4CA4A

Crystal structure of fimh lectin domain with the tyr48ala mutation, in complex with heptyl alpha-d-mannopyrannoside
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDAPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 32
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4ca4A00
4CSSA 5JQIB 4XO9A 2UY6B 1UWFA 1KLFB 4X5RA 3BFQG 5FS5A 2XG5B 1ZE3H 4X50A 5ABZA 1PDKB 3ZL1A 4AV5A 2WMPB 4X5QA 2VCOA 1KIUB 2UY7B 1QUNB 5IQNA 4AV4A 4J3OH 4XODA 4AUYA 5LNEA 5F3FA 5FWRA 4LOVA 4XOBA 5LNGA 4XOCA 1TR7A 4J3OF 5FX3A 4BUQA 1N0LB 1N12A 4XOEA 4AUUA 4ATTA 4X5PA 4CA4A 4AVIA 5F2FA 4XOAA 5AALA 4AVKA 5IQOA 5FLUA 2J2ZB 2XG4B 4AVHA 3JWNE 2JMRA 3ZL2A 3BFWA 4AUJA 4AVJA 3JWNG 5IQMA 3SQBB 3ZPDA 5AAPA 4CSTA 3RFZA 4J3OG 3ME0B 4XO8A 2JTYA 3BWUF 3MCYA 4AV0A 2W07B 5AB1A 5CGBA 3JWNH
chains in the Genus database with same CATH superfamily
2NUPB 3PJSB 3UJTH 2WP3T 1FA4A 5D2NC 5DYOA 5FDWB 4BFJA 1VJSA 1RFDL 5FYKH 3IJSA 2X2HA 2IDFA 1AI1H 3F01A 4F3FB 1IQWH 2HTLD 1RZFL 1JPGB 4LRIA 1CUOA 3MJ9A 3KLQA 3JZYA 5I15L 1IGCH 4XMPH 2H0JA 5I71C 3U1SL 3H2WA 4M5TA 5EU7C 2UVEA 1A5FL 2H2PD 3IPBA 4R7NB 4WENB 2QMJA 3DOIA 4K3HA 5H37A 4DCQA 3OKKB 4PJ7F 4M62H 3GSRB 4F58L 3HC3L 4JZOB 3Q48A 4WFFE 2CDEB 5EIIA 5E6SB 3DTXB 4PRBA 1PZCA 2XOTA 1D5IH 3BKYL 4FHKA 2YGOA 5I66A 3U4AA 1QLFB 1UADC 1OLLA 1RP8A 3GS0A 5GGQL 1UENA 4K7PH 3FU5A 7CGTA 5HHOB 1A65A 1CLCA 2QVFB 1PZ5B 2CJ3A 3PGDA 4AJ0A 3U7YL 4NO0A 2KZWA 1R33A 1WK0A 5HI4C 4KVCL 1DCLA 5J57B 3R4RA 5BV7B 5IKCB 5FGBA 4X7EC 2ZOOA 3NIFE 2WUCH 5IGXH 4LPXA 5B22A 2ZWNA 1DEDA 1G5AA 5BNXD 3JWDH 1A6AB 3QDJB 1YEKH 3MRMB 5ID0A 1GAFH 3MHZA 3SBQA 1XH3A 4ZBJA 1V5JA 4Y4FD 3WIIL 1RZIB 2GSIA 3O81A 2HPTA 1HN1A 5LBSL 3IDYC 2EEFA 5TE6H 3B9EA 2G9KA 2ZUQC 5FO7B 1XBDA 4AE1A 2EH8L 4GAJH 4B7IA 2IFFH 1U0QA 3TBTA 4DZBB 4Q9QL 3LB6D 4P23C 2VLKA 3EYSL 4M4PA 5HP5A 3TLRA 1AGDA 1FC1A 3NRFA 1TJIH 4G80A 3D87B 3GEWB 2V8LA 2ZUXA 2IADA 2XN2A 2PXYA 3GWJA 4GRWE 1FL3A 4LMQI 5G4MA 4S0SD 1OTSD 1ETZB 4F7MB 1NFKA 3DHUA 1T4WA 1VHPA 1D5MB 4ADIA 4WI5A 5LVEA 1W8EA 4YAQB 2YLHA 1E2WA 4FTVD 4GG6E 3NIDE 3FTWA 4WFED 3VG0H 5GGUB 5LUMA 5INDA 4CMMA 1NWOA 3QFJB 4XCEB 3WDIA 2AABH 3F2LA 5D1QD 1KCVH 1P4IL 3CVHL 3V6OC 2ESVD 1G1YA 2JLLA 2NY0D 1E9PA 1XF3A 2VYRE 4TPRH 3QJFA 3AGWA 2CLRA 4L29B 5D7EA 3ZKND 2BSTA 4M1GH 3RIFK 1UOKA 5T1KB 4J3OC 2SEBB 1MAJA 5C0RH 1F1AA 3QDGA 3RA7L 4JPIB 4DP9X 1GL4B 1F3JA 5F9DC 5DLLA 3WV0A 5L2JA 4ZNEE 5E08L 2BH0A 4MDJA 4U33A 4AWJC 1DN2A 3SDCD 3SDYH 2UZIL 4JS7A 5DFTA 2ADFL 4NUGL 4NBZB 2R51A 3S3PA 3NAAH 2WN2A 5EU5A 5CR8A 3B1UA 2BJMH 3MRJB 1A7PH 3O41B 1XD0A 1OIOA 2NLJB 4PGEA 1URIA 4Q9RH 4HF5H 4OJYA 3RGHA 3W5MA 1JGIA 2Q7AA 1XSKA 3T3MF 1J0KA 2CUHA 3FB7A 2NCMA 4JFFE 3FKUS 2OYPA 1RIVL 2CO2A 2K6ZA 2QFRA 4HYTB 3PIQA 3QHFL 4K3GA 5JIDA 1PFCA 4U49A 1PVHA 1MIEL 2WLLB 2X3AA 3IVKA 1CC3A 5T5NF 3K6NA 2DS4A 4J3OF 1BBJB 3HUJB 3UTPD 1WT5A 4AMKH 4BUHA 2EICA 4TSCH 2R23A 4YBLB 1JGDA 3RVUC 2MTPA 4DGVL 4FKHA 2PYEA 4E41A 2QVMA 1P6WA 2MEJB 2X44D 2HH0L 2FSEB 2E9WA 2J4WH 3EIFA 4HUUB 2NY1B 1JNLH 2YQGA 2X1QA 5E5LA 2Y6SC 3QPQC 4PTTB 2YGVA 5DD6A 1TXKA 3RX8A 2VTFA 1S2EA 3ZQ9A 1BG9A 5BUAA 3TCTA 1SHMA 5LDSA 4G6FB 4PYGA 2B4CC 1QHOA 4KRPB 1QBMH 2CJSA 4WO4D 4DAGH 2UWEB 4Q97A 2G75A 4JK0D 1PY9A 4Q58C 5L2KD 2PWDA 2VQTA 3EFFB 4ZMAT 4PJHE 5JHDB 5IEKB 4KV5F 5DURB 3QYMA 3D51A 5K9JL 2E59A 2P5WE 5F7KC 3H7LA 2YKLL 5BRZD 1KYAA 4N8VA 2ZKYA 2NY6B 4L05A 3N85H 4FLHA 4L8BB 4Y1AB 5AW7B 3BPOC 1UM5L 2I07B 3D08A 4D0CB 4EOWL 2CJUL 1GJIA 2GAZB 3P3RA 1INDH 2YUXA 2F8VA 3AMKA 4TVPL 1BZ7A 1SJMA 3ZHNA 4Z7NF 1Q94A 3LRHA 3ZDYE 3UABA 4IKKA 5GZOA 4YPGB 3IJYB 3MA7A 4OCMC 4UT6A 3RUGA 2P44B 5SWSE 5J12B 1BA9A 4PJXE 5C9JA 3J8F7 3WFDH 1YUHA 1I1AA 2X6UA 3DA0A 1O5DT 4NIYE 3NCBB 4GP5B 3HMXH 5EF3A 3SOBH 5EG6C 4NB7A 2ZONA 4JPQA 3U48A 1U8JA 4EIUA 1AY1H 1YC7A 2GJZB 3K2KA 2HG0A 4JNXA 1E4HA 3NOIA 1MW0A 2MNUA 4UIMB 2VZ1A 2OP4L 3QPXL 3MLVH 1R4XA 2FYYB 3LKOA 4LKCB 4ESKA 4ZMTA 1ZHKB 4I89A 3EDFA 4ZUSA 5E0FA 5HY9B 3QRLA 1CDIA 4F37K 1R17A 1INQA 1KJMA 3U36A 4EVNA 1NGQL 3U6XA 3VM5A 5KSVB 1OEZW 3QWQB 2OMUA 4DHLA 3U79A 3S3SA 4PJ8B 3C09B 3HJEA 3NG5A 4FQHA 4UYPA 5FWRA 1AQ8A 2HJFB 3E8VA 2OSYA 4IS6A 2ICES 5LBVA 4P5TC 4OH2A 4FMKA 2NW2B 4HUXB 5AYTA 5I8EB 2HKHH 4Z7WF 4NZRL 1QEXA 2Z7YA 4N8CL 5T3XD 1WFIA 3UERA 2V2TB 1MWAB 1TZGH 4BCXA 1VFUA 5CZXD 1GR7A 3V5DB 4JMXA 2CMRH 2DDQH 3S5LB 1S7QA 3VDCA 5BV7H 3PDOA 3MLXL 1HEZA 5LAPA 2BNRA 3PUCA 1Z5HA 4N8UA 5T33L 3EXJA 1CFTA 3W38A 4FXGC 1MJ8L 4U1NA 1LWJA 1YN7A 1CTOA 4AYEC 3ZKMD 4F2FA 1CGUA 1KCSL 5AW3B 4Q74A 2AXGB 1E4XI 2AJYL 2E4FA 1JV5B 3LXUX 3K8MA 3RWJA 1S4IA 4U1IB 3HLKA 3MRHA 3WI9A 5FM5O 3SDDD 3SPJA 4JFPA 3VQLA 1AGFA 2W91A 2Z34A 5F89A 3PP4H 1T0MB 3EJSA 4UDUA 4TTDD 3VFOA 1U3HD 2RTTA 4X0KA 3MR9A 3ILQC 3PHOA 4ZMLA 3FTYA 3IMVA 4LXFA 2JIXD 5LGJB 4OIBA 4N20A 4W9LC 2DH2A 5C6TL 1NGZA 1M1XA 3QJXA 4GMSL 4WWKA 4RZCB 3LKSA 1FZOA 2O6FA 3SSGA 5AVZB 3B37A 3KPTA 5CMAB 3CZSA 3C5ZD 2EDKA 4X4KA 4TULL 4HDIA 1LLAA 1JHTA 4F8NA 4Z3HA 1CFSA 3TWYA 4XVUD 3AFLA 2GBVA 3G7TA 2V5TA 4PHXA 3WEAA 2P8PA 4P46D 4QOKE 3RGBA 3Q2NA 3ME0A 4HSQA 1JXDA 2R27A 5CZVL 1S5HB 3KL0A 2X0UA 5I9QB 4APXA 3AREA 1KB9K 4CNIB 5LXGH 4FP8H 2RCSL 1RUQH 2BY3A 2VKWA 3N44B 1FGVL 1MHCA 5DO8A 5HVHC 2OYKA 2DQJH 2GJJA 1U8HA 2MQGA 3QQ3B 2NXZC 4EUPA 2HJLA 1L5GB 3RDTC 3OAYH 4JPVH 3V52L 4JE0A 3RIKA 5MHSE 3QISA 1WUZA 3BAXA 4FXKC 1M6OB 1PPIA 2ADIB 4NN7C 3MRKB 35C8L 4O02L 3ZT5A 1OQOA 4S0TD 4UQCA 4FADA 3FO1B 4UT9L 3OKNB 4GP8B 3UAJC 1FAIL 5EB9A 5CINL 4U3HA 3HFFA 4Y0GA 4OT1H 3T8XB 2DLFL 2XKUA 3E7JA 3HTLX 4R4FH 1QSED 2XVKA 1MFDL 1OK8A 4OZHA 3SPGA 3P4MA 4LRNL 2DKUA 3U0WL 2V0AA 3UXFA 4I18B 2A83A 4UIKL 1YMMD 4JGMA 3LZPA 5ES4B 1UHVA 2OV0A 4PJCA 1F1GA 4HA1A 2LGNA 4DWHA 1GJUA 2P49B 3UG5A 5F7DA 4PY7A 4ZYKB 2O5YH 1F97A 4X4XA 1CICA 3EADA 2CWRA 3OR7A 2H9GB 3DC0A 2VDPB 3RJOA 4Z7OF 2IXQA 4KK5D 1CF1A 5SWZD 1WWWX 2RFXA 3EFDL 4ZPVA 3VD1A 4ILDA 2D4FA 2YAPA 1CYXA 1LD9B 3MUJA 1B90A 3X11B 1QATA 1HQRB 1AS8A 2KT6A 3PHQB 4WI2A 2WZPA 1NEZB 3EGDA 1V7MH 1N0XH 2LAGB 3MROB 1XF5A 4KKAD 2Z65C 3RGVC 1I1FA 2IAMD 3L8QA 4MQXD 1TEGA 3MCLH 4AG4H 3MGOA 4ISVB 2IWGA 3VWKA 1MREH 4I48A 1F0LA 1B0RB 1EBPA 1MELA 2BIMA 2VSKB 2VR8A 2ZOLB 1MJUH 2CLZA 1SFDA 5GRJL 3C8KA 1A02N 4TLSA 2NZ9D 2VUOA 3LCYA 4P5KB 1E30A 3HZMA 3JXAA 2OL3A 5DJ6B 4L1HA 4K5LA 5JXAH 2X9WA 2P43B 2Z92A 1FO0A 4MAYA 5AYUH 5ISZE 4J8RA 5DMKB 1PU0A 1ODUA 3EH3B 3IFLL 1ZLWK 1L7IH 2FUQA 2ZUVA 3EHBC 3L2LA 4LESA 4QHNB 4AQ1B 7PAZA 3LDBC 5DO2D 6TAAA 4LSPH 2D3LA 4HUWA 5C0BB 1O9ZA 5J1SC 3TBYA 3A22A 4OZ4A 3HG1B 4WTWA 4LPTA 2H32B 2QZQA 3H55A 2R9HD 5F6IC 3EGXA 5J5EA 1JWMA 2YD7A 4HX1A 2DEXX 1XR8A 4OD1L 4WK4B 3U9PL 3NFNA 5K9KB 1UURA 5J89A 4EN3D 3Q2WA 4F9PA 2XZZA 4O9HL 2EYRA 1SF5A 1AGEA 3FJTA 1KPVA 4H20L 3PLYA 3LZOA 4C56D 2WXMA 3MOBH 3ZGIA 3CBKB 2VJXA 4OJAA 2HTKC 4FG6C 1LMIA 3CC1A 4BZ2L 3HS8A 3WIAA 2DLTA 3QFDB 5GIRB 3U9WA 5KAQF 4LCVA 1N68A 4WU7A 1OT2A 4PP2B 4L4TE 1HXYA 2VZOA 1UFGA 1Q9OA 2WXLA 2Y07L 2L04A 2OTUA 3QUYD 5IHZA 1IL1B 5MEQA 5JMOC 1T2JA 2QV4A 2FDBP 2WOBA 4HKZA 1ICTA 2C7UB 2V7NB 4OGAC 3E38A 4FKKA 4HEPA 4KRLB 4M61B 3WN5C 5E2VL 2PMZA 4NAJA 1NC2D 2JKRM 2X4RB 4NRXB 1XEDA 3KM1A 4LSRH 5L4JA 5PAZA 3ASNB 5DRWB 1Z9PA 1F90H 4WKZB 3MCKB 3MMEB 4ZOBA 1IM3A 3QDMA 4OZIE 4Y9EA 3LRKA 1E4XL 1WFOA 1NMAH 3I75B 3LV3B 3U0TB 2AW2A 1E8ZA 1WUNT 4FTVA 3HN8A 1SMOA 2A3TA 2VDOL 4I13B 3IMTA 3FT4B 1YAZA 3C5SA 3NPSC 3X12A 3KLHC 4YHMH 2J5LB 3SYQA 1TPXB 1X4ZA 3FU6A 4OCXH 2QVIA 3EW3B 1A3RL 4LDOB 3VTAA 1EJOH 4Y7MA 4M7KL 4QIRA 1FRGH 2ESVA 3Q44A 3X3FL 4LOUC 4RDBA 5HDQL 3N04A 5FLVA 1NM4A 3QG6B 1Q1PA 4GIPD 1H15B 3BAEL 2VR9A 4XRCB 4G8IA 2X4OA 4POUB 1Y18B 5C2UB 3NCFB 1OGTB 1DDHA 1WTGT 4L4JA 5FYKU 3V4VB 1OSPH 2B1OA 3KDPB 4PRIB 4OJDH 1LJMA 1DQDH 1N64H 2VAJA 3BVNB 5LBSA 4APQB 3D9AH 1JYVA 1KWGA 2XYCA 1R3LA 1DDTA 2ICEB 5HJ3A 5HI4D 1A6TB 4DKTA 2WUBL 3FW6A 3RNKA 3SDCA 3FOMA 3GSWB 4YHOL 3IJHA 3GSOB 1H3WM 2YEZA 2VZUA 2Q10A 3AQDA 1YQVL 3PV7A 4YHIA 3TO2B 3VFGL 2OXGA 1FH2A 1AHWB 2XICA 4IRJB 3SHSA 4DGIH 2HMIC 5IQNA 4YO0B 2E27L 3QCUL 4P4RB 1N6VA 3P0VH 4AYDC 1SVCP 1O7DE 5FDYA 3DIDA 1AZVA 1F1DA 3KCPA 1LP9F 4N2KA 2R2CA 1BREA 2D73A 3MBWA 3U4EA 4KDWA 3IS0X 5CLXA 2X70A 4MD4B 4Y4HB 5GGVY 5IR1A 4Q6KA 1BJMA 2AJUL 3AADB 2BWIA 2HB0A 3CX5J 4KZ0A 4HS6B 4YHZH 1QACA 3O9WC 4PB0H 1AS7A 2VC2H 4P23D 1QLEB 4BWUA 1KTBA 5J4MA 2QSCL 4YHPA 4M7LT 4IBSA 4ANUA 1GSKA 2GIYA 4ABWA 1HXMB 3ZRCC 3BWUC 4WI6A 1V54B 1ZHNA 2FX8H 2EYTA 3CVHA 4XXWC 3PQYB 2KZ1B 2G4EA 3BT0A 4HAFA 2FATH 4N90E 5GRUL 4DKDC 1ONQA 3QXDB 1UD2A 4HWZB 5DHXB 4L2LA 6PAZA 3CFTA 3KMDA 3IFOA 4LSVH 1DUZA 2HFEB 3RYMA 5BJTB 1UGKA 2PF6A 2AZUA 1JZHA 1UKTA 3WJJC 3KWWB 1VCBC 5FOBB 4X42A 1FVEB 2UZYB 3FUJA 1KSRA 1FNAA 5CFHA 4GKOA 1T2QH 1AKJD 4LSQL 2FT7A 3LHPL 3KBHE 2FWUA 1T7WA 2C1OA 5I30L 1AO7D 4X5WA 4WO4A 4OCRH 2N1TE 3FL7A 4AH2A 1RIUL 3A4DA 5AW1B 3D2TA 4D0BB 5DJDA 5AOJA 1BWWA 1HL9A 1PX3A 4LIQH 4GQRA 1AQDA 4BH7A 3V0WH 3D05A 4J3OD 4KGLA 4N86A 2VZ3A 1CYWA 1KXVC 2YOAA 4F2MB 2GJ6A 2EDTA 2A6KA 3B3BA 3BWUF 5D93C 1MNUL 3FQTB 4DKEL 4XPGH 3K71A 3IRCA 3JT2A 1AR1B 4ZUVB 4ZTOH 1GXEA 2B4CL 2HCZX 3EOYG 4JFEB 2EKSA 4X98A 3TP4A 4PJAB 5HHOE 3LKQB 2EEDA 1JZFA 1SMDA 2KL6A 5DUMH 4UNVA 5EOCH 5ICZB 1PNDA 1UD8A 2GITB 3ZDXF 3OLIA 4L8CB 3IF1B 4AL8H 2PO6B 4L9LA 4LFHG 1UB5A 2I9LA 1S7VA 3S37H 3TBSB 3KPNB 4GAFB 4PI2A 1AOHA 2K4AA 4N2LA 3CFEA 1KGJA 1A7QH 3F7RA 2IOOA 3MFFA 1IBYA 1KJ3H 3HVDA 4KQ3H 3WJMA 4FL4C 4X5QA 3QDJE 5EU4A 5JOPD 1F4WH 3WE6A 4QRSA 5E2WL 4JFVA 2OCFD 3HNVH 1DJGA 4Y2DB 5DHVB 4YFLF 1YJDC 2WLZA 1AFVH 2FX7H 2OQJA 2OTWB 2R69H 2X4NA 1PG7L 4QF1B 1E28B 3KXFB 3UZEC 4PJEF 5ICUA 3V6FB 3OKLA 5IESL 1R3HB 4XC3H 5BO1L 1P7HL 4FE9A 2KC0A 4JB9H 4WCYH 7FABL 4U6YB 1CFMA 4ZX3A 1PDKA 4R6UA 3WJLA 1T03L 5GS1A 4AW4A 3OKDB 2XHNA 2EDXA 4Y16B 4CSPA 5IHLB 1QMUA 4OZGB 2X5PA 3HI1B 4S1QH 3MOAL 4MB1A 5FX3A 4NOBA 3VGEA 3SYCA 5IMOB 5CBEA 2HAZA 2X1WL 3NBNA 4J3WA 3UBXA 5HXMA 4FQ1H 4FZ8L 1OY3B 3V0DA 3S4SG 1YG9A 3QFJE 4WTZA 1U3JA 3QI9A 3V79C 2H6PA 2GSGA 4JHBA 3KL5A 5HPMA 3KNBB 3ARFB 2VRQA 3GO1H 3TCLB 3OLGA 9CGTA 5AD0B 1GZHC 4G9FB 2BVOA 3MV8B 5CF3A 3ARDB 1FLTX 4E9SA 4UM9D 2C4FU 1OWWA 3EO9L 2J8UB 3CFKB 2VDQH 4TNFA 2OMVB 4BSVA 1VA9A 4NWUH 5E1QA 1M7XA 3WUWA 4KOCA 4WGWB 4WY7L 3P02A 1S9VA 2LTQB 3L5JA 1LO2L 4KK8C 2DYPA 5I16B 3UPRA 3SDDA 3VI3A 4AENB 1JNNH 1JAEA 2J88H 1HE7A 3GMQA 1FFOB 3WENA 4ZUUA 1TETL 3L3GA 4M7JH 4TNVK 3VTMA 4XPAH 2DMKA 3OHMB 4NKDA 2VWEC 5TGBB 1ZVSB 3HZVB 5DQJA 5FV2A 4GH7B 4K2UL 2EZ0C 1E4JA 3HPJA 5KOVC 3FU0A 4LBEA 2IH1A 2BC4A 6FABL 1HSAB 2HKFL 3FO2B 4N24A 3UJIH 1JRHI 4KUZH 3C5ZA 1CD0A 4A7UA 4D9LH 4IJTA 3BGMB 1CFQB 1WFNA 5E2JA 2A7BA 1PKQB 2HFTA 4R5XA 5CUSL 3AM8C 5FF6A 1IC5H 4NQSB 4XPHL 3QR0A 3ZIMA 2EDNA 4R97C 2C3VB 3R7RA 1BSIA 5E51A 5C0JB 3GXNA 4UV4H 3DSFH 2H45A 5EN2A 2QTVA 3HUJE 1JZ2A 1T04B 3EZ8A 2DWSA 2WZAA 5LQBL 4K15A 3DV4B 3FHQA 1AVAA 2AEOA 3KDMB 2V3EA 3JTBA 3I02A 4TSAL 1RJZB 2YN3A 1E5CA 1SEBB 2AV1B 1OSYA 3GZPA 5FC9A 4I1NB 5BZDA 5IROC 4RNRA 1I8KB 3W39B 3IJ7A 3Q3GA 3FT3B 2R0ZH 1AZBA 3MUGA 3TNNB 5J9PB 5KG9B 5CJ5A 5E94A 4E0RB 3FO0H 3G08A 3DTUB 4HKJA 4PVBA 3CLEL 1Z5LB 1M42A 3FYIB 1EA9C 3VUAA 4BZ1L 2A38A 2P8MB 5AOIA 1JVLA 3RWIB 1G0XA 2QGCA 4DN3H 1VFOA 1WA2X 4O2EB 1BZDA 1AQMA 3T3PB 3OPUA 5F88A 1MDTA 4EO5A 5DWPA 2KPWA 4MXQC 5D5MA 2XIBA 3BWAA 1MFBH 2JJVA 2UWEE 2FHCA 3KJ4B 1JWSA 1YEEH 3WFHA 5JHDE 4DVBA 4K73A 4MXVF 4FABL 2BINA 4JFHD 2HVJB 1WZ1L 3LXBA 5DVOA 4IRSA 4HUVB 3GHBL 3MLWL 1J9CT 3VFWB 3E6FB 4U6XA 2VERA 3C08L 4PUBH 4XXCA 1OW0A 1IGIH 4Y1AE 4URTB 4WWOA 5F9OL 1FFNB 2DYRB 4OIIH 4U6TA 1ETJA 2GB2A 2X6BA 5HHPB 2EO7A 4AYBA 3CK0H 3BEVA 3IJ8A 4S10A 1KDJA 3R1GL 4AEHH 3S5YA 2G2PA 2MPAL 3HHSB 1LE9A 2DWDA 4ODVL 1OV8A 3ZN6A 3UTQB 4Z7AA 3ILQD 2DQCL 2VDLH 3N06B 2RACA 4MCYA 4DQOH 4UB0L 4NRYA 2NNCA 5E9AA 1BM3L 1EANA 1U92B 2GHZA 2J2ZB 4OFPA 1KGIA 3QXWA 4V33A 3LKNB 1HILB 4S0HA 3K6OA 3U2SB 4FA8A 4BD4A 1K8DA 2YAFA 3Q5OA 4X7SH 2FO4A 2AJVL 1BD2B 3ULUC 3AABA 3B6SB 3H3PL 4IBWA 1GMEA 4CSTA 4AEIH 4WUKL 5I1CH 5CP7A 3MLPA 1KIRB 3CLFL 4YUEH 1SDDA 4NQDA 4ZFGH 2AEPH 3ILPA 5CD5C 4XH2A 2IAMA 1IO4C 5FYJE 2Y06H 1V7NL 3DOHA 1I3RA 3N42B 1M7DA 4ZFFB 3RL1B 4OB5L 4PGDA 4XAKD 1HHIA 4UV7L 2EKJA 2WYHA 2OR7A 4R2GB 5LN8A 4YXKH 3VXOB 4IBTA 1PCSA 2EDQA 3IDMB 4NHUA 4X4YB 3BLKA 2NY4C 2A9MH 2WNWA 4O02A 5AVUB 4UT9A 5C97A 1G9HA 3RHWF 3VX0A 3NN8A 5D4QA 1XDTT 3BDBA 4FFYL 4OZFB 3LQMA 2TRHA 4IDLA 2QQNL 1C1EH 1TNMA 3B8YA 2V2WA 1N8ZA 3N40F 3RDTD 4JFYB 2VO5A 3DX2A 4PJ5D 3CSTA 3ZK0A 3NSFA 4GEJA 1FIGL 1UACL 1T3FB 4LBAA 4WEBH 3ULUF 1KIQB 2VDNH 1J12A 3EYFA 1JXGA 4OFKA 1GVIA 4HOXA 8FABB 4ONGH 2YPLA 1FP5A 4AIEA 2Z31B 4LARL 3UAJD 3SO3B 1SEQH 2JKSA 2NR6D 4FQJH 1ZT1A 4P2RD 2BVQA 4PLNC 3G6AA 5IVZA 2A74C 3MNZB 4IBLT 1ZS8A 4KROC 3VWJD 3QIUB 4EN3A 5BOPA 1AE6L 1BQHG 2FT8A 4B50A 5ESAB 3L3OC 1R3JA 1TQCC 1P4UA 3EKCA 3JZ7A 5D2LF 5DD1L 3MGAA 5DVNA 5GJSL 5DCCA 4RX4D 4M5ZH 4MJ4A 2UZXA 5JO5A 1CXLA 4PS8A 1KXTB 3GNML 3I9GL 1ZV2A 1NMBH 2Q8BL 3FFDB 4ZXBD 3V4PH 2LR4A 3FRUB 1PG7W 1QASA 1N5AB 4BFKA 3APDA 4N6QA 3EF7A 3QUYA 3RTQD 5DC2A 4KNTA 3JWOH 3MA9H 3NFPA 1TF4A 4MA8L 4QI3A 1B4JL 2X4TB 3BIKB 3TO4A 5B8CA 4ZMZA 2Q8AL 2VDKH 4HGWA 1T7XA 2W1NA 3EFOB 3VE0A 4WV1A 2HLAA 3E6HB 1OAKH 3RZCB 1N2RB 1NMCC 2GI0A 3DBSA 2JF1A 4JFDB 3C09C 4HHAA 2R0LH 4OLYL 2DWXA 2HYMA 5E56A 5IB4B 5C71A 3G5YB 1WFMA 3SPVB 5CAYB 1J1PL 3OZ9H 5D2NA 1Q8MA 3LRLA 3H2QA 2BM3A 1YEFH 3QRGH 3TEYA 3FN9A 4IOIA 4Q6IC 4BBWA 3DETC 4HJ0D 2CXKA 1N67A 2NTFA 3O4LD 3JYBA 4V2CB 3O6MH 3LEXA 5C0AA 3VB8A 3WG7B 2R2HA 1NDGB 3ESNA 3AXHA 3WNMA 1J18A 4KTYA 3K6IA 1FVCB 3LVEA 5IY5B 2JE8A 1JRHL 5F7UA 3RWFA 4MASA 5DQDH 1EMTL 4F5CA 3IE4A 4ABVA 2AC0A 3RWCB 4BZ2A 1SMAA 1L0XA 4G9DA 3WEBA 1G5GA 2KKQA 4IIQC 3GJFB 2NXYB 4X6BA 1OF2A 2Y4SA 3GBNH 3KPSD 3RJQB 25C8L 4GW4B 4OCWL 2X0VA 2UXGA 1S8DA 3QAZB 3S98A 3SJVB 1MJJB 3SKJL 3SBPA 3L3HB 3K1KC 4MNGB 1IKNA 1D5XA 3QXAB 2IAND 4OCSH 3RY5A 4FG6D 1HHHA 4U1LB 3T0ED 4KITB 1HZLA 1B3JA 5KSBF 1FL6B 3F7KA 4WJG3 4XVTH 1I85C 2CBQA 3L81A 1AXIB 3QH3B 5J13B 1UT2A 2B5IB 5EA0L 2A2QT 2PKDA 4N1HB 4QAWA 4QXUL 1TOXA 4XN5A 1G9MH 4P23A 2DYSB 1IT9H 2EDDA 5F0MB 1RHHA 3HE7B 5D7LB 4KFMA 3BZFB 3VFRB 3W9DA 3P9WB 1W91A 3OX8B 1LEIB 3MJ8B 2Z35A 4XMTA 3WYRA 5I17B 2KMWA 5D1XC 3CHSA 4TRPL 5HTSA 1F11A 5TFSH 4MZRA 1SLXA 4BRJA 3DV6A 3NH7L 4X6CB 4RGMB 5FO9B 1W0WA 4WI7A 2AQ1A 1IGYA 2O5XL 4OF3A 3D39A 2Q3ZA 4AJWA 4GNKB 4EN2A 1U58A 3KLHD 1GCFA 3N43B 3ROLB 4C4KO 5I1EH 5F8QC 3L3DB 2G60H 4U4IA 1NAMA 3ARXA 5GS0H 3S8FB 4HLJA 3V6OA 4NN5B 5JW5B 2GVYA 2XN1A 4GUCA 3O8XA 4MKTA 1TUPA 1S7WA 4Y9BA 4ZX6A 4PJBF 4CVUA 5TDPA 4ODWB 4LNRB 1MXDA 1OAUH 1AG6A 2BMKA 4KMQA 4BFOA 2BS8A 1KPUA 3MNVB 4GQPH 4Z7UF 2BSRA 4UZUA 1VENA 2B2XL 4H8WC 5D72H 1RJYA 2COQA 5F96H 1KLGA 3GK8L 3WLWD 4P59L 4MMYB 2A73B 5C0BE 1U95B 3P40A 4PGBA 5ALCL 4R26L 2XWBA 4PHZA 3HG1E 3ALXA 2BP5M 3O3UN 3P11L 2FX9H 5CEZE 1N26A 2VMCA 1TFHA 3Q8AA 2XRAH 3CCHB 3PG2A 4PRDA 5HYIA 32C2A 2G3XA 1DJXA 2ZWKA 5A2LH 2IGFH 3WAJA 2HMID 1DVSA 3MRPB 3DX6B 3KL3A 3PHAA 4K23H 4A67A 1TJGL 2JCCB 2BSSB 3LZNA 1RUAL 1WJ3A 2D7OA 3US9A 4P05A 3HG5A 5FXCH 1P9MC 3L95A 3NYKA 3O9WD 2Y2YA 1I8IA 1QZNA 1A3LL 3GMLA 3ZTJH 5HJDA 1PGRB 3MO1B 5E00A 1NINA 4OCYH 4QXTB 3O6LH 5KVGH 5AZEL 5TF0A 3FQUA 4OZFH 2QADD 4M5SA 2EEXA 4GKSB 1AJ7H 1YECH 3MNWA 4GG6A 2H1LM 4BKLB 1RZGA 1GS6X 1VGKA 5KJ4A 2YPVH 1YEDB 3U0PB 4LCCB 1FAKT 1Q1JL 3BVXA 4D8OA 4BH8B 1F00I 1YNKH 5LG1A 3OJ2C 3S36L 4MYWB 5J6SA 2EUVA 5AW9B 5G5DA 3PREA 3VXMB 1SN0A 4QJ5B 3TJEH 1N6QH 1VERA 4JY5L 3QQ4B 4MD0A 3VRIB 1HWHB 1KIUA 4IGBC 3LEYH 4N0FA 5LXVA 2XPZA 4Z6AT 1KNOB 2DQIH 1J8HA 3GMOA 3SE8H 1BPVA 1HH6B 3E8UL 4F57H 4JRFA 1IEBA 3X13A 2MCPL 4AZ8B 1IEHA 2OZ4L 4DP7X 3OJMB 1QG3A 1JF5A 2Y23A 3HN3A 3MPCA 1XZ0B 4WO0A 4ZNEA 4NZJA 2PCXA 5FO2A 5D70H 1CDYA 3Q8FA 3RQ3A 4B9GA 2QPUA 1MFVA 2HG5A 4G70B 1SLVA 5HYSA 1IFHH 1S46A 5ID1A 4PRIE 5ERWB 3BUBA 4YDNA 4QRUB 3LKRB 3AG4B 3KPRD 4JANB 3CD4A 4JFZL 4YHKL 1HCVA 4CDHA 3NCXA 1A7OL 3OG6B 1A1MB 1B0GA 4JFFA 4Z7WA 1T1YA 5JORA 2GSMB 1HI6B 2AQSA 2CUMA 2K70A 3UZQA 3LS5H 4NUJB 3UG3A 2EVIA 1AMXA 1KBPA 2A9NL 2B1AH 1SXSA 3L9BA 3ZY7A 4ELMB 4Z23A 1JZ8A 5KANG 3ATDA 5EO1B 3ULVC 2DM2A 5F9WB 1TVBA 1NGYB 4OFYD 4OCNC 4PRHA 3B9AA 5GJTH 4ZQKA 4P2OD 4BK5A 1HCFX 3NIGB 3DXAD 4GKNA 3DGGA 3KLSA 1G1CA 1NGPH 2X4PA 1NDMA 2E8YA 5TPWH 3L7EB 3WHXA 3DOSA 4YFEA 1TU2B 2NMSA 5E8OB 3L17A 1FN4A 4JM4H 3BZ4B 1RK1A 2K4WA 2WP3O 4KH9A 2J20A 3PQYE 1U3NA 3EBGA 1S7SA 4C8XA 4P5TA 2Z0UA 2F5AL 2X87A 4HV8B 3QORD 2XQYG 2YARA 4GI6A 4RMVA 5HYQB 5IBUG 3B5TA 1ND0B 2V17L 4JO4L 3LQAH 4MCZB 4PP1D 4YXLL 1MIMH 2BSCA 2LVCA 2AP2A 1T6WA 4AGOA 3GJFH 3KG5A 3QNXA 4LU5L 4Z78B 1YNTA 3CPLB 3MLUH 1RUML 5IUSA 4AKQA 2CK0L 1D9KC 3F6IA 5CILL 4H8PA 5FA4B 5I8KL 2BVPA 3SKNA 2W60B 4UUJA 4HGMA 4ZAKD 5J11C 1WEJL 2DD8H 2BPBA 2WXPA 3VFSB 2ITDA 5A2JH 4FXGA 3DJ9A 3IJSB 1IAOA 3WFEH 4HFWA 4N0RA 1OP5H 2GK2A 4F7CA 1OK0A 2EE6A 4G6JL 1K3IA 1IM9A 1WBYA 2JELL 2BDNL 2E5EA 4F2ME 4PJXA 2FGWH 4Q7DA 3MRFB 4KK8D 3HRZC 1OP3H 4KJQC 1BZEA 2JI2A 4L4VD 5I6NA 2BERA 2H8PA 5L88H 4DCQB 3EYQC 3LD8C 4G6KL 2HVKA 4L8SC 2DAVA 3A21A 4JFEE 3VTTA 1DVFD 3EYVA 3L5XL 4PJAE 1Z32X 5BUGA 1TYRA 4PRBB 3OKMA 3TL5A 3ARBD 5MI0C 2EVFA 1EHNA 2PWGA 3V4UH 3TVMD 5I18H 5DI8A 4I77H 4Y4HC 3F65A 2QPDB 1DBKH 1OT4A 2YZ1A 4DGYH 3WBDA 1Q9LA 1IGJA 4NO0B 4K9EC 4LNVA 3CFDA 1BEYL 2IV9A 2A9AA 4W9HC 43C9B 1EDQA 1VZHA 3EJJX 5KZCD 2JTYA 1RIHH 3O0RH 3I3BA 1ETB1 4BZ1A 4MHHG 2DMHA 3IDXL 2BSED 1YYLL 3ESUF 5ID0B 4XE5B 4TSBH 1S9YA 5DJ0B 1NCNA 3KXFE 1BOGA 1XH3B 2FHFA 4OQTH 5C0ND 3ZZSA 2GSIB 2MCMA 1LK2A 4KDVA 2P5PA 3ULUL 1RUPL 4L5FE 4P3DB 3TBTB 1MRFL 5DLML 5T5FH 5AAWC 4KHTH 4ODSL 3K91A 1MEXL 1SQMA 2VLKB 3CFCL 4PRAB 2YK1H 1JOIA 2F74A 1AGDB 4G80B 4OZGE 4YDVA 3VXQA 4MA1C 5AZ2H 4ACPA 2WMPB 2IADB 2PXYB 3ZZ1A 4LLQB 2XY1A 5JPMC 1I3VA 4ZG1A 1C08A 1T1XA 5JOFB 1PAMA 4ZS7H 1F58L 3NCJH 4DEUA 2IBBA 1V10A 2MKLC 4QHKI 5INDB 4CMMB 1KLFA 1E4WH 2YXFA 4NKMA 2DWEA 3UAJA 1ZSDA 4G9FE 3MV8E 4GKLA 1T20A 1XB8A 2DLEA 2LV4A 4XNBA 2WXQA 2ZXDA 4PH8A 1BQKA 1E9PB 1XF3B 5MEOA 1MI5B 3QJFB 4KI1A 2CLRB 1QP1A 3EOTH 4RX4A 3JUZA 4UQIM 1BVNT 3Q1SL 1EXHA 3OWEA 3FFOA 3ZW3A 5C2BL 2D7NA 4KO7A 4S1SH 4DFHA 2A0LC 1XWVA 3AY2A 1F3JB 2GTQA 1SDAB 1XF2B 5L2JB 4KZEL 3ULUD 3W81A 2Z8VC 1K4DA 3P0GB 5F0JB 4NZUL 4F8TA 2GY7B 2EH7L 2YAQA 2K3HA 4FFYA 1CE1L 2ZKHH 2XJKA 2ZNWA 4OLXH 5EUOE 5EU5B 5CD5D 3JWNC 4HWBL 5C3IA 4AC2A 1SF3A 2LU4A 3RGVA 1PKQE 4JQIH 4KXAA 4KI5C 4A55A 3FB5B 3AXIA 2C9RA 4TOYH 3B2VH 3ATEA 1JGVH 2PTUA 4M6ML 4PCSA 4Z3FA 2G3ZA 2VM9A 2WM0A 3FB7B 1T83C 2ZXAA 5KBKA 5LG6A 2NY4D 1OAJA 2NY5H 3ML8A 5D7JA 3PIQB 1B6DA 1OOAA 1MCOL 5I8CA 5IZ7A 1CYGA 3BPCA 5FYJL 3IGAA 5GSVA 4NLAA 5CBAA 4G42A 5FYLH 3GKWL 1KENH 4NQCD 1NFIA 4A6YH 3DKHA 2R23B 3PWJA 1HZHL 3GUTA 2VDRB 3F83A 5B1JC 4UANA 1PBYA 2ZXWB 5F7WC 2AQ2A 4XBGB 2PYEB 1MY5A 4E41B 3FQNA 4LCIH 4TNEA 3GFUA 1FQ9C 2K6WA 4M9PA 1JF1B 3T3PE 2DM7A 2HLFC 3A4FA 4Y5YC 5IW6A 4UCFA 5ALBL 3V2AR 4ERSH 4G2AA 4M3HA 1DBMH 1XTMA 5IM7A 1SY6H 2ZWLT 3JSSA 1GOGA 3U4BH 5EOCJ 1TKWA 3U7WH 4KI5F 3UTTB 2W9EH 3T5WA 2Q86A 1HJBC 5ITBL 2BZDA 4FFVD 2F6AA 4XPBH 1RZPA 5L7XH 4KROD 3VI4B 2G75B 1M05A 1WITA 3KPSA 5PCYA 2XQBH 3HBQA 1TSRA 3DVGA 2JI1A 3WLBB 1VF5C 3KPPA 4G7YL 1BQRA 1EEZB 1YEIL 4MB4A 4XP5L 3BE1H 3CUPA 3OGCA 4N26A 4Z0BL 4DKAA 1SGKA 5D6DC 4LVEA 2E7LC 4LE8A 3UROR 2AXWA 1OGSA 4L1SA 5I1DB 1ODAA 4WQOA 4D3CL 1YY8A 4R7VA 1BZ7B 1Q94B 1ZTMA 1BXXA 4KO9A 2BNQA 3MA7B 3RUGB 4FG4A 1RH8A 5E2TH 1W6LA 1YEHL 4FNSA 1BD2E 2JK5B 3E2HB 1PY0A 3HG2A 3WN5A 1X7QB 3GTNA 1UATA 4NO3B 4MDIA 4RGNB 4YQXH 1YUHB 1I1AB 3FSWA 2A77L 2YN5A 3QIBB 4ALAH 3HR5A 4YZFF 4O58H 3VJ6B 2DTMH 4FXTA 3TC9A 3OC8A 1U8JB 1QSFD 3UIZA 2BVEA 5TE7L 2BNUB 2GFBA 2OS7A 3QBTB 2JI3A 3BH9B 4KKLD 1NZRA 2ICWJ 4V1DA 3ARVA 4Z3JA 3TZVD 4GRLC 3HHMA 3ATAA 3PWVA 1N3NA 1JGLH 3H9YA 1CFBA 5BQ7A 1ACYL 3WMSA 4ZUSB 3DTDA 4YSSA 3CDFA 1OXYA 3P0YH 1CZ8L 1LP9A 4UTBL 1INQB 2CIIA 3FCSA 3U36B 4GFTB 1M7UA 4EVNB 4PCYA 5D7IB 2OMUB 2PPAA 2CLVA 4NPYA 5A2FA 4OLVH 5FM4A 5H37H 5IP4A 4WI4A 4Y19D 1A22B 1ASOA 1KXQA 2FJUB 3JTSB 5TE4H 2PCFB 4IS6B 2B3IA 1E3ZA 3GSNA 2AMUA 1TQUA 4MJID 3GTTA 1E5ZA 4B60A 4PS4L 1KCUL 5DJYB 5D4IA 4EZKA 4HD9A 1IFRA 5FW7A 2Y0SA 3K6FA 1ZGLM 1SYVA 4HS8L 1I3GL 4X9FA 2Z93A 3VFVB 3P77A 1IZKA 3SD2A 1S7QB 3DJTA 5EZOL 1XH0A 3PDOB 4HT1L 5J3HC 1D6EA 2XWCA 2BNRB 5M7QA 2F58H 1CFTB 3UPAA 3ZL1A 3UC0H 4H8WL 2F8OA 4U1NB 1SBSH 1KEMH 3J07A 3SE9L 3VXUD 1WD9A 4HCRL 1UA6L 1B4LA 2PPDA 3RWJB 3VD2A 1NLBL 3MRHB 3O9WA 5I1LA 1C12B 1NCHA 3QEGH 4JFPB 3S8GB 1AGFB 3LNDA 4WW1A 2UY6A 2UZPA 1WCBA 3KGTA 4UDUB 5H35B 5BW7C 4NZ8A 3VFOB 4X0KB 3TEUA 4DEPB 4X6FA 1NCBL 4HJIA 1E90A 1NCAH 3M45A 4HH8A 1URLA 2ZCZA 1O6TA 2ATPA 2IIJA 3QYCA 1NGZB 4YS4A 1M1XB 4F8LA 4WWKB 4PS7A 1LEGA 5F7BA 5AVXB 5GISH 3LKSB 4POZC 1FZOB 3CZLA 4LQ1A 4NYLA 4S1RH 4XNMA 1DBAL 3TWCH 4BJLA 4HJJH 1OAYH 5AW5B 3JUYA 3OHXC 1MFCL 1OSZA 4G1MA 4JFDE 5E1GA 4HDIB 4TNWK 4FNLH 3RBGA 4BGDA 1JHTB 3WJJA 3VGGA 5IBTL 3DDFA 4B3EA 1CFSB 3TBWB 4L3CA 4YBQC 1BDYA 1D5BA 2KH2B 2YQ3A 3KYOA 4LZKA 4BE6A 3HB3B 2NSXA 1BLNA 3HZKA 4NCDA 4RMUA 4XCFH 1MCFA 1VZIA 3FF7A 4Q56A 3VGAB 3D7PA 1UXWA 1IAIH 4XMKH 5EIQA 2VMJA 3KS0J 3VNZA 3PYCA 5CJ8A 3STLB 5GSRA 3AREB 4APXB 2ICCA 3H2PA 2Z31C 1PLGH 4B53A 2IDTA 4Y2OB 1KXVA 1T6VN 3MV9D 1J1XL 3S34L 3X14A 4CBPA 1UXMA 1DQMH 1MHCB 4HEME 5IHWA 4KY1L 3F3HA 1GOHA 1ROWA 1U8HB 2XN9D 3BLBA 4EUPB 2ENJA 4PW4A 4HWEL 1BZ9A 5KYXB 2NY3B 2VXVH 3QIUC 4JRYD 3ABMB 3N1MC 4IHOA 2FB4L 2ICWB 4XNXL 4ORGA 1UWYA 4RWYL 1S9XA 2K6YA 1E7VA 1KXHA 4G5AA 3UO1H 4KNUA 4F7TA 4MCNA 3MACH 1NKGA 4O2FA 4N6RB 2CGRH 3SJVE 2OCCB 4ONFL 4LHUA 5CEZL 4MNGE 1Y1UA 1P6FA 5TH2A 3O6FB 1R5IA 4PCKA 4YE4L 3O4OC 4ETYA 1PZUB 4ZSOB 3D85A 1F13A 2LW3A 1JZ3A 3ET9F 4BWTA 4LFHD 5JOEA 3PXLA 2BIIA 1EJFA 1NCIA 1CFNA 2W88A 4JJOA 3K4AA 4NZTH 3U4KA 1QRNB 3QEHA 3LNGA 1MOEA 3JVGC 3UZEA 5IFHL 5IVXF 4FLRA 1IZJA 5FUZH 3RKDD 4JMNA 4PRPA 3UFIA 4YSAA 3BN9C 4PY7B 4Z95L 2VDRH 5KBDA 1W0VA 4H8QA 5D7LE 5DRXB 3JWDC 1CICB 1TNNA 5AOKA 5DS1A 3OR7B 2K3TA 2MOQA 3RHWK 3NCYP 2DWTA 3EAKA 2OZ4A 4A2MA 2IXQB 3PJSA 2E47A 3P30H 2RFXB 4OR1A 4ZPVB 2E46A 5EO0A 3ULVL 4PLJD 1UM4L 2XV6B 3OLEA 4WSKA 4X6CE 4IGBD 5CU5A 1AXTL 1I1RA 5AVYB 1GYWA 1MAKA 1XF5B 1I1FB 3QR1A 2X28A 3QO0B 2Q0ZX 5SX5K 1ECZA 4JO8A 3OKKA 4NO2B 1GTFA 1QA9A 3BZDA 3KEHA 4HGKC 4K71B 3BI9X 3MGOB 3IXAA 3QUXD 5LWYL 4I48B 3ZE1B 3DTXA 5KYNA 2YAEA 3FHEA 3HC4L 1GZHA 5HVFB 3QQ9C 1CLOH 2H1PL 1G9NH 2VH5L 2VLJB 2EEBA 4NHCL 1JD9A 2CLZB 2K8MA 3CIAA 3KYAA 5TK4A 1ZLUK 3NRQA 5KVEH 1N12A 1OP9A 2CU9A 5HI3C 1QFPA 3HZMB 5KBPA 3QJHA 1NBZA 3FRPA 2VDMB 4ZTPH 5IKCA 2Z92B 3UH8A 2IQ9H 5ILTL 1ANUA 1KFAL 4MAYB 1WFUA 5F2FA 4J8RB 4L4VA 4JPSA 1AZCA 5FHAH 1T1WA 3KYKL 3MLTA 4NNPL 4UT6H 1EZVX 1KY7A 5DJXA 5E5MA 3TBYB 3MRMA 1T0NA 4B9PA 1NCWL 4M43L 3V4VL 1KZYA 5HHVH 2H3NA 4H8UA 3ZL2A 5DD5L 1RZIA 4HX1B 4AX3A 2M83A 4DP6X 1XR8B 1DQIA 3LPWA 3A23A 2AGJH 5FO7A 1AS6A 3NFNB 2JCCE 5HDRA 3QPKA 3LZFL 3BVDB 4JGUA 3GXPA 1EEUA 2XVLA 5EEYA 2EYRB 1BV8A 3WTSA 3AM8A 1A6UL 1AGEB 1Q0YL 1KPVB 5ACZB 3EOBA 5I19L 4QTFA 3ETSA 3VXRD 4F7MA 5I74B 4MX7B 4XOCA 2CDFB 2BSEA 4JDTH 4IKJA 3B7UX 3FDWA 3GSQA 2FGZA 5JW3H 3TEWA 4WU7B 2IH8A 3GI8L 1Q9OB 1OHZA 4HIIA 2OTUB 5IHZB 3K6DA 3LRMA 5IROA 4IOFD 1K6QH 5MEQB 4K9EL 3N40P 5TQ2L 4IBZA 2CIKB 3FQ4A 1QLEL 5IJBC 3QFJA 2OA9A 3BVWA 4HKZB 2VKXA 5KVFL 4YWGH 1ED3B 2RQ8A 1T4KA 2HX7A 3VXME 5IB2B 2BRRH 1NIFA 2BY1A 3L9RB 4BFGA 2FL5A 4FA7B 4DH2A 1B9ZA 2WBWB 3L2MA 3NGBB 2ZYHA 4RMWA 4PGCB 1IM3B 3QDMB 3WY2A 5A2IH 1CVRA 3GINA 5I19H 1TQBB 4I9WE 1YYMH 2PWEA 3A5VA 2AZAA 5E4IA 3B2UD 4FTVB 4KJPC 3LJ3A 4X6DB 43CAA 2DW5A 4DQAA 3TESA 3C5SB 1M9WA 5DD0L 3K6SA 4GIAA 2CD0A 4UQEA 3IMSA 1BBDL 1FV1A 1ZKAA 3ZHFA 1VPOH 1O0VA 4IBQA 4P9ML 4JG0H 5T3ZE 3W5NA 4G6MH 3RP1A 1JK9A 4BK8A 1WSST 1IBBA 3GHPA 4KJQD 3SE6A 2V9QA 4ZODA 2ESVB 3O11A 4KKRA 2C9XA 1N4XH 4FQLH 3PWUA 2OULB 4U1KA 4F93B 2NY0B 4NN6B 4G7RB 3HNTL 4RESB 8CGTA 1KDIA 2BY0A 1T7ZA 2F53E 2Y25A 3MRJA 5DJ2A 3RB7A 2XETA 1PEWA 4K3JH 1F5WA 1X9UA 1MFAL 1JD7A 3Q6FA 1OHQA 2X4OB 3IGFA 4YGAB 1RZKC 4ANWA 2BFVH 5FHBL 1F41A 1DDHB 4EDWH 1QLRA 2VJ8A 3L3KA 1Y7VA 1PJWA 1DL7L 1E43A 1QHPA 5E03A 2DN7A 3N41F 1R3LB 2E7CA 3DJRA 5F7FA 5HJ3B 3MLSH 4ELME 3BMWA 3LN9A 3Q6GL 3GMMA 3RNKB 3SDCB 1Q9WB 1OARH 3IJHB 2YEZB 3MRBA 2XU9A 4AVHA 4FYSA 4AYID 1EHLL 4YHIB 3V0EA 1U30A 3CVBA 2OXGB 2Y3NA 3EUDA 2F5BL 4QJ3B 4Z7QB 2BP3A 2WK2A 1OD9A 2P45B 3BFWA 3DYMA 3MRCA 1QUNA 4HUUA 4M7LL 1UASA 3NIGE 4F9LC 3H42H 1GGIH 3MBWB 3U4EB 4KTEH 1SBBA 5IMKA 2X70B 5AAPA 5IR1B 3RVVC 1ZT4A 1JI2A 2ALWA 5HD8C 3DVFA 4CMHB 2OK0H 3FQWA 1JPTL 4AZUA 2W0FA 4M00A 1DSFH 4I3SL 5D4HA 3U30C 2I9TA 2XTJD 1QNZH 1IB5A 4N0YH 1JP5A 4HPYL 4M8VA 4YHPB 2XIIA 3QWRD 3MFGB 3ARPA 1NCGA 1CJYA 2J44A 1MPAL 3MODL 4HZAA 3ZHDA 1UZ6E 2LLNA 2EYTB 4EUPH 1EDHA 4AMWA 2N4IA 4W70A 1IC4L 2BLFA 3BT2L 1E6OH 4L5FL 4XZUA 4E5XA 1H3GA 3IFOB 5LN4A 3HNSH 1DUZB 1MCWM 1DQLH 4ONHB 3ZTDC 2GAZA 3TJPA 1B3IA 1R0AH 1DLHA 2WY3B 4HBCL 2AI0L 5I5MA 2A74A 2C1OB 2EVJA 1ZDSA 3EYOA 4X5WB 4WO4B 5HGBB 1VFBA 2HT2C 3PAYA 3L3OA 4I3RH 4G7SB 3IFNL 3Q13A 4HWBA 3QUMH 1AQDB 4BH7B 2WINA 4R0LC 1KYDA 1UG9A 2GJ6B 2A6KB 2A0LD 3K71B 1JHLH 4BINA 1CR9H 4ZW6A 3V9EA 3RU8L 4BQ9A 2EKSB 3OPZH 3P4OA 4X98B 5BO0D 4A2LA 4Z1PA 5GZNC 2I27N 2B8OT 2FYYA 2PTVA 3TT3H 3QJRB 2I25N 4NWTL 3VYNA 1I9RH 3K5RA 2BP8B 5HY9A 5IB5A 2PCYA 3Q06A 4L9LB 1UB5B 1MAMH 2I9LB 1OAQH 1S7VB 1WO2A 2MQCA 2K7PA 3DECA 5DVKA 1V3MA 2W9LA 3D8MA 4IJ3C 4UAOC 3P9MA 2IDCA 2X1XR 2MCG1 1OCWL 3MFFB 1QSFA 1NAKH 4JKKA 3WJMB 5JW4R 1A3ZA 4M7ZC 5EU4B 1A6WL 3WE6B 2VL5A 1TJHH 2NW2A 4HUXA 5D6CA 5I8EA 3VFTA 2CKBB 4QHLA 4P3CL 1JZIA 3RVTC 4OF7A 2OQJB 2VXSH 2X4NB 5ADPH 4Z0XB 3GXIA 4Q6IA 3LH2L 2X42A 3NJKA 2OL3H 2UY7A 3OKLB 5KSBA 3HPLA 4MLSA 3S5LA 3ABZA 5HGDA 5JDSA 4MB5A 3RFRA 3VH8G 1WRFA 1FO0H 2IEPA 2P5WD 4PI0A 2VOTA 3RKPA 5HVWA 2I85A 2XJLA 3BP6A 5AOZA 3AY4C 4R8WH 4YJZL 4N1EA 1CG9B 4XR8C 3TFBA 4LSSL 2AAAA 4GW5A 4NJAL 1X5LA 4OIAA 5FIEA 1A6VL 3MLYH 3WXWH 2V9RA 4Q14A 3EO1A 2DQDH 4J7RA 5CBEB 1G7QA 1JV5A 4IIQA 3UBXB 4CC1A 5CJQH 1EO8L 1TYEB 3I3EA 3ZMEA 3TA4D 3QCVH 4JO2H 3ZTCC 4JM2C 2H0EA 1FDLH 2H6PB 4XP1H 2GSGB 2NPLX 5C0CA 2NNFA 5C0EB 3GXUB 4CBZA 4ZMPA 4UILH 4MQ7A 2ZG1A 2ZPKH 1MI5E 3F62A 1ZEAH 1ZA3A 3UDWC 4ENED 3WN6A 3OB8A 3HKFA 2EC8A 1E6JL 2MOVA 3VXUA 3C6SA 3UO8B 4BSVB 3SGEI 1I85A 2OM5A 4D94A 2FQGA 1IX2A 3D4YA 1MVFA 5CMAA 3WUWB 1EDYA 2F1AA 5IJVA 4KHXL 1X7SA 4BSWB 4PJBA 2DYPB 4KJWC 5E7FA 3SDDB 3VI3B 2ZOKA 1ZJAA 4RISL 1PQZA 5TQ0L 1U3HB 3EJZD 3L3GB 2R4SL 4NKDB 1KEGL 4HIHA 4UTBA 2JIXB 1BJ1H 5DQJB 1OL0A 3UBFA 3U1SH 2HRLA 1ZA6B 3HPJB 1E4KC 5D1XA 2ENQA 3M7FB 1A5FH 4PY8J 1S5IL 1HNGA 4LBEB 4ZMWA 1JGEA 4U0RC 5HPOA 2BC4B 2FHBA 4JM2F 1F4AA 4F58H 1BF5A 3HC3H 2WGXA 3L1OL 4ZMYA 4C47A 1KTCA 4HHWA 3C5ZB 5FFLA 1P6AB 2OYLA 3BKYH 2W5PA 3BVVA 5HDWA 5HHQA 3Q2LA 4LLMB 4OLUL 5FF6B 2ZWZA 5GGQH 3QQ3A 4UF7C 2Q3AA 3CSFA 4Y9CA 1NLDL 2ERJC 3H3BC 2MCAA 3O2DL 4PJFF 4ZOCA 2AVGA 3HN5A 4LP8A 4YDIL 5EN2B 5D8JL 2WXKA 1AANA 2FEEI 3U7YH 4KKBC 3I9PA 3K4ZA 4EDXA 1FFPB 5I1KH 3II2A 3MCG1 1U8OA 3LPPA 3ZXAC 3MRKA 2F1BA 3D4ZA 3K81A 1XIWD 4LHQB 4JKNA 2XKNA 1X9LA 2PYEE 4E41E 5BZDB 1B0IA 3OKNA 4XP6L 1Q72L 5F1IA 3MV9A 4ATWA 3HKZA 3L4CA 5E94B 3G08B 2K9UA 3MRGA 3HG3A 4HKJB 4P4KD 3AS2A 4HCRA 2APXA 4UQAA 3WIIH 3ASOB 3ZL4H 1RV6X 5F1NA 4JRYA 2OMNA 5F3HA 5F88B 3FUIA 3UTTE 3VFUA 5D5MB 2O72A 3BWAB 4Q9QH 1FJ1A 3EYSH 3VI4E 3MCYA 2AJXL 2YIHA 3WFHB 1J11A 4DVBB 1LDPL 3LNFA 3REVA 3LIZL 3BQVA 5E8NA 3MKGA 4J39A 1VADB 5A6MA 1N5YL 3UJTL 1W8NA 4ELKA 4R90L 2W80C 3CQPA 1P9MA 2UWEF 2XPGA 3FULA 1YN6A 5ANHA 1QSEB 5AB2A 1B2WH 3BEVB 1MLCA 3G5XB 5D4JA 1FZJA 1C7TA 5I1IL 3TA3D 3PHQA 2DWDB 2JTDA 1LE9B 1XX9C 1NEZA 3PL6C 3BPNC 3Q0HA 1HEHC 1JMZA 2DBLL 2VABA 2BZ7A 3LX9A 4MCYB 4NRYB 3RUGE 5EZLB 2FIRT 1P4IH 1K5WA 1CDHA 3CVHH 3NESA 2B15A 2VERN 1G7LA 1TMCB 4RGNE 4Y8AA 3AXLA 4NIKB 4NFDA 3RTLA 1B0RA 1I7RA 4P5SA 4HOWA 5IEHA 4K7PL 3BIAX 1K8DB 1P7QD 2ZOLA 5SWZB 3CFBB 3MYJA 4LP4A 2DQMA 3G6JF 3VRJA 4P5KA 5GGRY 4KRNA 3SYOA 5IJDC 3DUUA 4NQXA 2PTTB 1LO3L 2YAHA 5CP7B 5IT2L 1JZ6A 3D52A 1SDDB 4IGBA 3RA7H 4YBQD 1F3RB 3ILPB 2WUCL 5IGXL 4XH2B 4AGQA 2IAMB 4NI6A 4XX1G 1WAAF 3ULSB 1MCHA 1I3RB 2GK0A 1M7DB 4OM0L 2YO3A 4PGDB 1HHIB 2YPKA 5EOQL 2FIKB 3JWDL 1D2OA 2ADFH 1IARB 2Y1ZA 1P84K 1E9OA 4O02B 3T8VA 5D7IE 1QYGL 4UTAL 5EU6D 2EAEA 4QYAA 2KERA 3NN8B 5FYKD 3T4YA 3H85A 2IWKA 1DBBL 4FNTA 4GI8A 3CZUB 2WCPA 4AVIA 5L0QB 1N8ZB 1GTNA 1RIVH 2ETWA 1TJIL 3UTZA 1V27A 4W9EC 4XGZB 5C08D 4PD4K 3QHFH 1S7RA 3BGFB 4J4PC 5AKSA 1KJVB 1MIEH 4YLBA 3CZNA 3J7HA 2GYSA 3LH8A 4I4WA 4NQVA 4EEEA 3DSNA 3ISWA 1OTUD 1DE4A 1PD0A 4A7SA 4DGVH 3FCBA 3DX8A 5TF1L 1AC0A 1B88A 2BNRE 1ZT1B 4JFTA 2N59A 2NNAA 2HH0H 4AEFA 2BVQB 3G6AB 2MIZA 5IVZB 1G7JA 1MW3A 1ZS8B 4KKPA 4QMEA 4JKLA 3D4CA 4EKXA 2AABL 1TSHA 4DO5A 4E9YA 4EN3B 1E65A 1R3JB 2V7NA 2Z8SA 1EUUA 4YL4A 2D2CC 4EZMA 3UJJL 3SCMC 2X4RA 2UZXB 1I1CA 2JJUA 3C60C 2H6UA 4RFNB 3S8WA 3VDAA 3A67L 3AS3A 1ZLUH 3VXRA 5I1JL 1A7RH 2WAHA 4I85A 5JQIB 4XO9A 1MVUA 2UX7A 3MZGB 4JL2A 5C0RL 3I75A 1NKRA 2Z1KA 5K9JH 1R9FA 3BXNA 2DLHA 3WTUA 3QUYB 3HBPA 5DR5L 4PJ7B 3V8OA 2VRKA 3EUUA 3UBGA 2VLME 3NFPB 3IKCA 4EOWH 3P2DA 2B0SL 2CJUH 3DUSA 4IU2A 3TO4B 2WSDA 3Q9PA 2NUTA 2CM5A 4MFHA 4TVPH 1NC2B 2WWKT 3VE0B 4DPBX 5ISZD 4WV1B 2HLAB 4XB8A 4KGJA 1MW1A 4IK6A 3NRPA 4Q9RL 3QG6A 4EI5C 4PLKD 4QXGL 5SWQA 5B4MD 1D9KA 4HHAB 5FOJA 4RH4A 2BVUA 2OMBA 1Y18A 2M2DA 5D2NB 3V4VA 2ZP8A 5KSAC 5HI3D 1KMGA 4RDQG 2Y7MA 3ARTA 1CGYA 4IOIB 4XOBA 4UAHA 1QBBA 5T1MA 4APQA 3EJTA 2AERT 5FECA 1ZANL 2YQBA 1T22A 1DLFL 2NTFB 1GYAA 4TSCL 1UD5A 9PCYA 1EK3A 5I71B 2W95A 3DHPA 3HRZA 5C0AB 3ELQA 2WC7A 5F7YC 3WIFB 2OP4H 2R2HB 3QPXH 4F33A 3T4AB 4L8SA 3TO2A 1AGCA 3HS0C 2VN4A 3CWGA 1NEPA 5L8LB 1JNLL 3IS1X 4P4RA 4U7SA 1CCZA 4WRLA 1BGXL 3RIFF 5KBLA 1NGQH 3TT1H 4YDKL 4Y4HA 2FECI 3IU3A 2C9PA 3TNMA 5HYJA 2R56L 4A68A 1OAZL 4X6BB 3SKOB 4U1MB 5DT1L 3C6LC 4A7VA 1MHPL 3INOA 4TQIA 3BN3B 4ZSOE 2J8HA 4NZRH 3FK3A 1S8DB 5F97E 2VW7A 3TIEB 3R8QA 2D31B 1HWGB 4NPKA 4N8CH 5DJCA 3QUHA 2QTEA 3IRZA 4LSDA 3PQYA 4JZJC 4AL8C 1PLCA 3ZTJG 3MZTA 3BW9A 1HHHB 1RZKL 4HKXA 1QRNE 3ZHLA 3WOVA 1C7SA 1PG7X 4L1LA 4D9QD 4OZFG 3RZWA 2AK4E 4EQ2A 3DRTB 3MLXH 3IDYB 5IMLA 2VDOB 2WN3A 2ZUQB 3QB7C 3NTCH 2Z3FA 2BHYA 2X2UA 4P23B 4D7BA 1MJ8H 1WFJA 1RHHB 3W9DB 2BHFA 3VACA 1HCZA 4TXVB 2Z35B 2AJYH 5DJAB 2H3XC 1S3KL 2ZKXA 1CTNA 5BS0D 1XCWA 5JPMA 4GXVL 4R84A 5CLZA 4BQ8A 3UTSE 1JJUA 5ABZA 4KJPD 1OCZB 2AMGA 2N3JA 1W0WB 2UX6A 3RNQA 1B4RA 1IGYB 3PWPD 3WKML 1FNSH 5F7NC 1U8LA 3D39B 2A1WL 3AQZA 5C6TH 3ZE1E 1M2VA 4GMSH 4L3ED 1J88A 2WKOF 2VLJE 4ZUVA 5K9OB 4LCYB 3MLVL 1NAMB 2C26A 3L4YA 1KPRB 4HIPA 1B9KA 4JFEA 4KPHL 2G30A 3GI9L 3H3KA 4F8OA 1HYSD 3T3MB 3E1ZA 1AO7B 5A16A 4QDGA 4TULH 2E3VA 2CCLA 4FG2A 2H26B 2EEAA 4QJ4B 2ENPA 3SOTA 4L8CA 5I8OL 5A3ID 4PJ9C 4PJIF 4RCAA 5TDPB 2F7QA 3VG9C 3KGUA 4KAQL 4OQ1A 1OWRM 2WWMC 4GPVA 2BMKB 3QGVA 3TBSA 5T3ZL 1F4XH 1KPUB 2BSRB 3B5GA 4PV8A 3UCQA 4YXHH 1KLGB 2SODB 3ZE2F 4M48L 3TTYA 4Y89A 4A7GF 4PGBB 4E9WA 3NIFB 4JPWL 3RVXC 3FUKA 1QAWA 1IC7L 2X6AA 2E9BA 4HAKA 5CZVH 2BVTA 2GQHA 1R3KA 1TZGL 1C9SA 5JA8B 4XNYL 2FYVA 3UMTA 4A37A 3FU9A 5B3NA 2RCSH 4PRDB 2WQWA 5C92A 1CF8L 1MG3C 32C2B 3E80A 5AL0A 2D9CA 2CO6B 1XGYL 1BYOA 2CRIA 4JHUA 5DK3A 5FWQA 3S97C 2JJSC 4U3CA 3OF6D 2ZKMX 2JKIS 1G84A 4BELD 1BXAA 2E9IA 2F54D 2CE6A 3GMPA 5FUCC 1T83A 3V52H 4PAZA 2MWCA 4MRBA 5K9QI 3G9AB 3IDGA 1PS3A 4UNIA 3DI2B 2AJZB 3L95B 2VZSA 3ROOB 1I8IB 3GMLB 4UQ3B 35C8H 4JY6B 1O5PA 1OE1A 4UT9H 5E00B 4BHUI 3KWTA 1JGUL 3F5WB 4HIEA 5EORH 4YX2L 3UP1A 4Z7VF 2E6QA 2L7UA 2ARJQ 4GS7C 5B1JA 2DLFH 4UQ9A 1BQUA 4H0LC 4MWFA 5IQMA 4GG6B 1RZGB 5IJKA 1JG9A 1VGKB 3MV7A 4F37F 4Z7NB 3LHAA 3O2WL 4A2EA 3BUPA 4UIKH 2V2XA 3D09A 3MV8A 3DPBA 4Y5YA 3LEVL 1IVLA 4HFUL 3N55A 3QDME 4AM0A 3BP4A 5G5DB 3VFNB 4URKA 5AVTB 2C1PB 2IG2H 2HUEA 4WW2C 4I8DA 3JTTB 2OMVA 4MD0B 4FTVE 3VQ2C 4OFQA 4X6DE 2QVTA 4G8GA 4N0FB 4WFEE 1FG9C 3AQYA 1J8HB 3OAUH 3GMOB 2HT2D 2H2PC 4AENA 3EFDH 5AKVA 4J3SA 1FFOA 3X13B 1NEUA 1ZIBA 1NPNA 1W9XA 5HDOA 1TEYA 4R5VA 2DH3A 1U8MA 2ESVE 5TGBA 1ZCRA 1ZVSA 4R4BA 3B9KC 2WTRA 2DJMA 2C8NA 3BPOB 1MLBA 4UM9B 5D6DA 4WF7A 2VT0A 4NSKA 3QDJD 1QW8A 5IFAL 2O5ZL 4GT7A 5F93C 2HG5B 1XSIA 4H2AA 5EUOA 3VXSD 2VR3A 1NCUA 1CFQA 5GZND 1I7ZA 2ENYA 3QC5X 3ISRA 5TK2A 4ODXB 1NM9A 1C5CL 5GRJH 3A3YB 1ZLDA 3SYPA 1J9TA 3RE0A 2C3VA 5CU9A 3BKML 4E9XA 4WW2F 5C0JA 1B0GB 5DFAA 4Z7WB 1T1YB 1FCCA 5JORB 3NJFA 2DWYA 5AFAA 2DLGA 4RSVA 3I2CL 2EXWC 1SJEA 3LN5B 5GGVL 3UZQB 5C6PB 3TJHC 1Q0EA 3KDMA 5I6XC 1CXKA 3GPEA 4Y4FC 3IFLH 2AJSL 3SPHA 4Z7QE 3W39A 3T0BA 1MCEA 1EERB 5C6WH 3TNNA 4GRLA 1YCSA 1X5IA 2YD9A 3LB6C 1EZLA 3RVTD 1TVBB 4D8PA 4E0RA 4BXVA 4PRHB 1MQ8A 4ZQKB 3HR6A 1R24B 3RWIA 1NIAA 5J7CC 3WEOA 4OD1H 2A4CA 3HI6L 3FH8A 1OTSC 3T6ZA 3X1GA 4JHAH 2H1XA 3DOSB 3UTPE 4WI0A 4MJJA 1FN4B 1IUZA 3EJUA 3IPEA 4H88L 4O9HH 2EECA 2L0DA 1RK1B 1KGCE 3NCWA 2DTSA 4H20H 1CE6A 1S7SB 2FTAA 1KYOJ 2QQQA 3D34A 2CG9X 4P5TB 1RXLA 5GGSA 1P0SE 4LAQL 3TURA 3E6FA 3IMWA 5T1KD 1DQTA 4BZ2H 3IAQA 2CKNA 3ESOA 2BIQA 1MCJA 4RGOL 1X5AA 5B1AB 3CSBA 5D1QC 1SXAA 3HJ0A 2M8XA 1J5CA 4KXDA 1YNTB 1V7ML 4BYHA 5HHMB 3ETBF 3C8HA 3VAEA 1A6ZA 3VGDA 4K8RH 4R83A 2BVPB 3SKNB 2ZAGA 4UUJB 2O4EA 5IVOA 5L2KE 5E2VH 1GMIA 5L8KB 1QSZA 2ITDB 3ZRFC 4FXGB 1E3FA 3ZTNL 1IAOB 2XQYK 4FF9A 4HFWB 3U2SA 4F7CB 4PYHA 1QKZL 1D7FA 2DPKA 1JUFB 1E4XH 1EXGA 3AAZA 2GJ6E 2HN7A 4U3XA 1MNNA 2R1YA 4P57A 4XBPA 3TBVA 1X5XA 5C0GA 4KJWD 3B9VA 3O6KL 2VDOH 4LGPB 5DGRA 1KIRA 3LXCA 5HJGA 4OF0A 5BW7A 4CC4C 2HVKB 4P8QA 2GBUA 3O2DA 3EYVB 4H1LB 4OM1L 4U6HA 5A40E 1A3RH 4ZFFA 3LN4A 1SM3L 4K94C 4M7KH 4WTQA 5DI8B 5C09A 1F6LL 1PFOA 3L9EA 4LLUA 4S11A 5DVMA 4HXBL 5HDQH 2IOMA 1FZKB 2G5RA 4V11A 3QZPA 3BAEH 1IGJB 2HP4A 1P7QA 5IBLD 5J1AA 2Q5BA 4JG9A 3RRQA 3OMNB 15C8L 5F1KC 3HBGA 3NDZE 4HVBA 3KZ8A 1CGTA 2WXNA 5A2AA 4M6OL 1L9SA 2QR0B 4LPUA 1Y0LA 1T3FA 2X4QB 1CD9B 3M86A 4KKBD 4KRPD 1XVSA 3VFPA 3ZQWA 3FPYA 1PNCA 5EEVA 1BOGB 2WUBH 2ICWI 3EF4A 4R7DA 1A3QA 5JHDD 4B0MB 1LK2B 3FUDA 1JHKL 5DURD 3CTTA 3V7AG 3VFGH 2Z31A 1J5DA 5HDBF 2E27H 3QCUH 3DX3A 4X9BA 4Y1AD 4NFBA 1VCAA 3KPOA 1ZHLA 1VSCA 3PFUA 4HIXH 3T6VA 5HVHB 4YDVB 3VXQB 3HFML 5AALA 3BHBA 3RDTB 3QIUA 1QOKA 3RI5K 2AJUH 2CDGA 3ESPA 4CC0A 1TJMA 4PJ5B 2X3CA 5CGTA 5ESAA 2AHIA 4Z7OB 5T3XE 3MYZA 4LSRL 2J1YA 4FXKB 1T1XB 4HK3J 4DP2X 1KXTA 1OKEA 1QQDA 2NT0A 3K2IA 1UD6A 3KH3A 3NT0A 4NN7B 1NMAL 1VFAA 2XKSA 4JN2B 1PTZA 3GS4A 1G4MA 3FRUA 4G8FB 1NC4D 4NKMB 2DWEB 5GRUH 1D7CA 5C7ZA 1HNYA 2QHLA 1U2HA 1T20B 4OGXL 4P2RB 4YHML 3MV01 3V5KA 1EWHA 3U25A 3BJ91 4UBDC 3S2AA 4ICXA 5C3LD 3Q2VA 3ZOAA 1AZRA 2Q76A 3BIKA 2BSBA 4GRWH 5DTFA 3UPCA 1IAIM 1HL5A 1I7UA 3JVGA 4PJDF 4LSQH 2NYZA 3KVDD 3LHPH 3VI3E 3ZGHA 5IV2B 2UV3A 3RZCA 1R6VA 5I30H 2WPGA 2J8UF 4FFWD 2CM6A 1RIUH 4GT0A 5DD3L 4K9JA 4GXUN 3UEZA 1OSPL 1CU4H 3B2MA 4JHVA 3G5YA 4N0UA 5DC4B 1T7VA 1N64L 4PJ8D 4UTAA 3SDAC 1K4DB 1JPSH 1IKFL 1H19A 3WKQA 4LL4A 1AACA 1MNUH 1S3RA 3FQRA 4DKEH 1KBGL 4QRPA 4GAYB 3RGVB 1DANT 2B4CH 1MCPH 4OD2A 1J87A 4H0IA 4Z18A 4DGIL 2VCOA 3KPLA 1UYWL 4QAMB 2Z4TA 3Q01A 2YXMA 3ES6A 3FFCA 3WFBH 3SDXF 2AEQH 5JW4N 3KLAA 3ECBB 1YPZE 5H8DA 5LNEA 5I8CB 2YRBA 3JT0A 4E36A 2CSPA 3BPCB 1KC5L 5DS8B 4W9KC 4PB0L 5H37G 5CBAB 1CDJA 2DV6A 1DR9A 3KWUA 2H0FA 3PWJB 3GUTB 3RWEA 2KLRA 5EIIG 5GS0C 1R3IL 3KEDA 2WBXA 3T08A 5E2WH 2FX8L 3X1EA 1UTDA 1OAXL 3F6LA 3EHBB 3FQNB 3FBQA 4QYOB 4B9ZA 1MJJA 4LMQE 1DZ0A 3ARSA 4MNGA 3LDBB 4C58B 5JUEL 1OPGL 3WHE0 5IW6B 3DX7A 4L1BA 5ESVA 1P69B 5IM7B 4H8HA 3V95A 5BO1H 1XO8A 1TKWB 7FABH 5JXEC 5F6IB 2EYSA 3QH3A 2Q86B 1T03H 3IDUA 4RSYA 1QWUA 1T2QL 3POHA 1FNFA 5F3BA 1KGXA 5M95B 1WZKA 1AC6A 1M05B 2BWQA 4O00A 3I6LE 1DO6A 3KPSB 2IDUA 3WFZA 3PU7A 3MOAH 4OCRL 1U3HC 3HE7A 1XMWA 3SCMD 1ZTXE 3VFRA 1TCRA 1SPDA 3MU3A 1QSEE 3OX8A 5J6HA 2Q87A 1CB4A 4JKPL 3CUPB 3T6QC 2LABA 4QPEA 1UUSA 4WEEA 5M94B 1XCQB 2DOCA 1Z3GH 3GBDA 2AAVA 5GS2H 2AXJA 3CPUA 4GP4B 4PQXA 2GTZB 1YY8B 4JRXD 1WP6A 1I75A 3WKNA 1TO5A 2DQ6A 2QKIC 3BC9A 4QHMA 5KW9L 3D3VD 2BNQB 3IT8D 3BWSA 3OD3A 4LLDB 5FCSH 1HU8A 2DB8A 2OR8A 3EO9H 4FQPA 4XVUC 4X99A 5SWZE 3WN5B 5EOCL 3S36X 2GKIA 2D9QB 4QRRD 3PS6A 4WZ9A 4P46C 4A39A 4WY7H 3HR5B 4DNLA 2IPKA 2K7QA 4EI5D 2RIKA 1A8JH 3AT0A 3QZOA 4W4OC 2XA8L 2GFBB 1SJVA 3IETA 1FG2A 1TETH 2XY2A 3MNVA 4V1DB 1K8IA 2FBJL 2QJDA 3PWPA 3HZ3A 1GS8A 3PWVB 4I88A 2KUTA 3BD3A 3NPSB 3MNDA 1G7IA 4K2UH 4L3EA 4ABUA 5BQ7B 3IMBA 1CT8A 2WQSA 2FX7L 6FABH 2D03L 4Y4KC 3NZHH 1LP9B 5K33A 5ITFA 3AVEA 2CIIB 2QQKH 3FCSB 4WFGD 1NA8A 4EF3A 4NPYB 2B77A 5I0YA 3GT6A 4NENB 3MRPA 5L6YL 4RMQA 4JDEB 4F91B 1XQ4A 3GSNB 4LEBA 4MMZC 4NUPA 3LS4L 4MD5B 4EBQL 2N7AA 1SHSA 3H56A 1KFGA 5F7HA 4KMLB 5LQBH 4JAMB 1KBVA 2BCKA 1OB0A 2YUVA 4TSAH 1P5UC 5C0FA 2Z93B 3C6LD 2AEWA 3P77B 4WNQA 2NW3A 4QXTA 5CEYB 5IQ7L 4RWHA 4CADB 4HXAL 1NUFA 1D6EB 5GRZA 1WAPA 5IOPA 1U4FA 2WSKA 3FTSA 4HWNA 1B4TA 1IBGL 3CLEH 4PGZA 2FRGP 4BZ1H 1RSYA 1J48A 1YEDA 4NO5B 3OAYK 4LCCA 3OF6A 1UH3A 2TSBA 4NZDA 3N50A 4JVWA 5EO9A 2L7JA 4HJTA 1GH7A 3K8LA 3N0PB 5H4YA 1NQBA 5GGRB 4GBXC 3VXMA 3U46A 3O9WB 4FABH 4U3SB 4MMXC 2BWDA 4PPTA 4WW1B 1WZ1H 1UWXH 4HPOL 5EEUA 4PSRA 1O7VA 4X6FB 4PJ7E 3C08H 3ILEA 1LO4L 5F9OH 1L6ZA 2DQHL 2QADB 1A4JA 1DUYA 1HH6A 2YAOA 2QZ5A 1LEGB 2YA2A 4JUSA 4OTXH 4AZ8A 1JYXA 1NUDA 4LP5A 2MPAH 4NYLB 5TD4A 4A2FA 4ODVH 1BZQK 1O6SA 4ABQA 1ET8A 2DQCH 2WXFA 5EFIA 1OSZB 4BUGA 5FM8A 1QEWB 1UEYA 4UB0H 4YGVA 3PDGA 3ZDXB 2NZ9C 4KUZL 1BM3H 2YWYA 5C0BD 2QMKA 3LNHA 4XWOC 4BQCA 5B39A 2PW1A 2IAAC 3HG1D 4GSXA 5ABAA 5L0QC 3QJOA 5AZUA 5D2NE 2F53A 4AK1A 3LQAC 1D5BB 1IC5L 3MUZ1 3T0AA 4N8VG 5ERWA 4AQOA 3ZRSA 4LEEA 2VQ1A 1BLNB 2VO8A 3HZKB 4L3FA 3FTXA 2FEDC 4G72B 3E3QC 4LSTH 4JQVC 3DSFL 3H3PH 1UXWB 4PJ9D 5DHMC 4N2FA 1DQJA 4WUKH 1UWEH 4ZW8A 1JTPA 2F08A 5FA3B 3SQRA 5EU7E 2WWMD 3TIDA 5D96C 2C3WA 3PUUA 4QHPA 5GSRB 5AVWB 5C0AE 5LCVL 4N85A 4R0LA 1CXEA 3IU4L 2R9HC 5JIIA 1KIPB 3C8DA 2Y1AA 3X14B 5D93B 4PJEB 4OB5H 5EO1A 1XTLA 4F5CE 3GRWL 1O7SA 1P7BA 1VFMA 2E6JA 4XCNB 2BP0B 1SUHA 1NIEA 1SDYA 5D55A 2QHRH 4E9QA 4D2NA 5GZNA 3CGTA 4IHOB 3S0PA 2VN7A 1U8NA 3KPRB 4JQXA 3RY6C 1G7MA 1UD4A 2BW5A 3M17B 3VQ1C 1MDAA 1BM7A 1S9XB 2QQNH 3SKMA 2J3SA 3X1BA 2J71A 4F7TB 1BQLL 1GKEA 5F9JA 1YEEL 4O2FB 1M6UA 3H1ZA 2GUYA 4TNVF 5E8OA 1TEFA 2DJSA 4FNQA 1FGNL 4YLCA 3X1FA 1FIGH 1UACH 2X40A 3BFOA 1QSVA 5TH2B 1R5IB 2FEJA 4FJZA 4FL4B 2RH0A 2I69A 3D85B 3NJXA 4N3TA 3GIVA 3CFIC 2CZNA 4HV8A 5BMFL 3L3IB 2AS5M 2WOYA 1CFNB 4LARH 5AKRA 1ZY9A 3ZYZA 3DURA 3O3AA 3UBXI 1NGWB 5B21A 3OSVA 3QEHB 3I50H 4Y9GA 2DQUL 4Z78A 1CDUA 3IE9A 4PRPB 4BQ6A 2HT3C 2VDLL 1W0VB 3FTUA 4BA0A 2KPNA 2VR7A 1AE6H 4AYFA 4JVUA 5DD1H 1KB5H 2O61A 4NP9A 2HSIA 5GJSH 3RX9A 4ZZKA 1BF8A 1CL7I 1UA3A 3AY4A 3VFSA 4X9YA 1YVLA 5EO0B 4QKTA 1HSBA 3GNMH 3WDHA 3QORB 2J12B 5CJXC 1MCCA 5L4IA 1PIFA 2Q8BH 4JREC 1THAA 3RPIB 3ZPDA 3MRFA 4PW3A 3D39E 4PRID 2IFGA 3QAQA 4M1CC 2OR9L 2WNKA 1C5BH 4JM2A 3LNIA 4AV0A 1QA9B 5KSUA 3T4AC 3UG4A 4AMXA 3IFPA 3CFNA 3IXAB 4MA8H 1B4JH 3T3ME 3V6OE 1AO7E 2MQ0A 1WICA 1TLKA 4ODTH 1CLVA 2Q8AH 3B9KD 4YXKL 2IALA 1E5BA 2FQFA 3HVNA 3U7AA 3UDWA 3A6OA 4U2YA 4ZFZA 4AOFA 4IRJD 1QTSA 3QE5A 2WLYA 3L1EA 4PJFA 5F6HJ 3QJHB 1KCRH 1NBZB 2GT9A 3FRPB 5LJYH 4X8CA 3EDJA 1C1EL 5EUKA 2CHNA 43C9A 1DN0A 4WWPA 3COOA 3IRPX 3B2DC 2B7DT 4L4VB 1J1PH 4KVNH 4ORZC 1T1WB 4WK0B 3MLTB 3QIWC 4W9FC 1DVFB 5DJXB 5E5MB 2QELA 2EXWD 2WJ5A 1T0NB 3GXFA 2WVSA 4PM1A 1S7TA 2HT4C 5DJ0A 3TJHD 4ZQTA 2H3NB 3QUZC 1WWAX 1E4KA 3RPBA 1JDCA 1PD1A 2GIMA 1SEQL 4U31A 3AT9A 4P3DA 1JRHH 4S2SA 1L9QA 2MSPA 1EMTH 2V3FA 3L45A 4MXWL 3VW3H 4PRAA 2YD5A 4NEHB 5KZCB 5JOPE 2FJHA 4KV5E 2WMPA 4R97B 4NQEA 2BSDA 3EOBB 4M5ZL 1T5WA 4LLQA 4MA3A 1NCTA 1KN2L 4K94L 5KUMA 3GSQB 4B9JA 25C8H 3QEQA 5JOFA 4OCWH 5JIMA 3ARGD 1TZAA 3OXRA 3V9CA 3V4PL 4V2BA 5KYUB 3NZUA 4HIIB 1RK0A 2EJ1A 5HGAA 3SKJH 2BIHA 1KACB 4EUPG 3V5HA 3BAIA 3NZ8A 2ISDA 4Z7NE 1A9BA 1X5YA 4DP1X 5CZRA 1FNLA 2BO0A 2NYYC 4OFDA 1N18A 2PUQT 1ITCA 3IWUA 1T4KB 4MS8D 5BOZG 4U7KA 1F3DH 2YD0A 4PVLA 2BXZA 2FL5B 1TITA 4GINA 4B41A 2VDKL 4N2DA 5EA0H 3CDGA 5BRQA 3I6GA 1MI5A 1EX0A 4AQAA 1YNLL 1W72L 1FE8L 3QZWA 5CXPA 2Q6WA 1P2CA 1J8HE 5EPMB 2CGYA 3G6JA 5I1HL 1USZA 3FU3A 4X0NA 43CAB 3U2IA 1WTLA 3QJZA 1RLBA 5E6IC 4JN1L 3K6SB 3SQBB 3VFMA 4P9HC 4WHDA 1XF2A 1FV1B 5GGSY 3T6WA 1WAAA 2A6JB 3BQUC 1JK9B 3NH7H 1FH5H 3O11B 4U1KB 1BVNP 2BK8A 2XBTA 3PWUB 3V0JA 1C8PA 3PL6A 3TFKC 1SNRA 4JFXA 1D6VL 5CN1A 5DJ2B 2NQDA 2Q3XA 3Q6FB 3FB5A 4WFHD 1L0PA 3O2VL 4NCC2 3KXFD 2ZSWB 3SD5A 1RZ8A 1QLRB 4Z7WE 4ZDHA 4UZSA 3L3KB 3ZX1A 5K59F 3OC5A 5LLIC 2FJFA 1KCWA 3PDDA 2UXTA 2PR4L 1TYJA 5GRVK 1ET7A 3GMMB 5CFAA 4JRLA 1HL4A 2B2XH 3HEIB 3IM1A 2Y9RT 3MRBB 1SXNA 1KUMA 4P59H 3LPOA 1VB9A 5ALCH 4R26H 1OPOA 4PY8I 3BAKA 1I4FA 5JDJA 4PRHE 4XBGA 2QPFA 1WF5A 3E9UA 3MRCB 4ALAC 1QUNB 1WS8A 4JKWA 4TQEL 1A7NL 4ELMF 4H0GA 1JF1A 2IJ0C 1UQSB 5IMKB 5DJ8A 1ZT4B 1EBAA 4GUOA 2NY4B 3MXWL 2W8CA 2CKBL 5D2LB 3WNIA 3ARFD 5IHHA 3CZEA