4CA4A

Crystal structure of fimh lectin domain with the tyr48ala mutation, in complex with heptyl alpha-d-mannopyrannoside
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDAPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 32
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4ca4A00
4X5RA 4AVHA 3RFZA 2UY7B 5CGBA 5F3FA 1UWFA 4AUYA 5AB1A 5LNGA 3JWNG 4XOBA 5FS5A 4CA4A 4LOVA 4ATTA 1TR7A 2WMPB 4AV4A 3BWUF 5JQIB 5FX3A 2XG4B 4AVJA 4X5PA 2XG5B 3ZPDA 5AAPA 3SQBB 4XODA 5IQOA 4AV0A 4X5QA 4J3OH 3MCYA 4CSSA 4AUUA 2W07B 1KIUB 3ME0B 2JMRA 4XOAA 3BFQG 4XOCA 5ABZA 1N12A 4J3OF 5FLUA 1ZE3H 4BUQA 4X50A 4AV5A 3ZL2A 5IQMA 4AVKA 1QUNB 4XOEA 5AALA 2UY6B 5F2FA 4CSTA 4J3OG 2J2ZB 1PDKB 3BFWA 5LNEA 4AUJA 3JWNH 2JTYA 4XO8A 4XO9A 5FWRA 2VCOA 1N0LB 1KLFB 5IQNA 3JWNE 4AVIA 3ZL1A
chains in the Genus database with same CATH superfamily
4RZCB 2HRHA 3CC5B 1HL5A 3GSNH 3F7PC 3DRQA 7TAAA 4WUKH 3UIYA 4AE0A 3HMXH 3RFZA 3E6HA 4HKJA 4ZUTA 5FDWB 3GS0A 3AY4C 2R0LL 3BKYH 3GRWL 1TLMA 2GKIA 4JFVA 4RNRB 2HWZL 1A14L 3QDHA 1I8IB 1XCQA 5LGHL 5D7IB 3QQ9D 4K8RH 3ARFC 2YGPA 1QOKA 1AD0B 4DKFL 1EJFA 4IRZL 1QRNA 3IJSB 4QRRD 1CN4A 3U7AA 1EFQA 3UZVB 3HLKA 1ND0B 1P1VA 2BSEA 2HJKB 5KOVC 3BDXA 2I85A 1SXBA 4IGBA 1E9QA 2IH9A 3RDTB 3OJVC 4TVPE 4R90H 2CPCA 4HH8A 2WUCL 5DD3L 1JRHL 4O51A 1OALA 4WFGE 4JO4H 4MJ4A 3U4BL 1KPUB 3KPOA 3GMOB 2CO7A 1E8YA 2GG1A 3L5JA 3Q5YA 1GHFL 2Q8BH 3GJEB 3KDPB 4X6CE 4JL2A 4OV6F 3IVKB 5DHDA 3BD4A 4OZGE 3MR9B 4GO8A 1T22B 3HRZA 1VFBA 3EH4B 3LKQA 2DKMA 4HSCX 3OR7A 4C83B 2F5AH 3JZ7A 2PLTA 3NMEA 3FTWA 4HS8L 4M6ML 3MLRL 1NFDF 1HFUA 1SRDA 5I19H 2JIXB 4ZS7L 3O6MH 1KJ2H 3Q6GH 1NM4A 4R6UA 3VXSB 5FHAL 1ESOA 1SVCP 3L81A 2DWDB 5IVXF 5ADPH 1WGVA 1M71B 1QBMH 4F2FA 4N0CD 3P30H 3R8BB 4BJLA 2MOQA 4AL8C 4BFRA 3VGEA 5D7JC 2XBZA 2Z92A 3Q5TA 5BOZG 1VB9A 2KDGA 1KXHA 4E9LA 2Z8RA 3U0WL 4KGJA 1M1XB 1R3LA 1U95A 5A2KH 1RZKH 3S37H 2UVFA 4UQCA 1OXYA 1T80A 2EIEA 1ZOXA 4N0UE 3IRZA 2AK1L 1WP6A 3PJSA 4PW3A 5DJCB 1A3QA 4K5LA 1MEXH 4AW4A 3GBNH 4BDVA 5EEUA 2HKHL 3FNKA 1XWVA 3P11L 2YMTA 1EHKB 4BFNA 1BVKB 1BAFH 1G0XA 1BEYH 1MDAA 2EXSA 2J2ZA 3VD5A 1G1OA 3QI9D 2XWTB 4I77L 2O1AA 4FXKB 4ANVA 3EJCA 5AZ2L 4QNPF 4Y1TA 5E6IC 1FYTB 3VWKB 2CO2A 2YS4A 4UT9A 1BF8A 3WO4B 2VC2L 2JWYA 3ESVF 5GISH 5L88L 2NW3B 4BGDA 3Q8EA 1BHGA 2Q86A 3T4AA 3EFDL 1AHWA 3VUAA 4ZT1A 1RSFA 1AGDA 3OWRA 1RIHL 1XGTA 2R1WA 4XAKE 3CFDB 2P47B 4HKXA 1AXSA 1G6RH 2ATKA 2FBJL 2ZCHH 1P1ZB 3A22A 2P5PA 1A22B 1AKJD 1HHJB 2WM0A 5I6XB 4Z7WE 2GBTA 3QORC 2ICEC 3M17B 3MTXA 4WLCA 3V79C 1A6AB 3ARXA 2JCCB 5GJTL 1L7IL 4IRSC 1MCEA 2D4DA 5A2BA 3MV8B 4JM4L 2UX7A 4JBSA 1N8ZA 3FB8B 4U6TA 4HGWB 2F9BT 3VDAA 5JTWA 3SKJH 2H32H 3OX8B 4ODWB 3D2UB 3NN8A 4J3TA 4MCMA 5D6DC 2P8PB 2BOLA 5GGQH 4YR6B 1LEKB 5F1OB 4WKZA 5CJBA 3TA3B 1F90H 5I16B 1FDLL 5H94B 3TJHC 3HC0B 1I8MB 3KPTA 5SV4A 2ZKMX 2FYVA 3LAFA 4OCRL 2VLKB 3SO5A 3UZQB 1SJEA 5F1IA 2EYSA 3RDTC 3BUYA 3S6CA 2WYZA 3O8XC 4G9FE 1AJ7H 1ASQA 2QGBA 4Y5XA 1GPOH 1I7TA 4S2SA 1JPGA 5GRZA 1TJMA 1E27B 3FUIA 3ISYA 4G7VH 3RPKA 4ILDA 1EPFA 4RIRA 3D4CA 3BWZA 5LAXA 4XXDB 1G7PB 4L48A 4WWNA 5E6ID 1UASA 4PBDA 4TRPH 1GTFA 1PG7H 2OK0L 4PREA 2G60H 3OGOE 2AKRA 1INEL 5H8DA 4DTGH 4FQHA 4G6JL 2V5SA 5TE7L 4PLJD 3P4OB 1FNSH 1EVTC 4LSUL 1FAIL 1SHXA 3C08L 1BDYA 4HWNA 4NSKB 1FNAA 5I5MA 3M45A 3OHXA 3B5TA 3ZYZA 2R4SL 1UOVA 2E76C 2YIHA 4BFGA 5F3BB 3F7YA 2VR8A 4Y1SA 4PJHF 1ROCA 4EI5C 4EQ2A 4JQXC 4XMKH 2LV4A 4LLQA 2A9BA 3LDBC 4QYOA 4G6KL 1JNHA 3ASOB 3CFJA 5DZNA 3FCBA 2B9AA 2YAQA 4KXZH 4RA3A 3SB3A 4OVVA 4Y9FA 3VB9A 4XO9A 4JDZA 4ORGB 2EEAA 1VKXA 5I1AB 3L3KA 3S36X 2NUTB 3KR3H 4S0TD 5IQNA 4GSDL 4LSSH 3WMSA 1KEGH 3QXDA 2EKJA 4EMZA 4JO3L 3SDCB 3IMTA 5SWQA 2KQMA 5DMKB 3GM0A 1KEML 1E65A 3GHBH 4FADA 1R4XA 4BXSV 4L1LA 3BO8A 4TQPA 4IBLT 3RA7H 4XBGA 3KYOB 3RDTD 3RIAF 4U7MA 2VL5A 4X9GA 4PMFA 2EYTA 1I75A 1B0GB 4QRSA 5H2BB 1JWMA 3FTVA 3H3PH 3EFOB 3KM1A 3TIEA 3GSVA 1QATA 2LU7A 3TV8A 4ZDHA 4PBWD 3QQNA 2H6OA 1WWCA 5TH2A 3IFOB 5K69A 2NX5A 3IFLL 1CIUA 5F9JA 1MVFA 4DW2H 1KGXA 4MCYB 5FYKH 3WJLA 3QNYA 1X4YA 1BD2A 4NNXA 1W8EA 3II3A 3GT6A 5KBNC 1DN0B 2XN9B 4KO5A 4YGVA 2GEEA 5HDBF 2BIPA 2JIXD 2QQLL 1QYGL 4PV8B 1JBJA 2QDWA 1E6JL 4DUWA 4HLEA 3UPRB 1U8KB 4K73A 3VXSD 4O58L 4N9GA 5L4MA 3U46A 1DUYA 1KYOJ 1XGYH 6TAAA 1HDMA 4EOWH 4J3OD 1EZLA 1XIWA 4GW5B 4EE2A 3ULUC 4OZFG 1WFNA 2X53A 3H3BC 2D3VA 4A2FA 2KBGA 3O2WL 1HX0A 1NJ9B 2JI2A 3O2DL 3T1WA 4MZ2A 4MQXD 3R18A 2EVGA 3HUJF 3HNVL 2AQPA 1YCSA 2FUQA 1OLZA 4JFZL 2ALWA 1ZT4B 1WRFA 3ZIMA 5EORL 2JI1A 2WXGA 2ZOKA 1QR1B 1P9MA 4MJ5A 1OGPA 2IPKB 5D71L 1T7YA 3AREA 3MJ7B 4R9HA 4A66A 3C60B 5KJRH 2FJGA 5DHMC 4OQTH 3FXIC 3W11D 4EVNA 4YXKL 3H42L 2WCGA 2R1XA 2EVIA 5I0YA 3HBGA 4NUPA 3JV4A 1W0VA 3VWKD 1A6ZB 1FYTD 4KXCA 3KLLA 3FT1A 3QPQC 3LQAH 3DUUB 4JFQB 3DBXA 1LWHA 3MA9L 1FRGL 2NY0C 2WJ5A 4I9WE 3MV9B 3TFBA 1LQBC 2D3NA 3L3HA 3IRCA 2DF3A 4IBYA 4KFZC 3RVVC 3SBWC 4HG4J 4KK9C 5E6ZA 4G1MB 2OMTA 4LLVB 4ABWA 1IKNA 3TZVB 2R9HC 3Q6FA 5E51A 1F6FB 2WXFA 5L2KA 4PS7A 3CX5J 3CMOL 3ECQA 4K9EL 2A0LD 3MOQA 1E30A 1AQHA 4DH2A 1JNLH 3MV8D 1AC6A 3UBGA 5DT1L 3N5AA 2HSIA 2Z7UA 3MRJA 4UDTB 4FKEA 4L9DA 5ANMB 4B6ZA 1OTTD 1N4XL 2VDML 4QHNB 5FKAA 4RAUA 3WFEH 2ZCKL 5HDQL 5SWSE 5ESAB 3RZWA 3D2UD 1JPGB 4GBXA 1FNGB 4HK0A 3QWRD 3VJ6B 1XF4B 2H45A 4UYQA 4YE4H 5F7FA 3EKCA 3TA3D 5JW5A 3R19A 4Q9QH 4TVUA 4PP2A 4LPYA 2F7PA 5LAXB 2WQ8A 3JWOH 1NZRA 2VLKD 3G04B 4AMKL 1NEZB 3TA4D 3RWGA 3FUJA 4W6XB 3MGAA 4MS6A 5B1AB 4HCRL 4LLWA 5J06A 4QRUA 3ZZQA 3BT2L 2XQ0A 2V5MA 2CDEA 4RFNB 5FFGA 3IN0A 3SZKC 1BWWA 3LZNA 1R19A 1UA6H 4M8UA 4Z18A 2F7QA 2CLVA 2HX8A 1E5AA 3BUPA 3GKWL 5GGTH 1DQVA 1PPIA 2PCFA 3CPLA 3MRMA 4P2AA 2VLJA 3SDAA 4O4YH 3PABA 4GAJL 2CE6A 4Y2NA 1H6FA 5HYJA 2V2XB 1QHOA 2NNXA 1FWXA 3QPQD 1OHZA 4XTRC 2J1XA 2YC1B 1F97A 3IJHA 1C8QA 1XGRA 5C2BL 3WKYA 1ZHNB 3K2KA 2QVMA 1K3IA 2HT3C 3WFCH 3GB7B 3RWDB 4PJBE 1MRDL 5AAWA 5HSFA 5BRZE 3GDBA 3K72B 4HK3J 1B88A 1W80A 3MRQA 1RFDL 1Q9KA 2BRQA 2DYPA 1NFAA 5F7NC 2R9HD 1IO4C 4HHWA 2GABA 2AEQH 1OZTG 2Z7ZA 4BKLB 3W5NA 1TQTA 3MFFA 4TNVK 4FQQA 3A5VA 4IKKA 3TBVA 1HHIA 1VSCA 4KK5C 4QUOA 4PHXA 1ZT7B 4N5ED 3ME0A 2R69A 3AM8C 1MRFH 4ZTEA 4LAQH 5HGAB 3C5ZC 5BZDB 2ZCLL 3WY3A 5EPMB 4M5ZH 1I53A 2YHGA 1KJVB 4IMKC 1RJYB 2DRUA 1PFOA 4X4YA 4UUJA 3FB7B 3SDCD 3VXRE 3N44B 5TH2B 4A68A 3CZNA 1H6TA 4NX0A 1PW3A 5JO5A 1B4JL 4H0HB 4Z8FH 1SPDA 2CO1A 2QSTA 3QNYB 5I1KH 3Q8CA 1YEDB 3OGCB 1ACYH 3S48A 4DEWA 2FD6H 3VGGA 1J9QA 1MCJA 2C5DC 2R51A 5KSBB 4GXUN 4OSUH 3FFCE 4JPVL 2V9UA 4K2UH 1CDCA 4YDJA 4KY1H 5A7EA 2ZXWB 1OF0A 1HT6A 1BVZA 3KS0H 3LPWA 4N8VG 4X5LA 1M3JA 3VXUA 2VT0A 3RTQC 1CE6A 4LSQL 1NGWB 3FULA 4K5OA 2QQNL 5JIMA 2IBGA 4YDZA 1UD4A 3BRGC 4K07A 2NXYB 2XN9D 5HJDA 5EUOA 3VI3A 4AM0A 4U1SB 3P69A 4YDMA 4OD2B 3TZVC 4N85A 4L9LC 5I8EA 5L7XH 4LASH 1DBMH 2XVKA 1FNHA 3QXTA 1HWGB 5E9DE 5IMKB 1EHNA 5IW6B 3H3KA 2WV3A 4E9XA 3BLPX 1FE8L 2X4OA 1KIRB 2PWGA 2CKBB 2YGOA 3IMBA 1J8HB 3OKYA 3BKCH 3QHZH 2UXFA 2IWEA 1G1KA 4WWKB 4O9HL 2LFGA 4JGMA 1E67A 3MLYH 1WA1X 3P9WB 4Y9BA 4D3CH 4NZ8A 3TBWA 1I4FB 3W38A 4UM8B 1PLGH 2JKWA 4NQCA 4LZKA 2ZZUT 3M07A 1AOHA 2CJTA 3DRTA 3JSSA 3SE3A 4PHZA 4POYA 4G80B 1UT1A 2P8MB 3LKNB 5IB1A 2VM9A 3C60D 3TURA 4RFEA 4NO3B 5CJQL 3BW9A 2PYFB 2IIJA 3WKML 1E7VA 4KJQC 2MQ0A 4BSWA 1XEUA 2ODIA 2OMTB 2ZWNA 5C0CE 3MGOA 1A1OA 4U1LA 4W9ZA 1MW0A 1EJ8A 1UB6A 2VDKL 1F41A 3SGDH 3FQYA 4ES9A 2ZSVA 3D4ZA 4N2DA 3MV9D 3QIBC 3WIAA 4HOXA 5CD3A 1ERNA 1JRHI 5ISZB 3TO2B 4Y0GA 1T7WA 3PLYA 4ZW5A 5T1DL 5AALA 3RVWC 2ZOWA 4HK0B 3TZVD 2V5TA 1FGNL 2ZKHH 3MOAH 3U7WH 3T0EC 3MODH 2GCYB 3T09A 4AENB 1PGRB 4AYID 1ZHLB 4FFWC 5CF3A 2OI9B 3FU6A 4WGWB 1IM9A 4FFZH 3INUL 2BVPB 4OIBA 1LHZA 1FN4B 1AGBA 2F54E 5G4MA 4XO8A 2ICWJ 1BXAA 4XMPL 4AYGA 2LGNA 1N6VA 2FDBP 5J6SA 1KJ3L 4PCYA 4PRNB 1N5AB 3IDYB 3NGBC 4XCEA 1XGPA 4NB7A 3WXWH 2IOOA 3WYRA 2XWEA 3RIFK 4GQ9L 1CI5A 4JY6A 1DQLL 4WI0A 1S5IH 2Z35B 3OAYH 4L3AA 1S9XB 5E8OA 1L7TL 2MPAH 1JWUB 4LK4A 4NLHA 1CL7H 5KOMC 1TJGL 3GTTA 3SSGA 2NSMA 3TBYB 1I1AA 5HYSB 3OMNB 1GA2A 4FFYL 1JGDB 3GI9L 4Q89A 4AYFA 2WXOA 1ONQA 4KI5F 3L17A 1A2YA 1RD6A 1NC2B 3MJ9A 1LJMA 4FNQA 1A3LH 1QFOA 2TRHA 3QUXC 4LNRA 4QHLA 4JRFA 3OZLA 1MCRA 2IV9A 5J1TC 1KB5H 3KS0J 1QPKA 4DP7X 4I89A 3FTXA 2FGZA 3GMMB 4QCIB 2KI6A 1FPTL 3ARDA 3PREA 4JFPB 4Z7WA 5ICZB 2ITDB 1QO3A 3L3JA 4UBDC 5EBLA 2F7RA 4UQ9A 5DF0A 5H37H 3HCVB 4P3DB 1KT2A 4Q9BA 2CDGA 4NDMA 4GLRH 4PJXA 4AIZA 4U6XB 2ADJA 4MB5A 2E8ZA 3MA7B 2D7OA 2WUBL 1JXJA 2OAAA 1HEHC 1F4YL 2K6ZA 3O41A 4LB8A 4QLRA 2PPAA 5C8JA 3QCUL 4Y8AA 2LU5A 4PI0A 4RDQG 5BOJA 1NGPH 5E6RB 3WFBL 2F19L 4PV9B 1NANH 3LXCA 1TFPA 4AQ1A 1E5ZA 5MEQB 4JFEE 5I8KH 1EEYB 3M8OH 5GGRA 4RGOH 4Z95H 3UABA 5C09B 3EYUL 3WS3A 2YQGA 5ALCL 2Q87A 3ZUNC 1FL6A 5E5RB 2EEBA 4UAOB 3GK8H 2KC0A 5CUSL 4G8GB 4AMXA 3SDDA 5CEZH 4FNRA 2YPLE 4O2FB 4KWUA 5EUOB 3UTQA 4QT5B 5JYMA 2OCJA 1ROWA 3VFRA 5IK3B 1T0NB 1EAQA 4M48L 2OMWA 4AL8L 2Q2LA 1M7XA 4RGNB 1W72L 4LSVL 1F11B 4PWHA 1KIQB 4LSDA 2X4OB 3OPZL 4TSBH 3RVXC 3SE4A 1G7HA 2NXYD 2P8LA 1P0SE 1EO8H 2ID5A 5GRYA 3DOHA 4AQAB 5LJYH 3IFNH 1YQVH 2NR6D 3TN0C 4PS4H 4QXTB 2R8SH 1VEPA 2G30A 4WI5A 2VM4A 2VL4A 5DSCA 5HHNA 5DJZA 3ZTCC 1Z5LB 4CVUA 4UBDD 4ZD3H 4MAUL 4OZIE 4GXVL 5IHZA 1F6LL 1JK8B 2W81C 4PJIB 3P4NA 1UOLA 3V7AE 1J8HD 4ZFGH 4IOSA 1H5BA 2PTTB 4OV5A 4PG2C 3DXAB 4WWKD 1QLEB 1U93B 3Q0HA 3IETB 4KVCH 2HFGH 3ABMB 4P5MA 4YSSA 4XVSL 1A65A 5ADOH 4YDNA 3ML8A 1JF1A 4P9ML 5F89A 5EF2A 4L8BB 3IN2A 4NBXB 1LXMA 3U30C 2EADA 4XP5L 2OMYB 5FOBA 1HL9A 3RY4A 4ONFL 3P9LA 5IHHA 3CPUA 1BM3H 3ZZSA 3LEYL 4HD5A 1JZ4A 3LSOA 1KCKA 5HI4D 1ID2A 3UERA 3V7AG 1J8RA 1K6QL 4Z7VB 3TWCH 4GRLB 2DIJA 3RAJH 2E4TA 4PH8A 4X6DF 4XCYB 4ZG1A 1HKLL 1RZGA 4OZFA 3V5KA 2Y06H 2EKSB 1DBJH 3MRRB 2EC9T 4P49A 4PJDB 1MNNA 4I7ZC 2XX1A 2VZTA 3VSTA 1FVCB 3G6JF 3DSNA 1FL5A 4MA1C 3RGVA 3F7VA 5IB3B 5MP6L 2YQ3A 1FL3B 2BVOA 3LJ3A 1RZJH 2YSTA 1RZFL 1YUHA 3IS0X 1CLZH 4I13B 1ZCRA 3L3OC 3MSPA 5ISZD 1LO3L 1A7OL 1WGOA 3L5WA 4HIXL 4IDJL 3NCJH 4KXZI 5FYJH 1ZLSL 1D5BA 4CUCA 5JXEA 3WTWA 1KTJA 1FIEA 4O02H 3JVFC 2W94A 4BFJA 3GI8H 4U1KB 1LDSA 2J8OA 3PE9A 3ZJAA 3P73B 2FSEB 2RJMA 5IJKA 2OMBA 4HJSA 4OJFL 3TT3H 5IJVA 3S36L 4I1PA 1HZLA 2RFXA 3KXFA 2L0DA 4RX4A 3V6FB 3WXVH 2PXYC 3RI5K 25C8H 3NIDE 1JPFA 2DEWX 4M03A 2Y36L 4OI8A 1YEFH 4AZUA 3ZOAA 4P9HL 4L29B 3AXLB 3K6NA 2CPUA 4F9PC 1PSKH 4XGZA 3G08B 1OAKH 1K3ZA 1TZ8A 4UNVA 3HB3C 5GS2H 4ZK8A 1PNCA 4WTZG 2CGRH 4FQ1H 5E9NA 4LSPL 3G5ZA 1C5BL 2AABH 2FT7A 2I5YL 2VLJD 4B60A 5E00B 5LNEA 1DJGA 3B7UX 4ODHL 1LD9A 3KYNB 4XMVA 3B9DA 1B2WL 3K6IA 2O6DA 5IBUG 1IC5H 3BT0A 5AW7B 4N2AA 2H9GB 4S1QH 2YRPA 2X88A 3FBQA 4P4RB 1QSFB 3BPOB 4ZMZA 4IIQA 1QNZH 4KTEH 4K3JL 4YDLC 4H1LH 1RUMH 3DI2B 1FZKB 3FQ4A 4LOUD 4AYSA 3MTRA 1NC2D 1NBYB 1OQXA 2AXWA 2MMXA 2WBXA 2WZ0A 4UIMB 1XT5A 3D39A 5DGRA 5AD0A 4BZ1H 1KLFA 5L9DH 2VAAB 2BY2A 3JWDH 5I1IL 5CJXC 1AY1L 4F2EA 3V0DA 3NJNA 4OGYH 3ABGA 1RY7B 2G2PA 5E2TH 4OFDA 1KGIA 1MHHA 3H54A 3DO4A 1OO2A 3SOBH 3TBTA 1T0MB 1T5WB 1EGJA 4Y2DB 1N19A 4HIJA 3PGDB 1Z32X 1JNJA 2R23B 4DVRH 1KN2H 4UV4H 3IMRA 3ZDYB 3CBRA 4C58B 5SWSA 2UZXB 1GR7A 1KBKA 2BS71 3ORJA 2VXUH 2P5EB 5ESQB 1HHGB 1DSFL 2AW2A 5INDA 2LQRA 4GKSA 4J3VA 4F24A 5D72H 3UYRH 2XY2A 3W9EA 3Q1SH 4PLNC 4PJ8B 3V0VB 2RCSH 2NDGA 2YSSB 2ERJC 2VDQH 5EU4B 4DVBA 4K94C 5C09D 2V0AA 4P4KB 1P7QB 4QAWA 3JWNC 5DD0H 2RQ8A 4DFIA 5I0VA 1S7UB 2FECL 1NGYA 4G8GD 2HFEB 4AYEC 5KSAC 4KGLA 4B9YA 2YQBA 1J48A 4GRLC 5E8NB 5A16A 5FCUH 4M7JL 3U4EA 3T65A 1OSZB 3GO1L 3FHEA 4S0SD 1UQSA 5DHVH 3A23A 3ULUL 1NCAH 1W0YT 5HHVH 3EZ8A 4RGND 4FTVB 3OKMB 1FBIL 3HZYB 4LHJB 3RNQA 5I1EH 4PJGE 2QT6A 4AJ0A 4OGQC 1K8DB 4YSOA 3QC5X 1TTAA 3E6FA 3EO0B 2HKFL 4V2BA 3RB7A 4PJBA 3KBFA 3UMTA 5ICXA 4X7EC 2OSLB 4Z7UA 5C0NC 2EE3A 3OAZH 5BRZA 4OV5B 1RUPL 3NFNB 4TXVB 2WXLA 4JCLA 3O45B 2IDQA 3BZDA 5SX5H 5T5FL 3K5SA 2CXKA 1RHHB 2Y69B 1Y6KR 4MB3A 4OM0L 4WNQA 1OB0A 1WTLA 1AANA 1NSNH 1XCWA 3Q8AA 4ZMXA 4PWFA 1MIML 4JGUA 4CU8A 2JXMB 2X6VA 1QVOA 3M86A 1C1EL 4KDWA 4KQ4L 4P2QE 2WWMC 3QIWB 4OF3A 5BUAA 4QYAA 1BVLB 2E6PA 2QV4A 3MBWA 1UXSA 3T1FA 5I76B 1AIFB 3DXAD 1IT9H 3T0WA 1SFDA 3MCLH 2W0LA 4YHPA 1A3RH 2P5WA 1EXUA 3CQPA 2Y3AA 4N8VA 4G8AC 4HS3B 3VXRA 3GHEH 3QJHA 5J11C 5TQ2L 1IC7H 2PN5A 4BZ2L 3MJ6A 3N0AA 5C0EB 1T3FA 5I73C 3KVPA 3WS6C 4UOJA 1JZEA 4JM2A 1TJHL 3HAEH 2WLZA 5C92A 3WUWG 3CAFA 5GRUH 3ZIYA 2Z7YA 3FFCA 3TEUA 3EYOB 4ZFQA 3OLDA 1HOEA 2GBAA 3LVEA 3MRLA 1I7ZA 2ZX9A 3REWB 5GRJL 5GRVK 2X3BA 2WZ5A 3JXAA 1I9EA 4GRLD 3CLFL 2AANA 1D5BB 1UWFA 1FO0A 4AZ8B 3VD4A 2YAOA 2ENJA 3VA6A 3TVMC 4P99A 5FUOL 1KENH 1MSPA 2ICWI 3F62A 5IUCA 5HGDA 3SZ6A 1OCWL 2B1HH 4XPGL 4BYHA 3I74A 1QBLH 1MY5A 2FATH 1DBKL 2KYIA 1A7RH 5KTEH 4Y4HC 3SGEH 4JDVA 1L4IA 2WQVA 5E9DA 1OT1A 2PPFA 3BAXA 3N3EA 1DL7L 2MEJB 1A47A 3B43A 3L95B 3Q1EA 3P9MB 4L4TE 4LQFH 3TV3L 4X6BB 2AS5M 3GSRB 2GTZB 5I75C 3MRNA 1KC5H 5KVGL 1PKQB 1AQKL 3CNKA 1ETB1 3K4DA 3MROA 1SEQH 1BEXA 4WO4C 2Y7QA 1R0AH 3P3YA 2F8XC 1RJZB 2E0PA 1HXMB 1UXWB 3OZKA 2N1TE 4JPWL 1T5XA 1UYWH 4KKPA 3US0A 2YUXA 3GSNA 1AXTH 3E2HB 4KDTA 4PJ8C 4JMXA 4K71B 2ZUTA 2NDFA 3QJRB 3HMXA 1E4KA 4LXFA 3RKPA 3DX3A 2AJXH 4K5MA 4NRZB 4OKVB 4IIQB 3KLAB 3WD5L 1DANU 3MBEB 8FABB 3GSXB 2EACA 2AV1B 2QVTA 3PJNA 1FZMA 5IMMA 1ZE3H 1EHAA 4PRAB 2CIKB 3KPQA 1CXIA 3RWCB 4ZO9A 2ENYA 4I85A 1CBJA 2DQHH 4QGYA 1F3JB 4NNPL 3G3LA 5T3ZL 1Q0EA 2JK5A 2X4QB 3MGTA 1BLNA 4JN1H 3NAAL 1E6OH 3KPRE 4TPRL 3N40P 4K5NA 1VFAB 4PRPA 1ANUA 3BQUA 2IF7A 3FCSA 3FT4A 1QSFD 3D69B 3FAXA 1T2QH 2FQDA 1A4JA 4JJ5A 4QR7A 2V7NA 4FQIL 3FQRA 3N43F 2VR4A 4QRPB 3IM1A 3WMQA 1AQDA 4GP5B 3P1VA 4JREC 5IQ7L 3HI6L 5I8OL 1NLBL 3AZUA 4ZX4A 4F7KA 5IR1B 3QWQB 3EUUA 3ULVL 1BXUA 3O3DB 4DP5X 3KYAA 2HT2C 4ALAH 5LXGH 3ATDA 3R0MA 2EIMB 4ODTL 1U21A 4J2QA 1MCWW 1CFMA 1F3DH 3PP4H 1W15A 4LEOB 4N1EA 4P5SA 5FO9B 4Y2DD 1JGEB 1W6LA 4HBCH 2G0KA 2CMRL 5DD6B 1BQRA 5EB9A 1JK9A 3B9VA 1K2DB 1RXLA 1YMMB 2C9RA 4LSRL 2BWIA 2F54A 5DJ0A 4IRJB 2HJFB 5T1MA 1IKFH 2P5ED 5MENA 2IQAB 2CJSA 4HOZA 5EF1A 2FEDD 2IALA 5AVRB 1NCBH 3SE8L 4WFFE 5ERWA 4HG4K 1ULVA 2A6JA 2DIBA 4P48A 4PJ8D 1A7PL 2PO6C 3NIGF 4B50A 4A55A 2WXKA 4P4KD 1P7QD 4UTAH 1QFWL 3CX5K 3SGDI 4PMEA 1ZSHA 2AQ1A 5EDSA 1J86A 1T6VN 4PCTA 5AOZA 1BIHA 2JB5L 1JGLL 3RY6C 4B96A 2B1OA 2EINB 5EC2B 1YEGH 4DZBB 2DQFB 4FTVD 2DLFL 3LHAA 4MNQE 1WYJA 3U1SH 5IV2A 1YJDC 1XF2A 1N18A 1FFRA 1HEJC 1FLRL 1N7ML 3FOMA 5BS0E 2Y24A 1LP9E 1CT8A 2QADC 3PRZA 5DVMA 5CP7A 4IOSD 4KOCA 1RIUL 2FWSA 4LLMA 1HHHB 4YGAB 4M5SA 4ZUUA 3ZGIA 4P2OB 3HR5A 4IHOA 4MMXA 3KYMA 3LRSA 3F05A 3BSZL 1UADC 1HSAB 2HT2D 5MEPB 3FZUC 4XNYH 1BGXL 1SOXA 3T3PF 4ZFOL 3CHQA 1SF5A 2FJHA 1CF1A 2Q0ZX 2R29H 2R2EA 3RWJB 3QIWD 1G6RA 5HJ3A 5E8PA 1SJVA 2XXGA 4PJAB 5ACZB 2FH8A 1BBDH 2Y2WA 4L1HA 2VDNL 3KH3A 2V4LA 3HZMA 4B95C 5C71A 4IBUA 1HIML 1FGVL 5DYOA 4DKAA 3DX9B 5IQ9A 3NJFA 4JFEA 1BECA 1CL7I 1OSEA 3ILEA 2H1PL 4QJ4B 1DJWA 1VAHA 3KLKA 4M61A 4WY7H 1I1CA 1S7SB 3CVCA 3DROB 3QW9A 3ZO9A 2X3CA 4GKOA 3IJEB 1VCBC 2J6EH 3AXIA 4J2XA 1X7QA 2XA3A 2VTFA 1IGJB 2ZICA 3OXSB 1QSEA 3MXVL 4IQHA 5LDUA 1CU4L 2PP7A 1PZDA 2P26A 2VDOB 4KNTA 2DY2A 2FHFA 3OC8A 4X4XA 2R83A 4XN7A 5H37G 1NGZA 3PWUA 1ETJA 3MUGB 1ICTA 5I17B 5ESVB 1S7VB 5E95B 5GS0H 1DBBH 2WXNA 4IBWA 2ZOUA 3RDJA 1HJBC 5I1LA 5MERA 4HJEA 1KLGB 3OQ3B 5CEZE 3PIQB 1XZ0A 4GLRI 1KACB 4IU2B 4PY7B 3VWJB 1G1CA 3HMWL 4GRWE 4XNQB 3GXFA 5ACLA 2ZP8A 1T5XB 5AOLA 3STLB 2BNQE 3WNOA 1A4AA 2JCWA 3F2LA 4EAEA 4ZX3A 5J6HB 7FABH 4OZIA 1U3YA 3U9PH 1IFGA 2VDLL 4PB9L 4B27A 1NANI 3UP1A 3VFNB 5CJ5A 2ITCA 3FZUD 4DGUA 1OAYL 3NBNA 4CMHB 2K8MA 1GAFL 1J11A 2XRAH 4WK2B 2P80A 3FTGB 3NRQA 2V2WB 3ZDXE 2WXMA 1FZOB 1NMBH 3KPQB 1F3DJ 2EP6A 4MJIB 3OB0H 3EYSH 4F7MA 2M83A 2XACC 3V6OC 3QUHA 4JCMA 4ZQKB 1YO4A 1FNFA 3ESPA 3O3EA 1WFUA 2RD0A 2CBOA 4MRCA 4OLYL 5IVZA 1JZFA 2HLEB 2UZYA 2NW2B 4PRPB 1Q94B 1JDDA 3JTBA 2QMJA 3DX6B 3RB5A 5KBDA 4I0PA 3MBED 5IQOA 3VH8G 1YPZB 2XTJB 1CYGA 2V7NB 2QSCH 2UWEE 1N6QL 3GBML 4X5QA 4XCNB 2SODB 2IGLA 1G7LA 3QRGH 4XAWL 3UG3A 2XZAL 3NJGA 4A2DA 1MFAL 3V5DA 1FCCA 3EJQA 3LKSB 5E1HB 3AFLA 2XZCH 2A1WH 1AS6A 1IGYB 1FC1A 3EJYC 4TS6A 3TTSA 3S3CB 4KI5C 3AT0A 4ZODA 4MNGE 4QRPD 4JRYE 2QGCA 4WK4B 2VO8A 1LO2L 3LV3A 4X50A 2X3AA 1KJ2B 1QZ1A 3FN9A 3ZU8A 1MLBA 5IF0B 2OTWA 1CF8L 3O9WA 4MLSA 4AVKA 4WTZA 1AGCA 3BP7B 1JERA 4LDCA 4H88H 2XKNA 4F7CA 3SDYH 2R0WL 4UU9B 4TQEH 3BD3A 5C0DB 4CSTA 4GG6E 3FQNB 3BFWA 4BQ6A 1EIBA 2Q3XA 3M6DA 3W2DL 1A66A 1MQKL 1AYRA 1YMMD 4XVUD 1KBGL 5IFHH 2MQGA 1XR8A 5D1QB 5BO1H 4M7ZB 4IRJD 4CU7A 1S3RA 4H8WC 3TPUA 4L8CA 5FYJE 4MGXA 1H15B 2ZPKH 5BV7C 4GAYB 3UXFA 43CAA 4A7TA 1E5BA 3HFML 1BIIA 3DVNA 1A9VA 5IEHA 3DUSA 2O5NA 1SF3A 2FGWH 2OL3B 4XNMA 1MAJA 4EDWH 1U92A 3GGWB 3VD0A 2EDEA 4N20A 2D31B 2IBZX 3MV11 1ZA6B 2C3VB 3DLQR 3S88H 3OKEA 4HUVA 2VW4A 2X10A 1F1AA 5DRXA 3DV4B 1TTFA 1WG3A 4G5AA 5EZLB 4NFCA 4Y5VA 3NJJA 1IM3A 4DPRA 5B7MA 2Z4QA 4FQJL 1OSPH 2FYYB 1JF5A 4XO5A 1GKEA 3LN5B 1ID5I 3PWNA 3O0RL 4OQTA 2VZ1A 4PJFA 2BHYA 5EZPA 2KS0A 3EGDA 3WHE0 1F86A 4AQOA 3PWPE 3STZA 1XF1A 2H8PB 3H9YA 4X6FA 1C7TA 1RJLB 3GSQA 3DYOA 4PGEB 2OMVB 3EOAA 3SY0B 4P2OD 3RLSA 1DBAL 2BOCA 4YUEH 3KPPA 4Z5RA 3CDFA 4HIEB 5A6LA 1JHTA 2JLPA 2JJSA 5D4QA 2IH3B 2IH1B 1MCDA 3ZTNL 3QO1B 1QSVA 3WLWC 4M6OH 4F33B 1Z5HA 1BG1A 3PHOB 2H32B 3VFSB 5IJBC 1HAUA 3FO0L 2YRZA 1WUNT 5FDYA 3LN4A 2H4EA 3QWOB 5TD4A 4DIXA 3H56A 2LLGA 1CGSL 2HX7A 2UZIL 1S4IA 6FABH 1L9PA 3LRLA 1NFIB 3DX8A 4NKMB 1LQSR 3VFWA 4J3XA 4E42A 2EIZB 3BAEL 1XEDA 1CLOL 2YD0A 2C7FA 3FQUA 4XNXH 5JXAL 5F3HB 2IXQB 1DLHB 4N8CL 3INOA 1BWMA 4L3CA 1C5DA 5B1KA 4M56A 3LHPL 1P6AB 5BMFH 3I9GL 3G7TA 4FQXA 1JAEA 2LTQB 1F18A 1ZGLP 2YKLL 4BRVA 3D85A 4N0FB 2AJZA 1I3GL 1OP4A 3L5HA 3LX9A 4L8SA 4PJGA 1ETA1 1YHPA 3VQLA 2YEZB 4YBQD 2HKAA 2H41A 2QZQA 4XVJL 3WIHL 2FLMA 1KIPB 3X3FH 3RJOA 4L1SA 3I6GB 3VWJD 3FB6B 1DDHA 1WCBA 2PTUA 1DVTA 4URTB 2AXJA 4YWGH 1HCZA 1HI6A 4N90D 5E94B 2XXCB 5HHXL 3WUWA 1I7RB 4HKBA 1OCCB 2XVGA 4AVHA 3DJZA 1XGUA 3LNFA 3IS1X 4P2QA 3VI3F 1FAIH 3HS0B 4I0PB 4GAGL 3BC9A 3ETBJ 4H5SB 5DEZA 3ZW3A 1MNUL 3T0DA 3TT1L 5F6IB 2EH8H 2N59A 2CWRA 4MJID 4WW1B 5FYKU 3GMPA 4OUUA 4UV7L 2ICWA 2DWTA 3RJDA 3T8MA 5JOEA 2QDVA 4JPIB 4JPKL 1TCMA 4PRPD 5D93C 5I66A 3VXOB 3KWVA 4DN4H 4NQXB 5EO0A 5KYYA 3SJVA 2G5RA 4YXHH 4H25B 5D1XB 3GWJA 4CA4A 1A8JH 2E5EA 2XTJD 5D2LB 1J0YA 4MA3A 3ESMA 3QUML 3RNKB 5JPMB 4KUZH 5ENWA 4NPYB 1ZS8B 2V3FA 4TUJA 1L0PA 1XF3A 1J1XH 1IGIL 1YRKA 4AGOA 4Q9CA 4F5CE 4IOFD 3O3UN 4QOKB 1TEGA 2XG4B 1IC4H 4F8OA 3V0WH 5FF6A 3K6OA 4OCWL 5CZXC 2Q7YB 4Y4FC 1CXHA 1JJUA 2OTPA 2DJ4A 3F12A 3EDJA 3UPAA 1M57B 1Y6MR 3AT8A 3BUTA 4XODA 3RHWK 3BGFB 4XVOA 1CS6A 1BX2B 3MV01 5K9QG 4TUOB 5BZWB 5K9QI 3L6FA 2D7MA 2E8YA 3H7BA 3TPUB 4GQZA 4KZEL 1GSMA 2PW1B 5LGJA 3QWNA 3WE1A 3LH9A 3K0WA 4K94L 5C07B 43CAB 5DK0B 4D7PA 2B2XH 3QEQA 2YOAA 1WFTA 5KVGE 1A7NH 2A74B 2DI7A 4F15C 3H55A 1A02N 2BNRB 2ETWA 5TQ0L 4P23A 1QYGH 5DK2B 1JUFB 2CBMA 2A83A 3OAYK 2HG5A 3BH8A 2Z34A 4C47A 1V8HA 1EMTH 2JKTM 2ZNXA 5D1QD 2JV6A 3Q13A 4OH2A 3Q05A 1I9IH 5D7SL 2DIEA 3B2XA 1AAJA 5B8CA 3VU2A 2JKXA 5LG6A 2J20A 4N1CA 4Q6IA 4D0CA 3HVNA 3H8NA 2R27A 4L0YA 3C6SA 3AGWA 3O2WH 3GXMA 5ALBH 1KWGA 3MZTA 3LMJH 4U0RB 1UC6A 4WHYH 3VRJB 1LE5A 5IB4A 1WLHA 2AMGA 3PQYA 5T3ZE 5ITFA 3SD2A 2XCMC 3PFUA 3CN3A 1Q9LA 5CBAB 1R3JB 1ZTMA 4R3SA 4WFHE 1ORQA 2C34A 3D18B 5FYLL 3OTTA 5DFVC 4XRCA 1SBBA 2NXZB 4BZYA 4X4MA 4QHKI 1HSBA 2FJFA 3TS8A 2A6DA 1INQA 3MLWH 2G75B 2B1AH 2CBQA 4HFUH 1KJMB 2VJ8A 4PPTA 2BINA 1I8LA 1T2JA 3ULVE 1M6UA 2E7LA 1MCWM 3DJTA 4YO0A 3IGLA 1JNNL 4P2RA 2ADYA 2DEXX 1MHCB 1JF6A 3GEWB 3CFNA 4BKSC 1KLUA 2DWXA 3V4UH 3S35X 4FTDA 3O4LB 3KHOA 4H26B 4QLWA 4DAGH 4BFIB 2QHRL 3HC2A 1HEZA 1U8IB 3HS0C 5TPWH 5G5DB 4E42B 3NIFB 3T3ME 2Y5TA 1BQHG 1RUKH 4Z7WF 4D0DA 2WKLA 1J1OH 2H2SD 2OULB 1KBVA 3L5XL 1QACA 1MUJA 4OF5A 2ARJB 4Z1PA 3RL2A 2X4RB 3SO3C 3P4MB 1QSED 2IG2L 4ZSOB 1KCVL 1P4BL 4LVHB 4FFZA 4PJXF 2O72A 3PV7A 5H4ZA 1HH9B 5SWZE 5A2IH 5KYWA 3RFZC 2QPUA 5D1XC 4APXA 3V4PB 1J8KA 2XN0A 5JR1L 2ZE0A 1OM3L 4ACTA 5B39G 2KPWA 5KYXA 2OJZH 1JZDC 1HCFX 3MBXL 4D9LL 4FHKA 4GMTH 4G6MH 3BZ4B 4PJEE 3D2TA 1CLYH 4UNUA 1XR9A 1FZJB 2VDPL 3F7LA 4UTBH 1CJYA 1ZPLA 2OTUB 2APWA 4IGBC 3BGFC 5TK2A 1NMCC 1IAKA 5M94B 4AYDC 3OF6A 2G3MA 4N2BA 4YXLL 1LP9A 2AEPH 1R5VA 1BZ7A 5DVLA 4BBWA 1KG0A 1KIUA 2FJUB 3OKNA 1WVZA 3L54A 5GGVL 3WJMA 1AYOA 5J57B 1NCDL 4YAQA 2I26N 4RISL 1LMKA 4AWJC 1IILE 3HRZC 5AAMA 4HU2A 1CK0H 3NPZB 2BK8A 1KB5A 4U3XA 4YC2B 4I0PD 3A4AA 2VXSL 4HPYL 5E8DL 4IYKA 5F93C 3O11B 1X44A 1MDTA 4GMSH 4XPTL 1P7HL 5H37A 3LIUA 4WV1A 5TF1H 4MVBD 1EJOH 1ADQH 1AZUA 3VW3H 1YNLH 3KNBA 3EGXA 3NJHA 1N59B 4KO9A 4TNGA 4A7UA 4XPAL 3H9SB 1DVUA 5D1XD 3OSKA 2XKUA 3CDZA 5GZNA 1R5IB 3UAJD 3VTMA 4ODSL 4AH2B 3B7TA 4J6RH 4A6YL 3BPCB 2NXZC 1Z1WA 4QOKD 5F71A 4AJVA 2R4RH 1ZLVH 3ROLA 3QE5A 5FYKD 3MO1B 2IPUG 4OJDH 3ROOB 1JN6A 1TU2B 4OCNC 5T1LA 3CFEA 3NZUA 4NAJA 1LL1A 2IADB 3HZVA 2A83B 2BY3A 2PR9A 1W9XA 5A43C 4DO6A 5J1AA 3WL9B 4NUGH 4NKOA 2BNQA 5D70H 3QZWG 1L6PA 4M1DL 4WCYH 5K1NA 1T5KA 2C1PB 3PL6B 2PETA 5C07D 2WVTA 2YRBA 2ZKXA 2XWBB 4QTIH 3VH8A 3T4AC 5E5MA 1U91A 1AHWC 2BNRD 1R1CA 4JPQA 2Z6FA 1KTDA 4E41E 5FW8A 1CTNA 1X7TA 3D06A 1FAKT 4C56E 4LGPB 3S2AA 5C0RL 2FNWA 5EZJB 2VR9A 3FDWA 4NQSA 1GMIA 3EYFA 1WSST 1A4KA 4CC0A 1GC1H 3QO0A 2CG9X 2UY7A 3RYMA 3BPLC 2B0SH 3UG4A 3Q8BA 4JNXA 2GK0A 3GZKA 4LVHC 1YJDL 1JHKH 4UILH 2YN3A 4HMCA 2HMID 4DN3L 2AJYH 3IMVA 1JMXA 4NJAH 3C5JA 1N70A 4YBLB 1OAZL 5DA0B 1YYLL 2UWEA 3BKMH 1MHEB 4K15A 4YHYB 4KRPB 4OD3L 3QDJB 5HTSA 1YNKL 4M7LL 3WIFB 1MJ8H 1G5GA 1N0XH 1QLRB 1MVUB 4KJWC 2NXZD 2EECA 1KLUB 1QA9A 3U2SA 4WZ9A 3H9ZA 4WW2B 3ETSA 4Y88A 1WBZB 4Y5YB 5DZVA 3H4FA 3RKDC 3ERXA 5CMAA 1ITBB 4HLJA 2XZQL 2MQCA 2HRGA 1MFEL 1YYMH 4JRYA 4XNZB 1B3JA 1URIA 1YEWA 4Y5XC 5D96C 2H0EA 3GXPA 4Z9KB 1U3HA 3SDXE 1A1NB 4I18B 4NI3A 4OTXH 4X0NA 5T1KA 4E9QA 4I2XE 2K70A 3PHQB 1QKZH 5IVOA 3GFUA 3KVQA 4KZCA 4MQ7B 4FG6D 4MDIB 5KSUA 1XL6A 5HDOA 1HOCB 3FSVA 3O4LD 2V3DA 2QPFA 1Y6NR 2BJML 4APQA 3VX1A 1AO7A 2FZ3A 4GG6A 1QFHA 1FHNA 2R59A 4LE8A 4HX1A 3QG7H 2N01B 2YLHA 4HH9B 4UQ3B 4APXB 2E7DA 1X5KA 3MUJA 4M00A 4X7TB 4X4ZA 3WLBA 1UTDA 1GXEA 2DQTL 4P46A 4Y1AE 2EIBA 4OJCA 4O02A 3OHXC 3U82B 2NY2B 3C2AH 3N41B 2DPKA 3NTCH 5B7EA 1ECYA 4UOQA 1DE4A 5HD8C 5E4AA 3OR6A 1VLXA 4FL4B 2YUZA 4B9CA 2VITB 3FN3A 3QDGB 3L9BA 3Q3GB 3W39B 4OU3A 1S3KH 3IEAA 3DO7B 1KXTB 1YY8A 3NZHL 4CBZA 1LNUB 5JQ6H 1D6VH 3OAZK 4R4FH 1CE1H 3FT2B 5D5MB 3QYNA 2BDNH 3QIUB 5SX5K 2ZD0A 5LWYL 1UURA 2PNDA 2X4NA 4M8QA 2VR3A 1KG0B 3CZJA 4NQEE 4JZOB 3BJLA 4PGDB 1DTUA 3B8YA 3TESA 1BYNA 3AY2A 4QD2E 3V52H 1CFSB 3K2UH 4X9BA 3EXLA 3A4DA 1E7UA 3N42F 3C8KA 2ZUSA 3GRGA 4P3CL 1MREL 5DVNA 2J6WA 1WBXA 3M1OA 4BQCA 2AQNA 2FO8A 2VZSA 3X3GH 3E3QE 3CVHH 4YX2L 1NGXA 2FK9A 4CVZB 3GMNA 4BA8A 4Q2ZB 3OKOB 4R0LA 5ITBH 1BPVA 4Y2OA 3RI5F 3KL5A 1RPQA 3WJLC 4CMMA 1M3IA 1SGKA 1DVFA 2MRYA 3RUGA 2A73B 4PJBF 2ATAA 2NSXA 1R46A 1MJUH 1O7VA 4Z7UF 3UBHA 4BZ1A 1PCSA 1RZ7L 3MRPB 3FQWA 2X7LB 4WUUB 1HQRB 1MCIA 4Z3TA 1NMAH 1PS3A 4QNPE 1ACZA 3DVGB 3LEVH 4W9CC 3IAPA 4KXAA 4NRYB 4NZUL 5AWNH 4ZYKB 4L8DB 4XOEA 4RAVA 4P0DA 4PRDA 1XIWC 2XPGB 4KUCD 2B59B 4QMEA 2COVD 3IU3A 4FG0A 3IF1A 3KH4A 5IW1B 2BMKA 3FQTB 8PAZA 1Q9WB 2BSCA 4MXQD 3N85L 4F91B 1ZHBB 5KVMC 3QZMA 2VIRA 2LVCA 3H9SD 4OLUH 3N50A 1BFVH 1C5CL 1UUNA 4LLUA 4OLXL 4EXKA 4OKDA 1YVLA 3LRGA 2YXMA 3G9AB 4Y19E 1U8HA 3HG1B 4JM2F 5FO2A 1CICB 1P9MC 1FFOA 2IAMA 4R7DA 3CFKB 1TTCA 3B2MA 5I1GL 4U1MB 3ZQWA 3S8WA 4HUMB 3AREC 1P4LB 3DHMA 2AERT 3QEQD 1FFNA 3O6LH 3VFTB 4EF3A 3BLKA 1QABA 3MZGB 2FO1A 2GJJA 3K2MC 5T5FA 1EEZA 4LCCA 3QUYA 1AGEA 5BV7L 3DIVA 3DMMA 3NFSH 4KZDL 2VUOA 3QJVB 3L3IA 5DHVA 1FF5A 3WE6A 2UY7B 5L6YH 1V7NL 3IKCA 1HNFA 3AWEA 1PTZA 2QL1A 2H0JA 3HIZA 2AQ3A 4YSTA 3PL6D 3AGVA 5IM7A 4GW1A 3PAZA 3IXAA 4RDBA 1AKPA 5SX4I 4PP1D 4PJ7B 2OJEB 3BZFA 5E8EA 3V4VH 3I2CL 3DTDA 5E2WH 5TE4H 5DVPA 4U4BA 3VI4B 1XGZA 4NO2B 4AQEA 3SKMA 3JTSB 2JKSA 1BOGB 1IKNC 1Q72H 3AAZB 4MCZA 4U6YB 4G1EA 4XXWA 3R7RA 3PS6A 1J88A 2V8LA 3LZFH 5CIPB 3OJDB 5EOQH 4NNYB 1HWHB 5KANG 2JQAA 4JFYB 1YN6B 5KANI 3FH7A 5FYJU 5AYUL 4MMZB 2GT9A 5EOCH 4KRPD 4EKJA 1KDIA 3QDJD 3DX4A 4GBXC 5LCVH 4AV0A 1AZVA 2LU4A 3IB4A 4U1JB 4F5CA 4OZ4B 3K4ZA 4EI6A 1TVBB 2AVFA 3D30A 1P2CB 1NOAA 4M43L 4E9VA 3ZT7A 1MCKA 3K5RA 4R5XA 5DUMH 1NWPA 3V0JA 3K80A 1OT2A 1TKWB 2K3TA 4K7PX 1WEJL 3EH2A 3M1CA 4YDKL 1NEUA 1QI5A 3VXNB 1RSYA 3V95A 3ULSB 5FWQA 3U0TB 3D9AL 1EJ6A 4UT6H 1O7DE 3DC0A 2W65A 4NI6A 2CK0H 2JJTA 5I6NA 4XNUL 1HH6A 3DK0A 2DJSA 4UINL 4X6CB 2SEBA 4AXWA 2WQUA 3UTOA 3Q01A 2ED6A 2HRPL 4OZGB 2G5BB 5AOKA 2BP8B 4LIQH 2MWCA 3MU3A 3ZHLA 5TDOB 3ZKNC 2WBWB 1XGQB 2P52A 1CFNA 1DSYA 1QR4A 1TNMA 2VLRB 3ARQA 3QDAA 4D9QE 4Z78B 2R0ZL 3ATEA 3QQ4B 5AAWC 2ILLA 4POZC 3D0AA 2FRGP 1JWSB 1HHKA 1A4BA 2V7HA 1IGTB 4LCWE 2NY2D 4GAFB 4U1HB 3RWFA 1T7ZA 2A77H 1R3IL 5MEOA 1OHQA 12E8H 4GW4A 1IFHL 1QPXA 5D1ZB 2VLME 1DEDA 2I60H 4H0IA 4JHAH 2GY5A 4FZ8L 3QDGD 5EIIB 5K9KB 1SDDA 3ZE1F 4ONGH 1OCZB 2DIAA 1M9WA 4HUWA 4XCCL 2ALAA 3H1ZA 2OMUA 5LXVA 2GSIB 4HHAA 3R1GH 4NQUA 1B4TA 3FRPB 5FYLE 3AS0A 3PWVA 1A0QL 4N0UB 3QIUD 2FO4B 3VQ2C 4PM1A 1E9PA 2R1YB 2WQXA 2X9XA 3D0VB 5DHEA 3CDGB 4H1LB 1BQHA 3OL2A 2O5ZL 4L4JA 1DO5A 2CIIB 3BIAX 1J5DA 2Q7NA 4AJYV 2N1KA 3DJ9A 5DEGB 2WLIA 4XOBA 2MQ3A 1INDL 5CZRA 4R84A 4AM0Q 3FUFA 4OJYA 3S4SG 2R2CA 2YBRB 3CFCL 3U4KA 4Y16A 3NABL 4YNYA 1IAIH 1S9YA 5F6HJ 2VH5L 4DF9A 3VSUA 1UKSA 3S3JA 3NT0A 4XWGL 3HPLB 4PRDB 4JHZA 3MRBA 4XP4H 2O6CA 4TNFA 5B39A 4RDQF 4XC3L 4WHYG 3UIZA 3WNMA 4JAMA 1D6EB 5JQHC 1UWXH 3ET9F 5JHLL 1BFOA 3QP3A 4AEEA 4QXUH 5JORB 1RURH 4WUUD 3G6DH 5ECJE 3I9PA 5T3XD 4POZD 3PV6B 3ZXAC 3WHXB 4JQIL 1VEOA 2X4TB 3IJ9A 4LKCB 3K8LA 4G8IB 1D3CA 1PZ3A 1R5WB 2C7UA 3EBHA 3MRHA 1TF4A 4L4VB 4Q4IA 2X2HA 3P0YH 4M02A 4V1DB 5SWZA 1DLFL 1JV5A 4R7DB 4Z7OF 1T66C 3S35H 3RZCA 1UGNA 1REIA 4MKMA 1IFRA 1F8TH 3VMOA 3BFQG 4FI6A 5CZVH 1JGIA 1HWWA 2B14A 1KULA 3CK0H 3EDKA 4DWHA 4ADGA 1WT5A 4K3HA 5FB8A 3FT9A 3I84A 3IDGA 3OZ9L 3T77A 1G9NC 1U8OB 1X5HA 5DR5H 3RWHA 3D3VA 4FA7B 2VM3A 3LOWA 3APFA 4X9HA 3HG1D 1VPOH 1CICD 5EOCJ 2VWEE 3MFGB 3SE3C 1L3NA 3QPXL 4OF7A 1EZUA 4JO1H 4R8WL 4UTAA 5E2UH 2KZ1B 3ZTEA 4PG9B 2EVJA 4PTTB 1IE5A 4G7YH 4HDIB 4G9FB 4N0YH 4MA8L 5GZOD 3ECBA 1Y7VA 3P0VL 1C12B 5C97A 3UYPA 2UXVA 3F7RA 1AP2B 4L1TA 1AD9A 5D2NE 1XF5B 3TM6A 4L23A 3MNVA 4DGWC 3NCMA 3IDMB 1M2VB 2ZXCA 5IZ7A 4ZFFB 3LZRA 3EAKA 4NO0B 1YEHL 4HS6A 4Z0BL 4O2CA 4R7VA 1PY9A 1TYJA 4PYGA 5EDXA 3CSTA 2HZHA 4WDIB 1N5YL 4OFVA 1EV2E 4GH7B 3EO1B 1E4WH 1RMFL 4FQCL 3FTYA 3VM7A 15C8H 1R33A 3MLUL 4UQEA 2FNBA 1OTSD 5IEKB 1T1XA 5E1AB 4JMNA 4NERA 2CAKA 4OZIF 4EI6B 5IROA 2EDWA 2XFXA 3VVWA 3HI1A 4OBRA 2GSGB 2D7TL 5CN2A 3HAEB 3WJJA 5EIVA 4KKZA 3NFPA 4ODXB 1L9OA 1U8NB 2FX8H 2IBBA 4HQQH 4FDWA 4LHUB 3ZBMA 4NIKB 3T0VA 4HWEL 3TYGL 3P77B 1D5ZA 3BAIA 1GGCH 2P1YA 3QZWA 4NS0A 3FSWA 3KVDD 3EGSA 2VXTL 3FSZA 2D3LA 1QEWA 3BH9A 4HOWA 4Y7MA 3VGDA 3S8FB 4AV4A 1SHSA 5DS2A 2VYRE 1Y18A 3P3SA 1RIVL 2LABA 4PBVC 5HHOE 3CVBA 5HHPB 1F3RB 4F80A 1S8DA 4UMSA 4R2GC 5AZUA 2I9LA 3MRFA 2J6EA 3O3AA 4IEFA 4NENB 3H85A 3UTSA 4F7EB 1SYVA 1BW8A 1FFPB 4OI9A 4LRIC 3MLXH 2X1XR 1S5HA 4PYHA 1JG9A 4F2MB 1O9WA 5KVEL 2NTFB 4CVXB 4DCQB 5LN8A 4WJG3 3GTNA 2W07B 2FIKA 3LNHA 2R0KL 4HUUA 4E41A 1YNTA 5GQBA 4J8QA 4F93B 3O81A 2OZNA 2VLRD 4MASA 3MRIB 1J1PH 3GMRB 3LKPB 3IDJA 2BSTA 3O0LA 2ZWYA 4X80L 5DJ2A 5E03A 2PYEB 3FO1B 2VXVL 2DKSA 4G43B 5GS2D 4MXWL 4W6WB 3NIDF 1PKOA 5D1ZD 1P5UB 1WD8A 5IHWA 3OC5A 2UY6B 1IL1A 1SDYA 4FQLL 1F4XL 4AT6B 1T1YB 1KTKE 3ILPA 3U1QA 4G6FB 1D5MA 4TSAL 1FJ1B 5DRZB 2OYKA 3W0WE 4E5XB 4YLCA 4N25A 5F96H 4WKXA 1E43A 2F5BL 3OMIB 1MAML 5FGRA 2CSPA 1QX1A 1MLCB 4DK6A 4AQ1C 1JPSL 2ORBL 2HVKB 2XQYG 1G5AA 3ELAT 4EN2A 4NZRH 5BVJB 3AW5A 2XWCA 4GT0A 4KPHL 5B4MD 5I0XA 2Z93A 2NY1B 3S34L 3ZL1A 4A39A 3SDXA 1FC2D 3SDDC 2H47C 4NNPH 4EUPH 3TFKC 4I2XA 4NZTH 3CMGA 3QAZC 5TFSL 1PLAA 1T21B 2NY5C 2XBTA 3B3IA 3K6SA 3WFHB 3L3GB 5CCJA 4MJ6A 2BHFA 1SEBA 4GKZB 3K3QA 3U9WA 4PJFF 5F1NB 3T8XB 5HHME 4X8JA 5IFJA 4MD5B 4X9FA 5ID0A 4MQSB 3ILQC 4U6VH 3SE4C 2ENQA 5FFLA 2HYMA 3U2JA 3HRPA 1HXKA 2WKGA 1MJJB 3QXAB 4JRWA 1UKQA 4JKPL 4U1NB 5I15L 3FL7A 4L4VD 4V1DD 3WI9A 5HPMA 3DDFA 3V9CA 2VZUA 4LARH 1TZHA 3C8DA 4LVNB 4NN5C 5IMOA 5H35A 1H5BC 4J28A 2PPDA 4YS4A 3ZL4H 2KMWA 1F13A 1E50A 2Y7NA 3CBJB 3QUZB 2DQGH 2ZOLA 2QEJA 4HSAC 4UT9L 3IGAA 2VN3A 5FXCH 2WIIA 2FX7H 3V0IA 1DJSA 3CQFA 4HWZB 5C0JA 4J1UA 3B7YA 1VGEH 1OWRM 4X9IA 2FHCA 1D5IH 1H0DA 3M7FB 2N56A 1L9TA 1T04B 4KXDA 1ZLUH 1IGFL 4XBEH 5BCAA 3QJXA 2BIMA 3FCTB 2VN5A 4FOMA 4G9FD 3EFFA 4PJ5E 4UCFA 4Z7NB 1U2YA 4LVOB 3AU1B 4DO4A 3NPSC 2CR3A 1KB9J 4XMWA 4KKAD 2OXHB 3SCMB 3AQZA 1KGJA 4KKCC 1TQBC 4UANA 3B2VL 4YHZL 4PJGF 4LLYA 3FFDB 5DS8B 5DTFA 1HS6A 2UYLA 4EZLA 3GBEA 4NO0D 5E7FA 3FT3A 1NUGA 3SKNB 3GPEA 3K2IA 4P59H 3RGVC 1ZRUA 3KL0A 2HX9A 2GVYA 1YEEH 3PP3K 4F58L 3II2A 2H1XA 3UAEA 3ILQD 3DIFA 2X4SA 4RFOL 2Y7MA 3UPCA 4WU7B 5ECGA 3UC2A 4L1DA 2O61B 2ATPB 2A2QT 5JXEC 5CINH 3GXNA 4OIIL 4PVLA 2A9DA 4KI5E 4YDVA 1S7XB 3HE7A 1YDPA 5IJKC 3RWIA 4NUJA 1CZ8H 2IQ9L 2DQJL 2X9ZA 2C4FT 4RH4A 4FZEL 4LP5A 3WAKA 1SMAA 4LHUD 1NIDA 1XTMA 5I5JA 1VA9A 4MWFB 3RTLA 1PIGA 4QHUB 3MLTB 3MRKA 1KBWA 4IEFB 5KN5A 2DTML 3FONB 1PZ5B 4NQVB 4ZMQA 2VABB 4Y19A 1CFQB 2W9EH 3BLBA 4PRBA 2HH0H 3DI3B 5DD1H 4M9PA 5EUKB 4AGLA 3ARBA 3THMH 1NKOA 1R3HA 1WZ1H 3QPKA 2NY1C 2WBKA 4YBHA 1F58L 1E4XL 1OAQL 2FBRA 3HLAA 1FI8C 3X14A 2BM3A 2A6IB 3HHMA 3CZLA 4ZFZA 1L5GB 5J5EA 4MFHA 4XC1L 1Z9MA 4ZOBA 3US1A 5IBTL 4YIQA 1XB6A 5DJ2B 4NAMA 4EBQL 1I3UA 4XMLH 1MN4A 1JXFA 4TQ8A 3B2PA 1WA2X 2WGXA 2Z31B 1KCUH 5DMIH 5GIRB 2XICA 4TNWF 3H6JA 5JW4N 3CVIH 3ZPDA 2FWLB 3D07A 5DGQA 3F85A 5A7BA 5AW9B 5J89A 1CR9L 5AVXB 2LU3A 3UDWA 1CG9A 1RAMA 3ZDZE 5ID1A 3ARGB 2PYED 9CGTA 4FXGB 1MOEA 4KK8C 5EWIH 5BXFB 3BJ91 1USZA 1DVXA 4KJYA 1G0YR 3L3DB 1R24B 1DQML 4NHCL 5CSZB 3Q43A 4JY5H 4BQ9A 3OKDB 3OVUB 4G6FD 5KVDL 1IZKA 1OM9A 4GSQA 3NCCB 5F6HI 3UJJH 1I8KB 1JPTH 2E4FA 3NP3A 5ELIA 3VXMB 1SXZA 2MCAA 1CFBA 1LEIB 2V9TA 4AQ8A 2MOGA 2IMNA 3UP6A 2NNAA 5CHNA 2E7CA 1SBSL 5AB9A 1QUNB 1KGYE 2BSRB 4FJ6A 4JFWA 2G4EA 2C9SA 2AXFB 2C9PA 3RURA 3PDOA 5DHXB 4ETQB 3FUDA 3B4NA 2IJ0C 4A7VA 5ID0B 2NY1D 1GZPB 2WCSA 2DS4A 2XN2A 5FA3A 1E0OB 3FUEA 5IB2B 4HFWA 3DGGA 4WU5A 3AG3B 4TSCH 2CKBH 4YSCA 5JW4R 5F0LB 1LEGA 2FX9H 3ATBA 3K81A 3KLHD 1SOKA 5C0CB 3BZEA 3I75A 4JHVA 1J87A 2NQDA 1H3WM 3WTXA 2EDFA 3QFDA 4BH7B 2ZYSA 4PGBA 3HZKA 3L9RA 1N0LB 4X4KA 4Y4KA 4BUHA 4X7SH 5KYNA 2BSBA 1D7CA 3FF8A 2F68X 1L9RA 3EF7A 4K7PH 2FR4A 1OV8A 2N3JA 1IGCH 2E47A 1H3PH 4LCWA 3SPVB 2XVBA 4JG0L 4DKEL 2W9DH 3T2QA 3US9A 2GAZB 5CWSA 3WN5B 4XE0A 5D7IE 5FECB 1HVXA 2EO1A 3ECVA 3E8UH 2ZX5A 1BFTA 3QQ3A 4G6AC 4YHKH 5J0BA 4KAQL 3S4SA 4CW1B 1WFIA 2WQRA 3JV6A 3BAWA 3DA0A 2F2HA 4OLWL 1UWEL 4R26L 4WVRA 2IPTH 4I5BB 3CZEA 1PZAA 3QUZD 5EZIL 2BP3A 3WTYA 4KNUA 4MQTB 4W70A 4D9RD 4PJ9B 3LS5H 3NH7H 4XPBH 2WBJA 3O3BA 4LLYB 2ZOOA 2QPEB 4JM2C 1IVLA 4ZUSA 5IHUL 4E9RA 1RPKA 3B9KA 4BGLA 4ZTOL 4NJ9H 2WAHA 4KOBA 4TTDD 3NCYS 2ADGA 3LKRB 4GEJA 5E70A 5IJDC 5KBPA 1MRCH 1GW6A 3DIFB 4GJTB 4G59C 3IWVA 2RB8A 2VC2B 4QEGA 2WSDA 4ZXBB 1EFXA 1RZIB 4L0PB 3SCMD 3SPJA 2J8UA 2W1NA 1WJ3A 2K4WA 2Z31C 2G2RA 5EU3B 3BZ5A 3VXSE 3EF4A 1SZNA 1LP9F 4ZQTA 1DQDH 5C6TL 5JA9A 1LYQA 1SMDA 1NLDL 2CBPA 1Q1PA 3TJPA 2FIRT 1MI5A 3TNMA 4ZW6A 4GINA 5DJYA 1Z2KA 3BGAA 3O2VL 2OYMA 2R2BA 2XNAB 1HJCA 1CQYA 3ARGC 3L4VA 3ZMRA 3A3YB 2VLLA 1ZLVK 5I74C 3QGVA 2P7TA 2ADIB 3O6KL 4EO5A 3TYFA 2QSVA 5IHLB 1OARL 3HJEA 4LDOB 2NZ9D 5KS9B 5ICYB 4JJOA 4J3OG 2R7EB 2NYYC 3D6GA 1HQ4A 3FOLB 5DU7A 5I2IB 2FWOB 3PWJB 1Z9SA 2GTWB 3A6BL 5DQ9A 3P40A 4KDTC 3MUHL 2XQYK 3LY6A 4HVBA 1V05A 1TNNA 3LEXB 4P07A 4YLBA 1JZGA 2RMNA 1E4KC 5K9JL 3LS4H 5GHWL 1TZOA 4RQQA 2Z91A 4ODVL 3T2NH 3SN6N 2ZWZA 1RUAL 4FJYA 1XAUA 1A8ZA 2CJUL 4K8RC 4KHXH 2YPLB 5LAPA 2I7SA 3BD5A 3MACL 3T4YB 1TO5A 1XCXA 4FC3E 2CLZB 3QFJA 4YPGB 5CEYB 5F9WC 1DR9A 1YC7A 3KD4A 2WTRA 3KPMB 4PVNA 3BQUC 3DSFL 2VDRL 2Z31D 1Q38A 2YA1A 4XE5B 3B1TA 2R69L 2C9VA 2WVVA 1YMHB 1PYWA 2VMEA 4I3RH 4NIYE 3MX0B 4GRWF 4DO5A 1ZY9A 3GXIA 2F58H 4KO6A 1KGWA 1DFBL 1IBFA 2DKUA 2JCCE 1HXYB 2M8XA 1H6EA 2MHAB 3CXDL 4K55A 3QHTC 2CDFA 1KELL 3MV8E 4OCSH 1G7MB 4MMYA 5GJSH 4XX1G 3PNWA 5E08H 3VFVB 2GFBA 1K8IA 2BFVL 2X6UA 3ARGD 4ELMA 2EC8A 4Z23A 1GZQA 4KX7A 4FKHA 1CDBA 3CCHB 1QTSA 5B1CA 5KVFL 1YLBB 4LLDB 4Z76A 1VADA 3ATAA 5GGSA 5DZPA 1A6PA 3ARSA 2BCKA 4A2LA 4UB0H 2FJSA 3VXMD 1PZBA 3L2NA 3LXBA 5CKGA 1ADQA 2DI8A 4X8GA 3ZQ9A 1TCRB 2OCFD 5GGUB 1ODUA 4FN0A 3KJ6H 4JG1H 4IM8A 5K33A 5L4FA 2F1EA 3QEHB 1AXIB 2UWEF 1U9KA 2LOEA 3O6FB 1RZKC 1ZSDA 2NY7H 5LN4A 5C3LD 3EYVB 4P5TB 4AG4L 4OCLC 2NLJA 3CV5A 3HNTH 3LYRA 4ZXBC 5KVEE 4DPAX 2QVIA 1MJ7L 5LQBL 4QI3A 4X5XB 4A7GA 1Z3GL 4X99B 4GSUA 4YHNB 5C0CD 4PIRF 1GGBH 4GQQA 4GKLA 3AG1B 2QKIB 3L1EA 4XHJC 5HGBA 1KTLA 1WA0X 2I07B 5JLZA 1QLEH 2EDNA 1YG9A 1B0RA 2J7LA 4NWTL 2GI0A 2V2TA 5C3IA 3CFIC 1RZ8A 3QG6B 5EIQA 1P69B 3PGCB 4P57B 3WKQA 1IC0A 2G9HB 3SKOB 2WYIA 3GRBA 2ZUYA 3LTVA 4XI5C 5AKRA 5HJGA 4EN3A 2XQYA 2CHNA 3GSOA 4MMXC 5D9SA 5DUBB 4GG6F 3B8SA 3JWNH 2H26A 5E1GA 3RX9A 3HG4A 5JMRA 2ZG1A 4Z3FA 3ECUA 4YQXL 4AMWA 2IGFH 5KW9L 4HWBH 2XQBH 1W16A 1I8UA 3VGHA 5IFAL 3S96A 2EVFA 4HXBL 4JANB 1FVEA 4G8EB 4X5RA 4DFHA 1IARB 1MPAH 1RKRA 2PWEA 4U7KA 1LK3L 4UDUB 4PJ9D 5GPRA 2ED8A 1EFXB 2MOVA 4XP1L 2EDRA 5EA0L 2BNUB 2DM4A 3SBRA 4RMWA 2G2RB 4KROB 1AGFB 1U8LA 4LPVA 2ZUQB 3H0TB 4R7XA 4UT7L 5CILL 3F65A 1I9JL 3J2PA 3S97C 2HFFA 1SXNA 4KMLB 2MJWA 1AC0A 4GQPH 4YDIH 5DI8A 1Q0XL 3ZR5A 4U6HB 1PL3A 2XN9E 3BN3B 3E80A 4ZXBD 2D03H 4ZUVB 5EBMB 5GS1B 5I5IA 1H3UA 1DQQB 3OAUH 5EBWB 3ZE2B 1HKFA 1JHLH 3TBSA 4ADJA 4DZ8B 1FNEA 3MRGA 2YPKB 2XV2A 3ZSTA 4QRTB 3A6CL 3ZMEA 5F7EH 2X0WA 5GGVY 1WF5A 3WCYA 1EANA 1DEEA 4M6NH 1J05B 1OAUH 2VKXA 2WQSA 2F18A 1MCOL 2GHZA 3EYQD 3RUGF 5DC0A 4JB9H 2Y1YA 2VDMB 2EDTA 4QRRA 3W81A 3DURB 3VCLB 3QEGH 1T03L 2DQIH 3QNXB 2CM6A 1J18A 2BPBA 1IQWH 2MPVA 1YECL 1UVQA 3L1OL 1G9HA 4M1GH 3S5LB 4MZIA 4J4PA 4Z0XB 1AE6H 3BE1H 3MNZA 3GSUB 3V5HB 4ENZA 2BERA 5DWUL 2CNZA 4KJPD 2D4FA 4ECNA 2Y5QA 2ITEA 4HJGB 3IXTA 3UH8A 1U8JB 5F88B 2QFPA 5CR8A 2FT8A 4P5TC 3TBCA 5BJTA 5HXMA 2FL5B 4AEHH 3BEWA 2BZ7A 1JZJA 5KG9A 2YPLD 5F7HA 4MB4A 1DVZA 2GW5A 5GGSY 3SE9H 1XH0A 3MV9E 4HF5L 4LF3B 4GP4B 1OF2B 4IU3B 1G4RA 1LO5B 2I25N 1J0KA 4NHUB 5E6SB 4B7IA 4C8XA 3C6EA 3UCRA 1O0VA 1G7QA 4N2HA 4PI2A 2A9MH 1KSRA 1AR2A 2VE6A 1O6VA 3GLEA 4K23L 5F7MC 4MD4A 3P0GB 4WI2A 1T1WA 2W0FB 3CLEH 3CVHA 3PPEA 4I4WA 3WNPA 4J39A 3AB0B 3G5VB 3O9WC 3ZKSD 5CCKL 2PW2A 1JXDA 3AY4A 5DFTA 1RK7A 4LEBA 3UCQA 3L1FA 3N1GC 1Q4NX 5CO1A 4G42B 4QXGH 2B15A 5K59E 3GMLA 3NOIA 4GO9A 4JE0A 4JZJA 3U7YH 1NAKH 3A67L 1KFGA 1IAOA 4HJIA 3HVDA 5C7XH 3DTXB 3IJ8A 4A2HA 2FLRT 4H0GA 2K7PA 3BP4B 1KFAL 4UQDA 2GHWB 2A38A 1A5FH 1M42A 2NY5L 1BVNP 2JJVA 3BGMB 2DWEB 3MLZH 4XPFL 2AJVH 1TFHA 1BREA 3QNFA 4N24A 4MDJA 4PGZA 1R3KB 1FG2A 2DWYA 4NYLA 3QI9A 2CO3A 1B90A 4HJ1A 4BE6A 3A47A 3FUKA 3NACL 3U25A 5I9QC 4PRHB 4XH2B 3RVTD 4IOIB 4XPAH 4PUBL 4GG8A 2D7PA 3QQDB 4RMBA 1JZ5A 5JHDA 2C1OA 2WLLB 3DX7B 3O6FD 1RULH 3FMGL 4X5PA 5ICUA 5JPNB 4DUVA 1AFVL 5C0FA 4YHLL 4P5TD 3G5YA 2XWDA 1IV8A 2Y6SD 3MLVL 1NEZG 1AZBA 5DDHB 1XCTB 1AHKA 1T89C 4JHWL 4KX9A 3BN9C 1BQSA 4PGCA 1QNIA 1MFBL 1AKJA 1EZVY 4GI8A 1I7UB 1UFUA 2PWHA 4K3EL 3OXRB 4M4PA 4NT6B 3C87A 2H1LM 3HS8A 1E4XI 3PG2A 4FE9A 2BSSA 5F7DB 5I18L 3MAWA 4JFUA 3EOBB 4LO9A 1T4WA 4PR5B 1OTUD 2IFGA 2WP3O 4MLIA 4CKQA 5IG7B 5J8OA 4ZTPL 4F57H 4BK4A 1I9RL 5LGYA 4YFLI 4JN2A 4KTDH 5L4IA 2JJSC 5LBSH 4K3DH 3TCLA 1N2RA 1MELA 3ETTA 1MFCL 2O5YL 4NQTA 4L4TB 3WFDL 3V4VA 1LWJA 5KVDE 1T4KA 4HBQA 1ES0A 4WTXA 2W0PA 1NOLA 4LFHD 4HKZB 3L7EA 5IESH 2BVUA 1OPGL 2JSFA 3EG9B 3HA0A 2H2PD 2Z8WC 4OAWA 1EAPB 1UJ3A 2HVJB 3L08A 3UEQA 5EC1B 1CFTA 3IFPB 4IDLA 5KSBE 1EFXD 1RI8A 3MCKB 4B9KC 1CGVA 4NAQA 1E4JA 3MMEB 4E9SA 4OZHB 1GJUA 3I02B 4FFVC 4JO2L 4KROD 4OT1L 5EZOL 3N55A 1Z6JT 3H2QA 5E6IA 1UWXK 4WJ5A 5AVWB 1QQDB 3ZHDA 1GZHA 1YNKH 4GYBA 2XYCA 3FN0H 4F3FB 5LCVA 3Q44A 1P5VB 1RU9H 1KB3A 1LE9A 4QO1B 4DGYL 1T20B 3C6LC 5IGXL 4OIAA 4FQXC 4URKA 1U6AH 2CHWA 5HI3C 4CADA 4E9TA 1JP5A 3KPRB 2ZJSH 4WWPA 2MFNA 5C6PB 4L8SC 2R56H 4RZCA 3CC5A 3ULVF 2WNGA 3VB8A 4RWYL 4M3KB 1YSOA 2YR3A 3IU4H 4UT6A 1DQKA 5DEJA 5C86A 1WFMA 3B9AA 4CJ1A 1JGVL 1F00I 2FB4L 3NQKA 5FDWA 2WWNA 1J8HE 1ZT1B 4RNRA 1I8IA 2PUQT 4TUKL 5D7IA 2G0LA 2YJQA 5IHBA 1AD0A 5FM5M 1ADWA 4F27A 2BOBB 3S9DB 1GYCA 1YEKH 1ORSB 3IJSA 1RV6X 2F53B 4NGHH 3P2DA 3IE4A 4Q0XH 3RX5A 3UZVA 3UTTB 4FABH 4NOFA 1ND0A 1QBAA 2HJKA 3L4ZA 1PX4A 3RDTA 3UZEC 2DYRB 1X9UA 1FFQA 3POHA 3W57A 3D0LB 4HJJL 5DFWH 1KPUA 2AP2A 1XSKA 4H8HA 1PVHA 3GMOA 3CXHJ 4PB0L 3KWUA 1YEJL 3GJEA 1FH5H 2VXQH 2XTLA 4S1DC 3IVKA 1E2VA 3NA9H 1A25A 5AKVA 2F15A 3IDXL 1M1SA 3MR9A 1T22A 3RVUD 4C83A 1OEZW 3WEXB 4FQ2L 1WWBX 2EE6A 2HG0A 2CHZA 2AEIT 2JIXA 4XP9H 4JR9L 5DA4A 1EGJL 1Y1UA 2QKSA 5BVPH 2HTKC 4OM1L 5CGYD 3VXSA 2EXYD 2DWDA 4HV8B 2BP0B 3N1PC 4MNQB 1OZUA 5JHLA 5EBGA 4TOYH 1SN2A 4R4BB 1PZ2A 3ARFB 2ZUVA 2IANB 3AC0A 1X5IA 2PWFA 5BS0B 1IEAB 4JQXA 2DQDL 2DOCA 2Q8AL 3B1UA 5D8JH 3VVVA 5I30H 4UNTA 5EO1B 2YUWA 5FK9B 3F58L 4AITA 3RPIB 1N6UA 1QFPA 1KCRH 1M1XA 3A4FA 3CFQA 1M56B 4L1BA 1KCSH 3TEWA 1KB9K 4Z3GA 3BKJH 5DJCA 3VNZA 2JTYA 2HFTA 2FCBA 3IJYB 4Q97A 1N64L 1OP5H 2CM5A 4L37B 5JHDB 2C1OB 2QR0B 1HYSC 1HZHH 1UM6H 1BVKA 2VLJE 3VDBA 1LGVA 2K7QA 3CN1A 1H8NA 5HYJE 1KCWA 3W5MA 4HCGA 1UXMA 2JKRM 4ANKA 5B8CC 2CZNA 3DX0A 5DZJA 2XWTA 4Q6IC 4QIRA 3GEFA 4FXKA 2BCMA 1L0QA 4KQ3H 4HYTB 1BJ8A 4PRHD 4AJWA 5F7UA 3VWKA 1FYTA 2HTLC 4KMTH 5E6YA 5DLMH 2NW3A 2COQA 3UADA 3HJ0A 4BKTC 4X9YA 5J9PB 3CHRA 5D7JB 1QI4A 3CFDA 1NCCH 1W72B 4GIAA 2AEWA 3QULB 4ATTA 1CDGA 1GGIH 3OPUA 5FA4B 1P1ZA 2GTQA 4OB5H 1QW8A 4JN2B 4W9JC 1HHJA 4RSYA 2HTKD 2B4CL 1BQLH 3D09A 4H8WH 3M17A 1NOFA 5FX3A 4F92B 1ZIBA 2YZ1A 1DN2A 2XPYA 4HEME 1A6AA 2PF6A 5HYSG 2GJ6B 3MXWL 1A6WH 4HMDA 1A3ZA 3MV8A 1M7IB 2HN7B 2OQJB 3FB8A 4GRWB 4HGWA 5DJ6B 2BVQB 4HPOL 1L9QA 3OX8A 4ODWA 3D2UA 3FSOA 1E42A 1TOXA 4H20L 2P8PA 3QWRA 4YR6A 1LEKA 1YNTF 4ZMPA 1SVBA 2WINB 2DMHA 1L0YA 1RK1B 1ZV9A 1QFUL 5CSGA 5KVFE 3TA3A 4AUUA 5I1DB 5I16A 5H94A 4L4TD 1UACL 2V8MA 3HC0A 5DRWB 3UZQA 2VDOH 2VLKA 1YY9C 5I24A 5IIEB 3ZDXB 2O5XH 3BISA 2AJSL 4XMUA 4M4RB 1O6SB 2OMXB 4XOAA 1RVFL 4PLOB 1FO0L 3DPBB 2C26A 1E27A 4G8GE 1MCLA 2UUDH 5K9OB 3VGFA 2HT4C 4NQQA 5ETUB 1QMUA 2AF2A 5EUOE 4BFKA 4G5ZL 4XXDA 1G7PA 3QRBA 3KPSB 4HJUA 3MOBL 4AEIH 1MW3A 4DPBX 4RGNE 3MRCB 1TUPA 3QORB 2ICEB 3WNIA 4FCAA 2K6YA 4IBTA 5IBLC 2NY3C 2EDQA 4IRSB 4UOW1 4AE1A 3D33A 5IOPB 2DQ6A 3BDBA 5TE6H 5HYQB 2DD8H 3P4OA 4G9DB 1UCBH 2DLHA 2EXWC 4FHJA 4TKWA 3KPRD 4NSKA 5EH1A 3TOPA 2IDTA 2G3ZA 2LFEA 3FU3A 2JFCA 5BQ7B 1NAMH 2YFNA 5L0QC 3SDXF 1FP5A 5F3BA 1LO4H 3HC4H 3ZK0A 4MNGB 1TEFA 3BVVA 4NQCE 4B0MM 4PGJA 3BAYA 2CO6B 4DGIH 2VRQA 3GSNL 4LVEA 4FNLH 2ICCA 3VXTB 4WUKL 4PJIE 1WC7B 2DMKA 3HMXL 1CWVA 3AG4B 1A9EB 3O8XB 4ORGA 1F5WA 4FNTA 5I1AA 3DXAE 2NUTA 4J4PD 1ZLUK 1XSJA 1JFQH 3BKYL 4JDEB 5AAMC 3SDCA 1HNGA 1N8OE 2VR5A 3MJWA 4K8RL 2F53D 4DJMA 5DMKA 2ZYHA 3UTTD 3AJ7A 3FUMA 1F02I 2F0CA 3KYOA 4DGVH 1J8SA 4PJCA 2CH8A 3CD4A 4ZS6D 3UOAB 1B0GA 4WV1C 5H2BA 2OW6A 2ZX7A 5C2UB 3EFOA 5DCCA 1Q0YH 4R90L 2J5LC 3ZKXC 2Y0SA 2IC2A 1K85A 1D2PA 4Z7VE 1A6TB 2J4WH 3IFOA 4IKNA 4JO4L 4YFEA 4GIOA 3ZE0B 3VD9A 4MCYA 2DQCH 1X9RA 2Q8BL 1CI3M 1A6UH 3OJMB 4TL4A 1XD0A 3IGKA 4EI5B 1QTYT 3QT2A 2XG5B 5GZNC 5EU5B 5T33H 1DN0A 2WZPD 3LDBB 2XN9A 3SQBB 3T9WA 1QLFB 3DETC 1N3NB 1CDIA 1VCAA 5HY9B 2PP9A 2F5AL 4PV8A 1KPVB 4HULB 3UPRA 1U8KA 2EXWD 5I19L 1P84J 4MNQD 4HW6A 3O6ML 5LDSA 1KJ2L 3Q6GL 4XNBA 1JXGA 3ARFD 4GUPB 4NFBA 1ZEAH 2IAND 4GW5A 3PWPB 5GRVL 5ADPL 5BS0D 3L48A 5JDSB 5F8RC 1QBML 1TJIH 2OL3H 3B5HA 3H2PA 1B2YA 3P30L 4HISA 4OCXH 4R5VA 5EEZA 4JUTA 3RPBA 5CN3A 5KJ4A 1NJ9A 1N12A 3BAJA 3HNSH 2I69A 4MBRA 2AK4B 2N7BA 3E8VA 5DD5H 4HZLB 1RZKL 1ZANH 3S37L 1ZT4A 4ELKB 1USQA 5F0PB 3D05A 1QR1A 1J12A 2IPKA 2XC8A 2EYRB 5JHDD 1MEXL 4X8CA 3MJ7A 3GBNL 3C60A 4KTGA 4EIZC 4A04A 4XNDA 4M9OA 2X1OA 1MHPH 5DMJB 3RL1A 3RRQA 5F1SA 3UEZA 1TVHB 1BAFL 2WXQA 1BEYL 3RWEB 4RGMB 4X0KB 5JZ7C 2F6AA 4YJZL 4YSAA 1MF2H 2QQKH 4HIQA 4N2IA 1A6ZA 3GPSA 3C9NB 3DUUA 5LHDA 3FUNA 1QSFE 4JFQA 4R97B 1W6WA 3HHSB 2V33A 3EH1A 4XN1A 3MV9A 5GISL 4WRLA 2VERN 1VEMA 4N2NA 3W1ZA 2AI0H 5D7JD 1U0QA 4AYBA 4PJXE 5B3SB 2E9JA 4AYMC 4G1MA 1KYAA 1TMQA 2F08A 4LLVA 3PWLB 2E27H 2ZAGA 3TZVA 5J56B 4AW7A 5F72S 5TGBB 1G6RL 3L9EA 2JH2A 3EJUA 2GJ6D 3K46A 1U36A 4UDTA 2YN5A 5ANMA 2Q10A 1XB8A 1COBA 4MD0B 4QHNA 4W9IC 3ZDYE 1OGAB 3EH3B 5ESAA 4MNHB 4XPHH 1FNGA 1NGQH 4HC1H 2P5EE 3VJ6A 4APQC 1XF4A 3SKJL 5HYIA 2J43A 1VENA 5ACMA 5I1JH 2P3YA 2XHNA 3VXPB 1E8XA 4JVWA 4P9HC 1UH4A 2AZAA 5GGQL 3OM3B 3G04A 1D9KB 1NEZA 1F90L 3Q2LA 2FE0A 4Z7QB 2E3VA 4U1IB 1PG7W 4XBPB 2NY0B 4L3FA 4GXUM 1KF9B 2PABA 4Q9RH 1AJ7L 1SLWA 1GPOL 2CK2A 4XWOC 4KNSA 2N7SA 1KGCD 3BUDA 2P42B 1IBBA 2B3RA 3EDDA 4JY4B 1H9DA