3SKNB

Crystal structure of the rl42 tcr unliganded
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
241
structure length
241
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASGQGNFDIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RL42 T cell receptor, alpha chain
publication title A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 241
sequence length 241
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sknB02
1SJHB 3NPSC 3CFEB 1T0NA 2FH6A 1JNLL 4G8GA 2H6PA 2NXZC 5EOTA 1JV5A 5TFSL 1S7XB 5FDWA 3TT1L 3EIFA 1XGUA 2N7BA 3SHSA 4U1SB 4HDIA 1CLCA 4Z76B 4EN3C 3EOBB 1H3GA 1KPVB 4NNYB 2EDFA 4PJFE 3DV4A 3QA3A 5C0CB 4FMKA 3STZA 2XTJE 1CLOL 1WCBA 4KKBC 3ESVF 4LLYA 5K9KA 1A64A 4JFQB 1U8NA 1ZT4A 4HIHA 5KN5B 3F7QA 1I8IB 3F7YA 4N1EA 4P0DA 5DJ6B 5AAMA 4ORZC 2WBWB 4WY7H 5K93A 1IC4H 5EOCH 4H8WC 3KWWB 1G9MC 1QVOB 2FGWH 1OGAE 1JP5A 1QZ1A 1TJHL 3L3HB 4YHYB 4XWOD 3H9HA 4OLXH 3HZYA 4RMWA 4QWWC 4EIGB 2PW2A 5GGUA 4QXGH 5DSCB 1I7TA 1IRAY 1TIUA 2NY4B 3M45A 4XNQA 3P0YH 1JK8A 3V5HB 4LLDB 4U1MA 5C09E 1CR9L 3PABB 4PGDB 2FYYA 4HS6B 4QTHA 2MPAL 2XRAL 4LIQH 1T6VN 4LCCB 4LSUH 4L5FH 2YD6A 5HHNB 2UZIH 1U8OA 2XNAA 3OAYH 4MQTB 4QT5A 4EN3A 1KJMA 3RVUC 5EG6C 1LE5A 2VISA 4JFOA 3EYFA 2HJLB 3NAAH 3LN4B 2LAAA 1W72H 5CZVL 1A7RL 4MNQB 5GRUH 2PXYC 3CDGA 4M6NH 4PD4K 3ARPA 3SDAB 4ZYKB 4U6YB 3JV4A 3IDJA 4E5XA 1QD0A 3VFVB 1N0XL 4OLWH 1F02I 4OF7A 3AC0A 1IGIL 1A0QL 3C8HA 1IC1A 3BWAB 2ZUSA 3X11B 2YK1L 4JKKA 4PJ7F 12E8L 5HHPB 2OZ4L 1YJDH 3DX6A 4AH2A 3TGXA 5JIIA 1ZOXA 4L4TB 1JPTL 1NGXB 3MCG1 2YBRA 1YQVL 3P77B 1Z9OA 3N85H 5CEXB 3DUUA 5FUCC 3EDJA 3B6SB 3OKOB 3U9PH 1A7QL 2DL2A 1TCMA 3MR9B 1VPOL 1J5OH 1CFBA 1ONQA 5FECB 3L6FB 2ZUQB 1OAXH 4QRTA 4N0RA 4R6UA 4N1CA 4X80L 3ZHLA 1PEZA 4M00A 4P48A 4YXLL 4XZUB 3MRHB 2PXYA 4FQJH 1Y0LA 4EVNA 2KKQA 4JEGB 2GSIA 5DC9B 4N0YL 1EFXB 3CLFH 5FYKD 5HHOD 5FM4A 3BKYL 3BUYA 3QIBD 1UC6A 2CUHA 1E4XH 1LEGB 5BV7L 2X4QA 4ZSOE 1F5WA 3IDGB 3T3MF 1I85C 1IQDB 4HAFA 1J1PL 4ZTPH 1R3KB 4LLVB 1NEZA 3VCLB 4PRIA 5CINL 4X6FA 5T3XD 3N9GL 4LEOA 3C6SA 3B9KD 1DQMH 1DQDL 2MQ0A 5DURD 3O3UN 3ARGB 4R7NB 2WIMA 1G7IB 5L8KB 4Y5YC 3MCLL 3HC3L 4KKLC 3F6LA 1T7VA 1FL5A 3NCYS 4XPGL 3HI5H 1RZFL 1J1OH 3WJJC 2JCCA 3B5GA 4WWKD 1BGXH 4NM8L 1G9NL 4OZGB 1NCBL 4GRWB 2YPKB 2AXFB 1ZTXL 4I18C 1FFNA 1NC4B 1XGRA 3FMGL 4YC2B 5K9QI 3PWLA 1DBJH 2UYLA 1T1WB 4WFED 3Q6GL 3BDYL 4FQXC 2ADJB 3MFGB 4XVTL 1CQYA 2QADB 1U41A 3MZTA 3THML 5KSAB 4NQEB 1OWWA 3QFDB 4YAQA 3LQAC 4UQ3B 1I85A 4Y2DC 1OTUD 3BP7B 3WO3B 2XWJA 2I9TA 4YDVB 3MFFA 4ZG1A 3O3EB 1P84K 3WIIH 3ZL4H 5I9QB 4DKFH 2YA0A 1XR8B 3SE9L 1KIRB 1ZA3A 4OGAC 3VFGH 4Z7WB 4Y5YA 1SEBA 4KVNL 1RHHA 2IPTL 5HI4D 3QDHA 3ESUF 4GW4B 3OF6D 1F3JB 5LAXB 3ZYIA 4F80A 2A73B 2WK2A 4HUVA 2QQKH 2VZTA 4HWZB 3MLXL 2WNGA 3L3JA 2R2BB 3QCTL 5BQ7A 1QO3A 2JE8A 3UAJD 1E27B 3EYQC 3PWPB 3I6KB 4UU9B 4OLZL 1TVHB 4ALAL 1R24B 4I18A 3WUWB 2EC9T 3TCLA 1Q0XL 2R1XA 1C5CH 2VDNH 3TF7C 3HNTL 4FQLL 1KJ2L 2NY5L 4FQXA 4JM2A 3RPKA 3EFDH 1JMZA 2E9JA 2EXWC 2NY0B 3E2HC 5IVZA 2AJUH 2PW1B 4WO4B 5IW1A 1AI1L 1LO4L 1MCNA 2AV7B 2UWEA 4Y2DA 5CUSH 2Q8AH 1AO7B 4PJAB 2EDOA 5F1IA 5EULV 1MFCL 5J57B 1MI5D 4EZMA 5HI3D 4UQ2B 5F3HB 2LABA 2A9MH 2R1YB 2ITDA 4NKOA 4BFIA 1U6AH 4M61B 4QXTB 5DS8B 3TNNB 4WHYG 3S98A 4MMZC 2JIXD 2Q86B 3ES6B 1M71A 1V7NL 2FO4A 3QXVA 1TNMA 2R1WB 4D9LH 2AJXL 5D7KE 1R5WB 1FG2A 5FCUL 5JXAL 1K4CA 4XRCB 3LQZA 2OL3L 3MUHL 5E4EC 1UM6L 4KXZH 1LEKA 5KS9A 1CGYA 1NFDF 4PJHA 4PV8A 3ETBF 1LNUA 4YNYA 2FJFB 1NPUA 1NL0L 5ISZE 3LZFL 1NCWL 4PJCB 4Q9QH 4MDIB 4MDJA 4TULH 4L8DB 5HDQH 1MCJA 3DYPA 4L4TD 1BZ9B 5IV2A 1A6VH 3RWGA 5ICZA 4CADB 4G80B 4HGMA 4GSDL 4RZCA 3EDEA 3ILPA 3DYOA 5C0GB 2YPLD 5C0BB 4JQVA 4AK1A 1CVSC 1H3WM 2VSCA 2HFGL 3VFOB 3IDNB 2FX7H 5DD0L 3K74B 4AIZA 5HVGB 4JFZL 5LXGH 2Q87A 3CVHH 4XPHH 1KNOA 1L7TH 4FMFA 4P59H 2VKXA 4OTXL 5I6XB 1I8LC 4JDZB 4M6MH 1NC2B 4RFNB 4X98B 1Q9WA 3ILQC 4U1KB 5HBBA 1NAMA 4FA8A 1VFOA 4OZIB 1CBVH 5DEGB 1U8KB 3KYKH 4MJIB 3KDMA 2J4WH 2Y25A 1EAPB 2HH0L 5DJ0A 3T2NH 2UUDK 4LCWE 3N1FC 3UJJL 4YDJB 4GMSH 4P4KC 1S7TA 3HN3A 4N8CL 4POZD 4QOKB 4CMMB 1A6ZA 3S4SA 4OF3A 5F6HI 1HCFX 3ARGD 1SEQL 3DNKA 1PG7W 3FFDB 4LBEB 4BH7B 1HQ4B 3LN9A 1I7RA 8FABA 2F5AL 1DQJA 1L4IA 5I8EB 4RGNB 3QIWD 2X10A 5I18H 4YWGL 2AGJH 4WI9A 5MENB 1RURH 1K9TA 4JE4B 4GKNB 2Y4SA 4HGWB 4KMQA 1T4KB 2DLGA 4WNQB 1A1OB 1I8LA 3HMXH 4M3KB 3G6JB 4OGYH 1FC2D 2XZCH 3VRLF 3VWKB 1WC7A 4GW1A 5MP6L 3FQNB 3RZCD 4NQXB 2R56L 4LARL 2Z35B 2QADD 2P48B 1HZHH 4XAKE 4C56B 4DQOL 1V5JA 3VXSE 3ARUA 1E4KC 4LHQB 3GSNB 4LMQE 4QYOA 1JHTB 3EFFB 2VQUA 4ACPA 1QBBA 2VLKA 5IBUG 1J8HB 3P4NB 2WIIA 3E3QE 2VZVA 5L0QB 3RTQC 4HG4J 3MRBB 2HJKA 1AIFA 4ZO9A 4L8SC 2VL4A 2IFGA 1CLYL 1X44A 4PJXB 4XBGA 4C55A 1ZKAA 4XHQA 5T5FH 3MROA 3K7UA 3M17A 1XIWA 1KTLB 2EIEA 4PJ7A 5DQJB 2N1KA 1MFDL 3PWPD 4RISL 1O5DT 1RQ5A 4ODTH 5D1XB 1ZT7A 2VR4A 1AD0B 1KCRL 3UO1L 3GM8A 4X8XA 3CLEL 4FQ1L 2R8SH 4FABH 1DQLL 1A6TB 1KSRA 2D7TL 3MC0A 4PJFB 5DJ2A 5KSUA 4GQPH 4WO4D 4YUEL 4DTGL 1W0WB 5C0IB 5D70H 2EYRA 5DQDL 3GMMB 4XVJL 3D3VA 4MJ6B 4QO1A 2YD7A 3FT2A 4DN3H 4E0RB 5EU6E 1A4KB 2IAMC 3S35H 4Z8FL 2V2TB 1T5XB 2IPKA 2GFBA 3DI2B 4NO3B 4DGYL 2BCKB 1OGAB 1H3PH 2YSSB 2B1AH 5E2TH 3DROB 4NQVB 4CNIB 2J1KA 4P5MB 1C12B 4U2ZA 2X4PB 3E1F1 2APWA 4HZLB 2DQHH 4JRXD 4MA3B 5F6IC 5AZ2L 3BKJH 3MGAA 5C0FA 3MTRA 1KELH 5C09B 1RZKL 1BJ1J 3L3IB 4M93C 4GRLD 5GSRB 5EZJB 1N6QL 4MA1C 1EAJA 5BRZE 2C9AA 1CI5A 4LSSL 5E8OA 3GO1L 4MD0B 2IALB 2YD8A 4LDOB 3FTGA 4J6RH 1AGFB 5I1EL 2VDQL 2P44B 4I4WB 1T1YB 2WZPD 2Z31D 1TJGL 1GGYA 5E03A 2H2PD 5JQ6H 1YPZE 2JB5L 5E6YA 5C0RL 1MJJB 4FQQB 2V2XB 3V6FB 4IHOA 1F8TL 4HKJB 15C8L 2NZ9C 3E6FB 1XT5A 2V5TA 2CGRH 3FQRB 4OQTL 2D03L 1PSKH 5L8JB 5DLMH 2BERA 1D7FA 5FO7B 3JV5A 2VXVL 1RK0A 4U31A 1GOHA 4U05A 4CRPA 2EE3A 3RGHA 1WICA 3EHBD 3QJHB 1Q0YL 4EXPX 3MNWA 4JFEA 3ARXA 4AQOA 3U6RB 3VG0L 4CN6A 1P84J 1NC2D 1VERA 4U6VL 1JRHL 4PLNC 3HS0A 3NFPB 4G5ZH 4NPYB 4F7EA 2R2CA 4MJID 4UB0H 3BP5A 4WV1C 3UTSE 3Q5TA 4BSWA 4NP4H 4QF1B 1JIBA 3D2UA 3LKNB 5E2VH 3TBYA 1RD6A 4ODWB 1RULH 5INDA 1NGYB 5HGDB 1BBJA 5IMLB 1DLHA 5AWNH 2DM2A 2EIDA 1HIMH 4DAGL 2BMKA 4Y5VC 2HMID 4NKIL 5FO8B 3LD8C 1FVCB 3GKWH 4NSKB 4GAFB 4ETYA 3BN9D 3U4BL 4BFEA 2EEDA 4ZSOB 2AVGA 4RGND 4JAMA 3O81A 4K7FA 2GY7B 3BRFA 1DL7L 2DQDH 4DZBB 2J88L 3MJ9H 2GUOB 1W8OA 4OUUA 3W9DB 4DVBA 4HF5H 3PNWA 5F7UA 3RY4A 1CFQB 4Q74A 4LFHG 3VWKD 2QHLA 1BVKA 1VEOA 4PRIE 3BRDA 5F1NA 4U0RC 4PIRF 2YR3A 4PRHD 3CIQA 1JFQL 1JNLH 3AGVA 4M4RA 4C56D 1BBDL 2IANE 5FUCE 1QFPA 1KOAA 5IB5A 3AUVA 3TT1H 1KV3A 4P5TC 2LE9A 1CU4L 2Y7QA 1XCQB 3EKCA 3I2CL 4LSVL 3WDJA 4CJ1A 4OLYH 1QFWI 3D9AL 4PJIF 1N6VA 2XQBH 1VFUA 1NFDA 1CLOH 4PREB 1IJ9A 2Q3AA 2I9LA 4GAGH 3I3EA 1OOAA 2GT9B 1CD1A 3KPOB 3LPGA 2XKNA 5K59F 3WFHA 5LGJB 1EMTL 3VXQA 5F9WB 1JPST 5C3TA 5C0DA 2MKWA 4M7KL 2ARJQ 1M05A 1EEZA 1MLBA 1ZHNA 1AHWB 3FOLA 2L4OA 4NKMA 1OAZL 5JIKA 4XCEA 1G7MB 4YGVB 1A4JA 5ILTH 3O9WD 1DBKH 3ARBB 4OZ4B 2VAAB 3TM6A 2FSEB 3DHJA 4P2QD 1CR9H 4HIJA 2P5WE 2DWEA 3AS0A 5HDOA 1IVLA 5C08E 2MPAH 2XRAH 5FKPB 1AFVL 2CLZB 2AXJA 5SX4H 5MI0B 4Y1AE 1JWMA 4P5TA 4JFXB 5EC2A 5IHUH 2V7HB 5DMYA 3ZT5A 2ZUVA 3A0OA 3GSVA 5E4IA 3NIGF 1IGML 3EOAA 5FUOL 1QSFE 3NCFB 2OQJA 4S2SB 4MLSA 4OB5L 3W5MA 4OD3H 1HSBB 5JA9A 1IILE 1OGAD 4KJYA 4ZS6C 3KPSD 5L8LB 1IM9D 2IEPA 5A43C 3UDWC 3ULUE 3RHWF 1S7WB 4QHMB 5FA4B 1IGIH 1A0QH 1HHIB 5J56B 4ERSL 4IMKC 2VL5A 1NDMA 4P23A 4V1DD 5FM5O 3O4OC 3QUYC 5D6CA 5FEBA 4NWTL 2CK0H 2UWEE 5HDLA 12E8H 3A6BL 4HWBL 2OZ4H 5GJTL 4YDLC 2YD9A 3T0DA 1MCSA 3N50A 5F7YC 5E8NA 3CJJA 4EDXA 2R4RL 1WFOA 4DK6A 2P8LA 3P4MB 4KRPB 3HNVH 4PJ9B 1E28B 1CXIA 2X42A 3GSRA 2AKRA 4TVPE 1VPOH 1HNFA 5H37H 1TQCC 3ZE1E 1JGUL 3I02A 4X80H 3QQ3B 2OTWA 1WBYB 3T09A 4TRPL 4YXLH 2QSQA 5KS9E 5I1JL 1EHXA 4PJHE 5B3NA 5ISZB 5CBAA 4N0YH 1X7QB 1J0YA 5JPMB 1XEDA 4JGUA 3UDWA 4Y4FC 3IDYB 4UTBL 3BKYH 1CFTA 2HN7B 5AYQA 4P2OD 5BV7H 5GZOD 3OG4B 4LSPL 4OI9A 3R1GL 4IMKA 5GS2D 5DJDA 1I8MA 3QUYA 5F1OB 1J1PH 2CRYA 1AR1D 4NQSB 1MCBA 1N8ZB 5CINH 4C4KO 3GMNA 5IGXL 4QTIL 2SEBA 1DQDH 4UTAL 1OF2B 4HJGA 3RDTC 3AXLA 2DIAA 4M7LT 4NGHL 2ARJA 2DTMH 3MCLH 2BX5A 1M6OA 4CAGA 5T5NG 2X40A 5INCA 4XPGH 1ZS8A 1RZFH 4MD5B 1CL7I 1TZIB 4ZTOL 4KZEL 5IM7A 4NM8H 1INDL 4O9HL 1BQSA 1NCBH 1S9YB 4RFOL 2Q6WA 3WV0A 1FO0H 1FGNH 2F53A 5T3ZL 4F8TA 3ZDXE 1NUGA 5ALBH 3PDOA 2ZSVB 5D7LA 3MRJB 4Y4HB 4LCWB 4HWUA 1JZ7A 4EI5C 4Y4FA 4XVTH 4XVUC 2YD3A 5FUZL 5EBMB 3SGDH 5IB4A 4PRPE 2LU3A 4L1HA 5DJZA 1HINL 3BFOA 1CDUA 3O2DL 4WI5A 4N5UA 4Z7NF 2ICWB 5ESQB 3SY0A 4GG8B 5J3HD 3K81A 1P7QB 4YBQD 1GVIA 3KLSA 4TTDC 1MF2L 1T0MB 4WUUD 3BKMH 5EU5B 4PP1C 3TBSA 2F58L 2WP3T 3RDTA 3SE9H 2LFGA 1K4DB 1GYAA 2QQNL 4G8EA 4J3UA 4KVNH 4N5ED 3GMOB 4I3SL 4U3XA 3SGJC 2A1WL 4U1JA 5IBTL 3TFKC 3G5XB 3EO0A 2DQEL 1JUFA 4PR5B 3MLXH 2BNQA 4OFPA 3QCTH 4KGJA 1S9VA 3D0VA 3V4VL 4WUKL 3C60C 5CZKA 3QUML 4OLZH 3ULVH 4KV5E 3L95B 3KPQA 3DURA 1HK6A 5DF0A 1Q0XH 3VXSB 1CD9B 1MIML 4MXVE 5FOJA 3RWDB 2BVQA 2J8HA 1PG7L 3HNTH 5M94B 1KJ2H 1YEEH 1C16B 1G7PA 4PLKC 2NY5H 3GJFB 4N9GA 5F7MC 4EI5A 1I75A 5EU3A 2ZKHH 2IGFL 3T4AA 2X05A 4K94H 1VFBB 3T65B 1NFKA 1A6AB 1LO4H 3Q3GB 3A67L 3VFRB 1SY6L 5E00B 2P49B 4OCMC 4PJ5A 2HP4A 2CDEA 1MFCH 5CILH 3BAEH 1PEWA 2G5BA 1BF2A 1CICA 4JFYB 3D69A 4O2EA 3NCJH 3MV11 1FZOA 4HUXB 1FFPB 1N4XL 3ZKQD 5ABDE 1NMBL 5ID0B 3CMOL 2PTUA 3K2UH 4PJ7E 1QLFB 1CDGA 1UT9A 4AJ0A 4F9LA 5CCKH 4JO1L 2B1HL 2A83B 3VGBA 2H6PB 1UM6H 1X4ZA 5EOTB 1CS6A 1JV5B 3O2VL 1CVRA 5FDWB 1PY4A 1XGUB 3OV6A 9CGTA 3VD9A 2BHUA 4HDIB 4O4YL 2BHZA 1JHLL 1BEYL 3TH3T 1NL0H 4OF6A 3QDJA 3LZFH 1NCWH 5DRNA 3DV4B 3QA3B 3QG6A 3STZB 4XNZB 4LLYB 5E6ID 5HTSA 3LEYH 1U2HA 4OAWA 1BECA 1ZT4B 4HIHB 3SE4C 3SJVA 1IGTA 4NN7B 4GSDH 3F7YB 2I5YL 5D9SA 4GXUM 5C9JA 2MNUA 4QHNB 1WEJL 5D7KD 4WU5A 4KRPD 1DBAH 1PGRB 3H9HB 3IRZA 1MRDL 3HZYB 5IG7A 4G7VL 1BFTA 5HYJA 2PW2B 4JFZH 4S1RL 5GGUB 3VJ6A 1QSEA 2R23A 4YFLI 2WW8A 1IC7L 1I7TB 1EH9A 4D9RD 4XNQB 1JK8B 5BRZB 3U30C 4OTXH 4U1MB 1GGUA 3TBTA 4APQC 3TT3H 2NXZB 2FYYB 4QTHB 1IARB 4LKCA 3BD4A 5CD5D 1IQWL 4TSCL 5AG9A 1U8OB 2XNAB 3V7AE 4QT5B 4EN3B 1NBQA 5J8OA 4OCSL 4LMQI 2VISB 4JFOB 1Y18A 1YPZB 4KQ3L 4OIAA 3EYFB 2EDNA 2HH0H 4J8RA 1RVFH 2XG4A 3CDGB 3UJJH 3JV4B 3IDJB 1JNJA 3KXFE 4N8CH 3VA6A 4X99A 5TDPA 4E5XB 4J2XA 5BXFA 4UILH 3SE4A 1A14L 3HB3D 1ZHLA 3QXUA 1SEQH 4PLJD 1WZKA 1OAYL 2D0HA 2VABA 3P3YA 5EUOF 3V0AC 3DUHA 1UM5L 4OF8A 1MEXL 2WINA 4OIIH 3O4LA 3KPRD 4G6JL 2PNDA 2W59A 5LG1A 3V5KA 3DX6B 2OX5A 4AH2B 2VH5L 4YWGH 1ODAA 3F62A 3LV3A 4UDTA 2CJUL 2YBRB 5D8JL 1CDIA 3LEXB 3DUUB 2AJSH 3QQ9D 5A16A 1UQSA 1C1EL 4APQA 3V8CA 3MV7A 3UTSB 4F3FA 4QRPD 5D7IA 1MCQA 2F8OA 4Y4HD 4MZ2A 4N90E 1ONQB 4E41A 3FQWB 2J3SA 4QRTB 3EDDA 4U6XB 3DOSA 4PJGE 3RVWC 5HYIA 5D72L 2PXYB 3WKNA 2Z8WC 1FQ9C 1HXYA 1Y0LB 3RY6C 3VXPA 4EVNB 5KVEL 2GSIB 1H8NA 4HFUL 5F9JA 1FNSH 4PY7A 4LVEA 1FZKA 4G3YL 1MUJA 1H3XA 3W5NA 2D7NA 3BUYB 3B83A 3WS3A 5JPNB 4TOYH 2X4QB 2AI0L 4TUKL 1CLYH 4FQPA 3BIKA 1ED3B 5ESAA 4DFHA 2XQYK 4LPWA 1NEZB 2PN5A 3SEPA 3F12A 4PRIB 4LEOB 3C6SB 2NY7L 3S36X 2QQLL 1KEGH 4Z7UF 5CWSA 2FECL 3EJZD 2P5EA 4ZFOL 4KI1A 2EO1A 7FABH 1KCRH 3UO1H 1FL5B 5EN2A 4ZXBC 3DBXA 3BZEA 4FQ1H 2IFFH 4PB0H 1DQLH 2J6EL 3BWUC 2EC9U 3X13B 1RZJH 4NC0B 2D7TH 4ZUVA 1R5IA 1S5IL 4YUEH 4DTGH 5EC1B 1NMAH 2X7LA 1A6UL 5DQDH 4YHZH 1FFNB 1XGRB 3RY6A 4XVJH 3PWLB 1TVBA 2UYLB 4NCDA 2JTDA 1LDSA 3CXHJ 1DSFL 3B8SA 5KVFL 5C8JA 2ATPA 1N5AA 4YAQB 2BRRL 2W9DL 2K3TA 3QPQD 1ORQA 4NNXA 4GUPA 3ZTJH 5H94B 2VE6A 3UPRA 4RWHA 2XWJB 4JANB 2I9TB 3B5HA 3MFFB 4U1LB 4G8GD 4UV4L 5F97E 4K3GA 4K7PL 5GZNC 2P5WB 1DE4A 1ZA3B 1N6QH 1UWXK 4Y5YB 3WN5C 1SEBB 2OS7A 1AXIB 1RHHB 4Y1AB 1AP2B 4ZXBA 5D96B 2YN3A 5EZLA 4L9DA 3GO1H 4D9QD 2HTLD 1X5KA 3LCYA 4HUVB 1S7RA 1ZHBA 2DLFL 4KK9C 5I1EH 2P45B 3L3JB 5BQ7B 3H2WA 4HUUA 2PETA 1EIBA 5KSVA 2B4CL 3SDYL 4XCNA 4I18B 2JB5H 5IT2L 4V2CB 3TCLB 2X4OB 5C0RH 2R1XB 1CGWA 1F8TH 3T4YA 5C2BL 1RAMA 3FB7B 4FQXB 4OQTH 5T33H 4JM2B 2D03H 5I1CH 2VXVH 5ALCH 5FGSA 2CH8A 3IETA 1INQA 1IEBA 4X4ME 3HKFA 1EEYA 2UWEB 1CG9A 1SYVA 4PV9A 1CK0L 1ROWA 1MWAL 1Q0YH 5E2WH 4Z7OF 5DVMA 1FN4B 4F57L 5CEZL 2NXZD 2PTVA 4HH9A 4AEHH 5DWUH 4UINL 1AQKL 4YR6A 3FKUS 4OQ1A 2ITDB 4NKOB 1JRHH 4BFIB 4NHUA 1T83C 2E7MA 3WN5A 4N8VG 5E5UB 5I76A 2YZ8A 1M71B 1V3KA 4EN3D 2OXGA 3BGFC 2EEBA 5EPMB 4CW1A 4I48A 5IFHH 4WFHE 3CDYA 5GISL 4LEXL 4XX1G 1FG2B 2ITCA 1GGTA 2AK1L 5KJRL 4KKBD 1R0AL 1NUNB 1LEKB 5KS9B 4JFHD 3QHFL 2FZ3B 4PJHB 4PV8B 3MRNA 1LNUB 4N8PA 4JRYA 4YNYB 2I26N 4P3WA 4RIRA 5EU7E 4PRDA 3U7YH 3OKEB 3U4BH 1UZ6F 1JI1A 3E2HB 3C8KB 3HMWL 4NFDA 1FNGB 4QWWD 5DD3L 5JXEC 1HHJB 4AEIH 3FB8A 1WBZA 4P99A 5IV2B 5FYJE 4RMSA 5ICZB 4WVRA 3RUGE 3HC0A 4RZCB 2WUCL 5JHDA 4OCXH 3ILPB 3HRZA 1NSNL 1DTUA 2FX9L 4KI5E 5I1IL 1YMMA 2CKNA 4TN9A 4QXWA 5C92A 1JFQH 4AIZB 1WITA 5L7XL 3RVUD 4XMKL 1BBDH 1JNHA 3WXVH 3C87A 5SWZE 3TH2T 4ZUSA 4KAQH 1LGVA 4UDUA 2PXYD 1X5FA 1F97A 1QFHA 5E4EB 2XV6B 4JGMA 3I2CH 4LSVH 1Q9WB 3BZ4A 4AY0A 3GSOA 3FHQA 1NAMB 1ZHKA 4G6MH 1QLRA 3QEQA 4FXLA 5LQBL 1YEKL 2DOCA 4QHKI 1V7ML 3KDMB 4PRPB 2HAZA 5D7LE 3SKMA 1XF2A 1JZ2A 3GBLA 5T1LD 4NQDD 5JXEA 1X5IA 1S7TB 1EMTH 2ZWLT 3B2VL 5C07A 1GAFL 2R0KL 3NCYP 1A6ZB 3S4SB 4O5LL 5HYSG 1VFMA 5LBSL 1M7IA 1S7QA 3BD5A 3GRWA 2DQTH 3W11C 3C5ZC 5DD6A 8FABB 5J1AA 4O2CA 1DQJB 2ZCLL 1EZVY 1FIEA 2BVPA 1QKZL 1J0KA 4JO4H 2EDTA 1C08A 5I1LA 4G8IA 2RJMA 1MJUH 5DJXA 3A6OA 3FQTA 4DZ8B 5CP7A 1WAAF 1HHGA 1WC7B 4GW1B 2VERN 4L29B 5FUOH 1RJYA 2V2WA 1NGWA 4GKSA 4OB5H 1F00I 4ODUA 3VDAA 1MAJA 1A1MA 5DJ8B 4LRNL 5FKAA 5MHSD 4A2MA 4U1IB 4F9PC 2R29L 1T03L 2VLKB 1I1CA 3IXAA 2WIIB 4YXKL 1ZLUK 5TDOA 5KVGL 5HYFA 2HJKB 1AIFB 4NWTH 5HGGS 4UBDC 4D0BB 3A6BH 1E4JA 3C5ZA 4KKLD 4ZFZB 3TN0A 1PBYA 1XR9A 4XBGB 2BFVL 5D2LA 5EUOA 5EWIH 2R4RH 4LKXA 4NO5B 3MROB 3M17B 1XIWB 3FO2B 1RIVL 4PJ7B 2GQHA 2XA8L 2DMCA 5A3IC 1ZT7B 3QHZL 2BVOA 1ADQH 4JFDE 1JGUH 1H15A 4YQXL 3BJLA 5CKAA 1LEIA 4HLZG 4RDQG 2JKXA 2RR3A 4FQXD 4TRPH 1YEFL 4ZQKB 3QO1A 1XF5A 4TSAL 4RNRA 5I1JH 5EFIA 1BZQK 1OARL 5ESVA 5DJ2B 5KSUB 4LHUG 3G5ZA 4Y2DD 5J13C 1OWRM 4UTBH 2EYRB 5HHXL 3OWEA 4F9PA 2HFEB 3D3VB 4QY8A 3QDJE 1HOCA 3PXHA 3FT2B 3R1GH 2Q7NA 3LS4L 4X7TB 4WTZG 4G9FA 4XI5C 4B0MM 5LWYH 2IPKB 4OGAD 2GFBB 3U2SA 3OKNA 3VE0A 3JWOC 5TE7L 3QFJA 1HYSC 5JIHA 3UP1A 4QTIH 4DGIL 5IGXH 3VD7A 4HS3B 4NGHH 1CZ8L 2Y07H 3KPTA 2LV4A 4MNHB 5C0FB 3EYQD 1BAFL 3IDXL 5TH2B 1F13A 4KZEH 3TVMC 4O9HH 1X5YA 4R3SA 4Z7UA 4G6KL 1M1SA 2EE9A 4PGZA 4DKDC 4O58L 1I9JL 2BOCA 2EXWD 3FTGB 1HH9A 5IK3A 5T3ZH 4S0SD 1NFIA 5EIQA 2QEJA 3V5DB 2WBKA 1TTGA 2APXA 3KXFB 1JPFA 4G43A 4D94A 4FXKA 5FUZH 4OCNC 1CXEA 5GXBB 1KTKE 2VUOA 4IHOB 4MLIA 1HINH 5J7CC 1J10A 1JPGB 4X6CA 3O2DH 3WIHA 4HWNA 1KJVA 4K9EL 3WFDH 4IOFC 2FHBA 1GCFA 3RWIA 1LP9E 1MF2H 1RK0B 3NCEB 4WENB 1KACB 4X4ZA 4ZFGL 4YHML 3WDHA 5FB8A 1RZ7L 4OM1H 4JFEB 3MLSH 1WTGT 4NJAL 2BY2A 1DN2A 2HT3C 3NGBC 4JZOA 4I3SH 5HGAA 2A1WH 2YD1A 5GIRB 5TQ0L 1T5WA 4Z5RA 3C09C 5IBTH 3HS0B 4DN4H 3TVMA 4F7EB 3O3DA 4UI2A 4MA1B 3UCRA 1VCAA 3BP5B 5E9DD 1KIUA 3V4VH 3MV7E 4WUKH 4BSWB 5D7IE 4PJGB 4KDTC 4YE4L 3D2UB 1MIMH 2CKBH 3TBYB 4DK3A 4KY1L 1PG7H 4S1SL 3EYSL 3P4LA 4FQ2L 2CO6B 3UROR 5INDB 1HXMA 1GPOL 4WFGD 5KSBF 1BBJB 1J8KA 1DLHB 2IGFH 2XY2A 4LSTH 1X5JA 1HWGB 1UB5A 4HJJL 2OMNA 5F9OL 4PTUA 2ARWA 4DVRL 3MRKB 3DPBA 3A67H 1D6EA 4XHJC 1H0DA 2F19L 3G04A 4JAMB 5AYUL 3QIUC 4K7FB 1MCRA 5E8PA 3OTTA 3W9EB 4DVBB 3BQUC 2NY2C 1U8PA 2W1NA 1UWXH 1X5GA 3F7VA 1UACL 1BVKB 3ILQD 2D31A 1NMBH 2VXSL 5F1NB 3CMOH 2FEEI 4MX7A 3SKUD 2XZQL 3L7FA 3ZMRA 4IIQA 1J1XH 3DWTA 1FC1A 4JO1H 2P5EE 1IM3A 3M1BA 1GZQA 5J6HA 2BVYA 1WTLA 2AV1A 2GITA 2A6JB 2Q7YA 2ED7A 1N5YL 4LCIL 4EDWL 2AJ3A 4KDTA 3MA7A 2Y7QB 1DN0B 2C3VA 2VLKD 2ADFL 4KTDL 4P4KD 2NLJA 3D85D 4XVSH 2W65A 5FYLH 2NX5E 3BYYA 2OJZL 4NC1C 1H8OA 3LSOA 25C8L 43CAA 3T3PE 3LD8B 5DXWA 2I9LB 5GS0L 5DJCB 1FLTX 1CD1B 1BD2A 3WFZA 2FHCA 1RUPH 1P2CA 2I5YH 2YPVL 3QIUA 3WFHB 4HC1L 1SBSL 3RJQB 3VXQB 5IFJA 3BDXA 1MRDH 1M05B 3BQUA 1EEZB 1MLBB 4DEPB 4U4BA 3FOLB 1RUML 1FORH 2VLJA 4NKMB 4S1RH 4L8CA 1IC7H 1A4JB 2AABL 2B5IC 2OM5A 3FAWA 3UTPD 1CD0A 1K6QL 5D2NC 5MERA 4HIJB 2DWEB 5FYJU 1MCCA 4N1HB 4D3CL 3WFCH 1I8KA 1RZGA 1JWMB 1IQWH 2PTTA 4P5TB 4TSCH 2AK4E 3SGKC 5EC2B 3D3VD 4RCAA 1RZIB 4OCSH 4H0GA 2JK5A 4KQ3H 3QDMA 3GSVB 3RTQD 3AB0B 2HWZH 4HXAL 3EOAB 3SDXF 1JZ4A 2FBOJ 2OQJB 5HI5C 1IZKA 2XWBA 4LPXA 4KJYB 1LILA 2IG2H 4Z7QE 1A14H 2P24A 3VRIA 5BV7C 3RX5A 1HN1A 4WI7A 4HKBB 2GK0A 2VL5B 1NDMB 1YNKL 4P23B 1JWUA 1FNHA 1NCDH 4M5ZH 3SCMC 6CGTA 5D6CB 1A5FL 4ZO6A 1FJ1B 1QRNE 1U3YA 5I74C 1Q9OB 2VH5H 5DD1H 1BOGA 5E8NB 3DVGB 3BW9A 4PPTA 2NQCA 4GAYB 4EDXB 3DVNA 3H7LA 3WKML 3REVA 2P8LB 5E08H 5DK2A 3UZQA 5CS7A 3GSRB 2AKRB 4XBEL 4LF3A 3PL6C 1G9NC 1MCOL 2Z0BA 2HFFA 4WW2F 3MLZL 5JLZA 5SV4A 3I02B 4OCLC 4MAUL 2OTWB 4RBPK 1MCPH 1Z6JT 2IAMD 2XT1B 1OT2A 3BEWA 3T2QA 1WAAA 5IEHA 1A2YA 5HHOA 3D0LA 4KRMB 4OD1L 4Q97A 5KVEH 3GSNL 3HZMB 5CBAB 1VDGA 5JO5A 1WQVT 1PKQA 2V7NA 3FJTA 3ZE0E 4JFED 3AROA 5HYQA 1KPRA 35C8H 1NCCH 2P8MA 3BSZH 2AI0H 5CIPH 4G7YL 3RWFA 3EDKA 5I71C 3SCMA 1I8MB 3QUYB 1S5HA 1F3DH 2DQIL 2GCYA 5J11B 1KB5H 4FZEL 3GMNB 3RVVC 2HKHL 2HRLA 2SEBB 4YHIA 4HJGB 1YNTA 3AXLB 1S9XA 2CUIA 3B9AA 2VXQL 2ARJB 3D2UD 1M6OB 4NJ9L 5IHZB 1INEL 5INCB 1FRGL 5F9DC 4F58L 4WW1A 5HVWA 5ITBH 1ZS8B 4XCFL 1LK2A 4KROB 4NZRL 3PL6A 5IMKA 3VFUA 5IM7B 1BQHG 2NZ9D 3U0TA 2Q6WB 1ZVHA 3JZ7A 4HEME 2D4DA 3SPVA 1KXQE 1B4RA 3W2DH 2E8YA 3CX2A 3PHOB 3T77A 2NY5C 3QEQE 1CF8L 4Y4KC 3PDOB 1OPGL 5D7LB 4Y4FB 1JTPA 2KQMA 5IB4B 4PRBB 5KVFH 3IYLW 5CEYB 3IFOA 1G0DA 1I9EA 5C07E 4K3EH 1G7JA 1NDGA 4JPIB 3EUUA 1HSAB 4LGRB 5ANMA 4UV4H 3C2AH 2Y23A 4GG6F 2DRUA 5CZXC 5C7XH 3OF6A 4G8EB 2VC2H 3AAZA 5IVXF 4JJHA 2DLEA 4RMTA 4Y19A 4RAUA 32C2A 2RIKA 2DLFH 1JUFB 1JGVL 4BH8A 2BNQB 1S9VB 5F72S 2G5RA 4N8VA 2ZUTA 1EUUA 4U1HA 1SJEB 4W6WB 2MKLC 1BIIA 5IT2H 3DURB 3DECA 2DLHA 1ZGLP 2XQYG 3D39D 4N68A 1CGSL 1AXTH 1QFWL 4Y4KA 1ZLSL 1G7PB 4NKDA 2IPUK 4N9GB 1D3CA 3MLYH 3O2WL 5EU3B 1U9KA 3P30L 1XZ0A 3VI4E 4G9DA 1XCTA 3MBEC 4YK4C 5BS0E 2Q1EA 1MI5A 4PGBA 1FPTL 1CK0H 1DZBA 1MWAH 5HGBA 3FN3A 4JJ5B 4PJ5B 3MUJA 4G6AC 4WIQA 2CDEB 4W4OC 1OTTC 4KMLB 3ARFB 5FYKH 4F57H 3TWCH 2G5BB 2JIXA 1A9BA 1UYWL 1KN2L 4UINH 5DHVA 1AQKH 1CICB 3MODH 3PGDB 3G6DL 4MSWA 3D69B 4O2EB 2BDNL 3RIFK 1PLGL 4P5TD 1FZOB 2Y06L 3QPXH 4Q0XL 4OCRL 5D2LE 1IEHA 5EUOE 3VXOB 4Z95L 1IAII 5T3XH 4JFDB 3MACL 4RFEA 4LEXH 2OL3A 3RBGA 4FG6C 2OP4L 3UZEA 2AK1H 4XT1C 4MGXA 2E9WA 2A9NL 4A6YA 1QEWA 2Z9TA 2FATL 2J8OA 1MCEA 4AMKL 3ARQA 4YPGB 5K9OA 3WEXA 4X9BA 4YPJA 3QDJB 4JY4B 3GHEL 5DRNB 3B9VA 3QG6B 3HMWH 3JUYA 5DD3H 5E8EA 1A1NA 1OAUL 4OAWB 2YEZA 4M1GH 1Y6KR 2WUCH 5C9JB 1KYOK 4G9FE 1NSNH 4L8BA 2HVKA 2FX9H 5I1IH 1R5VA 3QFJE 4YLQT 3DX7A 3I6LE 5IG7B 3MRRA 5D93C 3OXRA 5HYSA 1X5LA 2R23B 3VJ6B 3WFBL 1RI8A 1FAIL 3KYNA 1MIEL 5IWLC 4MB3A 4XC1H 1WBXA 3BUTA 4FNLL 2VZSA 4PRNA 3TBTB 3N1GC 4ZS6D 5DI8A 2AJVL 2C1OA 4LKCB 3TBWA 3MA9L 4M9PA 4ONHB 1V3JA 5LQBH 1FIGL 1XH3A 1NJ9A 1V7MH 2XXCB 4J8RB 3IFNL 4I1NB 3QUYD 2WAHA 4UAOC 4X6DE 3QP3A 3V7MA 3QNZA 1C8PA 3B2VH 2ICEA 4X99B 5TDPB 5M95B 4N9OB 2J7LA 1FZMA 2R0KH 5BXFB 2GHWB 1LP9B 3K46A 1IKNC 2BC4A 1ZHLB 4X6CE 1SMOA 5C0EA 2VABB 4QRSA 1CIDA 5IBUB 2ZCLH 3V4UL 2CMRL 2WINB 2A74A 3FT4A 4N0FA 1QKZH 4NBYB 4R26H 5DQ9A 3V5KB 3MV8E 3G5YA 1YEHH 2VNCA 2PO6C 2VWEE 3LV3B 4UDTB 3FONA 3HE7C 4NM4H 5IWLA 1UZ8A 4MWFA 1KLGA 3MX0A 1NLBL 3U30B 2F53D 5A16B 1UQSB 4APQB 1JI2A 3MV7B 4F3FB 1CL7L 5DT1H 5D7IB 3DO7A 3RWEA 1JBJA 1OD7A 1I9RL 4Y4FD 3UJTH 4JY6A 2R2EA 5J0BA 3BPCA 1OSZA 4LRNH 1YYMH 2E7CA 4KMTL 1PX4A 1KB9K 4WW2C 1HDMA 2P42B 4UOJA 1WJ3A 4D0CA 3ZT7A 1HXYB 2R29H 3VXPB 5AAWA 4LP5A 2CRIA 3SDXA 1RMFH 4HUMB 5F9JB 4YXKH 2AJZA 4PY7B 4NFCA 5KVGH 1FZKB 4UIKH 1IKNA 4RMRA 3RDTD 5EUKA 5I15L 4LHUA 3BISA 4KDVA 5EO0B 3KG5A 4X5WA 4U49A 3BIKB 5ESAB 2BFVH 4EBQL 5IROC 2I25N 2NW2A 3W0WE 1EXUA 3F12B 2PO6A 4WTZA 2BNQD 1RZKC 4KQ4L 4H5SA 3VWJC 4JKMA 2P5EB 2W0LA 3PUCA 4HWEH 2JJUA 3OJ2C 2ZG2A 5HVHB 1PZ5A 3BPNC 1U91A 5LGHL 2R2HA 1J0IA 4NRYA 5EN2B 1P53A 3OAUL 2Y5EA 4JQXC 5AEAA 3DBXB 4EI5D 3BZEB 1YEFH 4F2MA 4XVUD 3R8QA 4TSAH 2ZZUT 4QGTA 2WUBL 1OARH 4ZUVB 1R5IB 4PBWD 2X2YA 2NX5B 2CDFB 4F7PA 2X7LB 4PGEA 3I75B 4PJ5D 5HHXH 1ERNA 4JN1L 4TTDD 1TVBB 4Q9BA 1A3QA 1TFHA 1KULA 3PWNA 4PP1D 3CXDL 3LMJL 4R96A 4PJBE 1HH6A 3KHOA 4XNUL 3LS4H 4XP6L 3P9MA 4X4XA 5GGVH 4F37K 4MS8C 4PY8J 1YNLL 1BD2E 4LPYA 1N5AB 3DGGA 3QWQB 3TBVA 2W60A 5TE7H 1Q9LA 4JRXA 2AERT 5E70A 1ORQB 4NNXB 5IMMA 4GUPB 4FOMA 2VE6B 5IROA 3UPRB 3HR5B 4ORGA 3RL2B 4P46C 3TFKD 3MUGA 3LRSA 1CZ8H 3QAZB 3MLRL 4U6TA 1BAFH 3OAZK 2OI9C 3C60D 1DE4B 1FDLH 4MJ5A 5L6YL 3B2UC 4MHHG 4ZODA 5SWQB 2DMKA 4G6KH 2Q20A 1SM3L 4HMEA 3CC5A 3PV7A 4JQXA 4PLKD 1OW0C 3MNVA 3HZVA 2Z8RA 3SOBL 3PGFL 2H41A 1I9JH 3H3BC 3MRCA 4GRWH 5CLTA 5ACLA 1S7RB 1ZHBB 1EX0A 3WNMA 3GFUA 1D9KB 4H1LG 4HUUB 4PJEE 3OR6A 4X0KA 5EOCL 2GEEA 3SJVD 3RWHA 5C0AD 2JJVA 2FGWL 4F33B 3OR7A 5CBEA 4OLXL 4JDTH 1F90H 3T4YB 4CVZA 4K9EH 3AU1A 1WFTA 3SO5A 1KTRL 3ARDB 3IETB 1INQB 3P0YL 1IEBB 5HYJD 3KPNA 4JO3L 1EEYB 4ZFGH 1CG9B 1QRNB 1SYVB 1QSED 5HD8C 4YHMH 4PV9B 3OPZH 5IFAH 1WWAX 4XP9L 3N0PB 4KK5C 4P46A 2YA1A 4ZFFA 4NJAH 4NQTA 3R0MA 1DQQA 4HH9B 4LSUL 3S37L 2UZIL 3TP4A 3U79A 3S9DB 1UB6B 5TQ0H 3BEVA 3NAAL 4MD4A 4JZJC 3WN5B 1W72L 2NNAA 5GRUL 3VXTA 4GG6A 1B90A 5FCSH 2AEPL 2P47B 4CW1B 5JOFA 1OW0A 1I1AC 4QXUL 3V6ZA 3HC4L 4DWHA 4YE4H 1XF1A 1RY7B 3MJ8A 2ITCB 4KY1H 3CSBA 4S1SH 4YJZL 3LPFA 4J3VA 1GPOH 2K7PA 2R0LH 4R97B 3LY6A 5E8DL 3VFPA 1MCLA 1Z0NA 4JRYB 4MA8H 1FNAA 2CRMA 4JREC 4WI8A 4HJJH 5F9OH 3FB5A 3LDBC 4PRDB 1YJDL 2BXYA 5HHOE 4DVRH 1PKQE 3O4LD 5I8OH 4BFGA 1NAKH 3FB8B 1JYVA 1YUHA 3WBDA 3CPLB 1YZZA 1J88A 3HC0B 5T3XE 5JHDB 3PP3H 4APQD 3KPMA 3HRZB 3MV7D 4PRHA 5IB2B 1J5OL 4OFVA 1F6FB 2VXSH 2NY3C 1RJCA 2O61A 4OLVH 3H42H 3IFLH 4JZJA 4E41D 4WU7A 4FQJL 3ECBA 4H88L 1CGTA 1JNHB 3BGFB 3DXAA 4ZUSB 3SKJL 1I1AA 2KDGA 4UDUB 1N5YH 1UCTA 1NCTA 2E8ZA 3CLFL 3HCVA 1N3NA 3KS0J 3MPCA 2O5ZH 3T0WA 3BZ4B 3GSOB 2YN5A 3BGMA 3QUKA 1ZHKB 3BPLB 2C1PA 1QLRB 3QEQB 2OJZH 1MFBH 4M5YL 2FB4L 5MEPA 3N1MC 4WFEE 25C8H 4ZTPL 3GMPA 4P49A 5GS0H 1QACA 2IBGA 2X9XA 1KBGL 3CZFA 1DQML 3GEWB 2YPVH 1XF2B 4HC1H 4LLQA 1D5MA 1SBSH 2OLDA 5C07B 3V9FA 4I0PC 4MXWL 5D5MF 1JHKH 5IOPB 4LVHC 3HI5L 1JL8A 1M7IB 1KXTB 1S7QB 2DI8A 3VFMA 3OHXA 4J1UB 3LHPL 1RUMH 2X89A 5DD6B 1EO7A 1BGXL 2AABH 1NMCC 5J1AB 4O2CB 4R4BA 5SWSD 1QFWM 1Q9KA 2BVPB 1K6QH 2WBJC 1GL4B 2PUQT 1C08B 4D3CH 5I1LB 2CUMA 5ID1A 3VMPA 3RVWD 2FRGP 5DJXB 4Y19E 3JBG7 5CP7B 5BZDA 1HHGB 2CIKA 3TEUA 2VB5A 2XICA 4JM4L 1E6OL 4HXAH 1BOYA 3KPSA 1IM9A 1RJYB 4HKZA 4KK6C 1NGWB 4DUXA 2E6QA 1CDHA 1A1MB 3HE6B 5FK9A 5DJYA 5CSBA 1WF5A 3Q0HA 5ELIA 5BS0B 4GLRI 5I8CA 4H20H 3KLAA 2ICCA 4DKFL 3NZ8A 3IXAB 3HPJA 4JLRA 4XNXH 1RZ8B 5TDOB 2X44D 4HWBA 1A5FH 3V52L 1MI5E 3D87B 3CVIH 3G5VA 3Q1SL 3C5ZB 4I3GA 2NY6C 3TN0B 1XR9B 1VGEL 2APBA 2FD6L 2QQKL 2Z4QA 5F88A 4ZXBD 5D2LB 5EUOB 3C6LB 2H1PL 2XG5A 3FB6A 1YEDB 4LKXB 2WBJA 3P4OA 1I3GL 3WKMH 1OD9A 2VDNL 1V05A 4XBEH 3W82A 3LIZH 4U1GC 3MLZH 1A6PA 5DMKA 3EFDL 2BVOB 1QBLH 3VRJA 1H15B 5CLWA 2JF1A 1LEIB 4MAUH 3RL1B 3UYPA 3QCUL 3QO1B 3X17A 3ZE2F 4K8RL 5CUSL 4RNRB 2Q8AL 5EFIB 5ESVB 4KTEL 3GSNH 4M1CC 3G5ZB 1VHPA 1BQHA 5DC0A 3C9NA 1KB9J 1XGTA 1FZJA 1HOCB 2CLVA 2VYRE 1U6AL 1U42A 2NCMA 1BFOA 4G7YH 3GIVB 1KFAL 5GZND 2NPLX 4G9FB 1VKXA 2X6MA 4PYGA 4D9LL 1FVEA 3LKSA 3OKNB 4NHCL 4BZ2L 3U2SB 2YPLE 2IQ9L 3VE0B 2JB6B 3L5WA 2X4SA 4WI6A 3QFJB 4FZEH 4M8VA 4GH7B 2HKHH 3DX8A 4LFHD 2VXQH 3TYGL 2ZOKA 4NJ9H 4KK9D 3VH8G 1EV2E 3OAYK 4F58H 4U1NA 3L3OA 4X7SL 3QRFM 4NZRH 3SE8H 2ZCKH 3ARWA 3TNMA 4Q9QL 4JRYD 4R3SB 5HDQL 3MREA 4X7CC 2KZWA 1ZGLB 3U7AA 1DJSA 1A6VL 1HH9B 2E7BA 5IK3B 3RBSA 5DEFB 3WHXA 1NFIB 2ERJC 4LQ1A 1CF8H 4HX1A 3PQYA 1OPGH 2RHEA 5J13B 1T21A 4X9GA 4G43B 1JPFB 3REWA 3FO0H 4HEPG 5JHDD 2H9GA 4WUUA 4X6CB 1MVUB 1YA5A 1KJVB 2ED9A 2V6HA 3VGEA 1YMMD 3ARSA 4PJDA 5BCAA 5I17A 5LXGL 5E56A 3HLAA 3RWIB 1FP5A 3AREC 2VQ1A 3AM8C 2I24N 5ID0A 3CSGA 5FB8B 4NYLA 5HYEA 5DZOA 4OZGE 2KBGA 4M9OA 4ZS7H 1CBVL 1QR4A 4JZOB 4XWGL 4HUNB 4NOFA 1T5WB 4YBLC 1FH5L 1GHFH 5IP4A 4HUWA 3O3DB 4WDIB 3FQUA 3QUMA 3RWJA 4K23H 5B3JF 3TO4C 1U3HC 1CGSH 5JXED 5D7JC 1QFWH 1ZLSH 3O3AA 1HXMB 4M6AA 5L2KA 2DF3A 3O2WH 3P30H 3CFDA 3ULUL 2P7TA 4FFYH 1UB5B 4ODXA 5DMIH 1SY6A 2G2RA 1T2JA 4PTUB 1FPTH 3WMSA 1D6EB 1H0DB 3G04B 4R4FL 1VENA 1NCAH 2GW5A 3AREA 3HMXL 4XBPA 2E7LA 3G6DH 4OGYL 5E8PB 2XZCL 3OAZH 1PLGH 1FG9C 4Q0XH 1H3UA 3FZUC 1U8PB 3F7VB 5I16A 5BO1L 1SVCP 1S78C 4BM7A 3QXAA 1HZHL 4LSRL 2D31B 4MX7B 4TVPL 2XN9A 3MACH 3L7FB 2D7OA 5CFHA 4IIQB 1GZQB 5J6HB 1BWMA 4FTVD 1ZWIA 2AV1B 5GGRA 3RFZC 3D18A 1PZUB 2GITB 2Q7YB 3ZKXC 3E0GA 2VLME 4HK0A 6FABL 2AJ3B 3TO4A 3PV6B 2C3VB 2I60H 1U3HA 2NLJB 3R06A 5E6IA 1R3HA 4KTYA 2K1MA 2W65B 1B3JA 4YGAB 3BI9X 1EO5A 3WHE0 3NVQA 4XCYA 3EBAA 4X5LA 4PJBB 3LSOB 43CAB 1YEGL 3LS5H 2GTWA 3W11D 4MQXC 3GMRA 3C5ZD 4XGZB 1OAUH 1BD2B 3MRMA 2Y5TA 1T2QL 4DFIA 4UZGA 3QIUB 1A6WL 4XP1H 4ODTL 1T7ZA 3EW3B 2LAGB 4DKEH 5IFJB 1FNEA 3BQUB 4JRXE 3UEZA 1HCVA 2Q3ZA 4OBSA 2R8SL 4CVXA 3FN9A 4UMGA 2VLJB 2XFXA 4L8CB 2X70B 4HIEB 3WL9A 3T1FB 4IRZL 2ZPKL 4LLMA 1G7QA 5MERB 1DUZA 4OGXL 3QR2A 1I8KB 4PJCE 1LO5A 1EGJL 3IAQA 3MA9H 1RZGB 2PTTB 1EZVX 4PJEB 3U1SL 3S35L 3CX5K 2JK5B 4XXDA 1JGLH 3HI1A 4HPOH 5E2TL 4Z78A 4G9FD 5TJWK 4EKXA 1MVFA 4UBDD 4QHLA 5HJ3B 4HIIA 5EO9B 3QFJD 1KCKA 5AUMA 4GOSA 2Y36H 3KR3L 1A7BA 3BKJL 3PDDA 3QI9C 1CDJA 3ZKSD 2GK0B 1OHQA 2CR6A 3IJHA 1JWUB 1DEDA 2EKSA 2X4NA 4RRPG 4IRJC 5A3ID 1S7UA 3LPWA 3SKOB 5DUPH 2VZ3A 1I3VA 1BOGB 3TA3C 2B5IB 1VESA 4QRPA 3BW9B 1UH2A 1NLBH 1N2RA 3L9RA 4NO2B 1SBBA 3DVNB 4MJIE 4P5KA 5JQ6L 3ZHKA 3REVB 1CL7H 5D1QC 5DVOA 4LF3B 1I9RH 2VLRA 1W0VA 2VZ1A 2ZJSH 3NIDE 2CGRL 1HI6A 5GGTH 5JLZB 1PSKL 1IGJB 5DLML 2EDYA 4QNPE 1PQZA 3NA9L 3H9SA 3BEWB 4X83A 1M7DA 2X4UA 4MVBC 4XI5D 5IEHB 3OQ3B 1A2YB 2Z91A 5HHOB 4HAGA 1EBAA 5DO2C 1HYSD 1EO8L 4J12A 1PKQB 1VFAA 2V7NB 4RGNE 5A2IH 1K3ZA 5I1GH 5I15H 2DWDA 3QI9A 4R4NC 3Q6FB 2P8MB 4WEMB 4G5ZL 4HW6A 4K3JL 3RWFB 2DQJL 3SCMB 1DDHB 1RV6X 2FBJH 3B9KB 4IRJA 5I74B 5DURB 3TVMD 4ONFH 3SDCC 3TA3A 1I3UA 5F93C 4ZFOA 5E2VL 3S36H 4PRHE 1S9XB 1RULL 4G6FB 5LGHH 1Y6NR 1RJZA 5AWNL 5D1QA 3IJYA 1HIML 4WW1B 3RJDA 2J6EA 3OAUH 2D7MA 1LK2B 4L9LC 5IMKB 1A47A 3DXAE 3VFUB 1CFNA 5B4MC 3RU8H 3HI6H 2WUBH 3BZFA 3G9AB 1NGPL 2P8PA 3A6CH 3PG2A 4HKXA 2EDRA 4KK8C 2B4CC 3U0TB 5IW6A 3L5JA 4YZFE 1OLLA 2Z92B 2DQDL 1NLDL 4IOFD 5GJSL 3SPVB 2RFXA 3ALWA 3AFLA 5I8KL 3CXDH 1RUQL 3GUTA 3GKZA 4DW2L 4XP6H 4XNUH 5GRZA 5EOCJ 1DUYA 3E6HB 4H1LA 3H8NA 1UKQA 2HT3D 3IFOB 1T89A 5I71B 4PGJA 3UTZA 4Z7WF 4N0UE 2BSRB 4OFDA 5DRZA 1KT2A 1G7JB 4OM0L 1NDGB 1Y6MR 3SDCA 4X6EB 1BVLB 3BP4A 5E94A 3MLRH 4KJPC 2L7JA 4P2QE 5L6YH 4OLYL 1K5NA 3AAZB 3MUY1 2FEEL 2XQBL 3I3DA 1SM3H 3JSSA 5JZ7C 4L9LA 4Y19B 4GAGL 3RRQA 3PGFH 3SOBH 3WLWC 4AZ8A 3BVNA 1JGDA 2NXYC 1CE1H 5CJXC 3GI8H 3HZKB 4N8VB 4U1HB 1BD2D 1CFVH 4XHJD 2H3NA 3WO4C 1BIIB 3QIUD 2ZNWA 3KPSE 5IEKA 4R2GC 3GNMH 5EOQL 3U0PA 4PJAF 4K7PY 4NKDB 5DHXB 3CFIC 2P4AB 1JN6A 1XZ0B 3BQUD 2NY2D 4IDLA 5ILTL 4I2XA 1XCTB 1OTSC 4JPVH 1DBKL 4V1DE 4JO3H 1MI5B 4PGBB 2VLJD 1QOKA 2GJ6A 2H32A 3NIFF 3PWJA 3JTTA 4CL7A 5HGBB 4PJ8C 4XP9H 2COQA 3TC9A 3IKKA 1B0WA 1LO2L 3S96A 4NKQB 2GK2A 2JIXB 3S37H 1A9BB 4YFEA 5DHVB 5IHUL 1GZPA 4Y5XC 4P3CL 4EUPG 3JWDH 3GSWA 4OD3L 2AEPH 1S9KC 4LGPB 3QDMD 2APFA 3EGSA 5E5MA 4QXUH 4RFEB 2OL3B 3HC4H 5I19L 4NCC2 1X5AA 5CJXA 4QRRA 2YD5A 4A6YB 4EXKA 4KZDH 1QEWB 2E27H 5E8DH 4OZHA 3KJ4B 2FH8A 1WGOA 2CK0L 3WEXB 1CIUA 5K9OB 1K8DA 3K8LA 1TITA 5IVNA 3RIFF 2FIKA 2IF7A 5JUEH 4YK4B 1U8JA 5E8EB 1A1NB 3ULSA 3PHQA 2YPLB 4PJ8A 1T80A 3HNVL 4JZNB 5FAAA 1X5HA 4YHYC 4M43L 1TDQA 4L8BB 1EFQA 4FRWA 4Y5XA 5BW7C 1R5VB 3ELAT 5IB3A 3NFNA 3FRUA 1TTUA 3DX7B 2XA3A 2NY4C 3CFEA 3OXRB 4H88H 4TTGA 4JN2B 3QDGD 4OZIF 3KYNB 3TLRA 5TF1L 3SKJH 2ZUUA 3HAEG 3AMKA 1BFSA 5HI5D 1S7XA 3WSQL 2EDJA 1XMWA 3OMZA 1JWSB 1UJTA 5DI8B 3GBNH 3VGHA 2HKFL 1PJ9A 2C1OB 3K2MC 3TBWB 4HCRL 2DJUA 1KPVA 4M5YH 2FB4H 1FNLA 2ESVA 2QKIA 5JMOC 3SDAC 1XH3B 1A21A 1NJ9B 5T1LA 2LU4A 3EO9L 4NQDA 1DP0A 1KBGH 3SCMD 2HLFC 1IAKA 3QNZB 3H7BA 5CD3A 2ICEB 2YRPA 1QUNA 2DTML 1FZMB 4MXWH 3V6OC 2BC4B 2A6DA 1QVOA 4WUUE 5C0EB 5ICYA 5EIIA 4G6FD 3QIWB 4PJDE 3G9VA 4X4YA 3LHPH 4BUGA 4QRSB 5BW7A 1REIA 1T1XB 3PL6D 2A74B 2IH3A 3G6JF 4N0FB 1FO0L 5D93B 5DQ9B 1FV1B 3G5YB 3UJIL 3V5HA 1FGNL 4LLDA 3PABA 4I8DA 4PGDA 3WIFA 3FONB 2JJTC 1UZ8B 4QCIB 4MWFB 1KLGB 5ALBL 3RZCB 1F2QA 1T0PB 4Z77B 2ZUQC 3DO7B 1U8LA 4OT1H 4JM4H 1E6OH 2DM4A 1DBBL 3P0VL 4ONGL 3S8WA 2HJLA 3FQXA 1T1ZA 1ZMYA 4JY6B 2R2EB 4MNQA 1OSZB 5ADPH 3CX5J 4ZYKA 3QDAA 3BKML 4HGKC 1IAMA 4D0CB 4UAOB 1EERB 1FYTD 1N59A 3SDXB 4PJXF 4RGOL 2DJ4A 2XACC 2NW3B 4KFZC 1F42A 2AJZB 3RVVD 2DQCH 3V6OA 3BWAA 2X4TA 4JPKL 4OUOA 3MOAH 5BVJA 4H8WH 4WTXA 3V52H 4LHUB 1G9MH 1MJ7L 3QISA 3WJJA 3IDIB 1F4HA 3Q1SH 2V17H 3JV6B 1JVKA 4X5WB 2EIZB 1VGEH 2FD6H 4OD2A 1UJ3C 4E9LA 4Y19D 5C6PB 3BIAX 2H1PH 2NW2B 4MA7L 1OQXA 2BVEA 3ULVL 1I3GH 2PO6B 1CCZA 3BH8B 1TTFA 4H5SB 4WEUD 2AEQH 2JJTA 4OI7A 1YEEL 4FXGA 5HHVH 4PJFF 1PZ5B 1U91B 2R2HB 1J9CT 1UEMA 5FECA 4DUWA 2ZKHL 1VSCA 3O3BA 4Y4KD 4K94L 2OSLB 3S3SA 4IJ3B 4O02L 5IJKC 3T0EC 3QCUH 4F2MB 3VH8A 3CGTA 1OP5H 4K8RH 5JW5A 4HQQH 4TSBH 4KTEH 4YC2C 1CDCA 1JF1A 2DD8H 3BAEL 4JO2L 5CILL 3V95A 4BFBD 4GT7A 3I3BA 4PGEB 2VDKL 1ETZB 4X7EC 1AQDB 3NCJL 5KSAC 1T66C 4K9EC 1LEGA 3PWNB 1HH6B 3P9MB 1KFAH 4LL9A 5H2BA 5KVDL 3VD5A 2QQQA 4K71C 5FYJL 4JHAH 5CZXD 1P6AB 3KPLA 1UFUA 5L9DL 4BZ2H 4NHCH 5IJVA 3V6BR 1NUDA 4GFTB 4LLVA 2IQ9H 3K2UL 3DGGB 3TBVB 4YEEA 2W60B 3VCLA 5CCKL 4JRXB 5IMMB 1UJ3A 5E5RB 4ORGB 3VFTB 5F7EL 5I9QC 2C4FU 4UIMA 3TYGH 3L1OL 4GRLB 3MGTB 3MUGB 3LRSB 5GGSA 1G7IA 4ZPTB 4DJMA 4F7CA 3RKPA 4B41A 4D9RE 1ITCA 4X7SH 5KVMC 2VUYA 1T2XA 4MJ5B 1F4WL 1MQKL 1SMAA 2XYCA 3BPNB 3RY5A 1IAIL 1U3ZA 4BK5A 4WCYH 3KLHC 2AEWA 3CC5B 3P40A 5IJKA 3T0EA 2Z93A 3HZVB 4F37F 3LEYL 2Z31B 3MRCB 1HKFA 2W0KA 4OZFG 3MRQA 4X7DC 1NC4A 3MBED 3OR6B 4JG1L 4X0KB 3RWHB 4MJ4A 4G6AD 1WT5C 1DBAL 1OTTD 5CBEB 2CSPA 2NY0C 4A2LA 4NQEA 5GGSY 1U2CA 4CVZB 3AU1B 3TIEA 3X3GH 4DKAA 1P7KA 2NYYC 5FGBC 4WI2A 5BZWB 1A8JH 3KPNB 1C7TA 2YKLL 3TT3L 3O3EA 3HG1A 2VN4A 3KPRE 2YD2A 4P46B 3AMLA 5J4MA 4ZFFB 4FG6D 4ZNCD 2EH8H 4XWGH 4Q6YA 1QNZL 5E9DA 1FH5H 3BEVB 3ZHDA 4MD4B 4QRPE 3EOTH 1RVFL 2NNAB 1BJ8A 3VXTB 1DANU 3IB4A 1ZEAH 3MRPB 5J1SC 2HT2C 4J3WA 5JOFB 3ISWA 3V6ZB 5K33A 2EE6A 4UILL 3MJ8B 2FDBP 1NCUA 3AS1A 4LSDA 4JHZA 3HUJE 1YMHA 1WT5A 4LASH 3VFPB 3ULUH 2CK2A 3CSPA 3TJEL 2ID5A 5DUBA 5GS0C 5JW3L 4OCWL 4OIIL 5K9JH 3FB5B 4CVWA 4AEFA 3LQAH 4R4FH 1AO7A 5FGBA 2AQ1A 1CFSA 2AJSL 4L3EA 1YUHB 3WNPA 2Q76A 3IAGC 2PKDA 3PWVA 5IHLB 4QXTA 3KPMB 3QZWG 1L7IL 2Q86A 4PRHB 5BO1H 4LSRH 4MNGA 2F5BH 5JDSA 1L9MA 4TVPH 2ZUWA 4JZJB 3U46A 2B0SH 2DIJA 4WU7B 3ECBB 2R69L 4XRCA 3DXAB 4PD4J 4AENA 4P4KA 1I1AB 5KANG 4K07A 1I1FA 6FABH 4RFNC 4LPVA 3D85A 1FNSL 3HCVB 2X09A 1N3NB 2FJFA 4TOYL 3BGMB 3QUKB 4PFEA 4HS8H 4W68A 4ODVL 3O6FC 2C7UA 4LHUD 4JREB 4L8DA 1YEGH 4ZOEA 3GMPB 3MZGB 3PJSB 3LDBB 4U6HA 3IGAB 3GDBA 1H9VA 3CZFB 4HC1A 1T2QH 3OL2A 4I3RH 2GJJA 4LLQB 1KEGL 4G80A 1D5MB 5DRXA 1A6WH 3RX8A 3K8MA 5CGTA 2PO6D 4N0UB 2QHRH 7FABL 3HE7D 5B38B 3ARVA 1HWHB 4G8GE 1KC5L 1U58A 3VFMB 3O9WB 3OXSA 1F58H 2IFFL 3OHXB 4PB0L 4NO0D 1JNNL 2VLMD 3I84A 4P2QB 3LEVH 1RZJL 5ACMA 1ZVSB 4R4BB 1OLZA 2WWKT 4IRZH 2ZPKH 3G6AA 1E4KA 1RU9H 1NMAL 1SHMA 5C70A 4OGXH 4RRPA 4YHZL 3OKMB 4D9QE 1HHKA 5ID1B 1EGJH 5C6TH 4X98A 3TZVC 3RTQA 2DM7A 2YUWA 3U1SH 4S0TD 3UYRL 1M7XA 2H26B 1NAMH 3VD4A 3EO1A 2VDMH 4L8SA 5HPMA 1WISA 1G1CA 1KEMH 2CIKB 1V3LA 2APTA 4HT1H 3KPSB 1IM9B 4HKZB 4F15B 3O6FA 4M7ZC 2DKSA 3VXNA 3BZDA 5D6DC 4HBQA 3E8UL 1XGPA 5DJYB 4HH8A 3KR3H 1UWEL 3QHTC 4V1DB 4GW5B 5I8CB 3KLAB 1T20A 3VFNA 3NZ8B 4XNMB 3X3FH 3VXUA 3HPJB 4IM8A 4JLRB 3FFDA 4I2XE 4NZUH 3VWJD 5J6GA 4JCLA 5I8EA 5JTWA 3CSYA 1Q38A 5CEZE 1QFUH 4MQ7A 5F88B 3L3GA 4JKLA 3FB6B 1T4KA 2WBJB 1MJ8H 3P4OB 5D1XC 1DQTA 3G6JA 3VGDA 4CJ0A 3TZVA 5T33L 2IAMA 3TJHC 3VRJB 5I1CL 4JFHE 4JGJA 1RIHH 5ALCL 2AJYL 4ODHL 1PVHA 3NA9H 4MS8D 2OR7A 3W39A 2VAJA 1NBYA 3OKDA 2XTJC 3QUZC 1JHTA 3CZJA 4XXCC 5D6DA 4P2OB 5E2WL 1I1RA 4OZHE 1EO8H 3D48R 1J8HA 3EJYC 3P4NA 1BQHB 4AEHL 4OFYA 5DWUL 3C9NB 3LKQA 3MOBH 3BO8A 4P46D 2CLVB 3P9WB 3QBTB 5JOEA 1BFOB 4K3JH 2RBLA 4N0CC 2DQJH 2FX8L 2BNRD 4GXUN 3STLB 1VKXB 4ZOBA 3B2UD 5F1KC 1FVEB 3LKSB 5HVFB 5IFHL 3L5WB 2GKIA 2NY6B 2X4SB 2G75A 1BX2B 2IADB 1YN6A 3DX8B 5F8RC 2X4RA 4ENEC 2HLAB 4P3DA 4U1NB 1MRCH 4MAYC 5D7SL 1IC5L 3SO3C 3U7YL 1BREA 3TNMB 1UXSB 1NGPH 4G8FB 4XC3L 4Z0XA 3GB7A 1ACYH 3RX7A 1B88A 1PD6A 4PJFA 4NZJA 1HE7A 4YDIH 4NNPL 1QPPA 4AEIL 2HT4C 1NLDH 5GJSH 4IOSD 4HHAA 2V5MA 4UT9H 1R6VA 3PE9A 3QUZA 4XXCA 3GMMA 5I8KH 4HX1B 4OCXL 1RUQH 3F65A 4DW2H 5HD8D 1T21B 2ESVE 1QHOA 2J8UF 3REWB 1CT8A 4NQDE 5FGRA 1LK3L 4KK5D 1FVDB 3QEUB 4WUUB 1WIOA 4P2CG 4S1DC 5IBLC 1O7SA 4WV1A 2DLTA 4PJDB 3DROA 5I17B 4J3XA 3WXVL 4IS6A 4P5MA 4KAQL 5J9PA 3QH3B 2VQ1B 4OM0H 4YFLF 5C0JA 4ZAKC 1MCDA 1MPAL 2EC8A 3DXAD 1I1AD 1MFEH 2JCCE 5C09A 3BXNA 3VI3E 5EZJA 4G6ML 1QYGL 2ZP0T 1E0OB 3FT3B 4Y5VA 5KZCD 3GM0A 5CSZA 1C5DA 4MAYA 4Y7MA 3VXRD 1G9EA 1KJ3L 1TZHA 4MD0A 1KN4L 1F45A 3NACH 4EUPA 3D39A 1ZAGA 3QUMB 1A3LL 3H3PH 3IXTA 3RWJB 4ODSL 4I4WA 3IF1A 4KKCC 4NQUA 4R7DA 5MHSE 2ERJB 5EOQH 3MGOA 5DYOA 3O3AB 4JRWA 1IFHL 1VADB 4HKJA 1XGYH 2DQTL 2YZ1A 5ITFA 5FGCB 4GQ9L 2VTFA 3CFDB 3FQRA 3NZHL 2P7TB 3GBMH 3MLVL 3OKKA 4JG0L 2X9YA 5FO7A 4ODXB 2G2RB 5GSVA 2X89D 4JO4L 4EIZC 2NY3D 4C57C 2GAZA 3MRDA 3AREB 1LO2H 2FWOA 1YQ2A 1MJUL 4LP4A 4ZAKA 1X9QA 4XBPB 4L4VD 4P3CH 2UY6A 1U36A 3QEGH 5I16B 2UV3A 2IMMA 3DIFA 3QXAB 4XMPL 3NABL 4YBLB 3RKDC 4C58B 2W9LA 5I19H 5GRYA 3VG9B 3CUPA 3MJ7A 1NH6A 1ZWIB 5GGRB 3D18B 3DRTA 1GOGA 4QHUB 3NTCH 4HK0B 4FQIH 4ODWA 3O0RL 3TO4B 4E42A 2VXTL 2DQUH 4WFFD 2WP3O 1X6NA 3HAEA 5I1KH 4I0PD 3R06B 2YA2A 3GK8H 1BLNB 5E6IB 4XCYB 4PP2A 4H26A 4ZSOA 3GMRB 5EWIL 3X12A 4XPFL 4DZBA 3MRMB 2Y5TB 1IAIM 2VXUH 3DSFH 2KZ1B 4M43H 1WLHA 4JDVA 2WBJD 2LTQC 4HD9A 1CFQA 3MRFA 1AHWC 1IAOA 1ADQL 2ZNXA 1FNEB 3CU7A 1QA9A 1MCHA 3ARBC 1F4YH 2XFXB 3TYFA 3P73A 5TF1H 3WL9B 5BOPA 4LLMB 1G7QB 4KK6D 2H45A 3WSQH 1UGNA 5MI0C 3C08H 1DUZB 1YPZF 1R3JA 2HFTA 5F8QC 4LNRB 3QT2A 4B5EA 4RAVA 4PG2C 2HKFH 2HRPH 4H25A 1E6JL 3ZKXB 2ADGA 4HCRH 2YRLA 2LVCA 2QSTA 4TPRL 3ARTA 5LWYL 4XXDB 3WXWH 3EO9H 4PREA 3HI1B 3B5TA 2BY3A 4Z78B 4X6BA 1NANH 4QHLB 4HIIB 1DR9A 2NY6D 2ADIA 5AUMB 5JHLH 4EI6A 4WHDA 2Y07L 4M02A 4YIQA 1EHLL 1GGBL 3U36A 4X7FC 1CTNA 3KPRB 3S5LG 5FM5M 1A7OH 3ZDYE 2DJSA 2X4NB 4QKXB 4LOUC 1WVZA 3GRWL 3GSXB 1FCGA 1MH5B 3S7GA 5SV3A 2VAAA 3UJIH 1QP1A 1B4JL 4QRPB 3OJVC 4PJ9C 5EU4B 5FKPA 5T3ZD 1N2RB 2YHGA 3L9RB 3TESA 1LMKA 4P5KB 5E9DE 2V7HA 4PG2A 3WNLA 3PQYD 4M1CD 4ONGH 2EO9A 1YC7A 1DBBH 1W0VB 2VLRB 3P0VH 2D0FA 5I1DA 2N7AA 1HI6B 3HUJB 3WFDL 1WZMA 3B9EA 1HSBA 4WFGE 5D1ZC 2EYSA 4L3CA 1PQZB 2BK8A 1M7DB 4W70A 5FO9A 2Z91B 3RVXC 1F6LL 4OM1L 2GYSA 3BP6B 4FFWC 3ABZA 4RGOH 3MLSL 2MHAA 5HHQA 4JPKH 1I9IH 2DWDB 4S10A 4QRUB 1MJ7H 4DCQA 2EDEA 4DN4L 4D8PA 1TQBC 2A6IA 4DUVA 4WGWB 2PYFA 4IRJB 3MV9D 1RUAL 4MA7H 3TPKA 3FO1B 1KLUA 2I07B 4MYWB 3VW3H 3NIFE 2CKBL 2CDGA 4PJ9A 1NGQL 4JVWA 1AJ7H 5IB1A 2R9HC 1G6RL 1JTTA 5IQ9A 1U95A 2WWMC 3IJYB 5D1QB 4LSTL 3S3JA 4O02H 5L2KD 2EDLA 2VLKE 1CFNB 5CP3A 1EHNA 4ODBD 3VXMD 2P8PB 3B3IA 4HKXB 5D1ZA 1MFAH 4JO2H 4ISVB 3R8BB 8CGTA 3V79C 2H2SC 1X7QA 1YN7A 2VDKH 4XTRC 2RFXB 2R15A 3ARRA 2OK0H 3ROLB 3ARED 3N06B 3BPOC 2HN7A 4X8JB 3HNSL 5KVDH 4OZFA 1CGUA 1DUYB 5FYJH 4BUHA 4R0LB 1Z0MA 4H1LB 2MQCA 2R0ZL 3SGJA 5L9DH 2RQ8A 1RHFA 2EE2A 4W81A 1MCWW 1T0NB 1J1XL 4G8GB 1K2DA 3NFSL 3UTZB 2XN9D 5F7EH 3C60A 5DRZB 3L1OH 4ZDHA 3ALXA 3SDCB 3UTPE 3BP4B 5E94B 4MXQC 1YDPA 4HIXL 5IQ7L 1F4WH 1MQKH 2FGZA 3TO4D 3N1PC 1BQLL 1K5NB 4XVSL 5FYLL 1IAIH 1U3HD 2APVA 5D7JD 5TE6H 1OAQH 4OLUH 4UUJA 4L9LB 2DQGL 1WCBB 5J12B 2FEDC 4JQIL 3D3VE 2ICWI 5K9KB 1U8NB 4WWID 4FQCL 3ULUF 5C0AA 3BVNB 1JGDB 1RUPL 3SGEI 4JM2F 4JG1H 2YS4A 2YD4A 2ZSVA 3MRJA 4KUZL 4LCWA 4I0KA 5EZIL 2UWEF 1YJDC 3E3QC 3RP1A 3UYOD 5IEKB 3U0PB 1KGCD 1FORL 1JN6B 3T3ME 4KJQC 3FZUD 3GZKA 4I2XB 3WIHL 1P7QA 3NPSB 4I13B 4U3CA 2J8UA 1QLEL 1IE5A 1S78D 2YKLH 2GJ6B 4CU7A 2H32B 3MXWL 3PWJB 1AXSA 3JTTB 5EU5A 5B21A 4CDGC 3WFCL 1WWWX 1K4DA 3S96B 4PUBH 2VDPL 3STBA 3ZE1F 3V7AG 5CJOL 5ETUA 2GI7A 1GZPB 2O5XH 1KJMB 1LE5B 5KW9L 1QNZH 2V9QA 1W72A 3LN5A 4OGZA 4RMUA 2EYTA 4HBCH 2GSGA 3D6GA 3GSWB 2HWZL 2XZAH 3O6KH 1PAMA 5KS9F 4ZPVA 4PJHF 2RCSL 2MCPL 3QZWA 3EGSB 5E5MB 2IG2L 4U7SA 4PJIA 3O6MH 4ZUWA 3U4EA 4CU8A 4S11A 4WHYH 1OAKH 4HV8A 3WD5H 3IVKA 4W6YB 1L0QA 4MQXD 1GRWA 4MHHI 3VXSA 1PG7X 4HJ0C 1KCLA 1PX3A 3WO4B 4JCMA 3TJEH 1NCDL 4M5ZL 4OZHB 1JF5A 5JW3H 1X4YA 4OCWH 4R2GB 1ZANL 5F9AC 4I9WD 4XNZC 1K8DB 1CXHA 5DD1L 5E2UH 4JFEE 2WMPA 2IQAA 1I4FA 2O93L 5E00A 2FIKB 3UC0H 1U8JB 2R0WL 3P11H 1H3VA 2O5YH 3ULSB 3PHQB 3BT2H 2E9IA 5BVPL 5E08L 4PJ8B 4NZTH 2DBLL 5J1TC 5A2JH 5B39G 5DUMH 1L7IH 5GHWL 5LKNA 1FCCA 1J0ZA 4Y5XB 5MEOA 5JW4R 2VLRD 3NFNB 4CGTA 3FRUB 2V5SA 1MCPL 1UXWA 1QLFA 2R69H 4OKVA 3ZSTA 5I75C 1QTYT 2A83A 3ZDXF 1I7ZA 3UPCA 1BM3H 3QO0A 3H9SD 5F21B 1OCWH 2HG5A 3CU1A 4FFVC 1FL6A 1FSKC 35C8L 1NCCL 3BSZL 1U8HA 4IDJH 1AGDA 2EEAA 4ODVH 3QI9D 1F6AA 4NDMA 2ESVB 2PCPA 2QKIB 4KHTL 4R90H 5JW4N 2YUVA 3P9LA 5T1LB 5H37G 4NQDB 5EU6A 2ATKA 4X6FB 1KB5L 3T0XA 4IRJD 3MBXL 1IAKB 4JKPL 3H7BB 5CD3B 3TA3D 2XOTA 4QHNA 1HQRA 1A02N 3N1QC 1IBGL 1KG0A 2L7UA 2A6DB 3K3QA 5I0DA 1UKSA 5ITBL 1P5VA 5ICYB 1KC5H 5EIIB 5SWSA 4JFPA 4X4YB 4NUJA 1JNNH 4UV7L 2JCCB 5D1QD 2Y6SC 1CLZH 2EICA 2IH3B 4KV5F 1JMXA 5EBLA 5BRZA 5EA0H 3QXWA 4XP5L 4MXVF 3W2DL 3FRPG 3WIFB 5HGHA 1RK1A 4HK3J 4MVBD 5JOPD 1NFDE 1Z5LA 2Y9RT 3UYRH 2IMNA 1D6VL 1J0JA 3BRGC 4YO0A 5DO2D 1U8LB 3EYVA 4ZO8A 1YPZA 4K8RC 3D39E 3EYUH 3FQXB 1T1ZB 2B2XL 3K4ZA 4HULB 4R4ND 3MUZ1 1L6XA 4PLOB 4K3EL 1M4KA 3E8UH 5E99H 4HG4K 1UWEH 1AGCA 2ZUYA 3C2AL 1P7HL 4G42A 4XMLH 1N59B 5C7XL 3SDCD 4BSVA 3VFSA 2VC2L 3D5OF 2P46B 2X4TB 4BQ9A 5BVJB 1CDYA 2ICES 3TO2A 3PWUA 2W9EH 2XI9A 4OD2B 1QO3B 3UTQA 1G7HA 5B4MD 3LEXA 5SX5K 4EEEA 1U3JA 5T1KD 1EEUA 4KK8D 3UTSA 3BHBA 1FBIH 1AXTL 1QQDA 2IBZX 1KXVC 4FXGB 5IF0A 1WIPA 3MLYL 2VN7A 3FQWA 5HDBF 1MHPH 4U6XA 3O3BB 2V9TA 5IVZB 2AJYH 5IHBA 4ODHH 5IW1B 5DR5H 3VH8B 4Y2DB 2ZG3A 2LU7A 5JW5B 5HHME 4LSQL 5F1IB 4XH2A 4ONOA 1JF1B 3QXDA 2NR6C 1ND0A 3B43A 2WQ8A 2GJ6D 5FYKL 3TWCL 4FS0A 3MODL 5CEZD 3MYJA 3DTXA 3QPXL 5JPNA 4FP8H 3SDDC 3WS6C 2FX8H 5H2BB 2FO4B 4KJPD 1IKFH 1ED3A 3KPLB 5DD5L 3BE1H 3SKNA 5T3XL 5IJVB 5ERWA 2N4IA 2XTLA 3J7HA 1K4CB 4MCZA 3LQZB 1FHGA 1DFBH 3F7RA 4RQQA 1B0GA 1UJ3B 5JZ7D 1J87A 3HTLX 43C9A 3WLWD 4UIMB 3IU3A 4U7KA 5GGSB 2IANA 2NXYD 1KTDA 4F7CB 1D5BA 1YEJH 4QRRD 5LGKA 2AEIT 3VRLE 2X1QA 5D96C 5D7SH 3W81A 1IC5H 4IEFB 1S7VA 4ELKA 4NC2B 4MDJB 3X13A 1ES0A 5IESL 4R2GD 4XC3H 2VO5A 5DVNA 3T0EB 2Z93B 4NNPH 5EC1A 4HXBH 1U93A 5F3BA 2G60L 1KPUA 3RWGB 4M1GL 5E0QA 3MRQB 1OTSD 2BRQA 3ULUC 5I73C 4PJ8D 4JM2C 1IEAA 1LK3H 1T83A 4J4PC 4LHJB 1UWGL 5F89A 1RIUL 1RUKH 3SDDA 3WS6A 3TIEB 4HZAA 3CVHA 4K71B 5F7KC 4DGVL 1P7KB 5H94A 1KNOB 4JANA 4XC1L 1EJOL 1I1YA 4U1LA 1MPAH 3CK0H 3HG1B 1P1ZA 2XWTA 4K7PX 2EKJA 5DTFA 3DVIA 2P5WA 3F58H 3H0TA 4D0DA 3OB0H 5C08A 1QYGH 3QSKB 5GRJL 5I66A 3ZYZA 4Y1AA 1AP2A 1KCUL 4PJGF 2F53E 5E9DB 1A3RL 5F7LB 4BA8A 1Z3GH 2B7DT 3QRGH 4GMTH 1KJ3H 5DJ0B 1KN4H 3T0AA 1PY9A 5C0CD 2ESVD 1DBML 4HFWA 3JUZA 4EJ1C 1A3LH 4MB4A 4ODSH 1QSFA 3ZO0A 1JYXA 5ECJE 4FFZL 1A7PH 5E1AA 1SVZA 2X4OA 1MY7A 2DTSA 5TPWL 1YMHB 1IFHH 4GQ9H 3FB7A 1I7RB 3NZHH 1T7WA 5DUBB 3DV6A 4J4PA 3MLVH 4M6OH 1SYSA 4JG0H 1A7NL 3BH9A 4R26L 1YEHL 4XB8A 4KJWC 4NM4L 2NY4D 1CFSB 3HMXA 4L3EB 1FN4A 1X5ZA 4HLJA 2Q76B 4LRIC 3RNQA 4JQVC 7CGTA 1WUNT 5DT1L 5IMOA 2DS4A 2BSED 1ZE3C 3PWVB 2J5LC 3QEHA 2BNQE 1WWBX 3UJTL 1QBAA 4XMPH 4MNGB 4FTVA 5JDSB 3NABH 1TCRA 5EPMA 1YYML 3U46B 3RI5K 5IUSA 4MNQD 4QYOB 2ZUXA 3SDAD 4F7MA 3HR6A 4AENB 4P4KB 1J05A 1I1FB 1RMFL 1VGKA 3O0RH 3D85B 2HLFD 2FZ3A 1R3LA 2VXTH 2W91A 4UIKL 4A6YL 4PY8I 4KVCL 4JR9L 4PJ5E 1H8SA 4OFIA 3OKEA 4GXVH 3J8F7 5I0ZA 2C7UB 4HMCA 4NWUL 4WTWA 1ZT1A 3C8KA 1FNGA 2WSKA 4GLRH 4U6HB 1HHJA 4XPFH 4NRZA 3UZVB 2OJEA 5DRXB 1H5BC 4HWEL 1EBPA 1ZGLM 3IKCA 4LRIA 5DDHA 5GPRA 1U58B 4TNVK 1MCKA 3OXSB 2YWYA 4S1QH 4MCYA 3S5LA 3BN3B 3G6AB 1QR1A 4X9HA 1IT9H 3IJSA 1EGJA 2JELH 3MRIA 5DJAA 2YXMA 1HHKB 2KUTA 1E6JH 4FZ8H 3BMVA 1EFXD 3RTQB 2A0LC 4Y8DC 5GGVL 2EXYC 3RQ3A 4Q2ZA 1JGEA 3EO1B 4TPRH 3KVQA 4L8SB 5D4QA 5HPMB 3ZYOA 3SJVE 3BDBA 5C0AE 4Z9KB 5LCVH 5D71H 5ENWA 4PRPA 3O6FB 3QWRD 3VXNB 3ZSSA 1XGPB 4HPYH 4JPWL 1Z9MA 3MRGA 1EHLH 1GGBH 2OTUA 4BYHA 5L88H 1UH3A 1T20B 1FGVH 5HYJE 3VFNB 1FDLL 1H5BA 4NOBA 3K0WA 1QSEE 3VXUB 3ULVF 5FA3A 4P9MH 2J8UE 3GRWH 5J6GB 5E8OB 3CSYB 4LIQE 2YC1A 5TDNA 4MQ7B 1B4JH 1XIWC 3L3GB 3T0ED 3H6JA 5BMFL 1YECH 3ZTJG 2V5YA 3MV01 1NC4D 2E7HA 4DZ8A 1J11A 1A9EA 1TJIL 4L29A 4JDTL 1F90L 3TZVB 3O6LL 2IAMB 1VACA 1UENA 4PJIE 5C0NC 5KSAD 1T66D 1RFDL 5CMAA 4NQED 1I3RA 5DJ8A 4KWUA 3W39B 1NBYB 3OKDB 3OPZL 4M7ZB