3SKNB

Crystal structure of the rl42 tcr unliganded
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASGQGNFDIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RL42 T cell receptor, alpha chain
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 241
sequence length 241
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknB02
3O4LD 5GGUB 4R0LA 3ZE0E 4YFLF 4U1HA 2VL5A 1QRNB 3KPSA 5TDPB 4AEEA 1XIWD 1ZV5A 2NTFB 1U8PA 1R3LA 3S35L 2QEJA 1JWUA 4PJFA 1MAKA 2UUDK 3MRLA 1X44A 5A3ID 3IGAA 2IEPA 1Z6JT 5CMAB 3ZSTA 4Q9RH 3KR3H 4NQEE 2GI7A 2Y36L 3W9EB 2YPVL 4FQXC 2FX9H 3ARFC 1S5IL 4PJ8A 2GT9B 4WWKA 5C0IA 4OFKA 1FPTH 3GBMH 3MBXL 4K7PY 5C8JA 3WIIL 2B8OT 3WO4B 5D2LF 4Z7WA 3B9KC 1ZA3A 4NN5C 3VWKA 5EBGA 1CFNA 1XF5A 1KPRB 4JFZH 1FE8H 5I1KL 3MYJB 4QF1A 3BXNA 5CJOH 3BGFC 4UU9A 1ZHKB 5SV4A 4NRXB 4QHKI 3CVHA 2FLRT 5DRWB 1PKQB 1T7WA 1KLGA 4MAYC 5BRZD 4MNQD 3G6JF 4YHZH 4OCRL 1JMXA 1M71B 1RMFL 4LCWE 2C7UB 3O8XC 2ZCHL 4TVPD 3L5HA 3BD3A 4PG2A 4EDWL 4EOWH 5JORA 2WNGA 3PWNB 2DL9A 3X14B 5I1IL 1OTUD 1EJOH 1J12A 3CJJA 2WUBH 4LPTA 1S8DB 3HFML 1F4AA 1PQZB 1FIGL 4BH7B 3PGFL 3GJEA 4AH2A 4GW5B 3ZKXC 1KV3A 4LCYA 5IVXF 5KSBA 3SDCB 2VISB 2MPAL 1NMCB 5KW9H 4AEIH 4JFDE 4HKJA 2NW2A 4K94H 3HI5L 5MEOB 2X4SB 3VXOA 3TBSA 5IMKA 4GO6B 3BPNB 3BN9C 3GIVA 2ORBH 4GBXD 3RDTC 3SDXB 4OZIE 3C8KA 3MLTB 4D8PA 1LNUA 5HTSA 1D3CA 1A7RL 4HIXH 3V5KA 5KN5A 2HLFC 1H5BB 3ARGA 3T2NH 2NZ9D 1QA9A 2XT1B 4YAQB 5EPMA 1H8OA 5D1XD 1FZMB 3P4NB 4BZ1H 1SEQH 1UM6L 1DUYB 4N8CL 4D9LL 2C9AA 5F1OB 3BRFA 1OPGL 3VFTB 3NIGE 4M4RA 4O2CA 1URLA 2R1YB 3NCCB 4KRPC 4PRHB 4PV8B 3FRUA 3OAZK 4JG0H 4U0QB 3LMJH 5JXEC 2DQCH 3DX9B 1AGDB 1NDGA 1TVDA 3DRQB 4ZXBB 4PG9B 2CK0L 3D3VA 3QDJE 3RZCC 4XBEL 3FQXA 3VFWA 4L8SC 3EGSA 3MV8B 5JW4R 3WHE1 4HH8A 3TJHD 1U95A 2BSTB 1D7FA 2QTEA 4M7LL 4MJIE 5DJ0A 3TH4T 3AMKA 2LTQB 5CUSH 2ITDA 3Q6FB 1FL3A 1NGQL 4HCRH 4BH8B 3RL2A 4ZFZB 4Y5VC 1RJYB 2W91A 4ELKB 5A16B 4LP5A 4FXKA 3RWJB 3P11H 1ORQA 3TBYB 2RB8A 1FV1B 3PHSA 4G8FB 5DRXA 4JKLA 4MA8H 1KPUA 3NH7L 1PGRB 3PP3H 3QDMB 4KTDH 4MDIB 1OAQL 1I4FB 4M9PA 5HHOD 4LRIC 1XR9A 1IVLA 2NCMA 2HWZL 2Z92A 3HAEH 4PJDA 4GKOA 1GVIA 1KXQE 3L3IB 2B1AL 2CRMA 2GTWB 2Z8SA 4PJIE 5GGRA 2ICWJ 2NY2D 2AEWA 4BQCA 2EECA 1AGBA 4MZ2A 3ZL4L 4V1DD 5F1IA 1UB5B 4O2FB 4PJ5B 4Y4KB 3RTQC 4S1DD 1UH2A 4ORGB 5KANI 4Y2OA 1HXMA 5EZOL 3Q2CA 3L5XH 5KSVA 4CVXA 4YBQD 3UYRL 1ND0A 3MC0A 4HUKB 4AM0B 1DL7H 4KUCF 2IAMB 2VIRA 2BVOA 1GGIL 4OQTL 1L9MA 5CBEB 1CFSB 2NXYB 3WL9A 3O3UN 4XAWH 4YHML 3TO4D 1YY8A 1EGJA 2B0SL 2XWJB 1E28A 1XCTA 4FQQB 2BP3A 2D9CA 2BOBB 3GDBA 2ZSWA 3BP4B 1T2JA 1TJIH 2CSPA 1ADQA 4Z7VB 1HOCA 3LDBB 1MREL 4QNPF 2N7BA 4OD3L 4FABH 4U6VL 1WFNA 5LCVH 4ENEC 1KTDA 3FB7A 1OTSC 3CFCH 1U8LA 5E08L 4WFHD 4HDIB 5DUBB 1W8OA 5IVZB 5ECJE 1ONQB 3LHPL 4KK6D 4LGSB 3SBWA 4NRYA 1NBYB 2VLMD 1MEXH 2WIIB 3NFNA 3PIQB 3QUML 1KN4H 4QY8B 3GJFK 1OOAA 4YBLC 3BAEL 1XGUA 4HG4K 3KYMB 5D7LE 3AU1B 1F4XH 4KI5C 3AREC 3FOLA 1KFAL 4RNRB 4YIQA 3QI9C 2A9NL 4JO4H 1CD9B 3DWTA 4WDIA 3RWCB 1RJLB 2VXUH 4JFFE 1PZ5B 4JZNA 3MACL 2IQ9H 3LRSB 5I8OL 4KZDH 1CDHA 1N59B 5C08D 5FB8B 4X9IA 5I1HH 1JNLL 3TIEB 1A6AB 4K9EL 1MJUL 2VDLH 1H9VA 4UUJA 5ALBH 1CE1L 4Q2ZB 4YJZL 3QAZB 6FABH 3AY4C 3VU2A 3X3GH 3DMMA 3FOMB 1KGCE 4WJ5A 1UFUA 4MLIA 3L6FA 4P57B 2V5YA 3K0WA 5EU5A 2VUYA 2ATKA 2NXZB 4XNMB 3EYVB 4BKLB 3QH3B 3D0VB 4XPGH 2CDFB 1IQWL 5CSZA 1N26A 1RZ7H 1UQSB 3KXFA 1Q94A 3IS0X 2PN5A 1I9RL 3D48R 1IGMH 1VEMA 1FVDB 2F5AL 4G6MH 4HPYL 4X5WB 3ZDXF 3PNWB 2DICA 5C0FB 4R26H 5HGHB 3DXAD 1R3JA 4PGZA 3JV5A 4YHNA 4YHOL 4PJ7B 1D5ZA 2CUHA 1S78C 1R5VB 3QIWB 4ODWA 4WUUD 2NY6B 2X1OA 1WJ3A 5DFVD 3QO1A 2RFXA 3NCBB 4UZGA 3A6BL 1IGFH 5GZOC 4NQCA 3HC4H 1Q9LB 4MQSB 4OBSA 3WSQL 1QFWI 1FL6A 1DVFC 5EO0B 3F65A 1TZHA 3LIZH 2DI7A 1DLFH 4DK3A 2GUOB 4X6EA 5CP7A 4MVBC 2JJSA 4OT1H 1FZJB 1SEBB 1KLUB 2K9UA 2OS7A 2QHRL 3MROA 1IAKA 3BJ91 3BH8A 5L0QC 3QG7L 4MS8C 3MUJA 1CE6A 1PSKH 2VLKD 3L5IA 4HKBB 2Z8RA 3KLAB 4Z6AT 3SGEH 4JFPA 2AQ3A 1LK3L 1EFXA 3HRPA 4LLQB 3VXTA 1U58B 4OGAC 2XTJC 2IGFH 3C5ZB 2ZNWA 3O3DA 4JDZB 2FEDD 1I75A 3H8NA 2F54B 2W59A 1CDBA 4V2CB 4KKAD 3V95A 3ALXA 4M1GL 3F5WA 4HMCA 3P40A 1J05A 2IAND 2YMXH 3VXRD 5TQ2H 3TNNB 4RGOH 2CD0A 2XRAH 3ULVC 3ULUC 5HYJA 2P5WA 3D69B 3FN0L 2NYYD 1K8IB 3G5YA 5ENWB 4MDJA 1M6OA 5B4MD 4D0BB 4JO3H 3WHE0 4OZGE 4JPIB 4PJHB 3VXQB 3FAXA 1FL5B 1W72H 1BQLH 1RURL 2DQEH 4P4KD 3ZE1E 3MLVL 4L4VD 1MIML 4ODVL 5FOJA 3VRLE 5K9QI 4OFVA 2X6MA 3MJGX 3ROLA 2ZUUA 4X80H 4DGIL 3PL6C 5FF6B 2PTTA 4NWUL 4LLDB 4NN6B 2V7HB 5K9JL 1RUPL 2EKSB 4DUXA 1WZKA 5I1EH 1KLFA 4CKVX 5E99H 1AIFB 3KPSD 2VN4A 4E41D 2EH8H 3GSVA 2EXWC 3MRPB 2JCCA 1KENL 5EWIL 4LNRA 4Y4FA 3OJDB 4EN3A 1IKFL 5C6TL 4OCNC 2VB5A 3CVHH 4PJ8D 2CDGA 5DHVA 4IMLA 4WWKD 1HHJB 1NMAH 3D25B 2EE6A 4D3CL 4LARL 2FGWL 3MRHB 4W6YB 3JWOH 5DF0A 2DKMA 5TDPA 3QG6B 2VRAA 1G6RB 5JOPD 2UYLA 3VWKD 4I0KA 2NTFA 5HVHC 3FQUA 1A14L 1WCQA 2DN7A 1LO0H 1QOKA 2AGJL 4MGXA 2FO4B 3GSOB 2NX5E 4IOFD 2F19L 3HG1B 4KPHH 3W9EA 5JDSB 1KJ2L 1IAMA 3MUZ1 5TQ0H 4JO2L 1S5HB 3LEXA 1FNLA 3QIBC 2FLBT 4BQBA 1LVEA 2EYSB 4AEHH 1A6VH 1A7NL 4M7ZB 5DO2C 2WBJA 4IJ3C 4FRWA 2WQ8A 4HQQH 4OFIA 1M4KA 5EC1B 1FO0L 3V0AC 1KPRA 1IAIL 2JJTA 3MYJA 2R0WL 1OWWA 3BPCA 2ICWA 3VXUE 4K3HA 4M9OA 2EC9T 4NRXA 4HKXA 2YWYA 1PVHA 1HHKB 3LEVL 5C09E 5DRWA 4CNIB 4U1LA 5LGJA 5ILTH 2V17L 1R3IL 2QSTA 1M71A 2FATH 2JJVA 4WFFE 3SKMB 2C7UA 4F57L 3QYCA 4OGXL 1IKNC 5FYLL 4YXLL 2R0KH 2ESVB 4PJXE 4P9HH 4JM2A 4KJPD 3PWPB 3QPXL 2R2HB 3V7MA 3MV7B 5LG1A 2VDML 3BP5B 3PWNA 4R9HA 3X14A 1EMTL 5SWZB 4BH7A 3MXWH 1KCKA 3ARGD 3BWAA 4GW5A 1AHWC 2XNAB 3GMLB 1QG3A 2VISA 1V8HA 4YDLC 4U1NA 2GJ6B 5MEOA 4ELME 2X4SA 5C07D 1B4JH 2BY1A 2BX5A 3GHEH 3J7HA 2DLFL 4XH2B 1IRAY 3V79C 1NGPL 5E2TH 3T1FB 3HPLB 3SDXA 5I1JH 2JF1A 2NNAA 3MLTA 4EZMA 3IU3B 3O6KH 4K7PX 5ICYB 4KK8D 5IBUG 1QBLH 5C0RL 2DIBA 1H5BA 1JGEB 3HE7B 1IGIH 5DURB 5D6DA 1AR1C 4OLXH 2NQCA 2JK5B 1FZMA 4OCXH 3THMH 4LIQL 2GFBB 3D3VD 4TULL 4KAQL 4H88L 3FQTB 4HGWB 3BKML 4UOW0 1WQVT 1CDYA 4OQTA 1YNTB 2M1KA 1PLGH 3Q1SH 4M43H 4OCLC 5J6GA 1DUYA 3I9GH 5DRZB 3SCMA 4TN9A 1YN7B 3VFTA 2PTUA 4JHWH 3RUGF 5EOTA 1AP2A 3DI3B 4PRHA 4NIKB 2Z8VC 4PV8A 5CILL 3PGDA 4X7SH 3OKOB 5D2LE 4XWGL 2N1KA 1CFVL 3MOAH 3QDGB 1G7JB 1IGCH 3DRQA 3MLWL 4HMDA 4ZXBA 5BVJA 1MHCA 5DI8B 2O93L 2WIMA 4LF3B 2BSTA 2RQ8A 5AZ2H 3QUMA 3Q6FA 3DUSB 2PW2B 3G6JE 2WANA 5E5UB 2R9HD 4EQ3A 3OXRA 3TBYA 3WKNA 1FV1A 4PB9H 2FD6H 3RBGA 4J1UB 1TJGH 1OTTD 3MO1B 3QDMA 5D1ZB 5JA8B 4MDIA 2HT2D 2Q8BL 1I4FA 1RHHA 43C9B 5FUOL 1F90L 5E5MB 4MXQD 4LASL 2GTWA 3VW3H 2B2XL 3M17B 3RWHB 3BDYL 5DD5L 4NZJA 4PLKC 1UB5A 1FNAA 2JE8A 2B7DT 3GNMH 2EH7H 4M6NL 4PJ5A 2VDOH 5IVXE 1A3LH 1LK2B 4ORGA 1AGEB 4J7RA 3FMGH 1C5CL 3DI2B 4JFYA 3H9SD 4TPRL 4TNVF 4HGMA 1U0QA 4I0CC 1R3KA 3U0TB 4J6RL 4MNQE 2J6EL 2IAMA 2QLVB 1ERNA 1T6VN 4XCNA 3DUUB 5CBEA 1CFSA 3SJVE 4EDXB 4HFUH 3TBWB 4WTWA 1KCVH 4PIRF 1K8DB 1L0XA 3RVTD 3VWJB 3B5HA 3W2DL 3QRGL 2XWJA 1ACYL 4U1KB 1MFCH 2BOBA 3EHBD 1J87A 1PY4A 3KWWB 3FQNB 4R7DA 4DVBB 4Z7VA 3AAZB 4OCYH 1N0XL 5ITFB 2RJMA 1QNZH 4I18B 3DBXB 4M6OH 4LLMB 1G7PB 5D2NB 1ETZA 2YR3A 4JFHE 2I25N 3OKEA 3S88H 3MUGA 4QY8A 5GRZA 5FXCH 4JPWH 4YDIH 4FQ2H 4J4PC 5DK0A 3DMMD 3KYMA 3AU1A 1QKZH 4V2BA 1KBGH 2PO6B 5DK2A 4EIGB 5T3XH 4YDKL 4HIIA 1GC1H 1PZ5A 4TNVK 3KXFD 4DCQB 2ENYA 5FYKH 1JRHI 1N59A 5LAXB 1QTYT 2VUOA 3TIEA 1A6AA 1MCOL 2DQUH 4LKXA 2DQIH 4Q2ZA 3NMEA 4WI2A 1A4KB 4NZRH 2YUVA 1S9YA 4XB8A 1VHPA 3ARUA 1KN2H 4P23A 4BKLA 3SGDH 3QH3A 3EOTL 4I0PC 4NQCD 5T3XD 2D7TH 5BJTB 3P4OB 4HIJB 4UIKL 1UQSA 1HXYB 2XA8L 5FYKD 4G3YL 4X5WA 1CLCA 5C0FA 3PNWA 5HGHA 1DJSA 1TJHL 3T8XA 5K9KB 3M45A 1TETH 3WJLA 4PJ7A 4EQ2A 4JREB 5GRWA 3S35H 3FCTB 1CLZL 2GY5A 5C0CE 5M7QA 5C2BL 2GQHA 5F93C 3W11C 2N56A 1MWAH 2YPVH 1UJ3C 1G7QB 1Q9LA 3QEHB 3FKUS 4C56B 4LU5L 4GRLC 1IEBA 5JW5B 1NFDB 4J3SA 1EFXD 1SJVA 5T1MB 4JAMA 2H6PB 2F8VA 4KHXL 3F7RA 2DQJL 3MBXH 3NZHH 3WIIH 1FZJA 3MOBL 1KLUA 4UT9L 3TC9A 4X4XB 5TE7L 1JHKL 2HT4C 4M93C 1YUHB 3CMGA 1LP9F 1XFPA 3IFLH 1ZGLB 4JHZA 1NEZB 1ZE3C 4NC2B 5KTEL 5I1KH 1Q1JH 1TZIB 5T1DH 4QNPE 4G8GD 1J1PH 3R06A 2QV2A 4P3CL 3QCTL 4XX1E 4Y19E 3KLAA 1PX4A 3HE6C 3HUJB 3G9VA 3FO1B 4LLQA 2ZG2A 1H8NA 1SQ2N 5HYJD 1RMFH 1U58A 2R29H 5HGGS 3MRJB 3C5ZA 4YHKH 1CTOA 4Y4HB 2EXYC 2BY3A 4EDWH 2PTVA 3LRHA 3OKDB 2B4CL 4K94C 3CDCA 4PFEA 4X6CB 1NKRA 3CX5K 3BEWB 5EOQL 3NA9H 4X6DF 5AUMB 4RFEB 5I1IH 1CGXA 1KJ2A 3EYQC 4K3GA 5FK9B 4DTGH 5FHBH 3TNNA 4ONOA 1AO7E 1FIGH 3BSZL 5TJWK 4DKEL 1HKFA 3MGTB 1X5JA 2A77L 3D69A 1M05B 3FT3B 3G6DL 1JHTB 3GM0A 4GKSA 5EBLB 1KIQB 1UACL 3HI5H 1XGQB 3LKPB 4D0BA 1FO0A 4IIQB 1MLCB 3UTTD 4JPIA 1ITCA 4PJHA 4BQ8A 3VXQA 4WFHE 4Y4FD 5KG9B 3EOAA 2BNQE 4EN3D 3MA9H 2XV6B 4YZFF 1T4KB 4KVNL 4FFYL 3ZDXE 3TBTB 1A7RH 1E27B 3MLXL 2VXSL 4LLDA 4OZFA 3V0VB 3U4BH 1A8JH 3QPQC 5JUEL 3U6RA 2ZNXA 1QRND 1OGTA 1J0ZA 2QL1A 3PWJB 4PPTA 1T3FB 3LKOB 3V8CA 4NKDA 1U93B 3FFCB 4XNXH 3ZKND 4MJ5A 5BV7C 1F4YL 4M1CD 2AEPH 5FA4A 3OZ9L 2HH0H 4D9LH 3QUXB 3ZZ1A 1JNJA 1MCIA 2WK2A 4KJWD 3UDWA 3SQBA 5HHPB 3JUYA 4AK1A 2AXJA 3OJVC 4OTXL 4PJEB 4M6ML 3KJ4B 4C55A 4FQ1H 1HHJA 1QUNA 4P5KB 3D25A 2GSIB 4F58H 5EDXA 2IFFL 3HR5B 4HEME 1ZVSB 4QRTB 5F8RC 2WBJD 3SHSA 2ZUQC 2VQUA 1WBZB 1I1AA 1OP9A 3S3SA 4ODHL 5M94B 2FO4A 3GSOA 5IR1B 2W0FB 1G84A 4L3CA 1NGQH 5I30L 3ZE2F 3I2CL 4K8RH 2V6HA 1S5HA 1PW3A 1MCCA 3DURB 1QD0A 4X8XA 2EYSA 1NAKL 4D9RD 3NH7H 1DBKL 1WWAX 4L9LC 4PLOB 1EPFA 1JPFB 1TXKA 2EEBA 3U48A 1YPZF 3FT4B 2B1AH 4X9HA 3VMNA 4XC3L 4LSRL 3OGCA 3BQUB 1G9ML 1IE5A 2J88L 2A2QT 1BM3L 2C1OB 4Y2DB 1JTOA 4CNIA 2XZQH 3WFDL 3DETD 1NFKA 2EDDA 1OW0A 3BEVA 3SKMA 4HK3N 4NKIH 1ZLWH 1XAUA 5LVEA 5E94A 3OHXB 2DLTA 4LHUB 2ESVA 2IPTL 1LO3L 4IS6B 2UZIL 3PV6A 4G6JH 4OQTH 3PWPA 1G7HA 2R2HA 3O4OC 1F45A 2MSPA 3BP5A 3VD4A 3SE4C 2B39A 5GGVH 1FNHA 2B0SH 4R7NB 3WE6B 3HLAB 4H0GA 5EZIL 4ZO9A 5F9OH 5F9WC 1CIDA 2XNAA 1GGCH 3GMLA 4OI8A 4U6VH 3U7WL 3FO2A 2CRIA 3CVIL 1VDGA 2GJ6A 3PWVB 3LSOB 3PABB 1RUMH 1T66C 2IMNA 4H25B 1A7QH 5I19H 2VN7A 4XH2A 4P2YA 4KK9C 2WBKA 3UJTH 4BSVB 3QUMH 1MFBL 3HPLA 4MQ7B 4UV4L 3BAEH 3SCMD 3LB6D 3F58L 2Q3ZA 1G9NC 3C6SB 1MRFH 2HG5B 5ALCH 3VGBA 3TBVB 5T1LB 4PRHD 4Y89A 3HE7A 1UZ8B 4LEXL 4XWOD 5CHNB 3QEGH 5CP3H 4ZXBD 4PYHA 3MACH 5I74B 5L8KB 3SKNB 2GFBA 5J56B 3B2VL 3FQTA 3HZVA 2J6EA 2HVJB 3MV8D 4HGWA 5DR5L 4D0DB 1MFAH 1YNTA 2GITA 1MJUH 1CE1H 5ID1B 1AY1H 5DRZA 4DN3L 4E41E 4LOUC 4ODSH 1U9KA 1BGXH 1YN7A 4S2SA 2QBWA 2ZJSL 3ARBB 3BP7B 4HXAH 5C9JB 5CKGA 2NR6D 1NQBA 3CAFA 1MCSA 4K3EL 3QDGA 1G7JA 2HLAB 5IJVA 3ET9F 3O3EA 1P5UA 3QDMD 1JGDB 1NEUA 3U83A 3N1FC 3F7QA 2Q20A 4HPYH 2F5AH 3AS1A 3PDOA 3MR9B 1LGVA 4R97B 5H8DA 4JPVH 3TT1L 4CADB 1T21A 4UV7H 2FDBP 4OD2B 1GRWA 3QDHA 3W0WB 3JVGA 1JHLL 1RK0B 5F9JB 4Z78B 1SMAA 1U91B 4O2EA 2VXTL 3A67L 4PJ5D 3O45B 4ZAKA 3CFEB 1EZVY 3WSQH 2FX7L 3GGWA 5D7KE 2IG2H 1HN1A 1VENA 1QYGL 4U3HA 1T22A 5HVFB 2Q7YA 3RY5A 1QFOA 1VEPA 1D6EB 2IAMD 2I26N 1NCUA 4FG6D 3IKCA 4H8WC 1MJ8H 5ADPH 4FFWD 3EOBA 4KMLB 2G5RA 2NXYD 3RWHA 5LWYL 3WFBL 4HV8B 1LD9B 1HH6B 4YHLL 4POZC 2DIJA 3QA3A 1T7ZA 1NL0L 2CLVA 5L7XL 3IFPB 1RU9L 3VA6A 1LK2A 5CZVL 1YZZA 5JOFB 1AGEA 1T0PB 2WV3A 1BOGB 1QSFE 1QHPA 1JTTA 1B88A 5E8EA 3O9WB 5BO1H 1F6FB 1HYSC 2FHBA 1S7RB 3TPUA 2Z93B 2X70B 5DD0L 3KHQA 1FYTE 4M62H 4UTAH 5DS8B 5HHMB 1YJDH 4XBGB 2ARJB 3DUUA 4MMXC 1A0QL 4N0UB 4OIIL 1K8DA 1T7VA 3VWJA 2H9GB 3TVMB 1NMBL 4U1KA 2WUCL 1CTNA 1CLYH 4M1GH 4FXGA 1BAFL 4A2MA 1MF2H 2X1QA 5H37G 2EDYA 3MRQB 1GJIA 2H45A 4P2OB 3FQNA 3LD8B 5HHQB 1CXFA 4DVBA 5JPNB 3AAZA 2AK1L 3IFOA 5GZNC 1U3JA 2XY1A 1VFMA 5ITFA 1WITA 5D8JH 4I18A 3DBXA 3CPLB 3M8OL 4MQXD 4ZUUB 4LLMA 1G7PA 2BNRA 1KTRL 5D2NA 1LILA 3VD5A 2D0HA 3RUGE 4R4NC 1JNHB 2YUWA 1BQHB 5C07E 4YBHA 1RZJL 1K4CB 4XP9H 5TDOB 2PO6A 3AS3A 2NXZD 4P23D 5HGAA 1GGBL 3C09C 2IH1B 2AW2A 4O4YL 4DGIH 1U8JB 2CKBB 1XH3B 4NWUH 4DCQA 1RZGA 3EBAA 3IDXH 1Y6KR 5LAXA 2O61A 1FAIH 2ADFH 4Y88A 1KYOJ 4ZTPL 3QUYB 3ARZA 3MLSH 5FM4A 2UZXB 5GQBA 1JNNL 4TSBH 1DE4A 2I9TB 4G80A 5F88A 1A4KA 2NY6D 1MPAH 3VH8A 4YR6B 1MAJA 4R90L 2CJUL 3O11B 4NYLA 5BVPH 3E1F1 4ZSOB 5DT1L 3UC0L 2IJ0C 1IKFH 2DF3A 3V7AG 3U4EA 4C4KT 4WCYL 2HT3C 3OKNB 1OAZL 4MA7L 5CIPH 2P7TA 3N9GH 4LLWB 5GIRA 1N3NB 5K9KA 5C0AA 4GXUN 2FH6A 1A14H 4HPOL 4JVWA 1IEHA 1T04B 4XI5C 4PTTB 3MODH 1Q0YL 1WZ1H 2F19H 3MTRA 3VRJA 3F7YB 1XGTB 4ZMAT 4FP8L 3QEHA 4EUPH 2H32A 5F6IB 3MRCB 2R2EB 4HWEL 4C56A 1NFDA 2WMPA 3E3QE 1RUQH 1HKLL 2YD9A 1JIBA 1JPTH 2H6PA 2ZCKL 5T1MA 2GJZB 4XVJH 4PRIA 3KLHC 4X4XA 3C5ZD 1YUHA 2F5BL 43CAA 4R3SB 1HSBB 2HAZA 1A7PH 1FO0H 3HZMB 1ZVYA 2F54D 4AT6B 3BH9B 3GSWB 4JN1L 4LSPL 1GH7A 1IAIH 1TZIA 5C0JA 2OZ4H 4QRUB 3E6FB 2P8MA 3H42L 3LEVH 5DVNA 3OJ2C 1HWGB 4GW4B 4NHUB 5I1DB 2E5EA 4ZOAA 2CKBL 4ACPA 2V17H 4J2XA 5BS0E 3FO1A 2Y5TB 4OZFH 1BQUA 3EIFA 2X4PB 1T7XA 4F57H 3HNVL 1O7VA 3MRJA 5FYLH 4KDTA 5EU3B 2DQTL 2ADIA 3H9SE 5AEAA 2H1PL 4BUGA 3CFKB 1I8LA 4X6CA 4MNGE 2VDMH 2X4QA 3BEWA 1NPUA 4DUVA 1H3GA 5FK9A 4DKFH 4R4FL 2XKSA 3MNZB 2PXYC 4M02A 3D9AL 5I76B 4HS8H 2YD6A 2VABB 1M7XA 2JB6B 1S7SB 3QHZH 3SKJL 1UWXK 1M05A 3FT3A 4LLUA 1JHTA 5EBLA 4I9WD 5ABDE 5JXAH 1LO2H 3C2AL 3IJSA 5CBAB 5DEZA 4KK5D 3RTQB 5D72L 3HB3C 4IIQA 4EI6A 3TH2T 3LKQB 1YEEH 5AYUL 3IVKA 1NGPH 1L6ZA 4EBQH 1RIHL 3GUTB 3SPVB 3QUZA 1JI1A 1T4KA 3BKYL 3OAUL 4HWNA 4GQ9L 2EZ0C 1HHHB 1MRCH 1PD6A 1U3YA 1MUJB 4ZODA 4AQOA 3V0VA 2QJDA 3LS5L 5DQ9B 2FEEI 5AAMA 1ZSDB 3OX8B 4W6XB 1EEYB 4KAQH 4U1GB 1BP3B 1T3FA 3LKOA 5K59F 4F7EA 1I1AD 2OR7A 5ISZA 5CWSB 1V7NH 2C5DC 1B2WL 3S97C 3TN0C 3G5XA 4ODXB 4RMVA 2H8PB 3MFFB 4EEEA 4PJEA 5D7SH 1CG9B 5E00B 1G0XA 1IT9H 4W81A 3RAJL 5A2FA 4P5KA 1BD2E 5SX4H 1CFVH 2GSIA 4UOJA 5IOPA 4UDUB 2AJYL 3HR5A 1LP9E 2MJWA 3ILQD 2D3VA 1ZVSA 3MRMB 4YBLB 4HK0B 2VLJB 1G6VK 5TGBA 3H7BB 1T1YB 3K8LA 1WBZA 2R4SL 4JZJB 3ULVF 1E4XL 5FEBA 4NUJB 3QI9B 3P73A 5IR1A 4P99A 2W0FA 2YPKA 1UVQB 3V6OE 1BBJA 5DJXB 4HUWB 3MRIB 3LH2L 4YPJA 4XC1L 2NY0B 5IB4B 3TFKD 4WW2A 4HKZB 4X99A 1MIEH 2PW1B 3BUYB 1QLRA 4RBPH 2DMCA 3E2HB 5EU7E 1HHIB 5JHLL 1KCSH 4O02L 4YDVA 1BLNA 3BIBX 1BJ1J 1DQML 3LQMA 2OK0L 2ESVD 4X6DE 3UPAA 1F90H 5TF1L 5FYJL 3PWPD 1S7XB 5E5RB 3MV7D 2B2XH 2Q87A 3BDYH 5DD5H 2CUMA 2J4WH 4Y16B 4Y5XB 5IEHB 4Y2DA 4HULB 5JHDA 4M6NH 4EIZC 5HD8C 2ZUWA 3E0GA 5E6ZA 1UXWA 5DA4A 1U8QB 2AJ3A 4PB0H 5DTFB 4G8GE 1OD7A 2ZOKB 5EO1B 1MFDL 2DQFB 3FTGA 1IZJA 1IGTB 2FZ3B 2R56H 2GJ6D 3OHXA 2J6EH 3KPNB 4YZFE 3QNZA 4N0RA 1PX3A 4HIEB 5IW1B 2ED8A 4P2QB 4K2UL 3P0GB 3TP4A 2HMIC 1DBAL 2JJUA 3DPBA 3HLAA 3DX8B 1CDJA 1UH3A 3HE7D 5DURD 1WBYA 1T1ZB 1N0XH 2P42B 1GC1C 4DZBB 5IFJB 4AG4L 2FHFA 1BFVL 5L0QB 3LSOA 3PABA 4K71C 3ILPB 5F3BB 1EHNA 4H25A 2PYEA 3BISA 3NABL 4A6YH 4BSVA 2DLHA 4BZYA 5GS0H 2O26U 4OKVB 3C6SA 5DJCB 1OAXL 2HG5A 4I48A 4IRJC 3UTTE 3TBVA 2HFTA 1I3GH 4FQCL 4JZOB 4JEGB 3QDGD 1HZHH 4YDKH 5CHNA 4ZOCA 3N1GC 3SKNA 1NCDL 1FIEA 4Z7UA 4NNXB 4H20L 3VDAA 4D0DA 2VZUA 2XKUA 1FORH 3U2SB 3ZE2E 3Q5TA 2X09A 1D9KB 4AL8L 3SEPA 1QFUL 4Y8AA 3OBAA 4LSSL 1QRNE 4PD4K 5ID1A 1S7WB 5KJRH 3R8BB 3MLZH 2APVA 4PJ9B 3ESUF 3ARBA 5C9JA 5E8PB 3TNMB 4O58L 3EOTH 5BQ7B 3ZKMC 4RGNE 4DZ8A 2X1WL 1CXKA 4RWYL 5FOBB 4UIKH 2XA8H 5D1ZD 2ARWA 1YPZE 2OYPA 5I66A 3SDAB 4FTVB 2X42A 2V7NB 2DL2A 1S9VA 3GI9H 2J7LA 4CADA 1TJHH 3AM8A 1I3RB 5EA0H 3MCG1 3GIZH 4YX2L 1RK0A 4I2XA 5F9JA 4AENB 2KL6A 4Z78A 3M1BA 3VMOA 1CLZH 1QQDA 4ALAL 4K55A 4L9DA 4M5YL 1HIML 3EDJA 1LEIA 2P5EB 1FFNB 3CFEA 4MCZB 4LU5H 4NP4L 3X11A 4RAUB 3T4YB 1MY5A 3RWIB 2XACC 5IGXH 1PKQE 1QSEB 3QXTA 3WIFA 4HUVB 1T5WB 1T1WB 1MCFA 4HV8A 1LD9A 1HH6A 3K1DA 3MNVB 4GW1B 3L3JB 3VWJD 4CW1B 1BFOA 5KTEH 3UZQA 4XMPL 4QOKB 1AGFB 5JOFA 1CFQB 4P3CH 5CSBA 5H35B 3O9WA 1S7RA 5FDWA 2Z93A 4RDQF 1FP5A 1IZKA 4JCLA 1WWCA 5DS8A 2PCPA 2ARJA 3ZYIA 4FQXA 4G5ZL 1EAPB 1MHEB 2B4CH 1QPXA 3QIBB 1QR4A 4QRRB 5EG6C 3TYGH 4L8BB 2CDEA 5I71B 2AQ2A 1Q9KA 3O3AB 3ULUL 5DGRA 2PO6D 1IC7L 4PJAF 3MRQA 3HA0A 3BP6B 4P2OA 4HJ0C 3SDXE 1RUKH 1KTLB 5JPNA 5CJQL 5BW7C 4DKEH 4R2GB 2NY1B 4Z9KB 4X4YB 3CPLA 3RGVC 1JBJA 4JO1L 3DVNA 3G6DH 1IGYB 4GAJL 3WKMH 5ERWB 1UH4A 2AJVH 4R6UA 4AJ0A 1IC4H 3NIFE 2Z31C 5I18L 5DEGA 1BQHA 5B8CB 5D93B 1QPPA 3K2UH 4JN2B 1JZ4A 3RVUD 5TDOA 1IL1A 3MRRB 2CR3A 4NN7C 4PLNC 4KVNH 4AMKH 5I75C 5I16B 1U8JA 1YQ2A 2CKBA 1XH3A 4H5SB 5L6YL 2D03H 2VXSH 1F8TL 4PJCB 2B5IC 3VA2C 5FYJU 1BX2A 1EO8H 3KYOA 1MAML 3QUYA 1X6LA 4YHYB 5JNYB 1MVUA 1U41A 2MQ3A 3OWEA 3RKPA 2NZIA 4L29A 3QCVH 3IB4A 2P46B 5DWUL 5GRUH 4KU1A 5DUMH 4RFNB 1II4E 3MV8E 2PETA 4YR6A 3GZKA 1CWVA 3RY6A 4ZSOA 1CL7I 2R2BB 4QRPB 4DGVL 5F7HA 4HF5H 4YDLB 4OTXH 2HFGH 4C56D 4K8RC 4OSUL 4H1LA 5AAWA 1A3RL 5D1QC 3ARTA 4M61B 1MCNA 1BIIB 4U1IB 3W9DA 1Z0NA 3LRGA 4GRMB 1REIA 5CINL 4PRID 1ZANL 1N3NA 2APXA 2XZZA 1G9EA 4QTIL 4S1QL 1IC1A 4Q74A 4MQTB 15C8H 1Z9MA 4MB5A 4WEMB 3VXSE 1U3HC 3KPPA 2YSSA 4PTTA 2HJLA 5ITBL 4UB0L 5I30H 4G9DA 2X7LA 2F74B 4BK5A 1ZHBB 4OUOA 5CS7A 5E9DB 3BKCH 2VLRE 5HDBF 5SWSB 4TTDD 5AWNL 3MMEA 5JW4N 5E6IC 4QO1A 4QHUB 1NBQA 5SX5K 1CVRA 2GJZA 1DBKH 3P0VH 1A6WL 1HSBA 3HZMA 1J0KA 5JXEA 4XTRC 3BH9A 3OXSB 1RZIA 3GSWA 4LSRH 4QRUA 2ZPKL 3RZCA 5CGYD 2GTZB 4GW4A 4NHUA 1FRGL 3ROOB 5I1DA 2VJXA 4LSUL 1IEAB 4XCYB 4LPUA 4YFDB 4GG8B 2WWKT 5FECB 2BHZA 1E6JH 1IC5H 5DJYA 4Y5VA 2VNCA 2C3WA 1WEJH 1KUMA 5EU3A 4BUHA 2RGSA 2IPTH 1KCUL 4XNQB 2F9BT 2AXHA 4KV5F 1HEZB 4K7PL 3B2UC 3CFKA 5A2LH 3LQZB 3H9HA 3HUJF 1FZOA 4POUB 4OF3A 3QUZD 4KQ3L 3WJJC 4JVUA 3MNZA 3F7PC 1KJVB 3MJ9L 4LRIA 5EZIH 5I6XC 5E2JA 1U8MB 5I76A 3FO0H 1KNOB 4OCSL 1OAKL 5D96B 2CIIB 1WBXB 2JB6A 2X44D 5DVLA 1U8HB 1A2YB 3U7WH 5CJ5A 5CBAA 3RTQA 1QFWM 5H2BB 5HDOA 3FFCD 1MOEA 3KPRB 4C83B 5ISZD 1GL4B 1XIWC 3M07A 4Q6IB 3QUXD 3SPVA 2P44B 5A3IC 2W9DL 4G8EA 1HHHA 5E4EC 4YXKL 1FFOB 3U9UB 5CCKL 3UJIL 3MJ8B 1MUJA 2MKWA 3OPZH 1UEMA 5DQ9A 5IB2B 1ACZA 3OX8A 1I9IL 1BZ7A 4XCEA 4P59L 5CD5D 3I6LD 3B2VH 1S3KL 3S98A 5CWSA 1YMHB 1XT5A 3N50A 1H3TA 1DEDA 1S7QB 1DQQB 1PJ9A 5IJKC 2EO1A 4ODXA 5E2WL 3MFFA 1RJZB 2OTUB 1A1NA 1IM9A 5E00A 3CD4A 1T0NA 3QWQB 2DWDA 4K3EH 4UDUA 1OD9A 2X9WA 4N68A 4HK0A 2VLJA 2I5YL 1MHPH 1T1YA 3V5HB 4IDJL 3S3JA 3TT1H 3D18B 4JZJA 1UC6A 2Q1EA 1V3KA 1MJ7L 3QI9A 1L4IA 3OKYA 2COQA 3RWDB 5JLZB 3W5NA 1JHLH 5IHUH 3GMNB 3BQUD 4HUWA 3MRIA 4KTEH 4LVNC 5J06A 3NCYS 4FS0A 4Y2DD 5JHDD 5I15L 2IH3A 1MCDA 1MCJA 4Z5RB 2PW1A 4LEOB 3DO7B 5DMGD 2FX7H 4FNLH 1QYGH 4RISH 2V9TA 5AYQA 3DGGB 1EH9A 3RVWD 3T3MF 1BMGA 1LO4L 3QEQB 2VC2L 4NZUL 2OR9L 1YJDC 3CC5B 4LSVL 4F37F 5F1NB 5LWYH 3C2SA 2VDNL 3C60B 4YHLH 1MCHA 2ZSVB 4Y16A 4Y5XA 5ACZB 1P4IL 1IGJB 5L7XH 2BDNL 3GMMB 1C16B 2F54E 5EFIB 1A9EA 1J86A 2R69L 3QXUA 4XP4L 4ZOEA 1IAOB 5KVMC 5DTFA 4FXLA 2QSVA 1HK6A 2NZ9C 1IGTA 2FZ3A 3NAAL 4P48A 4MD5B 3QJHA 5D1XC 2A6DB 3WXVL 2PYED 5HBBA 1OSPH 5D70L 5IHZB 5FV1L 2IF7A 1FLRL 4HIEA 4OCWH 5DQJA 1N6QH 5IW1A 4P2QA 4GRLB 1WAAF 4Z0BH 1FFPB 3QFDB 1U2CA 5FHAL 4MCYA 5T33H 5T1LD 1BAFH 1LDPL 1I1FA 1CLOL 3ARDB 1YEIH 4MNHA 3RIFF 4M5ZL 1T1ZA 2AK1H 1Z0MA 1FNSH 5K59E 1FBIL 1RFDL 1NCCL 4LPYA 1OT1A 1RULL 1CGVA 3MRDA 2F58H 3ILPA 5F3BA 4WI3A 1E4JA 1JGLL 1YEHH 3U4AA 2EE9A 3UPRA 3MV9B 2HP4A 1ZEAL 3WIHL 4U6TA 4KMTL 3TZVB 1AXIB 1RZJH 3ARBD 5LKNA 1Y0LB 1GGBH 1F3JB 4OLWH 2VZSA 3B43A 4O4YH 2BVQA 4N8VB 1S7UA 4GAGH 5ICXB 3RJQB 3VFMB 3ULVE 4NKMB 4K23L 1VA9A 3SKOB 4PJBA 4HUUB 4IRSB 1XF3B 2APFA 2XZCH 1D9KA 4JY4B 4Q9RL 4KC3B 3KR3L 1JZ7A 1OLZA 3IXAB 3D39E 2Y07H 5F7UA 2FX9L 4DEPB 5KS9B 3CFJB 4R90H 4PJ9A 1K5NB 3GBML 5DT1H 4QXUH 5E8PA 3UC0H 5BQ7A 4U3XA 2HJKB 3RIFK 1ODAA 3HG1E 5FOBA 3UBXA 3LN5B 1UENA 4HS3A 4MA7H 4FTVA 4ZS6C 3RVXD 4YBQC 5FGBA 2L7JA 1FE8L 3QFJE 5CJOL 1R5IA 4GG6A 3FONB 3PL6A 2X9YA 4ZPTB 4PBVC 5C2UB 1Q0YH 2YRLA 4YHZL 3ECBA 5EBWA 3FHAA 2AVGA 4R8WL 5DMKB 4MCZA 4FP8H 1ZT4B 5EU4B 3PG2A 3O9WD 4F3FB 4ZPVB 1BZ9B 4TYUA 4I4WB 3T0WA 3ALWA 2BMKB 4RAUA 4XNZC 3RWIA 2D7PA 4Z95H 3DNKA 2A6IA 5JMRA 4HUVA 5HPMB 5HHMD 1T1WA 4FQXD 4OZFG 2F5BH 1U6AL 2NY2B 1JZ6A 1EJOL 4Y1AA 4XPAH 5GGQL 3O41B 2WUBL 5GRVL 4GW1A 3L3JA 4CW1A 1UEYA 1YECH 5FM8A 1AGFA 2DMBA 4LVOB 3VE0B 1CFQA 4NQDB 3MV7E 4JRXE 4UAOC 1I85C 5H35A 3V4VH 3ES6B 4JQXA 4P2OD 3LOWA 2ZUQB 1KOAA 1MFNA 3K3QA 1FFRA 3MUY1 4OUUB 3QUKA 5SWZE 1EEUA 4AEIL 2B1HL 4K94L 1MCBA 3HAEB 5K9OB 1N0LA 5DDHB 1OF2B 2ORBL 4G8IA 1CD1B 1DQJB 1EAPA 1ZTXH 4Y5YC 3RWEA 5DZNA 3QP3A 1DQLH 3R8QA 4OLZL 3AVEA 3QIBA 4HS6A 4BFIB 4L8BA 8FABB 4HIXL 4NJ9L 1OB1A 2BRRH 2YN5A 1UA6H 4KKLC 3BP6A 4FOMA 4R4FH 1KTLA 3FZUC 2LVCA 4HWUA 3NPSC 3MRFB 5EUOF 4PGCA 4E0RB 1FZKB 4H1LH 2FHCA 3ZT6A 4X4YA 4EVNB 1NGWA 3QUYD 5D7IA 1JP5A 1NBZA 1IGYA 2NW3B 3C2AH 2BXYA 4JDVA 5ERWA 4WY7H 3BESR 4YNYB 1CR9L 3IFNH 2X1XR 2LU3A 1ZT7B 1MELA 4GAYA 3H9ZA 1RIHH 1WCBB 3MRRA 2DQCL 3L3OB 1IKNA 2YEZB 3BKYH 4NNPH 5DFVC 5D5MF 3QIUC 5KVDL 4H5SA 3KDMB 1WWWX 5IP4A 1ZA6B 3BN9D 5BV7L 3D2UB 5C0BE 1AQDB 2H41A 1ZLVK 4YEEA 2VL4A 3NCJL 3C9NB 3DV6B 1A6TB 1BJ1H 3BOVA 4HCRL 4ODBD 4B50A 2HLFD 1B2WH 5F9WB 2UWEB 4D9QD 3P11L 3LV3A 3KG5A 4QRPA 2IBZY 5GGSY 3MLPA 2FJHA 4MA8L 3T0EB 2GEEA 3MJ9A 3MREB 2AEQH 1L7IH 5EUKA 3WLWD 2DI9A 4KTDL 4Z7OF 3RAJH 4WENB 1MQKH 3MBEB 4G42B 4U1IA 4M61A 5JW4Q 2W0PA 2Q76B 5DRNB 4WUUB 1E4XH 3TEUA 1QP1A 4ZDHB 5JXED 2VZVA 2FEDC 5E7FA 1DBMH 5I9QB 5IV2B 4FQPA 2EDBA 4XC1H 5KVEH 5IKCA 3RZCD 1ZHBA 3L5XL 5E9DA 2VDPH 2A74B 3NIDF 2BCKA 2OQJB 4PREA 1NJ9B 1DANT 1H3WM 2EDTA 1TIUA 2EICA 5L8LB 1INDL 4O02H 4GT7A 1R5WB 5IHLB 1DQMH 1FDLL 4FMKA 4XAWL 3UTPD 5IBTH 3KAAA 4PJAE 3OXSA 1SY6L 4RMSA 5B4MC 1QFHA 1TJIL 3QDAA 1SHMA 3CSBA 5C92A 3ROOA 5DJ8A 4GKNA 5LCVL 3GB7A 4C57C 3UTQB 2DD8H 3CFCL 5E7BA 1IEAA 4XCYA 3CH1B 4UTBH 4JPKH 4GG8A 1Q8MA 5E2VH 1UJTA 5FCSH 3VD9A 1PAMA 4ODUA 4DN4L 2EDKA 4PGDA 1ZLSH 3QXVA 3RTQD 2VOTA 5GS2H 5FYJD 3QNYB 1NANI 3EZJB 1S7TA 4BM7A 3LQZA 4ZO6A 2ICEB 3DTXB 3O6ML 2CUIA 4JO4L 3BFOA 1DBAH 2VXUL 1KJVA 4L3AA 2CDGB 1MCLA 2IQ9L 1KNOA 5GSRB 4X7FC 4WI7A 1AC0A 2CIIA 2WWMD 1WBXA 5I1HL 2P8PA 3RWFB 2VDLL 3ME0A 5ALBL 3CXDH 1BFVH 4RMTA 4ZUSB 3BI9X 5H2BA 3G5ZA 3NABH 3WS3A 2FO1A 2L4OA 1CXHA 1VPOH 4C83A 5ANMA 1CICC 4ZUVB 4Q6IA 2W65A 3TGXA 3RIAK 4XPGL 2ZUSA 1OAXH 1FGVH 4NNYB 5EU6A 2QSCL 4R0LB 4FQCH 1GZQB 1FFOA 1ORSA 1IGML 3U9UA 4G6ML 3FJTA 3MJ8A 4U1HB 1HWHB 4R26L 2DAVA 5IB2A 2W9LA 2VLJD 2ICES 4PJFB 1RD6A 4KQ4H 1W72B 4KI5D 4L8CB 3IGAB 1YMHA 5HGBB 3QI9D 1RVFL 2WP3T 2YA2A 1P2CB 4KKCC 1S7QA 5HDBE 4LSSH 5LQBH 1IGFL 4BFBD 3HC4L 2NY0D 1P84K 4WWKB 2OTUA 4WI6A 5C0IB 3RQ3A 4QXTA 4YXHH 2I9LB 5EBMA 3O6FB 3VXME 3VFVB 1DSFH 4URTB 4PY8I 3CK0L 3BN3B 4KY1H 3VFOB 4Z7WB 1ZA3B 4NQEB 4J4PA 1CBVL 1CFNB 1RPQA 1XF5B 2HFEB 3D18A 4WI9A 3VFRB 4NBXB 4OKDA 4ZNEE 5JR1H 1Q0XH 5CLWA 5IESH 3RWDA 1PSKL 4YX2H 4N1HB 4RRPA 4KJPC 3WIHA 3CVHB 4ALAH 2Q8AH 3B83A 4Y16D 1DQTA 1KLGB 5JIHA 3FT2B 2E7BA 3RKDC 3ZDYF 4KV5E 3ARGC 3HUJE 1OGAE 3QEQA 1OP5K 3CIQA 1UZ6F 2E6QA 1IM3B 4LK4A 5JORB 1GZPB 1P69B 5GZOD 4I0PA 1G1YA 2BVPA 4WU7B 4L4TE 3CC5A 5F1NA 4P2QD 3C60A 4N0YL 2ZSVA 5TQ2L 4XMPH 4RGOL 1IGJA 1C16A 1RZ8B 5EFIA 4MVBD 4AH2B 1LE5A 4ORZC 1P4LA 2EYTB 3VH8G 4JQVC 4KK8C 1K2DA 3VFGH 5I1LA 4HKJB 5MERB 2NW2B 3OKLA 5IIEA 3TBSB 4JO3L 5IMKB 2A6DA 1IBGH 1J0IA 3GIVB 5A2JH 3BPLB 1W72L 5IHZA 1BQLL 2DQEL 1ZGLM 2D4DA 4G5ZH 4P5TB 2P24A 2XG5A 3C8KB 2CO7B 3HNSH 1LNUB 4GRLA 4WO4B 1XGPB 1FFPA 3QFDA 2PNDA 2OI9C 4X80L 5C3TA 3ULVH 3DUHA 3VGGA 5AD0B 3ULUH 4OGAD 2ERJC 3ZHDA 3ARDA 4CN6A 3S8WA 5CJQH 5E99L 2EH8L 2KKQA 4WV1C 1MHHA 1IMHC 3BT2H 4JO1H 5JIPA 1D9KD 2ZCLL 4GAJH 3MV9A 3PQYE 4ZTOL 4LPXA 3HE6A 3EYFB 3OG6B 1MJJB 4PJ9D 1D5IH 3TZVA 3FFCE 1Y0LA 4YGVB 5F7KC 3E3QC 1NDGB 1HYRC 3T2PA 1J8HE 4ZOBA 4N8VA 5L6YH 3FQXB 3VFMA 4XT1C 3SKOA 4FTVD 5DJ0B 3NGBB 1LO0L 1MAMH 4IRSA 1XF3A 4K3DL 3X12B 4JY4A 2HT2C 2ITDB 5KSAC 2PXYB 2BNUA 3IXAA 3RL2B 4KPHL 3VXNB 3PL6D 5DWUH 4HWZA 3B8SA 3QEUA 4MXQC 4FXKB 2Q6WB 3QDJB 1A9BA 4F9LC 4UNVA 2NY5H 2XFXA 4CDHA 3AB0C 4AEHL 1A6VL 4HEPG 1KPUB 1ZLUK 3T3ME 2ZKHH 1V7ML 4O5LH 2EXWD 5C3LD 2A1WH 3LN5A 4GRWH 3UAJD 2HTKD 1A3RH 3CXHJ 3DVIA 3ZLQC 4PJDB 4WUKH 2IADB 1JV5B 1DTUA 4L4JA 2YPLE 5E95B 3ZTJH 4QTIH 4S1QH 4Y1AD 3JWDC 5F1IB 3SBWC 4XRCB 4CVUA 5ILTL 3RVTC 4UB0H 1EERB 1HXMB 1Q9OA 1X5HA 2FATL 1F13A 5KSVB 2Q86A 1ZT4A 3QJFB 5EU4A 4CMMB 4F3FA 4ZPVA 4PJIB 5I1GH 1KPVA 3EHBC 5AWNH 2BMKA 5FCUH 1FFQA 1UB6B 4MD0A 2DJUA 4PP2A 4P9HL 5I2IB 3TN0B 3CSPA 1WAAE 5HPMA 1CFTB 2XTLA 3A0OA 4F7MA 5IFHH 4HCRA 4QXWA 1A6WH 1YY8B 3ZTNL 3O41A 3QIBD 3RA7L 2VE6B 4XPHL 2J8UF 3BE1L 1OL0A 2ZPKH 3VE0A 4NQDA 4YPGB 4X4ZA 1FRGH 2GSGB 1KTDB 4X8JB 4OUUA 4R2GD 3UX9B 2NY1D 2BVTA 1B4JL 3HAEA 5K9OA 4HLZH 3FB6B 4TUOB 1OF2A 3GHEL 2J12B 3PWUB 2MWCA 1CD1A 2VDQH 2W9EH 2F53B 5E2TL 5CJBA 5BMFL 2HTLC 1GCFA 1XGUB 3ZKQD 3RNKB 4K7PH 4BFIA 3BZEB 8FABA 3FOLB 4PRDB 4MXWL 1DEEB 3PP4L 1IGIL 4KQ3H 2H2SD 4OLXL 4JZNB 1JFQH 2AJZA 3MJ9H 3THML 3I50H 3ARWA 4ZFOL 1DBBH 2K3TA 5BOPA 3KLSA 4E0RA 1FZKA 4UIMB 4EVNA 3VGAC 1PLGL 2J8OA 4U7KA 2NW3A 1YQVH 3QHTC 4JY6A 3I9GL 5MENE 3V6OC 2JJSC 3DMMB 5E2UL 4JFFB 4WJ5B 1SY6A 3IDYC 1JZ2A 2AKRB 2EEAA 1ZT7A 2DQHH 2ATKB 4X7SL 3UPCA 4Z7NF 1WCBA 4QRPD 1A64A 3MOAL 5CSZB 5CSGA 1IGCL 3X13B 2YEZA 1JI2A 3KXFB 4DAGH 2XKNB 4OLUH 4YXKH 5JIKA 5EU7C 3KDMA 3UJIH 1ZA6A 3D2UA 2J5LB 1SM3L 5J0BA 1AQDA 1R3JB 1I9IH 1Z9LA 3RVVD 3SE4A 3IJYA 3MGOB 3NCFB 1MCWM 3DV6A 1D5ZB 4ODWB 3QQ4B 1NGZA 5IW6B 3U9PH 4MB3A 1TVHA 2UWEA 1AR1D 1UG9A 3QBTB 2DTMH 2FJGB 2DLIA 4PB9L 4PJCF 5E03A 5FO8A 1RIUL 1J8KA 3W0WE 1IQDA 5CJXC 5E9DD 4ONGH 1TZHB 4K71B 2GCYB 2E9JA 2XWBB 5CP7B 4L3EE 2A6JA 5ADOH 2I5YH 1A21A 4ZUWB 3VW3L 1P7QA 2Q76A 3DSFL 4IMKC 5DRNA 4IRJB 4Y7MA 3BH8B 4ZDHA 1MJ7H 2R4RL 3GNML 2EH7L 4G9FA 1A3LL 5IV2A 4PR5B 3FMGL 3R0NA 2FX8H 2A83B 4JFPB 3VGFA 2Y7QB 5E70A 2A74A 4YC2C 2OQJA 1NJ9A 4NO3A 3MRNB 3VXTB 5F7EH 3BW9A 2OMNA 5EO9A 4IOSD 1R5WA 4U49A 4HFUL 5EC2B 1KCVL 4XCCH 5ESAB 2MQ0A 2VC2H 1IARB 3V2AR 3VFNB 3GMOA 2VAAA 2OR9H 1ZKAA 2LABA 5GS1B 4LSVH 1MWAB 2OJEA 4OZHA 5C0GA 2VDNH 5IMMB 5EUOE 4IEFB 4HXBH 3NOIA 3UTOA 4N0UE 1P4IH 4Y4FC 5L2KA 4GS7B 2UY7A 4EN3C 3L5JA 2R69H 5HYJB 2P5WB 3MLYH 2E6PA 4MDJB 3P0YH 3SE8L 4KI1A 3IETA 4JPWL 4YDIL 1FCGA 2IBZX 4FQ2L 5CAYB 3QNYA 5D70H 1FLRH 1QKZL 4NKOB 5BZDA 5D5ME 3ORJA 4HZLA 5HDQH 3DTXA 1KBGL 2XA3A 3BWUC 1AJ7H 2EIDA 4OGYH 3ROLB 2VSCA 3RNQB 1NCWL 1GC1L 1QSZA 2PTTB 5EU6D 4KJWC 5TE4H 1ZAGA 4MJ2A 1LDPH 4OZGB 5GSRA 2ITCB 1CLOH 2KBGA 4PUBL 3OB0K 1F2QA 4GMSL 4Q7DA 2DQUL 1FBIH 1RFDH 2BZDA 3GSVB 4U33A 1RULH 2DQIL 2JCCB 1D6VH 5HVWA 1C12B 4ZUSA 3IAQA 4LNRB 1JGLH 3OTTA 3MRKA 3WO4C 4ZUVA 1GYAA 4HHAA 1CDIA 4Z7OE 4Q0XH 4WFGD 2IFGA 1CGYA 3GI8H 5DHVB 3BUTA 4IMLB 4POYA 1XR8B 4KMTH 4NNYA 1GZQA 4UT6H 1PG7X 1FVEB 4HC1H 4LRNL 4ZSOE 3B3IB 3PGCB 4K23H 2UYLB 3HI6H 3MRBA 1TETL 4DOHE 4J4PD 3FQUB 3V4UH 2IC2A 1YMMA 2CPCA 1W72A 1NCNA 4L8CA 1VGEH 5HGBA 3GO1L 1FSKC 4W70A 1P2CA 1MWAL 3NIDE 3LKRB 3LEXB 2C3VA 2GYSA 2ADGA 2I9LA 3O6FA 3WDHA 1G7IA 1TPXB 3B9DA 4WNQB 3VFVA 3NZHL 3DETC 2WBJB 2CXGA 3RZWA 3VFOA 4B41A 3K4ZA 4NQEA 4UBDC 1A7BA 3IFLL 4QHLB 3VRIA 1I8MA 3S6CA 2HFEA 3QEQD 4GAFB 4CGTA 3SDCC 3VFRA 1E4KA 4M03A 4HUXB 1NMCC 1Q1JL 5T1DL 5A43C 2CMRH 3BPCB 2ICWB 3UTSE 4HKXB 3SGJC 3BD4A 1J1PL 4PBXA 3VG9B 4OB5H 3C60D 3BPNC 3WNPA 5IM7A 4U1LB 5LGJB 3FT2A 4EI5B 2EDQA 3F7VB 4R8WH 1BQHG 4ZD3L 2R29L 4I3GA 2BSSB 3F62A 4YHKL 1T89C 4WI5A 4JM2B 1H3UA 5IQ9B 5C09B 2O5XL 4LSQL 1FC1A 5JZ7D 2O5ZL 3QRFM 3W11D 1IM3A 1GZPA 4IHOB 4WU7A 2JKXA 1U6AH 3NA9L 3L1OL 5BZWA 5GGQH 1QHOA 4KDWA 4GRLD 4OF6A 1LEGA 4LCWA 4DTGL 5FHBL 2BVUA 3QWOB 3MCKB 4DW2L 2BFVL 1RZ8A 1TTFA 3SO3B 1HSAA 3BWAB 4PJXB 3LB6C 2EYTA 1FAKT 1CN4A 3S37H 3ARDD 5JTWA 2G2RA 4R96A 4WFEE 4U1NB 5MERA 2B1HH 3VFSB 4NPYB 5B22A 1W2KT 2P48B 1W8NA 2C3HA 4P5TA 3AFLA 3B5TA 1U8OB 3MA9L 3MV9D 4H1LG 5HVGB 2OTPA 3HE6D 2NNAB 3O2DH 4OLZH 4QWWC 4WO4A 1XGPA 3X3FH 4L8DB 1YYMH 4NJ9H 4JFDA 3TZVD 5AD0A 4UI2A 4PJGF 4ELMB 3IAPA 3DVGB 1G7MB 3U4BL 1J10A 2EXYD 3OF6A 4M1DL 2KZ1B 3C87A 4OZIA 1AD0B 3GKWH 4Q9QH 1KB5H 4XNXL 3PHQB 4HWBL 4IRSD 2AEPL 1OSZB 3EDEA 2HH0L 3ZT5A 1I7UB 5J6GB 3SCMB 2X4TB 3GMPA 3EYFA 2HKFH 4K9EC 3VD3A 1CR9H 2VWEE 5EOTB 1MJJA 1AP2B 4YH6A 4FQ1L 4MXVF 3PGDB 1PEWA 4U0RB 4F58L 1I9JH 4YGVA 2YOCA 4P2RB 5BVJB 1MHCB 4Y4KC 2ICWI 4AEFA 7FABH 5KVDH 3EJJX 2AS5M 5BV7H 5DVKA 5EZLB 5ESQB 3QHFH 3X12A 3QUMB 3NCJH 4E5XA 4FFZL 4G6FD 5D2LB 2PXYA 4P46C 2VLJE 3I6GA 4PGEB 5I6XB 3VXNA 2OCFD 5T3ZE 1PG7W 4YK4B 4FFWC 4K8RL 3ZDYE 2Q6WA 3QDJA 2GHWB 2NXYC 3RRQA 1UM4H 3OXRB 2R8SH 3QPQD 2FB4L 2OX5A 4MJIA 1NFIB 4LFHD 1EUUA 4YFEA 1Q38A 4QLRA 1T5XA 1UZ6E 4ZFOA 1RHHB 1PDKA 1A6UL 4LQFL 4NC1E 2XICA 4H26A 4MJ6B 1KULA 3WFZA 5KS9F 4C59B 2IADA 4UNUA 1JV5A 1SJEB 1E0OB 4NZTH 2YA0A 1F6LL 4NM4L 2XZQL 3BGAA 4XRCA 2YD3A 3OR7A 5FYKU 3V6ZA 1AXSB 4NQDD 4JFYB 3QJFA 4CMMA 3BO8B 4NKIL 1R3KB 4PJIA 2BC4B 4PLJC 3O3BB 1UB6A 3FRPA 2H26B 4Y0GA 5GRVK 5I2IA 4G6JL 3TN0A 4JFXA 1O7SA 4XCNB 1INDH 4D0CB 5IVXB 2P47B 4M3KB 1CFTA 1FDLH 4MQXC 3NCEB 5GGVL 1GSMA 2VE6A 1SY6H 4WW1B 3U36A 4UINH 5A40E 5F9OL 3TYFB 3VFUA 3QAZC 4NT6B 1HI6B 4R7DB 3DGCR 4YPGA 1GGCL 1JF1B 2DYPB 3BMWA 1XZ0B 4P2QE 5D71H 2GSGA 4XNYL 2YC1A 4X8JA 2APWA 3OR6A 5LGKA 1RUML 5HYSB 3WS6C 3FB6A 3FHQA 4TUOA 5MEQA 1A7QL 5I19L 1ETZB 2XIDA 3OKEB 3PWUA 5DVMA 3UJTL 4DN4H 2CH8A 2F53A 2BHYA 1CQKA 3MUGB 2G9HB 1WZLA 1P6AB 4B53A 5DK0B 1MRFL 3RNKA 2XPGA 4XP6H 5ALCL 3BZEA 1XGYL 4AZ8A 1WFOA 2WQRA 4PRDA 3WJLC 3O6MH 5DK2B 1G0DA 1EXUB 1DEEA 1CXLA 3QIWC 4HIIB 3QEGL 1YEFL 3SO5A 1XF2B 4I8DA 2YD7A 1INEH 3SKUD 1MFAL 3HZYA 5D7LA 3D2UD 3LPWA 4UIMA 4LKXB 4IM8A 1AY1L 1G9NH 3G6AA 4ODSL 1ED3B 1BGXL 1O5DT 4JFFA 5E4IA 3W82A 2AKRA 1S9YB 4HXAL 3R1GH 1H3XA 4P23B 3EYUH 1MFEH 5DFTA 3QQ9C 4HSQA 5F7NC 3X13A 3T0ED 3ZMRA 3L3KB 2QSCH 2XKNA 1T66D 4U6HB 3V6FA 3HC3H 4JPVL 3MBED 2HN7A 4UV7L 3T8XB 3MGOA 1P7QD 1MCPH 3QQ4A 2X4NA 4F7TA 1P4BH 5IW6A 3LKSA 1WTLA 4BA8A 3PP3K 1RVFH 3C5ZC 5J6HB 4G9FD 2K7PA 2VDRH 5DFWH 2ADJB 3ULSA 2FJGA 5KBNC 1RK1B 1IEBB 2IG2L 3AXLB 4I3SH 1J1OL 2AXGB 2DM2A 2GCYA 4PGBA 2MHAB 3U1SH 2XWBA 4JAMB 1AFVH 4KROC 4UOW1 1BF8A 5DMIL 4JG1H 1UGNA 2BVYA 3CK0H 5C0CB 1MJ8L 2P5EE 3TM6A 5ADPL 1WUNT 3EW3B 4LOUD 4ZUWA 1CBVH 4JDTL 2J8UE 3QXAB 3EO1A 4IRJA 5DUPL 4JRYE 5KVGH 4L1DA 1QSEE 4PR5A 1DCLA 3R06B 3EFDL 2A83A 2D7MA 4TUJA 5BO1L 2WLYA 2Y7QA 5F70A 5L2KD 2VH5H 3DJ9A 3C8HA 5CIPB 3VCLB 3MRNA 4H8WH 4M62L 4QOKE 5EULV 4UTAL 5JW3H 1AD9B 1YJDL 1MRDL 2Y25A 3JV6B 4QTHB 3SY0A 4NN6C 4IOIB 2I27N 5EC2A 4Y19B 5ESAA 5JA9A 3VFNA 5LXGH 1CLYL 5GS1A 2BK8A 1MWAA 1X5AA 1KJ2B 4LDEB 1MF2L 5IMMA 1YEJH 4EUPB 4N0YH 1J7VR 2FWOB 4LVEA 1MI5E 4DGYH 1J0JA 4XBPA 4QRRE 5D8JL 3PE9A 3EO0B 4AYFA 4GKSB 3ETBF 1CYGA 3RPIB 3TA3C 4LPVA 4POZD 1FO0B 3PHOB 4LPWA 1RI8A 4Z7NE 4OFYA 3EOAB 1AO7B 3UBXG 3PJSA 4LLYB 4NKOA 3STLB 4XP9L 4GUPA 5HHVL 1I8IA 1HYSD 4XNZB 3O2WH 3RNQA 3OG4B 4KRMB 4YWGH 4OZFB 1TQBB 3IDXL 32C2B 1QLFA 4OZGA 2ITCA 3EKCA 5FA3B 1FAIL 3BPOB 2ADFL 1JPST 1OT2A 3U6RB 1CD0A 1JYNA 1EIBA 1OGTB 3MLSL 1AR2A 5I1CL 4NKDB 4TSBL 1C12A 4WEBH 5EB9A 4OBRA 4MJ5B 5EOCL 4M7ZC 1MPAL 5FA4B 2QADC 4PJCE 5BVPL 1VFAB 2ZCLH 1WIOA 3K81A 4ZTOH 2CLRB 3S36L 3WEXA 5DHYA 1JZ5A 1XR8A 2EE2A 1V3MA 1VFUA 5IB1B 3E6HB 2NY5C 3O6FD 1UKSA 3OAYH 3U82B 1FVEA 1Z3GH 2ED9A 4Y5YB 3N9GL 1FHGA 1T7YA 4NKQB 3B3IA 2VITB 3PGCA 5MI0C 4KMQA 4NQED 5KAQG 4KGJA 3C08H 1H15A 1FVCB 4N9GB 1OW0C 2MCPH 1I1AB 4K3DH 4NGHH 3MODL 4L3CB 1WZ1L 2OJZL 5ETUB 4FQJH 4M00A 5J57B 4C54A 3LKRA 4HT1H 4BSJA 4HG4J 3RGVA 5C1MB 4G6AD 1RUQL 1SBSH 2I24N 1JPTL 3NN8B 4PJFF 2VZOA 4WNQA 1V7MH 4XVJL 2AI0H 1BJ8A 2NX5A 1X5IA 2HYMA 4QHLA 1A7PL 4HWBA 3NZ8B 4FQLH 5EOCJ 5SWSE 2DB8A 2E7LA 1EAJA 4HUXA 5CEZE 5J89A 2OZ4L 3OGCB 2GJJA 5SV3A 1FH5H 1WTGT 3QIUB 4FHBD 1VSCA 4LCWD 2VR4A 3P2TA 4Z7WF 2DKSA 4EI5A 3F7VA 3T2OA 1IAII 3WXWL 3BEVB 2P8LA 1KSRA 5LGHH 1J1XL 2BSSA 5E94B 3VXUA 3H0TA 3HE7C 4FQHA 2PYFA 3PV6B 5IQ9A 5C09A 3NTCH 1G7HB 1XMWA 2EDHA 1S9WA 4IHOA 4P5TD 4X5XB 3TWCH 5HSFA 3U30B 5GPRA 3ZTNH 1JF5A 4FZ8L 4DKFL 3RA7H 4WO4D 3WO3B 5B39A 4XPHH 1WGOA 3QWOA 3MCKA 3BE1H 2NY3B 4HS8L 2VYRE 4PTUA 4PJXA 2X1PA 3QHZL 1EX0A 4YDJA 3TIDA 1BVZA 1ZWIB 3FO2B 1LO2L 3OF6D 5JXAL 3VFSA 4NPYA 3GHBH 1U3HA 1NSNL 1I3UA 1YEEL 3MJ7B 1R24B 4EBQL 5BMFH 1U8OA 4KRNA 3DV4A 3JWNC 1S9XB 2ATPB 5TE6L 5KSBF 4OI9A 4TOYH 5E6IA 1KJMA 4L8DA 3OB8A 1MRCL 4MXWH 5F8QC 4ELMA 3KPRE 4Q9BA 3PP4H 4RSVA 3DVGA 4U7SA 1G7MA 1FGNH 4XVSH 4AIOA 2X5PA 5MP6H 2A0LD 2C4FU 4FFVD 3HZVB 1AD0A 4DWHA 5T3ZH 3PHQA 2GITB 2AK4E 2D4FA 3RU8H 5DMYA 1V7NL 1OSZA 5D1ZC 1I7UA 5CJ8A 4OJFH 4I3RL 2X4TA 2LAAA 2PXYD 4PRAB 4HIHA 5E2UH 4S2SB 4LCCC 5HY9B 4R4BB 5D7SL 1X5FA 3QDJD 4DFHA 1IT9L 1YNKH 4C4KO 4HAFA 4CU7A 2EDWA 4M7LT 5IJVB 4P2RA 3O3EB 3RPKA 2VLLA 3O4LE 3PDOB 4A6YB 2UZYB 5EZLA 5ESQA 2EIZA 1SM3H 3C5JA 2FYYA 1T21B 2N7AA 1VKXA 1NGYB 2HVKB 2OXGA 5D2LA 4PGEA 1PBYA 5DLMH 1B0GB 4KKBC 4O2EB 1BVLA 2V2TB 1MIEL 2VO5A 2MOVA 3ARXA 4ZAKB 5F6HJ 3B9VA 5CP3A 1RIUH 1F58L 3GGWB 4M7KL 1NFIA 2KZWA 4TUKH 2VTFA 1KCSL 2R0ZL 1T22B 4NJAH 2Q7YB 4XMKL 2RBLA 3G6JA 3V0WL 4MJ6A 4OM0H 3IDIB 3IKCB 4MMZC 3TN0D 2IPKA 5JO5A 3EOBB 5A1AA 3MYZA 3U7YL 3DSFH 1SJEA 5J4MA 4I18C 1YEDB 2GAZB 4N5ED 4ODTH 5BOZG 2J4WL 3QA3B 4M7JL 4YEFA 4WHDA 2CLVB 2R4RH 2KUTA 5HYEA 3H7LA 3BZ4A 5DD6B 1BHGA 2EO9A 1AXSA 3CU1A 3KPQB 5E8EB 4PB0L 4PJDF 3BO8A 3TPUB 2UY6A 2N4IA 2BC4A 2PO6C 2Y6SD 5C0ND 2R56L 3O3BA 1UM5H 5BRZE 1KXTB 2H26A 1G1CA 3KJ6L 4D0CA 1W0WB 5IVXA 5IJKA 4W68A 2F53D 4TVPE 4NQXB 5I17B 4PJGE 3CDGB 1NBVL 2DJSA 3IRPX 4WW1A 4ETYA 4S11A 4FXGB 5EIIB 4Q9CA 3TYFA 1FYTB 4MNQA 3MCLH 4NT6A 1HI6A 1JF1A 2DYPA 3L5WB 3NBNA 3IFOB 1XZ0A 3HTLX 3SJVA 3TPKA 3EDDA 1J0HA 2YZ1A 4XMLL 1J18A 5HYSA 2BNRB 4LL9A 4A6YL 5D7LD 3ZKSD 1YN6A 3O2VH 3SE8H 4MXVE 2G9HA 2I07A 5J13B 4DUWA 5GS0L 4JFFD 5HD8D 1TCRB 1I3GL 4JREC 1DFBH 1EXUA 5HGAB 4J12A 2D2OA 1HZHL 1NCWH 4S10A 1XF2A 4RRPG 1RZGB 1YYLH 2O61B 3C6LB 4PUBH 1FORL 4GMSH 4XP5H 1KGCD 4Z77B 3SE9L 4ZFFA 2HMID 1DE4B 1B3JA 4M8QB 5IG7A 3HC0A 1ED3A 4G80B 5F88B 3VH8B 3F12B 3LPFA 5KJRL 3MLZL 2FBJL 4NYLB 2HJFA 1X4YA 3DO3A 2YK1H 5GJSL 4QYOB 2ARJQ 3U4EB 4DVRH 3I85A 3L3KA 5J9PB 5KS9E 4U6HA 3VD7A 3FL7A 1T2QH 2P7TB 4S1RH 4LRNH 3GI9L 5IWLC 5GIRB 4AY0A 1CCZA 5C0AB 1ZOXA 3ELAT 5EA0L 1CL7H 3GIZL 4RCAA 4KXZI 5IQ7L 4U2YA 4WHTA 5DJDB 2VKWA 4IRJD 4JB9H 1GGUA 3GO1H 1BEYL 5J6HA 4KDTC 4Y4HC 3VRJB 3T77B 2ADJA 4TSAH 4WV1B 2H32B 4X4ME 1RK1A 1LEKB 1TVBA 3AXLA 2AXGA 3SQOL 2MHAA 1KJ3L 1FNEA 5TPWH 4FN0A 4F7PB 5IGXL 4LSTL 3CLFH 4PRIB 5C0CA 3SE3C 1F6AA 1UCTA 43CAB 3QXAA 4F80A 5HHOE 3P4MB 4TNWF 1I7ZA 5C0JB 2W1NA 1EBAA 5JOEA 2P8MB 1CDCA 3E8UH 4HD9A 1ULVA 4V1DE 5F72S 5CIPA 1TQCB 5FO9B 3VCLA 2JELL 2P5WD 4ZD3H 2CXKA 5F7LB 1AD9A 3JV6A 4QTHA 2ADIB 4X7TB 4IOIA 1S9KC 4HAGA 4Y19A 3EJYC 2O5XH 4LSQH 1VADB 2XWTB 2O5ZH 4N8VG 3TYGL 4OFYD 1MCRA 2X4QB 1A4JA 3L1OH 5CLTA 1LO5B 4EUPA 4DW2H 1RUKL 1T20A 2BFVH 2XI9A 2FWOA 1YEGL 3QUXC 1J5OL 4LLAA 1EJ6A 4WTXA 2RCSL 3S37X 4OZ4B 3A6CL 4GMTH 12E8H 4XP1L 3EO0A 4LLUB 5E8OB 3KJ4C 1AH1A 4MNGB 3WNNA 1JTPA 1GIGH 3RPIA 3WKML 3IJSB 2AJVL 3BYYA 4F15C 1IC4L 3PHOA 4EI6B 4TNWK 1G7LA 4P3DB 1TLKA 3K2UL 2OZ4A 1AO7A 5CD5C 2DRUA 3IVKB 4E42B 4LLYA 3STLA 3U0PB 3QUZB 5I8KH 4CN4A 2VLME 3V5DB 1BOYA 4TSCH 4AMKL 4LSDA 3I3DA 3GSUB 2D03L 4GXUM 1J9CT 32C2A 4DJMA 4LCIL 5FA3A 2QQKH 1EO8L 5DD3H 1HNFA 5F3HB 1N5YH 2X89A 2OP4H 4M1DH 2BNQA 3QCVL 2XQYK 5BXFA 4LFHG 5GRUL 4F7EB 2EYRB 5DUML 4HWBH 5C08E 5ISZB 1OAUH 4OF8A 1VFAA 3DYMA 3BKJH 4NSKA 1I85A 2V2WB 1TNNA 3G5XB 4HJ0D 2AJSH 2CLRA 5D7JB 3DLQR 4HF5L 4YLQT 2EDOA 3WFHA 2HFGL 3MJ6A 1T03L 5IB1A 3BQUC 3E6HA 5IOPB 2JCCF 5IT2L 2JJWA 4Y5YA 2YD8A 5TGBB 2VITA 3PXHA 5CEZH 3L3DB 3T0EE 4LVHB 1BZQK 1F97A 1FVCA 1WSST 4N9GA 15C8L 1CXEA 3G5VA 3RFZC 3P73B 1TENA 4FFZH 2YPKB 1BBJB 3DXAE 3HAEG 4JKMA 5ETUA 1KXVC 3NACH 5D6CB 3GSNL 4WW2B 1JK8B 1OAYL 4J3WA 4G6KL 3BKCL 3LEYH 1UWEH 4X99B 4WUUE 2UUDH 1JGUH 1K9TA 4EI5D 1QLRB 3KYNA 5LBSH 2FB4H 3GKZA 4HBCL 4N0CC 5J8OA 4GSDH 3NN8A 3H3PH 4YDVB 4NQUA 1BLNB 2V2XB 2NY4B 3P0VL 1E4WH 5CD3A 5HI4C 1A6UH 4LQFH 3JWDL 2LQRA 3NZ8A 4JM2D 4QT5A 5EZJA 5C09D 4MA1B 5SWQA 4LQ1A 5DHXB 3QIUA 3IYLW 4O00A 4NM4H 1SJHA 3O0RL 4K8RD 4WFFD 5JHDB 3JTTB 2XZAL 3DARA 4PS4H 1FN4B 5FGSA 3QNXA 1UXWB 5J11C 4APQC 2VLKE 2AJ3B 1E6JL 4Z7QF 3V4PH 1IC5L 1NAMH 3FTGB 3LS4L 1WEJL 1RZKH 5HI5D 1U3HD 5E8NB 2DBLL 4F2MB 5I1AB 5I74C 3QNZB 4I1NB 1T83C 5EH1A 4X5XA 4GLRI 4QXGL 2R1WA 1JCKA 2O5YH 1F42A 3L7EA 1Z2KA 3GMRB 5E6ID 3VDCA 1B0RB 2ID5A 3ZYJA 3FO0L 4KH2A 1WBYB 4MWFB 4JM2F 1CT8A 1ZWIA 4XNYH 2IANE 3VXRE 5B3NA 1N8ZB 4FQIH 5HHNA 4XTRD 2FRGP 2PYEB 1TTGA 2NTSP 1JF6A 4RGMC 1P7HL 3MJ7A 1R24A 4MAUL 1S9XA 4R97C 3PDGA 2ATPA 5FGRA 2VXQL 4I48B 5JMOC 1XGYH 5JQ6L 1NCAH 1KG0B 2BVEA 3F6LA 2YD4A 3OPZL 4JFEB 4UDTB 4L4VE 1YEFH 4LHQB 4P2RD 2ZUTA 1CGSH 4Z7UB 3SDXF 5GGSB 3B2UD 2LFGA 2E7HA 3WNLA 4BQ9A 3KPSE 4F9PA 4X9FA 3RVXC 4NZDA 4JR9H 4PRAA 5CEXA 3J8F7 1X5XA 4JRWA 2R23B 1Z5LB 4CMHB 5HY9A 4R4BA 4PJFE 3NIFF 3CX5J 3MXVH 4DZ8B 4OF5A 5I8CB 3LQAC 1MHPL 5I66B 1QVOA 3KYAA 4E41A 1BFSA 1S9VB 4A6YA 3OAZH 1CI5A 3QQ3A 3O9WC 1NGYA 2HVKA 3LVEA 3K4DA 4BSWB 4I2XB 5IHUL 2QR0A 3KS0J 3M1BB 4KTEL 5JOPE 4Z7WE 4RGNB 1QQDB 4ERSH 1B0GA 3MGAA 2PKDA 4YQXH 2V2TA 1YPZB 1LEIB 5CZXD 3KYKH 4XXCC 4XPBH 5JQHC 3HZKB 4JFQB 4FNLL 3TVMC 1SYSA 3GK8H 3X11B 1J1OH 4RISL 3G04A 1EEZA 3H3KA 4TVPH 5DMIH 2LE9A 3GRWL 1XGRB 4P2OC 3RL1A 3LD8C 1CICA 3WIFB 3IDIA 2H3NB 4JDTH 4NFDA 1YEDA 2GAZA 2W38A 5DUPH 2W60B 1BFOB 3VDBA 4JE4B 5HXMA 1N7MH 1ZLWK 1ITBB 2AV1B 5IROC 3GSQA 3V7AE 5DD6A 3WHXB 3BDBA 3EFDH 3KPQA 4GOSA 1DBJH 2DYPD 4OLVH 5FDWB 2WWKO 2EDJA 3SJVD 4JFOB 1FSKB 2PCPB 1MRDH 3EYOA 1OSPL 4FQXB 1W0WA 5KSBE 4OCWL 3ARFB 4WTZA 1N6QL 4J3VA 1QSFA 4NQXA 5I17A 4Z0BL 3CDGA 3QUYC 4X0KA 2OR8A 2CDEB 3VGDA 3ZHLA 5T33L 1Q9KB 3S4SB 5EIIA 1FYTA 1YEIL 3B9KB 3D5OF 4UNTA 4CU6A 4NN5B 3W5MA 4NM8H 3L5WA 4TVSa 1FNSL 4JFHD 5T5NG 3RY6C 1MCWW 4QHKJ 3MLRH 5FM5M 5E24E 1I1CA 1TFHA 2F58L 3DVNB 2X05A 3DROA 3BGFB 1YEHL 1OP3K 5IMOB 2PR4L 5J7CC 4MAYB 5DEGB 3QULA 4A2LA 4Z7VF 1L9NA 2UVFA 1TCRA 3HR6A 1IL1B 3O8XB 5HHVH 1U8IB 1PG7L 1EHAA 4OGZA 4OLWL 5IBLC 3GJFH 3HS0B 2H2PC 1UYWL 4QGYA 4GAGL 1A5FH 1EEQA 4U05A 1X7QB 3RUGA 2YKLH 3HMWH 3RP1A 4KRLB 5IVOA 3LKNA 3C6LA 4CJ1A 1BX2B 3KYOB 5HJ3B 1E6OL 3WLWC 5C07A 5F6IC 1MVUB 2XZCL 4Z77A 4B7LA 1MLBB 5I1CH 3Q3GB 4L29B 4UMGA 2Y07L 3D3VE 4J23A 4M8QA 5GRJH 4K3JH 5EOCH 25C8L 3F12A 3T4AB 4X6BB 2QKIB 3ZKXB 1P1ZA 2YXMA 3ZO0A 1P7KB 4QXUL 4JQVA 3QSKB 3S36H 4QYOA 4AQ1B 1XF4A 1N64L 5EORL 5ACMA 5J9PA 1WIPA 4Q97A 4H1LB 3W9DB 3RDTB 3UMTA 1SVCP 4XVUC 1SVZA 5C0CD 2BJML 1GGTA 5F9AC 5BCAA 5DJDA 1AKJB 3KPPB 4KUCD 2YSSB 3U79A 2HJLB 2OJZH 4PJDE 1BWMA 4G9DB 3T77A 2X7LB 1OARL 4WV1A 1C5BH 1LEKA 3MMEB 3CSGA 2DQDH 4PJ7F 4F7PA 4Z95L 1B4RA 3VXSB 4LAJH 4S1SH 1YEKH 2W0KA 4Z76B 4WEUD 4KRPB 1YDPB 2X2YA 4XPAL 4Y19D 4ZS7L 3P4MA 2VLRB 4N1EA 1RZIB 1KEGH 1D5BA 3DSNA 1NH6A 1YECL 2G60H 1QO3A 1KTKE 3MV11 3RZCB 3N1PC 4L8SB 1YY9C 3V4VL 3CFDA 4YO0A 1JYXA 1WK0A 2A9MH 1X5KA 4ZS6D 1DQDL 1I7RB 5FO9A 3WXWH 5KSAA 4P46B 1B6UA 3FAWA 5DJYB 4JHAH 4Y5VB 1J1XH 1ZTXL 1AQKH 4X7TA 3Q5OA 1X5YA 2WWMC 4F9LA 3GMQB 1DQLL 1QACA 4KHTH 1U36A 1VADA 2XWTA 1JUFB 1JPGA 3EOYG 3H9HB 1AO7D 4U1GC 1FZOB 1TDQA 2VWEC 5BS0A 3K7UA 2BRRL 3GSNA 1LO5A 1UA6L 4FZ8H 5H94B 5FGCE 1IJ9A 2F53E 3IDUA 1ZK9A 2D9QB 5DXWA 3S5LA 1M1SA 3H9SA 4X9GA 1A1MB 4OZ4A 1NANH 5E8OA 4MNGA 3ABZA 5FYLD 2X89D 2BNQD 4WY7L 1F2XK 1NSNH 3UCRA 4ONHA 3IFNL 4P3DA 2AABH 4E42A 2DBJA 3U0PA 4EXKA 4JZJC 3A6OA 5TE6H 4G8EB 3V5DA 4NNPL 5B38A 3K8MA 3GSUA 2NY0C 3LN4B 4PJHF 5F3HA 4NC1C 1BZ7B 1RIVH 4XCEB 1OY3B 1L0QA 4WI4A 3BVNA 4XPTH 3KXFE 1MVFA 3E2HC 2EYRA 4U7MA 4XNUL 3QXDA 4PY7B 1RV6X 4I3RH 1Q9WB 2V2WA 4KKLD 5DJAB 3U0WH 3FRPG 5JW4M 5D7JA 3FZUD 3RX8A 2A6KB 2BSRA 4KUZL 4JVPA 4CVZA 2EC9U 1A1NB 2AEQL 1IM9B 1L7IL 3B6SB 2VDKL 1T0NB 2DWDB 2YWZA 1MQKL 4Y16C 4Y5XC 4LHJB 1U8NB 4NQCE 5T3XE 4PYGA 3L3DA 5FUCE 5FYKE 3AREB 1QFWL 2DI8A 3S96B 1DBML 4IRZL 3D85A 1BD2A 3DRTA 3QIUD 5D6CA 5KVEL 1LP9A 3FQRB 1JK8A 4HMEA 2FBOJ 1RSFA 2WBWB 2IH3B 4YHIA 2VDPL 1E4XI 2M26A 1F58H 4M7KH 3VXPA 4DKDC 1BFTA 4RMRA 1PFCA 2V2XA 2R0ZH 3V6OA 2LU7A 3JTSB 4XMKH 1YNLL 3V0WH 2P43B 1BQSA 5IBTL 1HQ4A 1VEOA 2E27H 3U7YH 4ZFGH 2X9XA 1KELL 4M7JH 5ICZB 1L7TH 2OXHA 3JTTA 1A9EB 2DWEB 2NY3D 2DD8L 3UJJH 4BELD 1FN4A 1R3HB 4X6DA 2QQNH 4UTBL 3OKKB 4JPKL 1I9EA 5E2VL 4NO2B 5EN2B 2E7MA 3P9WB 1ZLSL 3QJHB 3KJ6H 5E8NA 4F2MA 5I1AA 4JY5H 3MQIA 3ARSA 5HYJE 2P5WE 4MD4B 5DQJB 1KC5L 4YE4H 2OL3H 1DVFB 5CJXA 1JVKA 3CMOL 1NBVH 1D9KC 4G8GA 4KROB 4MCYB 3GMRA 1DLHA 1B0RA 1F02I 3HPJA 2DM4A 1I1FB 3BDXA 4NWTH 1CU4H 4MNHB 3BYTA 1HILB 3TESA 4KJQD 4MWFA 4IMKA 2R1XA 4PJ9C 2MNUA 2Y1VA 4K7FB 3WFCL 3TCLB 3FB5B 1N8ZA 3CXDL 3SDDC 3MRDB 3X17A 4XMLH 1UKTA 3GRWA 3T3PF 2IWGA 1VPOL 1QBMH 4RX4A 3UPRB 1AI1H 5H37H 3SDAC 5A2KH 5TF0A 4LGRB 5FGBC 3QZWB 2JCCE 1I8KA 1FGVL 1NC2A 3CUPA 1KG0A 2XTJB 4NBZB 1UKQA 4JFEA 3TLRA 4UDTA 2BVQB 1OWRM 1S7UB 5KVFH 3HNTL 4EXPX 4PJBB 2XQYG 3P9MA 5GGSA 4KQ4L 3FO9A 4NQSA 4J3TA 1Y6MR 3UTTA 3UAJC 3SE9H 4KZEH 2CQVA 2HTKC 5LQBL 4UQ3B 5CGTA 5GS0D 1DN2A 3QWRA 2R23A 1Z5LA 5AG8A 2FBJH 1BVKB 4YXHL 4OLYH 3AGVA 4JFOA 4LLVA 3K80A 5GJSH 2FR4A 4ZAKD 5GGUA 3TA3B 1PZUB 1DSFL 5I8CA 3UBXB 4KY1L