3SKNB

Crystal structure of the rl42 tcr unliganded
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASGQGNFDIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords RL42 T cell receptor, alpha chain
total genus 47
structure length 241
sequence length 241
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknB02
5K59F 1FG2B 3SQOL 4L8SB 5JZ7C 1RZ8B 3HRZA 2MHAA 3QIWA 5I1EL 1JNJA 2YPLD 1CICB 3JV6B 4B7LA 4TULL 4QHNA 3UMTA 3N85L 1T0NA 4RRPA 3P9MA 3RWIB 3LEVL 4JLRA 4CN4A 2QSCL 5FK9A 1VB9A 3RY4A 3OQ3B 4PREB 2QQLH 3ZT6A 4U2YA 3TBVB 3L3HB 5HPMA 2E8ZA 1JHLH 2OL3H 2PNDA 4ONGL 2OZ4A 5GZNC 3DBXA 3DXAE 1QHOA 3LQZB 2OS7A 3O3AA 3ARTA 4P59L 4OZFB 4P9HC 2HTLD 3X11B 5CBAB 4BSWA 1BVLB 4J4PC 3JUYA 2W60B 1QOKA 3BGMA 1KUMA 1CR9H 5TDPB 3RY6C 3T4AA 5BQ7A 4UB0H 2X4SB 1R3IH 1N4XL 1HHGB 4JM2F 1MHCA 1J0KA 4HLZG 4XBEH 4X6BA 4DQOH 1OWWA 1T80A 4X9IA 2Y06L 3O11B 4JFFD 4OZGF 2VXVH 5JHLH 3DMMD 5EBLA 5D7JB 2J8UF 3LN4B 5JXEC 4O2FA 3U82B 3EFFB 2FBJL 3MR9B 3ULUH 4LKXB 2ICWJ 4OGXL 4KUCD 4PYHA 4ZOAA 3RJDA 1AQDB 4XMPH 4QYOA 2Z31D 4LHUA 3B2VL 2AXGA 1CS6A 1BQUA 2PXYD 4JFFA 4N1HB 3K8LA 2NY3C 1CFBA 2EDWA 2VABB 1DQMH 3PL6B 3X3GH 5CLTA 2WK2A 1QQDB 2XICA 3MRIB 4OGZA 3DX8A 4LLVB 1BGXL 3SE3A 1EHLH 4XI5D 2BRRH 4PRHB 2FX7L 2ED7A 4BQ6A 2FDBP 3RZCC 3TPUB 1S7SA 2VDMH 1BD2D 1G9ML 4Q7DA 5JUEH 1HNFA 2HG5A 2HTLC 3PV6B 1CF8H 4PLKC 1ZT7B 4CADA 3AFLA 2NX5D 4L3CB 3QIUB 2A0LD 4Y4KB 1YDPA 3DURA 5HHOD 3L1OH 5TDNB 3Q5TA 3B2UC 3SDXE 2WINA 4I0CC 4JY4B 4YGAB 3CVHA 3OAUL 1Z5LA 4MMXC 1QKZL 1MSPA 5C0CD 2VDQH 2EKSB 3IU3A 1F45A 1YC7A 1IEHA 1IBGH 1KTLA 2QQQA 4JRXA 2X44D 4ZG1A 1HSAA 4C56A 3BGAA 2Y72A 3MNVB 4H5SA 3GSOB 4IIQA 3MOBH 3VXTA 1YQVH 4MMZC 3E6HA 3IETB 4GFTB 2HN7B 1A7OL 3FB6A 4XXDB 2ZCLH 2ZUQB 4UBDC 1YEGL 4YHPA 4FQLH 3UZVB 3WMSA 2OCFD 2CRMA 1LEGA 2EDOA 4RNRA 3N85H 2HLFD 1FL5A 1KIQB 3V4PH 2P43B 4BYHA 3ZYOA 3CLEH 4ODXA 4RMSA 3S4SG 4BK5A 4NFCA 1G6RB 2DIJA 2WUCL 5K9KB 3LKQB 2ZG2A 5JORB 5I8KL 2ZNWA 4I3GA 2O5YH 3KNBB 3QHFH 1YUHA 2E9JA 3FOLA 3WFCL 1LO3H 1PKOA 2YPLE 1HHIA 1I1AC 4GMSL 4PJ7A 3EYVA 4U6HA 5HDQH 4CU6A 3MLRL 4GRWH 4JVWA 5C3TA 3CUPB 1NANI 2VYRE 1OAYL 5TE6H 2X9YA 5ESQA 3SGEH 3QI9D 1CDUA 5C8JB 1HYSC 5TE7L 3C5JB 3CFJB 3DV6B 2ZSWA 2VSCA 3GSNL 4L4VE 2F54E 3AAZA 3C6LA 3RBGA 2Q8AL 1KJ3H 1HHJA 1RZKH 2DTMH 5DD1H 4CW1A 3Q5OA 3Q3GB 4P5MB 4WEBH 1TQCC 1A1OA 2X1XR 5DA4A 4ZUTB 4HGWA 5DJDB 3L5HA 3GJEB 3JWDH 4C54A 1HHHB 2ATKB 1JVKA 3ZHLA 2ITCB 5DMKB 4WO4D 4HDIA 4OM1L 3CVHL 1UM6L 2ZCKL 4U1GB 2NX5A 2OMNA 4J4PA 1CDCA 4HQQH 2ITDA 2BVYA 2X9XA 5E2TH 5HHOA 1X5ZA 1D9KB 3WYRA 2B1AL 4OCWH 5KVGL 1KCVL 4KRPB 5EN2A 2BOBB 4JDTH 4JFEA 4LCWB 2VDOH 3C6SA 2JCCB 1OPGH 4RZCB 1K85A 4JFXA 3Q2CA 5IB3A 4D9LH 3RL1A 4FFWC 3WCYA 3WXWL 5SWZA 4P9MH 4U05A 5D7JC 2EYTA 4S1SL 2VWEC 1OAUH 5CEZL 3P4OB 1OAZH 5DSCB 1TVHB 1XR9A 3DTXA 4MLSA 4G8GE 2A9ML 3OR6B 2DQDH 2LTQB 1EVUA 1X6LA 4M3KB 1HKLL 1DZBA 2C3VB 3G9VA 4HIEB 4XMPL 1OAZL 1BBDL 1OW0C 4UMGA 1OAUL 4MNGB 1OLZA 1FPTH 3QBTB 4NNPL 3CFEB 3VRIB 4K2UH 1KTLB 3P9LB 3LIZL 1JZ3A 3SY0B 5BV7H 1AD0B 5JHLL 1NFDB 4JFHD 3MOAH 3OB0K 3CFBA 3SKOA 3IJYB 4HWBL 2VSDA 1ACYH 3EJZD 3U79A 1EEZB 5FHBL 3VFUA 3CNKA 3D0LB 3EYQC 1VKXB 3CDGB 3LQZA 4ZO8A 3QUXB 1P6AB 4Y5XA 3MRBB 5KS9E 2FRGP 4JN1L 3NAAH 2R2CA 3C5ZD 2OTUA 3KDMB 5DDHB 4H0GA 3VWJC 5L2KB 1H8SA 3DVNA 1YY8B 5CD5C 3QO0B 3B3IA 1UEYA 4KJQD 3HZYA 1JGUH 1SJHB 1BIIA 1CDGA 3S34L 5FO8A 2IALA 2Y4SA 3FTGB 2RB8A 2Q8AH 4UTAL 4BQCA 1RI8A 1KTDB 4RA0C 5FYKE 4NKQB 4POUB 4X6DB 1NGPH 2WINB 2NYYC 4PUBL 3WNKA 5MENA 1QR1A 1LO0H 3UTQA 5DMIH 4JO4L 1OAYH 3KPRB 3B43A 1RUAH 3FQXA 3QUXC 3IDIB 5T5FH 4QRPB 1BFOB 4KVNH 1UJ3B 3QPXL 5IMKB 1FN4A 3RWCB 5EC2B 3K2UL 5EIVA 2GHWB 3ROLB 4MYWB 4K7PL 1AI1L 4K7PX 4ZD3L 5BJTA 1ACYL 4Z77A 3GJEA 4XP5H 5EB9A 4NC1E 2OZ4H 5DJDA 3QDGE 1FJ1A 4OLWL 4R0LA 4XNUL 2BSSA 1QO3B 1SJVA 3G6DH 2GITA 3GMPB 3K4ZA 4HT1L 1A5FH 3EO0B 3DOSA 2XQYK 1KPRA 4ODUA 3BXNB 3TO2B 1YEGH 3AREB 4P3CL 5FKPB 2VDLL 1D9KA 1VACB 2XXCB 4KHXL 3SO3B 5IHLB 2WUBH 1MAML 1BVKA 1BZ7B 3VE0B 5GRUH 5A1AA 3EGSA 3C2SA 4MS8C 5HVHB 5EZOL 4IM8A 1BFVL 3EYUL 4E41E 3FT4A 4YFLI 2I9TA 3QEUB 3DXAA 4HWBA 4OZFG 5DFVC 5J11C 4N0RA 5FYLH 1CD1A 5C08D 1FORH 2Y36H 2QADD 4RRPG 4TNWF 5GSRA 4PJAA 2ZUWA 1A22B 3CSBA 4N5UA 2XZCL 1WBYA 2Z92B 1E4WH 4N1EA 4GW1B 3GMMA 5DJCB 4Z76A 2EDHA 2YD3A 3ZKMD 1FNGB 2NR6D 2PYEE 1E6OH 3OKKB 5D1ZD 4X4YB 4I0PC 2BOCB 2X4RA 2I9LA 3CFKA 1QTYT 4JRWA 5D7IA 5FF6B 3L3IA 5DHVB 1J1PL 1TJIH 4RGMB 2FH8A 4UOJA 4NRXB 1JK8B 3IDUA 3RY5A 3UTSA 1MUJA 3RI5K 1M7XA 1EFQA 2KPNA 1UXWB 1U8PB 2E3VA 4G5ZL 1YJDC 5EOCH 2EDXA 3VXMB 3QIBD 5KSBF 1D5IL 4RDQG 2CPCA 5SWQA 4KPHL 3PGFL 3V0VA 3SHSA 3VG9C 4PJ5E 1WJ3A 5CGTA 5I1HH 1L0QA 4GBXD 4XRCA 2OM5A 3ULUD 3VI3E 2E9BA 2CUHA 3C87A 4LP4A 3UBXB 5IB1A 4DZBA 3F62A 4P5TD 4Z5RA 3MRBA 1B90A 1T0PB 4MJ5A 5EG6C 3S88L 4M7ZB 4NYLA 5GJSH 4BUGA 3BW9A 2NY0B 5GISL 3MCG1 3CVIL 1DQJB 3FFDB 1OW0A 3C6LC 4Y5VA 3AUVA 3U46B 3TWCH 3IDYC 3SGDI 3GUTB 1CFSB 3BSZH 1SJHA 1YPZB 2UY7A 3I2CL 3MRGB 1TZGL 4PP1D 4NDMA 4DZBB 1MCBA 5LBSL 5DURB 4KK5D 4IDJH 1I9RH 2LU7A 1QFPA 2A74B 4NN7C 2VLKD 3LKRA 4WRLA 2A9NH 2Q7NA 1TJGL 2XY2A 3DNKA 3MREB 3QCTL 4LSVL 1MCHA 1SYVA 3PHQA 4O9HL 8CGTA 5HGDA 2CLVB 4O00A 3JV4A 3MO1B 2MWCA 4UTBL 4R96A 1X5GA 4Y19D 4LEOA 3IVKB 4YIQB 2R56L 3D39D 4UILL 4UU9B 4ONGH 4H1LA 3RNKA 1I1CA 2BVPB 4PJDA 3HC3H 5HGHB 2VXQH 3RWJB 1XT5A 4JVPA 3H9SD 2BOBA 2VQTA 1JPFB 2A73B 1U42A 4MHHI 1HINH 3O4LD 3HG1E 2EE3A 1JV5A 5FDWA 3MJ8A 1KCLA 4OV6F 3N1MC 5C0AA 5CD5D 4NUGL 1DVFD 4Y4KC 3AMKA 1GOFA 2XFXB 3TYFB 2BRQA 3E8UH 1RAMA 2RJMA 5T1MA 5E8OB 2W1NA 1S7UA 2NY4B 3VRLF 3VE0A 1JZ5A 4X0KB 4I0PD 3LEYH 1J7VR 4LRNH 2C1PB 2X4OA 3LS5L 1MPAH 3L6FB 5L6YH 1KTKE 3TNNB 4F7EA 5EZLA 5IFJB 2FHBA 3KLDA 2AABH 3NPZB 1YEJH 5EWIL 3GI9L 1NEZA 4U1JA 1CDYA 1RSFA 1KCUH 3MRPA 4ISVA 1BF2A 4NPYB 2O61A 3D9AL 3RKPA 4XB7A 3PP4H 3T2OA 3TBTB 5E6YA 1XGUB 4JCLA 1V7NH 1Z3GH 4PY7B 3HPJB 3HRPA 1T21A 1JI2A 3OKEB 5JPNA 1IGFL 2E27H 3BO8A 5BV7B 1KPVB 3P0VH 3QUZD 4OJFL 3VXQA 1I7ZB 3KPRE 3MUZ1 1UB5B 4HK0A 4PJEF 4TRPH 2DWDB 4KQ3H 5D2NA 1T1YB 2HTKD 2QQKH 5BOZG 2A6JA 1KN4H 1T7VA 1K4DB 4EUPA 3QXAA 4UAOC 3TEUA 1HH6A 2LU4A 5EBMB 4G5ZH 1Q9OB 5FYJD 5C2BH 4UUJA 5C7XH 3GHEH 4F3FA 1CICA 3O0RH 1CN4A 3FB5A 3SJVB 1PLGL 4X5LA 4PRDB 2F53D 3AREA 3REVB 3GBMH 2J88L 1CFVH 4KMLB 1FGVL 2XPGA 4WUUA 3O6FC 4JQVC 5T1KA 3SBWC 4Z5RB 2VXVL 2UVFA 3T0BA 3S97C 1VFBA 4JM4L 2V5RA 4JFDA 4X5WA 3RIFK 3PABA 2E7MA 5EBMA 4WHTA 1U8JA 2IBZX 1IEAA 2QHRH 4PJBB 5ISZB 4HEME 2WP3T 4QKXB 5HDBF 3SE9H 4WFED 5L7XH 4ZXBC 1JF5A 2VO5A 5GGSY 5ACLA 2XPGB 3SDCC 2A77L 3P77B 1T2XA 5GRJH 1X7QA 4S1RL 4X98B 3PQYB 5EU6E 2IANE 1CD8A 1YECL 2JJSC 2VH5H 2NY5H 2GSIA 1QFUH 3CVHB 4KK8D 4D3CH 4ODHL 4S1DD 1WWCA 1QRNE 4ZTPH 3OPZL 1T3FB 2HJFA 1IL1B 5IW1B 4YHNB 5TQ2L 1RUKH 3QRGL 4ODSL 4PB0H 2YPKB 1QYGL 2ADIB 3MV11 4ZYKA 4RISH 4L8CB 4LPCA 3MRQB 4LGRB 1FFNB 5B22A 4JGMA 2AERT 2Z9TA 1YY8A 2YD7A 4OLEA 2KZ1B 4U0RB 4JM2A 1NL0L 3LVEA 3Q48A 1ZLVK 4DOHE 5M7QA 2VLKE 1MFBH 1NDMB 1ZEAH 4NQCD 4RMWA 4HKXB 3V6BR 2KDGA 1QLEH 3C60B 2VXTH 1YEEL 3RL2B 32C2B 2VUOA 4YFDB 3TZVC 4RGNE 2C4FT 2X05A 2IQAA 3C6LD 4FABH 1CL7I 5GGVY 3A0OA 4ZFOA 4UINH 5B8CA 2GQHA 3QH3B 4RQQA 3VMPA 3K4DA 1CIDA 1U6AH 3HG1D 3U9UB 2QJDA 2W0FB 4WCYH 3VFOB 2DD8H 2WBJA 5KVDL 5ACMA 3LKNB 2EIZB 5I8OL 3TA3D 3HZKA 4H26A 4Z6AT 3UBXG 5HHOB 4Z7UE 1J11A 5C0RH 1QSFA 4GRWF 5IBLD 2B0SL 3ETBF 1HEZA 2ZUQC 3VWJB 3SE3C 1QSEB 4PJ9A 1FYTA 5D5MA 5FA3B 4RFOH 4OKDA 3VXNB 1NEZB 3GBNL 2B39A 3T77A 4S0TD 4XWGL 2WWKO 2W0FA 5A2LH 3VFOA 5H8DA 2X4PB 2YEZB 1K4CA 2PUQT 4YDVA 2IAMB 1NCAH 3SDDB 2FD6H 2YD5A 1AQDA 5J1SC 1RUML 3RIFF 3I3EA 3WFDL 3B9KD 4XP5L 3V7AE 4BFBD 4MSWA 3PDDA 1B9ZA 2EDEA 2UYLB 1PQZB 1GZPB 3FFCA 5ACZA 3DIFA 1RUMH 3KLHD 2VDNH 4I3RH 4F15B 4X7TB 5GGSB 3RQ3A 3GGWB 1I9JL 3QHTC 4J23A 1AO7B 3QI9B 3JUZA 3L3KA 5E8PA 1NC4D 4KQ4H 1NBZB 1VADA 1RUAL 4RIRB 5FECA 2X09A 1XFPA 1GIGL 1VPOH 3GMOA 4LSRH 3CFKB 2FYYA 4JB9L 4ZUVA 4UV7H 2IH3B 1XGRA 4XP1L 3VXSD 2AGJH 4FQXC 3QUKB 2IGFH 5A43C 3F65A 3IXAA 3HI5L 4M03A 2AJZB 4JQXA 4I2XB 4XPHL 4OZIA 1IVLA 2AI0L 3ZDYF 4G9DA 5GQBA 4P2OB 1DBJL 3MLVH 5DJ0B 3SKJH 1IGYA 1YMMD 5CEZD 1ZE3C 1WITA 2AJ3B 2DQHL 1KSRA 4QRSB 3GSOA 5SX5H 2F5AH 4CVZA 3SBWA 1P2CA 1RJYA 4HWBH 4J3UA 1LDSA 5E00A 3TZVD 2PTTB 1IL1A 2GSIB 1LO2L 1U92B 5GZND 1IGCL 3C09B 5F9WB 4XGZB 5E56A 3Q6FA 1JYVA 4YBHA 5EORL 5DC0A 2BMKA 5CJ5A 4OCMC 5DJ2A 5TDOA 1ZV5A 5IJKC 4ODXB 1A02N 1J5OH 1IC4L 3MRFB 4FA8A 2E7HA 5DXWA 2DLFL 4HKBA 1F4HA 1EO8H 3SDAD 2BNQD 4YPGB 4CMHC 3DGCR 5JXAH 4KJPD 3NH7L 4JKWA 4CGTA 2CR3A 4KJYB 5JNYA 1U8JB 1ZT4A 4PJDF 5EIIB 3FRUB 5BVJA 3NACH 1UCBH 1EPFA 4KK6D 1NBYA 4XCCL 3ARQA 1I1AB 1BLNA 1W0VA 3LQAL 5EO1A 3I6KB 5HDQL 4EUPH 2K7PA 1NCWH 4JZNA 4Q6IA 2CIKB 4GQ9H 4L8SC 1K5NA 1QFWL 1J1XH 5CEXA 4LGSB 5E08L 3PDOA 4YQXL 5F9JB 1WEJH 4LSTH 5D7LD 5FO8B 5F7WC 2D31B 1F3RB 2F53E 1CE1L 1JWMB 1DP0A 1UWXK 2F19L 2YEZA 4LLAA 4OAWB 4PP1C 3DX7A 4MDJA 4HH8A 3BZDA 2XKNB 4JJ5B 5EU6B 3VD7A 3EYFA 2ORBL 3O6FA 2BCKB 1A2YB 2FL5B 1HSBB 3JWDL 1KEGL 1KB9K 4L8DA 3BEVB 4M48L 4WEMB 3WXVH 3THML 4X7SL 2C1OA 5TQ0L 5D1XD 3MGOB 2XG5A 1WAAF 1E28A 3TV3L 5EZLB 1TTUA 1HDMB 4UDTA 1V7NL 1LE9B 5T3XH 1KNOA 1QD0A 4PRPD 5IEHB 5CGMA 3D9AH 2ARWA 1LDPL 5C2UB 3U7YL 2DKSA 1DDHB 3O2DH 2NY1D 3BKCH 1EO5A 4YXHL 2H8PB 1NCTA 2B8OT 4L4TA 3BZEA 3WE6B 5SWZE 3QUXD 2CJUL 5D1QB 1DUYA 3TCLB 2C3GA 3KR3L 4RGNC 1IQDA 4LQ1A 1BWMA 1PZ5A 3QR2A 3ZKQD 5I1LA 1UH3A 5J12B 4FZ8H 5LGJB 4IIQB 1WEJL 4LSTL 1CXHA 3KHQA 3HUJB 1KJ2B 3EKCA 2WUCH 3QIBA 3H0TB 4NNXA 3L5JA 4UBDD 4DKEH 4MB4A 2YBRB 3ESUF 3GSNB 4RMTA 2BRRL 2APFA 3QFJD 1EHLL 2FR4A 2UUDK 2CK2A 4PJBF 3C08H 2NY3B 1NJ9B 1TTFA 1EJOH 2VAJA 2GAZB 1JGDB 1MQ8A 4FQLL 4QRRD 1WTGT 2X89A 4H8WC 4GUPB 5J57B 3F12A 4LBEB 2BNRB 4D0CB 3NOIA 3CZFB 3HC0A 3TNMA 5ELIA 3GMQA 4MNQA 5F1KC 3RVTD 1RJLB 2EH8L 1DCLA 4QOKD 3WJJA 1JNNL 5FAAA 1OOAA 4PJFF 1J0IA 1FFOA 2Y7QB 1JL8A 4U33A 1CGTA 1U8PA 3QJHA 4LCCB 1BZQK 4M6MH 5EORH 2IQAB 4YAQB 1QKZH 1RJZB 2CIIA 3HB3D 5CBEA 2K1MA 2EDBA 1OF2A 1JNLH 1IC5H 4PJEB 5JHDD 1WCQA 5GGVL 1W2KT 3FCTB 5AZEL 3ZO0A 4MA7L 4LLMA 2NY7H 5AUMA 4OBSA 2IFFH 4YHKL 5IMOB 3KWWB 2NY6B 2YXFA 4FQJL 5FA3A 5SV3A 1C16B 4M6ML 1CF8L 4BQ8A 3MBXL 4IRZH 4WTXA 3H6JA 4ETYA 5KVFH 5DMGC 1J88A 1B0GA 2WANA 5GSRB 3VFVB 3DUUA 3BMVA 1ZT4B 5EIIA 1PKQA 3NABL 4Z7WF 5F89A 4X5XA 2PR4L 4LLDA 3MMEB 1F11B 4NM4H 3JWOL 1CQKA 4PLJD 3D2UA 1BAFL 1M6OB 3EYOB 5E70A 1WZ1H 4I2XE 4R9HA 3WUWA 5I8CA 1X5JA 3OG4B 2EDDA 3EZ8A 4POZC 5CCKH 2H32H 5I1GL 1RMFL 4P5TC 3HAEG 3OAZH 1OAQL 2NY6C 4XCEA 1CCZA 3BP5A 1MNUL 4JPKH 3DVGB 4HEPG 1FQ9C 2C1OB 4M62L 4X4ZA 4XNQB 1BQHA 3RVVD 4EI5C 2XZAH 2NXYB 3ARBA 1I7ZA 1MRFH 3S8WA 5L2KE 1A21A 5GRVL 4HC1A 1X5IA 1R0AL 1CYGA 1PD6A 4P48A 5HI4D 3ALPA 1UC6A 5FM4A 1JZ4A 2V2XB 3BP5B 1DANU 5E1AA 4IJ3C 2I9TB 1FZMA 5CBAA 1FGNH 3MGAA 5D7LE 1H9VA 4QTHB 4Q9RH 1CL7H 1CVSC 1T2QL 5C08B 3GMRA 5E2WL 1BFVH 3EYUH 5A2IH 4L9LB 5ISZD 1MCPL 1MFEH 2NYYD 3KPNB 3PWLA 1NFKA 2P5ED 4A6YL 4RFNB 5DO2C 1PQZA 1CXLA 3FFCB 4Y4KA 5EUKB 2VLJA 4Q0XH 4MA8L 1ZA3A 3U4BL 2PW2A 1VFAA 1TVBA 1GGYA 4NQEA 4X6DE 1YC8A 4G6ML 1EA9C 3JV4B 3ARZA 4FP8L 5TF1H 1QNZL 2HVKB 3HRZB 5D96C 4H5SB 5KZCD 3C5ZC 4KZDL 3H8NA 1MHPH 2VE6B 2YRLA 4RBPK 4D0BB 1QSFD 3LH2H 1MCKA 1EAPB 4LBEA 4MNQB 4O51A 4WV1C 5FCUL 1VFAB 1U8NB 3DRTB 4PRIB 3K7UA 4LCCA 4NM8L 4GAFB 4YDJA 3MUY1 2ZOKA 3NFNA 5J06A 4M8VA 4AMKH 3FFDA 4B53A 1INDL 3T2QA 3EYSH 5F7DA 3LN5B 5BRZB 1KT2B 5IG7B 4B41A 5T1LA 5IKCB 1K2DA 4O4YL 1XZ0A 2DLFH 3IYLW 4K3DH 1C5CH 4M6OH 4WI9A 1R3JA 4QNPF 4MXWH 1N0XH 3HZMA 4POYA 1LP9F 4OZ4A 4JQVA 3H9YA 1VA9A 2UV3A 4MJ6A 2D4DA 4MQ7A 1MCSA 4U6XA 4TSCL 1DVFB 4OB5H 5CWSB 5J13C 4K3GA 2Q6WA 2AW2A 3I84A 3HNSH 3TH4T 1AXSB 3MBXH 3T0WA 4KV5E 1ZTXL 5LAXB 4NWTL 4ZFZA 3V4UL 3QNZB 2ZJSH 3MV9E 2F54B 3UROR 5HHMB 1OGAD 5GS0C 4Z8FL 3V52H 1SJXA 4H8WL 2VZ1A 3UDWA 1C8PA 2EYSB 2DMKA 2RIKA 3HS0A 5C0AD 4BH8B 1RZJC 4FTVE 4A6YA 4IOFC 3RPIA 4OBRA 1RZJL 5K33A 3IRPX 4NQXA 2QADB 4HULB 3QG7H 4OT1L 4NNYA 2YPKA 3HI5H 5FIEA 5HHVL 3UP1A 4Y19B 2PO6B 4P2RB 3ZKNC 3WN5C 1PG7W 4HAGA 1D5ZB 3T4AB 1JHTB 1JF6A 1LWRA 2VJXA 2DI7A 5I9QC 4OGAC 3V9FA 2IJ0C 2VLJD 5C1MB 5JW5A 4JM2C 4HGMA 5DC9B 4LMQE 4TRPL 2M8XA 5IJVA 4F37K 1DBBL 1RZGB 2PCPA 2DRUA 1UCTA 1J0YA 4KK9C 3NCYP 1JYXA 2LAGB 5FUZH 2ENYA 4HT1H 2JJWA 5E1AB 4U3CA 1KCUL 4P57B 3MRJA 4UIMB 3BN9D 4DAGL 4KRPD 1IAKA 1ZANL 3HMXL 3IRZA 3RDTD 5DK2A 4N90E 4HK0B 3RZWA 3VXQB 3KPNA 2ZPKH 4J4PD 4AQ1B 1RJLA 3S35H 1SEQL 1UM6H 3ARBC 3Q3GA 4P5MA 4K3EH 3K2UH 1OD9A 4WTWA 1EEYB 3U0TA 3MROA 4GW1A 4RNRB 1IAOB 5EOQL 2YMXH 2DI9A 2IH1B 4NZTH 4Q9QL 1FVDA 3WSQL 3OKKA 2CIIB 1AR1C 3B5GA 4I1NB 4X4YA 2IF7A 4JDZB 2VERN 4PJ5A 43C9A 3KPQA 2JJSA 1DEDA 1UM4L 4NKDA 5J11B 3VXRE 4XMKH 5EU3A 3QB7C 4OD3H 5IQ9A 3C60D 3VA2C 2V7NA 5F8QC 5HJ3B 4XP6H 4L9LC 1I1YA 2PYED 1RHFA 4LEXH 3EIFA 4HWUA 4MJ2A 4HG4J 2Q20A 2GW5A 5D71H 2CGRL 3TIDB 5IMOA 3NABH 4Z78B 3IFOB 2P24B 4WI5A 2EDFA 4PJ7F 4XMLH 5IVZB 4RGMC 1NFDE 4LDEB 4GMSH 5EU6D 1N2RA 3TBWB 1JGLL 3O3EA 3SCMC 1S7TA 5HHXH 2VAAA 2IALB 3FTGA 4BSVA 3CSPA 5MP6H 3TZVA 1CFQB 2K9UA 4ENED 5I8CB 3VRJA 1G7JB 2FX9L 2R0LL 4MNGE 1J1XL 3QDHA 3B3IB 3L3GA 1UZ8A 2FYYB 4ZUVB 2YOCA 1I9IH 2CMRL 2D0GA 4QGYA 2B5IB 1DQQA 3HE7B 2W0LA 4OCYL 4WV1A 1U9KA 5FGRA 3NVQA 3KLHC 2AJZA 1LK2A 3QJHB 4OCSL 5JMRA 4IRSD 5IB2B 1Z2KA 2GTZB 5HBBA 1NQBA 3TGXA 4ELMF 1YPZE 4O2EB 3RFZC 4ODHH 5DMJB 4YC2B 2Z0BA 5D72H 3MGTA 1ZLVH 1DR9A 1JPST 3B4NA 3DGGA 3MLZH 1NAMB 4M7LL 1TVDA 2ARJA 2IAMD 3LQAC 5I1HL 2HLFC 3LZFL 4D2NA 2VR4A 5E2VL 4YGVB 5JW4N 3ARDB 1MCLA 1NC4B 4IRSA 1AO7A 3MCLH 3CU7A 2Y23A 1MRCL 3W2DH 4M9OA 3UC0L 2QLVB 3IFPA 3L1OL 1G6VK 3AMLA 7FABL 2XN9E 1F3JB 4U6YB 5M95B 2EC8A 3E1F1 1R3JB 4MNQD 7CGTA 1TVHA 1QSFB 3GJFH 5I74B 5IB4A 4ZXBD 3KPSD 2H3NB 4J7RA 2G5BA 4I13B 1PX3A 3GB7A 1UKTA 1S5IH 2WMPA 1HHHA 3H9SE 5TDPA 1MRCH 4IMKC 4LVHC 3VGAB 1K5NB 1MCQA 5I1IH 2W0PA 5C0AE 1T7XA 1WFTA 2GFBB 4JHWL 5D6DC 3EFDL 1W72B 1GHFL 3UZEA 3V6ZB 4QRUB 4NHUB 3HMWH 1MY5A 4W6XB 2NY4C 5HYJB 3BX7C 4MXVE 2X4RB 4K23L 1GIGH 2ESVB 2JLLA 4ORGB 5BO1H 4XNXH 2O93L 3KJ4B 2FSEA 3H7BB 4M43H 3MXWL 5ALBH 2R1XA 4TYUA 3CXDL 3GSRA 5I73C 5IT2L 1KC5H 1MCWW 4JJ5A 4QXGH 5EU6A 2DQTH 4JFOA 4NKDB 5JXEA 1DN0B 3MLRH 2Z91B 1XIWB 1E28B 1CE1H 5K9QI 3MUGA 4HIXL 5EBWB 5ILTH 4JGJA 1KN2H 2F58L 4MJID 3T0EE 4XP4H 3D85B 4M5ZL 3SE4A 3FO2B 3QIWC 2QL1A 2VQ1B 2ZG1A 4JVUA 4Y4FC 2AK1L 1OTTC 3GMNB 4KJYA 5SWSE 5JNYB 5HJ3A 4P4KA 5HHOE 4EI5B 2DBLH 3OJMB 5D2LB 5IFAH 4KKCD 1L4IA 4ETQA 2IPUG 1WZLA 4PPTA 4CDGC 1AGDA 3OGCB 4XCCH 1UYWL 3BP6A 3JV0A 2Z8WC 5CKAA 5I73B 2AJYL 1MCJA 2XRAL 2B0SH 3IAGC 2NY0D 1NAML 1B6UA 2X4NB 3QUMB 4YHZL 1B0RA 4QOKA 3QDJD 4BELD 1MREH 1WGOA 4M1DL 1Q1JL 3PP3H 3L3IB 4QT5A 1U95A 3L7EB 3SDXB 1OGTA 4D9RE 1KB9J 3CIQA 5DJ2B 5KSBE 4U6VL 5DVNA 2G9HB 2YUXA 3TBSA 1JPGB 1HYRC 1EBPA 1IGCH 4AENB 2VISA 2HN7A 3FB6B 3V0VB 1AHWA 3S3JA 5DUPL 3CCHA 4NT6B 5C0CE 3D1MC 3S36H 2VZVA 1X9QA 2E6PA 4Y1AB 4HS6A 4M61A 4ZAKB 3FAXA 1QRNB 2I26N 5MI0B 4LFHD 4EOWH 3BP4B 3FQWA 3UTTD 3P30H 3QEHB 3ECBA 4IRSB 1S8DA 3L9RA 1FBIH 5E8NA 3W9EB 4EN3A 3JXAA 4J1UA 3MYJA 1F90L 4QHUA 2EE2A 4MA3B 4XAKE 4NRYA 5AYQA 4JREB 4OF8A 4K9EL 1BGXH 1JTPA 3U2SA 3NCJL 4FXKB 4J6RL 4OCRL 2MJWA 4ELME 4XP1H 2ED8A 4K3DL 4X0KA 3P3YA 4FFZH 4JR9L 2BNRD 5KSAD 4Z76B 1BBDH 4R8WL 5IOPB 3Q6GH 3IGAA 1KPUA 3H0TA 1JN6B 4NN5B 4AY0A 3F8UB 3M8OH 4N68A 3KPSE 4TPRH 4F2MA 5F89B 5ICZA 1CLOL 2BK8A 3KVQA 4NM8H 3LN4A 1JPTL 4MDJB 2B1HL 4ZTOH 4PRPE 1TNMA 3PG2A 4G80B 3ZMRA 4ISVB 2O61B 2IPKA 4JFFB 1JF1A 3U48A 3BPOC 4C4KO 5J13B 2CQVA 2NXZB 3KPSB 5GS2D 3U0WL 2DQIL 1P6FA 2BNRA 4OCWL 5JPMB 5KVGH 3BE1L 3Q0HA 4H8WH 4FTVB 1J86A 1PG7L 4YHPB 1HDMA 4UDTB 4XTRC 2OBGA 1LE9A 2EDTA 5H37G 4JFOB 3I85A 3ZTJH 4Z78A 2EDKA 2JCCF 4M93C 1IMHC 1EDQA 3HNSL 3C2AH 2D7PA 4M8QB 4XWGH 3V7MA 1ORQB 3CZJA 1XCTA 2CDEA 3VGAC 3G5XA 1X5XA 2FATH 2X4TB 4G6AC 1J18A 4FXGB 5I1LB 3LHPL 1N3NB 5BMFH 1MCPH 2FEDD 2EO9A 2VLME 4P3CH 1C12B 4NZUL 4GOSA 1ORSA 4NUJA 5IMLA 2VOTA 2J6EH 1S78D 1PFCA 2FIRT 5EZJA 1OCWH 2FX8L 3ARDD 1HNGA 1ADQL 5IB3B 1KACB 4OLVH 3NPSB 2OZ4L 2X42A 5D1ZC 2DQGH 1WWWX 4LIQL 4X83A 1MPAL 3KPMA 1FCCA 3G6AA 4HUNB 2GTZA 1NCNA 1OGTB 3F7YB 1Q8MA 5C0IA 2HT4C 2PXYB 1KB5H 3CJJA 1TVBB 2J1KA 4G3YH 4X8JA 4GSDH 5D7IF 1JHKL 1F13A 1A3RL 3QUMA 3T3ME 1ACZA 4AEEA 1K4DA 5I8EA 2EIBA 3R06B 1K3IA 1T3FA 4R90L 5FA4A 1I8LC 3ARDA 4MNQE 4JO4H 3TBSB 4ZYKB 1OLLA 4Y5VB 4HH9A 1QUNA 1AHWB 2HT3D 4YHNA 3LKQA 5JORA 1QPXA 1RUKL 1H15A 3QRGH 3H3BC 2X5PA 1INQB 2VAAB 4IDLA 4WY7H 1MQKH 4XVJL 3QWRA 1P7QA 3RIAK 5D1ZB 1BAFH 3H9HA 3D85A 4B7IA 3GSUB 2XWTA 2YKLL 3WHXA 4FOMA 5K9KA 3D39E 5E8EA 3ILPA 4WHTB 5GRJL 1S8DB 2XI9A 4LQFH 5F96H 3AS2A 1T04A 2UVEA 4XP9H 1TITA 4Q9RL 3ILQC 1R5IB 4GRLB 4JKKA 1AGEB 1U8HA 3OAYH 4FFVC 2OL3A 4LSQH 4WGVB 5T3ZL 5F71A 2A9NL 5GPRA 4DEPC 3EJYC 4F7TB 3VFGH 1IAIH 1XR9B 1MJ7H 2R0ZH 5GZOD 3D85D 4MQTB 4R4NC 4K9EC 5IESH 1B2WL 3DLQR 4XZUB 2DQFB 2MQ3A 5F7KC 3LRSB 4HHAB 3U0WH 4RFEB 5A2JH 1A4JB 5IBUG 2ZKHH 5ANMB 3RGHA 5IT2H 4RWYL 4OSUH 3NIGE 5BXFB 4XPBH 1WBYB 2Z92A 1CLOH 4WI8A 2OJEB 1EJ6A 3O4LB 1QLRA 3H7BA 1Q9OA 2EH8H 3QUYC 5I18L 3T77B 5AWNL 2EZ0C 2IADB 2E8YA 1WC7B 4P57A 1AGCA 3UTTE 5BJTB 1ADQA 1AXTH 4BH8A 2DDQH 1A7QH 2XACC 5A40E 5EFIA 1GGIH 2P8LB 1I8KB 1C08B 5FYJE 2I24N 3QDGB 3L3DB 4X6EB 2AV7A 5IMMA 1AXTL 1QEWA 12E8H 3JWOH 5CP3H 2GJJA 3SDCA 5C0CA 3BXNA 3TO2A 2JKXA 3BWAA 3QUML 1CQYA 1RHHB 1U91B 3IDGA 1YMHA 1FH5H 4AEFA 2C26A 3REWB 1JWSA 1T1WB 1WTLA 2XT1B 1D5ZA 1FVCA 3JTSB 3P30L 1N3NA 1ZHLB 3GZKA 3T3PE 5IWLC 3T09A 2VDPH 5DMGD 4CKVX 1MRDL 3AS1A 4LVOB 1TJHH 1AIFB 2ILLA 4X4XB 4FMKA 1FL3B 4PJBE 4MHHG 4X6CA 5B3JF 1DEEB 4K07A 2EC9T 4UT7H 1D5MB 1NGYA 4YXLH 4F57L 5ICZB 1F4WH 1F8TH 3JVGA 3W39A 4NQEB 3B9DA 4G8EB 3KJ6L 3RIAF 2HT3C 1IQDB 4PJIF 3ROOB 5I15H 2HKFL 2PYEA 5IHUL 2Z91A 4L4TE 2DJ4A 1IGIH 2R0KL 1VGKA 1RUPH 3KPSA 4PG2A 3A6BH 4CVZB 1G9NH 1JHLL 2OL3L 3C9NB 1ZVHA 3O2WL 4QRSA 4M48H 5LQBL 5CGYD 4MVBD 5IK3B 2VDLH 3S37X 2Y9RT 3H3PH 2L0DA 3GSNA 1B0WA 3WIHL 1P4IH 2UZXB 5DRWB 4PJGF 4UILH 4FQHA 4JO1H 1UYWH 4QHUB 4P2QE 4FQXA 1ZT1A 3QI9A 5E8NB 1ZLUH 4HXBL 2AJUH 3MYJB 1BF8A 2UUDH 4JLRB 5EOTB 5IG7A 4HIJA 1ZLWK 3GDBA 4KROC 4HS8H 4Y16C 5ALCL 4G6AD 5HPMB 4JG1L 4YZFF 2X40A 5EO9B 4R4ND 5EUOB 1CIUA 43CAB 4I9WD 3P0YH 1QA9A 1AXSA 4FG6D 2DL9A 3IFOA 5DWUL 2VMFA 5GRZA 1NMBH 4BSVB 1C5BL 2CO6B 3CFDA 3NH7H 5DJCA 4AIXA 3V5KB 1N2RB 3TBWA 2JIXA 4BFGA 1H3TA 4P2RE 3O2WH 5LQBH 1A6ZB 4CJ0A 4XPAH 5LCVH 2Z8RA 1GYAA 1RUPL 3HE6A 1P84J 1UZ6E 3N1FC 4GLRI 3SCMA 1JTOA 2NX5B 4F7TA 5ADPH 5BW7A 1R3HA 1XGQA 1G1YA 3KXFE 5FGCB 5AYUL 3DX7B 3J7HA 2OI9B 2BJML 3LDBB 4OFPA 4P49A 1DQQB 4JO2L 1TZIB 5BVPL 1UVQB 4QEGA 1QLRB 3KYNB 4AYFA 3C6SB 3C2AL 5EOCL 2VLMD 3TT1H 2P5EE 4GT7A 4IHOA 2GTWA 5C0GA 1LEIB 4P46C 3JWDC 4KJWC 2YA0A 1F02I 3RVXC 2UZYB 4LNRA 5D8JL 3AM8C 2EH7L 4QRRB 4ALAL 3WLWD 2YRPA 1UKQA 3KAAA 3TBVA 8FABA 4BKLB 5ID1A 2ICEB 2CUMA 4MJ4A 4N0CD 4LLYB 2YS4A 4QRPD 1J1OL 4FQ1H 5DJ6B 4XCNA 1H3PL 5D9SA 5D5ME 1G9MC 5C09E 1JIBA 3GFUA 4WO4B 1QSFE 5IVOA 1TCMA 2FWOA 3IS1X 4NOFA 1MJ8L 2B4CH 5JW3H 1UQSA 5DK0B 2M1KA 2W92A 2YZ1A 3AY4A 4PS4H 3DO3A 4I77L 2J8UB 4WW2A 4BKLA 5C0BE 5IBTH 3ZE2E 2WW8A 4P46B 1EO8L 4PS4L 1QLFA 1IAOA 4KQ4L 4IS6A 4Z7NF 5IFJA 3D0LA 4FFWD 1JGEA 1VKXA 4M7JL 1JNHB 1EMTH 1OT1A 3MFFB 1MELA 3ZYZA 4D0DB 1VGKB 4H1LG 1LK3H 3VXSE 4PRPA 2V2WB 4X9HA 4JE4B 1OAKH 3ULVL 3KLAA 1U3HD 4ONFL 4ERSL 2CLRA 2IFGA 4UQ3A 4HMDA 1M7DA 1YEDA 2FX9H 5F3BA 3MRKB 2ZCKH 2OLDA 3ILPB 3Q1SL 4Y7MA 3ZKND 4HWZB 5GGRA 1FL5B 1T1ZA 3D39B 4PGBA 1HXMB 4PBXA 4PRDA 4YDIH 1O7VA 5F7YC 4OGAD 2AEQL 4EEEA 5KW9H 5IIEB 1UADC 2D9CA 4WDIA 1KEML 4GAYB 3W9DB 3QFJA 4LSUH 5CBEB 1FVCB 2APXA 1A7PH 1P69B 1YN7A 3JTSA 5FOBA 5KSUA 1F00I 5JOPD 1CZ8L 1C5CL 3BPCB 4M6OL 3LD8B 2PXYA 2NCMA 5CP7A 3NBNA 1I3GH 3S96B 3B9KB 1HIMH 4PRIE 1JGUL 4HUVA 4XMKL 5DQJB 1IAIM 4TTGA 3STZB 4TSBH 2VZSA 5TE7H 2A74A 4LSUL 5KVEL 4HIHB 3VFVA 3OKNA 5CJXC 5J0BA 4NFDA 3HTLX 4Q58C 4WI4A 3QXDB 2GJ6A 4L3EA 1ZA6A 5DGRA 3BJ91 2VR5A 4KRMB 4XPTL 4KTDL 3S35L 1EIBA 3FO9B 4PJDB 2DQCH 4LHUB 4HUXB 3JWNC 3TA3B 1NGQL 5DC4B 1Y0LA 2V5YA 3LPWA 5JHDA 3BGFC 1ZANH 3HMXH 4LKCB 3AXLA 5H2BA 2ATPB 2YK1H 1GGCH 3VXNA 3MOAL 1LEKB 1J0ZA 3UTPD 5DD5H 1RHHA 1MLCB 3QNXA 2Q8BH 3DMMB 3K74B 3U4BH 2F54A 3BZEB 5CD3B 3SKNA 3SDAC 1YECH 3BQUA 3TNNA 5JPMA 3VGHA 1J0HA 4MZ3A 4K23H 5C92A 5HVWA 1E4JA 2DLEA 1DBML 5DQ9A 3JVGC 3RL2A 5I15L 1WCBB 3QO1B 3WBDA 3IFLH 3MCKB 5TFSH 4MWFA 3O6LH 1F8TL 2H2SC 4Z7WE 1QFHA 2IMMA 5GS1C 3WXWH 4BM7A 4KTEH 1NGYB 2ZSWB 4L8DB 2KKQA 4DGVH 2WIIA 1X7QB 2AXFB 3QA3A 4XVTH 3U6RB 4Z95H 2VKXA 3G6JF 4ZSOB 3ZTNH 2V9QA 2IPTL 3PHOB 1I3RA 4Y5YC 4TOYL 1RD6A 4K55A 4GRLC 4PLJC 1P9MA 5IQ9B 1CD1B 5C09D 3PWNB 1FH5L 2HJFB 4JPKL 4AEHL 4OKVA 4HXAL 4FQCL 4BJLA 3SGEI 3WHE0 2R2BB 1MIEL 1P53A 3B6SA 4APQD 1LEIA 1MFDL 5TQ2H 4TSCH 5E2VH 3MLTB 2BJMH 1KIQA 3FB5B 3SJVA 2EDQA 3NIFE 1OP5H 2VXUH 5KVMC 1QP1A 2EO1A 1DLHA 2QR0B 5FM5O 4WJ5A 5AAWA 4Y1AD 2KQNA 1A7QL 3TBYA 3DX6A 3PWPA 1KJ3L 3TM6A 4G8IA 5DVLA 3MUHL 4FQQA 3BT2H 3R06A 4LLUA 2X1QA 4JFDB 4N5EC 2W07A 5IM7A 1S7QB 4N8PA 1KFAH 2GJ6D 1CLYL 1NMBL 1K8IA 4YK4C 4WO4A 5DDHA 5L8LB 5L8KB 3JV6A 3OJVC 5I2IB 4QWWD 4X6FB 3DMMC 1TNNA 1M1SA 5H35A 3FN0H 3BAEH 5FGSA 4RAHA 3MXVH 1JE6A 3S36L 3DX6B 4L4VB 2LVEA 1HHJB 3FO0H 2ADGA 5DQDH 3RX8A 2XWTB 3WHXB 3T0AA 1AO7E 1JUFB 1N8ZB 5EU7C 1KJ2H 4FQ2L 5MENB 1QR1B 4JY5H 1HQ4B 5E2UH 4KZDH 5IBUB 3CLEL 3SKMB 5HYSG 3MRNB 3E3QE 4XAWH 1QNZH 3RVWC 2RQ8A 1MF2L 2DQJL 2OJZH 3L3JB 4PJAF 3I3BA 5FO7B 5A3ID 4KKAD 1KOAA 5HHPA 1T0MB 1N5AA 4S0SD 1GZPA 3UO1L 5DI8B 1CGYA 3FO1B 1YEIL 1VSCA 1N26A 2OQJB 4B50A 2H2PD 1YNTA 2C1PA 4PLKD 4Q6YA 3QH3A 4RQQB 5C86A 3LEXB 3F58L 5LXGL 3O2VH 4F7EB 1H15B 4ODUB 4BFEA 3ZHDA 5KSVA 5SWZB 3HB3C 3O9WC 4H1LB 1WBXB 4F57H 4RZCA 3SQOH 1G6RH 1QO3A 1X5AA 1MCFA 4FMFA 4V1DD 1YEFH 4FZ8L 5DI8A 3IAPA 1I8IA 4NC0B 1BIIB 5E4EC 3O41B 4EXPX 1X44A 1CXFA 3TJEL 1LVEA 2ICCA 2VDPL 4MA1B 2QQNH 1T20B 1QQDA 4JFPB 2WWKT 3UDWC 1KPUB 3B2UD 2UWEB 3C5ZA 4RAUA 2EEAA 1N6QL 4QHMA 2R0WH 3QG6A 1OCWL 1XF5A 4NBXB 3IDIA 2ERJC 2XY1A 2F74B 4PRPB 2MTPA 1BP3B 2W60A 2ZUYA 4LCWD 3HFMH 3QDGD 2VKWA 5E5MA 2AEPH 5ENWA 3LHPH 2B5IC 4Y5XC 4D0BA 2ADFL 1KXVC 4DZ8A 3IJYA 3MLXL 3VCLB 1L0XA 3MR9A 2GSGA 5DA0B 1EAPA 1JWUB 4XNYH 1QBMH 5EN2B 4ZUSB 4OQ1A 5JOFA 1XGPB 5D2NE 4NNXB 5E8PB 2PR4H 1NCBL 4UT6L 3RVTC 3OKLA 4CN1A 1FZMB 4YC2C 2WLZA 2XKNA 1IEAB 3W39B 2F19H 3V7AG 1X5KA 4OKVB 5SWQB 3IJHA 4U3XA 1HSBA 3S6CA 1QSED 5EPMB 2IFFL 3TBYB 3UYRH 4XXCC 4DGVL 2IQ9L 1I9RL 1T22B 4NYLB 3FO0L 4TUOB 3MRRA 2UWEF 1NEZG 5FEBA 5GJTH 5DD3H 3IDJB 4HUMB 1XGYL 1SBSL 4TUJA 1ZAGA 1BZ9B 4APQB 3SDCB 2YR3A 1UCBL 2Y36L 5F3HB 1BVLA 4LVNB 1U91A 4ZQKB 1MIMH 3MRHB 4NP4L 2NY5C 4EIZC 4QOKE 2KBGA 1F2XK 4LLWA 3PABB 2R8SH 2UZIH 5GGTL 5J4MA 4F33B 3I6LD 1I3RB 5CAYB 2AJ3A 1EEZA 3VFUB 3L5XH 1EH9A 4PGJA 2MHAB 3QIWB 4YHML 3OXRA 1HHIB 4K9EH 4I3SH 3UTSB 4ZPTA 2YUVA 4G6KH 1UZ8B 4PJCF 4N8CH 1SM3H 5EA0H 1I7TB 3C08L 4NQVA 4TULH 2IWGA 3N1PC 1KTRL 4KZEH 3WDJA 1WT5A 3CFDB 4AMKL 3RWGA 2ZUTA 4ZD3H 3O4LE 4Y5VC 3KYKH 2NPLX 4C4KT 1NDGB 1RU9L 1RZ7H 2RHEA 2FGWL 1Z9OA 4HV8B 1HHKB 2APTA 1NBYB 1AY1L 2F15A 1WWBX 3AGVA 1IGMH 2OL3B 1JV5B 1T04B 2NLJA 4L29A 1FFOB 2Y7QA 4XNZC 3MRMA 2ITCA 3F6LA 1NGPL 4PUBH 2P42B 4YFLF 5IMKA 2J6EL 3IFPB 4OLXH 1A9BB 3GSWB 2NZ9C 4U1NB 5CUSL 1ND0B 1YUHB 4NZUH 4OD3L 5IUSA 1BBJA 3N1QC 3VG0H 4Q0XL 4HCRA 4LLMB 1BQLH 2CK0H 4DKFL 2PETA 3T0XA 1M71B 5FYLE 1S7WA 4R0LB 3BFOA 5IB4B 1FDLH 4YEEA 4YDIL 2XQYG 3BUYB 3PV7A 4OTXL 3OHXB 3EYQD 3S9DB 1L0YA 3VXME 1T21B 1J12A 1FSKC 4LASH 4IRSC 1XGQB 3MJ9L 4UIKH 5B21A 4EKXA 1IQWH 4AM0B 3VXTB 3WFDH 4LLVA 4MXQC 1JWUA 5JO5A 4K7PH 4WJ5B 4HBCL 1MRFL 5HYJA 1BD2B 5EIQA 5GGTA 2FJHA 1DDHA 4NN5C 3UPRA 3ABZA 2VABA 1KYOK 3TN0A 4PRAA 4YDVB 3CX2A 2H8PA 2B1HH 4PJFA 5GSVA 3TFKD 5JMOC 4HWEH 3RWEB 2R15A 3BGFB 4XNXL 2JK5A 3MV7B 4CL7A 3DSNA 5BS0B 4PB9L 2CLRB 5D6DA 5I1GH 4MZ2A 2V2XA 5LGKA 5HHMD 3E2HC 1D5MA 5CEZH 5I1DB 1CZ8H 1U6AL 4JFYB 1C1EH 2X6MA 2MPAH 1G7IA 3NIDE 1TQBB 2A1WH 3M45A 1CK0H 2GIYA 5GGUB 1C7SA 3AB0B 5I19H 2D4FA 4C56E 1FBIL 1SJEB 5DSCA 1T7YA 4PJIB 4ONHA 4MDIB 2WNGA 3K1KC 4XCFH 2ZOLB 3AY4C 4YO0A 4XC1L 4LHUG 3CFEA 2BSRB 4XNMA 2DIBA 1HCFX 3HAEB 1MOEA 1ZWIA 3KYMB 3WL9A 1FFNA 2Q76B 3MJ8B 5FV2A 2P24A 5L0QC 2ADIA 4JO2H 5BVPH 4E42A 3D18A 3EOYG 4LPTA 2VRAA 4I3SL 5IW1A 4KK6C 2YPVH 4YGVA 3CCHB 3WS3B 3MRGA 3NCFB 4XWOC 1U8NA 4IEFB 5K93A 3ME0A 1OHQA 4QRRA 5F9DC 1MCNA 4YDJB 5D7LB 1Q9KA 4PGDB 1JUFA 3VMOA 3MJ9A 1A6UL 2AK4D 4X4ME 1EAJA 4BZ1H 2AJYH 4MA3A 1T6WA 5EO0B 4APQA 1CICD 4S1SH 3RUGA 4OCYH 4OQTA 3P0YL 4U0QB 1ND0A 5GJTL 3MJ7B 2LABA 3DV6A 4KRNA 1JPSH 4ENEC 2EIZA 3WFZA 3HI1B 5CZXD 4W70A 3KXFD 3PWPD 2AK1H 3RWDA 3ZSTA 4UZGA 2DWDA 5D93B 1CVRA 3G5ZA 5CP7B 3HAEH 4LMQI 3I50L 1AHWC 1KN2L 3ZKXB 5C0NC 2EH7H 4ALAH 1BVZA 1FZJB 4CW1B 5J1AA 4HMEA 4YX2H 4ZUTA 2NW3A 3K1DA 2VDKL 3V5HA 5CLWA 1XGPA 3DV4B 1KC5L 4HFWA 3FB8B 1DN0A 5K9OB 1XF2B 1KN4L 4AIOA 3ORJA 3MUJA 3SDYL 5IGXH 4XZUA 2R4RL 4TNWK 2GJZA 4WHYG 1RJCA 4XHJD 2MOVA 5D7SH 4UQ3B 4PJHF 4QXUH 3S37H 2PO6C 4JKMA 3NN8A 2R4RH 1YMMB 4OLXL 3TYGH 4Y19A 4PP2B 5D2LA 5C6WH 2BXYA 4NQXB 3PHSA 1XCTB 1FIGL 2G60H 3P4MB 1R5VA 1HKFA 2W65B 1H3GA 1CGUA 2NZ9D 4OCXH 4PY7A 4FTVD 1IKNC 3TJEH 1MRDH 1QLFB 3FMGH 1XGRB 3H9SA 5DR5H 4RIRA 1CT8A 2YA1A 3QXUA 5JW5B 2D7OA 5E95B 7FABH 4XXDA 3RP1A 1HH6B 1WCBA 3OKOB 3QO1A 1LQSR 3QZWG 1R5WA 1WT5C 1OAQH 4ZUUB 1YMHB 4KY1L 5HYJE 4WI7A 1X5YA 4LNVA 4P0DA 4MGXA 4WU7B 12E8L 1K4CB 3IJSB 2HG5B 3IKCB 5GIRB 2RBLA 3DI2B 1P4IL 2ZZUT 3FQUB 4KV5F 4OQTL 5J3HD 3TIEB 3QIUD 5HYIA 3H3PL 3B2VH 3RU8H 1GJIA 1DQDL 5ETUA 2Z4QB 5HVFB 5JHDB 2DMBA 1Z5LB 4OD2B 5HVGB 4Z7UA 3RWHB 2AJSH 3SKMA 2XN9A 3KJ6H 2FBJH 2XTJC 4NO2B 1O0VA 1FYTE 3U9PL 3W82A 3ULVF 4OCSH 5J1TC 5HSFA 2BFVH 1P7HL 2WV3A 2GT9A 4ODWA 4PJXB 4PJEE 4YIQA 4GG6E 1F6LL 5ETUB 1A6AB 1NLDL 4OCNC 4MJ5B 3HC0B 3CZFA 3TNMB 3FFCD 4BK4A 1E4KC 4H25A 1RIVH 1Q72L 1WK0A 4JZJA 1R3IL 1Q0XL 3V8OA 1A9EB 3IB4A 1BQSA 4H26B 4HUVB 3NGBC 3I6GA 1ZTXH 4WHCA 4NJ9L 4JO3L 3TWCL 1Q9LA 1HK6A 5FUOH 3IGAB 4PGDA 3ZYJA 1ES0A 1IGJB 4XMLL 5KSVB 3MRQA 1H8OA 3HI6L 4LK4A 3DWTA 1YQ2A 3RVUD 3TZVB 3QIWD 1MHCB 5F9JA 3QISA 5IW6B 4Z0BL 4K8RL 4F7MA 3LS4H 5A2KH 1LD9A 1Y6KR 2D9QB 3BZFB 1T4KA 1P2CB 1RJYB 2NXYC 1VPOL 1QZ1A 2NZIA 3FQWB 3MREA 2DQFA 3L3JA 4W6YB 1K8DA 1A2YA 3T0EC 5JIIA 3MZTA 1AR2A 1D3CA 4U7KA 4HXAH 4K8RD 4WWID 5C0BA 3VDCA 1V3MA 4DVRH 5E5UB 4JRYD 3GJFK 1J10A 3BIBX 3MSPA 1S7RA 5KTEH 4GSDL 4KHTH 1CGWA 5CZKA 4DFIA 2EYTB 1IT9H 3FJTA 4I3RL 1BEYH 1UG9A 2VDNL 3KR3H 3MGOA 4FZEH 4RAVA 5BRZE 2VTFA 4YDLB 3CX5J 4N9GA 3KPTA 1RZIA 1GC1L 3EHBD 1DE4B 3QDGA 4P3DB 2YPLB 2G75B 5EZJB 4NO5A 1WLHA 3IFNL 3B9VA 3VI3F 3W0WA 2DM4A 3RA7H 4KJPC 3WUWG 4YUEH 4CADB 1I85A 5EUOF 5KSBA 4KHXH 4WW1B 3PHOA 3G5ZB 4LLYA 5IROA 5JOEA 3EOBB 5DJ6A 4HFUH 1RZ8A 2YN5A 4LGPB 2PW1A 4LHQB 4LPYA 1YNKL 1GOHA 2F53A 2Q8BL 3ARED 4AT6B 3RAJL 1FG2A 1A1NA 1U8QB 4YX2L 3TBTA 4HKJA 4WVRA 4IMKA 2HLAB 5CSZB 4OF6A 4XVSH 1JZ8A 2DJUA 1NJ9A 3GMOB 2EDJA 3VW3H 2ZUSA 4GG6A 3W11D 3IETA 1I8KA 1QBLH 3WNMA 4HGKC 1QLEL 5DQDL 1R3KB 1V7MH 5BZWB 3DETC 1H3WM 4Z7UF 1KENL 2Z4QA 1MHEB 1XGTA 1Q9WA 1KCKA 1YA5A 3MACL 4WIQA 2H1PH 4Y1AE 1CG9B 5CHNA 3KPOA 1A6TB 3KPRA 1G6RA 3RZCB 2JJTC 1C5DA 4L4TB 2J5LB 4H1LH 4W6WB 3STBA 2ICWA 1I3GL 2C5DC 5DHYB 4ONHB 5K9JH 2QSTA 4OD1H 1HHGA 1XF3A 4NCDA 4PJHA 2NXZD 4OLUH 1F4XH 3CPLB 2UZIL 1OP9A 32C2A 4LIQE 5GGTH 2NY4D 5TGBB 3QIBB 4O4YH 5E7FA 3BPLC 3O8XA 3QULB 5C8JA 2R23B 5TH2B 4LKXA 1TCRA 1AQKL 1DQLH 4E42B 4PJIE 3U1SH 2EEBA 3QUZC 5IKCA 3GHBL 4P4KC 2AEWA 3MO1A 1GAFH 4ELMA 2V6HA 5FO7A 1L6XA 1Z9SA 4BA8A 4NQSB 2I25N 1KGCD 3RNKB 5HGHA 3B9KC 2D7TH 2J4WL 2CDFB 2G2RA 1L7IH 3X14A 5DRWA 3OXRB 3HMXA 4EQ2A 1CFVL 3PWJA 5TF0A 4LPWA 2GJ6B 4DKDC 3X11A 1EHXA 3TJHC 3TVMC 4ZTOL 4DEPB 1PEZA 3HC4H 1EGJL 4PGZA 4R4BA 4PRNA 1QG3A 3RAJH 3N1GC 3I9GH 5L88L 1CE6B 4FN0A 5DD0L 1RUQL 5EOTA 1OTUD 4PJ9D 3D6GA 2XQBL 3H42L 4M61B 1CBVH 3X3FH 1DL7H 2YD6A 5HI5C 2YSSB 4LSDA 2QQKL 4U6YA 1KELH 1PZ5B 3V79C 4X7TA 5HDOA 1BFSA 1DEEA 3OAZK 2Q87A 2HMID 3PIQA 1F6AA 5DS8A 1FFPA 1OD7A 2W38A 2VC2L 3WDHA 4EXKA 2NY2B 2N4IA 4F37F 3DVIA 4YH6A 1F90H 3C8KB 3OJ2C 3WFHB 4N0UE 1HWHB 3WEXA 1EEQA 5FGBC 2N7BA 2Y6SC 2BNQA 3SDAB 1HEZB 2FHCA 3MLSL 3PQYA 5DUBA 4P46A 1AI1H 4GRWB 1SEBA 2F53B 3OBAA 4JDVB 3LEYL 4JEGB 3L3DA 3C60C 1YZZA 2WIMA 4XRCB 3SPVA 4F2MB 2A6JB 5DUPH 5D5MB 5L2JB 1FNFA 5D2NB 5ECJE 3TT1L 3O2DL 4YDLC 2GSGB 4KKAC 3KPRD 3Q5YA 2ATKA 1NKRA 1WF5A 5GS1B 4UIMA 2IMNA 3U6RA 2FJGA 5L8JB 5BO1L 2FBOJ 1T83C 2VLKA 4OUUB 1KBGH 3MNZA 3RDTC 2NY2C 4HS3A 4JCMA 1J8HD 2I9LB 4OZIE 4GKOA 4EBQL 1AD0A 1NDMA 2D03L 3DUHA 3THMH 5F1SA 3OJDA 3RVVC 4PJXF 5F1NB 4HJGA 2R9HC 5DLMH 2XRAH 3WJLC 4YBLB 5LG1A 1G0DA 2DB8A 4NQCE 1T5WB 4X7EC 4XGZA 2BNUB 4X7FC 5CHNB 4XHJC 3MNZB 1U2HA 3RGVB 4RGND 4P23C 1L9MA 4Y0GA 1V8HA 4NWUL 2VUYA 3P9MB 3WUZA 5HYQA 4DK6A 2H26B 2O5YL 2R2EA 3C8DA 3QHFL 5J6GA 1U58A 1MFBL 1CD0A 2AQ2A 1PKQB 2ESVD 1EGJA 3IXTA 4XB8A 1Q0XH 5HPOA 4HX1B 3ZE0E 3W81A 2A2QT 3LAFA 2AJUL 2V5MA 3QUKA 4GAGL 5KS9B 3ZSSA 1LK3L 1N59A 4ODSH 4PB0L 1U41A 4GRMB 3NZ8A 3BRGC 4NQVB 2Y5EA 3T1FA 3OAYK 4XVUD 3IAQA 3S7GA 1KXQE 5CJOL 4M3JA 4L3EB 2JJTA 2NY1C 2DI8A 4NKIH 3FQTA 3O6KL 2HKFH 1MIML 4CAGA 3QDMD 2A6KB 4O2CB 4MB3A 2FEDC 1G1CA 3GK8L 3HN3A 1MLCA 2VLJE 1ZLWH 2EDLA 5MEQB 1A3LH 1F97A 2BVUA 1ZLSL 5FFLA 1OSZA 5ERWB 2P48B 1BOYA 2AXJA 1INQA 2F5AL 1PJ9A 3BESR 4G8FB 4N0UA 1DLFL 3HZYB 3LKPB 4M4PA 3FT3B 1S3KL 1MEXH 1A4KA 4TOYH 5JUEL 2JCCE 1N64L 1RZFL 4HKZA 2HKHL 4L3AA 2NY1B 2PF6A 5FHAH 4YBLC 2QEJA 5F7LB 3VRIA 3ZHKA 1RULL 3OKNB 1OGAE 4WWKD 3U7YH 1AXIB 4KMTL 4R0LC 3OKLB 4X80H 1E27A 1ZS8B 2XNAB 3W0WE 4NN6B 4AG4H 3SE8H 5LAXA 2WIIB 1EBAA 2AVGA 4PBVC 4UV7L 3PL6D 4IOIA 4NQCB 4CUCA 5ID0B 2X4OB 3ZDXE 2WQ8A 5C0EB 2RCSH 1S7VA 4MJIA 3O6KH 1FO0L 1N5YL 1RZKL 3SKOB 3B5TA 1JFQL 5ACZB 5FUCE 3QUYB 1KIRB 3D69B 1OAXL 4D9QE 2P47B 4JY4A 1D6EB 4HC1L 4FTVA 5ANMA 4NZJA 3A6CL 4C83A 5TE6L 1FC1A 1MI5B 4C58B 1MCDA 1KB5A 2X4TA 2YUWA 5C08A 1DSFL 2GUOB 4NKMB 5T1LB 5DK0A 5FO9A 4LAJH 1HZHL 4Y4HC 1ORQA 4ORZC 5DYOB 1H3VA 5DJAA 3VFMB 5F7DB 1I1YB 3U30C 1AE6L 1NMCC 3MLSH 4G43B 5C09B 3EJYD 5DT1H 5BS0A 1T89C 1FAKT 2R0LH 4S1QL 5E6IC 4KI5E 3A67L 3FT4B 3UCRA 1OARL 4GXVL 2XXMB 3QUZA 3MRIA 4JM2D 2O5ZH 1P9MC 4HXBH 4KVNL 4BSWB 2Y5TB 3BWAB 1AC0A 4KKLD 5SX5K 2VL5B 2YHGA 3REWA 3VXUD 5C9JA 5KANI 1G7HB 3BN3B 4JPIA 3QUYD 4GLRH 4ZPVA 1I1FB 1MQKL 3PHQB 4XVJH 4NDMB 3QPQD 3OKDB 4PJBA 4HZAA 4XX1E 4LCIL 4R26L 5T1KD 1Y0LB 1IGTA 1VEMA 5E0QA 4KRPC 3EYFB 5B4MD 5ESQB 2YMXL 5LVEA 3NIFF 4JGUA 1GOGA 1SYSB 4DW2H 4YXLL 5TDOB 3WO4B 1CGVA 4I9WE 3JTTB 3V5KA 5DRXB 2BMKB 1DVFC 2EYRB 4Y4KD 4MCZB 5E94B 2DLGA 3T1FB 1CDBA 3AROA 3EAKA 1RU9H 5FHBH 5C3LD 2PCPB 4EZMA 3SKJL 3STZA 3ULVH 1W0VB 4PY8J 1FO0A 3O3AB 2BY1A 3M07A 4K3JH 5HD8C 4JZNB 1ADQH 1SVZA 1W72L 2ESVE 2EE9A 4HPYL 1K8IB 1GGTA 2H32A 3L5IA 4G7YH 5T1MB 4LAQH 4D8PA 1GZQB 1F58H 2AK4E 3MJ7A 2FIKB 4NNPH 4DOHB 4GRLA 1R5IA 2IGFL 1CD9B 2VH5L 4ZSOA 5C0AB 1NMAH 4FHBD 1G7QA 4LFHG 5F6IC 2VXSH 3C5SB 4U1JB 4LSRL 4JPVH 4NP4H 4V1DA 1X5LA 4MD0A 2KUTA 1U8MA 5K9OA 1HN1A 3FL7A 5I18H 5GS2H 3MV01 3GJFB 3SE9L 1HH9B 3FRPG 4P3WA 4PV9B 3NA9H 2DM7A 2JE8A 2NXZC 2FGZA 3K8MA 4M93B 2AS5M 4L5FH 3RKDD 2VLLA 3G9AB 4YHYC 3VFNB 1HOCB 5BS0D 4Z95L 3MLPA 3VRLE 3NGBB 2OQJA 2R1XB 3QEUA 4ZUSA 2AKRB 1JPFA 1T66C 4IS6B 4DUWA 4UB0L 3VCLA 2J8HA 5EZIH 1NSNH 3IXAB 3IFLL 5TFSL 3G04A 3K80A 3PE9A 5I30H 3CSYA 3LV3B 3OKYA 1AQKH 1DQLL 2AJVL 4TVPE 4PRHA 3VI4E 5HHNB 2BP3A 2LVCA 1VEOA 1YDPB 5GGUA 1MJJA 1LNUA 4M7KH 3O4OC 3GI8H 3BPLB 4XBPB 2D7QA 2AJXH 3PV6A 4JFEB 4LCWA 1N0XL 3QWOA 2DTML 5IEKB 1AD9A 2YBRA 4XCNB 1N8ZA 3UYPA 5KOVC 2H3NA 4J6RH 1WICA 3DO7A 4WI3A 3VGEA 1A7NL 4EDXB 3QUZB 2ICEA 3BKMH 5DEZA 4BFIA 2EEDA 1MJUH 2OTUB 3KDMA 3QAZC 4UINL 4K3JL 2VZUA 4QRRE 2E6JA 2CDEB 1Y6MR 5CJBA 5CSGA 1T5XA 1NGQH 1JZ7A 1KLUB 2V7HA 2XWBA 2VLJB 2HT2C 4KI5D 2YWYA 4I8DA 1MFAH 4KVCL 2IG2L 4N8VA 2HJKB 3ESVF 5ITBL 1H8NA 1S78C 1NCUA 4JAMB 3QPXH 5GS0D 5C6TH 3G6JA 1YNTB 3QDJE 3U30B 4W4NA 4DVRL 5DRZA 3WNPA 3FO1A 4HPOH 4P5KA 5D7IE 2ARJB 2E9WA 5I0DA 2DYPD 5BOPA 3F58H 4M00A 3HLAB 3PWPE 3VXSA 3ULVD 3QJFB 5GRXG 5EO1B 5ADOL 3IKKA 5T33L 1Z9LA 1AGEA 1U8HB 4J3WA 3LS4L 5ANME 3WIHH 5INDB 4XI5C 4Y19E 3FZUC 4NO0A 3BKJH 5B39A 5I6XC 3NFNB 1O5DT 2G2RB 3QDAA 3HE7A 2APVA 4GQPH 5EUOA 4NRYB 3IFNH 3EDJA 4Z7OE 4JN1H 1CL7L 1H0DA 1CFNB 3ZDZE 3RL1B 5HY9B 5KVFL 3MRFA 4JO3H 4TVPL 2CH8A 4FQXD 4EN3B 5AZ2H 1TJGH 3QCTH 2OSLB 1F4WL 4LSVH 2OYPA 1OARH 4GXVH 3WFBL 4ZOBA 2FL5A 1XF2A 1E27B 3C5SA 3HNTL 2SEBB 3VJ6B 1QACA 1R0AH 5TJWK 3S98A 3BE1H 3O8XB 4NZRL 3UYRL 1UJTA 2C3HA 2LE9A 3ZE2F 2BFVL 1IT9L 3CPLA 4PTUB 2PW2B 2DM3A 1Q94B 3SDCD 1U8LB 1A6WL 4PJAB 5J3HC 1U93B 4L8CA 2FSEB 4WHYH 4JKLA 5IF0A 4DVBB 1ONQB 3P4LA 3ROLA 3REVA 5F1OB 1VERA 2ENSA 4XXCA 1BM3H 4R2GC 3OZ9H 2D31A 3G5VB 5K9QG 1FO0H 4PBWD 4YPJA 3ZT7A 4NQEE 4MD5A 4KWUA 5JW3L 2B4CL 5BZWA 4AG4L 4GRWE 4LCWE 5DVMA 4AIZA 3EO0A 4X4XA 1NKOA 1YPZF 1FE8H 2P4AB 2W59A 4HK3N 4QRTA 3STLA 1WBZA 4NSKB 3FB7B 3HPLA 2Z8SA 3MRMB 4LPVA 4P4KB 5EU7E 1N6UA 3ULUL 2ZKHL 3BO8B 5DR5L 2WBKA 1Y6NR 5D8JH 5E9DB 4ZDHA 3UTPE 3FMGL 1AKJB 2OX5A 5HHNA 3BDYL 1I1FA 3MNVA 4L9DA 4XVTL 4GUPA 3PGCB 2R29H 4RGOL 1A1NB 4DQOL 1U2CA 2J8OA 1RIHL 4X6DA 3BKCL 1LO4L 2DYPA 2XZCH 2X1WL 3GMMB 4GW5B 1G7MA 3CGTA 1RK0A 5B38B 4G6JL 5DZOA 2CKBL 5DRXA 1FZOA 3G08B 3MLZL 5DZLA 3N9GH 2WUBL 4PGCB 3O8XC 3FN3A 2P8PB 1LO5A 1AP2A 1MFNA 2DQEL 3VFRB 2ZCHH 3K81A 2NTSP 5B8CC 2BSRA 3QUXA 3L7FA 3RPIB 4WWKA 4D94A 3HLAA 2MQ0A 2D3VA 4ZFGL 4ZO9A 3QNYA 2GITB 3GMPA 1WFNA 4JRXE 1QRND 2WSKA 4O9HH 2VLKB 3C9NA 1N0LA 4H88H 3A67H 5INDA 4JKPH 2D7NA 1U3HA 2HFEA 2OXGA 1QFWH 4GS7C 2F8XC 5B39B 4KDTC 2Q3AA 5ILTL 3DBXB 1MVFA 4JFYA 3HZMB 5DTFA 3WIIL 3LKOB 4MQ7B 1AGFA 1HXYA 4GXUN 4OZGB 1BLNB 3FQXB 1KIPB 5A16B 4PR5A 1VEPA 4ZAKC 4KROD 3BQUC 1LO0L 1QR4A 1A6UH 4IJ3B 2YD4A 1JRHL 4QHKJ 2JB6B 5JDSA 3VWKC 5J8OA 4R4FH 3IT8D 4MCZA 4P5TB 1B4JH 2IAMA 2UYLA 1UEMA 1KULA 1TETH 2OI9C 1G7JA 3FAWA 1GSMA 2FATL 2FJHB 5GS3A 3BYYA 4R96B 1UZ6F 2X10A 3KXFA 3SE8L 3T4YA 1MLBA 4PRBA 2AXHA 5KW9L 3MROB 3RX5A 4MD4B 4N1CA 5I6XB 4U1KA 1LK2B 1KXTB 1LO4H 4HJJH 3EFFA 3OX8A 5B38G 4FQCH 5E5RB 4V2BA 4AEHH 3LKNA 3GSWA 5C0FB 4DVBA 4PRNB 3BDYH 3BKYH 4O58L 1PG7H 1C08A 1AGCB 1AD9B 1UWEL 4FFYL 1DBKH 2JB5L 3DX8B 5B4MC 5DK3A 1G9MH 3S36X 3T4YB 2XTJB 3OR6A 1BD2E 4CMHB 5EUKA 2CDGB 4L5FL 4MD5B 3T0EB 4RBPH 3IDGB 4X99B 3T2PA 1I4FB 3QQ3B 4G8FA 1FORL 2FO1A 3LZFH 5F7EH 2IPKB 5ERWA 1NC2D 1FNGA 1S9YB 4HWNA 1PVHA 5FV1L 5FYKU 2FLRT 3DPBA 5F70A 1FP5A 5DVOA 3KLAB 4FQIL 5FYJL 2XQBH 3OKOA 4OI9A 1IGYB 1JTTA 1V05A 5DFVD 4V1DE 5JXED 2X1OA 1NGWA 3HC4L 5T1LD 4P9ML 5F8RC 1MCOH 3TO4D 2BSTB 3SO3C 3FKUS 4LVOC 2VDOL 2DYPB 1W72H 1J9CT 4M5YH 2Y6SD 2GFBA 3V6ZA 3VXSB 1WAAE 3RZCA 1P7QB 4JRXB 5F7MC 5HGBB 3NZHH 4FNLH 2L4OA 4I0PB 3F7VA 3H9ZA 4MAYA 4L4TD 2HFFB 1Z9MA 3ARFC 4KTDH 2ERJB 3WV0A 3QXAB 1IZJA 1U3JA 3FRPA 2JELH 3L3HA 3U1SL 5E7BA 1AP2B 1AH1A 4YWGH 3GSRB 4P99A 3T04D 1U58B 1F4XL 4LCIH 4IRJA 5C0IB 1TETL 3HUJF 1M05B 25C8H 2GY7B 5B3NA 1HI6A 5I8OH 3V5DA 4JB9H 1U0QA 4NQDB 1OTSC 4QHLA 5CEXB 3GSNH 2Q7YA 1NAMH 1KBGL 1C5BH 1X5HA 4DUXA 2VQUA 2R1WA 2DL2A 2EKSA 3IU3B 1ZOXA 4PRHD 2BNQE 3QO0A 5EOQH 5F7NC 4QOKB 3D2UB 3EYOA 3NAAL 3V4VL 4DGYH 1F3DH 3HPJA 2ED9A 4LEOB 5ITBH 2X7LB 5SWSD 2PO6A 1EHAA 4P2RA 3WD5H 2XZZA 1ZEAL 3U83A 4WUUD 2P5EB 2P5WB 1UB5A 5DURD 4NKOA 1SY6H 3MRLA 1A6ZA 2X1PA 4NFBA 1AKJD 1XF4B 3WNNA 3B8SA 4KDTA 1QYGH 1I8MB 1MJUL 4G6MH 3S5LG 5E8OA 1MLBB 4PRBB 4F15C 4HFUL 2K7QA 1M4KA 4QRQB 2ZCHL 2X4SA 4OIBA 5F93C 4M7ZC 1KELL 4YUEL 4FQIH 5FYJH 2XG4A 2E7BA 2YD8A 3SEPA 1N5YH 3MBED 4E9LA 1EXUB 2CKBH 1BECA 4X6CB 5EBLB 5DTFB 1T20A 3EZJB 5L9DH 2EXWC 3VXPA 1EGJH 3I75A 4E5XA 4J3VA 5F6HI 3CX5K 4EN3C 1LGVA 5C6PB 3WO4C 4KGLA 3T0EA 4R3SB 2R29L 4RGOH 5AG9A 2VZTA 3DTXB 4YEFA 5E6IA 2XYCA 4MAYD 4OUUA 4QGTA 1D7FA 1KCRL 2UWEE 4XAKD 4NQCA 5MEPB 1S9WA 3DYMA 4MJIB 1U3YA 1DLFH 1QEWB 1X4ZA 2Q3ZA 1XIWD 5SV4A 2HVKA 5I1CL 5C2BL 1S9VB 4ZS7H 3GNMH 1DFBL 1IAKB 4PJDE 4NHCL 1VESA 4POZD 2PTVA 3GK8H 3BPNB 4OZGE 1BX2A 5H35B 3HE6D 1R3KA 4KRLB 1FNSL 2V9RA 1I1RA 3UPRB 5ISZA 2APBA 3CMOH 3T65A 3PWVB 3B83A 2IH1A 4U6TA 5KBNC 4WDIB 3B9AA 2XV6B 5FUOL 4O5LH 4ZNCD 2FJFA 2ICWB 4PGBB 3M17B 2CLZB 1DLHB 1MY7A 1KENH 4GAGH 5IESL 4O2EA 3QT2A 2ZSVA 2IQ9H 3QCUL 1B3JA 4PJ5D 4XH2A 1M6OA 4WENB 3DSFL 1C12A 3LH2L 1M71A 2EICA 4HSQA 5E8EB 5AZ2L 2WAHA 2VWEE 3RWFA 1NPUA 4CU8A 4G8GB 3K8KA 4Z7QE 1IARB 1T2JA 4HGWB 4R26H 5CEYA 4K94L 1ZKAA 4H20H 3CH1A 3QIUC 4LVHB 3P73B 3E2HB 2CIKA 3FQNB 3HZVA 3EO9L 3TFKC 1RY7B 3LSOB 1MREL 1ZGLA 4PJAE 5F7FA 4KK8C 4I18C 2PTTA 4KQ3L 2BHZA 4L29B 4H20L 1FJ1B 2AEPL 5I8EB 4HW6A 1Z0MA 5GS0L 6FABH 1T2QH 4GW4B 3DUUB 1GPOH 2CR6A 1KLGB 5F1IA 4U1MA 4FQ2H 3TO4B 5D9SB 2BNRE 3T2NH 4AEIH 1GC1H 3W0WB 5I1AB 3QCUH 4KJQC 3GKZA 2Q86B 4BH7B 2G75A 1UKSA 3MLWH 5L6YL 1KJMA 1NFIB 1JN6A 4QCIA 2V2TA 1I7RB 3BSZL 5EO0A 1NGXA 5ESVA 5F88A 3LPGA 5IOPA 1YEFL 5KTEL 4I18B 5F1IB 4CVWA 2D7MA 5IEHA 4NUGH 1ZK9A 1FNAA 2FX7H 4UV4H 4LP5A 4TQEH 2EKJA 1U36A 2ADJA 1R3LB 3RTQA 4QXUL 5IVXF 3S37L 4Z0XA 1BWWA 4HKJB 1IFHL 2HT2D 3IU4L 4KI5C 4WEUD 3SPVB 2SEBA 4M7KL 4Q6IC 4UQ2B 4G42B 1SEBB 3SDAA 5KAQF 1D9KC 1EEYA 3U0TB 5C0DB 1U8IA 1Z0NA 5I1IL 1FL3A 2ATPA 3PUCA 3H42H 4JY6A 3MRRB 4HMCA 4OAWA 5C0JB 2DQJH 2OJZL 4PFEA 2Z35A 1N64H 4U1SA 4OM0H 4M1GL 3TP4A 1UXWA 4BZ2L 3GKWH 1JGDA 1G9EA 4JHZA 5IIEA 5JR1L 4QYOB 1HILB 2OTPA 1VADB 2ZG3A 4PRHE 3UBXA 5CMAA 4L8BA 4L1HA 3G5XB 4NN7B 2RAMA 3NCBB 3BW9B 3BWUC 4Q9BA 3FHAA 4BFIB 4XPGL 1BQHG 1G7LB 3O45A 3ARGB 3MA7B 2W9EH 4MNGA 4QT5B 4Y5YA 1N4XH 1CU4L 4RWHA 4EDXA 1GL4B 1SMAA 3DO7B 1CR9L 3JZ7A 1KB5B 3MODL 2KZWA 1ZT1B 4OZHF 1YNLH 4P9HH 3MV9A 3NCMA 3QULA 1HILA 5J6HA 3GBLA 3ZKMC 3RPKA 4GAJH 1CFQA 1MAMH 1NH6A 5IHBA 1DQDH 1J8HA 2B2XH 3IDNB 4OQTH 1JK8A 3TH3T 1SYVB 1NAKL 4G9FD 5MHSE 1QRNA 1NUDA 4HCRL 4N0FA 2JF1A 2WQRA 4DN4H 3LN9A 5FK9B 3G08A 5AG8A 5HI4C 4EI6A 3MV9D 3FQUA 4HLZH 4KFZC 4G6FD 1FC2D 2H1PL 4K7PY 5I1CH 3MMEA 1K2DB 3RWIA 2DTSA 1IM3A 3DYOA 4P2OC 2KL6A 2OK0H 5KJRH 1KCSL 1SBBA 3EGSB 3RWJA 1YYML 3TH2T 5HHXL 2BVPA 3BH8A 3P11L 3DXAB 4NQUA 4PG2C 3V4VH 4FXLA 4BUHA 4DGYL 5JZ7D 1A1OB 3QXWA 5BV7C 3UJIH 2B7DT 5TE4L 1D6VL 3BGMB 3FONB 5J89A 2HRPL 4XCEB 2R9HD 3JWOC 4OFDA 5FGBA 1QFWM 4PJEA 3D25A 2Q86A 4BH7A 5C0GB 4P2YA 3VXOB 4ZXBB 4ELKB 4Y1AA 2P8MB 1RIUH 1CI5A 2GK2A 3GB7B 3NFPB 4K7FA 1PBYA 5TQ0H 3NA4A 5D6CA 2G5BB 3LB6C 4NOBA 1F4AA 1MUJB 1BOGA 4I18A 1PAMA 3E0GA 4NC2B 3SOBL 3U4EA 3T0DA 5GGSA 2XKSA 1XMWA 1U8KA 5CZVH 4L9LA 2JIXB 4OLWH 5DGQA 3PWUB 4DZ8B 4NCC1 4XVUC 1IRAY 1CTOA 4YR6A 1AE6H 1MFCL 3RHWF 1FV1A 1FNEA 3KYAA 3NCEB 2V5SA 5B3JE 1BOGB 1E4XH 3BDBA 1G9NC 2R2HA 4NQTA 4P2OD 3RVWD 4GQ9L 2CD0A 3LIZH 5BW7C 1OWRM 1NCWL 2RR3A 4C56D 3NA9L 1V3KA 3HCVB 2AV1A 3GBNH 4QTIH 2WZPD 5T1KB 2QSQA 1I3UA 4R2GD 5HI5D 35C8L 3BP7A 1L9NA 4OZIB 5JXAL 1Y18A 5KANG 3RVUC 4R7DB 2A9MH 1WIUA 1X4XA 3WJJC 5IVXE 5CCKL 4PJIA 25C8L 1NMAL 4MXVF 3MYZA 1NCDL 4DWHA 4JFHE 3RWFB 3UEZA 4YHYB 3L3KB 1BPVA 3MNWB 2IAND 2YWZA 1ES0B 1IGJA 5T5NF 1EZVY 1A6VH 4HUUB 3MV9B 3UJIL 4G8EA 1ZVSB 2OR7A 3M1BA 3OKEA 5JPNB 2FZ3B 3LOWA 5I66A 2PYEB 2HMIC 2NXYD 1IE5A 1MEXL 3QJFA 4O02L 3TT3L 4P23B 1LD9B 2BXZA 4GO6B 4C57C 3UC0H 3X12B 5JOFB 4MLIA 1BHGA 5IROC 1OQOA 4DN4L 3FOMA 2AI0H 4GKNA 1R6VA 4RGNB 1J0JA 1SM3L 5EA0L 3VWKA 4C83B 5CILL 3ARGC 4G9FE 1A1MA 5JIHA 5FYJU 5ITFA 4I48B 1IGTB 1NCCL 1C1EL 4M7JH 1M7IA 3ZZ1A 5IV2B 5JW4M 1FPTL 5DVKA 2E7LA 1JBJA 3WNOA 4YAQA 1XIWC 2FEEL 4N0CC 5LKNA 5C09A 3MRLB 5SX4H 1Q9WB 1J05B 4JZJB 4R4FL 3L9RB 1UH4A 2A77H 4YHZH 5LGHH 3G6JE 3QDJA 3KLSA 4JFPA 1C16A 2DKUA 2VB5A 3KWWA 2F5BH 1EJOL 3MRNA 4X4MA 1MJ8H 3WIIH 2XN9D 3BIAX 4LCCC 4LARH 5D7JD 5IP4A 4PJCB 2DBLL 4FXKA 1I7UB 1U8OB 1OL0A 1OPGL 3WFEH 4LL9A 4EVNB 4KGJA 1JI1A 5I8KH 3QCVH 2F74A 5T5NG 4V2CB 4Z7WB 4XBGA 3PGDA 4YFEA 1QFWI 5ALCH 5DT1L 4OI8A 3NCCB 2F8OA 4S1DC 5ID0A 3UTOA 1FL6B 4NWUH 1XR8B 1U8IB 3UTZB 5MEOB 1CICC 3TESA 4PTTB 4PD4J 2X9WA 2P49B 3OG6B 4GRLD 4Y8AA 5C0DA 1D5BB 2DMCA 2DQTL 4OTXH 2WWMC 5DRNA 4WW2C 3B8YA 3MRCA 3CXHJ 2X4QB 1FG9C 4M6NL 3ET9F 4ZUWA 1FV1B 2ADFH 2BVQB 4LDOB 4P2QB 4HUWB 4LPXA 3D0VB 3VFPA 5JQ6H 4YR6B 3EO1A 1NFDF 4ZFOL 3EDEA 1VFBB 4OJFH 3F7VB 2R0KH 1RIUL 1T03L 5ESAB 3ARBB 4JFXB 1UM4H 5KSAA 5IVXA 2I07B 3SDYH 3NPSC 1T1ZB 1CLZH 3FO2A 4Y2DC 4ESKA 3BVNA 4JFQA 1BJ8A 1LE5A 3UJTL 2ORBH 1KG0A 3ZLQC 1HCVA 4HUWA 1IGML 4XCYB 2QSVA 1BEYL 1TZHB 2V7NB 4AQOA 2N56A 4Y4HB 5INCB 4LLWB 2P46B 3KYKL 2FNBA 2C3WA 3QHZH 3MV7D 3PXHA 4LLUB 4R2GB 3VWKD 2KH2B 1JGEB 4Y88A 1JPGA 1MVUB 4N9OB 5BZDA 5I75C 2XKUA 4KH2A 4G7VL 1H5BC 5D1XB 3BYTA 4YHMH 2EE6A 2DQEH 3FO9A 4CU7A 4U4BA 3FCTA 1YEHL 4NQDE 4Z77B 1CWVA 3SN6N 1U3ZA 4S1RH 2LTQC 4O51B 5M94B 3BUTA 1DUZB 2DIAA 5GGRY 1WWAX 3GRWA 1FLRH 4QF1B 1ZWIB 1B0GB 1WIOA 4H0IA 2QR0A 3V6OA 4M8QA 1XGYH 4OV5B 5FKPA