1F4XH

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
216
Chain Sequence
EVQLEESGGGLVTPGGSLRLSCAASGYVFSTYDMSWVRQTPEKRLEWVAFISSGGGRTSYPDTVKGRFTISRDDAKNTLYLQMSSLQSEDTAMYYCTRHFYAVLDYWGRGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
total genus 44
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4xH01
4GRLC 2X4TB 4PB0L 1DFBL 1QEWB 1CD1A 4L8BB 4MQSB 5LWYH 3PF2A 2GYSA 4WW1B 4MDJA 2FJHB 3MMEA 1DQJA 5BVJA 1CGSH 2OZ4L 3PUCA 5E0QA 5JDJA 4QTHB 5HHPB 3CVHB 3UTTE 2ADFH 4LU5L 1JYXA 4OGYH 2FJGA 4UOW1 5FECB 3BKCL 2IBGA 5K9KB 3EYFB 1QACA 4OTXL 3CXHJ 4JZNA 5HYSB 3TYFB 3KPLB 1KXQE 3ZKNC 3HNTH 5EZIL 5D2LF 2J8UB 4W4NA 3QIUA 4BSVB 3U6RB 3WBDA 5DQDL 2R9HC 2XV6B 4LRNL 1KCUH 5IEHA 2K7QA 1N0LA 1MJ8L 3RQ3A 4LLQB 5GZND 2PW1B 3ZKQD 1OWRM 3BWAA 1HHGB 1FFPB 5ENWA 5D7SL 3WN5C 1RIVH 4D9QD 3F65A 4XPTL 1K2DB 2H2PD 5DDHB 3ZKMC 5L8LB 4KC3B 3V6OE 5KZCB 4PRNA 3MCLH 1A7PH 1CZ8L 5HHQB 5CLWA 5CINH 3S5LG 1NBVH 3U30C 4HUXA 2XN9B 3FT2B 3O8XA 3RVXD 1FORH 3GBNH 5C92A 3W2DL 3MGOB 3TP4A 1Q9OA 1YN7B 1JF5A 1I3GL 3TPKA 2HRLA 4I5BA 1CGUA 3GGWA 4J4PC 2RR3A 4OCXL 4OQTH 1E28A 1ZHLB 5CBAA 1SQ2N 5TDOB 1JZ3A 3TM6A 1IGFH 5L2KB 1MHHB 3T4AA 4Q6YA 4CN6A 4C59B 2L7JA 3C5JA 3HKFA 4R0LB 3QFDA 4HUKB 5E1AB 1T6VN 1I1CA 3ESVF 1D5BA 2ICEA 5E8PA 1H8SA 4ETQA 4JO4L 2WBJA 3UTZA 4B5EA 5H2BB 4X6BB 3C6LD 4I3SH 1JYVA 1NCCH 2VDOL 4IHOB 2HP4A 4IRJC 2DQHH 4M6OH 1GGCH 1ZSDA 3PWLA 1J05A 4JRWA 4RSVA 4P9HL 4J3VA 3QDGA 1W8OA 1FL6A 2EDJA 4F57H 1C5BL 1NPUA 3C5ZC 4LARH 1AR1C 3RX5A 3EO1A 5ESAB 4OFPA 4JAMB 4CVXA 2E3VA 1F3DJ 5KZCD 1NGQH 1BJ1H 2ZKHH 2RFXA 3VG9B 4LLUA 5KANI 2V9TA 4NNXB 4WCYL 1BFOA 2H9GB 1KTDB 2LVEA 3RHWK 2XN9D 2D7MA 5GJTL 3ZHKA 4PRIB 5F6HI 4UV4H 3LH2L 4LCWE 1CT8A 1YMMA 4Z76A 5JMRA 4ZUWA 1JNHB 1F8TH 1MNUH 1W72A 3CFJA 1H5BA 1AC0A 4RFOH 2YPLB 3L7FA 4QRQB 4RA0C 4Q0XH 2DJ4A 3E6HA 3EO9H 4LLDB 1KENH 4U1GC 1XF2B 4DGIH 3T0DA 1INQA 1S7SB 3MLUH 4MWFA 4MB5A 5DK0B 4TUOA 3ZTNL 35C8L 3KPMA 1NLBL 4R4BB 1HYSD 1JPSH 1XZ0B 3WHXB 1T5WB 5JIHA 3VXSE 4FFWC 2VYRE 1YQ2A 2D31B 2CRMA 4OM0L 5B4MD 2XA8H 4YO0A 1UJTA 3MV8E 3MFFA 1KNOB 4X4YA 1YZZA 4ONGH 3QJFA 5F21B 3KLHC 3OHXB 3F7RA 5K9QG 2B1AH 5DUPL 1AD9B 1RZ7L 5HYJA 3MLSL 5I1LB 4RMRA 3H9SD 4U3XA 2D3VA 3MRDA 4RQQA 3DX6B 5D7IE 1FZOB 5MENA 5CGYC 4J3XA 2JJVA 2VO5A 1JWUA 3VWKC 3W9EA 4NQEB 1FNAA 4L5FH 4KQ4H 1OM3H 3N85H 4JO3H 3F6LA 2XZCH 5I17B 4YHPB 3MJ8B 3MROB 1OAQH 1R5VA 2BOCB 3OWEA 4RMWA 4I2XE 3MV9E 4XWOC 3WNKA 1SMOA 4U1IB 4YFLF 2ZCKL 3T1WA 4X4XA 3V6FB 4NQXA 4PGDB 1FO0A 1ORQB 3KPPA 4P5TB 2BVOB 4ZOCA 3GMPA 2AJXH 3KYNB 1NGZB 3JWDL 3SDDC 4GLRH 4DKDC 4K94L 4NN7C 5T3ZD 3NAAH 1C5DA 1KBGL 3D3VA 2WUBL 2Z8RA 4QXUH 2P8LB 1NFDA 4OM1H 3S3PA 5KJRH 1RULH 5KVDH 4KGLA 2BVPB 2NY2C 4M6AA 2W59A 4K8RC 5HDBE 3O11A 2ZG3A 1WWAX 5DJ8B 4JFFE 5DO2C 4O2CB 4WENB 4ODXA 1CE6A 2FX9H 1WK0A 4C55A 3RFZC 4I77H 2VLRA 4G9FB 2CQVA 4NQSA 4P4RA 4XPGL 5E9DA 4MAYA 4RMVA 3PGFL 3RWDB 1BQLL 4S1SL 3MRFA 4DK6A 1XGRB 1ZA6B 3VGDA 4APQB 2EH8H 5JHDB 4KRPB 1BP3B 2OR9L 4RWHA 5IG7B 5FHAH 5LJYH 1RPQA 4R90L 4TVPL 2E7BA 4Q58C 1U8JA 4OZ4B 1KJMB 1SYVB 1SJEB 2EZ0D 5FYJL 3EDKA 3VRIA 1ZHKA 4ZSOE 5L88L 1IKFL 1YYML 5SX4I 1OAUH 3T04D 3D69A 4GS7C 4ODUA 4XNQA 1G7QA 3G9AB 1F4XH 2PETA 3NA4A 3ULUC 3NCFB 4NO0B 4KRMB 1CU4L 1TZHB 4TRPL 2DQFA 5TE4L 2YC1A 3H0TB 3MR9A 1T21B 4XHJD 4KKNA 5BVPL 4OIBA 1DE4B 5FUOL 4D0CA 1NFDF 3HUJB 1NC4A 4LMQE 1B4JH 2EDTA 1CK0H 1PG7H 2DQEH 2J88H 1RUPH 4ZS6D 2V7NB 4GBXA 1JPGB 4OLZL 3B6SA 1CG9B 4LP5A 4RISH 3ZE0F 4ZTPH 4U3CA 3OL2A 4XPBL 5IEKB 1E4WL 3SKMB 4AL8L 1QQDA 4LNRA 4X6DE 1UG9A 4G9FD 4L1HA 3AMKA 5FO9B 4JPIB 4WWKA 4JPWL 2UV3A 4Y4HB 1VPOL 2OX5A 3HZKB 2CLRA 1EJOH 1KLGA 2DLFH 3E8UH 4TVPE 1WWCA 4NIKB 4PRPE 4YK4B 5DJAB 5DZNA 5C0AE 3UDWC 4AYFA 5FYJE 4HDIA 4APQD 3PGDA 4E41B 1GZQA 3P0VL 1IAIH 4K23H 1X7QA 1UM6H 3FTGB 3K4DA 4HGMA 2VDLH 3H3BC 3IXAA 4M48L 5CUSH 1DDHA 2FBJH 3BIKB 2IQAB 3RWIB 2R2EA 3TIEB 1QLFB 4G43B 2BCKA 4ZUVA 4ENEC 1T7XA 3MRKB 3PHSA 4PB9L 2ZUYA 3UYRH 1UM5L 5GGRB 2CH8A 2V2WA 3CSBA 1J9CT 5CP7B 2G60L 1E4XL 5HI3C 1AGCA 4LPVA 1JE6A 4U2ZA 3DUUB 4JKWA 3CFDA 5DHYA 5FF6B 1OOAA 3S8WA 3FFDB 3I2CH 2HT3C 1EHNA 1QO3B 1I1YA 3PABB 1RIUH 2I5YH 3O81A 3O6LH 1NC2B 3WFCH 1R5WA 4P2QE 3WO4C 2VNCA 3QIBB 2VUOA 3AM8C 2H32B 3A6BL 3ROLB 3Q5YA 2WNGA 1BPVA 3DO7B 1C8PA 5C9JA 1AO7A 4G7YH 3EJZC 4Y4HD 4LIQL 3LIZL 3BGMB 4LHJB 4UT6H 3ZYZA 2MQCA 2O61B 3RX7A 1QFWM 4I4WA 2GI7A 4N8VB 3QUXA 3LEVH 1N5AA 4KHXH 1T5XA 4E41D 4Z7VA 4OD3L 3K81A 2A1WL 3IFNL 2A6IB 1AD0A 2H8PB 5IOPB 3CJJA 5AYQA 2YD5A 2EEDA 3RUGB 1MHEB 5CKGA 1MRFH 4RCAA 4K55A 1FC2D 1X5AA 4S1DD 2A9NH 3DXAB 1P84J 5DXWA 3ARBB 3LHPL 1F4HA 4PFEA 5DFWH 1SYSA 3SJVD 5JXEA 4CU8A 1TETL 1G7HA 3B43A 4I9WE 1W0VA 4R4ND 3FB5A 3RWJB 4EI6B 3F8UB 2HVJA 2CLZB 2VOTA 3UAJD 1AJ7L 1CF8H 4ZDHA 3UPAA 3B9KD 1MLBA 3L7EA 4Y5YA 3O3AB 5EZJA 4L9LA 5JIKA 2ESVB 4M4PA 4I48A 4ZS7H 3GSQB 3HE6A 5FCUH 2ICES 1JPTL 1CFSB 1NC2D 5AYUL 5LXGL 1HHJB 3QIBD 3VFMB 1T1WB 1AC6A 4HS3A 4YFLI 2XQYG 3JZ7A 3GJEB 2MNUA 3TBWA 4HGWB 1DLFL 3DHMA 2P47B 1HWGB 4JO2H 5IW1A 3P2TA 1N64H 2HJFA 2DLTA 1CICB 2OZ4A 3TJEH 1TZGH 1KEMH 2AKRB 4Z7VF 5LBSH 4PY7A 4PRHE 2IQ9H 4NKDB 1GJIA 4BUGA 1WCBA 3VXUB 4M8QA 4U6YB 1I1RA 5B21A 1JGLL 4ODSL 3OXRA 1A4KA 1W0YT 2DQGH 2NMSA 1J88A 3EDDA 3CVIL 3N9GH 5DVMA 3FFCD 3DXAD 4JREB 3ARBD 1ORSA 4U1LA 1T1YB 5D9SB 4AMKL 4FQXB 4NQCD 3MOBL 3WIFA 3EOAB 4OGXL 1Z0NA 2GITA 2NR6D 4M6ML 4ONFH 4HUWB 4G8GB 1OTUD 4QRTB 3MNWA 1LO4H 3KS0H 5DURD 4X7SH 2FB4H 1OGAB 4XHQA 4DWHA 3EGSB 4XPAL 2QKIB 3REWB 5I1HH 3CZJA 1T89C 5GSRB 1FL5A 3KNBA 1AE6H 3RVTD 3ARFC 5KSAB 4L8SB 4XP4L 4Y19D 2C3WA 4RA3A 4XMKL 3LZFH 2Q3AA 3DO3A 3JV4A 3D2UD 5CILL 1BAFL 3G6AB 2WIIB 4IOFD 5IROA 5JW3H 3GHBL 3HG1E 3FN0H 1INDH 6FABL 2W9LA 2B5IB 3K1DA 4RGNB 1MHPH 4G6AC 3V8CA 1CICD 4O9HL 5F1NA 2PYEB 1KJ3L 1YEEH 4Y4KA 1JHTA 1ED3B 4ALAL 3VXUD 2CRIA 1RZJL 1DUZB 1AFVH 2J5LB 1U93A 1ERNA 1DEEB 5HGBB 2QV2A 1N3NB 2ZSVA 1KULA 3SQBA 2ZPKL 3B5TA 4TUKL 4FQXD 1WFUA 5D2LB 4MCYB 4IOIA 1H0DB 1EAJA 4O5LL 4LSRL 1PBYA 4X5XA 1CIDA 1JMXA 3NH7H 4H88H 1A7NH 2WWMC 3I6LE 5IMKA 1AI1L 2CO6B 3U1SL 2DLHA 2MFNA 2EDBA 3MACH 3QULB 5TPWH 3CMGA 1A22B 1KT2B 4WV1C 5HHOE 4LLMA 1IAKA 3BVNB 4OCSH 2GSGA 5JNYB 3QZWB 4F15B 3VXSA 5ADOH 5KSAD 2V7HB 5K9JH 3QXWA 3MV8A 4MQ7B 1BD2E 1CR9H 1QYGH 3T2NL 4Z7UE 1P4IH 3OAUL 1WAAA 2A73B 3RDTC 5DVLA 3HMWH 5EZLA 3WIHL 4HLZG 4ZMAT 2IF7A 3WE6B 3MXVL 3T4YA 2BNQE 4M7ZB 2EXYC 2BY0A 4RGND 3GUTA 5D7IA 4PS4H 2O5XL 4Y5XA 3S35H 5DJCA 2PYED 4C56B 4R2GC 4PJFA 2EDQA 1QRKA 1JF6A 3OB0K 4KTDH 4ETYA 2YWYA 5DGRA 1GGBL 3QQ4B 3QWRA 1SMAA 3GK8H 5JTWA 3ARRA 4RBPK 3G08A 4WGVB 4LKCA 3KPNB 2VDQH 3VXMA 4Q7DA 4NYLB 3E2HB 1KJVA 5BV7H 1NDMA 2R15A 2P5EB 5EU5A 4NFBA 3CDFA 2J6EH 4AEFA 4YHNA 4PJAE 2EE6A 5DJYA 2ZG1A 4M6NH 1LE9A 5FO7B 3GDBA 5F3BA 5HGHA 2PCPB 5IT2H 5FOBA 3STZB 4XCYA 2VXVL 3KXFB 2EDDA 5FA4B 4PRNB 4XNUH 3PWJB 2Z0BA 3BKML 3U2SB 4R0LC 1OTTD 1ZGLA 1WAAF 3G5XA 5DEZA 3T3PF 4JFPA 1DUYA 4KH2A 3UBXA 1IEBB 1FNLA 3O8XB 4L3EE 5FYLD 2B4CC 4U6XA 4TTDC 1AY1L 5JPNA 3PV6B 4IRSA 1MJUL 1TITA 3AGVA 1NANH 1IC7L 4WVRA 4BA8A 1A6PA 1QHPA 2Z92B 1MCBA 1W8NA 4MJIE 4PJFF 1S9VB 3CZFB 4CMMB 2C4FU 1UCTA 4YZFF 4OD2B 4OAWA 3L3OB 4D3CL 5EOTA 2RJMA 2AS5M 5BO1H 1TJGH 4WUKH 1F4AA 2F54A 5AZEL 5DSCB 3QIUD 2FX8L 2UY6A 2P5ED 2AJVL 2D0GA 4QTIH 2APWA 4WFED 4UT9H 1MRDH 5I1CH 1CDGA 5E7BA 2WBWB 5CP3A 3BEVA 1G84A 3CX2A 3Q6GL 1MEXH 1TQBB 4XXDA 1U95B 3KXFD 3MLYH 3TVMA 4GKZB 2EXWC 3VFWA 5F89B 4JM4L 1UJ3B 2Z8WC 3L95B 4H26B 5JIIA 1KCRL 5GGQH 4DVRH 2XZAL 4ZTOH 3S97C 1GSMA 1H3XA 3O8XD 5FIEA 2YA2A 5D7JA 1GC1L 4X9BA 1OP5H 1OTSC 1YMMB 4X7CC 4NN5B 5I9QB 3NIGF 5IUSA 4X6DA 3QFJA 4P23A 1VFUA 1WTGT 4C57C 1A5FH 1T1ZA 3SE8L 4TNVK 4RIRA 2X4SA 5I15H 2W38A 2VXUH 2G9HA 1S3KH 1T4KB 4NZTH 4ONHA 1PG7W 3NMEA 4JKMA 1DBAH 5J1TC 3L3KB 3P11H 4MXQC 4LDOB 1H3PH 2HT2C 4N8VG 4QT5A 4EKXA 2P24A 3V0WH 2Z35B 2NW2A 3QO1B 3D0LB 1FP5A 1K4CA 5KANG 2RCSH 4LPYA 2G75B 5GRWA 2R2CA 2W9DL 3IDGA 3ZYIA 1N6VA 4F33B 5C0EA 2D7NA 1MFBH 3QA3B 1VGEH 5F7YC 2F8VA 4OZFA 4ZAKB 1X6NA 2EO9A 1UQSA 1Z5LA 2D7TH 2A74A 3OXSB 2I9TA 2XTJC 5I1DA 5MENB 2R1XA 4NZRL 2W91A 4AM0B 4P4KB 3AREA 2HT4C 1MI5A 1AGDA 1L4IA 2EKJA 4P5TC 5TFSH 3RI5F 3OV6A 4QOKE 1OAZL 4YDVB 4GMSH 1CD9B 3MBEB 1U6AL 1YMMD 1X4XA 3QUMB 4P9MH 4YC2B 1A6ZB 1VKXB 3QEUA 1BJ1J 1KGCD 5F8RC 2DQDH 3QXVA 3S96B 3B5HA 4R3SB 4RWYH 1RHFA 1FO0B 3SKOB 1WEJH 2EH7H 3O3EA 1CVSC 3C9NB 1A3LL 5I6XC 5IR1A 2BOBB 1X9QA 4M1GL 3GMPB 1IQWL 2OQJB 3MRJB 5EPMB 4X6EB 4D9LL 4RX4A 2EDLA 2OL3L 43CAA 4HFWA 4IMLB 1A02N 2E7CA 4MZ3A 3NFNB 3BZ4A 4DFIA 1NFDB 4P2RE 4KRLB 3WNMA 4Z7OF 4J8RB 3OJMB 1PFCA 3ZE1F 1AGEA 1RUKL 5D71L 1ZA3B 3RHWF 2RHEA 5HYJD 4KRPC 4ISVA 4UILL 1KCVL 3WD5H 7FABL 4RAUA 1BZ7B 3ULVH 1NCAH 2O5YL 3V6BR 4WHYG 5IW6B 1CE6B 5MEND 3VFTB 4LSVH 3GSNH 1CN4A 3O4OC 4MXVF 5D1XA 2V6HA 3GIZL 1FNEB 1C16A 3NOIA 4ZFGL 2GSIB 5IHUH 4KXZH 1F6AA 1NGXB 2E9WA 1GGIL 3I75B 3QNZB 5C8JA 3W82A 1QSFA 3WS6A 3U0WL 3W9DB 2IANA 3PWVB 5EFIA 3UTQA 3PWNA 4FQCH 1A14L 5A3ID 3HC3H 1J18A 1YDPB 25C8L 3SKNA 5JOPE 1U8JB 2AAVA 2BFVL 4OZHA 3MLZL 5DI8B 1P53A 5JW4R 4DW2H 1HN1A 5HPMA 4FRWA 4RRPA 5E8OA 4NC2B 2DTSA 3DRQB 5SX5K 4PRHA 2HN7A 2OTWA 4U7SA 1X5KA 5DEFA 1DN0A 4QNPE 5T1MA 4ZPVB 5CWSB 5C2UB 3MGTA 5EUOE 2EE2A 2ZNXA 2PUQT 3UJTH 3D3VD 4ZYKB 3NIDE 5FGBC 4OQ1A 4K7PL 2NZIA 4YK4C 3VD7A 4P2OA 3ROOB 5EN2A 2VLLA 1KXTB 1NBQA 2JIXA 4BFGA 1ONQA 3VH8A 5H37H 1WBYB 4BH7B 2P8MB 1MFEL 2AGJH 2UYLA 2H26A 2MOVA 4LNRB 1KIQA 4OZIB 3DURB 4IRZL 4G9DA 1ADQH 1CGTA 4KKCD 2VDRH 3QUKB 5IB5B 2CLRB 1KLGB 3FQXB 4M00A 5FM5O 3LV3A 5LGKA 3B2UC 3S4SB 3DETD 3V6ZB 1I9RL 1M7IA 1MHCA 4NQDE 1GZQB 2LAAA 3JV5A 1J1XL 5BV7B 1BGXH 1RSFA 2VZTA 1ES0B 4BZ2H 3P9MA 1Z9OA 3B83A 4GAFB 5JW4M 4OZHF 4UIMB 1I7TA 4QEGA 1LO2H 2R2EB 1P7QB 1D5XA 3GO1H 1MSPA 2FLRT 2BCKB 3D85A 4J1UB 5DA0B 2KL6A 3LCYA 1D5IH 1XR9B 3QPQC 2PO6C 5KSBB 4JM2A 4JHWH 3UBXI 4PD4K 1JYNA 3ULSB 4NC0B 1NC4D 2MSPA 2YPVH 3EYQD 5M7QA 1QVOB 1NFIA 5I1JL 3FQUB 2XZQL 1IJ9A 3ZO0A 4OIIL 4GBXD 5I16B 3CFKB 2YPKA 3CK0H 4Z7WE 4ODWA 3ESUF 3NN8B 4X6FA 5IBTH 4X0KA 5IMLB 1NAMH 4G8EA 1N7ML 5HHOA 5GRXG 1B2WH 1SJHA 1IMHC 3V5KA 4HXAL 1IGML 1LP9F 4JRYB 4M62L 3RVWC 2FDBP 3CXHK 2ID5A 5E6ZA 4HQQL 4Z7UA 2A6JA 2C3GA 4PGZA 4JKKA 5L9DL 5KSUB 2IH1A 2ATKB 3NTCH 2W0KA 1HCVA 1QFPA 4MA3A 1SJXA 5C0GA 5LQBH 3HFML 2AQ3A 3MRBB 3F5WB 5LVEA 1QHOA 1XIWB 4PY8J 2W07A 5KAQF 1N4XH 3MYJB 1AP2A 4HT1L 5E5RB 3QPXH 3GSVB 2B1HL 4OIAA 3TJHD 4FZ8L 3DIFA 2XQBH 2P5WE 3LEYH 4KJQC 2DI7A 3RVVD 4P3WA 2X40A 4FQHB 1FFOB 2HVJB 4TN9A 4CRPA 4JM2F 1G0XA 2ZUWA 2AK1H 3P0YH 4YXKL 5IKCA 5I8KL 5I8CB 5I74C 3WUWB 3ZLQC 3MLRH 1QFUL 4XBGB 5D93C 5E99H 5C0BE 1CDBA 4N0CC 1T3FA 4GKNB 1IM9B 2VB5A 4GQ9H 5D1QA 5DMJB 5KS9B 1AO7D 3QCVH 2ZZUT 1G6RH 3TBWB 3IDXH 3BX7C 3WIHA 1T03H 5EU4B 3T0VA 1KPUA 3PL6B 1HHKA 5CEYB 2L0DA 4JFYB 4OZGE 3QUXD 1RY7B 3QI9C 1X5LA 1M71A 2HJFB 1A6WH 1VFAB 3H3PH 3SKJH 5DWUL 2NYYD 3EW3B 4ZFZB 2I9LB 4YGVB 1I9IH 2XRAL 2YD3A 4YBQD 5JOFA 3PP4H 1WCBB 3O9WC 4M8QB 1II4E 1JPFA 4EIZC 1I7UB 5DS8A 1XIWD 2YZ8A 3WNLA 5C0CE 4JQIL 2CK0H 1Q0YH 1E6OH 4L8SC 5CZXC 4Y5VB 4FFVD 4U1SA 1X5GA 4MJIA 5JXED 4P49A 5D70L 5C6WH 5F7DA 5AUMA 2WINB 1AGBA 5IHZB 5GQBA 3IAPA 4AIXA 1U41A 5GJSL 4QWWD 4WY7L 4E42A 5I2IA 3O3BB 4ESKA 5KTEH 2HKFH 1O5DT 1JV5A 1JUFA 3U46B 4HKZA 1P9MC 4ZUTA 3HE6D 3WCYA 4OLUH 5DQJA 3QEQE 3OJ2C 2DQTH 2BDNL 1CLZL 4ZNCD 2ITCB 3INUH 3T0EC 1NGWB 2VIRA 3V4VH 4ZXBB 1AKJB 3BUYA 1MFAL 4NCC1 1MCEA 3U9PH 1EMTH 3D18A 3I6KA 3OPZH 1TZIB 1Q0XH 3VE0B 4G8IA 4MNQB 3EYSH 3F7PC 4MXWL 2BVQA 2A38A 3O4LB 3DMMA 1WC7B 2R29L 2XKSA 3LKSB 4PRDA 3WKMH 5I1AB 5F9WB 5GGSY 4KMTL 2AABL 3V4UL 3P9WB 2CRZA 3TLRA 3GSUB 3V5HA 2R4RL 2HFTA 2DQJH 4MB3A 3TZVB 1NCDH 4AZ8A 3OKOB 4PJCA 1EH9A 3M8OH 5TE6H 1TENA 5JHLL 3LKNB 2J4WH 3QRGL 2KKQA 1IC4H 4ZFOL 3KPRE 1CLYH 3IXTA 4P2YA 2BVTA 4M7ZC 1CDIA 3GSNB 4JVUA 3CLFL 2Q8AL 4LLMB 5E00B 3WFHB 3TNMB 3CH1B 4NT6A 1QA9A 5AG9A 1GOHA 1XGTB 2Z91A 1S5HA 4WTZA 4ZXBD 3E3QC 4OFIA 2VXTL 4PJ8B 3LEXA 4M7KL 3AU1B 1C1EL 4PLJC 2GK0A 4MNQD 4NWTL 4FTVE 3CCHA 4K2UL 3T4YB 4QXWA 5BRZA 3ZHDA 5ID1B 4DN3H 3V7AE 3ILQD 5EU3A 4JGMA 1P7KB 4JE4B 3P4MB 4X5LA 3UYOD 3GM0A 2GFBB 1HSBA 4ZNEA 4ZOAA 1QP1A 3BW9A 4QOKA 5GZOC 1IZKA 2X4NA 1OP9A 2XFXB 4QRRB 1HSAB 2GAZB 4PRBB 3VFUA 1RU9L 5DZOA 4CGTA 4R8WH 2BNUA 3TZVD 4J7RA 3TO4A 2D9QB 2A6DA 3IF1A 3G08B 4PJCF 2H6PA 3STLA 3TV3L 4DCQA 3RWFB 3LOWA 4WI8A 4KV5F 5IQ9A 1BVLB 3VXMB 1CS6A 3SDCC 3BP5B 4PJ9B 2V2XB 4ERSH 3L3IA 3PE9A 3BH8A 5J0BA 5ETUB 2R23B 3C8HA 4DKEH 2JE8A 1O7VA 1P2CB 5DJYB 3QHZL 1G9EA 5KBNC 3DV4B 4NUJA 3D39E 3SKUD 4RNRB 2F19L 4OBSA 1NAKL 4NM8H 1BIIA 2VR4A 5C09A 1PX4A 5ANMA 1IEAA 3GJFH 4PJ8D 4P59H 4NSKA 2DN7A 1JGVL 1QFOA 4FQLH 2IFFH 2D9CA 1OSZB 4XP5H 3UBXB 1DSFL 1RUAL 2BSED 4U6XB 5J3HC 1QBMH 1SM3H 5I1GL 4NZUL 5IVXF 4QCIA 1IARB 1T0MA 4BZ1L 1XF1A 3RKDC 5F3HA 3QDJA 4MMXC 4QXTA 4X83A 5DD6A 3SQOH 5GIRB 3R4DA 2XWTA 3HCVB 4KDWA 4QRRD 2Z4QB 1J0KA 3P4OA 4OAWB 4PGBA 4D0DB 1EXUB 3PHQB 4FHBD 2Y5TB 3EO0A 2YOCA 1UA6H 4AEHH 4YHYB 3BJLA 3DJ9A 3VXMD 3QG6B 4N5ED 4N9GA 4M8VA 1MLCA 2I07A 1JF1A 2DMKA 4KJYA 5GSVB 1CLCA 4XNMB 2OL3A 4HMDA 5I66A 1QFWH 1U8HB 2HFFB 3D48R 3S4SG 4QHNA 1RMFH 4XAKE 5CGMA 5CEZL 1WITA 3HMXH 1KG0A 3BZFB 4LVHC 4TNWK 5I9QC 3EFFB 4N0YH 5ITBL 4HW6A 1EEQA 5EORH 2V17H 1U58A 4U49A 5D1ZA 3TVMB 2N7BA 1RAMA 4HS8L 4YIQB 4I0PA 2NY7L 1U3HC 2MQ3A 3WJLC 1RK0A 2VAAB 5GRZA 2JJSC 4EN3C 2R1WA 3QDMA 1ZXQA 2GJ6E 4JDTH 2I60L 1EVUA 3CFEA 2EC9U 1J0HA 1EEYA 4IRSD 4LF3B 5I71C 4GRMB 5MI0B 3MLTB 3I85A 5JLZA 4WUUE 4JY4B 2YXMA 4OGAC 4HS6A 2IAMB 4Z6AT 4YPJA 1HKFA 1YNTA 4M5ZH 1XGPA 4YFDB 4XP6H 2DI9A 1RFDH 3RY5A 3SE4C 2X4SB 1HYRC 5HY9A 1G7JB 1KTRL 4LSPL 3IKKA 4ORGA 4ZAKC 5A2KH 2F54D 3DYMA 2ZOKB 1FIEA 3U7YH 4I0CC 2IMNA 3GMLA 4P4KC 3JXAA 5CSZB 3FO0H 4IEFB 1UWGH 3LQZA 5T33L 5HXMA 1GGYA 4QT5B 5I75C 4XVUC 3MBEC 2VN7A 4R9HA 1MVFA 5DJZB 3TNNA 4YC2C 1K4CB 3RWEB 4U6HA 4NRXA 4Q2ZA 2XNAA 3LN5A 2NPLX 5C0EB 5LCVH 3TVMD 3DBXA 1JZ2A 3R0MA 1QLRA 2E7HA 4PLNC 5FO8B 3W39B 5J1AB 5DJ6B 4FABH 3AREB 2CXKA 1D9KB 2J12B 5KVMC 5D7JD 2FX7L 2H1PH 3WEXB 4K07A 4CUCA 1FNFA 4Z7WA 3RWGB 3QUYA 1IGCH 3CDCA 4X7FC 1FSKC 1OCWH 3T0BA 3MBXL 4FXKA 1P84K 2VZVA 4A6YL 4ODHH 4YEEA 3NACH 3QFJD 3MUZ1 4P23D 4LVNC 1ZT4B 3HC0B 4OCWL 4YBLC 1D5MA 3F7YB 4Y2DA 3OKDA 3V2AR 3V5DB 3T8XA 2A6KA 3TBTB 3LS4H 3MJ6A 4PJDB 2CDGB 3EYUL 5A40E 3KGRA 1ZVHA 5EO1A 1PQZB 4MSWA 4XBEH 3SCMB 4Y0GA 2EE9A 4Y4FA 5I19H 2W0FB 1PKQB 1HH6B 1L6XA 2QSQA 4XP9H 3SDXE 3QEGH 4PP1C 3ARDC 5ISZE 1NGPL 4ZUUB 1FAKT 1ND0B 4LSQL 2GKIA 2YWZA 5HDOA 3O41A 4IDJL 4H0HB 1BFVH 2FECL 4Y1AE 1AGEB 1NCWH 5BS0E 4LLWA 1DBML 1T83A 2NY3B 1FH5L 4MGXA 4UZGA 4ISVB 2APVA 4YHML 1IT9H 2XIDA 5TQ0L 4RAUB 3FCTB 4G6KL 1LMKA 1W72H 4NQUA 2NZ9C 5CMAA 5ICZB 4E0RB 2D03H 4YQXL 1OF2B 2H3NB 4OFDA 3ARED 1MI5D 4W4OC 1MCLA 1D9KD 4X4ME 3BPNB 5C0BA 5E56A 2WMPA 1Y6KR 1FE8H 2X4RB 3UXFA 4TNVF 4ZUSB 1DP0A 4PV9B 4X7EC 1X4ZA 4U1JA 1YY9D 1P6FA 2FBOJ 3HNVL 2AXFA 4NJAL 4HWEL 1S7RB 4QXGL 3WKNA 1J7VR 1JZ7A 3VXRB 2AV1A 5HGAA 4XX1G 2QHLA 4JFOB 4OZGA 3WN5A 5IESH 1RVFL 3K4AA 4UB0L 1J8HB 4J23A 4WRLA 5IVZA 3SGDH 1B0RB 1E4KC 2FD6H 1YEGL 5HPMB 4Z7NE 5J6GB 5JZ7D 5E8OB 2X9YA 3I9GL 1RK1B 5JQ6H 1JPST 4M5YH 1Z3GH 4O4YH 5IJKC 2Q7NA 4DAGL 4XNXH 2FATL 3L5XH 1I1AC 1JTPA 4EI5A 5K59F 3HZVB 1FZMA 3VG0L 1G1YA 1N59B 2NCMA 4AIZA 3MCG1 1PY9A 4LGPB 5D7KE 4QHLA 1MFDL 3S36H 1SY6L 4JQVC 1DN2A 1HQRB 2R0LH 5BV7C 5GXBB 3UJJH 2DYPA 2NY6D 4GW1B 3VH8B 2WK2A 5EA0H 4JZJA 1CDCA 4J3WA 4HPYL 5BW7C 4UDTA 4CMHC 4M02A 4M7LH 5D1XD 3DV6B 4X8JB 3V0AC 3MV11 5EBMB 1V5JA 4H8WL 3VFPB 5GHWL 3H9YA 1LP9B 1KLUA 1DBBH 1JN6B 4JR9L 5B3JF 5HI5C 2R1YA 2X4OA 1HXMA 2ZOLA 1QSFD 4IRJA 3OAZK 1RURH 4NO5A 2IAND 5C2BL 3QNXB 3G6JA 3C5ZA 4WU5B 1J8HD 3WXWL 5I1KL 1U36A 3BD4A 3MRNA 2DAVA 5HGDA 3DUSA 3CVHL 5GGSA 5F7WC 1S7VA 4WNQA 5L8KB 4M93B 5SWZB 2EE3A 4LCUB 2ADGA 2HKHH 3IB4A 2W9EL 3NCJL 3MLWL 3TA3B 1P1ZB 1EUTA 4X6CB 1BZQK 5DD1H 5FYKU 5DK3A 2E9BA 4YNYB 5E7FA 4L8DB 4JFXB 5ILTL 3PQYB 3GJFB 2G2RA 2OTUA 4OF3A 3VFRA 4D9QE 5H35A 5FKAB 2AJ3A 1NGYB 1LK3H 1CBVL 5C08A 1P4BH 4KROB 3F12A 2JIXD 5T5FH 1T0PB 1ITCA 4UV7L 2HJLB 3RZWA 1DQQB 4MNHB 4Q97A 2MPAH 2AEPL 4PGEB 4X0KB 1KIRA 1E6JL 1LO3L 4XCNB 4YDKH 2PXYB 4G8EB 2V5YA 1V7NL 2FEEI 3LSOA 5E5MA 4GAJL 3WL9A 4DGVL 1SJHB 2VXQL 5CD5C 3V5KB 4BSJA 5INDB 3GSWA 4GXVH 2ADJA 1ZKAA 3IJYA 4B7LA 5JW5A 1R3HA 3H6JA 3BP6A 2FR4B 3KPQB 4FTVA 3LKPA 4WTWA 1R0AL 2IBBA 3G6JF 1RJZA 1YY8B 4HBCH 1F4YH 1FVEA 4NKMA 3M1BA 4QHKJ 3OKLB 3LKOB 3W81A 1BEYL 1AR2A 3D85D 1IC1A 1GZPA 4EZMA 3UBXG 2HG5B 2ZWLT 4EUPH 4BFBD 3TA3D 4PR5B 3VD9A 1UKSA 4JM2D 3BN9C 3SE9L 3ILPB 3PL6C 1I75A 1KPRA 4L3CB 3C87A 4ZFOA 3PQYD 1KB5L 3I02A 1KN2L 3KLAA 5GGTH 2MJWA 2Y6SC 4PUBH 4L4TB 5EO9A 2ZCLH 2YK1H 1RZ8A 3MXWL 2L7UA 3V52H 3ES6A 4QYOB 2QQNL 4PJIB 4LP4A 1R24A 3VGFA 1UVQB 4F7MB 5FXCH 2PXYD 4R4FL 4NO3A 2G5RA 4HJ0D 2XN9E 4B50A 4RZCA 2P7TA 4Y5VC 1MELA 3HR5B 2WLZA 2YSSA 4F2MA 1J1PH 3NCYP 3NA9L 3WJJC 3QXTA 4U1NA 4FP8H 3V9FA 5L2KE 3FQWA 4WEBH 1OAYH 32C2B 5AD0B 5F96H 4N0UA 5DS8B 4PRAB 1J10A 1MFCL 3DROB 4X4ZA 2E6QA 1D5ZB 2XTLA 3VD5A 5HVHB 3D9AH 4DKFH 2X70A 5SWQA 4MJ5B 3MODH 2R2HB 3C60B 3P73B 5ERWB 4BFIA 3RPIB 5AUMB 5D5ME 3AY4C 4N90D 5D72L 3I50H 4OLWL 2D4DA 2N7AA 4WGWB 5MEQA 3G5YA 3A67H 3S5LA 3C8KA 5BZWA 4C83A 4L4TD 3BN3B 4XGZB 5B38B 3JWOL 3LQAH 4NGHH 3NPSC 3KYOA 4EBQH 3DGGB 3LAFA 5GS3A 5JPMB 2EYTA 5DQJB 1RZFH 5EBWB 3H9SE 3VRLE 4CNIA 3ECBB 1R3LB 5ABDE 1ZAGA 1OARH 1Q1JH 5FOJA 2DICA 1K8DA 4U0RC 5EU7E 5KVEH 4UNUA 1H3TA 1BFSA 1FLRH 1BZ9A 4R7NB 3MRHA 1UB6B 3GSRA 2NTFB 5DVOA 3DI2B 3IDMA 3FT4B 5J12B 3ULVC 1PG7X 1CFTB 3DECA 5DJDA 5IVOA 1KSRA 1T7WA 1XR8B 4MDIA 1G7LB 3BEWB 3S88H 2XXCB 3VI4F 4YDLB 3F58H 3FO9A 1IBGL 5DFVC 4WUUA 5ALCH 1IGIL 4JVWA 1KN4H 1PLGH 2NY0B 4H20H 4UIKH 1RJLA 3IDJA 4PJCB 2FEDD 3QUZC 4DEPB 1ZHBA 5BOZG 5T3ZE 3RL1A 2NLJB 3MRGB 4HFUH 3DSFL 5FK9A 2CKNA 4JG0H 2DWEB 2WQ8A 1MCCA 4Q9BA 5IJVA 4YHOL 4JY6B 2ADIB 3ARZA 1MOEA 4FZEL 4GSDL 3UDWA 5D2NE 4AQ1B 3H42L 3KDMA 3SBWC 1CD0A 2OZ4H 4I8DA 1KCLA 3I6GA 3VCLA 3BP7B 2ITDB 4LU5H 2YD6A 4OKVB 5I8OL 5EBLB 3BKCH 2CKBH 3QO0A 1GYAA 1CGVA 4OTXH 5BRZB 1WWBX 5IVXB 1B9ZA 2E6JA 3PGCB 4YE4L 5C9KA 4PJ9C 4GRWF 3DMMD 5E6IB 3O2WL 3ULUF 1LILA 5IFAH 2NXZB 4G80B 4GT7A 1LK2B 5EZIH 2E27L 1FGNH 5K33A 4Z95L 5DR5L 3R8BB 1A9EA 5I0ZA 4LRNH 1N5YL 1S7WA 4GG8B 5HHXL 1QPXA 4QF1B 2AXHA 4RGOH 3IFLH 1S9YB 3RWHB 1A6UL 3FO2A 3OR6B 4H1LB 3QCUH 4DGYL 3A6OA 1OQXA 5JW4N 4MAUH 4L29A 2A6DB 5IF0B 4JGJA 4KHTH 1K6QL 3O0RH 4NBYB 5CJ8A 2H6PB 4YHZL 3DRTA 3IDIA 1NMBL 2F5AL 4GW5A 4OSUH 3CXDL 3V4PH 1DQLH 3KWWA 5FHBH 2M8XA 3HZMA 5J13C 1ACYL 3BH8B 2D4FA 5TGBA 1NCBL 1YN6A 1W2KT 4L3AA 1M1SA 4I18B 1KCSL 3K46A 4LCIL 3WFBL 1FIGL 4ZS6C 4ELMA 3PIQB 3T08A 4YH6A 3TFKD 1OPGL 4JFEB 4U4BA 1KELL 2IGFH 5GISL 4OCXH 2K3TA 5ANMB 1IEAB 5HYQA 1CVRA 4G9FE 4Y1AA 4FN0A 5BS0A 4DZBA 5ESVB 1Z0MA 2ATPA 3ZYOA 1CGSL 3L9RA 5BRZD 1G7MB 1TVHB 2D7PA 3HNSH 4Y16C 5F3HB 3QDJB 4FG6D 2DL9A 4A6YA 2FIKA 4JGUA 1KXVC 4X4MA 4QOKD 1S9XB 3N0PB 4HJGA 2VDOH 1JGDA 1FNGB 4JN1H 2HAZA 5C86A 3FZUC 3UPRA 5JR1L 3P4OB 1JNLH 4NUGH 4P9HH 3VH8G 4PGCA 3HNTL 1TVBA 3EO0B 1YNKH 2Q76A 4BQBA 3MUGA 1KCUL 3ALPA 4WU7B 1JWMA 5GRJH 5F88A 2R2BB 1CL7I 4H0IA 2I07B 3RWCB 3UYPA 4KJYB 3VJ6A 1UXSA 4WCYH 1ZWIB 1ZLUH 3HUJE 3TN0C 1BOGA 1YJDH 3D25B 4O2EB 1G7IB 5GJTH 5C0IB 1I4FA 3FB8B 1QPPA 1W0WA 3GFUA 3PHOA 3GBMH 3R1GH 1MCDA 4U33A 2AXGA 4ELMF 5KAQG 4M43H 5C09D 3S3SA 2VQUA 3MPCA 1NDGA 1EEZA 2D7QA 3SOBL 1FORL 4CVZA 4OFKA 5LAXB 4LHQB 2VQ1A 3IKCB 1ZMYA 2VR9A 5EIIA 1KTLA 2XWJA 4FQ2H 2FH8A 3CPLA 4PJGB 3ARYA 3NABL 4N0FB 4V1DA 2DDQL 4E41E 3GMQB 4U7MA 3MLVH 3QDJD 1LO0L 2LTQB 4RAVB 1YEDA 3L5WB 4OFVA 4OF6A 1CCZA 1XGPB 5KVFH 3IT8D 3EKCA 3VXNA 3LKQB 3PV7A 4G8FA 5HY9B 1CTOA 4XCEA 3P4LA 2XY2A 4I3SL 4LASH 3SJVE 3ARFA 3BKJL 4RFNB 4KK9D 2DQHL 5E70A 1BX2B 1GGCL 1IGJA 5DUPH 3RY4A 2VLKA 3MLSH 3L5JA 5GGRY 3RP1A 4F57L 4C4KO 4LARL 1HEZA 3VFSA 1EGJA 1HINL 1D7FA 3FRUB 3HAEB 2JKXA 2ZKHL 4KMQA 3JVGC 2JB5L 2XNAB 3LN5B 1PGRB 1DBJL 5D1ZD 1SY6A 3R06A 3LPFA 1AIFB 4I0PD 2NTSP 3O6FB 4WI2A 3JV6B 3T0AA 1MH5A 3P4NB 4OD1H 3QDMD 1MQ8A 3SCMC 1YEHL 1BIHA 5F7HA 1U8PA 3UTOA 4YR6A 1F8TL 3MC0A 2H2SD 2UZIL 3CC5B 3SY0B 3SGJA 1T0NA 2PTTB 3WDIA 3G5VA 3WIIL 4KZEH 4WW2A 2VXSL 4LSTL 2X4TA 2HTLD 2EC8A 1KJ2H 3EO9L 1KENL 2X10A 4L8BA 5DD3H 2V5SA 4DGIL 3RNQB 4EVNB 4M3JA 5IQ7L 1OGTA 1VERA 4PJBB 3RUGE 2OTPA 4WW1A 1A2YB 1FG2B 2FJHA 2WUBH 2NY3C 4WDIB 4BSWB 5CP3H 3FFCE 3DXAE 2K9UA 2ORBH 4QTHA 5EO1B 1MCHA 5HHPA 3CVHA 4KU1A 1A1NB 2P44B 3RZCC 5FECA 5K9KA 3LDBC 4MJ2A 5EO0A 4NQCE 2XA8L 3EYFA 3KYMB 2E8YA 5HYSA 4K3JL 1U92B 4ONGL 2JJTA 2JELH 2Q1EA 4GRLB 4YUEL 3DX8B 5L0QB 1F45A 3PP3H 4HHAB 3ZZ1A 2B1AL 2J8UA 3U6RA 4BSVA 4F3FB 2VQTA 5M95B 1WIOA 3O41B 4XPGH 2VL5B 1X4YA 3S34H 4LLQA 1BQLH 2PW1A 3Q1SH 4S1SH 4Y19E 5L2JA 2DQCL 1HHGA 1FFPA 3EUUA 4E5XB 1QTYT 3UTTB 1K2DA 2BHUA 4W70A 5DDHA 4L5FL 3QAZC 1LEKB 2OR9H 4TVPH 1A1OB 4P46B 4OV5B 1OM3L 3N85L 4JO3L 4W68A 4OV6F 1EZVY 5FYJH 5HHQA 4X9HA 2OXGA 4CW1B 4UBDD 1QD0A 1IKFH 2XN9A 3FT2A 2K7PA 3V8OA 4X5WB 5T1KB 5B38G 1JYWA 4Z0BL 3VXUE 1CU4H 2FWOB 3U83A 1M7XA 4WTXA 1PVHA 2AJXL 2FGZA 5FUOH 1ZHLA 1MRCL 4Y4FD 3HC4L 5L2KA 1MHHA 4XWGH 3KPSA 3PDOB 3NAAL 5DMYA 4R0LA 5HYEA 5E03A 3OG6B 4OZFH 4QXUL 3U30B 4OM1L 5E1AA 5KJRL 1RULL 4GRLD 4XPBH 1J0IA 3BXNB 1E4WH 3H9ZA 4MJ6B 3PXHA 5H2BA 1KB5A 3IRPX 4X6BA 4AIZB 2J8UF 4HBQA 1ZLVH 2X1QA 2QSCH 3FL7A 3ZKXB 2CKBB 4BELD 3ORJA 2CDFB 2FX9L 4U6VH 3BT2H 1PJ9A 2DYPB 3C08L 5J89A 2QSVA 4N1EA 5ESAA 2BSRB 4JANB 4ZD3L 4UDTB 4ORZC 4PLKC 3ELAT 3X12B 4M93C 1RUQH 5DFTA 1KLUB 4NNXA 5JMOC 4RGNE 2H9GA 1KTDA 3LMJL 2IMMA 2R9HD 3QH3B 2Z8SA 2X4OB 2PYEE 4PRIA 5T1KD 5FHAL 3OBAA 4HG4J 4PB9H 1AGFA 5E4EB 1ZVSB 5FYKD 3G6JB 1AHWC 1E4XH 4KROC 1JNHA 1OAXH 4EQ3A 1I1FA 1K8IB 1OAUL 3OAYH 1Q9LB 2VZ3A 2VL4A 4F9LC 5LGJB 1R5IB 3BH9B 1S78C 4WTZG 3ZKMD 3A0OA 2YPLA 1BQUA 4QRQA 5D2LE 2X9WA 2XY1A 5GS0L 2LABA 3CUPB 1XF2A 3GHEL 1S7SA 3VWJB 3IAGC 4HH9B 5DK0A 2NX5A 1CK0L 4PJHF 2J88L 4R4BA 1PY4A 3VFRB 2OTUB 2YD8A 1XZ0A 1T22B 3WHXA 3WNOA 4J3OC 3EZ8A 1T5WA 4K3HA 4LCWB 4RISL 4I3RL 4ZTPL 4LEXH 2X1OA 3O45B 5DD5H 5MHSE 5CZKA 3V0VB 1KNOA 2DYPD 4H1LG 4LPXA 1TIUA 3OHXA 4NP4H 4OD3H 2AV7B 1EJ6A 1AD9A 5TJWK 5FYLE 2DLFL 3E8UL 5DMKB 5I1LA 2AJZB 2VSCA 3F7VB 3DX6A 4EDXB 4G5ZL 1FZOA 5HDLA 3MV7B 1IAIL 3LHPH 4C56E 3X3FL 2C1OB 4IMKA 4F9PC 4IRJD 3AUVA 1WVZA 1KC5H 2W92A 5CUSL 3VW3L 1R3HB 4NQEA 2FBJL 1I8KB 3C5ZD 1AR1D 1RJZB 2EEBA 3C8DA 4YHIB 2OP4H 4F58L 3B3IB 4XH2B 3K0WA 5I17A 4YHPA 3MJ8A 3UYRL 5KOMC 2DKUA 4FQPA 2FL5B 3PDDA 4WFFD 4U1IA 5GGVY 2P5EE 3V6FA 4LL9A 5J9PB 3DUHA 4PGDA 4GW4B 4F7TA 2XKUA 1ORQA 1L7IL 4WFEE 4P5TA 5J4MA 1Q9KB 5J11C 1KPRB 2BERA 5ACMA 2N4IA 3I2CL 3VWKB 3KYNA 3I02B 1NGZA 1VESA 5C08D 3KHQA 1RIUL 3O6LL 3VXQB 3WFCL 2VWEE 3RY6C 3KXFE 1Q94B 3FMGL 1JRHH 2P8LA 2HRPL 3DGCR 1VGKB 4Z18A 4G7YL 5DF0A 4TUJA 2BVPA 3MV9B 2P7TB 4UAOB 5HVHC 2HTKC 3N1GC 3C60C 3VU2A 5DJ8A 4GXUM 1I3UA 4HX1B 4KHXL 3RL2B 1JZ4A 2QL1A 3MV7D 3SDDB 4NN7B 4FFWD 4NKIH 4AMKH 5DRZB 3NFPA 3LKRB 3PWUB 3MOBH 3G9VA 3RWDA 4G6ML 1ODAA 2CGRL 2FH6A 3KLHD 2A9NL 1XGRA 1ZA6A 3J8F7 3PWPB 4NRZB 4APQA 5JHDA 1WT5A 3CFIC 5IG7A 1FJ1B 2WBJC 1KPVA 4JFFB 1KJMA 1SYVA 5T1DH 4XP4H 3TCLA 4XMKH 1DQMH 2P45B 2YR3A 5D7LB 3FQRB 1BLNA 1SEQH 3VWKD 3W5NA 5IBUB 4ZS7L 1J0YA 2ICCA 3GHBH 4XI5D 3CLEH 5FCUL 4Z8FH 4PREA 5J12C 1NMAL 4NO0A 1TZHA 1SEBB 1IGYA 3H0TA 1T21A 3BRGC 4P3CH 4BKLA 1DE4A 3C6SB 4HIEB 4O9HH 4JLRB 5BQ7B 1NEZB 1FNHA 4XWOD 4ALAH 2NY0C 2V7NA 1JPGA 1N64L 1CG9A 3H3KA 2VTFA 2Q8BL 3GSRB 4PG2C 4ZSOB 2Z31C 5IEKA 1YMME 3OX8B 3TJEL 4GS7B 1TZGL 1KEML 4GRWB 3SDDD 1QG3A 1FLTX 3SKMA 5LBSL 2DM7A 4CDGC 2IQ9L 1S5IH 2ZPKH 1J5OH 4Z9KB 3IU4H 5FO9A 4JPIA 4Y4HA 1H5BC 1KGCE 1ZLSH 2HA1A 3HZKA 4F7PB 4LSRH 12E8H 2DQGL 3QUML 3N9GL 1YECL 4HZAA 5DJAA 4KKAC 3PWPD 1F6LL 2NY2D 2LQRA 4LAQL 3O2VH 3LD8C 3FTGA 5DO2D 4ONFL 1T7ZA 3BIKA 2IQAA 5GS2H 2WWKT 3RWIA 3TIEA 4X7SL 1QLFA 3TH4T 3MRQB 5IJVB 2X4QB 3MRKA 3OKKA 5ICXB 5I1HL 1AXSA 1AE6L 5GGRA 1Z6JT 2NXZC 5CP7A 4GH7B 3MXVH 5HYJE 3LZFL 3WLWC 2GQHA 5C0AB 1EFQA 4JY5H 3DUUA 3CIQA 4XCFL 2O5XH 5FF6A 4S0TD 5MENE 4RMTA 2FLBT 1E27B 1REIA 3FFDA 3RU8H 1QO3A 4ODTH 4NC1E 2KPNA 3PABA 5CHNA 3Q3GA 3SDYH 4L9DA 1IL1B 3QO0B 1GCFA 2H32A 1YNLL 5E2TH 3ULUD 1YEEL 1GL4B 1G9MC 5DHXB 3ROLA 3HR6A 3MNZA 3VMPA 3DO7A 2UUDH 2PO6A 3RGVC 2YEZB 1I9JH 1MFNA 1MREH 4JG1H 3BGMA 5EOQL 4MQXC 1IVLA 1U8QB 5AWNH 3OKMB 1JHLH 5DRXB 5IOPA 1YYLH 3QWOB 3NH7L 3DRTB 3WO4B 1S9WB 3RUGA 3EHBC 2VXVH 4P2QB 1MHEA 5DHVH 2NY1B 3QP3A 1YEIL 5TPWL 3D3VE 4W81A 3DXAA 4KI5C 3ARBA 2QSTA 1NFDE 2GT9A 4OCSL 5A2FA 3SGKA 1CFBA 1DLHB 5IV2B 4KDTC 5ADOL 5CEZD 3TT1H 1PX3A 3MO1B 4EI6A 2CLZA 1CR9L 3ZE0E 1HKLL 1MJUH 2VKWA 4K71C 1IC7H 2AEQL 2DS4A 4MMZC 2ESVA 4HV8A 3GSQA 3S7GA 1P69B 2NXYB 4KK8C 3CFBB 4MAYC 4ENED 1HHJA 3VFMA 1T1WA 2E6PA 3S35L 1KIUA 3MRCB 3GJEA 4HK0B 3LQMA 1ZOXA 4HGWA 4U2YA 4HGKC 5AZEH 1RZIB 2BJML 5HI3D 2DQUH 1L6ZA 2FX8H 4P57B 3GK8L 2A77L 3LRGA 5KW9L 1CICA 4A2MA 2BY2A 2HT3D 3OJVC 5BV7L 2Q76B 4LGRB 2XWBB 3TBVB 3MUGB 2RIKA 3Q6GH 2LU3A 1A3RH 4NKDA 1WGOA 1MWAH 2XACC 3BESR 2XT1B 3NZHH 3VXUA 4U6YA 5HYFA 1B6UA 3VJ6B 4D0BA 3CSPA 4M3KB 3EJZD 1HI6B 1KCRH 1T1YA 4KUZL 5IT2L 4FQXA 5MP6H 3MSPA 1INEH 1Q72L 1WJ3A 2GJZB 3FN9A 4KKBC 3EOAA 5A43C 1GC1H 1M7DA 4UT7H 1HHHB 4XNUL 4FXLA 4YHLL 4HUWA 4KKLC 4G8GA 4QRTA 3MREA 2WUCH 2EDYA 2J2ZA 4PBWD 4PTTB 1BBJB 5LGHL 1OGAA 3EGSA 3O9WA 2QKIA 3ZTJG 2VUYA 1S7QA 5BS0D 1KACB 4WWKC 5KSAA 4L8SA 2XWJB 4RFNC 1AQKH 1XAUA 1A7QH 1BWMA 3NGBC 3T1FB 2V2TB 1MPAL 1UENA 2WIIA 3G6AA 5IFJB 5F9DC 3MA7A 4OLEA 3WXVL 4FXGA 4JHAH 3PJSB 1QNZL 1S7UB 1TJGL 4WUKL 2DJUA 2ZJSH 4G8FB 2PYEA 4Q6IC 3O6FC 1QOKA 3C09B 1ED3A 3SPVB 3ARFB 5DJ2B 1PD6A 4QTIL 4WI5A 3WDHA 2A83B 1DUZA 1K5NB 1UKQA 1BMGA 3CMOL 1DEEA 5HGBA 1N3NA 1WSST 3HG1B 4NZRH 2HFGL 4MCYA 1H0DA 4YBHA 4OKDA 2R0ZH 1ZANL 4JQXA 1OAZH 1AQDA 1P5UA 2XZZA 1U6AH 5GGQL 4HIIA 4D8PB 4RDQF 3QULA 1JL8A 2R4SL 4ZTOL 1KT2A 4XPHL 5JNYA 3QZWA 4RBPH 4HUNB 1AO7E 3NVQA 2DMBA 5EOCH 5T5NF 3VGAC 4UQ3B 2V7HA 4MQ7A 5DQ9A 4YGAB 2F15A 3LQAC 5HBBA 2IEPA 4CKVX 4V1DD 4NM4H 2F9BT 3QT2A 4XVTL 2A73A 1A5FL 3UCRA 4Z7VE 1A3LH 1UXWB 4M1GH 5L0QC 3TWCH 1EZVX 4LLYA 3WE6A 1IQWH 5I15L 5F44A 2VXUL 1S3KL 1OGTB 3JUYA 4NDMB 2F58L 4WV1B 4KVNL 1JMZA 4C56A 1OD7A 1M6OB 5HSFA 4JPKL 3ARFD 4MA8L 3P11L 1RUKH 1U8OB 5D71H 5EO0B 2VLKD 3QQ4A 4UILH 2OI9C 1KCVH 1L9MA 4GAGH 4LNVA 5DTFB 3J7HA 5EZOL 2EDHA 5DMIH 4P46C 3RDTB 3DLQR 1UEMA 2Z9TA 2RCSL 2UZXB 4K3DH 4Y5YC 3KPNA 4NYLA 3RIFF 4C58B 4L9LC 4BK4A 2FSEA 1MFBL 1UM4H 4ZFGH 4M9PA 1VGEL 4G6AD 3MRRB 1I8LA 2BNQB 2P5EA 2XKNB 4UDUB 4UUJB 4R2GB 4UNTA 5L2JB 4PYHA 2ARWA 5TFSL 3WV0A 5FO7A 2FCBA 2PCPA 3KYAA 4GMSL 3MRLB 3BQUB 3STZA 1BQHB 1SBSL 3KXFA 5ACZB 4P9ML 5FA4A 3V6OC 3PWJA 4AK1A 1RD6A 3MLZH 3U2SA 2IH3B 3ZDYF 3PG2A 4KK6C 4KAQL 2DQDL 5IBUG 3R8QA 4PBXA 1L0XA 1IEBA 5A2IH 5L8JB 4RWYL 2WWMD 4KMLB 1T66C 3PV6A 3ZKXC 1WEJL 4PJAB 3RI5K 2EH7L 2IALB 1XCQA 4MNGB 1PZ5B 2Z92A 4K7PH 1C7SA 4MA7L 1S9VA 3N1MC 3CZFA 1JZ6A 3HB3C 4CMMA 3KPSB 2N56A 3ZDXF 4KY1H 4OD2A 2B20A 3L3OA 3FOLB 4YXLH 4XB8A 1UFUA 3RDTD 4HWUA 2HLFC 4PJHB 3U7AA 4FS0A 5DSCA 1FV1A 4L3EB 1WZLA 1KB5B 2EXYD 1ACZA 4HUUB 5E8EB 1FRGH 5CBEB 5CIPB 3WD5L 4XX1E 3Q5OA 5GS1B 4R2GD 5E4EC 4GAYB 3RAJH 3GSNL 1YUHA 4V2CB 1OT1A 1I9RH 4QHMB 3UTSB 1RUMH 5IROC 5C6TH 4Z5RB 1A6VH 1U95A 4GKZA 4MNQE 2PYFB 5F89A 4HKXA 1UJ3A 3DVNB 3L95A 4H26A 3VWJC 1RJYB 1H3UA 3HC3L 4PJEA 1T20B 2CJUH 2IG2H 1U8LA 5F71A 4ZG1A 1EA9C 4Y4KC 5ESQB 1AGFB 5DHVB 4TVSa 1EDQA 3MLXH 4Z77B 1I1FB 1XGQB 1JZ8A 1GHFL 1MVUA 4PJ7A 3S37X 1N6QH 5L2KD 2V5RA 3KPSD 3UJTL 3WJLA 1YEFL 2JJSA 3A6CH 3Q0HA 3EOBA 1T4KA 4NFDA 2NX5B 4R96B 4P9HC 4U1MB 2AK4A 4TTDD 3FQTB 4QY8B 3L3KA 2X6MA 1RZKL 4KRNA 4HXAH 1IGMH 3QG7H 2Z35A 3MZGB 2AGJL 3QO1A 4HQQH 3D0LA 1F13A 1WAAE 2HFEA 5CZVL 3T3PE 3UTSD 2G75A 1ADQL 4F33A 2IADB 1YJDC 5E2JA 1UH2A 3QA3A 5D96C 4ZAKA 2K1MA 3OXSA 4HT1H 4AM0A 1T1XB 2W1NA 4P4KA 4PRID 1BGXL 4PJFE 4PJEF 4FZ8H 5EH1A 4BZ2L 5AG8A 1MWAB 2EIBA 2NY4C 4YDVA 4QRRE 2EKSA 3MBEA 4YZFE 1LO2L 3QUMA 3GO1L 1EFXA 1A6ZA 4YJZL 1VKXA 5I8KH 3RA7L 1EHXA 2YN3A 4PJ7F 2HH0H 2YPLD 1QFUH 3S96A 3IVKA 2EXWD 3VXME 4R3SA 4JHWL 3D5OF 4MLIA 4UAOC 1CXLA 4KJWC 2XTJB 3C2AH 3QXAB 4F7TB 2Y1VA 5TQ2L 3SKOA 2NX5D 3C9NA 2BOBA 1OTSD 1DQDH 4AT6B 3BAEL 2OQJA 2J8HA 3MRJA 5EPMA 4X6EA 3UO1L 3CK0L 4DVBB 1OD9A 5IBTL 4IMLA 1NAML 5L7XL 2XYCA 3NFNA 3K2UL 2QQKH 1OAKH 4J8RA 3OR7B 2GIYA 1B2WL 4TUJB 5FDWB 5T3XD 3AVEA 4O02L 4LCCB 1ZA3A 4WFHD 4M7LT 1MAMH 5E08L 4NBZB 1GPOL 1MAKA 1YMHB 4GO6B 2EC9T 1BZ7A 4GLRI 2C3HA 3VFVB 5I6XB 5IW6A 1TTUA 5E94B 3VFTA 3HHRB 3NIGE 5F1KC 4J3UA 2VDPH 1FNEA 3NTCL 5SWSB 4MXQD 5D70H 2HT2D 3NFPB 3T2OA 5LQBL 4NQED 5DVKA 2GSIA 1NGXA 3OGCB 1N4XL 4N9OB 3VI3F 3QPXL 3I75A 2VITA 3QNZA 3W9DA 3PWVA 3TF7C 2X1PA 2F54E 3LEYL 4F7CB 1YDPA 1HOCB 5EWIL 1KPVB 4WHTB 1SVCP 5DI8A 1J87A 2XTJD 2BDNH 1CLZH 5KN5B 4JFDB 2B0SL 3TCLB 3O4OB 2HT4D 4P5TD 2D7OA 4W4OA 3THMH 2DKSA 3CD4A 3DRQA 1BLNB 5E99L 5HHNB 5E5UB 5IW3A 4OCNC 4PREB 4S1RL 4ZPVA 5CWSA 4POYA 4DQOL 3U0TB 1VACB 1IGYB 4ZYKA 3ME0A 1FFNB 3GM8A 2EYSB 6CGTA 4BKLB 3AC0A 2R29H 2O26U 4JB9L 4TQEH 5DUBB 1TFHA 4WO4C 3ROOA 2EDWA 3IDXL 4XTRC 1PZUB 4KMTH 2AABH 4J3TA 1R3KB 3MLPA 1CWVA 2R8SL 2V5TA 1E4KA 3GJFK 2R4RH 1A6WL 1WBYA 5FUZH 3H3PL 3SKJL 3TBYB 4BH7A 1Y0LB 2P8MA 5ID0A 1TQCB 4G6JH 1I9IL 4JPVL 5SWSD 3X14B 3QFJE 4OZIA 3DURA 3PP4L 5J8OA 3S36X 2CLVB 3QXDB 3MJ7B 5GRUL 3QUKA 5IB5A 4HAGA 2CK0L 1PW3A 3FQXA 2BNRB 5K9OB 1MCPH 3CDYA 5HHMB 2FNBA 3S4SA 3V6ZA 5JHDD 5J56B 4KRPD 2BZDA 1T04A 4CL7A 1ES0A 4MD4B 5D8JH 5E8DL 1NCNA 4PY8I 4ZO7A 5BW7A 4UIMA 4JFDD 1P7QA 2HKFL 5F7MC 4WEMB 4Z7OE 4J1UA 3QQ3B 5FM4A 2VXTH 3OKKB 5KSVB 1AXSB 4OLUL 3ZE1E 1LO5B 1XR9A 4M7KH 4NO0D 5IBLC 1JTTA 5KSBA 1IAII 3VGGA 4HXBL 3ULSA 3INUL 3V4VL 3SE3C 3NIFF 4NQDB 5CJOH 3U9PL 5FA3A 1QVOA 2E7LA 4MXVE 3OPZL 3FQUA 1MI5E 2P49B 3EYSL 5I16A 5CHNB 3EYVB 1PYWA 3CFKA 5D6CB 3G5ZB 3Q3GB 1RU9H 5HVFB 5HYSG 3NN8A 4NZJA 4OJFH 2UY7A 1UZ6F 3WKML 5IMLA 1NMCB 2NY1C 5B3NA 1ZHNB 4IJ3C 2ZSWB 3MNZB 4GKSB 4JDVA 4OZIF 2PO6B 1VADB 4M61B 1UACL 3NBNA 1TTGA 4JRYA 2DQJL 1Q9WB 2MCG1 1EO7A 2UZYB 1NCDL 1PDKA 1T2QH 2BNRD 1QBAA 5HHMD 1A21A 3HE7B 2M1KA 2QR0B 4MJ4A 2OR7A 2RB8A 3M8OL 2PW2B 5KSUA 1LEGB 5TE6L 2UVEA 1PKQE 3WUZA 2ATKA 3QXUA 1IC4L 2C9AA 3QQ9C 1FCGA 1EHAA 1CLYL 5IM7A 4N8CH 3MRBA 3F5WA 1XIWA 1NAKH 2YN5A 2AQ1A 2NXYC 3MYJA 1F4WH 3GSVA 1JJUA 2I25N 4LPCA 2GT9B 1JZ5A 4UOW0 3MA9H 1JGVH 2BXZA 2R69H 4MVBC 2AJSL 3TO2B 1MJ7L 2XICA 5KSBF 4FQHA 1FFOA 4HUVA 4E9LA 3B2UD 4M7JH 4HKJB 2GCYA 4NZUH 1NEUA 4BZ1H 5GPRA 5I8CA 2NY6C 3WUWA 5H8DA 2Q86A 1A7RH 4XBGA 5EIQA 2BMKB 4HV8B 4J2XA 1DTUA 2MWCA 4DN3L 4GKNA 4LIQE 1IM9A 1QSVA 1TPXC 3VXTB 3BMWA 5KS9A 3QPQD 2PO6D 1QSFE 2IANE 5C7XL 2P5WB 4GG6F 2YBRB 1LNUB 5EU4A 3PL6A 5CEYA 1XF5B 1CDUA 1Q8MA 4OLVH 4JFYA 5I74B 1J8HE 4OZHE 1QRNA 2DTMH 2VMFA 2YUZA 1VFAA 4I13B 5D93B 4ZFZA 2I9LA 4YGVA 4BUHA 2X4PB 3GEWB 5F9OH 1ZEAH 3BPOC 3L3HB 5ITBH 4ERSL 2VZOA 3BGAA 4Y8DC 1I7UA 3K1KC 3MCKB 1LGVA 3BDXA 3H2WA 4D0BB 4Y5VA 4JHBA 2WAHA 3HI5L 2FGWH 1FAIH 3B5GA 4U05A 4P2OC 2WINA 4UTBH 4Z78B 3WJJA 1M7DB 5IHZA 3QI9B 4JJ5B 4NM8L 3TGXA 2AI0H 4NNPL 1OL0A 3MREB 3O3BA 1MCOH 4FQLL 2IFFL 2ESVD 4XP5L 5H94B 3U46A 3O9WB 4CBPA 1S7QB 1QBML 1SM3L 3C09C 1YPZF 4HCRL 5C0CB 1DJSA 1LP9E 3P9LB 4OF0A 3ET9F 2ITCA 4GXUN 3SQOL 1NGWA 3HLAB 4ZXBA 1AKJA 2OSLB 4QKXB 5KS9F 4KJQD 4MX7B 3AY4A 1LEIA 4TPRH 1TZIA 3NCYS 3VE0A 3GMNA 3MA7B 4MNQA 5I1IH 1FDLH 4ELKA 4FXGB 4U3HA 1JWSA 5T33H 1CFQB 3O4LA 3K80A 1WC7A 4PJXF 3LKSA 1IGTB 1QR1B 5I1AA 3UPCA 2AJYL 2EEAA 4N0CD 3RTQC 3OSKA 1X5YA 2Q3ZA 3QEQB 4LEOB 4XCCL 3GSUA 1QFWL 4HZLA 4WHDA 3T0EB 5B39B 3N1QC 3TZVA 3OKOA 4LQFL 3HMXL 3PQYE 1UYWH 5EORL 1F2QA 2E8ZA 5KG9B 3JTTB 2V17L 4HIJB 1T2JA 3LKNA 4BYHA 3QI9D 4YHKL 4HULB 3FAWA 1AQDB 4G8GD 4WI4A 4HIIB 2P48B 4OI7A 3GSNA 1OSPL 4A6YH 5JDSB 4BQ8A 1OGAD 4JDTL 3O9WD 4HJ0C 3U36B 1XGUB 5E00A 3RKPA 3WFHA 3TNMA 5CJBA 4TSCH 3CH1A 4H5SA 5DQ9B 1UB5A 1VHPA 1P7HL 1XGTA 3P40A 3EYUH 4TULH 2Q6WB 1EERB 3BPLB 2FYYB 4JZOB 5EBGA 4G3YL 4PJ8A 4UNVA 3AU1A 4OLXL 4LLYB 4N0RA 5DT1H 2ERJB 5ID1A 1BVKB 1TCRB 1YEKH 1P7KA 3P4MA 2EDRA 2GFBA 3U7YL 1I7RB 3DVIA 1FZKB 1UKTA 4JN2B 1U8KA 1IAOB 1L0QA 3FO0L 2XFXA 3SBWA 2WQRA 4QRRA 1HSAA 4BZYA 2QBWA 1DBMH 2GAZA 4PRBA 4L8CB 4N90E 3T0ED 3BQUC 4YHMH 2WWKO 3MRPB 3Q6FB 5JUEH 1GAFL 3RWFA 1EBAA 4L4TE 2PN5A 1BVLA 2ZP0T 5BJTB 1R3IL 5I30L 2FSEB 3BP5A 3DI3B 4PJ9A 2V2XA 4QRPB 4NQTA 15C8H 2WLYA 5ETUA 5I76B 3ULVF 2R23A 4HK3N 3BHBB 1P2CA 3GMRB 5I73B 4NHCL 3DV4A 5D1QC 5C0NC 2EIDA 3OZ9H 2H1PL 3TC9A 4QXGH 4RNRA 1ADQA 5MHSD 1OCWL 2W60B 3OB8A 3QCTL 1ZLWK 1RVFH 3JTSA 5A2JH 2C3XA 1XCTB 1YEGH 3WYRA 1B88A 3SDCB 5F7KC 3I9GH 1OSZA 2D0FA 3LS4L 1UCBH 4DAGH 1A6TB 1IILE 4KK5C 4HMCA 1IZJA 4XBEL 1EGJH 3WSQL 5EOCJ 1XCQB 5GS1C 4C56D 5I19L 1KF9B 1QSZA 3VG0H 5HJ3B 5GIRA 4MD0A 4XP9L 3D39B 3HCVA 4OI9A 4Q74A 1PSKL 5GS0D 2Z4QA 1H8OA 5I18H 5CSGA 4D0DA 1EXUA 3PHQA 2Y5TA 1X44A 1QLEH 1ZT7B 4PLJD 1BFVL 2O93L 5ALBH 1FV1B 1NANI 3QG6A 4H8WH 2CDEB 5GHWH 5GSVA 4XNMA 2WW8A 5HD8C 2MHAB 4Y16A 3W5MA 4JR9H 3AXLB 5IIEA 5CFHA 1U8HA 2D03L 1NAMA 2HFFA 2I27N 2O5ZL 1EAPB 1YUHB 5GZOD 2F53B 4BH8B 5F1SA 5IFHL 3BZFA 2B2XL 3EFFA 3SDAB 3QEHB 1MJJB 3NFSL 1A9BB 3FT3A 4YIQA 3WXWH 3SGEH 5I1KH 3ARSA 1I3VA 4HKXB 2F8OA 2VAAA 1XH3B 3CVHH 3SDCD 5E8NA 2A9MH 4PJEB 1U8LB 5IESL 2DB8A 2W9EH 2BY3A 2IFGA 5FUCE 1MCWW 3TN0A 4LF3A 5TF1H 2FD6L 4GRMA 3MLTA 5DLMH 4JY4A 4LVHB 5C3LD 2IAMA 3I84A 1MVUB 1MCNA 4PJ7B 4X99B 5JQ6L 4HF5H 4PJCE 3SEPA 1CBVH 2UWEA 4KV5E 4FOMA 5C0DB 2CXGA 3WFEH 1V8HA 1U3HB 3REVB 3EDEA 3HI6H 1G0DA 3EOBB 4EN3B 1G7JA 5CLTA 2AEPH 2JK5B 4TOYH 4NWUL 3AAZB 1BHGA 2E7MA 1QBLL 2AK4B 2GJ6B 2ZOKA 4PV8B 1LHZA 5J3HD 5CSZA 3UMTA 2VXQH 3UJJL 5I71B 2Z93B 5HHVH 3RKDD 4YX2H 2XG5A 2F53D 4M7LL 4D9RD 5FM8A 1I7ZA 2KQNA 1VSCA 5DJZA 2HFEB 2B8OT 3RWEA 2QLVB 3DWTA 3T65B 3K8MA 1DBBL 4X9IA 1TJHH 3N06B 1BVZA 2BC4B 4XVSL 2DF3A 3TEUA 2WV3A 3FN3A 3P3YA 1XF3A 5BRZE 1GC1C 4F7EB 5IVXE 1HHIB 3X3GH 5TDNB 5FO8A 3W39A 5J1AA 1F58L 5DJ6A 4ZNEE 1D9KA 5JA8B 1J86A 2VISA 1HDMB 5T1LB 5I75B 1WBZA 4LQ1A 3WEXA 3F62A 2EKSB 4M1DH 3RWGA 2FO1A 4K9EH 1Z9LA 1EFXB 4CVWA 1IKNA 5E24E 3BGFC 3JVGA 3TO4C 1ZT4A 4XC1H 3HC0A 1DQTA 2VE6B 1OLZA 3F7YA 3IVKB 2UWEF 1U3HD 3V5DA 3TBTA 4LCCC 2FEEL 4PJDA 2F5BL 3HRZB 2CDGA 3EDFA 4WI9A 1PQZA 4MB4A 3SCMA 1CQYA 1P4BL 2AK4D 2W0FA 3EJYC 4P2CG 1PKQA 1HH6A 5T5FL 4XNZC 2DRUA 2ILLA 4JO1H 4NJ9H 1FSKB 5D6DA 1Y6NR 4OGAD 2MPAL 2FHFA 4ZUUA 4LVNB 1ND0A 5C09E 4P5MB 1JGEA 4YBLB 5ANME 3ZL4H 4HLJA 4XMLH 3OKEB 5DMGC 2CIKB 2NNAB 5C07B 5F7NC 2IPUG 4HD9A 4KJPC 3MJ9H 4ZAKD 2AEWA 1CFVH 3FCTA 3LY6A 4JFQA 3RZCA 4NQVB 4EEEA 5ICZA 4E0RA 2WM0A 1OF2A 2H3NA 4P4KD 3L3JA 3QDJE 4NNYB 3ARDB 3FONB 3SDXB 1U91B 4HBCL 2X4RA 2FO4A 4V2BA 1F4YL 3MBED 4XVUD 4ZUSA 4PV9A 3HPLB 3BE1H 1EFXD 5DRWB 4RDQG 3O6KH 3IJHB 5EU6A 4DUXA 2Y36H 2VITB 5MERB 4P5KB 1F11B 1S7RA 5DJ0B 5T3ZH 5E6YA 5T5NG 1JHKL 3JWOH 5INCB 3VXRA 4JFOA 2SEBB 1XGYH 1J8HA 4PJDF 1B0RA 4KTEH 5GGTL 5J6GA 4KXZI 1GH7A 4EDWH 4IOSD 3UJIL 4RGMC 1JTOA 2JB6B 2ZCLL 2YK1L 4FFZH 1RK1A 3V52L 1TQCC 4FQIH 2C4XA 1FZJB 1HH9A 2HVKB 4UINL 3G6DL 3KPOA 2GTWB 5D1ZC 3HZVA 4PTUB 1N59A 2VDMH 5LKNA 4MS8C 4YAQB 3QDME 5J6HB 1J1PL 5C07D 3KJ4B 3QIWB 1HQRA 3DVGB 1YQVH 4GW1A 2KBGA 1Y6MR 3DOSA 2P43B 5ID0B 4IDLA 1OAYL 3DV6A 4PP1D 4X8JA 3ARDD 5EBMA 3VFPA 2X4UB 1I1AB 3D1MC 1LP9A 1WICA 1JN6A 4Z7QF 3D9AL 4OLYL 4DKFL 3L3GB 1IM3A 3MODL 3WFDH 2ZUVA 1EX0A 4HLZH 3QZWG 1J0JA 3QNXA 4LSDA 4FZEH 1T04B 3I50L 4UQ2A 3BP4A 2NZ9D 43C9B 2YHGA 4WU5A 4QHKI 1CYGA 3A67L 4CMHB 1FQ9C 1EUUA 1WBXA 1NMCC 1QSEB 4NGHL 5SWZA 4LCUA 4EBQL 5IWLA 4HJJH 4K7PY 2KH2B 3K4ZA 1RZFL 1IC5L 1ZLUK 1U8IB 3TA3A 1P1ZA 4X6CA 4YNYA 4L8DA 4JFXA 4YE4H 3O2DL 3CSGA 3PQYA 4D94A 3GJFA 5BXFB 3O2WH 2PR4L 3GI9L 1Q1JL 5FKAA 4CN4A 1NGYA 3HE7C 5FA3B 3WNPA 5TE7H 5BMFH 4Z95H 1HNGA 5DR5H 4J3SA 1N5YH 1PYWB 2HJLA 3IRZA 3GMOB 4HCRA 1DQQA 4HWZB 4MNHA 2QADC 2R0KL 4PGEA 1QKZH 3QUYC 4XCNA 2PXYA 4AQOA 1KIPB 1K6QH 4JDVB 3C2SA 4GG6B 1I1AD 3S88L 2F5AH 5HDQH 3O3DB 3F58L 4PIRF 3QHFH 4Y2DC 3GSOA 5C0RL 4ZO8A 5INDA 2VZ1A 4AEIL 1KN4L 3B4NA 1ACYH 1D6VH 4H20L 1TJIH 1FVCB 4UTAL 3P77B 4W6YB 4PBVC 1HILB 2APFA 2VLJB 4M03A 3QNYA 3BISA 5FYKL 3KPQA 2FR4A 4JG0L 1VEPA 5EC2A 3IGAA 5E2WH 4GJTB 1FIGH 1YY8A 5IM7B 4JRXA 2ZUQC 4XMPL 4YXHH 1P7QD 3OKLA 1H15A 1OPGH 3LKOA 5K59E 1KELH 2Y06L 5GISH 3BPCB 3HMXA 1QSED 1C08B 4TSBL 1J0ZA 4MD5A 2HG5A 4WFGD 4U0QB 4H25B 3SO3B 3MFGB 5HI5D 4PR5A 1RZGA 2ICWI 4HUVB 4X6CF 1T83C 1WFOA 4F9PA 3ILPA 4CADA 2GCYB 4L3CA 3VFOB 1NSNH 4OFYD 5CD3B 5DRNA 4DZ8B 2X1WL 4P3DB 1BJ8A 4L4TA 5CS7A 2Q86B 3LB6C 2CKBL 4DOHE 3VRJB 3M07A 1F02I 5ADPH 1YPZB 5DD0H 4QYOA 4PJIA 1V3MA 4U6TA 5JR1H 5DJXA 1UVQA 5B3JE 4F7MA 5IFAL 2CIIB 1FGNL 2YMXH 4JCLA 3V95A 3C6LB 4XRCB 4NOBA 1ZVYA 3HR5A 4X80H 4RGOL 5MEOB 3IFLL 4JRYD 5FYKE 5IHBA 1NFKA 1CDJA 1ZTXL 3QCUL 1ZGLM 4MAUL 1QRNB 4N68A 3UC0L 4CN1A 4KHTL 4KVCH 4PJXB 3LRSB 3O0RL 4OCYH 4OSUL 2VLJD 3RY6A 3V4PL 1DQLL 2MTPA 1IFHL 2X44D 2XA3A 32C2A 5FHBL 5AD0A 3ZKSD 4PRAA 3DROA 1D5ZA 3U9UA 1C12B 2J8OA 3RNKB 5I1EH 4EI5C 3SOBH 4MJ5A 5CD5D 2R2HA 3C60A 3P73A 3WS3B 5ERWA 3VFGL 4X98B 4AG4H 2J1KA 5B8CB 3RPIA 3MOAH 4LKXB 4AY0A 4ODVL 4LGSB 3PP3K 4LPWA 3NABH 2H32H 4LDLB 2IGFL 2CRYA 2DDQH 5IVNA 1LO0H 5F7EH 4JZJC 4XGZA 4LOUC 2WZPD 5B38A 2JCCA 5E2VL 5C1MB 1EK3A 3DGGA 3BZEA 4Y8AA 5JPMA 5EBWA 1IM9D 4PJIF 3HNSL 3TBSB 3ECBA 3TCXA 1CL7L 1VCAA 1R3LA 3TYGH 4O58L 2L4OA 3EOTH 1BM3H 1FG9C 1LDPH 1O0VA 2X7LB 3BKJH 1LEIB 2FJFA 3BMVA 4JN1L 4KPHH 5D5MB 3BN9D 1V05A 3GNMH 3MRIB 1JNLL 3PL6D 4R7NA 1UB6A 4NUGL 3GMNB 4O51B 4ZFFB 3G6JE 2NTFA 3OF6D 4ELKB 3EOYG 1JWSB 1QRND 4X7TB 2Y6SD 1YNKL 3FT4A 4B53A 3P30L 4XXCA 3QWQB 3KYKH 1CFTA 3NPSB 1HINH 5GRJL 3CFCL 1XR8A 1G7LA 1U8MB 3U79A 4WJ5B 3T77B 3BEWA 4WFFE 2JB5H 4IS6B 3H9SB 1DBJH 3HI1B 4HZLB 4LSSH 2AQ2A 1YJDL 5FKPB 4U0RB 1MUJB 5DEGA 4ZOEA 2R56H 3BPLC 1CLOL 4PG2A 2Z31A 5C08E 3GBML 4TYUA 3R1GL 2C26A 1YEHH 2NLJA 3MRGA 3CH8A 2DWEA 4M43L 4FQJL 3I3BA 4NKOB 2UZIH 3GKWH 4G42B 1CI5A 2ERJC 3UZVB 1ZLVK 2X5PA 3WIIH 8FABB 4JY6A 2VXSH 4LSTH 2ADIA 5AZ2H 4FQ2L 3L3DB 1KEGL 3EFDH 2JCCF 5IQ7H 1VFOA 2IPKB 3MJGX 1U8NB 3D0VA 4H5SB 1QZ1A 1UB5B 4JFHD 3MLVL 5BOPA 4NO2B 4OCRL 1J1OH 2C1PB 3QUZB 3MV7E 4NN6C 5E2UH 1AKJD 1JIBA 5KVFL 1DCLA 4WI6A 3BP7A 5EDXA 2ITDA 3QB7C 4OKVA 5EBLA 2FRGP 3BRDA 2ZCHL 1H9VA 3H9HB 4EXKA 3KLSA 5AAMA 3KS0J 3WO3B 4K3JH 5IVXA 1MCJA 2YKLH 3PGCA 4WHYH 3O4LD 5E6IA 4YUEH 4UU9B 4LASL 4RMUA 3HS0B 4G80A 1LK2A 1VDGA 1ZS8B 2Q20A 1GXEA 1S7XB 3ARGC 1U8KB 4R26H 5D2NB 5I73C 5BCAA 3OAYK 4Y89A 4GG8A 4QF1A 3RRQA 1S9YA 3RWHA 1A1MA 3OR6A 2DQCH 4H1LA 3IDNB 4IIQB 2J7LA 4K8RL 5IF0A 3X13A 3L5HA 2NW3B 4XI5C 1MF2L 2GUOA 4PJ5A 4HIXH 3RVUC 1CE1H 4DFHA 3L5IA 2DIAA 5CEXB 3ULVD 3RGVA 1DL7H 4OD1L 1GGTA 1YC8A 4R97B 1XF4B 4HEME 1O7SA 3CU1A 4I18A 1H3WM 2AJUL 1A6AB 4OUOA 2RBLA 5DFVD 4Z0BH 3TIDB 3GRWL 3PIQA 1I85C 3JTSB 4JFEA 4DKAA 4KZEL 3QUZD 3GIVB 1KJ2L 3ZDZE 1MRCH 5DD3L 3HC4H 4CJ0A 4X7DC 2VRAA 5J13B 4LSUH 5ESVA 4HEPG 1G7MA 1TVHA 3VI4E 1R3JB 3BI9X 3AS1A 3FOMB 4N0UE 3ULUL 2ORBL 4KDTA 1T7YA 3PWPE 3FB6A 4ZQKB 3VFNA 1S9XA 2QJDA 4GMTH 4MD0B 4XC3H 4J6RL 1FNGA 2NY5H 2JELL 3SDAC 2IPTL 2Q87A 2CSPA 2OM5A 3H7BB 4XVJL 1MIMH 2HJKB 1M05B 3C08H 4CU7A 4S1QH 5D7LE 3VXPB 1P4LA 1ROWA 1DVFC 5CJ5A 4ZD3H 5L6YL 4WU7A 1F00I 2X09A 3OMZA 3S34L 2R2BA 5SX4H 1NLDH 1FFRA 3D6GA 3Q1SL 4PJ9D 3RWCA 2HMID 3OKYA 1WF5A 2HWZL 3FAXA 4Y16B 1ZWIA 4YDIH 5IIEB 1NAMB 3LMJH 3DX7A 3D25A 4O2EA 1G7IA 1RIHH 5C0IA 4KGJA 3FB8A 2LVCA 5FYLH 1WTLA 3UEZA 1FVDA 3C5SB 5F9JB 3FT3B 2BSSB 4GRWE 3CSYB 3DTXB 3VA6A 3ULUE 4KQ3H 3RX8A 3WLBB 2BK8A 2EICA 5F1IB 3S37H 5LAXA 5E8NB 3IKCA 3W11C 1QFWI 2ICWB 2GHWB 4FMKA 5GS0H 5DUMH 3T3MF 1QFHA 4LVEA 5JIPA 4PJGA 1AH1A 4KI5F 3GHEH 4N0FA 2BXYA 1RJCA 4S2SB 3TN0B 2YUXA 5MEPB 3GMQA 4U1HB 4XWGL 4RAVA 5GGVH 5IB2A 3L5WA 2BY1A 2E9IA 3N1FC 1S7TB 4EUPA 3FHAA 2UWEB 3LKQA 4EIGB 2CK2A 1WZ1H 4I3RH 1IQDB 5FAAA 4LCYB 1FBIH 3BUTA 5F70A 5GGTA 1X5JA 4X8XA 3VXOB 2QSCL 5IB4B 1BX2A 4HK3J 2V9RA 5CEZE 4U6VL 3BT2L 1HXYB 1NBYB 5J1SC 4Y16D 1EHLH 5F7UA 4GUPA 2VC2L 4G5ZH 4X9FA 5FGCB 3X3FH 1I7ZB 3FRUA 4RFEB 3FZUD 5DGQA 3HAEA 5HI4C 1G6RB 1RUQL 2Y23A 3VW3H 4XBPB 4WI3A 2MCPH 4Q6IA 1AIFA 3O6FA 1MQKL 1XF3B 4TSAL 4W6XB 3JV6A 3ZMRA 4F58H 3U4BL 3P4NA 5GGUB 3QDHA 3SJVB 5ITFB 1MIEH 4LDEB 3Q5TA 5IMOB 5FB8B 5KOVC 2PTVA 4HIHB 4QHUB 2ED8A 2VISB 2Y7QB 1FGVH 1OAXL 1WBZB 4PJGF 1OW0A 4WIQA 3TN0D 3CC5A 3SY0A 4AJ0A 3B9KB 2PTTA 1L7IH 3GB7B 4YDJB 2IAMD 3WUWG 3CU7A 5I8EB 5EC1B 2VZUA 1A0QL 3U7WL 3RNQA 4EVNA 2CPCA 4PJBA 1F2XK 4DTGH 1A8JH 5HVWA 2XG4A 1A2YA 1FG2A 4DN4L 4AIOA 1HIMH 2MKLC 3BKYL 3FMGH 4DK3A 4QRUA 1P5VA 4WDIA 3ZE2F 4BSWA 2HRPH 2IJ0C 1A1NA 2VABB 1UC6A 4LEXL 4HKBB 5DD5L 3KYMA 3ALWA 4HPOL 1U92A 5FEBA 4ELME 4GRLA 3DX8A 4NP4L 4LLVB 2E5EA 1UWEL 4HHAA 1JGEB 3O2DA 5BZDA 4F3FA 2ZUXA 4YWGH 1KLFA 1UZ8B