGH 4BFIB 4K2UL 3G6DH 4K3EH 1HCFX 4ONGL 3TN0A 4ODUA 3F7PC 3BSZL 1U8LA 4G9FB 1FVDB 3TFKC 2ZPKH 1CYGA 2BVTA 2APXA 1H0DA 2VDPH 3MCKB 3FAXA 3MV11 4P5TC 4LMQI 1T7WA 1JNLL 4KGLA 5KSAB 3QEUB 4GRLB 1A7OL 5FYKU 5D2LB 2AEWA 3KYNB 1G7LB 3FFDB 2VLME 1QHOA 5ADPH 5L7XL 5HHQB 3EGSB 4BSVA 2R9HC 4YXHH 2CK0L 2K7PA 3DVIA 3G9VA 3RVVC 5B39G 1A6TB 4HG4J 1DLHB 3KR3H 2NLJB 1S3KL 2PTTB 5FAAA 4PRID 4Y4HA 2WBJB 3QRFM 1UWXK 1FNHA 4JZOB 3AB0C 5JOPE 3C5ZD 1RHHA 1CFTB 5D1XC 1JZ3A 3BYYA 5EBLA 2FX7L 3OF6D 3QI9B 3SCMB 5D7IE 4KZDL 3Q5TA 4YXKH 3TA3C 2DN7A 2WWMD 1PQZB 4GJTB 4C54A 1JPSL 2R69L 1NFIA 3SGKA 3VGFA 1KIPB 3VFGL 3FO2A 1ZGLA 3V6OA 2JJTC 3SJVB 5IJVB 4I2XA 1KYOJ 1RUPH 1SJEB 3LQAC 1JPST 3F6LA 3LB6D 3TJHC 2Y6SD 3C5ZB 2ZZUT 3VWJA 4CVUA 3QEHB 1QQDA 4TVPE 3SCMD 5C0CA 2OQJB 1LO3H 2B39A 2NNAA 2HP4A 4RAUB 3MRCA 1HQ4B 2FL5A 1Y0LA 1AO7E 1IGTB 4PJFA 3KLHC 1W0VB 3OKKB 1CFNA 1LD9B 5EZIH 4CJ1A 2DWDA 2FECL 5H94A 3T8XA 1B2WL 1H3XA 1QRND 3SPVA 3ZKQD 1G7LA 1XMWA 3FFDA 3MXVL 1QO3A 4D9QE 4HLZH 5KW9H 4UIKL 3WHE1 1Q8MA 5KSAA 3RPIA 3V5KA 1XZ0B 3SKNA 4Y5VC 4XAWL 3N1FC 2Z91B 3BO8A 1RD6A 1U58A 1CLZL 5ITBH 1F4YH 1I9RL 4BH7A 1BEYL 1MCKA 5JOFB 3EIFA 1WICA 5CSZA 3J8F7 2CMRL 4AYFA 2GJ6B 2IH3B 5DTFA 4H1LA 4Y5YC 4I0CC 3MC0A 3L95B 4S1QH 2HFGL 3GMQA 1R5WA 4UT9L 4LLWB 4YPJA 4X9GA 5F93C 1FLTX 3KJ4C 2HVKA 3PHOB 2W65B 2APWA 1MFNA 3ULSA 4XCFL 1MUJA 4CDGC 1FZJB 5D6DA 4ZXBD 2OTPA 2OJZL 4HJ0C 5ID0A 2DYPD 1R5VB 4O2EB 1LK3L 1RK0A 2HVJB 1AD0B 3CFCL 1AGFA 4LLQB 2HJFB 4P5KA 3SE8L 1RU9H 4OV6F 4XVTH 5I1LA 1HHKB 2AXFB 4YEFA 2XTJD 1CFQA 1RIHH 3MQIA 4MCZB 1A1OA 3R8BB 2GJJA 4J3SA 5C0ND 1HYRC 3RX8A 3QJFA 2VXSL 4LBEA 2HH0H 1G9EA 4KHXH 4E41A 4HUXB 2GY7B 2VDPL 1NL0L 1PY4A 3C2AH 3T4YA 4Z0XB 3ELAT 5IB4B 4F7MB 4ENED 4QRRB 4OZGE 1W72L 1X7QB 1CVSC 3C5SA 3VXPB 4N9OB 1IC5H 1ZHBB 3WBDA 1KJ2B 3WEXB 1C1EL 4PJ9B 5HGGS 3V0WH 1VGKA 2XWBA 3DGCR 2I26N 3W9EB 3P4MB 3V0AC 2NY5H 5C8JA 1JF6A 3RZCA 1YY9C 1B4JH 4N0UE 5F97E 1R3KB 3SKOA 1DBKL 1FE8L 2B1HL 3BUTA 3HZMB 4ZOEA 5E6ID 4ODWB 1UA6H 1OOAA 2Q86A 3I2CH 5T1LA 4GQPH 5A43C 3MRPB 1MCBA 4ZO6A 1H3PL 5D1QD 4PV9B 3VDCA 3UTTB 1REIA 3QUXB 4YGVB 2F8XC 4OFYA 5E9DE 4FS0A 3ZKXC 4PV8A 1N6VA 2D03H 4FXKA 5IBTL 5D70H 3W0WE 2EE2A 4EUPB 3Q3GA 3PE9A 3TZVC 2FBJL 3TNMB 4PJHA 1OGTB 1HKFA 4NQVB 5J89A 4CN6A 4TRPH 5SWQA 1FNFA 2IPUG 2WLYA 3TBVA 5D1QB 4L9LB 2VAAA 4S2SB 3MA9L 1VA9A 5C09B 4WW2F 1ITCA 1U8KA 1S7UB 4HQQL 3TV3L 3TO2A 1UJ3C 3H9ZA 2XKNA 3QDGD 5DK0B 5IQ7H 4BZ1L 5SWZB 5DFVC 1BIHA 2J8HA 3V6OC 2BNQB 1Q1JL 4M9OA 4OLWH 1DBMH 1I1RA 4XVSH 3T4AB 1LO5A 2VXTH 3NA4A 3BRGC 4UTAH 2DB8A 4JO4H 4WV1C 2NZ9D 2C1OB 2CUIA 3ARQA 43CAA 1T3FA 3FFCD 4OGAC 4GAYA 4ERSH 4B7LA 1WFNA 4W4OA 2AV7B 3D18B 2CDEB 1NAKL 3RKDC 3B8YA 2ITCA 3JTSB 3BXNB 2QSQA 3DHJA 3C60C 4JKMA 1BJ1J 2VXVH 4GBXC 4MAYD 4QCIB 1KELH 1BVLA 1S7XA 1RV6X 1D6EB 4ONFL 4WHYH 2Z8RA 1OPGL 3T65B 6FABH 3P2TA 4PP1D 2EZ0C 4GRMA 1NFDF 3QUKA 5IGXL 2IG2H 3ARRA 1ZHKB 2MPAL 5E2WL 3HR6A 3L5WB 3V4VH 5EFIB 4Y89A 2A74A 5E7FA 1UT9A 5JR1L 5DURD 4NRYB 4HV8A 3GI8H 4O02L 5GGRY 4YHPA 5DJ0B 3IU4L 4WFFD 5IG7A 4ENEC 3VCLB 5FUCC 3SKJH 2AJXL 4S11A 4M7JL 1NBYA 4Y2DD 2XTJC 2EE6A 2FDBP 3IFPA 4CGTA 5T33L 1F3DJ 1WJ3A 2EO9A 3AM8C 3CUPB 3D9AH 6CGTA 1EXUB 5JIHA 4EVNB 3QNYA 5C0CE 1EPFA 2XN9A 2JB5H 2MQ0A 2AVGA 4RISL 3KYKL 2GAZB 1XCTA 2CK0H 2E8YA 4HWEH 4PGCA 3HZKB 3H7BB 1IAIH 3DV6A 4PJGB 5DD6B 3O3BA 3L3OA 2F54E 4L4VA 2DIJA 3HAEG 4P2QB 3H7LA 3B6SA 4RNRB 4P3DA 5K9KA 1YEKL 4M62L 4P3DB 2HRLA 5AUMB 4JRYE 1JK8B 5MEQA 5TDNA 1OGAA 4NT6A 4LASL 4FXLA 4PR5B 4RWHA 4QYOA 1VFAA 5M94B 5FDWB 1SMOA 1JZ5A 5DD0L 3VXRA 3BWUC 4R4BA 3MNZB 3PDOA 4Z78B 5GIRB 3KPQB 5IM7B 5C0AE 2AEPH 5HGHB 5GRYA 1SY6H 2FEEI 4M61A 5IB5B 3I6KB 3IJSB 1SQ2N 2YPLA 3HNSH 4ORZC 4FTVA 4RX4D 4DVRH 4EI5C 4S1SL 1OAUL 4YUEL 1S7SB 1I7TB 3Q1SL 5E8OA 1XF3A 3HRPA 3EO1A 2YD6A 4JM4L 4UQ3B 1G9NL 3K3QA 3V8CA 4MJ5B 4NJ9L 4DTGH 4PJ9D 3HMXL 1KB5B 5C9JA 4WHYG 1ORSB 4XAWH 4OLWL 5I1GL 5C0DA 2OP4L 3PWJA 2MFNA 5I17B 4X7EC 4XGZB 5F7EH 3STLB 4OIIH 8FABB 3BUYB 2VISA 3QDAA 2NZ9C 3BDYL 4OLZH 1H15B 1XT5A 1OP3K 3E6HA 4H5SA 3MOBL 1A4JA 4XP6H 1N5AB 1J1PL 2VLRB 5TDOB 4OZIE 1ULVA 3OKDA 4JN1H 2F19L 2GTWA 3MCG1 5BS0D 2J88L 3JV6A 4P5MB 4Z7VF 1T21A 4UAOB 1D5MA 4XMKL 1CXLA 3VFNA 3TO4C 3SO3C 1CGUA 2BOCA 4PUBL 5FK9A 3QJFB 4G5ZL 5F7LB 5I1AA 5L0QC 1KCUL 4JGJA 1ODAA 5EIQA 1IC7H 4POUB 3NBNA 4NQED 2XKSA 3BQUA 1KCLA 4GKZB 3TBWA 5D7LD 2VDRL 4K7FB 2Z31C 3QUMB 3X3GH 3WS3A 3FCTA 4PJDB 5DRXB 2JIXA 2ADIA 4U1SA 4K94L 4U1JB 3TZVD 4Z8FH 2VDOL 2YOCA 4JFZH 3BOVA 4PJDE 1FP5A 5FA4A 3U0WL 5ETUA 1KPRA 5LAXA 4UDTA 1NGYA 5KVFL 2G60L 1R5VA 3VGBA 1A7NH 1FIGH 3IDMA 4ODHH 5IT2H 3MPCA 5KSVB 3CX5J 3MGOA 3FOMA 2LU4A 2ZUSA 4NN5C 2ZUTA 1MCPL 5HY9B 4EQ2A 2YZ1A 2HMIC 4FXGB 3MNVA 1K85A 5F6HI 1JJUA 3O45B 3QFJA 1NGQH 4HWBA 4X0KB 2VAAB 4N0RA 5J1AA 2X4UA 2DL9A 4HIJA 1KXVC 3UTZA 3RVUC 3BP4A 4HWEL 1OAKH 4O2FB 4P9ML 2DQDH 1TLKA 1KBGH 3CGTA 4KPHL 3BEVB 5IR1A 1HH9B 4NNXB 2C7UA 4GLRI 4OF0A 3GSNL 5JOFA 2YBRB 4ZG1A 1I8MB 2WP3O 4X98B 4JKPL 4FXKB 3DXAD 3FOMB 4WTXA 3HUJB 1HYSD 1UVQB 4J3VA 5L2KB 4EIZC 1QO3B 3TVMA 2GFBA 1KLGB 5IHUH 3I6GA 5DI8A 4ZQKB 1MY5A 3MLRL 3WO3B 5E8NB 1P2CA 3S4SB 3ILPA 3U2SA 4K8RD 4PJBE 2NY5L 3CSPA 2KQMA 4TUOA 3D39B 4GAGH 1S8DB 4POYA 3INUH 3DGGB 4IRSA 3AXLB 4QEGA 2EDJA 3PHSA 3MV8D 4URTB 5GGSB 4OB5L 2VDML 4XWGL 2Q7YA 4LNVA 4ZNEE 2PW2B 4CNIB 1D5MB 3K0WA 2G2RA 4UAOC 1JV5B 5FGRA 3DTXB 5ESAB 1QG3A 1A6PA 5HHMD 3ET9F 1G9NC 1NGZA 3T4YB 3U4AA 3D85D 2CJUL 2FX8L 1I1AD 2XN9D 2A2QT 4PIRF 1INDH 3B83A 4IRSB 2LU3A 4DN3H 1EA9C 5KVEH 1VERA 3S7GA 1FJ1A 2VUYA 3LEVH 5D7IF 1H3GA 1Q9LB 3ULVF 2NY0C 4M7ZC 2OYPA 4H25A 1P69B 1N64H 2BXZA 4N1EA 2R2EB 3IDNB 5EU7E 1TZGL 1S9VA 3B3IB 5KVDH 4N90E 3G5ZB 1ZHLA 1CE1L 1MFDL 3D48R 5D7JD 2GYSA 2O5YL 1XR8A 1RJZA 5C0AB 4NQCB 4NO5A 2EDHA 4OTXL 4EQ3A 1OPGH 4CVZA 1QRKA 1JPTL 4ETQB 5LGHH 4GW1A 4RA0C 4M6AA 3IJYB 1MAJA 3HMXA 1IT9L 3MLVH 3V6OE 3MRDA 4JLRA 1MEXH 3MV7D 1OM3H 1NC2A 4OCSH 3V7MA 4RRPG 1GZPB 2R1YB 3HE7A 3WD5H 4GAFB 2CDGB 3PIQB 1VCAA 3KPOB 4KK5C 1HDMA 3KG5A 4X6DB 2K9UA 3PWPD 1XEDA 2PO6B 5E2WH 3THMH 1NGQL 4U1SB 1BJ8A 4JO2L 4JZJB 2ADIB 1EIBA 5KVMC 4O02H 1K2DB 3LKRB 1PZ5A 3MRCB 1XGPB 1WIOA 2DQJL 3GSOA 5TE4L 1I9EA 3PJSA 5DR5L 4ZS6C 3ZT7A 2I9TB 5ISZE 2D7QA 1K4CA 3EYVB 2IPTH 5FM4A 4YHYC 3D69B 3I75B 4KAQL 3H9HA 4NZTL 4NNPH 3MRMA 3FO2B 2X4SB 2BSTA 1L0QA 2P8PA 3H9SD 1LEKA 3GNMH 3ZTJG 5B39B 3E6HB 1I85C 4GG6E 4MA8H 4LGPB 4FZ8H 2XY1A 2PN5A 3ROOB 1W2KT 2BNUA 4YPGB 1QFWM 5FFLA 2HG5B 1P7QB 3VFMB 4OLVL 4YDVB 2ENSA 3JVGA 2PTTA 4Q6IB 1WBXA 4TSCL 3QEGL 1N3NB 3M8OH 4YDLC 3WL9B 3HPJA 2RCSH 5DRNA 1P2CB 3CDGB 1UWGH 3W0WB 1YQ2A 2YN3A 1JUFA 4FFZL 4OZ4B 1RQ5A 4D0BB 3K4DA 3KYNA 5JW4Q 3BD3A 4JREC 5CP3H 4JFXA 1T83A 2C4FU 1FORL 2Y06H 4M61B 2IFFL 3CZJA 1CXIA 3H9SE 1BFOB 5J0BA 1F4WL 3L3KB 4MDIB 4WW1B 1SYVA 4PY7B 4J6RH 1TZHB 2AJ3B 4OT1H 2FBOJ 4NT6B 1N64L 3DX9B 4FQPA 1DDHB 1HXMA 1CIDA 4FFYL 4X0KA 1ZT7B 3L5XH 3VFOA 1R3IH 3ZDXF 3DOSA 5IWLA 4X6CA 1FDLH 4RNRA 2PYEB 1UZ6E 4XBEH 3TPKA 5KSBA 2ZNWA 1IAKA 1SYVB 3D3VD 3R06B 4Z95H 4Z9KB 4ZXBA 3Q3GB 4O4YL 4EUPA 4NKMA 5LGHL 4WCYH 3MV8B 3DV4A 2CKBA 2H6PA 2O5XH 1E4XH 2MKLC 5FKAA 1L6ZA 1SEBB 3VWJC 2GAZA 1C5BL 2VNCA 5HDOA 4AEIL 1D6VH 3SN6N 5GRXG 1XFPA 4IRJA 1M7DA 2JCCA 2XWTA 3OKLA 3SBWA 3JUZA 5FK9B 5CBEA 3ZE1E 2MTPA 3S5LG 4HS6B 3P3YA 1IGCL 4JGUA 3ARBA 1JF5A 2UWEF 3S5LB 3BZFB 4JPVH 4OFVA 5TDOA 1D5XB 4JG0L 5ICYA 3CVHH 3GJFK 1DBAL 3TPUB 3P4MA 2X4QB 4Z18A 1FL3B 2YPKB 4YFDB 3TLRA 1EVTC 3RVTC 1XF2A 1INQA 4K3EL 2OR9L 3NACH 4KQ4H 1A0QL 1FZOB 2WK2A 1KSRA 3BIAX 4MXQD 5CZVH 1XGQB 4MCYB 4MSWB 1BP3B 3ARBB 1D6EA 1NFDE 4OZFA 2AK4D 1QD0A 3PABB 4XPHL 2P45B 3EOTH 1A7RL 4LAQL 3VMPA 2E7CA 4JFOB 4XI5C 4KHTH 2X4TA 1GGBH 2DWEB 1KXTB 3SKUD 3T77B 1WFUA 2DBLH 3SO3B 4XCYA 2YPLB 3CVHB 1FFOB 4RQQA 4PRHE 5ICXA 3O4OB 2CKBB 2H6PB 4NQDA 4LARH 4TVPL 2PF6A 1MCIA 4MB4A 1JN6B 3G6AA 1YYLH 5ACMA 3TN0C 4ZXBB 1P4BH 5CEZD 2P24A 1MHHB 4EDXB 2ICWB 4PP2B 3QQ4A 1IEBB 3VG0L 4GAGL 2BSRA 3WN5B 3QWQB 5TF1H 3ARFC 5CEZE 1OB1A 4OB5H 2DOCA 1AI1H 1U8QA 1JWMA 3ZSTA 3TO2B 1U8KB 3CSGA 3O6FA 4OIAA 5K9KB 4XPAL 1BVZA 4D94A 5CCKH 3BHBA 3V6BR 3GBML 1TJIL 3ZL4H 2VDLL 2CJUH 3IJYA 5IVXE 4LSUH 4EOWH 2AS5M 4PY7A 1F6FB 4XVUD 4WDIA 1CD9B 1QLRB 5F1NA 4NHUB 3KGRA 3ROLB 5T1KA 2E8ZA 2Y36H 3EYQC 3DVNB 1BQHB 5DRWA 1VKXA 1HXYA 4GRWF 4P2OA 4PJCA 5INDB 1CFBA 4Y5XB 3HMWL 3DO7B 4LGSB 4G42A 1XGTA 4AM0B 2VDMH 4XWGH 3OJMB 3RIFK 1P9MC 3W81A 4YDKH 4ZTOL 4X4ZA 4KC3B 4P0DA 4LLUB 3QXWA 4JFXB 5HYIA 4TPRL 2R29H 4QRPE 3SY0B 1DQDH 3JBG7 4OD1L 2R2BB 4HMCA 3BH9A 4PJ8C 3EO0A 3B5TA 3CUPA 1P53A 3MRKB 4JM2C 1II4E 3FQXB 5D6CA 3DUSB 4HXBH 4ZUSA 2ESVD 4JDVA 3VGDA 2YK1H 3QEQB 4EI5A 2DLTA 4YGAB 4GAJL 3BKYL 3H42H 4L4VE 2AXGA 5BJTB 3E1F1 3FN9A 4M5YH 3T0DA 3W39B 5DQJA 4G6JL 4WWKC 3RWCA 2A73B 3CD4A 1JGDB 3QA3A 1ZT1A 1YPZA 4CAGA 3WKML 4MXWL 4OLYL 4HCRA 3MRFB 1NH6A 3VJ6B 1TDQA 3VRLF 5JMOC 4C59B 3UTSB 2IALA 1F2XK 4KKBD 3QAZC 2R1XB 1EHLH 3KPNB 1F8TL 1DUYA 4HBCL 5IEKB 1SY6A 1YEEH 4HUWB 2E9JA 5I1KL 1MJUH 1RZJL 4RMVA 1JPGA 5DDHB 3FRUB 1OLLA 5FA3B 1OY3B 3W11C 1WEJL 4NM8L 2WBJD 3OHXB 1FNGA 4TUOB 4JPIA 5K93A 3NIGE 4OCWH 1QA9B 1PX4A 4X6FA 3NGBB 1T3FB 2B1AL 4R8WL 1M4KA 5EZJA 4XVJH 4BQBA 1D5BA 1MRFH 4ZFZA 4X6DA 3K7UA 4DGVH 4O2EA 2P8LB 4L1HA 4OI7A 2CDGA 5C9KA 4YHNA 2WWMC 2V2TA 1DQTA 3HE6C 4WFHE 3FQUB 4JQIH 4RAHA 4GUPB 5I0ZA 2EH7L 3BISA 3M17B 2CKNA 5L8KB 2R56L 3D3VB 3AM8A 3FO9A 3VWKA 3LN5B 5KTEH 3IDJB 2DICA 3L3HA 3OB0H 2YUXA 5M7QA 3U79A 1T1YB 3TCXA 1A6UL 1RIVH 4MA3A 3T3PF 2R0LH 2IPTL 4KV5E 2NW3B 4NO2B 4LQFL 3KPMB 4OZHA 5EWIH 1J0YA 3MJGX 2FR4B 3MLZL 3U36B 3KPSA 4OGYH 4PJIF 4NN6C 4HKJA 3MREB 2P44B 2R2EA 1A9EB 2X89D 1CIUA 3UPRA 4F8QA 4PJDA 5DRXA 2H2PD 4X6DE 4LHUG 4NGHL 3MRNA 3BQUB 4X4YA 5IBTH 5E2VL 4I18B 5D1QC 1OF2B 1AC0A 1C5CL 3D1MC 3C8KA 4NQUA 3WEXA 2CK2A 5JHDB 3QO1A 1DUYB 4R0LC 3T0EA 1QSEE 4QT5A 5I6XB 1CXEA 4O58H 3DMMA 5CAYB 5GSVA 3GO1H 5IIEB 1F90H 3EDDA 3PXHA 3RWCB 4HUXA 5HVGB 3F8UB 1KXQE 4WRLA 2HT4C 4IMLB 4KGJA 3WNPA 3L3DB 3RX5A 4M7LH 4I5BA 3DGGA 1Q1JH 4AG4L 3TJEH 3STLA 2XZCH 1JNNL 2NLJA 1KB9J 3PWVB 4YHLL 3RQ3A 1BFVH 4PRPB 4DQOL 1KTLB 5C2BL 5CJ5A 4L4TB 5KS9E 1VFMA 1F11B 2F53D 5F9DC 2CGRL 2O5XL 4UT7H 3UBXI 4XBPB 3E2HC 3K2UL 3QUZC 3I6GB 1WLHA 3MREA 1NDGB 4HKJB 1MI5D 3PQYB 1I1AC 3V5DA 3HRZA 1FGVL 2DQIL 3MSPA 1FL6B 4Z7VB 4JHBA 1UH3A 1NLDH 3RNKA 1BZ7A 5CEXB 1HHHB 4F80A 2DI8A 2A9ML 3I3DA 5KAQG 2J7LA 1ES0B 5H37G 3BEVA 4JKKA 5D7SL 5IR1B 2R0WH 5E2UH 4Y4KA 4O2FA 5T3XH 4C57C 1FBIH 3PV6B 4X6DF 4ZAKA 5IMMB 4NQEE 3EYSL 2P4AB 1QEWB 5IP4A 1E27A 2IADA 3HG1D 5E2TH 1RZKL 5HVHC 3JV0A 1HSBB 3VXSD 5BV7L 4KKNA 4PJ8B 1HZHL 2FWOA 1ZXQA 4QRRD 3SPVB 3HI5H 1TQCB 3MX0A 4JR9L 1JI1A 5J3HD 1MAML 4MS8C 4J4PC 1V8HA 3QDGE 2EECA 4HS8H 1ROWA 4X6EA 4OJFH 2R15A 1UM4H 2GHWB 4PJHF 1T0NB 1BLNA 1ZVSB 4BQ8A 3CC5A 1UKSA 9CGTA 3MV8E 4FABH 5EUOF 5HPMA 1IKFH 3NTCL 4PRHB 3D6GA 2B8OT 1R0AH 4JANA 1CLZH 4XWOD 1AGCB 1FNAA 5D1ZB 1I9RH 4HMEA 5DD1L 1CF8L 3KPPB 1AI1L 4PREB 2VQ1A 3GSQA 4MDJB 1TENA 2PYEE 3BGAA 3RL1B 3QA3B 4P2QE 3UTQB 3MRGA 2JJWA 3NN8A 1X4ZA 4LRIC 2VISB 1LDPH 4HXAL 1CFTA 2UVFA 5HHNA 4DVBA 5JPNB 5DWUH 4U6HB 1P7KA 35C8H 2FYYA 5C0IB 1J8HA 1I9JL 1BD2D 3PG2A 3IGAA 3JSSA 2VQTA 5C9JB 2NX5E 1NQBA 4OGZA 3U0TA 2OJZH 7FABH 1MIEL 1M7IB 1OAXH 1NMBH 3IDXL 5JIPA 2YD4A 3FKUS 4W81A 2ORBH 1LK3H 5BW7C 4RCAA 1ITBB 5D2LA 2OL3B 3O4LE 4CUCA 1FH5H 4TVPD 5KSAC 3QPQD 3QFJD 4BZYA 2IAMC 4UILH 3G5VB 2F54A 3QCUH 2H2SC 3GJEA 3FONB 5IUSA 1QHPA 4ALAH 4AG4H 1X5LA 3R06A 4PJEE 3TBTA 3GJFA 1NMCB 1AP2B 3TYGL 3VGGA 3DHMA 4EXPX 4PR5A 4JFED 1NL0H 3T0EC 3UROR 4S1RL 1U92B 4NWUL 5ISZD 4RGOH 1A7OH 4NDMA 2Y5EA 1WFOA 2XNAA 4LLVB 3OR7A 4Q6YA 1GIGL 4RBPH 4Z7WB 1VPOH 3MMEB 2XNAB 3VFOB 3IRZA 2H8PB 1DQML 4LCUA 5D1QA 3TWCH 4V1DD 5F7MC 3DXAA 3IFOA 5SX5H 4XMKH 3ARGB 2IJ0C 3SGKC 4Y4KB 3TBTB 4ODVH 3ES6B 3MROB 2DDQL 4M4RA 2EYSA 4LSVH 4MMZC 1FE8H 3HAEH 5SX4H 5D1XA 4NM8H 1UQSB 2YMXH 2QQQA 4PV8B 3P0GB 2VDRH 4Y4HC 4FQHA 4QRTB 5K9QI 4YHKH 3U4EA 2KKQA 2YXFA 3WKMH 2ZKHH 2XN9B 1JPSH 2VDOH 1O7SA 2FH6A 2P5WA 1PG7X 5ACZB 1I7ZA 2G75B 3PABA 3FN0L 4I4WA 5J11C 2WWKT 4FTVE 5GISL 3KAAA 4IMKA 2QADB 1RZJH 3BKCL 3WFBH 1CK0H 3FB7A 5C09E 5EOQH 1TMCB 2BP3A 2EIEA 2OSLB 4M1CC 1WEJH 1TETH 2CLVB 1GGUA 2YD9A 4P5TA 5MEOA 4KXZH 1T2QL 2DTSA 2C3WA 1MHCB 4R8WH 1HNFA 4PJEB 3VRJA 3MCLL 4DGYL 4OZGF 3FT3B 3O6ML 4G8FA 3ZHKA 4DCQB 4E42B 5IQ7L 3GSNH 4HH9B 5CJBA 5HVWA 2NY1C 5E9DB 4BSWA 4LP4A 4HKBB 1WFTA 4JY6B 3H9HB 4MQTB 2AABL 4HS6A 3UJJL 2Y07H 4D9RE 1YQVL 3FMGH 4PGZA 1B88A 1NMAH 4WUUD 4P2RE 1A3RL 5BQ7B 3VRIB 3WLWC 5IHUL 2FX9H 2KBGA 1GCFA 2XN9E 5DJCA 4PS4L 5I18L 3FQWB 3PWLA 5J6GA 4UT9H 1YMMA 1HIML 4MD0B 4LSRL 3ILQC 1HINH 1BBDH 1U8PA 2EZ0D 3T3ME 4PJXF 5EU5B 5DHVA 3BPOC 2C3HA 4EUPG 4UINL 5FYKE 4LQFH 5TQ0L 3P11H 4Z76B 1A7QL 4LLDB 4M43L 3EJYD 4JHZA 4XCEA 4OI9A 1JYVA 3QJHB 1CN4A 4CMMB 3WCYA 5GSRA 1KJ2L 1WWAX 2WBKA 4YBLC 2X7LB 3CFKA 4H20H 3WDIA 3SGJC 3W0WD 2XG4A 3P0YH 4ONHA 4U3XA 3LRSB 3PF2A 3SOBL 1ADQL 3MBED 4RMQA 1M05A 3QUYB 2NTSP 4OZHE 3MR9B 4Y7MA 5F89A 4U6YB 4Y4FD 1C12B 2MWCA 3O3DB 1ONQB 5D1XD 2DTMH 1BZ7B 5CEXA 5ALCL 4P4KC 1RJZB 5F3HA 5IHZB 1JNHB 1NCTA 3ARDB 1U3ZA 1ZANH 4MXQC 3VFSA 1L7TH 2HJKB 3LRGA 3OAYH 3LZFH 5I0DA 3X11A 2EDQA 4ZFZB 2ERJC 5EZJB 4AQ1B 2CR6A 3LS5H 1U93A 4P3WA 1ED3B 3MLTA 1KEGH 4LVHB 4GSDL 4JO3L 5CLTA 1PZUB 3B9DA 1KF9B 3I50H 3RAJH 3RY5A 2V2WB 4G6ML 1QNZH 1U8MB 4JHWH 4OKDA 4RWYL 5FA3A 2KUTA 4NQEB 2WINB 3RZCB 5I8EB 2GTZA 4MHHI 2E5EA 3OWEA 4LSVL 5EO1A 5JIIA 3EYFA 1IEHA 2XZQL 2IBZY 5JQHC 4Y1AA 3NN8B 2GJ6E 3QWRA 3BPOB 3I2CL 4PJ7F 1F13A 4MDJA 2AKRA 1OTTD 3DROA 4TUJB 1HOCA 2HN7A 2DI7A 5D7LE 5IBUG 2NY2C 2A73A 4NQSB 3P73A 3FN0H 5HGAB 1OVZA 1LP9B 2CXKA 5IBUB 3GMPB 1J86A 5DHYB 1CK0L 4XAKE 2APVA 4JRXD 1Q94A 4UZGA 3D39D 3FO1B 3KYOB 4M6MH 3TNNA 1MWAH 2VRAA 1DQJA 4JO1H 2I24N 1JWSA 4I3SH 1CD8A 1KG0A 2AJUH 5F6IC 3QQ9C 3KJ6L 5E8NA 3D39E 1A9EA 2Q20A 2YPVL 3TC9A 4AL8L 4IMKC 5EOCL 2W91A 3EGSA 4BSVB 1KULA 2HVJA 3VFSB 1EMTH 3RHWK 5LJYH 3QFDB 1UB5B 2VB5A 1AY1L 3KPRE 5J1SC 3UJJH 5F3BB 2D2OA 1WT5A 1T6WA 4Y4KD 1CBVH 1EBAA 3SDDD 2FX9L 2PW1B 4YNYA 5B8CA 1T80A 5MERA 5I1JH 3OX8A 1QFWH 4LVNC 5AYUH 3H8NA 4BJLA 1FQ9C 2MKWA 2BC4B 2P8MB 2X70B 2YPLD 3QH3A 5MERB 4A2MA 2EXWD 4CVZB 4OLVH 3CFDA 3D0VA 4K3JH 2VDQH 3UTOA 3KPSD 3ARDC 4NQCA 4OCMC 4O2CA 3GUTB 1B0GB 1OB1B 4JQXA 2GJ6D 1YN7A 3VMOA 3CXHJ 4AJ0A 3JWOC 4CMHB 6FABL 1NCAL 4QHNA 3V5DB 1FC2D 3E8UL 4UDTB 5EA0H 1Z0NA 4ZXBC 4XBPA 4MNHB 5GS1A 5E5RB 3VG9B 3ZYZA 3UZQA 1IVLA 4ZDHB 5D71L 3T3PE 2IPKA 4GKZA 5HYSG 2BVEA 4U1HA 1Q9WA 1G1CA 1GJIA 4G9FE 4GKNA 1RZ8A 1YMHA 2A1WH 1F3RB 1GVIA 5CMAB 1N59B 1MFEH 3A6OA 3DVGB 1MIEH 1NMBL 1CDUA 5FM5M 3KNBA 3L3JA 1IGML 5GGSY 1IGFH 4WFEE 2OX5A 4FQQB 4QY8B 4G9DB 2W1NA 2DM3A 4NWUH 4LKXB 5DJAB 3PP4H 1K6QL 3AS2A 4W6WB 1F58H 1LMKA 4IS6A 5ESAA 3S35H 5I1CL 1UM5L 1A6ZB 1GIGH 1FH5L 3AMLA 3FB5A 2PW2A 2JB6A 2XWJA 3D25B 2APFA 4XPTL 5C08B 4ZODA 2YPKA 3BUYA 4L8SB 2HKHH 2X89A 1PD6A 4LCYA 3AREA 3CLEH 2K3TA 4Z7VE 4JVUA 1N4XL 4OCYH 1NC4B 2DQTH 4KTEH 4CVXB 4DKEH 4PJCE 4HJGB 3BH9B 3LB6C 4H88H 1ZWIA 1S7SA 2BJMH 4G7VH 5JQ6H 4JZNA 3STBA 3S96B 2YD8A 3VXME 1J5OH 5F9OH 3T0EE 2VSCA 1IGCH 5ADOH 4HJ0D 2YWZA 3IB4A 4U6YA 1KNOA 2IAMB 1KCRH 3L6FB 1YEGH 3L7FA 3SJVE 3H0TA 5EN2B 3MJ7A 1CDHA 5CGMA 5EZIL 2ZKHL 4Z7QE 4R4NC 1TJGL 1CQKA 1RPQA 2ESVB 3MNVB 2CIIA 3B5HA 1CFSB 1SM3H 1KCKA 2UUDH 5E1HB 1JYWA 3B9KB 3DPBA 2CRZA 4L3ED 3WFCL 2X2YA 2I60H 3MRIA 5KVEL 4KUZL 4YX2H 1BEYH 4QRPB 5DD6A 4H8WC 3P4NB 5BXFB 5EOTB 5IW6B 4Y4KC 5K9JH 1AXSA 3DUUA 1DUZA 2F54B 5K9OB 3G5VA 3U0PB 3IFNL 2HFGH 3RDTD 4JHAH 2I5YL 1KTDB 1P7QD 3DBXB 1J1OL 3TT3L 1FPTL 4LCWE 4OKVB 1B2WH 1B0RB 1U36A 3VRIA 1L9NA 2FHFA 3QNZA 1OCWL 2EC9T 4C4KT 4HK0A 5JOPD 5F88B 2OL3L 3NGBC 4H0IA 1ZLUK 3TIEB 2BY0A 1VADA 5GGVH 3L5HA 2AXHA 1T21B 5GZNC 3QUZA 3JTTB 1N3NA 1MI5A 3FFCB 4G8FB 5ELIA 4AT6A 4NKQB 1LE5A 4Z0BH 1PG7W 4XNZC 1NSNH 3VH8G 4DUWA 2ZCKH 1MEXL 3GKZA 2V7HA 3RL1A 1J05B 3NVQA 5IQ9B 4Z7WE 2ZSVA 4P57A 4Y16A 1ZTXH 4NHCH 3DMMC 5TJWK 1J0IA 1ZV5A 2YPLE 4QHLB 1RZIB 1FV1B 4PRHA 4UDUA 1D5ZA 4K71B 5D2NE 1RZJC 2DQFA 2W38A 1F58L 1TTGA 4BQ9A 1NBZB 3KPSE 4TTDD 3U4EB 3ZE2E 1KTRL 4EI6A 4J1UB 4P46D 5TE4H 1G7QA 3PGCA 1S78D 4U1IB 3KDMA 2E9IA 3UJTL 1FNSL 2QBWA 1YEFH 3LPGA 2IMMA 5GGVY 4Q2ZB 1Q9OB 4YHML 2DLEA 4DUXA 1LO5B 1ACZA 3WO4B 3RVWC 3ARBD 4JPKL 3P9LB 5IMOA 1HSBA 2XZQH 3BHBB 3B2UC 3QIWA 2ED7A 2LVCA 1G7IB 3F58H 1A6AB 3OR7B 1G7JB 5EBWA 2UUDK 3U4BH 1F97A 2AQ3A 2NR6C 3KXFA 2Z9TA 4L4VB 5J6HB 1JE6A 4UIMB 2BVUA 4PJEF 4B50A 4GBXD 1DQLH 1L9MA 3KR3L 1MCRA 2E27L 4JFDB 4TSCH 1I7UA 2JK5B 1ES0A 5SV3A 4ZOAA 3D87B 3F7VB 3T1WA 4BUGA 1T22B 1RUKH 1JRHL 1WC7A 2HA1A 3TVMC 1N2RB 5MP6H 3FQNA 4HT1L 3DX7B 1BECA 2CLRA 1FFOA 4RQQB 4KZEH 2H3NA 1ZOXA 4XVUC 2VO5A 1HSAA 1C7SA 3HRZB 4JZNB 4U49A 1MRFL 3U1SH 2PR4H 2EDKA 2FX8H 3C08L 1F4WH 4C56E 1MCJA 3VXQB 2ZOKB 4BSJA 3QISA 3KYMA 4MCYA 5C92A 2KDGA 5F9JB 2ZSVB 4EBQH 3QIUC 2NY1D 2E6PA 1P7KB 5C0IA 4NRXA 3G9AB 5FO9A 1XAUA 2RBLA 2YC1B 3QUML 4I0PD 5C8JB 5IVOA 5BZDB 2AJUL 1EO5A 2BNQE 4LPCA 4PGBB 3SGEH 3KJ6H 4U1LB 2YPVH 1L7IL 1ZHKA 3WDHA 5FCSH 5ICYB 2PXYC 1KOAA 4G7YL 3DMMB 1J0KA 3LHPH 4GRMB 3RVXC 1RURH 3GGWA 4MNGE 5D2LF 1FZKA 5A16A 3HZVB 3OKYA 5ALBH 1GOFA 4NC0B 2JCCB 3OKLB 4IRJB 3QRGL 5IOPB 1BQSA 3D39A 1CQYA 1AO7A 3G04B 5ECJE 5IKCA 4NKIH 5J4MA 5GHWL 4XX1G 4N5ED 5JR1H 2ZCLL 3U7YH 4MNQD 1V7ML 3MRQB 4KFZC 2QHRL 1QFWI 2GFBB 2MCPH 4F9LC 4QHNB 5FCUL 4PJ8A 3RA7H 1WWWX 5EO9B 3RIAF 4XMPL 5T33H 4DKAA 3GRWH 4G80A 1HK6A 1FRGH 4WI6A 5BZWA 5I8CB 4KK6D 1VEMA 4UV4L 4KVNL 4HULB 4MA3B 3AU1A 1Z5LA 3SE9L 1K6QH 1DBAH 5E6IA 3MA7B 3UTTD 1C16B 4FG6C 2ZOLA 3K80A 4NWTH 4O00A 3MLSL 2Q1EA 4PB9L 1R5WB 1OT2A 4WV1B 4XNMA 2D7MA 4XPGH 1RIHL 4YNYB 4KKAD 4U1MA 1FCCA 1I75A 3MRJA 3O9WB 1HEZA 4QF1A 3QFJB 2HTKD 5EUKA 3VXOB 3ZKNC 1YEHL 5C0AA 3Q48A 2B7DT 1XR8B 4PRIB 3ARUA 5IBLC 2EO1A 1YYMH 3ARSA 2BFVL 5DO2D 4OZ4A 1NGWB 3ARFA 4JB9H 4GQ9H 1E6OL 4K8RL 4LARL 3O0RH 4RDQG 3Q6FB 1DL7L 3C09C 4OCRL 4PJFB 2B4CL 1Z2KA 4KRLB 2G5BA 4PGDA 1J5OL 5IJKA 2Q6WA 3G6JA 3LH2L 2VZTA 1VB9A 4XX1E 5TF1L 5D96C 5JXEC 3AAZB 1HQRA 2B5IB 3GBNL 4M03A 3D25A 2W07A 4R90H 5IJVA 2NXZB 3PWUB 4TRPL 5I1EL 3X13B 1JNJA 1E4KC 3PHQB 3V5HA 2EDFA 4S1SH 3NFPB 3MRFA 5CCKL 4QRRA 1RJCA 5HHXL 1TJIH 2E7MA 4BH8A 1YY8B 3K8MA 3GHEL 5H8DA 3IVKA 1YECL 1A64A 3TFKD 2Q7YB 2PXYA 1QRNB 1U8JB 5JA8B 1R24A 5ICZB 5DD0H 3WYRA 1V05A 2GTZB 4QO1A 2FBJH 1DBML 4HS3A 3W11D 2V2WA 4K07A 1YJDC 3CMGA 3ZKMC 5A2KH 4N8PA 5GRJL 5E7BA 2X1WL 3WFDL 2YZ8A 3ILPB 5AG8A 4OLZL 1JHKL 3LEXA 4NC1C 4PRDB 3IETB 2HJKA 2HKFL 1MAKA 2F19H 5DRZB 4FABL 1S9XB 4XTRD 2J8OA 1AXIB 3HMXH 2YEZA 5ESQB 4NO2A 3RJQB 1JIBA 2MQCA 5C3TA 5T3ZE 3ECBA 3DWTA 3AS3A 1J0ZA 4P59L 3V0VB 2NY6B 3OG6B 5F89B 1JGEA 3OG4B 5MHSD 3D0LB 1XF4A 3N85L 1UKTA 4PJAB 2D0HA 4F33B 2CDFA 4WUUB 2X4UB 4ZUWA 3FO9B 4JCMA 1KV3A 3D3VA 1X5IA 3FN3A 3WIIL 1D9KB 1KT2A 1P84K 3K8KA 3SKJL 2F8VA 2B5IC 2VLKD 4YFEA 2K1MA 1IMHC 1U8QB 2YEZB 1HHJA 1YEEL 4TSBH 4BZ2L 3RPIB 4YWGL 3OGCB 5DFWH 3V5KB 1BVKB 4RAVA 4R9HA 5I19H 5LAXB 3C09B 1EFXA 4WGVB 3CVHL 4J8RA 3MGTB 2DWDB 5HHOA 2DRUA 4RISH 5IFAL 1NMCC 3MYJA 3MV7B 1IAIM 4U6VL 2BSED 3OHXA 4UILL 4XPGL 2A6IB 3C6LB 2W9DL 2GITA 3JWNC 4K7PX 2WUBH 2DLFL 3RGHA 4WO4B 1JPGB 1IGYA 1FVCB 3MRHA 1UJ3A 4JJ5B 1QRNA 1T83C 1U8JA 4NHCL 4N8VG 2EIDA 3TA3B 1CG9B 3RBGA 1S7TB 2A77L 3VFWA 4P5MA 5E6YA 1A3LH 2P42B 1NUGA 5BV7B 2AKRB 3EOBA 5F7DA 3CFEA 3CVIH 5BVJA 5I16B 1T0MB 1A4JB 3VXMD 2EDYA 2WW8A 4DZBB 3TZVA 2OTWB 1U8NA 1LWRA 1DQMH 1PG7L 4AH2A 1FO0H 2OZ4L 4GRWE 1MWAA 3PGDA 4M7ZB 1FNEB 3BD4A 1GOGA 3QG7L 5HBBA 2HLFD 1LK2B 5EWIL 1CDGA 3NCJL 3WLBB 1TVHB 1I7ZB 5MP6L 4I77L 1FYTD 3FT4B 4YO0B 2GSIB 3BRDA 2AK1L 4MVBC 3SY0A 4W68A 5JORA 3NIDE 1S7VA 5HGBB 2EKSA 4L8DB 3RZCC 4JFEE 2PR4L 1MJ8L 3LIZH 3FQNB 1SJHA 3BPNC 4GAYB 5T5FL 3RVTD 1RUPL 5D1XB 2HJLA 4G6AC 3UC0L 1U8HA 1P4IH 3CK0H 2Y36L 2LV4A 3VXRB 1G6RL 2P43B 1ZMYA 1EJOL 5HHPA 4HIXL 1RUKL 3MLXH 4AENB 3DXAB 3IFOB 1KN4H 5F6HJ 3V4PH 5GZOC 4FP8L 4HIJB 1T2QH 4MNQE 1F4HA 3MACH 2NY7H 1JI2A 3OXSB 3EBAA 4YDJB 4LHUB 5D7KD 3DARA 1SEQH 5DS8B 5KVDL