4CA4A

Crystal structure of fimh lectin domain with the tyr48ala mutation, in complex with heptyl alpha-d-mannopyrannoside
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDAPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4ca4A00
4XOCA 4X5QA 4XODA 4XOBA 2WMPB 4AUUA 2UY6B 4LOVA 5IQNA 3BFWA 5FS5A 5CGBA 4J3OF 3JWNE 3RFZA 3ZPDA 1PDKB 2JTYA 1UWFA 4X5PA 4XO9A 5FLUA 5LNGA 4AUYA 5F3FA 4AVJA 3ZL2A 5F2FA 4XOEA 2XG4B 1KIUB 3SQBB 4AVKA 4AVHA 4X5RA 4AV5A 5FWRA 1ZE3H 5FX3A 2VCOA 4BUQA 4CSTA 4XOAA 4AUJA 3BWUF 1TR7A 3JWNH 4AVIA 5IQMA 5ABZA 4ATTA 5AAPA 5AB1A 3ZL1A 2XG5B 3ME0B 4J3OG 2JMRA 5LNEA 4AV4A 3JWNG 5IQOA 4J3OH 3MCYA 4AV0A 4CA4A 1N0LB 3BFQG 4XO8A 2UY7B 5JQIB 4X50A 1KLFB 2J2ZB 5AALA 1N12A 2W07B 4CSSA 1QUNB
chains in the Genus database with same CATH superfamily
5DRXB 3TZVC 3GBML 1JWUA 3M88A 3Q13A 4S2SA 1CGSH 1NOAA 1CICC 4WUUD 4D0BA 5I6XB 4N2FA 2Q3XA 3IFOB 5IM7B 2BXYA 3AREB 1G1CA 1TT6A 2ZTBA 4OSUL 5JQ6L 3LTVA 4ZPVB 3BFWA 1YNLH 4W9JC 3V79C 3TVMA 1NAKH 1P6FA 1DVFB 3ECWA 5ID0A 2XYBA 4R7VA 3ZE2E 5E4AA 2HJLB 4YSAA 4JFDB 2FO4A 3RFZA 1ZAGA 4BE6A 4JY6B 1Y18B 4ZX3A 4H5SA 2DS4A 5GISH 2PCPA 1U3JA 4OZIE 4DERA 3O8XD 1Z66A 2A9CA 2VTFA 1SM3L 3BSZH 3N50A 3AC0A 2QQKH 4OQTH 2VL5A 4D0CB 3GMLB 3T65B 4OFPA 4TRPH 2N1KA 1HH9A 1SLVA 1SDYA 2IWFA 2R1WB 3FUNA 4M56A 4EAEA 2ZCLL 1X9QA 5EA0H 1GOFA 3IJYA 5JPNA 3VD3A 2X5PA 4L8SB 4U4BA 2BIMA 2EEDA 3KLAA 5AG9A 2A6IA 2VXQH 3MRLA 4MJ5A 3WKPA 4B97A 5ACZA 4ZMAT 3CFDB 3IFPA 1LQBC 4Y9CA 1BBJA 3BEVA 1PKQB 4FXTA 3EBHA 4ODHL 4M4RB 3L3JB 4TNWF 5C3TA 3DSFH 4QXTA 1NOFA 2L7JA 2OXHB 3TZVB 5IF0B 2UY7A 3VO0A 5IY5B 4JCLA 2IIJA 1CICB 4IYKA 1W8OA 2VE6A 1JV5B 2OULB 2WBJB 2YD7A 4L4TB 1ZIBA 1FA4A 1F13A 3MCKB 5TE7L 3D85A 4M6NH 1UASA 5DR5L 3NQIA 3T77A 5IOPB 5FYKU 4YSQA 3HE6D 5IFJB 2UZYB 4QWWC 1DVTA 4RX4D 5T3ZD 3OVUB 2WQUA 5JHDA 1YY8A 5E6IB 2OTWA 3RVXC 2K70A 2E7CA 3M1BA 2SODB 1CGXA 4DVBA 4IK7A 5F7LB 1EFXA 2YPKB 1SYVB 3BDXA 4WU7A 4K94L 3GD1C 3CZFA 1ZGLP 1H3PH 5FK9B 1E8ZA 3BZFA 1KGJA 2PYED 3PAZA 2HKAA 2NSXA 5ACLA 4KQ3L 3LH8A 3AAZB 3B83A 4U1JA 4NM4L 2D0GA 2XZAH 2A1WL 4IW4C 4R0LA 2FSEA 5DLLA 5IW3A 2ZUTA 3SDXA 4EXKA 1UOWA 1FL3B 1UURA 1SJHA 4QLRA 4AGLA 4NC0B 3MRJB 2DWDB 4M5ZL 4ODVH 4ONOA 1WBYA 4L3EE 4TUKL 1G7QB 1AYRA 1AY1H 2VSMB 5E2VH 3QFJA 5HI4D 3U9UA 4LCCC 3OB0K 3KJ4C 2GIXA 3US9A 1PJWA 2VDQL 1M2VA 3MUHL 4CKVX 2YWZA 3G6JA 1WBXB 3QFDA 4NRYA 2DJSA 3KL5A 1DBML 1INEH 4KBPA 4R6UA 4X98B 2WZ6A 2Y36H 3FB5A 1F58L 1LO0H 3MOAH 2BX5A 2F8VA 4K3JH 3FSVA 4DFHA 1VADA 1JGUL 4BFGA 4KJYB 1D9KD 4TULH 1EJOL 2IJ0C 3UTTA 1F0LA 2WUCL 4JRXB 5DJ0B 1ZKAA 3BI9X 5BVJA 2O5YH 1AZRA 2DMHA 3VFUB 4MDIA 2G9KA 4RCAA 4A67A 3PWUA 1KYOK 2VW6A 5J6HB 4KXZI 1DVQA 3GJFA 1XGUA 4YMPA 1ACYH 3QQDA 4TNVK 3MBXL 4FFTA 3TCLB 2AS5M 3QRFM 3UH8A 4IS6A 4LKXB 1KXQE 3W0WE 5DK0B 4Y4FA 5ICXB 5FX3A 4RZKA 2P52A 3NDYE 1G84A 1T2QH 3RVWD 4J4PA 2DM7A 5E2TL 4UTAL 1NGYA 4KH9A 3FB8B 2NX5A 3F3HA 3GK8L 2YGNA 3WNLA 1TZAA 4LCCB 3CU7A 3KJ4B 4DO6A 3ZRFC 3VTTA 4LSQL 1AKPA 3ULUL 1BF5A 5AKRA 1MCPH 3HC4L 1ZJBA 3OKOA 3BH9B 5CWSA 5L9DL 1V3KA 3ME0B 1S9KC 2GFBA 4JKKA 3C9NB 5EOCL 4BIKA 2ZG1A 5EO1A 3P11L 1BBDH 4RGNE 5K9OA 5MEQB 5GGSA 3TH4T 3T04D 5GS0C 2A83B 2MOGA 3ARUA 3KPSB 3H9YA 2NQDA 4KGJA 1ZT4B 3FTGB 1HJBC 4UT9H 1TFHA 2R0KL 4AYDC 4PJ9C 4RWHA 5EPMB 2CNYA 3UZEA 1KXVC 1XCQB 2V7NB 2Y0SA 3GJEA 4S1RL 5DHYB 3QUXD 3BAJA 3JYBA 1BXXA 4GG6A 2JLLA 1FNLA 4ODWB 1HXYB 1LGVA 1KIPA 2JKTM 3CDZB 4HV8A 4LOUC 1ZLUH 5DS8A 2FLBT 3K74B 1FNHA 2NXZD 4G9FD 4PJ5E 3PAUA 3L3IA 3L7EA 3RDTA 4NKIH 5L2KD 4FYRA 2HTLD 3QWNA 4E9VA 4AIEA 2FX8L 4NIYE 5I5JA 2FCBA 4HFWA 1G7JA 5EU7C 3L95B 5K9JL 1OHZA 3FTYA 3P4OB 3HG1D 4KNUA 4PY7B 3WD5L 1T3FB 2ARWA 1E4XH 2D03H 3FTZA 4WSKA 1DDHB 3D0AA 1HEZB 5MENA 1QTYT 2K4WA 4WHDA 2Z7WA 3VRJA 3VMPA 2CCWA 4DPRA 3HMXA 4QUOA 3ZPDA 5HYSA 4OIFA 3TT1H 1RAMA 1M7IA 3L3KB 2WY3B 5DQJA 4JVPA 2W9LA 5ESAB 5L4FA 1MELA 4HW6A 1Q72L 2ZOUA 2ALWA 3UJIH 1OTSD 2BHZA 1QR4A 4LK4A 1WAEA 4XR8C 1MRCH 5AZUA 2WXLA 4N9GA 2CLZA 9PCYA 3SQOH 4Y2OA 3QRGL 3BUPA 3OR7B 5FCSH 4DOHB 1RURH 4PJ9B 2A9NL 1PIFA 2WKOF 3UG3A 3GC3A 3T8XA 2HRPL 5IHBA 3LRKA 1OTUD 3CN4A 4LEEA 3MLTB 3VI3B 1SN2A 1I3GH 5E5LA 3VM7A 3U1SL 2P46B 2ZOWA 5BV7C 1AR1C 4WK4B 2JE8A 1YDPB 3LZQA 2Z31D 5JUEH 3DX3A 3BAKA 3NK3A 1O6SA 4CBZA 2Q87A 2KZKA 5FM8A 4GXVH 3D0LA 1NC2D 5IEKA 2YZ8A 4ZMPA 3PPSA 4LBEB 3CDGB 3BCDA 2W9DH 4KY1L 3HEIB 3Q8EA 2C9AA 1N26A 2BOBA 5AVYB 1K4CB 4NSKA 3B34A 4AYID 2HVJB 2Y7NA 4XCYB 5FCUH 5BW7A 4LCIL 2YEZB 5JXEC 1RIUL 5E08L 3HE7B 1HINL 3D48R 5DI8B 4FZ8L 1BZ9B 1H19A 1UHVA 4XNQA 3BP7A 3OKYA 2APBA 1MHPH 1M56B 5DRNB 4NAQA 3LKQA 5FYJH 5I1IH 1B90A 4NC2B 5KYWA 1U2YA 1YJDC 3F7PC 3CPUA 4PP2A 2JK5B 1RD6A 1M2OA 2AP2A 2HTKC 3FOLA 3GKWL 5E8PA 4CSZA 1XR8A 1B2YA 4PJCA 2B4CL 4PTUB 3V9CA 5IVOA 3HPJB 3JZYA 3FN0L 2FGWL 5HDQH 1JPSH 1U8PB 1WISA 2MJWA 4PRHB 5JYMA 1E9OA 4MVBD 1UGNA 3WTVA 1IGJA 4N90D 3WFCH 3I02A 4PJIB 5BV7B 3FT0A 3WXVH 3HCVA 4F9LC 3QYMA 2OJEB 3N85H 4O2CB 1E2VA 3RB7A 3WJMB 4U6VH 4JFZH 1KF9B 1Z3GH 3G04B 4J1UB 5SX5K 2B16A 4D9LL 5F8RC 1G6RA 1YEIH 3H9ZA 4XB8A 3VJ6B 4OF3A 5K39B 3FFCE 1TJIH 4OGAC 2B9AA 4IJ3C 1R5WB 1RSYA 3PGDB 1OAUH 2P24B 3ZE2F 1AD9A 1VRSA 3FSOA 5DJAA 2AABH 2HMID 2GSGB 3NCMA 3GBLA 4LKCB 1JL8A 2NW2A 4OGYH 1IFHH 1NPUA 4YAQB 1CS6A 1AXIB 3MR9B 1R3LB 3CHQA 2DWSA 3WI9A 5HHXH 5HYFA 5I2IA 4OZIF 1E8YA 5TFSH 2VW7A 4F2MB 2HRHA 2VDRL 4F9PA 3FQRA 4BCZA 5ESVA 1I1RA 4JHBA 2VXTH 3IBEA 4RBPK 4XNDA 3J07A 5HHVH 1U8JB 4U6HA 3DX0A 4QO1A 4ZODA 3QDAA 4ANUA 1HEJC 3AJ7A 3CFKB 5B3SB 3GUTA 4WTXA 4OD1L 1OW0C 1GGUA 2VGLM 2F2HA 3Q6FB 2E9JA 3UERA 2V3FA 4FYQA 4ZMZA 5CEZL 3C75A 1D5RA 4NHUB 3WHXA 1NEZA 3H7LA 3MROA 4WI0A 4CN6A 3WIIL 5D7LD 1T1YB 2CO3A 1BZEA 1H8NA 1F3RB 3IDXL 1L6XA 1M6UA 1A65A 1DQMH 2H3KA 2IGLA 3QJHB 2FQDA 4MKTA 4YX2L 4IBUA 2CRMA 3CZGA 4HH9A 4XNYH 3FT3B 1BLIA 2M8XA 3KBFA 2CKBB 3I85A 1L7TL 5LUMA 2RMNA 4LCVA 4X0KA 5DUMH 4JLRA 2ZNXA 3ARGB 3MBED 4IU2B 5C6WH 2WD0A 5GZOD 1YQVL 4RFNB 2ADGB 1C8QA 5EU6B 4E9YA 2A2QT 3BH4A 1FDLH 1N2RB 3P3RA 1OLLA 1UWGH 4MZ3A 3THMH 2AMUA 3QORD 4KU1A 1DQIA 2F5AH 4LVOB 4YDLC 1NGPH 4OFVA 1UXSB 3ZK0A 2G30A 1PEZA 2WOYA 1M7DA 3G7TA 2FX7H 3GLAA 5GRZA 3PWPE 1EXHA 3IVKB 1QWUA 3KHQA 3OPUA 3VQMA 1EO8L 4RRPG 3LQAH 4L9DA 4UAOB 4K5MA 4M7ZC 5IJVA 5I17B 4BFIA 3E0GA 2X42A 1W2KT 5CF3A 2BW4A 3O2DH 4FQJL 2Y69B 4JDTH 1CDBA 1U8NB 1N3NB 1AO7A 3X2QB 3V4LA 2TRYA 3ZMRA 1AHWC 3KS0H 1CPUA 4GSDH 5CJQL 1R3JB 3LHAA 2E6QA 4NKOB 5ELIA 2YFOA 4QHUB 1S7UB 1J5IA 2CDFA 1WBZA 1BFSA 1LEKA 2CBOA 1VFAA 2EZ0D 2JXMA 4AH2B 1BP3B 1S7RB 1JN6B 2PYFA 3MFFB 5FYLE 5C0CE 2YUVA 3L3GB 4ZMTA 5HHOB 1OAXL 2X3CA 1WSST 1UFGA 3WELA 1OP4A 2X2IA 1AR2A 1IGYA 3IRPX 1B0RB 2HKHH 3MRNA 5DVNA 2WXIA 4ZUVA 1J87A 3NZHH 2WYTA 3P2BA 3OHXB 4K3EL 4YPGA 43C9B 3BZ5A 3L5IA 2UWEE 1FC2D 4G8GE 1PF3A 4PG9B 4K7FB 2VZ3A 2K6WA 1MXDA 1JVLA 2IMMA 2OXGA 4WENB 3CSBA 2JKIS 4J3SA 3EO9L 5HDOA 2BVUA 3D0VA 2YRZA 3QO1B 3BAEH 3CLEL 2RCSL 1HHIB 3AT0A 4OLUL 3KLLA 4OJAA 3B1TA 4KHTH 2WTRB 2QELA 1Q9LA 3WEXA 4JO4H 1MVUA 4G7VL 5EEVA 3KVDD 1VGEH 5IB3A 4MSWA 1TVHA 3KWUA 4P46B 5TD4A 1AHWB 3UTQB 4JN1L 1ZHNA 4LRNH 3VB8A 1XZ0A 3CZUB 3D33A 4WNQA 5ITFA 1WT5A 3FU8A 5CGMA 2VXUH 4IMKA 4X6EA 2KDYA 2O5NA 2UXFA 1JWMB 5JOFB 1THCA 2XQYG 1LQSR 2QMJA 2XY1A 3QZOA 2BY1A 1A3LH 3QZWA 4TTGA 1RHHB 4EIUA 2PTVA 1KLUB 3V55A 4L5FL 1WZAA 2BK8A 2OL3H 5EU5B 1XGYL 4L8BB 1YEJH 2ZXAA 2P8LA 4JJ5B 1CMOA 2GYSA 4ONFL 5J1SC 3Q2NA 1XO8A 3S0PA 1JZ5A 3V4PL 2FB4H 5IROD 1XF5B 5G5DA 3DV6A 2CKNA 1C16A 1QATA 3SKMB 3PDOB 4U3CA 3T0EA 4WGVB 1EAOA 3AXHA 4X8JB 5GGSY 2Z92B 2DMCA 3I9GH 5D5ME 1ZS8B 1XWVA 2R27A 3EO0A 5DZAA 3NZ8B 4DESA 1ERNA 4HJIA 2J5LC 4NYLB 3U0TA 3WLBA 3UADA 4LLQA 4PR5A 2OSLB 3EO1B 3O2WL 2G2PA 3JV4B 4MA1C 1E4WL 4XB7A 4ZFOL 3ZTJH 3QCVH 5BRZE 1JI1A 3CFBA 3GSQA 3MLSL 5FO2A 3T71A 3K8MA 3CCHA 1SJVA 2YKLL 2DWXA 3OXSA 2A77H 2GK2A 2SEBB 3GDBA 4QF1B 3SN6N 5GRWA 1CE6B 4HWBH 1UD3A 3UBXI 4B9CA 5F6IB 2PWEA 4K7PH 3VX1A 1ZGLM 1FH5L 2B1OA 1XGRA 5DF0A 4KMTL 4W4OC 1XZWA 1HOEA 1F6AA 1INQB 4LP8A 3UGUA 4X5PA 2G4GA 4R4FH 2ZZUT 4QJ4B 5FA3A 4NM4H 5K1JA 1QZNA 2EDOA 4LSTL 4JQIA 2ZAGA 2J72A 4Z7UE 4BKSC 2WXOA 1IZKA 4HPYH 1AGBB 5C0AE 5ADOH 4AQ8A 5DUBB 4YFEA 4DTGH 2X88A 5B39A 4CUCA 1J8HB 3TT3H 3I6GB 2WWMC 1AI1H 2IH8A 5CU9A 4YK4C 5D1QC 3TVMD 5GSVA 2EEXA 1P7QA 1ZSDA 4XXWC 1OEZW 3CUPA 5FWRA 4H8QA 3U9WA 3VXMB 3BGMB 3BN3B 4LQ1A 5JIDA 1E4JA 3D4CA 1OSYA 4OLYL 1AZCA 3TN0C 4AL8C 4JPVL 3WOVA 1LO2H 3M45A 2DY2A 4MA1B 1EIBA 1A4JA 1UXWB 5J3HC 3VW3L 1SGKA 2CK2A 3C6LC 4UYPA 1KTCA 3IBOA 1BAFL 1RH8A 3IDYB 2IAAC 5KANI 3H42L 5K33A 2XJKA 4X7TB 1BVNP 1WV7T 1F4XL 2X7LA 2XWZA 2BVQB 4IIZA 5D7HA 5JPMC 5IB1B 3HB3C 5KSAC 2B59A 3B9AA 1EMTH 2HSIA 1IGCL 4X4XA 2IGFL 4XBEL 1QLFA 2ZAHA 4BYHA 2V5YA 2XUWA 1IQWL 3II3A 4A7QA 4NPKA 4J3OH 3WIHL 1U3ZA 3CE1A 3P4NB 1SJXA 2IGTA 4HFUH 1KJ2A 2OJ1A 5D1ZA 1JFHA 4TSBL 3AMLA 3RPIA 4ZO7A 1RZ7L 1D7BA 2WLIA 5IP4A 5JIKA 3OC5A 4H13C 1N6UA 4WW1A 4XI5D 2PXYA 1ZPLA 1XBDA 4WO0A 2ZUYA 4GSUA 4Y1AE 4Z0XA 1BVLB 2VWEC 1UM5L 3MJ8B 5EU3B 1N0XL 5D1QB 1YO4A 4P3CL 1PLBA 3PHOA 2V2WA 2QDVA 3PGCA 4P9HL 3ZBMA 1AQKL 3GBNH 3LPWA 1MH5A 1OLZA 2WXFA 5EZPA 3TN0B 1XGZA 5JHDD 4DP2X 4DGIL 4K7PX 3KMDA 2XTJC 1QNZL 3SBRA 4ABVA 3C6LB 3US0A 1EFXD 1KENL 2CGYA 4G1MB 4HIIB 2WOBA 5HGAA 1N5AA 4UT6L 3BKCH 5EO0A 3QDJD 4GFXA 4A7GA 2O6DA 2H2SC 1GRWA 3RIKA 5EC2B 3HB3B 5KSAB 3DV4B 5GHWH 2VN6A 1FRGH 5T3ZL 2MPAL 4JHWH 5HGHA 4LCWD 4KDTA 4CMMA 4FCAA 4S1RH 4ADIA 1RLBA 3I6LD 3VXSE 1A6WH 4FQPA 2XVBA 3D3VA 1BFTA 2XKSA 4X4MA 4LFHD 3KPRA 1AOZA 3UGEA 4ZT1A 2NZ9C 2F61A 3ZYJA 2E0PA 3L4YA 1ZSHA 1QWNA 3BWSA 1FC1A 2VN5A 1OGTB 5DJ6B 4AKQA 3KEDA 4BHUA 5C86A 5CCHE 1S9VB 1CLVA 1UZ6F 4UIMB 3VXQB 3RTQB 4BCXA 2X0VA 3HKZA 3MGOB 2YUXA 4TUJA 3QDMA 1TQTA 5JHLA 1NDMA 4HMEA 5IFAH 5BCAA 3ZKND 1IIKA 3UBFA 5E5RB 4GT0A 2XXGA 2OX5A 1JV2B 4OI7A 4Q4EA 4RWYH 3SO3C 5J1TC 4GQPH 3JXAA 2IAMC 1T6VN 3W57A 1KBGL 3TO4A 4Z7OE 4GG8A 4PREB 3AG3B 4HKBB 4DKFL 2BZCA 1IGFH 1OY3B 5D1XA 2XFXB 3QEQA 4IQHA 4PGEA 2GSIA 2R4SH 2NY1D 4JZJA 1VEPA 3EGSA 5GPRA 5H4ZA 3BP6B 4Y4KA 4Z7QE 4F8OA 1ETZB 1BAWA 3R4RA 4XCEA 3D18A 2X53A 4KK5C 4KMLB 2QGBA 4WV1A 1IFRA 2Q7YB 1A6ZA 1P4IH 1HKLH 4Y5XC 1FO0L 1KCUL 1OAKL 2HRPH 1IAKB 2KUTA 4GI9A 4LLWA 4X9GA 5AVTB 4JHAL 5AW2B 2A6KB 1QI4A 2HLFD 3ATEA 3G5ZA 4JRYE 1EAPB 5CBEB 2Z93A 4GW4B 1CIDA 2ZKMX 1UA6L 2B5IC 3MN8A 5FHAH 1ZPUA 4UOW0 3NJHA 1ZHLB 2IPKB 4J4PD 4YR6A 5B3JE 3E3QE 2K78A 3O41B 5E0QA 4EBQL 4OIIH 3ZZLA 3V4UL 1G0DA 1ZLUK 4L3CB 5AZ2L 4MZIA 2R69A 2JNZA 5DEFA 1V54B 1HH6B 4N1CA 1E4XI 1QOKA 1QBML 3HLAA 3F7YA 3K2KA 4YSUA 2QT6A 1WK0A 4N6RA 2IQ9H 4P4KC 5F9OH 5GJSL 1SEBA 4XOBA 3L1OH 5DD6A 4OLXL 1Z5LA 1ZWIB 1BVZA 2ITDA 4I4WB 1JHKL 4NPYA 4E9TA 5BPPA 1AGEA 1CXLA 2IAMB 3NSCA 4AQEB 4U1SB 1VZIA 2H1LM 1WZKA 5BZWA 1SOXA 4FQ2H 5IEHB 5FF6A 3QNXA 4DK3A 2HKFL 4AQZA 3VXTA 1YMME 3WMSA 4I77L 5AOJA 4D0DA 3GKWH 1IBGH 3RBSA 1ZMYA 5E1AA 2HX7A 5D7KE 1BQLH 4FQQA 3KBEA 5LJYH 5DZNA 4FDWA 3BRDA 4R4ND 4UQ3B 2WANA 3OBAA 1MRDH 4Y5XB 3RDTD 5ENWA 1W0YT 3P9LB 2AEPH 3M8OH 3UAEA 2AZAA 3ERXA 1XVSA 4P49A 2G2NA 2X4NA 2B5IB 2Z8VC 1MAML 3L2MA 3P40A 4OGXH 3D39B 3AW5A 2UWEF 3GSWB 1T0MB 3L4ZA 3SQBB 4C58B 5KOMC 2XNAA 4MXQD 4JREC 3V6OC 3OKEB 2XYCA 4TSAL 4UQ9A 3LV3A 5MEND 1F2QA 4GJTB 3VAEA 3DJ9A 4XHJD 3EDKA 5CJOH 5KW9L 1I4FB 3MV9A 3H3KA 1NA8A 4DPAX 1FNGB 2BIPA 3BZ4B 4JGMA 4P5TB 3DBXB 1KTRL 2FJHB 2G5BB 1DQJA 3L7FB 4UCFA 1EAQA 2AK4B 5CO1A 3VFMA 2BIHA 3B7UX 3FTWA 4AW7A 4KO9A 3NAAL 1MREH 3MV7E 3OX8B 2CA3A 4TUOB 5L8LB 1PFOA 4OZGA 3HG5A 3F84A 4JNXA 2XWXA 3IPEA 3U46A 3MGTA 4OKVA 4FLQA 2HX8A 5JOEA 2Y5TA 1JDCA 1A2YB 2LE9A 1X4YA 3VFVB 4NC1E 1T21B 3PWNB 1K4DA 2AXHA 5DS1A 5F96H 4LE8A 1XEUA 4RMVA 3HHSA 4V1DA 1TQBC 1MEXH 3K0YA 3NJMA 4YQXH 5F0PB 2VITB 2WXNA 4AM0A 1ZTXL 4L0ZA 4FXLA 5A3ID 1LEIA 2EUWA 1WRFA 5C0BE 3VGBA 1RULH 5D5MF 3NIDE 4HLEA 3WY2A 2GK0A 4H1LH 1TKWA 1XGPA 2CXGA 4JREB 1ED3A 4MX7B 1VESA 1PDKB 2DYSB 4ZNCD 1NC4A 2J6EH 3GYRA 3HZYB 1BZ7B 2R2EB 4PJEA 5GGTL 4Q14A 2E7LC 3I9AA 1I8LA 1VZHA 1OD9A 1LE5B 4XZ4A 1Q90A 3UAJC 3GMMB 5F88B 2OMWA 3HZKB 3KYOB 2AEQL 1SMDA 4QEGA 3IMVA 1J1XH 3MCLL 5EOTB 1MCOL 3DVGB 1WAPA 4CC1A 3LPOA 3SE3C 4XWOD 1DFBL 4F7TB 1KIQA 4JHVA 4MXWH 3SJVA 5C8JB 3ZHFA 1UKTA 1NFIB 1JXGA 3FOMA 4QRRA 1J9CT 5EORH 3QDGE 2AW2A 1LL1A 2YQBA 4HIPA 4NNYB 3BOVA 1T5WA 1NCNA 2MH4A 3COOA 4J5VA 3RVVD 5IFHL 1TTCA 3LKOB 4Z7UF 1FNEB 5KVEL 5MI0C 3AY2A 3O4LE 3RU8H 4OU3A 3ROLB 4Q6KA 3M17A 1TQBB 3PS6A 2EDKA 5AD0B 4BZ1H 2WBXA 3JV0A 4Z78A 1N59B 2VW4A 4LDCA 4I2XE 2G60H 2PCFA 3H56A 1KIRA 3QIWA 1DLHB 3R1GH 4M6MH 4MAUH 4YGAB 4HJ0D 1UH3A 3IB4A 2IWGA 4GYBA 1GYCA 5IG7B 4JFFE 1D6EB 1EA9C 2EVGA 3ECBB 4DKEH 5HYIA 1N70A 2OMZB 1AC6A 4P2RE 1KB5H 4G43A 3WJJA 5DJ2A 1I1CA 3CK0L 5I16B 1DSFL 4P57A 4HUXA 4HG4K 1C08A 2FH8A 3QI9A 3LZNA 3I6KB 2AJ3A 1Q4NX 4OM1H 1KN2L 2RHEA 3D51A 5BZDA 1RU9L 2HH0L 4EIGB 4ZX5A 2NTSP 1QHQA 2CCVA 3FT1A 3K2MC 3CAFA 3NN8A 2EVHA 4O4YL 4JY5L 4PJAA 4MNGE 4RMSA 2IH3A 1C5CH 2IPTH 1W72B 3O6FB 3PNWA 1PS3A 5T33H 2OM5A 1JRHH 3VE0B 2A3TA 3EO9H 5D7EA 3L9RB 4K8RD 3UO8B 4N5UA 1ASOA 1NIEA 3WUWB 1ZT7B 2OZNA 3CN2A 2MWCA 3O3AB 3CLEH 1KLGB 2EH8H 3FO0L 4JX0A 1AS8A 3AGWA 2K4AA 1PG7W 3H9HB 4G7VH 1UOVA 1ZLDA 2GTZA 4BK5C 1I85C 3OKMA 1RPKA 3OKLA 1A7PL 4JN1H 2WP3O 2HA1A 2P47B 2IBZX 1OWWA 2Z8RA 1HC1A 3BW9B 2VDLB 1F97A 1CBVL 4YFLF 1QVOB 4ENEC 4G8IB 4FFWC 1G9ML 4DZ8A 1MF2L 2HLAA 1NCGA 1UQSB 1SN5A 1YNKH 1EDHA 3IJSA 3T8MA 4L5FH 2V5TA 4BSWB 5T3XH 3C87A 2OK0L 2EUZA 1BM3H 4P2OA 4XVUC 4PJDA 4M00A 4NQDE 4Y0GA 4QRAA 3MOBL 4Z7AA 3UJJH 1NJ9A 2C3GA 1FSKB 3QHFL 4ZBJA 4RA3A 3TIEB 1U21A 2XPYA 2MOVA 3FRPA 3UTZA 3QEHB 3B1UA 1XSIA 1IJNA 3NMEA 3IJHB 4L0YA 1U8CB 2Y06H 4N3TA 2QFRA 3MRKA 4KI5D 5K93A 4RETB 3EXLA 2D0HA 2VQ1A 4DAGL 3PHQB 5GGVY 4BE5A 1JUFA 2NY5H 1LTXA 5D8JL 2DQCH 3UTSB 4KVNH 1AGCB 1KEML 2VR5A 5E8OB 4EKXA 4KFMA 1N0LA 2C9SA 4N2MA 1ZLEA 5EWIH 5D93B 5IESL 4JO1L 2HJFA 5HGBB 5L2JB 4B7IA 2YKLH 4Y16A 1WG3A 2HX9A 2N7AA 4CSTA 4M7LL 3QNYA 5J06A 4XCNA 2D31A 4Y5YB 1ZA3B 3WUWG 4ODUB 2RALA 4QXUH 4EEEA 1WCBA 4Z7OF 2XWRA 3KWTA 1QR1A 1NCCH 1CR9L 4JAMA 2C3VB 3RJQB 1L9SA 1NGZA 2ATPA 1I8UA 4JFOB 3CH1B 1BEXA 1WP6A 2BFVH 2KQMA 4B5EA 3V10A 1K8IA 5E4EC 4ZW6A 5DK2B 1VERA 2HRLA 4BWWA 4Z7QF 1S4IA 1RHFA 4UQ2A 3FFOA 4KGLA 4E41B 2VLKE 1JDAA 1URIA 4GBXA 4YHIB 1ZK9A 4L2LA 2VB5A 5I9QB 3UABA 4Z7WA 4HIHB 5IK3B 3V6ZB 4Y89A 3P3SA 4NAMA 4ZZFA 1WS7A 2WVVB 3QUYB 2GI0A 5B3JF 1LWHA 3H4FA 4JFWA 1XGTB 2ZJSL 5KG9A 4X50A 3V52H 2EILB 3L6FB 3TPKA 3S88L 5ERWA 1OAQH 2DI9A 1IC4L 3MAWA 2OMYA 2FQFA 4RH4A 1P7KB 3EOBA 1GHFH 1VDGA 2WCPA 3IRZA 2A4ZA 3RIFF 5CGYD 4AG4L 5INDB 1E3FA 4KK8C 4WU5B 5F6HJ 3C60B 4ODTL 25C8L 3G6AA 3L4WA 1HHJA 5FHBH 3OJDA 5T1MA 4CN4A 1R5VA 3VD5A 3M1CA 1EGJA 4GXUM 5CMAA 4FYTA 2PW1A 4PCYA 5A16B 1ICTA 4WWKB 4PJXA 3B7TA 4WJG3 4OT1H 4Z95L 3V7AE 4W9GC 1WAAE 3GS0A 3MYZA 1WQVT 3HNSH 2QMKA 5CEXA 2NYZA 3FO1A 2ESVA 3J7HA 1JJUA 3HRPA 4EVNA 2F53B 5I28A 1RZ7H 2GSMB 3VI4E 4YPJA 2YARA 3V5KB 4RAVB 5FO9B 4YXLL 3UYPA 4PWHA 3BEWB 5ES4B 3MLPA 4WWNA 4AQOA 2CD0A 5FKAB 4KVCL 5DMKA 5KYYB 5IMKA 3U2IA 4LSDA 3VFWB 1J5CA 4ZTPH 4LQFH 3P3TA 4P3CH 4ZJ9A 5IUCA 4M3JA 3GI8L 1MCDA 5DJCA 4F7CA 2PN5A 4PLJD 3GMOB 1P1ZA 3WSQH 1MWAL 1N4XH 3GRWA 1OM9A 1L9RA 1MSPA 2I26N 1HZHH 1H0DA 1B0GA 3CIQA 2MOQA 1LO4H 3KPQA 4ZQKB 4D9QD 3OKNB 1TTGA 1GAFL 4RAUA 4YGVB 5E9DE 3P77A 4G8EB 3DX7B 4FZEH 2B1HH 4ANWA 4QOKA 5HHPB 4PEEA 1KB9K 2GJ6B 3IU4L 3QE5A 4BA0A 5D55A 1IM9A 2B77A 2VC2L 2CCLA 1SOKA 3T0BA 4HS6A 1JNNH 4JFYB 1RUQL 1NAML 4MNQE 1I8KA 1RUKL 4DFIA 1NPJA 3BPNC 1JNLL 1DTUA 4QAWA 3ZGHA 5IHUL 1FNSH 1KYUA 1Q94B 3LDBB 1GOGA 4JJHA 4CW1A 3QJXA 5A7BA 7PAZA 2HFEB 1P7QD 3DK2A 1KBKA 3BPCB 3K71B 1X5ZA 1YCSA 2NQCA 3ARTA 4E9SA 1K2DA 4G6KH 3X11B 4WGWB 1RK0B 1W0VB 2IC2A 3R7QA 1VZGA 2H2PD 4C56A 3QUMH 4XC3H 5TTRA 4KMQA 3WKNA 4JZOA 1M4KA 1Z9LA 5BJTA 3W2DH 3QB7C 1YPZA 1K72A 1YEDA 5JNYB 3TS8A 2NUPA 5KANG 3NIDF 4GRMB 2UZXA 1A7NL 3UDWC 3MMEA 1TETH 5D7LE 1HYSC 1SYSA 1KPUA 2A73B 4P5MB 1O6TA 2EE6A 1UTDA 4HWZA 4MJIB 1Q0YH 5HPMB 2W65A 4GW5B 3WEMA 1MHHA 4PGCA 1BFVL 1CF1A 4Q0XH 3MA7B 3B43A 2YPVL 4G80B 2YAEA 1M71A 4E2OA 8FABB 4I9WD 3IJ7A 4X9IA 5ICYA 2A9MH 4GEJA 2FZ3A 4WI2A 1TPXC 4Y1TA 4KJQD 5F1OB 4ETQA 2XV0A 4IRSA 3TEXA 2PXYD 5I1GL 5J89A 5LNGA 1NFKA 3UCQA 4Z77B 4J3UA 2R7EB 2HVBA 4AKOA 1SVZA 3SDDC 2IFFL 5I74B 5I1JL 1PFCA 2YK1H 2IV8A 2YKKA 2ZICA 2F58H 4TL5A 1CC3A 3TV3L 1BXVA 5LAPA 3QUZD 2HG0A 4XBGA 3SE6A 1BFOB 3IDJA 1E50A 3MO1A 5TQ0L 4RVBA 1XSOA 5BQ7B 3CVHH 1M1SA 1X5HA 4RMQA 3PUUA 3D25A 5DJZA 3HC0B 4LLDA 1TYEB 4XVTH 1NUGA 3EYVB 5JXAH 4M8QA 1UD2A 3VYOA 2BNRA 5EZJA 3VMOA 4X6BA 2HWZL 4P3DB 4Y4HC 4FGMA 2FNBA 4BA8A 3P0VH 5DD3H 4CVXB 5K69A 2O6EA 2ZOKA 3HR5B 4N2DA 3BLPX 5I8KH 5ISZB 1V5JA 4NHCH 2HN7A 2N0MA 5KYUB 3BT0A 1WIPA 2PPCA 3BN9C 4HU8A 1A8ZA 2P9RA 2C7UB 2Z91A 4IBQA 2R29L 2OPCA 4FC3E 5T1DH 4HEMA 4ZSOA 1G7IB 1EEYA 5SWZB 5EIIA 1FJ1B 1W8NA 1XR9B 4R7NA 4WO4A 5CLZA 1G94A 3QH3B 3RUGA 1NGQH 1WA1X 1KN4H 3FUKA 3QDMD 5AOLA 1GC1H 4WHTB 1G5AA 3L3HA 4JFPA 3DXAE 4YSCA 4MQTB 2W0LA 2DB8A 2F8OA 5CJBA 2BY3A 4QRSB 2EXSA 4F3FA 1E3XA 4XO3A 1KPRA 5AKSA 2VDOB 3U7AA 4JM2C 4MJJA 3EFFB 4IM8A 1HSAA 5HHMD 1KWGA 2NXYD 4UM8B 4V33A 4WW2F 3WNPA 2EXTA 2CDGA 3VRIB 1N8ZA 1DJWA 1WCQA 3D69B 4HJSA 5HHNA 4CDHA 1IAMA 7PCYA 4JO2L 1QRNE 4IRJB 1IBZA 3ZE2B 4FI8A 3FS9A 3PABA 5D1XD 2JIXD 4P5SA 3QEQD 4JFED 1A4BA 1RI8A 3VXRA 4U1LA 1AJ7H 2GPZA 5CILH 5EOQH 1R5IB 2YMTA 5C08E 4YWGH 5EBWA 4Y4HB 4HCIA 1H8OA 3AM8C 4O02A 2ZXEB 4NQVB 1RJLA 4YHZL 5J0BA 1N5YH 4OZIB 2OMVB 3O9WA 1S5IL 1JPGA 4E0RB 3PWJB 3IETA 4DW2H 1XF1A 4UTBA 3LNIA 3U0WL 2EDHA 2WWKT 2K3TA 3BUQA 3EF7A 3DHUA 2ICWB 2K45A 4YDJB 5EN3A 1YVLA 1N67A 1QSVA 3IMBA 3HTLX 3DURA 3K72B 4EXPX 2ZIDA 4U1MA 5H8DA 1GZHC 3S34H 4WFEE 5IOKA 5HYQB 2FD6L 1PZAA 3WN5B 1KJ3L 4NWUH 5IMLA 1IBYA 4QRPA 5L7XL 1MW0A 1JNJA 4IKNA 5CU5A 5FXCH 2X3BA 3GFUA 5L0QB 3BAXA 3VSTA 2G5UA 3NCFB 2MNWA 4QRQA 4XVSL 4JL1A 1HCVA 4MBRA 2AAVA 2ENQA 4HUWA 5CN3A 2P7TB 3ALWA 3LKRB 2XWJB 2X1QA 4WFGE 1J10A 3D06A 4XPAL 4XRCA 3T4YA 4RNRB 4FABL 3D30A 1WC7A 4FKHA 2WKGA 3F04A 4MWFB 3FQUA 2EXWC 3WFHB 3UPCA 4OZHE 4ZS7L 4PI2A 2D4DA 2ODHA 3MV8E 1MQKL 3QIBC 4PLKC 5L4IA 3V0VB 1CE1L 1R3HB 3STLA 1KBBA 5DHEA 4WY7L 3FSZA 4RESB 1A6TA 4Z3EA 4Q97A 1WITA 5K9KB 1KXTA 1D6VH 5DRXA 4HKXB 1ND0A 3GBEA 2W0FB 3HVNA 3QG6A 1PSKL 1FN4B 4E36A 1FAKT 2QKIC 4BFOA 1WUNT 2ADFH 2OA9A 2IQAB 2WUBH 3IFOA 5IM7A 3OAZK 3AREA 1XD0A 5IFHH 1PY4A 2QGDA 4ZPVA 2MMXA 5KVEH 4JPWH 5F7KC 1FGNL 5FYLL 4APQC 1DVFA 3IXAB 2J3SA 2VUKA 2FHCA 1IARB 3SE4C 1U3HB 2HJLA 2MKLC 3FQTB 4D9RD 2GAZB 4JFDA 4N8VB 4L3EB 4Z3FA 1B2WH 2YLKA 3LQAC 2X1XR 4OZFH 5A2FA 2DQTH 1S6NA 2QL1A 2OQJB 2P8PB 3M6DA 1A21A 2Z4TA 7FABL 2NR6D 5I5IA 4OI8A 1Y18A 3QRBA 5D4IA 5E0FA 1EZLA 4OCSL 3MV9D 1ET8A 4UMGA 4ELDA 5DWUL 1BECA 4YE4L 4JFSA 1JZ2A 2VSCA 4D0CA 2Q7NA 3B7RL 3T65A 4HKZB 2ZPKH 5F1SA 1PTZA 1JXDA 3LKNB 4N0YL 3U4BL 5GRVK 2EKSB 4RGNC 3QIBB 1S9XA 3HMXL 2O5XH 5LLIC 2QV2A 4KPHL 1NCIA 3RKPA 4O4YH 3CFDA 4CILA 3RBGA 3TEYA 2BSRB 2PR4H 3QIUB 1ORSA 2XWCA 5D4HA 1PKQA 1HI6B 4M4RA 3BFOA 5AOMA 3RWDB 2CHNA 3L3JA 5LDUA 2OXHA 4JO5A 3UBGA 1IKNA 3P73A 3TZVA 5IF0A 5C09E 3MA9L 4POYA 4V1DD 5D71L 3BHBA 1WAAF 3RKDD 1GS8A 1VKXB 1JV5A 5F3HB 4HUKB 3BE1H 2CE6A 2WBJA 3N43F 1SBSL 4L4TA 1F86A 5SWSD 5BXFB 5F7AA 2FGZA 2AJSL 1J1OL 2WJ7A 3W0WB 4O58L 3VI4F 1AXTL 3O11A 4DP1X 4PAZA 4PRBB 5IOPA 3VSQA 2EINB 5IFJA 2UZYA 3ZMNA 1A7PH 2Y7MA 1PX8A 2JB6A 1ET7A 5E6IA 1H6EA 3NOIA 5KVDE 1LEGB 4FP8L 4NO5B 5D7JA 5DEJA 5F1NB 4DCQB 2YPKA 3OKKB 4DGVL 1J05B 1TTFA 1SYVA 2UUDK 1X7TA 4AYGA 2AQSA 2CQVA 1ACCA 35C8H 4MCZB 5FK9A 3IAQA 1GW0A 4GRWE 3DMMB 4XE5B 1MJJB 4P2QD 1IC5L 1J9TA 3AAZA 3ZW3A 3HJEA 3NGBC 4RGNB 4N8VG 4LU5L 4YSOA 3SJVD 2Y1VA 3B8YA 1NBVL 2DIAA 1FL3A 5IQMA 3MRJA 4POZD 2DWDA 3JTBA 1JOIA 1JRHI 3BSGA 1JD9A 1KEGL 4E5XB 4EN3C 3ARBB 4B5ZA 3VWKB 4DT2A 2TSBA 3EH2A 1VFOA 3OZ9L 1NGWB 5IBLC 5CKGA 3SGJC 5JORB 1BGXH 4J3XA 1QEXA 1WBXA 3HS0B 4MB4A 4AC2A 3LS5H 5FGBA 4U6YB 4PJ5B 5EIQA 3QIWD 5L8JB 4XNXH 3FXIC 5I6KA 2COVD 5DMGC 4W6WB 2R8SH 2WBKA 3MJ9H 4X98A 5IESH 4HUUB 5FOBB 3QFJE 1KCLA 2FBJL 5DZOA 5DD5H 1O7DE 2LU7A 4KJYA 2AEOA 3B9KB 2QKSA 2ITCB 3MRQA 5ALCL 5F7EH 4YDKH 4ODSH 4DHLA 4IBZA 3BPLB 3G6JE 3BKML 3O6MH 3DROB 1AYOA 4NQEE 4OCNC 3BDBA 3C8KB 3QI9D 3VFUA 4GP4B 4DP7X 3R19A 4PSPA 5CHNB 2XIDA 2ZYSA 4FXGA 5J6HA 2EDFA 3OLDA 3HKFA 2WLLA 1H3XA 3C5ZA 1KCVH 4Y7MA 3TCLA 5I19H 3AZUA 4TS6A 3S5ZA 4LKXA 3UTTE 5DK0A 4MD4B 2DQGH 4OTXL 2WQRA 1J88A 3CXDH 2B7DT 3VYNA 1IRAY 1RZPA 1JGEB 3EJZD 3D9AL 2VJXA 3QUKB 5KVGE 3JVGC 3FB8A 2E75C 2OL3B 1YSOA 4HC1L 5DYOB 3OGCA 2J71A 4AQAB 5I8CA 3NFNA 1RZGA 2RJMA 1HZLA 2QPDB 4HS8L 2ZJSH 4J6RH 1WD9A 2Z7YA 3BAWA 2K1MA 3BH9A 4JANA 2XQBL 3ME0A 4PSRA 1MFNA 3AACA 1VIWA 3C9NA 4NN7C 3VGAC 2VXVL 3HN8A 2R2BB 4LDEB 4AG4H 2NX5E 5MEQA 1FVCA 4M5YH 1ANUA 1UOKA 4E5XG 1X5FA 1P4LB 2A83A 3S8FB 4ODTH 25C8H 1QSZA 4X4KA 4GKSB 3Q3GA 2VH5H 1ZT4A 2H0JA 3FTGA 3JWOL 2GJRA 3GS4A 4P2OD 4HT1H 3V0HA 4LP5A 6FABL 5G2NA 3TJHD 5DZPA 1XCQA 2V7NA 4X5XB 3WV0A 4MS6A 5F89B 5BOJA 4MMZB 3DETC 4ODWA 1HXYA 3QW9A 2WZPA 3CDZA 2GCYA 3HI6L 4LAQL 4XPHL 3TEZA 2CDEB 2KPNA 2XA8H 1XF2A 3CFMA 4XP5H 1T89C 2KQNA 3CLWA 1GTNA 1UWEL 1PL3A 1XEDA 4MA7H 2VR6A 4N3UA 4YXLH 1I82A 2V8MA 3TFKD 5ABDE 4J3OC 4NI3A 4R90L 3IF1B 4S11A 3H0TB 4HS3B 4L3AA 3NPSC 3E6FA 4PY7A 5I76A 2XWTB 1T3FA 3DYOA 1TXKA 1DO5A 4UI2A 3N2JA 4MLSA 4HAGA 5DDHB 1MAKA 1DDHA 3QP3A 2KDGA 3U9PL 4XPBH 2ERJB 2LGNA 4Y16D 4XO8A 3FU9A 2MEJB 2DBJA 4HSQA 1CU4L 1JGLL 4NN7B 4R97B 2X05A 3L3KA 3Q06A 1D5XB 3CC5B 3S36X 1HSBB 3TXAA 4LPVA 4Z3IA 2RGSA 2E6JA 1YN7B 4FQHA 3BAIA 1LO3H 1D5MA 2DJMA 3S3BB 3FFCB 3IU4H 4ONGH 1L5GB 4NBYB 3ATAA 5BO1H 3IDIB 1QUNB 3OR7A 5C2UB 4PJ9A 1UGKA 5E2WL 1CFQB 3W39B 4JFXA 4OM0L 1XH3A 2NT0A 1NAMH 5I66B 1KB9J 4FTDA 4HDIB 2QV4A 1YQ2A 3FQ1A 2H1XA 3FQYA 4PJHE 5JOPD 1KJMB 5I0WA 5I6PA 3H6JA 1VEOA 3MLTA 4NI6A 1S9WB 2IXQB 2XN2A 2VUOA 1MCLA 3FT4A 2R9HD 1YDPA 2Q8BH 3KR3L 4MQXC 4O00A 3MLRL 4KJPD 3LS4L 3X1FA 2AGJL 4NZFA 2AJYL 4UT7H 5ITBH 4LGRB 4WK0B 1LHZA 2NY6D 4LBEA 4MRBA 3SPHA 4G6MH 2A0LD 1JZ3A 3NPSB 2C9RA 4P5KA 2BW5A 3F6IA 4KK9D 3QAQA 1K4CA 4WHYH 4XP4H 1I9JH 1DQLL 2HVJA 4XCYA 4QRUB 2YEZA 3JV5A 2DIBA 3LRLA 3HE7A 4JPKL 5DI8A 3A67L 2APVA 1BZ9A 3DTXA 2QSQA 3MU3A 2ZWNA 1MJ8H 2KZWA 4LEOB 2ZUSA 1G9NH 2QADC 4OW6A 2H9GB 4H25B 3WDHA 4Q6IB 4NJAH 2JK5A 4QKXB 1GYAA 3UACA 4OZHF 4X80H 3JWDH 1Z32X 4BUQA 4JFQB 5J6GA 4OCYL 5EOCJ 1GSMA 4F33B 2PO6B 4K07A 3HPJA 2N56A 3MRRB 3D7PA 4A7SA 3SDCC 2K9UA 1U8PA 1VFMA 4GSRA 2DQHH 3AB0B 4W9IC 1T20B 4PRHA 5IB2B 2Y07H 2YD0A 3HNVH 4BFBD 3QG7L 3T6ZA 2WINB 1RZKH 4PJIA 3QCTH 4FNLL 5HDLA 2E4FA 2OJEA 4DVRL 1I1YB 1Y1DA 2PTTB 4NENB 3GZOA 3PWPB 4HQQH 1BA9A 1CUOA 1KTDB 1TF4A 4J1UA 3TV3H 4ORGB 3ZU8A 2IMNA 3MTXA 3AS1A 5K39A 1L9NA 2ENPA 5TQ0H 4ZXBC 1R5WA 4NN6C 4KDVA 3PGDA 2P24A 4UV7H 5C6TL 4GO6B 4RRPA 5CLWA 3TBTB 4WI5A 3E38A 3T6VA 2J4WL 5ECJE 4LRIA 4LKCA 1CXHA 1EZUA 5TDPB 2C1PB 3SCMB 3BQUD 2HWZH 4QOKD 4TYUA 4YAQA 5I75B 1DANT 3MR9A 4FI7A 5ALBL 5A6LA 1FF5A 3CZJA 1IM9D 3HNTH 4JO8A 1CJYA 3MXWH 4W9FC 4F2MA 2QADB 4U1HB 3FYIB 3K91A 4BJLA 1PY0A 1EBPA 2KPWA 1TSRA 1UEMA 1PIGA 4XNZC 1U8JA 5F0JB 4IJTA 4NUQA 5F97E 5HVFB 1EHLL 3S96B 5C0CB 3NCJH 4YHYC 1L9PA 2VDMH 5TF0A 4DQOH 2AAAA 1U8KB 5AOKA 2A99A 5AENA 1YEEL 4G70B 4HD5A 2BSDA 4F1SA 1MCKA 2WPGA 5FS5A 1NFDA 4NHUA 3C5JA 2X4PB 1YC8A 1T1YA 4JQIL 4NQUA 4PJ7E 2QFPA 4QHNB 1FH2A 2Y24A 4JKMA 3SPVB 3V0EA 4HBQA 3D08A 4GIPD 3VXOB 2EVJA 2UWEB 3BSHA 4G8GB 3T2PA 4X9FA 3V9EA 1A7RL 1JZDC 3FT3A 4LHJB 5GGQL 4LSVH 3ZTDC 1T7VA 5J56B 4RAHA 1F3DH 3GM0A 3M7OA 1GGTA 3IS1X 3CHSA 2RBLA 3ARGA 3PL6B 1T5XB 1NM9A 1XGQB 1YY9C 1P5UB 3CZEA 2G0KA 4NN6B 4ZXBB 2JB5L 3G6DH 4JRLA 2OMXA 1GJUA 1PZ2A 3EF4A 4WEBH 4J12A 4JKLA 4WRLA 5TE6H 1I3UA 4HKJB 1N2RA 4LT7A 1BIIB 3F5WB 2WQXA 5EC1B 3RLSA 1AS6A 4ESKA 2OP4L 3WAKA 4L4VA 1RJZB 4ADGA 4FTVA 1JIBA 3Q44A 1KGWA 3K0WA 5A2IH 3X14A 4PWFA 4GRWF 3AXLB 4K5LA 3IVKA 4XMXA 1LWJA 3BGFC 3N5AA 3VWJC 4RFOH 3EYUH 5KVGH 5EV7A 3RDJA 2E7BA 2XQYA 1PD0A 4ZAKD 2J21A 4YHYB 4NAJA 1TTUA 4MDJB 3GJFH 5I17A 3BIBX 3ABZA 1KCRH 1KJ3H 1IUZA 3MLZL 3B9VA 4WDIB 5D2LA 5BRPA 1SQMA 1XD1A 1AIFB 1X6NA 5M7QA 3N40P 5CUSL 1KJ2L 4XNUL 1ZE3C 4LPXA 1U8NA 5E1HB 4G42B 4QT5B 3TONA 3TNNB 4GB9A 4FL4C 4C55A 5D5MB 4HIEB 1A9BB 1R3JA 1GJIA 1IEAB 4PUBL 4LDLB 1TTAA 2BRRH 5GJTH 1G1OA 5AAWA 4ZUTB 5D72L 2IDUA 3VFNB 4CA4A 4KKBD 3KGRA 4JDZB 4AH2A 2YN3A 1S7RA 1JN6A 5DRWB 1AO7E 3MFFA 1DCLA 5IMMB 3APFA 3L3GA 5HHOA 5AKVA 5AW7B 1IBDA 3GF8A 4BFNA 3MOQA 3L48A 1CF8H 4XC1L 4I13B 5BRZB 3FU6A 4JFTA 1B4LA 1JXJA 2H6UA 1B0RA 4YBLC 2DLFL 1PG7L 3GI9H 4RFEA 1OCCB 1AQHA 3OHXA 2AANA 2LU5A 3TA3A 43C9A 1NKGA 3T1WA 4PG9A 4YBQD 2N3JA 4DNLA 4WO4D 2B9BA 3B3IB 2OCJA 1QSEE 5DQ9B 4O2EB 2EXYD 3I74A 4TM9A 1CVSC 2ARJB 4MAYA 4KXAA 1J0IA 4QY8B 3CFCL 4LCYB 2WLJA 4TPRH 4JGNA 3WENA 1HHIA 5I18H 2X09A 4B27A 3ZKXC 4Z7UB 2P5WA 5DT1H 2N0KA 3K3QA 3G5VB 5C0AB 3IXTB 3STBA 1DJYA 3J27A 4P46A 3UTQA 1NLDH 2W8CA 1CGWA 1UKQA 1FAIL 4AEIH 3Q0HA 3DVFA 2OR9H 4WI6A 4YHMH 3IDNA 1A25A 3L3OA 1JWMA 5JOFA 3F2LA 3VMNA 3AWGA 2VMCA 3VXRD 1Q9WB 1J86A 1PGRB 4K71C 4NZRH 3RGVC 4A7VA 3WS6C 2DD8L 5D4JA 4XOEA 1KLUA 1PX3A 4S1DD 4AW4A 4HEPG 4K23L 4H1LB 5AW4B 5EU5A 4L8BA 5TGBB 4EOWL 3HMXH 4JJ5A 2O5ZL 32C2B 3O9WD 4IIQB 1BQSA 3TYFB 4UTAA 1XF5A 2GG1A 5EU7E 3SKMA 3PDOA 4UB0H 4AQ1B 2YC1B 5LXGL 4MMYB 5IHWA 1TIUA 1Q9OB 1BCIA 3RWGA 3U6RB 1OL0A 1ZS8A 4HZAA 4CNIB 3MRDB 2VLRE 2Z4QB 3PE9A 2LOEA 5HJ3A 4QRPD 3TGXA 3NZ8A 1KTJA 4NYLA 3GTNA 2R2CA 5ABZA 4ISVB 1J1OH 2DAVA 4IRZL 2OSLA 3EO1A 3FZUD 3SYOA 3O6LH 3GSRB 3T0EE 3JV4A 3ULVD 3RYMA 2CK0H 1U8MB 5AW3B 2IV9A 1R9FA 1GOHA 1G87A 1J1PH 1NL0H 1ILSA 4M93B 3S35X 4H88L 4Y1AB 3O2VL 2ED8A 2IDSA 3I9IA 2EIBA 3QULB 4QF1A 1CE6A 3EHBC 4BEIA 4DGVH 3MRPA 5AZEH 1TJHL 4UDUA 3AU1B 3ZYZA 5IUSA 4K71B 1CDUA 2CHXA 1OGAE 1YECH 4BQBA 2PR9A 4M62L 5GZND 3TO2A 4L8CA 15C8L 3MBWB 3SGEH 1FLRH 4IGBC 4LU5H 1Z7JA 2WLKA 2K6ZA 3PXLA 3GSNH 4ILDA 1TSHA 3CXHK 1PW3A 2CPCA 1AGBA 3NCBB 3W9EB 3KGSA 4H44C 3ARED 3CVIH 2H3NB 1J8HA 3A6BH 5JDJA 5JIPA 1B3JA 3I6GA 1UC6A 4KKAC 3VXSB 2ADJB 4PJHF 1DVFD 4M1GH 4H4NA 2LU4A 3L4UA 3VXMA 4JFDD 4H1LG 3BD4A 4P5RA 3FPXA 4HGKC 2CMRL 1RZIB 3GTTA 5K9QI 1KDJA 2WZ5A 1BF2A 1OIOA 1UXWA 2XXFA 1VA9A 3H54A 1B88A 4PB0H 1F56A 1CGYA 4PJGE 5LN8A 2CJSA 3H2PA 4AUYA 5ALCH 1G6RH 5I82A 2NY0C 3L4CA 3L9YA 2BVQA 3EOTL 3UJTL 5C7XH 2NY5C 5DFAA 5IB1A 5GS1C 1C5DA 4HPHA 3TBCA 5JR1H 5I1HL 4BFEA 3B5HA 3PGFL 6CGTA 2HT4D 3DIVA 2F19H 4Z7OB 1GSKA 2L0DA 3L5JA 2W60B 1JZFA 3TCXA 2XBDA 3P4NA 1USQA 2R83A 3MXVH 4N2CA 4AEHL 1U92B 4KKCC 5C2BL 2BHFA 3ABLB 3TZVD 3D52A 4AJYV 4HVBA 3DO3A 1CICD 3D9AH 4Z7QB 4F7KA 3N6YA 2WBJD 4L4TD 3CFJB 1H15A 1P0SE 3MJ8A 4FQ1L 4FLRA 5EU3A 2N4IA 3ZY7A 1IO4C 4OD3H 2KMWA 3VG9B 1GW6A 1JZJA 2WVTA 1RFDL 4JRYB 4CJ0A 2NRDA 3LH2L 1H3TA 3S8GB 4KK6D 4K8RH 4DKTA 3SOBL 2HAZA 2WK2A 3RX5A 5E6ID 4L3FA 2IF7A 3BUYA 2EE3A 3G3LA 5IBTH 3SYQA 3FH8A 4FQCL 4XPGH 2WAQA 2VZTA 4HIIA 2J1YA 2ENYA 3ARFB 2GITB 1MW3A 2ROXA 4YHNB 1E5AA 1KZQA 3EJTA 4ZDHB 2HZHA 3HI5L 3KL0A 5E5MB 5EC2A 2IADB 2BY2A 5E23A 4HCFA 4LBAA 3D09A 1FG2A 3NEOA 4LLUB 4WFFD 1JXKA 1YEGH 3JSSA 3PP4H 1WWAX 4H0HB 1IEBA 4WKZA 5KJRL 4JFUA 4KO7A 3HI6H 2UZIH 3FUDA 4TQPA 2W80C 4XN9A 2NQ3A 4I87A 3GNMH 4AI7A 1OGTA 1WO2A 3W5MA 1XMWA 3EG9B 1S3KH 1YMMB 2LW3A 2LT9A 1F90H 1CLCA 4UIMA 3RTQA 3VXQA 3H9SE 2X6AA 2VZ1A 3MGOA 5KN5B 3O8XC 1WZ1L 3ZIYA 2UY6B 5HSFA 1QFOA 1UA7A 3NK4A 4BZ2L 4M48L 1CD9B 3A22A 3D3VE 3WFDL 1L0YA 4HK0A 3US1A 1AVAA 2BP3A 3LX9A 3KPRE 3EJCA 2FBOJ 5AVZB 3GINA 1KG0B 1JV2A 5D2NC 3LEVL 2OAAA 2WSDA 1QSFE 4PJ7F 1X9LA 1IGMH 4QWWD 4LXFA 3CFUA 4MYPA 3JV6A 3AXIA 3BUIA 2JTYA 4PREA 3FQWA 3L13A 2Q2EB 4HKBA 3RVXD 1H3WM 4HIQA 4M1CD 5IQ7H 4JRXD 1MZYA 2MTAA 2E3VA 2V3EA 5E56A 3CX5J 4A7UA 2XFXA 1E4KA 5D7SL 1B4JH 4GQ9H 4PIRF 2Q76B 3BWAB 1ETZA 3VFTB 3KLHD 3PDDA 5TPWL 3CMOL 4LARL 3PU7A 3NSYA 2AQPA 4FFYL 2Q7YA 1M3IA 1SN0A 1MFAL 2D3LA 2YIHA 3FB6B 3O3BB 1IAKA 2A6KA 3O0LA 4M7KH 1A3QA 1EAPA 2EH7H 1SFDA 4HOWA 3HE6C 3MLWL 5CBAB 2WW8A 1QBLH 2E9GA 2IPKA 4OFIA 1UT9A 3IFLL 1NCBH 2JCWA 3D4YA 2FDBP 1KELL 2OTUB 3O41A 3VVVA 3ESMA 1OZUA 3MV7B 2OYKA 3GHBH 4KO5A 2VO5A 2BWIA 1RIVH 1HH6A 4TOYL 2XY2A 2WHVA 3MNVB 4AIZB 3LNEA 1DQLH 4XNBA 4IKKA 2JJVA 4MXVE 4I4WA 3A67H 1F3JB 4JMXA 4UNVA 5JHBA 4U1SA 4UNIA 4E9QA 3SGDH 3KPSD 4XCCH 4IDJL 2YHGA 5C0BB 1A14L 3NIDB 1F11A 5IEHA 1PD6A 1QABA 3N44F 4GMTH 5SWQB 2ZSWB 2X4UB 4W9KC 2ARJQ 2JJSC 5BS0E 4TVPE 1NCTA 3LSOB 4J7RA 1HL8A 3FQNA 3FUIA 2ITEA 3HMWH 1A3RL 1KGIA 2WZPD 5F9AC 4N5ED 1EEZA 1RLWA 4G7YH 4KTDL 4B9FA 3BJLA 2EDMA 4LNRB 2OSYA 4XN2A 3VGHA 1ETJA 3EJRA 4HA1A 5CZVH 4OGQC 3C8DA 4RRPM 5HI5D 5E4OA 3LY6A 1DJIA 1UXLA 1WEJH 3D39A 3P9WB 4LLVA 2LAAA 1LK2B 1T0MA 2VM3A 3R0MA 5AWNL 3SQBA 5IW1B 3VXNA 2BP5M 1XB8A 3PFUA 4JE0A 1P9MC 4YIQB 1PU0A 1P1VA 4H40A 1NWPA 3OKEA 5JIMA 1G9EA 4W9HC 1X5GA 3QDGB 1X5JA 3PCYA 1XH2A 1E6JL 3QUZB 4B3EA 2HT2D 3VQ1C 2C26A 4JCWA 1SBBA 3MRBB 3TWCL 5E95B 1DR9A 2EJ1A 2GY5A 5FM5O 3QXWA 3O4LB 1I4FA 2FWOB 4DP0X 2Q0ZX 4S1SL 4RMUA 1FNGA 3FRUB 3BZ4A 2GUYA 1LMKA 4P5TA 1JF6A 3DBXA 3EIFA 4KC3B 5GS0D 2F1EA 4OIAA 2JI1A 1SVCP 2Z6FA 4ALAH 4ES9A 2G5BA 3EKCA 4I2XB 1DN0B 2EKJA 3RVWC 1OGSA 3QUMB 1BQHA 5HVWA 4PJ9D 1TZOA 5F7FA 3LKPA 1CYGA 5F7DA 2R15A 4TUOA 4JFFB 5H37A 4CJ1A 4A2EA 1JGIA 2AXFB 3WJLC 1T1ZA 3RQ3A 1EHKB 4P2RB 1A2YA 1FWXA 4GP5B 5FV1L 3VFVA 1W0WB 1SOSA 3U1PA 2YGPA 1LVEA 1T21A 4NZUH 4XP1H 5FUZL 3QZNA 2R0LH 1O9VA 5CD3B 4JQIH 2PWHA 2VITA 3TBSB 1IKFH 4OZGE 4MNGB 4NNXB 3OMZA 1XIWB 3W11C 4NFBA 1MPAL 1NDGB 2NY4B 1PDKA 4O5LL 4FJZA 2WXPA 3HOGA 3UZQB 2QVKA 4AYFA 4AX3A 3OSKA 2R2EA 1C5BL 3HE7D 3QUXC 4HIJA 1G7MA 3IK2A 1GC1C 1MXGA 4WW2B 4E9LA 1S9YB 4FCHA 2APXA 2IANA 4I18C 1LE5A 3HRZB 3V4PA 3I84A 2NXZC 1I9RL 5T1LB 5F88A 3T2NL 3U82B 5B1KA 1E90A 3HZKA 4PGJA 3DX8B 3KYOA 3X1EA 5BZZA 1S8DB 4WJKB 2YXMA 3I3BA 5EOTA 1IGIL 4C83B 1CL7L 3DVGA 4LHQB 3E2HB 5DA4A 2YOAA 1I7UB 4LNVA 1MIEH 4KKLD 1C8PA 3CVHB 4F7TA 5C8JA 1T0PB 4PCSA 2PTUA 1NFIA 2DMKA 1D5IL 2IPUK 4PRHD 4MD0B 3VFSB 3LZRA 5I73C 3D2UA 4NNYA 1R17A 3ARDB 2J56A 2PPEA 3F12A 2JQZA 2YJQA 3NYKA 5FYKD 3V5HB 5HP5A 4NQDB 1RMFL 1FNEA 1WLHA 3IJ8A 5E99H 3ROLA 1KJ2H 3HLKA 1NBCA 4J2QA 2OBGA 5AD0A 1X4ZA 4FRWA 1MDAA 4OB5H 5CNHA 4QRRE 2XFGB 2C4FT 1VGKB 4YL9A 3K8LA 4YOKA 1KYFA 1N59A 2ADIB 1F2XK 1MI5A 3RAJL 2V6HA 1DLHA 3MYJB 3P69A 2BNUB 5E2JA 4FD0A 1NCAL 3CSYA 4Z3JA 4ZK8A 4NO2B 1LDPH 5JXED 1D6EA 4J3TA 3DSNA 3ECBA 4F1ZA 1JXFA 1FIGL 4UZUA 3ES6B 1R0AH 2OMZA 2BHYA 4EI6B 2VQUA 4I18B 4XPTL 5I16A 3TIDB 5MHSD 3UAJA 2H45A 4PJGF 1AP2B 2GI7A 4RQQB 5CJXA 4ZNEE 1S7TB 4CL7A 3Q43A 2MSPA 5F2FA 1TVBB 2V4LA 1JYNA 4IOIB 3L5XL 3ZXAC 3O6FA 1K85A 2YD5A 1HNGA 2VWEE 4MA3B 3AS3A 3RJOA 3MLYH 3RWHB 2G3NA 2Q8AL 3VE0A 1TUPA 2XX0A 3I50L 4WUUA 5GGVH 2EEAA 2L4OA 4PG2A 2ZUQB 2F7OA 3L9RA 4UV4L 3LMJH 5CSBA 2EADA 1JCKA 3CQQA 3O3AA 3QQNA 1NIDA 3RNKB 1DVXA 1RUMH 3AS2A 4JR9L 1Q0XL 5AFAA 4HJGB 1PQZB 4NBZB 5FWQA 5I26A 3EYSH 4AXWA 3STZB 4QTHB 5DRZA 1XFPA 1UH4A 2XTJE 2XXMB 3GJFK 4OJCA 5G4OA 2A4CA 2UV3A 2VLKB 4IDLA 2V17L 4JPIB 3ARGD 4M43L 5F0LB 5JHLH 3BW9A 1NQBA 5C0RL 5AAPA 1QVOA 4W93A 1I1FB 2DQFB 2KI6A 2JI2A 5EU6D 4LVNB 5D96C 3BT2L 3WIHA 5LCVA 3RL1B 1UQSA 3AADB 2Q7AA 2DD8H 3R4DA 4D3CH 1KCSL 3ZKMD 4BSWA 3NJXA 4U1GB 4WUKL 1TU2B 2JKRM 2BSCA 3X17A 5KSUB 1GY1A 1JZHA 1U0QA 4ZMVA 2AJVH 1MNUL 1V7MH 1HIMH 2BOLA 2N7BA 2NNFA 3TIEA 3BRFA 1IVTA 4ZFGH 2ZOTA 1QA9B 3KW8A 4X4YB 5B7FA 1OXYA 3VU2A 3QEHA 1K8DB 2MFNA 5KVDL 4DK6A 4NWTL 1J8SA 1F4WL 1U8CA 3NFPB 3E6HB 1MHCA 4X8XA 3VDCA 5GGUB 4LB8A 1J8RA 3MLXH 4JFVA 4YUEL 3PHQA 2EYTB 4UINL 4LLYA 3N43B 3JVFC 2WWOA 3NIGE 4XODA 4F2FA 3RRQA 4HIXL 3UTSA 1J48A 3NQKA 2YAQA 1AGCA 1U42A 2DM3A 3SPGA 3JUZA 3GMRA 4I0PB 4UT6A 3VI4B 2CIIB 1I85A 3N40F 2N1TE 3MLVL 4TQ8A 3L8QA 1T22B 5HGBA 3O2VH 4K3GA 3R8QA 2R69H 2ZUWA 1CK0L 1YEWA 4XP6H 1O5DT 2IALB 2WSKA 5HHOD 3QJVB 4Y5YA 4ODUA 1F1GA 3IU3A 1HNYA 2EDWA 1A5FH 5HYJD 1CLOL 5IWLC 2A9AA 2C3VA 3N9GL 3HS8A 1CFMA 2VM9A 2OMUB 4K2UH 4OCRH 4OCWL 2VXSL 3JTSA 2BNQE 4O9HL 3W9DA 2WJ5A 1C1EL 3RY6C 5E9DB 2XV2A 5DK2A 4DN4L 5E2UL 1DDTA 4XP9L 4AMXA 3VDAA 3BSZA 1J5OH 1KGCD 1U8HB 4G6JH 4E41A 5B1JA 3VXPA 3WE6A 1E7UA 3MBEC 4YHIA 5LGHL 4PRIE 3ZDXE 2R2HB 5IK3A 4HIHA 5GZOC 2FT8A 2H1PH 4KH2A 1QFWH 1L3NA 3LXCA 4LOFA 1V05A 1W6LA 4MNQB 5CFAA 1PKOA 3QUYA 2CHZA 1YNTF 2HP4A 4BKLB 1OPGH 1MVYA 4UOW1 1RP8A 4X7FC 3X12B 4EUPB 4P46D 3BVNB 1PAZA 4QYAA 3T4AC 3L6FA 5KYNA 1J12A 1I8AA 5IZ7A 1OAYL 1P7KA 4NQSB 5DS2A 5INDA 1GXEA 4A6YL 8PAZA 1XXDC 4WU5A 3UGXA 1SEQH 3C60A 1A1NA 1D9KA 2ICWJ 2H7WA 1FO0A 2VNCA 2XTSA 1PZDA 1U91A 1OWRM 2ALAA 4OJYA 3UC2A 4MXVF 3V7AG 4EZKA 1ASQA 2V2XB 4D8OA 5A16A 5J11C 3IGLA 4EDWL 4WWKA 4QKTA 1PJ9A 5I30H 3SGEI 5T1KB 1YUHB 1ETB1 3QXAA 5HDBE 2W9EL 2Z8SA 3V6FB 4ZO8A 1LWRA 4JG1L 1V7NL 4ODXB 3DTUB 1JZ4A 1CZ8H 3WXWH 1O9ZA 3V6OE 4HCGA 4X7SH 4O02L 4WJ5B 1EK3A 5C0ND 4IBYA 5CKAA 3V5KA 3BCFA 3DHPA 5FO9A 4BH7B 3BEWA 1AOHA 3IEAA 1HWHB 4JG0H 1ECYA 4PJXE 5FKAA 3FUJA 4JFHE 4CGTA 1I3VA 2EZ0C 2ZXWB 3ASOB 3T2LA 1RFDH 4YH6A 2XRAL 4D7PA 5H35B 2ESVE 1YEKL 1A0QL 2LTQB 3LH2H 3NSJA 2J1ZA 2ODIA 3GMOA 3TF4A 4ERSL 2GHZA 5C0EA 5FFLA 4WGKA 4LSQH 4PGBA 2YQ2A 1UCTA 1OARH 2D9QB 3T4AB 1MY7A 1MFDH 2BP8A 3HFFA 4PD4J 1I7TB 4ZQKA 3BUTA 1A6PA 2FNWA 3OKNA 1PNCA 4YGVA 4PYGA 4CU8A 4G8EA 4E68A 1THAA 1OANA 3DX7A 5E1GA 1WHOA 5HHPA 3VRLE 3NCWA 2GJ6A 3EJUA 4Y5VB 1SY6L 1NEPA 3PJLA 1UWXH 2WLNA 3WEOA 2XWBB 4EUPG 5KJRH 1G7HB 4Q9CA 2F68X 2FEEL 3WU1A 1S7WB 2LAGB 5FC9A 1DJGA 3TOPA 2C1OB 5CIPB 4R3SB 2IBGA 1UENA 2CGRL 1DANU 1J8HD 1Q94A 1EZVX 1X7QB 1NLBL 2J20A 2YBRB 1UCBL 4Q52A 2HFEA 1M7UA 1MHEB 1WZ1H 2TAAA 3OHMB 1PYWB 3K71A 3U2JA 3VXMD 2ZCKH 3ILPB 3X11A 4KRPC 5F1IB 4HGWB 1RK0A 2W59A 2DTMH 3V0IA 1W0VA 3PY9A 3HG1A 1AACA 1CIUA 1CDGA 3GDCA 5K9QG 3B7YA 4XOAA 2ICEB 2EE2A 5T8IA 2ZUUA 3D87B 5JNYA 4OZGF 2JJTA 4UQAA 3S5LB 4GRMA 3DXAB 3AY4C 4LSUL 2D4FA 4HETA 1I8IB 5J12B 2MKWA 4FFZL 4WFHD 3F7KA 2A73A 4P5MA 5I1DB 3NABH 3FUMA 2MQCA 1SXBA 4C56E 5A2LH 1AC0A 5HVHC 5HPMA 4GW5A 3OV6A 1DBBL 4LSRL 1YPZE 4MKMA 43CAA 3CC1A 4WTWA 4GRLC 4LARH 3QRLA 5J4MA 1QRNB 1ORQB 8FABA 2EO9A 2NLJA 4N2AA 4X5WB 1X5KA 5GRXG 2WKOA 3L3DB 5C08B 1R4XA 4HALA 1QYGH 4WWPA 2VDKL 4NN5C 5FM4A 4HF5H 1MFCH 1II4E 6TAAA 3Q1SL 4GQQA 5D1QD 1NM4A 2IOMA 5GGTA 2AV1A 4WTZG 1NC2A 3P9MA 4M6OH 4TOYH 3X3GL 5D1XB 2DBLH 4X6CA 4KRPB 1BFOA 4PFEA 2Y1YA 3TN0D 3VFGH 1BZDA 4M02A 2FECL 4K9EH 5BQ7A 1F4AA 5DO2D 4P9ML 2RQEA 3C6LD 3OAYH 3HC0A 3RIAK 3LZOA 3EYVA 3GIZH 4AENB 3E8UL 2E59A 2EDJA 3FULA 4AK1A 2QQNH 2YRBA 4DEUA 5I8EA 4GKOA 2I07B 1CT8B 4CVUA 1FPTH 2BXZA 1R3KB 1BX2B 4OCXL 4P3DA 3HB3D 5KSAD 3JWNE 3R0NA 1WGOA 3EJPA 3HVDA 3RP1A 5B1BB 5AVRB 5HVHB 3VD2A 3TVMC 5DD0L 2XZCH 2AXGB 4FA8A 1N64H 5LB1A 4DP6X 4Q6YA 5KYUA 3K5RA 3NJJA 4GRLB 3RFZC 2WP3T 4KTDH 4OZHB 2C7UA 2FK9A 3MV8B 4ZZKA 1HN1A 3QO0B 4DEWA 1KV7A 2BNRE 5ID1B 1G9NC 1QLEL 3S5LG 3IMTA 2FJGB 5SWZA 4I89A 1XR9A 3JBG7 1CDYA 3RTQD 4DZBB 1I75A 1MIML 3QH3A 5AKTA 4PRPE 1AE6H 3JWDC 5L6YL 5AWNH 2ZOLB 3MX0B 1BZ8A 1EERB 4QRSA 1G1KA 1MCBA 4X5RA 1E4HA 3BAYA 4I3GA 5JLZB 3EFFA 4FQIH 4UM8A 5JPNC 1SUHA 2QGEA 3A6CH 1NMAH 1RZKC 3IAPA 2CSPA 3VRIA 1U6AL 4JKPH 1XF4B 3D69A 3FU5A 4EDXB 4S1SH 1K6QH 5G4MA 4IRJA 3SGDI 3P4LA 3X13B 3IJEB 2ISDA 4FKEA 5FO8B 3WTYA 4OF6A 3APDA 5E8DH 3WLWC 4H8WH 4P2YA 1FZOB 5ANHA 1FV1B 4XI5C 1D7FA 4KZEL 3KPLB 5I0ZA 1WICA 5DC9B 2E4TA 3FN3A 1UM6L 3ZDYE 1AAJA 4WSGA 1FYTE 2WSPA 4E0RA 4KQ4H 3PWJA 3CD4A 3VSUA 3ULSB 3N42F 1JYWA 3I3DA 5ID0B 1CLYH 4N20A 3FDWA 2ICWA 3F7QA 3F58L 3ZZSA 2UXGA 3RFZB 2BY0A 3GPSA 3K72A 4N8CH 5I1LA 2FO1A 5HYQA 3WN5A 4K5PA 1FL5B 1TMCB 4P3WA 1ADWA 2IG2H 2PCPB 3QHZH 1SVBA 4JY4B 4GLRI 5FECB 3NJFA 4NGHH 3TFBA 4ZTOL 1OPOA 2ED9A 4BKTC 2AJZB 3KDPB 3HC3H 1AXSB 2P7TA 1MPAH 3LKRA 1A7QH 3R18A 2DQIL 5C09B 2C8NA 4IOSD 3NRPA 4R0LC 3ABMB 4RNRA 5JPNB 1MCEA 2Y1ZA 4OJFH 2IAMD 2PKDA 5IT2L 3NIGF 1TMQA 2A6IB 3FQXB 4MJ5B 4MWFA 4EF3A 3RZCB 2X1PA 3WFHA 3GHEH 4HJEA 3BPOB 1BBJB 3BEVB 3AROA 5DUJA 1C9SA 4XMKH 1L7IL 3V0VA 3NTCL 1R3HA 2IH1A 3KNBB 5I6NA 3P2DA 2VDPB 2X4OA 4R5XA 2VE6B 4Z8FH 4LL4A 2VM4A 2NY2C 5JW3L 2CU9A 2J1WA 4HXBL 3QDHA 4H7VA 5KSBE 2FUQA 2Y9RT 5IB4B 2QSVA 2W0FA 1EGJH 2FLRT 1FN4A 1QKZH 3T77B 1RZJH 4GRWB 1YLBB 5E8EB 5GIRB 4PJBE 2IQAA 3C5XA 4RA0C 2Q6WB 1TNNA 1YMHA 4P23B 3UO1H 3S7GA 1P4BH 2GTWB 3D39D 2PMZA 5KS9E 3ASWA 1NUFA 3OG6B 2OTWB 4KUCD 3WMPA 1F4YL 5ICUA 1B4RA 2ZWKA 3MJ6A 1T6WA 3NUKA 2P1YA 1U3HA 3DTDA 3FQTA 1CYWA 2NYYD 2GAZA 1T2XA 3GXDA 4L3EA 4N8VA 5DHVB 4DP5X 2O61B 4ICWA 4ZD3H 2J1KA 2NNRA 3NPZB 4WHYG 2NY1C 3ZDXF 2JFCA 1X9UA 3BZFB 4N2NA 2P8PA 2VDMB 3ML9A 4U7KA 1UB6B 3QCUL 1RIHL 1HTYA 4P99A 1JYXA 5L4MA 4IBTA 2Y7QB 4P5TD 5TDOB 4Y4FC 2FSEB 5FV2A 2EIMB 1ITCA 4KUZH 4GXUN 5DD1H 3ZL4H 3OGOE 3T09A 5FDWA 3OPZH 3LKNA 1XB3A 3GRWH 2AK4D 4OGZA 5HJBA 4J4PC 5E4IA 5E1IA 1BYNA 3QIBA 5C0FB 2JQAA 3QFJB 4NKDA 3SE9H 3IS0X 5D70H 1R75A 3QVAA 2V2TB 3LIZL 3MLUH 3MODH 1Q1JL 4M5TA 1F3DJ 4TF4A 4WAFA 1D5ZB 1M42A 4GUOA 3FMGL 5L4JA 2BSRA 2X9XA 2GKIA 3QIUA 3G6JB 5GS0L 4I48B 5DYFA 3RY5A 1HI6A 4NQEB 2NY2B 3KGTA 2WQVA 4NNPH 2Q8AH 3VG0H 3HI1B 4HPOL 3N91A 4NP4L 5C0JA 3NFSL 3U7YL 1N7MH 3UYRL 4UV4H 5CZKA 1VKXA 5F3HA 5HDBF 4I5BB 4EI5B 3RI5F 5BXFA 5D1ZI 3T0DA 3W0WA 3UTTB 1PCXA 1ZK5A 4PRBA 3WS3A 4UILH 4HK3N 5BVJB 3NSFA 3UZEC 2Z65C 2V17H 4M43H 5D9SA 1LK3L 3VFOA 4YZFE 1H6FA 1JZEA 1AG6A 1XGUB 3K46A 4NO5A 5F1NA 5BZXA 3OKKA 1G5GA 4GQZA 1J05A 4R4NC 5C07E 3ILQC 3RDTC 4XX1E 3RWCA 2D8KA 4MCZA 5TQ2L 1UKSA 2IPUG 3DGGA 3DMMA 2Q86B 1MJJA 2WLMA 2G75B 5AYTA 1NFAA 3NCXA 2NX5B 4J3BA 1KMGA 2VLME 2GT9B 1XTMA 2QZ5A 5CZXD 3HUJF 4MCYB 1H5BB 3VRLF 5IROA 1YZZA 1OV8A 4RGMC 4AMKL 1HU8A 2F5BH 5IREA 3UC0L 5CD5C 4K3HA 5CP7B 1EEQA 4E5XA 4P0DA 2ZYRA 3NVQA 3ARBA 4IKLA 4OFYA 1SF3A 3VWKA 4XHJC 1H8SA 2GFBB 1DBAL 1MWAA 1NGWA 2I69A 4UQIM 5K9OB 1ZRUA 4YUEH 1I9IL 4PS4H 4LSSH 3O3DB 3MGAA 2DI7A 3HS0A 4M1DH 1R33A 2OMTB 4BQ8A 4U6YA 1YN6B 4BHUI 2BVOA 2E76C 4N2OA 2ZAIA 1V3JA 4GINA 5C97A 4XMUA 5JW4Q 5BV7L 2P5EE 1SLXA 3DECA 2H41A 2CBTA 3BKYH 1LP9E 2MNJB 1T7WA 4XTRC 4J39A 1ZOXA 2CRZA 2AQ3A 4CVWA 2J8UA 5F7YC 3B9KA 2ITCA 3BRGC 2I5YH 2V0AA 4KZDL 3JWNH 1ULVA 3DROA 1SXNA 3UAJD 4FNSA 1X5LA 1FI8C 3C8KA 5EZIL 2EQDA 5EG6C 3ZTNL 1LNUB 5LWYH 3KYKH 3POCA 5CHNA 4PGDA 1LMIA 3FC8A 5DLML 1JMZA 5HXMA 4BDVA 1ET5A 5A3IC 4S10A 5MP6L 4KKRA 2BRQA 1FGVL 4OCLC 3O6FD 4DN4H 5AVSB 2OI9B 1FQ9C 4UANA 5H2BA 4XP9H 4F7EB 4QNPE 4MD4A 1YPZF 4UBDD 1RUAL 4KHXH 4RIRB 1UD5A 5BW7C 2F1AA 1YJDL 1JGEA 4WCYH 1VEMA 3KPNB 4QHMA 2OL3A 5DYOA 3OSVA 1YYMH 3SDYH 1U33A 3QQ3B 4PJHB 2F0CA 2VDNH 2YBGA 4Y2DB 5DJ8B 4OLWL 1GGIL 3WG7B 4W70A 2DOCA 5HJDA 1S46A 3D05A 1UJTA 4HHAB 4R26H 1VACA 4Z5RA 3SD2A 3REWB 1WA2X 4MHHG 2FT7A 4XWOC 1JGVL 1J0KA 2AITA 3H8NA 3DJTA 1P4LA 2YPVA 3F7RA 4PW4A 3ALPA 4Q9QL 2XHNA 2CKBL 3CZSA 3TA4D 3RVVC 4LSPH 4EE2A 1A6UL 5FYJE 4NEHB 1PZCA 2DJ4A 2EYSB 1IL1B 4X5XA 4TQEL 5F89A 3WGVB 2VDKB 1JDDA 5KVFH 4MMZA 4FI6A 4GSXA 4CC4A 3CSPA 3RVTC 1TQWA 2QLYA 4FQXB 3SPJA 2CDEA 1RUPL 4HJJL 1HESA 3FAXA 1XCXA 4HJ0C 5JMOC 5F71A 3BUDA 2QQLH 5DQDH 1DQVA 4OLEA 4UTBH 5J9PB 1QFWI 1JHLH 1XQ4A 1FE8L 3EJYC 4HS3A 4YHKL 2HG5B 4LASH 3O6KH 1RV6X 3UTSD 5DDHA 3VVWA 4NO3B 4QTIL 3GSNB 5I1CL 2DICA 5GS2D 1TOXA 4MJ2A 1RZFL 4NJ9L 5EZLA 4AVHA 4F9PC 4MZ2A 4Z3GA 1A4KB 4HSCX 5AEAA 3S37H 1H3UA 1HK6A 1HE7A 3QXVA 1ROCA 2YQGA 5E8PB 1XR8B 2BSTB 4ENED 4HOXA 1D5XA 3CC5A 1LD9B 1HSBA 3S5YA 1UD8A 3BQVA 3ULVH 3LIUA 2Y6SD 1Y6MR 1YN7A 3UPRB 3SDAC 5DEGB 2R29A 3FFCA 1T0OA 1L5GA 2LLLA 3QDJA 2WO2B 4K8RC 2A5UA 4Q9RH 1QLEB 1ZCRA 2B39A 1M57B 2PW2B 4M61A 5AB0A 3I02B 2VUYA 1QUNA 3IDIA 5DZJA 4XVUD 3LRSB 4LCWA 3UEZA 3W39A 3UG5A 2CO6A 3HCVB 4ZX4A 5I66A 5I8OH 5IVXE 3RB5A 4HDIA 1BD2E 2YPLE 3RHWK 1U41A 2J55A 1ZGLA 5E6RB 2NUTB 1G6RB 4E41D 3ZDYF 1FFRA 1RJCA 2CGRH 2EO1A 3KH4A 4MZRA 4M9PA 2GUOB 1PMYA 5ESQB 1OM3L 2DIEA 1ETA1 2P4AB 1NWOA 4TNEA 4JHUA 1DSWA 3QUYD 4P2CG 3T08A 1TTRA 1SMOA 3ESNA 1IAIH 2PPFA 3OJ2C 4L2YA 2YAMA 4MLIA 3LZFL 2APTA 4DGYH 5KBLA 4PJFE 1HZKA 4KAQH 3QPXL 4PRDA 1A6VH 4I1NB 4QRUA 4PJ8C 3FQRB 4P2AA 4GNKB 4PJ7B 3H3PL 1UXMA 2FEJA 2TSAA 4G71B 3C60D 4QO1B 1AHKA 2B1AL 2D7PA 3WDIA 4LEOA 3HZVB 3MRGB 3QHTC 5K1NA 2X3AA 2H9GA 5DC4B 4Q6IA 4WWKD 3V6BR 12E8H 1TCMA 3SDAB 1NEZB 3BIKB 5ECGA 3MROB 4WI0B 3CU1A 4JFQA 2QVTA 1I7RB 1B9ZA 4AZUA 2PO6A 4DJMA 3MRRA 4A2GA 3SY0A 2G2RB 1SHMA 4NQCE 4TL4A 2F53D 2HPOA 5FUOL 1T20A 2YSTA 3CHRA 5K59E 4GXFA 1UWXK 1MVFA 2WINA 5CAYB 3VSVA 5KSBF 3H2WA 5I15H 3ETBJ 2PABA 1YYLL 3Q6GH 4F58H 3INUL 2NMSA 4YSPA 1O0VA 1I1YA 2PTTA 3UCRA 1JSYA 3PWPA 2JKLA 3CBKB 1KTDA 2BZDA 1WFJA 3PQYE 4PJBF 4UU9B 3RA7L 1I9EA 2FATH 2YMXH 3APMA 4ORGA 5KS9F 5J13C 2DQEH 3S37X 4IHOA 5TK2A 4NUGL 4JM4H 5DURB 2ICES 3TBTA 1RZ8B 4R8WH 3S6CA 3SBQA 3UPAA 4L8DB 4PJ8B 3MACL 2G9HB 5F7NC 2C1PA 3U48A 3ESPA 2B0SH 3SCMA 1PLGL 2JKSA 1TJGL 4G59C 2GJ6D 4E9RA 1AFVH 2C4FU 2H6PA