2R69H

Crystal structure of fab 1a1d-2 complexed with e-diii of dengue virus at 3.8 angstrom resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
212
structure length
203
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGYSKYDPKFQGKATITADTSSNAAYLQLSSLTSEDTAVYFCARDYEGFAYWGLVTVSSAKTTPPSVYPLAPGAAVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPTITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Major envelope protein E
publication title Binding of a neutralizing antibody to dengue virus alters the arrangement of surface glycoproteins.
pubmed doi rcsb
source organism Dengue virus 2 thailand/16681/84
total genus 19
structure length 203
sequence length 212
ec nomenclature
pdb deposition date 2007-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r69H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2r69H02
5C0JA 5AG8A 1VPOH 4NUJA 5J1AB 1G7HB 4WJ5B 4D3CH 1R3IH 4NOBA 1N0XL 1OGAD 3CDYA 5C08A 4HWZA 4MAUL 4XAKD 5J3HC 5CD3A 1FLRH 1WWCA 2EE2A 3AB0B 2VABA 1DR9A 5I9QB 4MDIA 4NUGL 3W5NA 5FYJD 3CH1A 4PRPE 1J12A 2YN3A 5DFVD 3VXMD 5I8EB 3KXFB 3RP1A 5IMOA 3CLFH 3CXDH 5GJTL 4MZ2A 5DZNA 1W72A 5IVXE 4XNZB 2F5AL 4HZLA 4KKCD 3UC0L 2DTML 4K2UH 4UAOB 3LMJH 3HZVB 4OIIL 5B39A 1C08B 3GSNA 3MOBH 3HLAB 3BGMA 5D2LF 4EUPB 4QRTB 2FO4B 4NPYA 4M4PA 5IGXH 2DS4A 2YKLL 1CICB 1MFAH 1PY4A 4OLXL 32C2A 5EOQL 1PY9A 2YPKA 5IJVB 3WLWC 4P2YA 4XVUD 1DEDA 4F8TA 3F65A 4FQLH 4NKMA 5GGTA 3LD8B 4O2EA 3O2WH 1IEBA 2ZOLB 1TETL 3GMQA 4HWBL 2FLRT 2D31A 5D7IB 5TJWK 3RTQB 3QIWB 4GOSA 4PV8B 5C70A 3HE7D 2A9MH 2AABH 2YSSA 4O5LL 4N1HB 3DECA 1JNJA 3MJ9A 1NLBH 3IVKB 4NO2A 4AY0A 8FABA 3BJLA 1JPTH 4QOKA 3D9AL 2FB4H 2AJZB 3FCTB 3BP7A 1JPFB 2BVTA 3GMRA 3L3IA 3HFML 1A3LL 3UTTD 4UT7H 5J06A 3MRKA 5F97E 3VFUA 4LCUB 3KS0H 1IL1A 1X5JA 5A2JH 2OMNA 3JV5A 4KI5E 5GGSY 1TZIA 3QXDA 1Q1JL 4ZTPH 1MWAH 5IHUL 2ZUQB 3MGAA 1FL5A 2PXYA 4XPFL 4Y7MA 1Q9OB 2YUXA 4NQCE 3JV4B 4HS8L 5CJQH 3UEZA 1DUZB 3TA3A 2YWZA 1KEML 4JHBA 3WBDA 4ZUTA 1LK3L 1S5IL 4PB9L 2E9IA 3THML 1DBKL 1LO3H 4KY1L 4GAGH 5TQ0L 5DA4A 1OD9A 5DO2D 4HFUL 3ULUD 5HYJE 1F3JB 2YK1H 3CXHK 4JM2B 4NQXA 3RGVB 4H20H 1W0VA 5I19H 2BY3A 3MRJA 1IAKB 4OD2B 3GM0A 4IBLT 4M4RA 2C3VB 1BLNB 1DL7H 5T5NG 2NLJA 5DS8B 2CMRL 4FP8L 4PYGA 3L3HB 5EIIB 4Z0XB 1CVSC 4HF5H 4OI8A 2BXYA 4LNRA 4AIXA 4JRYB 4P2CG 1QR1A 2X09A 3ILPA 4JFXB 3HMXH 2FHFA 4Q9BA 3DBXA 1RZ7L 4UIMB 2R0WL 5JXED 3G08B 3QCUL 3SO3B 4NQDB 2A83B 4YBQD 2DWEA 4KXZI 2HJKA 4Q58C 5EU6A 2KL6A 4OF6A 2EEBA 5GGRY 5HPMA 3P0YL 3PP4H 3KS0J 2Q76A 3ARFA 4Y19B 5DD5H 1FVEB 1CLOL 4ZAKA 1Z9OA 5DMGC 1MHCB 2CO6B 1MELA 1QFPA 3P9LA 1NEZG 4UOJA 3UBXA 1AHWB 3B2UC 1WUNT 2MJWA 4P23C 3QHFL 8CGTA 3STZB 1QFUH 2KKQA 3A6CH 1ZK9A 2F5BL 4MNGA 4FQ2H 2Y6SC 3MGOB 1BM3H 1CE6A 2X7LB 4M7KL 1I85C 4LEXL 2ZZUT 1DQDH 3NPZB 1MHHB 4HUWB 3WD5L 5C2BH 5DHXB 1HXYA 4GKSA 5ENWB 1HQ4B 4MXVE 2JELH 4JFPB 4UV7L 1LO2L 3BZEA 1A1NA 3FB8B 4OLWL 4A6YH 1G7JB 3I6GB 1SEQL 4LSQH 5EO0A 5LCVH 4W6WB 1JNNH 1UM4L 4YHOL 3OXSB 1XF1A 3DI2B 4KKNA 4L1HA 4X80L 2W9EL 3HZYB 1YEEL 4QRPE 4WWKD 3K8KA 3M1BB 3WFEL 2Y06L 4OB5L 4LCCC 5IEKB 3KXFD 1YQ2A 3ULVC 3L3OA 4GG6F 2QKIB 3B5HA 1YPZE 4GQPH 4S10A 3SDXA 4DFHA 2HWZL 2YD6A 3ARBC 3B3IB 5A2IH 2YD4A 3EOTL 1PEWA 3QUYC 1WWAX 1K8IB 2P49B 1GZPA 3BPOB 3D18B 3BH8A 1GGCL 4N0CC 3QQ4B 4NN7B 3ZE0E 5KS9F 1N3NA 1RIHL 5LQBH 1S7TB 5JIPA 4MQ7A 4N90E 4R2GC 4HUKB 3RL2A 5A2KH 1CICD 5D7SL 5D7JD 3W11D 2FYYA 1M4KA 4NM4L 2IADA 1ZHKA 3HCVB 3IDMB 2ZSWB 4UT6H 3UJJH 3ETBF 3BUYA 3LPGA 3H0TA 1CFSB 4AJ0A 4J3XA 4XPTL 4PRBB 5BRZA 3TN0B 4CVXA 3QIWD 3TC9A 1JWUB 5F88B 1MRDL 4RZCA 1KLGB 1SM3L 1UWGH 2FLBT 4X5XB 1AQDA 4IIQA 1FIEA 4OSUH 1U58B 1FC1A 3U6RB 2ED8A 1JTOA 4QNPE 5EWIH 1A3RH 1KJ3H 3QUXA 1AI1H 4XNUH 4OZFA 4Y4HB 3VWKC 2Q86B 4OAWA 2X5PA 3E1F1 5C0AA 2J8UB 2FECL 1JGLH 2O26U 1NFDE 5SWZA 3WFCH 2JCCE 3QHZH 4PD4K 5DJ2B 1PLGL 5M95B 4U6TA 5DVLA 1EX0A 2A6KB 1E6JL 4U1JA 5HGAB 5D1XC 3TNNB 1MCKA 3CD4A 3BEVA 1UCBH 4R7NB 3UTQB 1FFPB 4XC3H 4G9FB 1FYTE 3S88L 4Z7VE 5GJSL 5CJ5A 3VXRE 3X11A 4X7TA 2DQCH 5FM5M 5CBAA 1KCUH 3IETA 1E6OL 4AMKL 4PJ5B 2QQKH 4B0MM 3ZTJG 3OKLB 3PJSB 2UY6A 1MAJA 4TNWF 5IQ9A 3WJLA 4GAFB 3PQYE 3SGJC 5C2UB 3FB6A 4JANA 1ORQA 3RGVD 1MRFL 3DX8B 2RFXB 1MLCB 1JF1A 2NCMA 3IS0X 4RMWA 5T33H 1U8PA 2X4NA 4ZQKA 3CSYB 4M61B 4U1LA 5E2VH 4ESKA 4PV9A 4XNMB 1ITBB 3SDAD 4DGIH 1KOAA 1DP0A 1CT8B 4UOW1 4XMLL 4OZHA 1QHOA 1VGEL 2PYEA 4Z7OE 4OCXL 5I1DA 5HGBB 5AWNL 4WHCA 1NDMB 1CE1H 1S9WB 2DL2A 1I1FB 3T0EB 4BSVB 1J86A 5FK9A 4L9LC 5IROC 4JVPA 3P4MA 1XH3A 4IRSC 2H2PC 4NDMB 3H9HA 4LOUD 1HHGB 5DRZA 4HWNA 3FQRB 3NABH 4LSPL 3I02A 5MEOA 1KXQE 4BZ1L 5DJAB 3IJSA 5J13C 4ZXBA 2EDKA 3V7AG 4XNXH 5LGHL 1YEHL 1NGPL 3EDFA 4PP2A 4G6MH 2DTSA 1M6OB 2B4CL 1I1CA 2R2BA 3MRDA 1W72H 1T5WB 1BPVA 1P4BH 2EO1A 5F9WC 4R3SA 3WS3B 3RUGE 3EYVB 2GY7B 2XA8H 3DVGB 1TVBB 4MCYB 5JPNA 3U7WH 2ITCB 1YDPA 3IGAA 4HGMA 2CJUH 1GIGL 1KIQB 5C0DB 2CDFA 2EYTA 2VAJA 5FIEA 3BPLC 3SKMB 1EZVY 5D9SA 2GIYA 3LN4B 1LE5B 4G5ZH 5AZEL 2WQRA 2ZP0T 4F9LC 2Q3AA 2B20A 3F8UB 2X1WL 3I9GH 5BQ7B 3GMMB 2H26A 4P3WA 1KACB 3CVIH 4XPHH 5GGTH 5C1MB 2ZUSA 4BH7A 3WJJC 1Q94B 3VXUA 2WWMD 1OARH 4N8CL 4U0RC 4JO4H 1G7LA 1ZLVK 2Z31A 3D39B 4MA1C 2CQVA 2DQUL 5MEPA 2F15A 2B1AL 1O5DT 3EJYD 1A0QH 1FPTH 1NCDH 3MJ9H 3MXVL 4F7CA 2WUBH 3ZSSA 2NY2C 3K3QA 1FIGL 4E5XB 2XZQH 2YC1B 2P24A 1CG9A 1XR8A 4DKDC 1YNKH 5DD0L 4P2RD 3GSQB 3IDJA 2ZG1A 4L8BB 2I26N 2VB5A 4M6OL 3P11L 3RKPA 4FG6D 1W8OA 2FO1A 1QZ1A 2YA1A 3W39B 2R69L 3BUTA 4P57B 3O3EB 4HXBL 4P4KA 4C58B 4HUUA 3EOBA 12E8L 3GSWA 3QUZC 3AXLA 3VH8G 1R24B 2BFVH 3EHBC 4M5YH 4GW1A 2OL3L 1SYSA 4WFHD 4X6BA 1CQKA 4D0CB 2Y23A 3WFHB 1KG0A 4WW2A 2OLDA 2IH3A 1NBVL 4XP4H 1ROWA 4K9EH 1A7BA 1DVFA 3LIZH 4P59L 3TN0D 4JRXB 3MRFB 3MLWH 5J12B 4P2QD 2GQHA 4JFZH 1YNTA 3QG6B 1KCKA 4M3KB 1BX2A 4XCFL 3IDYC 5EZIL 1FN4B 3HG1A 5CEZH 5FECB 4MX7B 5KSAA 3RJQB 3NFNB 4KU1A 4Z7WB 1J8HB 5IUSA 1F58H 1NEUA 4U33A 4G7YL 1BQHA 4ZO9A 4F33B 3UZQA 5GGSB 4PJCA 4PJ9C 4LCIL 3F7RA 4EEEA 5E99L 1S7XB 1P4LB 4ZPVB 5I71C 5HGHA 4C55A 5E95B 3V4VH 4G9FD 1Q9WB 5JNYB 1MJUH 1IAMA 4OJFH 4KMTL 2QHLA 2XFXB 1BQSA 4MNQD 4PJ5D 4IOFC 4ZFZA 2BZDA 4IJ3B 1HZHH 2DQGL 2WIIA 5DWUH 1TJGL 1N6UA 2BVUA 4JZJC 3WIHA 1OB1B 3MO1A 1NKOA 5GISL 1HSAB 1FSKB 4XP6H 2XQYK 3V5DB 1C12A 1RHHB 3VG0L 4I18B 1O7SA 3GI9H 2YD7A 4FRWA 3QNZA 3NTCH 2VL5A 3HI1B 4G6KL 1V7NH 5F1KC 2DRUA 4L8SC 4ZODA 2YMXH 2XWBB 3STBA 2YPLE 3VRIB 4MXWH 4OT1H 3R1GH 2A1WL 3ZDZE 2X4OB 5D71L 1TCMA 4FTVE 4HIXH 5IJKA 1YYLL 2XZAL 4RAUA 4TSAL 2UV3A 2X70B 4U1NB 1PSKH 1BF8A 5EU4B 4XGZB 3FQUB 5ESQA 1NC4A 2XN9B 4PJXF 4G8EA 5MI0C 2EDNA 4J3OC 2P8MA 3H8NA 3VD7A 3LEVL 1HNGA 5HHQA 2GT9B 3ET9F 2IALB 1HEZB 3CFJB 3TCXA 5E6IB 5L9DL 4QHKI 4LHJB 3GUTB 3QJFA 4ZS6D 3OJMB 3C8KA 4B53A 2IPKB 2Q8BL 3G5XB 4ONFH 1QBML 4G7VL 3TJHD 1AQKL 2DLTA 4XXDB 4LDLB 1K2DB 3HR5B 2A6IA 5DFVC 4JFED 3F5WB 1A7RH 5DD6B 1FE8H 3S3JA 5E03A 3UX9B 4E41E 4KKCC 4FQXD 2Q7NA 2QEJA 4NQUA 1QSEA 2X4RA 1F4XL 1BHGA 4KDWA 4QRUA 1IQWL 1TZHB 4X6FB 1NMAH 2CRYA 4OFYA 1DBJH 3S9DB 3IJYA 2AJ3A 4MS8D 1GGUA 3EW3B 4JFFA 2HRLA 2GITA 1JGUH 3NMEA 1XF2B 4CJ1A 2WINA 4LF3B 1GGYA 1ZVSB 3DUUB 5T3XH 3UZVB 4XVUC 4GLRH 5GS1B 4PJGF 4GT7A 2W38A 3VFNA 2VLJE 1EFXA 3KPPA 4OCRH 4HWUA 4NO0B 5HHME 3ROOB 3TYFB 5HDQL 4O2FB 3HE7C 2CDGA 3D39D 3HUJE 2ADFL 4WUUA 1P2CB 2IAMD 2AXGA 4KJYB 3TWCH 3RWGB 1EIBA 2XPGB 4G8GE 4JREC 1TQCB 4NKQB 1XGTA 4PB0H 4PTUA 4YGVA 3MNZB 4OZFH 2JE8A 1NUFA 1OAXH 4JGMA 3ARSA 3CUPB 4DK3A 4V1DB 4YUEH 5BO1H 1EAJA 3MJ8B 4ELKB 1U91A 1U2HA 3KPMA 3AC0A 3VCLA 1A3QA 2ESVB 5IFAL 1GOFA 3ZYZA 1MAKA 2YRPA 3KYKH 4Q0XL 1MFEL 1ZANL 2VDML 3I85A 4NCC1 1KJVA 1U93A 1RFDL 2D7TL 2E7HA 4I0PA 2QLVB 4UTBH 3PDOB 1C5BH 2LU3A 3RL1A 3C5JA 4GXVH 5TF0A 1LO0H 3UTSD 3P30L 1ZV5A 2D2OA 4QYOA 3DX9A 1T83A 3Q6FA 1LO5B 2AJSH 2QR0B 5DQDH 1QSFB 2DBLL 3ARGA 4JRXD 1NPUA 4PY8I 5DJZA 2Y9RT 3BP6B 2FJFA 5DO2C 3ULUC 4QRSB 1VACB 4KZEH 5LG1A 2PW1A 4NP4H 3VXSA 3JWOH 2EDRA 4BFIA 2YXFA 2X41A 1LD9B 4JHAL 5D72L 2QQNH 3H9SE 3I6LE 4LNVA 5D2LE 4HIHB 1QRND 4F9PC 4KUZH 5ERWB 3IFPB 3KPSE 1JZ8A 5CEYA 4ALAL 1YJDL 3QA3B 4X98A 1CN4A 5GZND 3ROLB 3K1KC 2X10A 2E27L 3UYRL 3S97C 3BP4A 3SCMB 4OCWL 3AVEA 1FNGB 1FL6A 4JJ5B 4G9DA 4EIGB 2EEDA 4G8IA 4UQ2A 3QEQA 3GIZL 3QCVH 5JXEC 3DO7B 2FJGB 1QA9A 4EDXA 1EO7A 5D96B 4OV5B 2CSPA 5I1AA 3R4DA 1A6VL 3VGEA 4KAQL 1EHLH 2HH0H 1BBDH 4OGAD 4YBQC 5CGTA 1XIWA 3LZFH 3HNSL 5MENE 3HTLX 4WHYG 4FZEH 1UZ8B 3TCLB 2HJLA 2V2XA 1KCVL 5HTSA 5FB8A 1F90H 1L7IH 2VITB 5BV7L 2GCYA 4JCLA 5KVDL 1MUJB 3SDCA 4OKVA 5JOPD 3VA2C 1W0YT 5L2KE 3JUZA 4EI5D 3RWEA 1II4E 5DSCB 3I6KA 1AY1L 4NHCL 1CGSL 2XTJB 3OPZL 1NCCL 4RRPA 3H3BC 2ADGB 3D0VA 4TUKL 3C09C 4L3AA 5IKCA 4PJ7B 3REVA 1I9JH 1IAIM 3BPNB 1UH3A 1I1AA 2P43B 1MJ8H 1M71A 3WLBB 1MOEA 1N2RB 1I8MB 3QWOB 4GBXA 3OKYA 2XN9D 4Q6IB 4F7MB 1IFHH 4RGNE 1FFQA 4D9LL 2EE3A 2G9HB 4KZDH 2Z35A 4FQ1L 3MV8E 2ADJA 3G6AA 3FFDA 2N56A 3RWHA 2R4RH 1MCPH 4OZIE 2W91A 1G6RL 1WAAF 3CH1B 1E4XH 5I9QC 3V0VB 3K2UH 4LHUG 1GRWA 5I1EL 4WWKC 5IMOB 1JRHH 2ATKB 5BZWA 5GS0L 4C4KO 2D4DA 3L3JA 2W07A 1RZJH 4UTAL 1W72B 1DQMH 4XP1L 4P9HH 4NGHH 4XI5D 4UV4H 4HZLB 3MLTB 4XNZC 4BQ9A 5B39B 3GSNB 1FV1A 1C8PA 2O5ZH 3O8XD 4MVBC 4I3RH 2E9WA 2CUMA 1H8NA 3QPXH 4RFOL 2LAGB 1AKJA 3LQZB 3R0NA 3A67L 5GRZA 3IDNB 1GC1H 2NY7H 1CICC 1RUPL 2QADD 5CIPA 5D7JC 2YPKB 3EYUH 2GFBA 1B0GA 3W11C 3QFDA 1FBIL 3MUY1 5EO1B 4S1QH 1ZT4A 4ELME 1CXEA 1KEGH 1G0XA 3FQXB 1IEBB 1WC7A 3GMQB 2N4IA 2D31B 2LFGA 2R1YA 2BNRE 2FGZA 4TVPH 3GBNH 4O9HL 3V5HB 1A7OL 5JQ6H 3QIWC 4NO0D 3GK8H 1K3ZA 4HUMB 4NO5B 3IDXL 1AIFA 3RI5F 1NAKL 3ULSB 2EIEA 1BD2A 3HE6A 4DQOL 5H8DA 3VXQA 1BJMA 1JZ4A 3KR3L 3QDMA 1KELL 2ZOKA 3PGFH 5IBUB 3E8UL 1ACYH 1BVLB 4LDOB 2X4SA 4V1DD 2I5YH 2EH8L 5F72S 3MRKB 1FL3A 4YXHH 3VFUB 4WV1A 4YNYA 3TVMD 1IL1B 3QAZC 1WBZA 4S1RH 3AM8A 1I8IB 2EDEA 3QXDB 3MZGB 4GRWB 5K9QG 1XF5A 5E2TL 3CJJA 3QO1B 4ONGH 2OI9B 5C09E 3FOMA 5SV3A 3F12A 1FZMA 1BWMA 4PD4J 5CMAB 4G43B 3S37H 5DMKB 3HC4H 4KPHH 3BD3A 3LKNA 4NC1E 4QXWA 4J7RA 4OUUB 1OP9A 1D5IL 3JSSA 5DD3H 5KANI 4JFDE 5KSUB 2PF6A 1QSFD 1ZHLA 3SE3A 2FL5A 3WIHH 5FKAA 2VSDA 4DKEH 4F7PA 1LO4L 3PWPE 5IBTH 3RGVC 1FQ9C 1ZVHA 4AIOA 3MRJB 4QWWD 1A2YA 4I77H 4X4ME 2VOTA 2P5EE 4QHNA 5JDSA 4HH8A 3QEHA 4YXKL 2NQCA 4IOIB 5KS9E 5E5UB 4OCSL 2HYMA 2X89D 2BNQD 4PRHE 4M1DL 4ZG1A 1O0VA 2CKNA 3SDAC 1MCJA 2GJZA 2BY2A 2HJFB 3HNVH 4LPUA 2DLFL 4XP9H 5IR1A 3QDJE 3U30C 1A1OB 1I7RB 4LLVA 5KG9A 1CD1A 2G5BA 1U8NA 3OR7B 2ID5A 1IGFL 1M7IA 3GGWB 1B3JA 1GGBL 1K4DA 1AO7B 4HX1A 5TF1L 4PJFF 3BKCL 4KDTA 3WE6B 3EFFA 4UIKH 1K4CA 4YFDB 5JMOC 3BMWA 4NHUA 1D5ZB 4NQEA 5CUSL 3SO3C 2VDRL 2BCKA 2HJKB 4LOUC 1OAUH 5EU6B 1ZLVH 3ABZA 5HPMB 1VENA 4RMQA 4X7DC 1JWSA 1JF5A 5F7HA 3MLUL 4HLZH 3PGDB 4LLDA 4PJDE 3CMOH 4O58H 5TFSH 2B5IB 3T08A 4L8DB 4BH8B 3DIFB 4X5LA 4HWEL 4LPTA 4M3JA 3WEXA 1AHWC 3MRPA 2AQ1A 2HLFD 1DDHA 3KNBB 5JZ7D 3ZL4L 1KTDB 2EO9A 4KQ3H 1F8TH 1TDQA 1CE6B 4F57L 3FT2A 2OXHA 1NC2B 2FBJH 4PJEF 5I1KH 5IMLA 3QEGL 4HHAB 3BP5A 2RB8A 1IKFL 4GKSB 1KGCE 3ALXA 3BZEB 3V0AC 2AGJL 4L3EE 4X7FC 4JHWL 4RWYH 4HAGA 1JI1A 3EO9L 4JY4A 3IAQA 4GG8A 3LS5H 5C08D 5HXMA 2Q1EA 4L4TA 4RAHA 2X44D 3T4YA 3P0VH 4C56B 2HFGL 5EO0B 2HT4D 2ICEB 5DEGB 5ADOH 2BMKA 1MFBL 2J3SA 5SX5K 2CKBL 3O4LA 4O02H 3U4BL 4K8RH 2WWMC 4L5FH 4J6RH 4RFEB 1KB9J 1E4KA 4KROB 2FGWH 5KTEL 1WIOA 3EJYC 1NUGA 2VIRA 4QXUL 3MROA 4TUJB 1AR1D 4QEGA 4R7DA 1WEJH 1C16B 2R0KL 3X14B 4N8VB 2BNUA 5DVMA 1FP5A 4MQ7B 3OR6A 4LIQH 4YZFF 1UG9A 3K74B 3RL2B 4FG6C 1KT2B 2X4QB 3CFBA 4QRQA 3MA7A 3B9EA 4ZS7L 3S4SA 4PR5A 1H3TA 1OCWL 2DYPA 1ZHKB 3MRBA 2D03L 5GSRB 5ICYB 3AMKA 3B2VL 3NIGF 1IGTB 2VH5H 1NDGB 4N9OB 5GS3A 2PETA 3NFSL 2GSIB 5BRZB 3T4AA 4UI2A 2HKFH 2YWYA 3KLHD 3TN0C 1KTRL 1INDH 2AK4A 2BC4A 4KHXH 2P7TA 4S2SB 2UYLA 5DI8A 4OD1H 3QUXB 1FJ1A 4M02A 4QOKD 4WY7H 3ZZ1A 4OZFB 4Z8FH 4ONOA 5KZCB 5C0AB 4EKXA 4PG2C 3MCLH 4POZD 1UACH 2Q8AH 3BN3B 5T3ZH 3LDBB 3MA9L 1S7RB 3VJ6A 3VU2A 3QDHA 5FGBC 4U1JB 4XNYL 3QISA 3BESR 4JR9H 1OW0C 3X11B 2PXYD 3SDXF 3WMSA 5CBAB 2P5WE 4GSDH 3CK0L 4F15B 4PRIE 2RIKA 2LV4A 5C0RL 5BZDB 3BWAB 3S37X 2C7UB 3G6DL 3TPKA 3U2SA 4PRPA 3MCG1 3OB0K 3LQAC 1C7SA 4LDEB 4DFIA 4ZFOL 1J0KA 4ODXA 2AJXL 2VXUH 4JANB 3MV9B 3X13B 1ORQB 5E2WL 1DBMH 3GJFK 4PS4L 3GFUA 5IVXA 1JF1B 5CEZD 5ICZA 3WV0A 2JB6A 3QH3B 1U8PB 2X4NB 4LARL 4U1LB 1IC5L 3HN3A 4AEIL 4XVTH 4YEFA 3MR9B 1HH6B 1C5CL 3D87B 4WEUD 4XMKH 1OAKH 4M7LL 1BGXL 4OZHB 5I1DB 1Z3GH 3SY0B 5IEHA 3IXTA 1FDLH 4LLAA 2J88H 1FRGL 3IS1X 4Y5VC 3WIFB 1S9YA 5FK9B 5KW9H 2HFTA 1YEIL 3A6BH 2CH8A 4Z78A 5HYQA 5I1CH 1AO7D 4M00A 4ODSL 3FO2B 4APQA 5MERB 1IILE 5EU6D 4LQFL 2W65B 1A6WL 3I02B 4KK5D 1T1YB 1IM9B 4ODTH 4ZS6C 2O5XH 2QJDA 4ZXBB 1CR9L 3ARFD 3TJHC 4PLNC 3MJ6A 4HT1L 1XAUA 3T0AA 4ZAKD 5C6TL 3PHSA 4EVNB 3LV3B 5EUOE 2AVGA 4YPJA 2EH7H 43C9A 4P5TA 3IKCB 4Z7QF 2WUCH 3SDDA 5D1ZB 4FABH 1PVHA 4JPWL 1NQBA 1C1EL 3UZEA 3MRDB 4PGCB 1CDBA 4R3SB 1H3GA 3WXVL 4FQXC 4QTIH 3O6MH 2IANE 5JPNB 5K59F 1F5WA 3KPRA 1S9VA 1YDPB 3DROB 3IGAB 5CLWA 3QR2A 1N5YL 2NTFA 3U0WL 5B21A 3RZWA 1FGNH 5DDHB 2XKNA 5HHOE 2K1MA 4NC0B 4MS8C 3T3MF 3C6SA 4MHHG 5TPWL 5IOPA 5CIPH 2VLKE 1CLZL 1F6LL 5K93A 5LJYH 4ZOCA 1IM3A 1JTTA 5KAQG 2CD0A 2ICCA 5HYJA 4U2YA 4BH7B 4OZ4A 1OPGH 5F7WC 1ZWIA 4HWBA 3VXUB 3SE9L 4YK4C 3VW3H 1G7LB 3NBNA 3NCMA 5ESAB 3KDMB 1LDPH 2R9HD 2VDPH 4KROD 1JK8A 5IF0A 4U1GC 2IAMC 2DQTH 5ELIA 4YC2B 1Z2KA 4HUXA 1EHXA 5FEBA 2I60H 1N7ML 4NJ9H 2J4WH 2X6MA 2MCPH 3SKOB 3SE4A 3FRPG 5H2BA 1PKQB 1BZ9B 3HPLA 3K4ZA 4MNHA 3U36A 4WFGE 3OKMB 1DBAL 4R4FH 4YAQB 4W70A 4Y5YA 4CU8A 4U6VL 5GRYA 1MQKL 5T3XD 3CVHL 1MLBA 2D7NA 4G80B 1E28A 1KG0B 5DHVA 1W8NA 1EV2E 2E7MA 2IH3B 3GJFA 3SDYL 3V52L 4M1GH 4GQ9L 3BKMH 5BRZD 1DVFB 4RISL 3FHAA 1FVDA 2ZUUA 4POYA 1U6AL 2JJUA 1HHHA 5J12C 2AEWA 1RK1B 1BX2B 4TSCL 3ZO0A 5J57B 4XAWH 4OF5A 1QVOA 3Q5OA 3EGSB 3MBEA 1CWVA 1VFBA 3QUXD 5KSAB 3TGXA 4XTRD 5H94B 5I18H 1JYWA 2UZIH 5KZCD 5C0AD 4LLUB 5D6DC 1MCHA 4U6XA 4H88L 5SWZD 4PJHE 35C8H 1B0WA 1AGCB 4JQXC 4PJCB 2COQA 1MFNA 5I66A 2V5MA 3QIUB 4X7EC 5J9PB 3ES6A 2VKWA 5GZNC 4QY8A 1JTPA 1BEYH 5JIHA 3JZ7A 2ZSVA 4MYWB 1SBSL 3RIAK 4AT6A 4CW1A 5GXBB 1YECL 4I5BA 1GH7A 4EUPG 1DEEB 3KPQA 1R5VB 3S98A 5HSFA 1KPRB 2HP4A 4I4WA 4OCNC 5KSBA 4HG4K 4M6MH 4QCIA 4IJ3C 4OLVH 3RPIB 4QRPA 4OGAC 2H1PH 3WL9A 1T2QH 1FSKC 2AEPL 4JO2L 3TIDA 1YPZA 2VL5B 2G75B 5DTFB 1DE4A 4GAYA 1PYWB 3CZJA 3IXAA 3RWJA 4EI5C 5FO7A 4EIZC 1MF2L 5GGVL 1I3GH 5FCSH 4D0DB 2LU4A 1IZKA 1EHNA 3IB4A 4XT1C 4M9OA 5EORH 5IV2A 2PYED 4RAUB 2F53B 3BAEH 2QHRL 3V5KB 3PE9A 4HK3N 5J8OA 1NC4B 5ILTL 4OM1L 2P8MB 3U4EB 2DQFA 4U1HB 5JW3L 2B0SH 3BXNB 2PR4L 2EEAA 3O2DA 1XF3A 3QJFB 1RURH 2NXYB 1LHZA 1RZIA 1L7TH 4YHPB 4YR6A 1A6UH 1L0YA 1KN2L 1IGJA 1TZGH 3LHPL 1AD0B 1MAMH 2B1HH 4ZXBD 5ICXA 2A6IB 2CGRL 4MMZC 3RWFA 5CGMA 5E8EB 5ID1B 4BZYA 3N85H 4OBSA 2R29L 1AGEA 1NFDA 4FQHA 1NANI 4N0UB 1NCNA 1A1MA 2JCCA 5D8JH 4L8CB 3KYNA 4XI5C 3C5SA 4XMPL 2YD8A 1H5BA 4FXKB 2HLAA 2F58L 1QSEB 5T1DH 2R0ZH 4OQTL 1EMTH 3SKJH 2DQJL 3DGCR 2FX9L 2Z8VC 5C3LD 2YD5A 4HEPG 5CSBA 3PWUA 3O8XC 5EU3A 5TE4H 1FYTA 4Z7VA 5DJ6A 4U1SB 3VXRA 3IJYB 1ZEAL 2AJ3B 1JUFA 3VI4E 3S8WA 4D9RE 2AP2A 4JFFB 4U6YB 5EBGA 2DI9A 5JO5A 2VJXA 4N1CA 3WUWA 5I75B 2QADC 1WCBA 4XVJL 1LNUA 2LVEA 1G9NH 3MACH 3NN8A 3ARDB 5E5RB 3IFLL 3PQYA 5EIVA 4L4JA 3MODL 4R96A 3RNQA 4O00A 3KPPB 5C0CE 3V4PL 3VXUD 2BVPA 3QBTB 3QI9B 5HDOA 3MXWL 5MP6H 3SE8H 1QACA 4DEPB 1JL8A 4PJBF 4X8JA 1BOGA 2DLEA 2Z31D 4YHKH 1MPAL 2VKXA 1HINL 3K81A 4UU9B 5BVPH 1YMME 1N64H 1UB6A 3C6LB 5D7KD 4EI6A 4O2CA 4PTUB 4H1LG 5AD0A 2W9DH 4ERSH 2HFFB 3RY6C 1CL7L 1U91B 1BIIB 3ZHDA 3KPMB 3U46A 3PWNA 1EEUA 4FFYH 4LASL 1MRCL 1ES0B 2GEEA 3WSQL 3TVMC 4PGDB 2ZG2A 3MNWB 4HDIB 3VFSA 1N6VA 2BHUA 4P4KD 4I0CC 3OKOA 5ABDE 3TBSA 4YXLH 1ED3A 2WM0A 3C5JB 4TSBH 1WAAE 3TBVA 4QYOB 1G6VK 5FCUL 4X6CF 1XFPA 4TVPD 5DYOA 1DVFD 4PLJD 4YBLB 2OYPA 4HIEA 3WDHA 5DJZB 1KPUA 2F54E 5IB4B 1MVUB 2PCPA 3UO1H 4MJIE 3VXSB 4BZ2H 4BFIB 1H15A 1BFTA 2C1OA 4HSQA 4IRZH 5CGYD 4QWWC 5KSAD 1WBYB 4YQXH 3DSFH 4ZFGL 3RUGA 1YNLH 1A6ZB 5CEYB 3RWIB 4XH2A 1RD6A 3HI5L 1SBBA 4WFED 3LN5B 1XR9B 3QUML 5F6IB 3GO1L 1FFOA 3Q48A 4Y2DA 3Q0HA 4YHNA 2NY3D 5DUML 4F37F 1WLHA 5BS0B 4JPKL 1PAMA 1Q0YL 4G9DB 4NNPL 1GJIA 3NIFE 4RX4A 1WIUA 1OLLA 4UQ2B 5D7LE 1IZJA 3RHWK 4Z77B 4NQVA 1MH5A 5LXGL 1QA9B 1B0RA 1YN7B 5IB3A 1J1PL 5SX5H 5I1AB 3DARA 2DQIL 5GGQL 2DDQH 3C8DA 1FNHA 1XIWB 1PZ5B 2W0FA 3OTTA 4LFHD 4MJ4A 1QKZL 3VGAC 3FO1A 4LSDA 1K8DB 2V2XB 2Y5TB 2ZCKL 4X6DB 4F7TB 4NUGH 3SDCB 4OKVB 4LVOB 2ICES 5DRNB 6FABL 2HKHL 2PTTB 1TFHA 3I6KB 5GJTH 3G5VA 5JW4Q 3LY6A 3BHBB 1J8KA 2I9LA 2HLFC 3D0VB 1H9VA 3KWWA 3LKPA 3QJHA 2F5AH 5E8PA 5F7FA 3UC0H 2DTMH 5IKCB 3QIBA 4JZOB 5JZ7C 4OIIH 1TCRA 5EIQA 3U82B 2KPNA 4X83A 5MHSD 1BAFL 3TEUA 1JMZA 1NCBL 3TBWA 2VE6B 5ANMB 3ILQD 4ZTOH 1NH6A 3FOLA 5CZVH 5A16A 1N26A 1NC4D 7CGTA 2VR5A 1OL0A 3KJ4B 2YKLH 2CIIB 2CRIA 4OLXH 1RIUH 2Z35B 3GRWL 5EOQH 3F7YA 1S7QA 2EDXA 3ARXA 5C9JB 2K7PA 3U9UB 5DGQA 3AFLA 1BREA 1JV5A 3RWHB 2L4OA 4XAKE 5B4MD 2HT4C 4KTEL 2KZWA 4HWBH 2V17L 2VLRE 3OJDA 5I76B 2NY0B 3BGFB 5FV2A 5BZWB 5EUKB 1G7MA 3BISA 2APWA 3L3JB 4LAJH 1FYHB 4O5LH 1JZ3A 1IQDA 1FO0B 1K5NB 1ZAGA 3FO9A 1AR1C 1A9EA 5H35B 2DWDA 1QSED 3PABB 1T7YA 5SWSE 4J3TA 4TTGA 3O3DA 2DOCA 4G42B 3HFMH 1C5DA 4BYHA 1A3LH 1MVFA 4Z95L 1U8LA 5C7XL 2FIKA 4PJFE 4JFFD 4M7LT 4U1KA 5CIPB 25C8L 4PPTA 5CFHA 1Q1JH 2GFBB 1ND0A 5IHUH 3QFDB 5EU5A 4WI3A 5C0GB 3OB0H 4PJAF 2GJ6E 4PJ8A 4XPFH 2R2HA 1I1RA 1HNFA 1ZT1B 4HS8H 4MCZA 4XPBL 5DHVH 2R1YB 4PJIB 3ULUL 5E4EC 3GJFH 4K8RD 1KEMH 1PQZA 2FATH 5FFLA 1EFXD 4HKBA 5F9OL 1S5IH 4PB9H 4HIJB 5ESVB 2VAAA 3ZMRA 1DBKH 4KY1H 3KLHC 2NY1B 5TQ0H 4LKCA 1WGOA 1EO8H 4HFUH 4WUUD 2C5DC 2YPLA 3HE6B 4XPGL 3VXQB 3T0WA 4HUNB 3WNNA 3DRTA 3ORJA 3NA9L 3BW9B 3QDMB 2ZOKB 4PJEE 1DCLA 3C5ZB 4FNLL 1RZFL 3OGOE 4FTVA 4R90H 4POZC 3TV3L 1P6FA 3NPSB 3UTTE 4WV1B 4YNYB 3VFWA 4D9QD 4ZFFA 5DRWB 3EO0A 4IEFB 5FO9B 4HAFA 4OV6F 3WHXA 2UVEA 3H2WA 4I0PD 2OI9C 4JFOA 3LRSA 4XVSH 3F12B 1FZMB 3BEWA 2PXYC 4XPAL 6CGTA 3GM8A 1QFWM 3V0WL 3W0WB 2R0WH 5E6YA 3TA3C 3AREA 4K9EC 3QCUH 4CN6A 1SHMA 1NL0H 1G7IB 3D69B 4ZPTB 2V7NA 1ZHLB 3ARGD 2FL5B 3HRZA 5KOVC 4FXGA 3ULUE 3X3FL 3P0YH 3DETD 3VXSD 3GMPA 5AZ2H 4PFEA 1LGVA 3QEHB 3MLRL 1PG7H 2WIMA 1S7SA 3GSVB 3W9DB 2DKSA 4J4PA 1P7KB 4YZFE 4K94H 3EDKA 3T65B 3QHFH 5T3ZD 3UP1A 5L0QB 4ZUUA 1T89A 5FUOL 2F5BH 4QO1A 3FAWA 3BT2H 3IFNH 4XXCC 3MLVH 4CADA 5IR1B 5J4MA 5DUBA 3NCFB 1MY7A 4HKZB 1AFVL 1HHKA 3FQTA 4LLVB 4RGOL 4RIRB 3H3PL 5DJCB 3ZT6A 1F3RB 1L4IA 4M7KH 1M7IB 3NIGE 4I48A 1MCFA 4X4YB 3QEQD 1ORSB 3WD5H 4WU5A 4EBQL 2XWTA 4IDJL 3EFFB 2EC9T 5FYJU 1K4CB 3VXPB 5IQ7L 3R8QA 4XBPA 2QBWA 1LO2H 2BCKB 5J56B 3CMGA 1D5BB 2VLJA 1CK0L 1XIWD 3MV11 4DKFH 1AXSA 3O2DH 3P4OA 4O4YL 4QHUA 3HUJA 4KK5C 5HHXH 3K0WA 5HBBA 3ARFC 1UM4H 3QNXB 5CJ8A 4G8GA 4ZAKC 2C1PB 4X80H 3SDCD 2W9EH 1YEEH 2EIZA 3GMOA 5DA0B 2Y06H 4OB5H 2B5IC 3IF1A 4PGBA 1VHPA 3LRGA 5IB5A 3MRPB 2W0KA 1DDHB 1JHLL 2IPTH 4ETQB 1BP3B 3H42L 4IRJB 1LEGA 3DX7A 1KIUA 3EOTH 1J9CT 3FT2B 3O45A 4KRNA 5EPMB 4LLWA 1GGCH 3V6BR 1I1AD 4JQVA 5E9DE 4JPIB 1EDQA 4W4OA 5IMLB 2MQ3A 2I25N 4GBXD 4JHZA 2ORBL 5I0DA 2HVKA 3QNYA 1A6TA 3BZ4A 5D1QB 3MRNA 3IJHA 4GG8B 2B39A 1JYVA 1U8IB 1V7ML 4K3DL 3T4YB 1GVIA 4NM4H 1BMGA 2AXHA 5C3TA 4LRNL 3W2DL 2Z91A 3GIVA 2WQ8A 1TLKA 3O4LB 4NZTL 4XPTH 4CBPA 1JGEB 3V2AR 1XGRA 4MA7H 2R9HC 4KROC 3H9SA 4PRNA 5D2LA 1SM3H 3FN3A 2JB5H 1CCZA 5I1GH 4ZMAT 2VIRB 1YEGL 3MROB 3INUL 4OD3H 3AAZB 4GRLA 4GUPA 2KQMA 5EC1B 2BNUB 3FFCB 1XZ0A 3JWDH 3BH9A 4ODVH 2BVQB 5L88L 2Z4QB 1J1OL 1AKJD 2GUOA 3GSXA 3LB6D 3CFBB 4QRQB 3VH8B 2W60A 3WIIL 4MXQD 3ESVF 3S4SB 5GGVY 3S88H 5GJSH 4X7CC 5MENA 3IYLW 1F13A 2E7LA 1UXSB 4TTDD 3TO2A 1E6OH 3TZVA 3VWJA 1BZQK 4Z7QE 1F4YL 2KZ1B 1KXVC 1IC4L 5ALBL 5J6GA 2AK4B 2NY1D 5L2KA 1BECA 2XXCB 4DK6A 4IIQC 2IFGA 2UYLB 1BD2D 3HC0B 1SYVA 3HE6D 3V6FA 2Y36H 3CSBA 1DFBL 2D7QA 1KNOB 4HH9A 3QUXC 1S8DB 3WFBH 5K59E 3SPVA 4XTRC 3EDEA 4WO4A 4YDKL 3BWUC 3K46A 1XMWA 3QDMD 1MJ7H 4M7JH 2VDQL 4F2MA 5K9KB 3MFGB 4DVRH 2EDDA 3B83A 4OKDA 5FM8A 4UUJA 3W81A 5JDJA 5C92A 2V2TB 3LDBC 3R0MA 4XMLH 5DXWA 2GHWB 1VGEH 1IMHC 4OCXH 5AWNH 1KTKE 3O2VL 4NSKB 2PTVA 2Z93A 3DMMA 4HZAA 3OZ9H 4OZIA 4F15C 4EOWL 3U2SB 1SJEA 1CLCA 3L5WA 3WJLC 4ODXB 1HXMA 4OFKA 4LSPH 5IVXB 1C7TA 3JWOC 1NGYA 5C8JA 4U1IA 2JB6B 5LGHH 2ZNXA 4FQCL 3HA0A 1NGPH 1S78D 3LSOB 1AGFA 3VI3E 2B4CH 4U6HA 1KENL 4PTTB 4JB9L 2DL9A 4JY5H 4GW4A 1T04B 3IXTB 1GGIL 3BKYL 1U8QB 4LBEB 4JRYE 3MUZ1 2BHYA 4JEGB 4Z7UF 1S9YB 4ZOBA 3IU3A 1GIGH 1OTTD 4ELMA 4Z78B 5HYQB 3U48A 5GS2H 5F1OB 3PIQB 5HHVL 1RJYB 1IAII 2EECA 2C4FT 4E0RB 2BNRA 4NQED 4APQB 4TNWK 3VRLE 5HJ3A 4NQDE 5D5MB 2IMNA 3DXAA 1CDIA 3RVUD 3G04A 5C71A 5JOFA 4P2OA 4ZXBC 4QKXB 4Y19E 43C9B 1CD9B 4M8QA 3O9WA 4N8CH 3SDDB 3VXTA 1J1XL 4DVBB 2BVEA 4JY6A 2B1AH 2XXMB 3MXVH 1A14L 2CXKA 3BE1L 2XQBL 3RDTA 1JNHB 1CXKA 3CDGA 4IRJD 4HBCL 1QP1A 4KXZH 3KPRB 1S9VB 2Q7YB 1J0JA 2VN7A 1JIBA 1YMHA 1HWHB 1CFNB 2VDNL 5C09A 2NTFB 4ORGB 5F93C 5ECJE 1RZKL 1DSFL 3MCKA 3QDGE 5KVGH 4JKPH 1OSZB 2XKNB 4F3FA 5GRUL 4GMSL 4YFLF 2OR9L 2A9NL 3EOYG 2R69H 4HXBH 4M8VA 4KRLB 1WTGT 5EFIB 2DQEL 4CVUA 1CBVL 2VXSL 1MEXL 3PP3K 4PBWD 1RJZB 4QXTB 3I3EA 4JFDA 1IM3B 4L4TD 4Y4KA 3GB7B 3UJIL 5HYFA 5GIRB 3LKRB 1UQSB 4OZ4B 1KJ2B 3H7BA 2NY5L 5IW1A 2RHEA 1NBVH 3FONB 3O4LD 2JJSA 3BSZL 4DUVA 3BIBX 4OGYL 4UNTA 1HIML 2WBWB 4X4MA 5FDWA 1JK8B 2P5EA 2Z31C 5DRXA 3WHE1 3M8OH 5KS9A 4WW1B 5F1NB 5E1AB 4XCFH 3WKNA 2AEQL 4IS6A 4PRHA 1J18A 5TE7H 5LGKA 4YC2C 1Z6JT 5EZIH 1VA9A 1UC6A 1WCQA 3PXJA 5DR5L 5L6YL 1NAMB 1T0NB 4P23B 3QDJA 4KGJA 1HILA 5F3BB 4G7YH 4MNHB 1F42A 2CLVA 2VISB 4M9PA 2I24N 1ONQA 1WITA 3ZT5A 1GC1C 4NC2B 5AUMA 5E99H 3QSKB 4P4KC 1G7QA 5EZJA 2DYPD 4HKJA 4NN6C 5J6HA 3I50H 1MLBB 1E28B 1ACZA 1YA5A 1CTOA 1MCNA 3LQAL 3FKUS 3MREA 5E94B 4KMTH 3GJFB 5E2UL 4KI5F 2ZCHL 4FA8A 4WW2C 2V2WB 4EJ1C 1MIML 1DVFC 2DQGH 5EOTB 4PLJC 4DGYH 5A40E 2Y1VA 4NZUL 5IMKA 5GISH 2AK4D 5KVMC 4NM8L 2A74B 5MEQA 1CU4L 3VG0H 4NKDB 4WUKH 3MBEB 1VFBB 1BFVL 1I75A 5CGYC 4G6KH 3DUSB 4Y1AE 5TDNA 5KSAC 5E00A 3WS6A 4U6XB 1Q9KB 3T0DA 3ARBB 2A1WH 2BOCA 3GMNA 3O81A 5I66B 5I74C 3ES6B 5B39G 4QY8B 3KVQA 2NY3C 5HGGS 1YYLH 5DUPL 1WJ3A 5DZOA 4TSAH 1T1WB 4L3EA 4I9WE 4JDVA 4AT6B 4CW1B 4I5BB 1H3PH 4LSUL 4R2GB 2X42A 4G9FE 5C07A 2EXYD 1F11A 5C6WH 1NBYA 2OZ4A 4I4WB 4MD5A 5T1LB 5KSBB 1JZ6A 3F7VB 3TFKD 3LEVH 4PJBE 3RA7L 4PJ5E 3QULA 2IC2A 3FN0L 4PRPD 3HI6L 3MRCA 4JAMB 3TESA 1OSPL 1UYWL 4O51A 2YD9A 1A22B 3SBWA 3WFDL 4XP5L 5L9DH 1GOGA 1P7QB 4K7PH 4X5WA 1QBMH 2IFFL 1YPZB 1AQKH 4G7VH 4PIRF 3CFKA 5F21B 5JHDB 2EKSA 3IXAB 2D7MA 1IGCH 1Y6NR 2WBJA 3O11A 2HVJA 2P48B 4QHLB 1EAPA 4CMHC 3D0LB 3VWKB 5FGRA 5IJKC 4GW5A 1F4XH 3NCYP 5D2NE 1IQWH 1NMBL 3ILQC 2CUHA 2NX5B 4U7SA 3D3VB 4AEHL 5D1XB 5FM5O 3T0EE 1INQB 4X6CE 1HI6B 1FLRL 2FHCA 4FN0A 3B5GA 4Y8AA 1P6AB 4P5MB 4HGWB 3MLZH 4APQD 4QGYA 2OTUB 3LKOA 3QEUA 5F1SA 4L29A 2ZUWA 2NY4D 3CU7A 4FQQA 2A0LD 4WGVB 5A2FA 5B4MC 4W6XB 3RWFB 4P5TD 1OAZH 3SDDD 4OUOA 5HDQH 5A1AA 3R06B 3HZMA 1AGEB 1NFDB 1D9KB 3MOBL 4FQHB 3TJEL 1I9RL 1KPVA 4B7IA 1H5BB 3FQNB 2H3NB 3JVGA 3LOWA 5IGXL 2PW2B 2WAHA 5TDOA 3AY4A 1MFAL 2CPCA 3KPRD 3PWUB 2R2CA 4YHIB 1QYGL 4U31A 3T77B 5IFAH 1V3KA 2P5WA 3L7FA 4Q0XH 1WK0A 3QYCA 5JO5B 2XKSA 4HIIA 1XF4B 2FDBP 3DURA 1ZANH 2VDMH 4NKOB 4JKKA 2ZKHL 4G6AD 1RFDH 1LNUB 5I75C 1VFMA 2D7TH 1RZ8A 4ZDHA 4L9LB 2X4TA 3PQYB 4R9HA 3DHJA 1U95B 5HYJD 4IRSB 3RNQB 1ZT7A 3MRGA 3KJ6H 2ADIA 3P30H 4K8RC 2MPAL 1BOGB 4PG9B 2C3HA 2FZ3B 2VXQL 4JKMA 3MMEA 2N7BA 1UB6B 1DTUA 1JPGA 1IAIL 3S96A 4O2CB 4ZUWA 5AD0B 4EN3A 4NFDA 5EZLA 5D72H 1KIRB 1CFVL 4P4RB 4Y4FA 1VFAA 3UBXG 5F9WB 1T7ZA 5ID0A 4FS0A 2X1OA 4P5KA 3UPRA 3NH7H 1ZMYA 4JFHE 2A73A 4P46A 2E27H 3OKOB 3UYRH 2ZG3A 4OCWH 5IG7A 15C8L 2JCCF 4I0PC 1DQJB 1LO3L 1T2XA 4H25B 1IGYA 4GRMA 1QSZA 5IB2A 4KGLA 3TBVB 2YK1L 4PRAB 3H7LA 2CIKB 3MFFA 1JGDB 2X9YA 1T83C 5FYKH 2YD2A 1I7TA 3F6IA 4H20L 1A6VH 2NZIA 4KAQH 4Z7VF 3ARGC 3HNSH 2Y25A 4ZFOA 2BVOA 3NIDE 4JRXE 1FNEB 4BQBA 4X9GA 3BZDA 1H15B 5DFTA 2MKWA 1DL7L 3DETC 4PGZA 3WDIA 3QPQD 1KCVH 1YN6A 3MBED 3PXHA 4RNRA 2VDKL 4P3DA 5KVDH 2X4PA 5KJRH 3OKDA 2IANA 3OKNB 4XH2B 5ADPL 1J8HE 2NY2B 1AY1H 1HYRC 2APXA 1X5IA 4NHCH 1CGSH 1MCOH 1NCCH 3HMXL 1IGIL 4JVWA 4YHNB 5F6IC 1PDKA 1FNLA 4TUKH 5HHOA 4YE4H 3E6HB 3MUHL 2IEPA 4PJAE 2VLKA 2A38A 4N8VG 1XGUB 1KN4H 3SHSA 5DJXB 1MH5B 4DGVH 2VC2H 1B0RB 4K55A 3BDXA 1XCQA 3GSRA 5I6XB 5DD5L 4Z7OF 2G2RA 1P84K 5FGCB 4YFLI 1KSRA 4QRPD 1XIWC 4FQ1H 1ITCA 4YGAB 3FO1B 3DV4A 1IBGL 1WICA 1FVCB 5FUCC 4D8PA 1I3RA 4FFVD 1B4JH 2VTFA 3KYAA 4N1EA 5A3ID 3PWLB 3KPOB 3A6CL 3SDCC 2NTSP 1LK2A 1T22A 1BM3L 5GS0H 2QV2A 4UTAH 3BD5A 4HBQA 3O3BB 2OR7A 3TBTB 3KWWB 3LKPB 3E3QC 3QJHB 5E8PB 4N90D 4X99A 4HKXA 1OQOA 2X4UB 4OZFG 2V9QA 3BVNA 4CNIB 2JELL 1OP5K 3O41A 1I1AC 3TO4A 1PG7W 4PJ9B 4YHMH 4XBGA 1HDMB 5A16B 2OTWA 3KHOA 4L4VB 5CKGA 5CZXD 3T2NL 1AD9A 3DV6B 4GBXC 4RFOH 4OTXL 2WANA 3A67H 4N8PA 4MAYA 5I71B 3KJ4C 3RUGF 4BKLA 1JNNL 1NCAH 4M43L 1RUPH 4QGTA 1VDGA 3F7YB 1S7QB 1DQQA 1UZ6E 1EUTA 4E9LA 4X9BA 3N1PC 2UWEF 4Y2OA 3OJDB 1ZHBA 3RU8L 5ACZB 1A7PL 1A7OH 1KCRL 1HHIA 4KQ4H 1H0DB 1GZQA 2H45A 4AIZA 1D9KD 5E08L 3IDXH 4PJHA 4G3YL 1NAKH 3RY4A 5LQBL 4L8SB 3RWCA 1G84A 3PNWA 3H9YA 2VZ1A 1C5DB 1KELH 4AENB 3MLYH 2M1KA 1FYTD 2WWKT 1U8LB 3VXRD 2FIKB 2VR9A 5HY9A 2R2EA 3UJJL 4UT6L 4U1KB 1AP2B 4LP5A 3LB6C 2EDJA 5HD8D 5E2TH 4AQOA 1ND0B 1S7UB 4MWFA 5EU5B 4MXQC 2CLZB 3CVHA 1MCCA 3LH2L 4PJ8B 4JO1L 5MI0B 1ZHNA 1R3JA 5EU7C 4YJZL 3PQYD 4X0KA 4TTDC 5BXFB 4LK4A 5I1JH 4MD4B 1EEZA 4LPYA 4HKBB 2HG5A 2VAAB 4KDVA 3ZT7A 5FHBH 5EWIL 1A3RL 4XCNA 4N0YL 4UINL 1RMFL 4XNUL 5JHLH 2NY1C 1JGLL 1TTGA 2CR6A 3HE6C 5C0ND 3DRTB 1NFKA 3QHZL 3VXMB 2OTPA 3LKSB 2GTZB 1RU9H 3QO0A 3DVFA 4FTVB 2VWEE 1FG9C 3N9GH 1UCBL 3VFWB 4OCSH 4V1DE 4NWTL 4WV1C 2VZ3A 3SGKA 2ESVE 3EO0B 3AM8C 4NQTA 1QPXA 2DLFH 3WHXB 4LPWA 1DQLH 4JPVH 4POUB 3HAEA 1IGFH 3DJ9A 4LSTL 2RCSL 3RKDD 2OZ4H 3PHOB 3P0GB 3SQBA 4ODWB 3BKCH 1T66D 2FJHA 4QHKJ 1CTNA 4LSVL 5FM4A 2VXVL 4X4XB 2QQQA 2G5RA 3SE3C 3AROA 4ZNEE 2F9BT 1NGQL 2AKRA 3KYMA 5E2VL 3RX8A 3RI5K 3GMPB 3T1FA 1UM5L 2G60H 3MLUH 1B90A 4RCAA 5GSVB 4R4BA 2MQCA 5HVFB 2ERJB 5C9KA 3S6CA 1BJ8A 4TUOA 4NQSB 4QXGH 1LE9A 3ZE1E 1S78C 2AEIT 2RR3A 3WKML 4HWEH 1WBXB 3JTTA 1CE1L 4ZUUB 4HEME 5IVZB 5L0QC 1JHTB 1N8ZB 4WI6A 4Y2DD 2ARJA 4CADB 5K9OA 4XCYB 3ZL4H 2VERN 3GDBA 1HHKB 3P4NA 1UEMA 5I15L 4UDUB 4UNVA 3PP3H 1XGQA 4I48B 4RX4D 3VXOA 3VMPA 1LP9B 3ZDZF 3OKKB 1OTTC 1IKFH 5EZOH 2GSGA 4XBPB 5JR1L 3O0RH 4KDTC 2NNAA 2NMSA 2AGJH 3WJJA 5C0CA 4XNXL 3EO9H 4K23L 4P3CL 1SEBB 3P4OB 4QHUB 1ZLWK 2HFGH 1CIDA 3RVUC 4G8GB 1YMMA 1W72L 4PY7B 3U1SH 1P4BL 2EIZB 3GMOB 3IF1B 4PGBB 5BJTB 4GKZA 4M62H 2SEBA 3GSNL 4KMQA 1T5XA 1T21A 3U7WL 5KTEH 1QG3A 1FGVL 2CJUL 4FZ8L 2XTJE 4NZDA 1KFAH 4QXUH 3L1OL 5HI5D 1X5GA 1CDHA 3QIBD 5T1KA 4IRJC 5HYSA 4OQTA 5CEXA 5JPMB 2QQLL 1HHJB 4G5ZL 3FB5A 4V2CB 2OJZH 5FHAL 4AL8L 1ZGLA 5DMIL 4XBEH 5GS2D 5DJDB 1WAAA 1HQRB 3BZ4B 3CVIL 4X9IA 3MQIA 3IJHB 5DGRA 2E7BA 2Y4SA 5EC2A 1OARL 4ZS7H 3C60A 1OCWH 4MA3A 2F54A 5E8OA 3B2VH 3GIVB 4M93B 1YC8A 4ISVA 1NCDL 2FIRT 5DK2B 2WUBL 1SVZA 1UM6L 3N1QC 2Z8RA 1VEOA 2AQ3A 4LFHG 4TQEL 1E4KC 3JV6A 2XZQL 5D2LB 3MYJA 1T1ZA 1F6FB 1MIEL 2O61B 2ZCLL 1U9KA 1CLYH 3O6FA 4GUPB 3EJJX 4K3HA 4S1DD 5F9JB 2WNGA 2WSKA 2YN5A 3HUJF 1KC5H 3LQMA 3VDBA 4R6UA 5T5NF 3C09B 4NBXB 5SX4H 2BFVL 4ONHB 5D7LA 5EBMA 1S9KC 4R0LA 2ZNWA 1DLHA 4XNYH 2W60B 1YEJH 4XP4L 2IF7A 1M7DA 2Z92A 1G9NC 3LIZL 1MHEA 3AU1B 4PJ8D 1P1ZA 5K33A 5DC9B 4YIQB 3NCJL 1SJHA 4YHZH 3FRUA 3TZVB 3VWJB 1QEWA 3P9MB 3Q1SL 1UEYA 3DRQA 5C0RH 3G6DH 4NNXA 4XCEA 2FECI 1EEYA 2AJXH 4UILL 1CDUA 2YPLD 4HLZG 3V6FB 5E8NB 4WWKB 4HH9B 3WN5A 1GGTA 3SPVB 4TULH 4F2MB 4FTVD 4X6DF 1IC5H 4AEIH 5IHZA 1OF2A 1BJ1H 3VMNA 4UUJB 4CVZA 1YQVL 1C5CH 1WZMA 5DJYA 4M7LH 1BGXH 2IG2H 2VQ1A 1INEL 1YUHA 4RGNB 4GRWE 5L8LB 1P5VA 4XRCB 1HZHL 1FRGH 4LLQB 2IH1A 4LPXA 4Q9QL 2EXYC 1VADB 2Z93B 5D7JB 1CZ8H 1E4JA 3TFKC 5FYLL 3UROR 3VFTB 3ARED 1J05B 3REWB 4ODSH 2VLRA 2A6JB 2H8PA 1EK3A 1V7NL 3C2AH 1X9QA 2YMXL 1A6WH 4NRYA 5ALCL 2BSTA 4MXWL 1NGYB 4OT1L 1CR9H 3ZTNH 5C6TH 5HPOA 3CC5A 1AGFB 1OVZA 4RMUA 2ATPB 4HFWB 4JPWH 1W0WB 4U6HB 5SWSA 4DN3L 4J4PD 2WK2A 1YEDA 2Z8SA 2BOBB 3VD3A 4ZUSB 3D85A 3DHMA 2MWCA 1PSKL 2V9TA 3WXVH 1T4KA 5D93C 4C57C 4PJFA 5EULV 5IK3A 4DZBA 4OCYL 3LKQA 1BFOA 2ITDA 1AGBA 3EDDA 3QAZB 5CAYB 1N5YH 3B9KA 4PRDA 4FFZL 3G6JF 5JXAL 2GJ6A 3U0WH 2GKIA 3MJ7B 4HMDA 1NFIB 4ONFL 1AO7E 4ZD3L 4OF8A 5TPWH 2VLJD 5HJ3B 4NT6B 5HHMD 1CLZH 3RWDB 4APQC 1XGYH 4JZNA 1BJ1J 3KPNB 3DXAB 5EU6E 2XQYG 1S7VA 5HHNA 5JOFB 1KF9B 1R6VA 1D5XA 1A7RL 2NY4C 5FYLE 2A0LC 4G8GD 4MJ6B 2APTA 1ODAA 3BMVA 4P5TC 5FKPB 3VXTB 3V6ZA 3SDDC 4PJEA 1RJLA 4QT5A 4C59B 3TYGL 4OZIF 3RDTB 4NBZB 1NMAL 5ITFB 1TXKA 4KTDH 1DBJL 1EXUA 4LKXB 4HPOH 1AJ7H 3SOBL 3VFMB 1X5HA 3LCYA 4YDJA 3MJGX 3SDAB 1P69B 5I1IL 1FZJA 3OHXB 1SVCP 4WCYL 3EYOA 3L95A 3EUUA 3MOQA 2QSQA 3QFJE 1DBAH 1NJ9A 3U30B 4LRIA 4ZO7A 1OHQA 1WZ1L 4G6AC 1EEQA 3OXRA 2QTEA 4HMCA 1OM3L 3RNKA 2IBZX 3CVHH 3LEXA 4RBPK 4GG6B 2Y7QB 4U1MB 4C56E 3HNTL 4KJPD 3OGCB 3TWCL 4GQ9H 3TBYA 3V9FA 1ZLSL 2P5EB 2ZPKL 4N0FB 1U6AH 4ELMF 3H9SD 3I6LD 5KS9B 4YDLC 4U05A 1S9XB 5BO1L 4IS6B 4MA8H 3M07A 4H1LB 4FXLA 2ICWB 1Y18B 4MQXD 2R23A 5CP7A 2OP4H 5FGSA 1JWMA 3LEYL 2B7DT 3HZKB 5CJOH 3SE4C 1F02I 3H6JA 2XZCL 1P4IL 4UTBL 4RRPG 5CCKL 3ALWA 4BFGA 4GXVL 4Y5YC 5AUMB 1RI8A 1M05A 2MNUA 2ZWLT 5EZJB 1CFQA 3JV0A 5J6HB 2I07A 1G9ML 1YECH 5MEND 3MREB 3HAEH 7FABL 4KZEL 2HFEB 4J1UB 3TZVD 3VWJD 4JG1L 3ZHLA 3MRHA 1CXIA 5BRZE 4DUXA 2EYSB 1Z0MA 3BZFB 4CL7A 5ETUA 5L2KD 5CSGA 1QFWI 3C9NA 4IMKA 4NYLB 1A6PA 2AEPH 3QPQC 3L5IA 3MBEC 3I75B 5DJ8A 5E5MA 1F45A 5TDNB 1H3XA 5GRJH 1EBPA 5EO9A 5E00B 1BVZA 4WO4D 2VDLL 3SJVA 3L6FA 4I2XB 5IW6A 3AS0A 1OP5H 2BSSB 4JN2A 2AK1H 2BOCB 3GMNB 5E9DA 1X3DA 1MF2H 1NGWB 1LDSA 4P2RB 3OMZA 5IVNA 4MVBD 1MSPA 2QHRH 4RGND 1DN0A 5C07B 4PP1D 4WJ5A 5ISZA 1EHLL 4M5ZH 2FWOB 2H6PB 43CAB 1UWEH 4Z5RB 4OM1H 1FCGA 5BW7A 3DMMD 4KHTL 4DOHB 5FYKD 3O6LL 4U7KA 3MRCB 1F90L 3FB7B 2OR8A 1ETZB 2PR4H 5IP4A 4O51B 4YPGA 2FHBA 1LEIB 3N1FC 1FHGA 2P8PA 3MV9E 4FFVC 1GPOL 3TT3H 3CFKB 1XGPA 5A3IC 2CGRH 2EKSB 2VLLB 4P2QB 1J5OL 1P84J 1G0DA 3O11B 3HZVA 2HVJB 1I8LA 3ZKSD 4LP4A 4K94C 5EA0H 3HLAA 2LTQC 4PJDF 4QRTA 2F58H 2O93L 5FAAA 1AXTL 2W9LA 4OQTH 4TOYH 2VLMD 2FX9H 1IFHL 1R3KB 4NOFA 5CZXC 1ZEAH 4IMLA 4KV5F 3IRZA 4ZYKA 2BNRD 1E4XL 2DIBA 2ZOLA 2XRAL 2GYSA 4XVJH 3K2UL 2Y72A 3RTQA 5SV4A 3QEUB 5I1HL 3OX8A 3DXAD 2Y5EA 4FQQB 4PV8A 5KOMC 3IFLH 4MNQB 2J8HA 3GSUA 4P2OD 3WNLA 3MODH 1DQML 4UV4L 3V4PH 3IVKA 2AQ2A 2A6DB 3MXWH 3HMWL 5GS0D 2JF1A 2UY7A 1ZA6A 1MPAH 1UADC 2AJZA 3FCTA 3GSOA 1ZGLP 1D9KC 4I3RL 1A5FL 3RDTD 1H5BC 1UWXK 3BDYL 2JJTA 3JWNC 5IBLD 2R8SL 1I8KB 4LCUA 1GC1L 2GI7A 4ACPA 2GAZB 1VB9A 5C09D 1GCFA 3CLEL 1MRCH 2P5WB 5HI4D 3WSQH 4S1QL 3DURB 2VNCA 1KEGL 1Q9OA 2GTWB 4JDZB 5CJXA 1J0HA 3FJTA 4Y0GA 4GKOA 3P3YA 5D4QA 1RY7B 5HD8C 4Y5VB 1RZ8B 1DUZA 1KBGL 5AYUH 1BFSA 4TVPL 1I3UA 3GBNL 4JFDD 2X4TB 4S1SL 4Y4KD 1JYNA 1V8HA 1ZT7B 3MRGB 5FF6A 2ADIB 4LGSB 1KUMA 1F3JA 4JM2A 2EE9A 2P5ED 2VSCA 3MMEB 3C87A 5EOCL 2FEDD 2V5YA 1IAKA 1ACYL 1JPGB 1EHAA 4PRHD 4F80A 2C3VA 1BLNA 4Y89A 1LILA 5C0NC 4JFEB 2CLRA 5EZLB 4Y4FB 3L3HA 3MLSL 1QFHA 4ZFGH 5BVJA 1VFAB 3JWDC 4Z0XA 3QDJD 5AAMA 4JRYA 3HI5H 4FQXB 1PKQE 1EH9A 4JFXA 5DQ9B 1KCSL 3FT3A 4UIMA 5DUMH 4LHQB 4JFQA 4JPKH 4NWUH 1Q0YH 4NNPH 4ZSOE 1TVDA 2GJJA 4NQDA 4H5SA 2UWEE 1ZLWH 4UT9H 4TRPL 5FA3A 5LXGH 5TE6L 3RKDC 1KB9K 4DKEL 1I7TB 1NLDH 1QLRB 4TVPE 4Y19A 1T66C 1FVEA 4PGEB 2BVOB 3CGTA 1QKZH 2FD6L 4YK4B 5D5MF 4RNRB 2J8OA 2X4PB 3HNVL 2VYRE 3OKDB 4K7FB 6FABH 3JUYA 2OSLA 2JTDA 4U1GB 2HKHH 2IAMB 2EE6A 1Y0LA 3RGHA 5IIEB 3WO3B 1FAIL 4Z0BL 2DM2A 1A8JH 2CR3A 1RIVL 5TGBB 3QDGA 3T04D 3ARTA 1KGCD 1X5FA 4Y2DC 1PX4A 4X4ZA 2V5TA 4HUWA 2PYFB 4NCDA 1HQ4A 1BAFH 4L3ED 1IEHA 1NCBH 4JRWA 4JFPA 2EIBA 3V6OE 5C07D 3NFPB 1XCQB 3GSRB 1G7JA 1EBAA 2ARWA 1MFCL 3GMLB 3GHEL 2G2RB 5I6XC 3OXSA 4O58L 3S4SG 2DIJA 5TFSL 1FORL 1OTSD 3DV4B 3MRLB 3KPLB 3UTSB 5EH1A 3T0BA 3M1BA 3CU1A 3UAJC 2R1XB 4KTEH 2QKIA 1RUML 3A0OA 2V17H 4HS3B 1CFBA 1LK2B 4TN9A 5DHYA 1F8TL 2B4CC 5ACMA 1K8IA 1T7VA 4UMGA 3QG7L 3ARYA 4PJXB 2XZZA 1L6XA 1JF6A 4X99B 4HKXB 4AH2B 5HI5C 1TJHL 3QIBC 1S7TA 5EUOF 1ZTXH 2NYYD 1QRNB 4F37K 1QFWL 2LU7A 3ZYJA 2F53E 4XBGB 4RWYL 4A2LA 3FN9A 1AD9B 4DCQB 1TJIH 3LS5L 4M6NL 4WU7B 1N59B 1MI5A 3WNPA 5C7XH 5CJBA 1MWAB 4BKLB 2ZSWA 1UKSA 1LEKA 3MV7A 1CFSA 4O02L 4WNQB 5EB9A 4J6RL 4PRBA 5EBLB 2FGWL 2ZUYA 1KLGA 1ZHBB 5FUZH 4X5XA 3HR6A 5F9OH 2YBRA 3U6RA 4Y1AA 2WZPD 4AIZB 3NACH 4Y4HA 4QRRA 3X3GL 2XWJB 4XPGH 3TLRA 4N0UE 4FQIL 3NA9H 3MLXL 5DJ2A 1R0AL 2DLHA 4EI5B 1UVQB 4S1DC 1RZFH 2JK5B 2A6KA 2OQJA 5HGAA 3ULVF 3TNNA 3EO1B 4R7NA 1MCWW 5B8CA 2AJVL 4PJGB 5IESL 2P5WD 4YWGL 2BSRB 3T0XA 2D3VA 4TPRL 4MWFB 4J8RB 3CAFA 3DNKA 3CVHB 4PJBA 1L0XA 1NANH 1R3JB 4HULB 4PJ8C 4XPAH 4X0KB 3V0WH 1KTLB 4MQSB 1OP3K 5IHBA 3MUGA 3BIKA 3WUZA 4OD1L 4XCNB 2RFXA 4Z8FL 1WT5A 1J0ZA 3CSYA 4M61A 4BFEA 4C83B 4CJ0A 3CZFB 4XNMA 3QO0B 3S5LA 1MCWM 2QL1A 3U0PA 3MRQA 4EN3D 3MLRH 1CT8A 4Y4FD 3ZLQC 2DJSA 4LCWE 5D2NA 1FNSL 1JHKL 3OBAA 5HGBA 4H0GA 4D9QE 1NDMA 1S9WA 5DC0A 1CF8L 3MRIB 1I1FA 3T0EA 4M1CD 4BSVA 4X6CA 3DPBA 1KXTB 2M8XA 3O8XB 4DW2H 4P46D 1AFVH 4RGOH 3H3PH 4PJHF 3FO0L 4OF7A 1HHGA 1IC1A 2QADB 4PUBH 4EXPX 2AJUH 4EBQH 4IDJH 5F6HJ 5IQ7H 4A6YB 1RPQA 2FJHB 3AREC 1MCBA 5C86A 3V4UL 5LAXA 1CK0H 3KYMB 5JLZB 4O4YH 1CGWA 1D6VH 5I16B 1EUUA 3VXSE 3EYSL 4TUOB 1T5WA 4XMKL 2ERJC 1OAKL 2IAND 2BJML 1V3JA 3WS3A 5HVGB 4J4PC 3JTTB 3CCHB 1QLEL 4MCYA 1JHLH 4FMKA 2ARJB 3FT4A 4HQQL 5HHPB 3H42H 1T89C 5KW9L 3BI9X 4OZGF 5C0DA 3NZHH 5HHOD 1NKRA 5F9AC 3U0TA 5I1CL 1D6EB 1IC7L 4KJWD 2AV1B 4B50A 3TPUA 2YZ8A 3LN4A 2VLKD 3TVMB 5BS0E 4RBPH 4BSWB 3RVVD 1UJ3A 3SQOH 3ZKXC 4WENB 2ORBH 4H26A 5INCA 1MFDH 2NNAB 5C0CB 3TIEA 2KH2B 1J87A 5F7EL 1Q94A 1U8MA 1V7MH 1PJ9A 4UOW0 1FFRA 5FUCE 5TDPB 4HJ0D 4NZTH 1FO0L 3QQNA 4X6DE 3PWJA 4MDJB 1RQ5A 3O6ML 3LAFA 3DVIA 5T1KB 4WFGD 3TH2T 4YLQT 1F4WL 1FZOA 4Z76B 2N1KA 3VFPB 2YPVL 1GSMA 2BNQB 2V5RA 5LWYL 5IM7A 4JQVC 3TO4D 3O3EA 4NZRL 4W4OC 5ANME 4KVNH 5TH2B 3TM6A 1CD0A 1J1OH 3TF7C 4LGRB 1OPGL 2VZTA 3WFHA 3QQ3B 2R15A 3WIIH 3C60B 3VW3L 4CVWA 1OGTA 1LDPL 5E8OB 1UXWA 3VI4F 3MRFA 1OWRM 1CIUA 3OJ2C 4KJPC 4M93C 3W9EB 3QG6A 4LMQI 3VGAB 1F4YH 3JV6B 3OAUH 1IC4H 1T1ZB 3DVNB 5FECA 1JE6A 3NFNA 1PX3A 4UQ3B 1J8HA 2GW5A 5AYQA 4MQXC 5GRVK 3O6FB 3FQWA 5GGSA 4YBHA 4DTGL 1IEAB 4YDKH 2PTUA 1S7XA 1P4LA 4MJ5B 4Q97A 3G6JE 4MQTB 4PJAA 4ZPVA 1BQUA 5F71A 5EBMB 3UTZB 5SWQA 5I30H 3P40A 4Q2ZB 1U3YA 5DEFB 5JNYA 3RJDA 1U92A 1DLHB 2EDTA 1I1YB 3BQUA 1NCUA 4PGJA 1P1ZB 5C0JB 3O2VH 1NUDA 5HDLA 1SJHB 2DF3A 4NUJB 1CVRA 3FRUB 2E7LC 4JVUA 1OB1A 3DRQB 3V5DA 3TZVC 3VWJC 4PJIE 4XAWL 5C08B 4I18A 4HWZB 3WDJA 4XCEB 1EEYB 4AQ1B 5CD3B 3HI1A 2VABB 4AM0A 2FRGP 4MDIB 5SX4I 2ILLA 2XNAA 3GI8L 3VRIA 3OSKA 35C8L 4TVSa 3FZUD 4FQCH 2X4OA 5CS7A 4WO4C 1AR2A 5E7BA 1TQBC 3I84A 3QZWA 1KENH 5DVOA 4JB9H 5DJYB 3QXTA 5EU4A 4YHLH 3FQUA 3Q6GL 3BGMB 5IT2H 5JTWA 2EDYA 1YY8A 1GGIH 1HKFA 3BKYH 4NPYB 4RGNC 5I8CA 4PP1C 2I9TA 4YEEA 5FOBA 3ZE2E 3CFJA 1HEZA 4JG0L 5E6IA 1M1SA 1KIPA 5GGRA 32C2B 4HCRA 3S36L 5EDXA 3GUTA 3DMMC 3W0WE 1RVFH 3WUWG 4XHQA 3G5XA 3C08L 4XXDA 3NIFF 1K2DA 4NKMB 4NRYB 4O2EB 2BSTB 5E4EB 5B3JF 4JN1L 3F5WA 1UWXH 2CK0H 2YSSB 3Q5YA 5DVNA 4MLSA 5L7XL 5J1SC 1VCAA 4NO2B 1J1XH 1YEDB 8FABB 1QPPA 4OGXL 1I9IL 3UYPA 3D85B 5DLML 1CYGA 4QOKB 1BVKA 1A14H 3BP7B 3BE1H 2XQBH 1TZHA 4PJFB 4D9RD 3GMRB 3L3IB 5IK3B 1BFOB 3C2SA 2ITDB 3GJEA 2V7HA 2ZJSL 3VXNA 2R4SL 2VDNH 2B0SL 4BK5A 3B9KB 1RZKH 2GJ6B 1DSFH 4R4ND 4LF3A 1TZIB 1CI5A 1ZVSA 3DUUA 4GMSH 1T20A 4YDIH 5GS1A 4X6EA 1PBYA 2OR9H 2A9NH 3SEPA 5C0CD 1FL5B 2PXYB 2DD8L 1Y6MR 2DQEH 1CBVH 2VXSH 1MEXH 3PF2A 3FMGH 5HYIA 3KG5A 1ADQL 3TA3B 1KB5L 3TYFA 2H9GA 5CWSA 3N85L 4O2FA 1U41A 4ZUTB 3UJTL 1YMMD 2NY5H 4P2OC 3V7AE 4KJYA 3RWGA 2XPGA 5FOJA 3BSZH 2Y07H 4OGYH 4UB0L 1RJLB 5GS0C 1OAYL 4K3GA 4NQXB 3T2OA 2CDEA 3MNZA 1W0VB 4C4KT 5TE4L 3CUPA 3MJ8A 2AEQH 4ELKA 5T1KD 3RDTC 5TQ2L 2ESVA 3U7YL 5IBLC 2GK0A 2IPUK 2NLJB 5DR5H 1IT9L 5I8OH 5L6YH 3ZYOA 2ED7A 1FZJB 2GY5A 3EYOB 3ZDYE 2VQUA 4WEBL 1G9NL 1A02N 3O4OC 1NJ9B 5HI4C 3MACL 5JA9A 4LNRB 2FX8L 3S34L 1QR1B 3A6OA 3ILPB 3OXRB 5JW5A 4NN5B 1SJXA 3NAAH 1IARB 4NC1C 3RNKB 1ZE3C 5MP6L 3DBXB 3LEXB 1RUKL 4M6AA 4AYFA 3C60D 4LLYA 2NY6D 2F54D 4Y4KC 4ZNEA 2CRZA 3WFZA 4LVEA 5E2UH 3BP6A 1RZGA 2ZCHH 1VACA 1ZA3A 2DWEB 3D48R 3MUJA 1CDYA 2JJSC 1LD9A 2Q76B 3ARFB 4NZUH 5B22A 2FEDC 3O6KL 1PD6A 4NM8H 4ZAKB 4HIHA 2P8LA 1A9BA 5ERWA 1D3CA 2R23B 3IFPA 4FHBD 2D9CA 3RZCA 3O6FD 3QA3A 3P9LB 3UBXB 5I1LA 1NGZA 3OF6A 3FFCE 4MNGB 3L5HA 3SCMA 1TTFA 4GAJL 5D7LD 4D0BA 4KV5E 4TSBL 4N9GA 2DLIA 5EBWA 3SKNA 1CFQB 1NSNL 3DO7A 4XWGL 5DUPH 2YZ1A 2I07B 1HXYB 3MNVA 1K9TA 1A1NB 1LP9F 1UZ8A 5KSVA 1JN6A 1D7FA 3FN0H 1S5HA 1QNZL 3C9NB 1MUJA 1UYWH 1OTUD 3QRGL 4XP5H 3WFDH 2AK4E 1YNLL 1X5YA 1DQTA 1WWWX 1EJ6A 3GNML 5DSCA 3T2QA 5CD5D 5DJ8B 5EO9B 1CFTA 4OLZL 5HGDA 3SJVB 3L3OB 4NFCA 5IW6B 1OD7A 3WS6C 4K07A 1RUQL 2APVA 3SDXB 5CLTA 5K9JL 3ULUF 1LMKA 4Y88A 1GZPB 3BH8B 5CINL 4CAGA 1I8MA 4ODHH 3T1WA 1N3NB 3MOAH 1DN0B 2DDQL 5ISZB 1AC0A 4Q6IA 4B41A 4YHYC 4F7MA 1NMBH 2G9HA 4GS7C 3DUHA 4AEHH 4HV8A 4NNYA 1UT9A 3EIFA 1T3FA 1RUAL 5GPRA 2FYYB 2ENSA 5JORA 3LRHA 2IADB 2VLRD 4YPGB 3UTOA 3BUYB 1OTSC 3V0VA 5K9QI 3SBWC 3H0TB 3L3DA 1K6QL 4AG4H 5KAQF 2ATKA 2P8PB 4CVXB 1XGPB 4RZCB 3MLTA 2E3VA 1AQDB 4IIQB 5SWSD 4JE4B 2WBJC 4Z7UA 3TJEH 1RAMA 3D85D 1I9RH 4ZTOL 3SGEI 2X2YA 2APFA 5CZVL 3AS3A 4OAWB 1X44A 2NYYC 1J10A 5SWZB 3LQZA 2FX7H 5F7UA 2EDHA 3IDNA 1RIUL 4JLRA 4TNVF 2DQDH 1R3HA 3ARWA 3V7MA 4LMQE 1QYGH 4URTB 3B9KD 3MBXL 4IMLB 2GJ6D 5I8KH 5EO1A 3BEVB 4ZYKB 4KRMB 2P4AB 3FQXA 1OP3H 2ZKHH 1KJ2L 4X7TB 1OWWA 3DTXA 1M7XA 1T1XA 3IETB 3OX8B 3V5HA 2W0LA 1UFUA 3GSUB 5D5ME 3TA3D 1VFOA 4NO5A 2VQTA 5IQ9B 3ULSA 1XT5A 2MPAH 1MNUH 3OG4B 4LVNC 1ZA6B 3FB6B 2NXZB 3ARVA 2R56H 2VXQH 3GSOB 1NAML 3QXAA 1BVLA 1IAIH 4U0QB 3JVGC 4KKLD 2BY0A 4ZQKB 1D5MA 1KV3A 4PV9B 3FTGA 3AY4C 1I8IA 1CFVH 3PG2A 4N68A 3KPRE 3CX5K 2MMXA 4K3JH 1EGJL 3QO1A 3DYOA 2L0DA 2PYEB 3KYOA 5KVFL 3E6FA 4LSRH 4PLOB 5CMAA 4G43A 4DWHA 5DMKA 2FATL 4HJGA 3AUVA 1NCWL 15C8H 1Z9LA 2AI0L 3E0GA 2NR6D 2O5YH 4OUUA 4WTXA 5FF6B 3P4MB 1EO8L 5KSUA 1XH3B 3VMOA 3PDDA 1RULL 3H9HB 5DRZB 4WTZA 2HMID 3E2HB 4M48H 1CL7I 5MEOB 3IJSB 1H3VA 4R90L 1HOCA 3ULVL 4OBRA 4IOIA 2XG5A 2ED9A 2CLRB 2AV7A 4PP2B 2VMFA 2VDKH 4EN3C 2HJFA 5D7IF 5GHWH 5BVJB 4UZGA 4HPYH 2R2BB 4XXCA 4Y4FC 4JQIL 3NCBB 5ADPH 4CDHA 3VD9A 1A7NL 4XVSL 1A1OA 1I7RA 3I3DA 1IGIH 3OR7A 4M1CC 3FT3B 5B38A 3GGWA 3QWRA 4JFQB 4P46C 1ZKAA 1AO7A 2CDFB 2EYTB 1G1YA 1NL0L 1U8OA 3WE6A 1P9MA 3F58L 4H5SB 1D5ZA 4JO3L 4NQCA 5D9SB 5FA3B 4IHOA 1L9NA 4HCRH 1LQSR 1UA6L 1W2KT 2X05A 1H8SA 5AZ2L 3PGDA 2H26B 3K8LA 5BOZG 1PG7L 4I3SL 1IBGH 2LVCA 4MSWA 2D0FA 4Y8DC 4L8DA 5GZOD 1JPSL 3DIFA 4BH8A 4K94L 1N4XL 2UUDK 2Z31B 3PL6A 2OSLB 5MEPB 3KNBA 3SJVD 3BT2L 1Y0LB 3IFNL 3MLVL 3ULVE 1VFUA 1KTDA 4F7CB 2C3XA 5E9DD 2E9BA 1NC2A 3QDGB 4W68A 4JM2F 2AERT 2P24B 1CG9B 1XR8B 3QFJA 1IKNA 4HHAA 3VFVA 3IDJB 4ZO8A 4KJWC 3VI3F 3RX7A 1UB5A 1QQDA 1F2QA 5ISZD 5D70L 3IU4L 1Q72L 4DKFL 3RVVC 3QWQB 3T2NH 3O2DL 5I17A 4OTXH 4FQPA 4P4KB 5HHXL 4RQQA 4HUUB 4C56A 3EOBB 3GSWB 3AXLB 5KSBE 4M43H 4NN6B 2Q87A 2ICEA 1QBLL 5DEGA 2F74A 4GW1B 4R26L 1SYSB 4X6BB 2DJUA 1G1CA 5C0FA 4RFEA 4WW2B 2R39A 1BQLL 5FV1L 4HJ0C 2IPTL 3RU8H 1A7PH 5DHYB 5DF0A 1YNTB 3VRLF 4QF1A 4TUJA 5JHDE 1KCRH 2NPLX 4FQJL 3HG1B 1PW3A 1C16A 5E08H 3X14A 1PZUB 4G3YH 4N8VA 3U4AA 4RFNC 4NBYB 3OKEA 1IGMH 1BQHB 4LVHC 1KT2A 5I74B 3TO4C 3VE0A 2X4QA 5KVEL 1MI5B 1DLFH 2NY3B 2NX5E 2MTPA 3D3VE 5ICYA 5GSRA 4FFWD 2VZVA 4MAYC 5HGHB 1IGTA 1LEKB 1NDGA 3MV7B 4XC1H 2GSIA 3RTQD 3LH2H 1GAFH 4JO1H 3CX2A 4MA7L 3VD5A 3G5YA 3IDUA 4GMTL 4ZFZB 2JB5L 2WIIB 5I1GL 5T5FL 2YBRB 3MO1B 4S2SA 4Y1AB 2DB8A 4N0YH 4OD3L 4UINH 1RMFH 2D7OA 1C12B 1YY9D 1CQYA 2NXZD 4QRRB 3QNZB 5HVWA 3JWDL 4ODVL 4OZGE 4HS6A 4H8WH 1NBZA 1S7RA 2OQJB 4CMHB 3GBML 1FFNA 3DSNA 5ITBL 5B8CB 4NWTH 1CGYA 4MJ2A 2LQRA 1U3ZA 2VR4A 4EDWL 4LPCA 3ZSTA 4PJBB 2EYRA 2H2SD 5ESQB 3V8CA 2OK0H 5BZDA 3BWAA 4G8EB 2C7UA 4X9FA 5F7KC 2QSCL 4RAVA 3HC3L 4LSTH 1BBJA 2Q3ZA 2RCSH 3CFDA 5HHQB 1B9ZA 1YEFL 3MUGB 3BIKB 3MV9A 4NO3A 3X13A 1S3KH 4JM2D 5F6HI 2Y36L 1AXIB 4RMTA 4Y16A 3WFBL 4LSVH 2VXVH 3L5XH 3C8KB 3F62A 4KVCL 1MCIA 4MHHI 3QH3A 1MJ7L 4M7JL 1NGQH 3ZYIA 4WI7A 1UM5H 5CBEA 4DVRL 2EDFA 3S5LB 1EFQA 3MR9A 1HH6A 2XY2A 3MRQB 4RMVA 3U0PB 1OT1A 3FZUC 4K71C 3LPWA 2KUTA 3WKMH 4Q9RH 5D2NB 3VFRA 4JRYD 5BMFH 3SY0A 3QXWA 3SGKC 1IVLA 2AAVA 2X4RB 2H41A 4X6CB 3WIFA 3ECBA 4QRUB 3OZ9L 5I15H 5F8QC 2J8UF 1GOHA 3UTPE 4NQDD 3FO2A 3VGFA 2GITB 5MERA 1EERB 4HGKC 2W65A 2WINB 1T1YA 1IM9A 5DMYA 5JR1H 5FO8A 5LAXB 3HB3D 4Y19D 4XCCL 1JNLH 4K23H 1FNAA 4P3CH 4EVNA 2IMMA 3LV3A 1NGXA 3IKCA 3VFNB 5D1ZA 4N5ED 1EFXB 2Z8WC 2BRRH 4JY5L 4PGCA 2CDGB 4WUUB 2AXGB 5LBSL 4OLYL 3HRPA 3GSNH 1QBBA 1XGTB 1X4ZA 3FT4B 3DROA 1FGVH 5C0BE 3QDGD 4YGVB 4FZ8H 2YEZA 3L1OH 3U0TB 5J11B 1FLTX 5DDHA 3TPUB 5IFJA 2QQLH 3VCLB 1J0YA 4XX1G 4HLJA 5FHAH 4N0RA 3R8BB 4AL8H 1UJ3B 5DMIH 4R4NC 4JCMA 4H26B 5INCB 3KPTA 1KJVB 1EJOL 1U93B 2R0LL 2EZ0D 5CSZA 3TIEB 4I0PB 1KCLA 2VXTL 1DBBL 3RL1B 1U8MB 5FGCE 3BJ91 1GL4B 1FG2A 1Q0XL 4HJJL 3IT8D 5DD1L 4Y5XA 2B2XL 4JDTL 2PKDA 3KDMA 5ESAA 2NW3A 3DX9B 4MB4A 5E56A 3Q6FB 1WISA 2BDNH 3RVXD 1N0LA