2W88A

Plastocyanin variant with n-terminal methionine - open structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w88A00
1X9RA 2YAHA 3SBRA 5PAZA 3IEAA 2YQBA 1MDAA 3ZBMA 1NICA 3BVDB 3TBBA 1AS6A 3MBWB 3UABA 3X1FA 2YAFA 1X9UA 2XV0A 2VN3A 3H56A 3EH5B 1JZFA 7PAZA 2FQEA 1BAWA 3SQRA 4BXVA 1ZPUA 3ASNB 1M56B 3NT0A 4X4KA 2PPCA 3TU6A 3L45A 2X88A 4HCFA 1GY1A 3TASA 3AG4B 4YVUA 4YSQA 4RH4A 4BK5C 2AFNA 4DPAX 1NIEA 1CC3A 3QJUB 4AI7A 2IH9A 3ASOB 1JZIA 4PCYA 4UANA 5D4HA 4NAJA 2B08A 4KO9A 2I85A 1GW0A 2P80A 3PAZA 4KO6A 4ENZA 2I7SA 2GIMA 2BO0A 4DP5X 1BQKA 3CZUB 3S8FB 3S3CB 4JHVA 1HAWA 1HAUA 5AZUA 4CSZA 3EHBB 1L9OA 3FT0A 3GDCA 1NPJA 2J55A 5I6PA 3V9EA 1M9WA 4DPBX 2XWZA 1JXFA 1NIAA 2NRDA 1JZJA 2GB2A 3T6ZA 4YSDA 1AG0A 1E5ZA 2BZCA 5B7MA 2J56A 1NIFA 4DP1X 2IDFA 2BWIA 2XU9A 1SF5A 1L9QA 4NERA 3H4HA 1GS6X 1EHKB 1PZCA 1RCYA 3NSFA 2N0MA 1V55B 3N2JA 4E9WA 1I53A 4L0PB 1PLBA 1KBVA 1WA0X 1PY0A 3OM3B 4BWWA 1OOWA 1MZYA 2PLTA 1J5DA 4BXSV 1N68A 2XV3A 4WKXA 3T6XA 1AZUA 4YSCA 4UF7C 1ET5A 3S3BB 1SDDB 1XB8A 3ERXA 3U25A 2XX0A 2Q5BA 1TEGA 4FAAB 2VW4A 2AZAA 1GYCA 2OV0A 1NIBA 5I5MA 2BZ7A 2JFCA 1A4AA 1WA2X 4E9QA 5B7FA 2IH8A 1JZGA 4PAZA 3IN2A 3T9WA 2HX9A 1ASOA 1RKRA 3AG2B 3PPSA 3EH3B 3UGEA 5I28A 2FQDA 4AZUA 5LDUA 3D12B 4F2EA 4GP5B 4G70B 4E9TA 2PP8A 2YXVA 4QKTA 1UATA 3KW7A 4M4RB 2YAQA 2CUAA 2VSKB 3ABGA 2VW6A 2Y69B 3CDZB 1JOIA 1AQ8A 2FWLB 1PCSA 3V9CA 1JVLA 3FQYA 2IWKA 3WI9A 4BWUA 3NSCA 1PNCA 4F7KA 1AANA 2XX1A 4A66A 2DYRB 2IAAC 4NB7A 4BWTA 1OV8A 2EIMB 1DZ0A 3QJTB 1CYWA 3X1NA 2HLEB 3EH4B 4AKQA 2UXGA 5D4IA 2XYBA 3T6WA 3BQVA 2ZONA 1GR7A 2JXMA 3UACA 5I6NA 1OCZB 1SNRA 3DTUB 1A3ZA 1BXUA 3WKPA 2FTAA 4DPCX 1OCCB 1OE1A 2YAPA 4W1TA 1ZV2A 4HAKA 5B1BB 1CURA 1JZEA 3JT2A 4ZK8A 4E9XA 1AS8A 2PPEA 3FSVA 1J9SA 4AX3A 2AVFA 1GY2A 3EF4A 3ABKB 2IDTA 5I5JA 3QPKA 2MTAA 2FT8A 3FYEB 2BP8B 1IBYA 1SF3A 3AG3B 3UADA 1IUZA 2HZHA 3OQRA 1ET8A 4HIPA 1NPNA 1IC0A 1NIDA 1VLXA 2TSBA 5A7EA 1B3IA 2J57A 4A2EA 3QQXA 4YSOA 5I6OA 1GS7A 5EHFA 2UXVA 2CALA 1WS8A 2XUWA 3H4FA 3QJVB 2R7EB 5F7BA 3ZIYA 4HZ1A 4KNTA 2YARA 3NJJA 4DP0X 3SBQA 1QNIA 2YAMA 3QJRB 2VM3A 2UX7A 2GI0A 2CBPA 1SFHA 3IE9A 4YSSA 1ASQA 3WIAA 1WAEA 2PCYA 1ADWA 1AZNA 3WNJA 1PAZA 1E65A 3QJSB 3S3DB 2DWTA 1J9TA 4AKPA 1NWOA 2QPEB 3FYIB 3PLYA 1CUOA 4DP8X 4HHGA 4G72B 3JTBA 1PLCA 2ZOOA 4K9JA 3NJGA 3X1EA 2PP7A 3FU7B 4DP4X 3WKQA 1L9RA 1J5CA 2DV6A 1KGYE 4YSEA 2X87A 3T71A 4Q89A 3T6VA 6PCYA 1NWPA 2BP8A 3NP3A 1RZPA 1SHWA 3NJFA 4HCGA 4KOCA 1OF0A 4F2FA 1AACA 2FJSA 3DIVA 1A8ZA 2Q9OA 4YVNA 1NTDA 2MRYA 3UAAA 1BXAA 1CYXA 2E86A 1EZLA 1FA4A 2H3XC 1ID2A 2HX7A 4A2GA 2VM4A 2QDWA 1TU2A 1AOZA 1F56A 1RZQA 2XXGA 4FA7B 1KCBA 2LLNA 2R7EA 2PCFA 5I26A 5I6KA 1ZDQA 1QHQA 1QLEB 4EF3A 3ZDWA 5ANHA 3CVCA 4N8UA 3IN0A 4N4YB 3DKHA 1SHXA 3OMIB 1AZRA 3RYMA 2PPFA 3FU8A 5E9NA 4DP6X 4CSPA 1MZZA 2QDVA 4GYBA 1BYOA 1AZCA 1OE3A 3OMAB 1W6LA 1GS8A 1A4BA 1NINA 4GP4B 1ZDSA 2IDSA 3NSYA 4QLWA 2W88A 1XB3A 4G7RB 4HALA 1IBZA 2HRHA 4A2FA 3FU7A 2IWFA 1ZIAA 2YAOA 8PAZA 2CJ3A 1N70A 3CG8A 1AIZA 5B1JA 1SDDA 4E9SA 2OCCB 4YSPA 2QPDB 3OMNB 3X1BA 3G5WA 2YXWA 1E30A 2ZWNA 3AG1B 3NJHA 3PAVA 3ABMB 3FS9A 2DYSB 1V10A 1ETJA 2UXFA 3NYKA 2FNWA 1ILSA 1AZBA 3WNIA 3KW8A 2FQGA 2IWEA 5B3SB 1E5YA 1NZRA 1PZAA 2WSDA 2BWDA 3QJQB 3AY2A 3GYRA 4GXFA 2GBAA 2BP0B 2RACA 3CDZA 1BXVA 3C75A 2ZXWB 2CCWA 1FWXA 5FC9A 1R1CA 2VSMB 3S8GB 1PNDA 2FT6A 2H5UA 2Y1AA 3PXLA 3OD3A 4DP9X 3ABLB 2IDQA 2BHFA 2JKWA 1E67A 2B3IA 3NJNA 2VW7A 3NP4A 5AKRA 3IBOA 5TK2A 4E9YA 1KDIA 2FT7A 5B7EA 1IKOP 1KBWA 2BW4A 1ZIBA 3FSZA 1OCOB 2XV2A 3AZUA 3FPXA 1J9QA 1GSKA 2HXAA 4Q8BA 4YSTA 1M57B 1ASPA 1BEXA 2UXTA 1BQRA 2OJ1A 4YSRA 2VMJA 4KO5A 3HEIB 4GY4A 4KOBA 5F7AA 5I6MA 3AW5A 5I5IA 4MFHA 2GHZA 3NJKA 1OCRB 1PLAA 4TXVB 4DP2X 4W9ZA 3FSWA 1W8EA 1KV7A 1DYZA 2HRGA 4AKOA 4KO7A 3WG7B 5I6LA 5B1KA 1A65A 1L9SA 5TK4A 2WO3B 1KYAA 1TKWA 2PPAA 1XB6A 4BDVB 2XXFA 4HHWA 2CAKA 3TBCA 2EIKB 1WA1X 4A2HA 2HX8A 2WO2B 1FFTB 3UAEA 1AR1B 1WS7A 2GSMB 2YAEA 3MX0B 3N55A 5B1AB 1OE2A 1W6WA 2GC7C 4JHUA 3SBPA 4YSUA 1V54B 4JKNA 1KCWA 3X1GA 4E9RA 2TSAA 2BP0A 4P5RA 2P80D 5D4JA 6PAZA 7PCYA 1URIA 1JVOA 1JXDA 4YL4A 1JXGA 1AS7A 1NDTA 3HB3B 2AANA 4A67A 2IDUA 1SJMA 1KDJA 3GXUB 2H47C 2EILB 2W8CA 1AG6A 3NJIA 5B1JC 4G7QB 4A2DA 3FQ1A 1ILUA 2PPDA 3FQ2A 3PAUA 1MG2C 1A4CA 1PMYA 4G71B 4YSAA 2J5WA 4A68A 1T5KA 4DP7X 3NJMA 3CVDA 1SFDA 2XLLA 5AFAA 4P5SA 1ET7A 1BYPA 1JERA 2DWSA 2FQFA 3X2QB 1JZHA 5PCYA 3FPYA 2XVBA 2EIJB 1PZBA 4UAHA 4GP8B 2GC4C 2AZUA 3NJLA 1L9PA 3TA4D 1AAJA 4KNSA 3ZX1A 4BDVA 2EINB 2UX6A 2PP9A 4G7SB 4M3HA 4E9VA 5IY5B 2A3TA 1BQ5A 1J9RA 2BW5A 1XMEB 2QT6A 3PCYA 9PCYA 3FSAA 4HCIA 4KNUA 3CVBA 1PF3A 1TEFA 1HFUA 3NSDA 3FU9A 2I7OA 1L9TA 1MG3C 2DY2A 1YLBB 4WTQA
chains in the Genus database with same CATH superfamily
1WEJH 1H8LA 3QNZB 3WXWL 3KPSB 4LEEA 2X0UA 2J71A 4BGDA 4CA4A 3F64A 1BPVA 5AW4B 1P1ZB 1UM5L 4NN7B 1E0OB 3Q2VA 4YL9A 3L5XH 2D3VA 1AS6A 1K8DA 2YGVA 1UZ8A 2QGDA 4Y4HD 1GIGH 5AG9A 4R8WH 2FJUB 3U4BL 7PAZA 5E0FA 1RZJL 3HG2A 2FGWL 1JF1B 3CZGA 5DJDA 3OZLA 4ADGA 3SQRA 3E6FA 4QOKE 2B77A 5B38B 1ZPUA 2A99A 2JIXA 2QZ5A 4J6RL 2YHGA 2X88A 3K3QA 3W38A 2ZTBA 1T6WA 1HNFA 3ZL4L 1WD9A 1F02I 1NJ9A 3NCBB 3HHMA 3TO2B 4ZODA 3VD7A 4WUKL 2H1XA 5BS0A 1DEDA 1JPFA 3ZVVA 1TJHH 1UXWA 5C6PB 3BSGA 2BNUB 1BQLH 5T1MA 1KT2B 2H1PH 3F3HA 4P4KC 5FO2A 2RAMA 3ATAA 5MEQA 2R1YB 4ZI8A 4FQCL 5ICYA 4Q2ZB 3ES6B 3S3CB 2E7MA 4Z5RA 2A83B 5I82A 2WJ5A 4FYSA 3MXWL 4WSGA 2CHXA 1SMAA 3GDCA 1W15A 1DBAH 4MCYB 2QVTA 3L7EB 4EI5D 4RVBA 2GIXA 5C0GB 1XO8A 3QWNA 2X2JA 2XWZA 4CMMA 3D9AH 4KKZA 5K59F 3B9KB 3TWCH 3UO1H 4XHQA 4P49A 1CJYA 4IBLT 3N44B 4NZJA 1XGRB 4Q0XL 4JJOA 5F7WC 5DYOA 2LU4A 5DK0A 4X6DE 4EZLA 4KKAC 4GUQA 3ZT7A 3MLWH 2ID5A 4JUTA 1ZT1B 2P26A 1TZAA 1V55B 1S7RA 3E1F1 3NFNA 4L0PB 3QEQB 2FB4L 5ECGA 2I25N 3QPQD 3OKMB 1EZSA 4JZJA 1Q9OA 3GRWH 1QP1A 4PV9A 3PWPA 3Q5TA 4N0UA 1HIMH 3BGMA 4MXQC 1OOAA 3IBEA 1YPZB 4N85A 5D1QB 1IIIA 3MV9D 4LPUA 1QSFB 2E7LA 3ZY7A 2EICA 3E9TA 1JNLH 3B2PA 5FO9A 1Y18B 2E8ZA 1MNUH 2R1WA 1BAFH 1FH5H 1GHFH 1MCLA 2WYZA 2YD7A 3OBAA 4BQ8A 4YHYB 3AXHA 5DUPH 4XMPH 3K5SA 4KPHL 1Y6NR 4KVPA 1QOKA 1U8JA 4ZJ9A 1HOCA 2C3WA 1JMZA 3VGGA 2CO1A 1P53A 1J1PH 4MYPA 5C7XL 1X5ZA 2AK4A 4WK4B 3WDJA 4CDHA 1G6RA 2Y22A 1K4CA 2OL3A 1SUJA 4PS4H 3L7FB 1NGZB 4YNYB 2DTMH 2APFA 5DJ8B 4ENEC 1JOIA 4ZMAT 4WLCA 3GD1C 1ZT7A 3H54A 4UTAH 1U8NA 3FL7A 2EZ0C 2X89A 3KCPA 3DURB 4N8PA 4PJ7E 1Q1JL 5DK3A 4PIBA 1JK8B 5DR5H 3RY5A 1LDSA 2OZ4A 1OT4A 4LAJH 4LCCA 5J4MA 1UACH 3BYYA 4P4KD 2GBUA 5DEJA 3RFZC 4BWTA 2ZPKH 5FR3A 3A4FA 5EOQL 3GS0A 3PHQA 4FP8H 1HZKA 3BZFA 3X1NA 2ZF8A 3GTVA 4B9CA 2G9KA 5DS8A 1OP5H 1AQDB 2IGFH 3IS0X 2BH0A 3L1FA 1A64A 4L5FE 3K46A 1XAUA 1PQZB 4DGYH 5D7SH 2BSRB 4NZUL 3MO1B 4PMFA 2DH2A 3CFNA 3UGXA 1WZ1L 1LO3L 3ZKNC 4APQB 3UC2A 2UZIH 2WSPA 3HG4A 4HKJA 1X4XA 1CD0A 4JY4B 3CZEA 2GITB 4H25B 4XAKE 2JKNA 1XZ0A 3J27A 1OTSC 1HS6A 2BSSB 2ICWA 3NDYE 5F6HI 4WI8A 1T4KB 3X3FH 4JY6A 4FQIH 4JFVA 3HMXA 1JCKA 4YMPA 4K23L 4UOW0 2HVJA 4NZFA 2CK0H 2N59A 2MTAA 4KX9A 3TIDA 4Z78B 3ESOA 4MXVF 4OLUH 5LCVL 5L6YH 1RIVL 1IUZA 2GTQA 3QEGH 4MXQD 1X4ZA 2VERA 5GIRA 4ABWA 3VX0A 2EDQA 4JGUA 2Q6WA 4X2UA 3RWJB 4BQ6A 5GJTH 4OBRA 5LGKA 4Z7VF 5T3XL 3D06A 1KENH 1B3IA 2F7QA 3S48A 1JVKA 2BRRH 3OAZH 3U9UB 3MBEB 1KIPB 2AXGB 1FYTE 3CX5J 2VDLB 4YWGH 4LOEA 4DQOL 5I6OA 3ECQA 1X7QB 3DUUB 4IU3B 2BNRD 2E27H 1Q9KB 2VSCA 3GSRA 3ME0A 3CTTA 2VM3A 4MMYA 2CBPA 1MLCA 2GAZA 3TZVD 3BP7A 4Y1AD 1YYLL 1ZHLA 3GZQA 4ZFFB 3BN9D 4MMZC 3UZEA 5HGHA 1KTLB 4S0HA 3VFSA 5T33H 5SWZD 3SDDC 3BFOA 1N8ZB 3AUVA 5IVXB 4CBPA 1RULH 1T66D 2EZ0D 4Q58C 1E65A 4F7CA 1NWOA 1WBXA 4QRQA 4BE5A 4KXCA 1R47A 3RWFA 1BZ9B 3JTBA 5IJKA 5I1HL 1BDYA 1HXYB 2EKSB 4M5ZL 1OCWH 4YSEA 1F6AB 1YNTA 1NDGB 3T71A 4LCYA 5GZNA 2JJSC 4OFYD 4EN2A 4U1LB 5SV3A 3QSKB 1S5HB 2GTWB 3QUXB 1SHWA 3K91A 4KOCA 3I50H 3PL6D 1WIUA 5TQ2L 4F20A 1KNOA 3EDEA 4NRZA 4DEPC 2QZQA 3DVFA 2FH6A 1KMGA 1PSKH 4L48A 2XYCA 4IBYA 5K59E 4JBSA 1UOWA 2PW1A 1IFRA 2HX7A 1OTSD 1P4UA 1D5MB 5CR1A 4YDJB 4L29A 1S6NA 2B2XL 3DBXB 3ZUNC 3QCUH 3L6FA 5DJXA 3CFIC 2FJGA 2FHBA 4RMBA 2OMBA 4OUOA 2MNWA 3G5YA 2CJTA 2NY0C 1J11A 2ZWSA 5JHDE 4Y5XC 4QGTA 5C09B 2LLLA 1JD9A 1QFWI 3EOAA 4BK8A 3UYPB 2AHIA 4MNHB 3PG2A 4HV8B 2OMYA 3HI5H 1HOEA 4FNLL 5HY9B 3T04D 1OLLA 3GWJA 2ADFH 1KYFA 1PDKB 3L3KB 4J5VA 4OZIB 1M3JA 1FLTX 3LKOB 3LH2L 3SYQA 1CF1A 1BJ1J 3MRFB 3QNYB 3TNNB 1UUNA 2VIRA 2JJTC 3RU8L 3H42L 2W88A 3ATBA 1YUKB 4IRSA 3RI5K 3VXSA 4F37K 4JPIA 2KLRA 3RIKA 4KWUA 4B9PA 2ZSVA 5A2KH 1EHXA 2X4NB 4P2RE 1IAKB 3KBHE 4YSPA 3VXUE 4TNGA 5FUCE 3THML 3L3JB 3Q1SL 1KWGA 1SEQH 1LMKA 3EBGA 3RY4A 3UTTD 1L0QA 1WFOA 3FUDA 3MNMA 4KKPA 3N85H 1P84J 3NJHA 3VB8A 3QJHB 1FH2A 4MJ6B 4F93B 4O02L 3DXAA 1EX0A 4XX5A 3LV3B 3TPUB 4ZZKA 3VA2C 1W0WA 2DLIA 4PJCB 5CBAB 1ND0A 2CA3A 4TUJA 2V3EA 3FT2A 4Y4KC 4ZX3A 3VYPA 1I1FA 5F3HA 1SYVB 1NSNL 4E5XA 4ONHA 4ZUSA 1AD9B 4QTIH 1JFHA 3DK0A 1KCVL 4RISH 2XQBL 1PG7W 2FECL 2Y07H 5IESL 1M7DB 2WLYA 1MCDA 2DQCH 3AS2A 1U2HA 3QFJA 4FJYA 4U1HB 2EC8A 2FT6A 2LGNA 3HG3A 4F7TB 2QVFB 3AAZB 3NEXA 3OD3A 5K1NA 5EEUA 3NJNA 2ENJA 4UV4L 4L5FL 1D2OA 4RGND 2Z31C 2ZX5A 4OJFL 1I8KA 4N3UA 4Y4FD 4FG6C 4X6BA 1BVNP 3R0MA 4I48A 4YHIA 3VM5A 4WI5A 2Z1PA 3U83A 1BOGA 1ZS8A 1YEKH 4UTCA 2YJQA 3E8VA 4DEUA 4GY4A 3LKPB 4DESA 4CKQA 3QNFA 4MFHA 1LO4H 1MFMA 3D25B 3QFGA 5IQ9B 5MEOB 1I9RH 1W8EA 3QQ4B 1S7WB 4OZHA 3WFDH 2YMXH 1ZGLA 5E5LA 5B1KA 2LT9A 1YNKL 4NXSA 5AB2A 5F1NB 4ZXBC 3UTSB 2BCKA 3RX8A 4JFDD 1PIGA 2WQSA 2OMWA 3PJLA 1KYAA 4WWKA 4MXVE 4YDMA 1NGXA 3JVGA 5HHPB 5EF0A 3ZMRA 4BDVB 4CW1B 4AZ8A 2IANA 4FFWC 1ZHBA 1E9QA 4L1DA 3BUIA 1YEGH 4X98A 4G1EA 4CILA 5I1IH 2XBZA 5C71A 4Z7VE 2GC7C 4G43B 3QCTH 1IGML 3LZFL 4YXHL 4MAUL 4R90H 3M1BB 1CQKA 1RMFL 2DTSA 4P5RA 1ZGLM 5EOTA 2HCZX 3V4VL 3INUH 1HCYA 3WTXA 3DO3A 1CXKA 5AW7B 3SCMC 4KKCC 2VN5A 4MNQA 2YA2A 1CQYA 1ZLEA 2EEAA 5F9DC 2ZWZA 3C8KB 3BPCB 1A1NB 5CHNA 3EJUA 4NM8L 3KPMA 4HJUA 1AG6A 4AV4A 4RWYL 2A6IB 4JFXB 3KZ8A 3QDJB 2P47B 3M1CA 4EOWL 4LCWE 4X8JB 3P3UA 4X42A 5ICXA 4R7DB 4RFOL 1VADB 2VDMB 3EF7A 4KHTH 4YPJA 4PLJC 3TBWB 4UBDD 4L8BA 2WXPA 3QI9C 5J1AB 2F8XC 4AK1A 3WLBB 3EO1B 2AAAA 2BS71 2VMDA 5AEAA 4AV0A 4AYID 3RVXC 1DVYA 2EIJB 3C5ZC 4HKBA 1UA6L 3S6CA 2B3RA 1R24B 4AJVA 1KJVB 3NJLA 4PJ9A 2Q0ZX 1NLDH 4G5ZH 4FQ1H 2QL1A 2X4PB 3GLZA 1KIQA 4JG0L 3W5NA 5FUCC 2IBZX 3RURA 1YEJL 4AMKH 3AACA 5C92A 1Q9WB 5AYTA 1S7UB 2VSDA 2ZWYA 4XNBA 3CVIH 1QR1A 3MOAL 4LVOC 3HLAB 4JR9L 4XN7A 3GUTB 1OVZA 3A67H 5DUBA 5JIMA 2C1PB 4PVLA 2VDOH 4HSAC 1TPXB 2C3VB 3AWFA 3UROR 2V6HA 2ENPA 2WIIA 4V33A 1B9ZA 1CLYL 1FFPA 1YLBB 3F7PC 3HC4H 5LAXB 3F6LA 5IMKB 5L2KE 3FSOA 1D9KC 3ETBF 3KS0J 4NN6B 3U2SB 3BLBA 4JAMA 1KLUB 5CINL 3IAGC 3O2WL 4LF3B 5HVWA 2ZAIA 5BVJB 3SPCA 4TNWK 4G6ML 1DJGA 4I3SH 5ITBH 1X9UA 4ZUUA 4AENA 1P9MC 2AV1A 3AFLA 4AGMA 5KVEE 1TVHB 4HJJL 1WCBA 4WEEA 4FFZA 1BQSA 4K5MA 4OCWL 3I6LE 4OV5B 2QSCH 2EDHA 3ASNB 3WTTA 3GSQB 4TLSA 1FL5B 3V0DA 1ZA3A 3VI3B 4YSQA 1EGJA 4RH4A 1ETZB 1WTLA 4BKLA 1AR1D 2XACC 3KVQA 1L3NA 5F7EL 1N0XL 3WEOA 3KYMB 3V4PH 2J88H 1JZIA 4PRPB 3WHXA 5KBLA 3NIDE 1T20A 3SCMD 3NAAL 2VDQH 4XCCH 4ZMQA 3MXVL 1AXTH 4ZS7H 2Q3ZA 4TQEL 3VFRA 4NQTA 4M6AA 4LFHG 3HB3D 1HAUA 5AZUA 1F1GA 3EHBB 4GG8B 5ALCH 3S96B 4FMVA 4HBQA 4L8CB 3WNOA 5GJSL 4D0CA 2ORBL 5DRZA 5DURD 4P2CG 2BNQD 1E43A 5D6CA 2VUYA 4I0CC 4YUEL 2C7UB 4PLJD 4G6FD 1HILB 1XCTB 3GJFK 3H85A 4FTDA 5DRNB 1ECZA 3RY6C 1VKXA 3K1KC 1SF5A 1L9QA 1XIWB 4PYHA 4UQ3B 3IVKA 1KN2H 3D39E 1VZGA 3K8LA 3ALPA 3NSFA 2QKIC 1RCYA 4MJIA 4HIIB 3WY4A 4CADA 1TNNA 5C0CD 2NLJA 1LDPH 1TTFA 3DTDA 1OW0C 4WTXA 4GKLA 4E9LA 5J13B 1PLBA 2HP4A 3IXTB 1KBVA 5DMKA 3FRUA 4MHHG 1YYCA 2Y6TE 3RGVA 1A47A 4YDIL 3RNKA 3V5DB 3QO1B 4WW2A 2OMXA 1CGTA 1SXCA 3QJFB 1SBSH 2CIIB 4NZDA 2ZX8A 5ERWB 3MA9L 3D69B 3C12A 4UF7C 3SQOH 2NNFA 3IDNA 5IUSA 4HJEA 5IJCC 2G5UA 4KDTC 3TC9A 4AUJA 3D2TA 2I07A 4FZEH 3DX0A 2XG5A 1WE5A 4QEGA 2VW4A 2BOBB 4JPWL 5KVGE 5E08H 2OV0A 4XC3L 2HLAA 3G6JA 1DLFL 2GT9B 3QW9A 5AWNL 3U4EB 5KS9F 1QI4A 1D9KD 4NAMA 1L7TL 2PYEA 4R7LA 3KH4A 4PR5A 5FDWA 2ZP9A 3OXRB 3I74A 3Q8CA 4MJ5A 4Y19E 1U6AH 2OSWA 1BBJB 4WFHE 4AZUA 3DPDA 4QXUH 3D12B 2FD6H 3OPUA 3PQYB 3LZQA 2YXVA 2ZKHL 2W9EH 4UQCA 1EWHA 4LEXL 4Z7NB 3Q6FA 4Z7WF 1KEML 2IWKA 1QSEE 5ABDE 1CTOA 2ENSA 1HDMA 4LEOA 1BZOA 5ESAB 5JORA 1AANA 3FU0A 2FDBP 5IQNA 4MTMA 1PEZA 3S34L 2PR9A 3FUIA 1XXFC 2R69H 3QUZD 1OTUC 2Y5EA 3HC0B 4ONGL 1EV2E 1DFBH 4M7ZB 4B9YA 1IBHA 2X41A 1AGBB 3HE7A 2OMTA 4OI8A 1NC4A 3K74B 4K7PH 2W07B 2ODHA 2UXGA 4AKQA 4LL9A 3OL2A 3SOBH 4KZ0A 4ZW5A 1OL0A 4HEPG 2X9WA 2YUVA 3G6DH 3FQWA 2D2OA 3SJVE 1J05A 1YEIH 4QRRE 1M05B 4C54A 5BPPA 4KXZH 4ZUVA 4EXPX 1EA9C 4DPCX 1NGPH 3OHXA 2OW6A 3PWLA 3GZOA 3HMWH 1UKSA 2YAPA 1I7TA 1U8IB 1Z5LB 4JRXB 4ACTA 2DS4A 1OGAE 1ETB1 2X2YA 4ZPTB 4J3OG 4NPJA 3PJSB 3RIFF 3H9HB 4R4BB 2YD1A 1E27A 2X7LA 2Y5TB 2CDGB 3U6XA 2BP8B 2CBOA 4Y5VA 4QRUB 5BUPA 4IIQB 4LVHB 1A1OA 2IH3B 3D09A 1THAA 2GSGB 5DA4A 3OSKA 1A2YA 4XP4L 1U3JA 5EH1A 5C2UB 4G8GA 2FWOA 4PD4J 2UZPA 4YSOA 3WHE0 4AW7A 3AQZA 5E4EC 5EHFA 3QQ9D 3FT4B 4LCWD 5E2TH 1EVTC 1WS8A 4ONFL 4PV8A 4P9MH 1X9LA 1TU2B 4PJHF 4DCQA 4M61B 1B0IA 3EYVA 3TFKC 4OZFG 1JYXA 1S5IL 3D85B 1RUML 4JB9H 1QNZL 4POZC 2OMZA 2K9FB 1NFDF 4KXBA 3RVTC 1O0VA 3TJPA 2QVKA 2AJSL 4D9QE 3ZMNA 5ENWB 5CJ8A 3RJQB 4C4KO 5KVEL 1ZWIB 4L4TA 3E2HB 1O6VA 5HYIA 1R46A 2O5XL 1OB1A 1SZNA 5GGUB 1VGKB 1Z32X 2P9RA 3H9SD 3ZHNA 2GY5A 2P24A 1SEBA 3AC0A 2JK5B 3FYIB 4UMGA 5HI5D 3G7TA 3TF4A 4QXGH 2ITFA 4K9JA 1A7BA 3Q3GB 1OTUD 4PREB 2HWZH 3OAWA 4KTDH 5DHEA 1KGYE 2QELA 2G3ZA 4M7JL 2IBZY 3Q5YA 4ODSL 5FO7A 5L2KD 4XHJC 1MXDA 3MV01 4ZMZA 4MQ7A 1MRDL 1WDAA 4YBHA 3A6CH 3N91A 3T8MA 4DK3A 1DVTA 5AVSB 4MS6A 5SX4I 3SPVA 1P7QA 2JCWA 1G6VK 1OF0A 2RFXA 2WCPA 2Q8AL 2JI2A 3KPRA 1CK0L 3D18A 3LXCA 5MI0C 4FFZH 2R27A 5MENA 4WEBL 5DQDL 3SDXE 3WOVA 3ZXAC 2NY6D 1COBA 1A4JB 3M1OA 3I6LD 3FRPB 2KZBA 5IBTL 3KMDA 1S78C 4U2YA 4KK8D 3OKKB 5IB5B 5IEHB 4N2DA 2LLNA 2GUOA 2CDEB 4D3CL 2UY6A 2VLJA 3UAJA 4G5AA 2CA4A 2RALA 1IKFH 2FGZA 1TO5A 1CXEA 3V6ZA 4HK0B 3B9DA 4DT2A 5DU7A 3VAEA 5A43C 2ZUQB 2D0GA 1O7VA 5FHBH 3AGVA 5A6MA 2QFRA 4JLRA 1AZCA 3OR7B 5AW5B 3OMAB 5IK3B 3ZE2E 1FZMA 1FL3B 2WVUA 1A4BA 5TTRA 2QHLA 5KVGL 2KZWA 1Q0XH 5JPNB 2F54B 2E4TA 1KCUL 3GMPB 3JV0A 3QS2A 1JSYA 4XI5D 4Z9KB 5F0LB 3WSQL 1TYEB 1ONQA 2CJ3A 3H3BC 5F71A 1AIZA 2Z64C 5T8IA 4CVWA 4TOYH 5KS9E 4FKKA 4Y16D 2OCCB 3MLZH 4LRIA 2QPDB 4FLQA 1D7FA 1ACYL 1E8XA 4MD5B 4EVNA 4GKNA 2GJ6A 2L7UA 3NCMA 4GMSH 2NUTB 1W72A 4F7MB 2GSIB 2M1KA 3KCWA 2K9UA 3MOBL 4XE5B 3NYKA 3MRQB 5SX5H 1LEGB 3SY6A 1KG0A 1BX2A 4NWTL 3NN8B 2AKRA 4XGZA 3UAFA 4AQ1A 3MLYH 2FSEA 4HKZB 4Z7WE 5EIIB 1NZRA 4KTGA 2VDPL 2VDKH 3A4AA 4IOFD 3CN4A 4S0SD 3LHAA 4HETA 2Z8VC 1FV1A 4IHOA 2O5ZH 3IKCA 3QXUA 2IQ9L 4B9IA 3T09A 1KB5A 3S8GB 1E2WA 1TQBC 1ZOXA 2H5UA 2HUHA 5IB2B 3BQUB 3DV6B 1H8NA 5KJRH 4UDTB 2B3IA 4JKLA 3CBKB 1PD0A 2D7PA 2XN9B 3HE6B 2JCCB 4FYRA 4UV7L 1IKOP 4WFHD 1O75A 1D7BA 2Y1ZA 2OP4H 4NXKA 2OX5B 32C2A 3TVMD 4NUGL 4FXGA 1UB5A 4OF6A 4Q8BA 4IKIA 1M57B 1W9XA 1TTBA 1G9MC 2F15A 3CXDH 3VQLA 2OJ1A 4Q6IC 5GHWL 3O3DB 5B8CA 3TCLA 5F3BA 3T0AA 2FH8A 5FM4A 3ZDZF 3VXMB 4POYA 3UMTA 1ZEAL 3RWGB 3L4XA 4B6ZA 1L0XA 2YPVL 3QZPA 3LZOA 2WTRB 4OM1H 1OARH 2HN7A 3DV4B 4XB7A 3UTPD 3WG7B 3WY3A 1Y7VA 4F9LC 4XCNB 1MCPL 3W0WA 2VAAA 2KDYA 2CU9A 1S3RA 1D5XA 2LVCA 5IQ7H 3AQXA 5BV7B 2I9LB 3JVFC 5IVOA 3TBYA 3ZMEA 2Z34A 3VCLB 3RHWK 2RJMA 3MYZA 3UZVA 4B53A 5BUGA 2WO2B 3NCYS 4WW1A 4Z0BL 4JQVA 3ARGB 1KCWA 3CU1A 4QRRD 4S1QH 4KK5C 3ROLA 3GF8A 2I27N 3BEVB 3H7BB 5MERA 4KAQL 5CGYC 4LSQH 3KPOA 4PJHE 4Z1PA 1FUNA 5FHAL 5AAMC 2NQ3A 1MAKA 3RLSA 1X5FA 3VO0A 1MHEA 4KJPC 5E8PB 3ARBB 5EZOL 3ISWA 4FLHA 1PL3A 1NFDE 1PY4A 3Q6GL 3SDCA 5ISZD 2OYLA 3CXHK 3GQFA 4DK6A 1CGSH 2VXQA 1FGVL 5MEPB 3SY0B 1WAPA 2W8CA 1X5XA 5E4IA 4PJFA 3SGKA 2VQ1A 4JPVL 4XXCA 3VUAA 1BD2E 1U8HB 3FQ2A 2BSTB 4WFGE 4Y1AB 5KSAB 3S4SG 4U33A 2VL5B 1F3JB 2UYLB 3CE1A 3OB0K 4TM9A 4FMKA 5HDOA 2FBJH 2K4AA 3FTVA 2XWEA 4N2BA 3RNQA 4WDIB 2PTTA 1F4XL 4LFHD 3QG7L 2V2XB 5FYJD 1C1EH 4PJEB 2WWKT 3QDGB 4MD0A 4OJEH 3VSQA 1U8MA 4A63A 2A9MH 2R2EA 1L9PA 3D3VA 4XNXL 4Y1TA 1AAJA 2FIKA 4RFNC 4WJKB 2XFXB 1DHKA 5MHSE 2UX6A 1CGWA 3ARDC 4HEME 1JWSA 3CN0A 4EJ1C 5E2UH 5DJ2A 1RUPL 2BS9A 4F33B 3IDJB 5F7NC 3BRFA 1JHLH 1CXHA 5FW8A 2J4WH 3BPLB 3KGTA 1MOEA 2IPKB 4IRZA 2NXYC 4HJGB 3L3GB 5TE6L 1HEZB 3RPKA 1ES0A 2DQGL 4KVNL 3OXSB 3DX1A 4UQ2B 2K4WA 4XTRC 5KW9H 1GCYA 1L9TA 4RSYA 3S7GA 4NQCA 3QIBA 4M1DL 4WNQA 2CM5A 2FO8A 1NAKL 3DWTA 1VDGA 4OF5A 1B0WA 3DHMA 3LCYA 4ZUWB 5D6DC 3V4UH 5HPMA 1JWMB 1KZQA 4XCEA 1XEUA 4OCRH 4HOMA 4AT6B 1HQRB 3V10A 2P4AB 2FSDA 4HXBH 3X1FA 2XV0A 4PS3A 4H5SB 4GIOA 1U9KA 4IJ3C 4IU2B 4K7PY 2AXFB 4QXVA 4KVCL 4L4VA 3HG5A 2PPCA 2VNCA 3DUSB 1ZLUH 1ZLWK 3U46B 3T6QC 1SJEB 3KPNB 4Y7MA 3C08L 3L1EA 1ORQA 4KK5D 5GS2D 3HG1B 4GUOA 3SDAA 4NFDA 1NGYA 1S7XB 4M43L 1ESOA 3OKDB 3HZVA 3CC5A 3ESNA 4QRTB 5BMFH 2EIZA 4KJPD 1IBDA 3K6DA 3QXDA 1ML0A 3P77A 5E8EA 3ZHKA 3S8FB 2PO6C 4JRYE 3ULVH 5AL0A 2Q2EB 4A6YB 1I7UB 4CSZA 3L8QA 3UYOD 1CFVH 1VIWA 5D7JD 3IGFA 4I0PC 4N28A 3K6SB 1ZTMA 1PZSA 1M9WA 2MOGA 3UCQA 3U0TB 1Q72L 4XR8C 3CMOH 4N1HB 5FX3A 1YEEH 1V7NH 5ADOL 4F9PA 1CE1L 3QVAA 2EXYC 2ICEA 3BEWB 3CMGA 5C0IB 3VSTA 4DW2H 2JB5H 4XXWA 3RX9A 3SDYH 5JQHC 2ZOUA 3TIEB 2BWIA 4G8EB 5DD1L 3EUDA 4TTDD 2QHRH 3GIZH 2BM3A 3MRCB 2DYPD 4GBXC 4LLQB 4XO9A 1BFVL 1QBMH 2X4UA 1TJXA 2JKIS 4OCSH 3IK2A 4C56E 1CFQA 5I1EH 1E9OB 4G9FD 1PY0A 3SO3B 4W6YB 4XPGH 4GAYB 3HZ3A 1CLZL 4X9YA 1J0HA 4TSBL 4JZNA 3MV7D 2WVTA 1K2DB 3AS0A 4UUJB 5L8JB 4XPAL 1KXHA 2IFFH 1E4XI 1NFIA 4U3SB 5C08B 5CGTA 1EIBA 2P8LA 4PCKA 4J3OD 2VO5A 4HZLA 2CUHA 3AU1B 4N2KA 2G75B 2D0HA 1WA2X 3RTQD 3LDBC 3ZDZE 2XPGA 5JHLH 3BGFC 3T3MF 2N56A 1FNFA 5CILL 3QZWA 1IC5L 1TMCB 2WGNB 3AG2B 3O6FC 5EU6B 3DO4A 1J1OH 3X14B 1QRNB 1KB5H 3WY1A 1O9VA 2NZIA 4OT1H 3LRLA 4XPHH 4R2GD 1FNGA 4QKTA 4NKDB 5I0VA 2EAEA 3ILEA 1KJ2B 2OJEA 3CDGB 3P4MA 5ICZB 3QAZC 1A6TA 2H1PL 3QT2A 3IDMB 3WXVL 2BHUA 4IK7A 3WI9A 4IGBD 1PNCA 4CJ0A 4AY0A 3BWZA 4BFIB 1HTYA 3TXAA 1I31A 3BZEA 15C8L 5L0QB 1DBAL 4AMXA 5JYLA 1IGJA 2R1XB 1A3LH 4TLTA 5GSRA 5E70A 3TLRA 5G4MA 4JMXA 2VERN 2B15A 5DMGC 1CL7H 1H3XA 2BHZA 3IETA 1INQB 3AABA 3D9AL 3UO1L 4GIAA 2A6DB 3K7UA 1ZTXH 2Q2LA 1MF2H 2XWDA 2E9BA 4I0PD 4I85A 5DVMA 5BS0E 4AEHL 3AREB 4ICWA 1XR9A 4LZKA 4Y2DB 2CIKB 4ZAKB 4NKOA 1TZOA 4Y2OA 2APBA 3MLWL 1YNTF 1RJLB 2ZZUT 1A3ZA 3HHSA 3O9WD 4OGYH 2FHFA 4NKMA 3QWRA 5DMIL 4O51B 1ZXKA 1BJ8A 4P9HC 3GRWL 1CFBA 3TBSB 4LU5L 1UJ3A 2ALWA 2OM5A 3FOMB 3JT2A 2F5AL 5JNYB 3LS5L 1CT8A 2OSXA 4AVKA 2VKWA 4GFXA 2AVFA 5EC1B 1QFUL 3PV7A 1EH9A 2IDTA 5LNEA 3QORA 3KHQA 3ULUL 3PABA 3GINA 2Z93B 1YSOA 4MCZB 1U8CA 3TH4T 3V0JA 2HZHA 2WWMC 2VXQH 5ETUB 3VG0H 3OLDA 3WMQA 3FFCB 1BAFL 1GHFL 3KLAB 2VITB 2HTKD 1NIDA 2TSBA 1ZAGA 5DUPL 3UDWA 1P4IH 4Z76A 1WBYB 1JMXA 3RDTC 1T2QH 3CLWA 2PXYD 4OD2A 4ELMA 1PBYA 1H3UA 4PH8A 1OF2B 1J1PL 5CR8A 2NY1C 2DWEB 4WFGD 1HL4A 4N22A 3FB6A 4M5YL 5JPMB 4G1MB 4YXKL 3PWPE 2VLKA 4PS4L 1KPUB 1DQML 1I1AA 4N0UE 1CBVH 4RQQB 2BHYA 4DO6A 1BIIB 1UWFA 2DWDB 2R59A 4UWQB 1FFNA 2A1WL 4A7QA 2XRAL 4B7LA 4S1RH 4IKKA 2NYYD 3MR9A 5FM8A 3QNZA 4PCTA 3ULUD 1ODUA 2V5RA 3HRZB 3HUJF 2KHAA 4RMVA 3STLA 2WGXA 1PS3A 1UACL 2OTPA 4X9GA 2YD2A 2P5PA 2IF7A 4P9HL 4U05A 5TJWK 2ZPKL 4GS7C 3DX6B 1A0QL 1OAZH 2V5YA 1MCKA 5EEVA 1I8LC 3WS3B 1NCAH 2O5NA 4ZFGH 2NX5B 1KELH 4QIRA 4PJGB 1JF1A 1WAAA 3DOIA 4AL8L 2L3BA 3X1EA 4FDWA 2AK4E 4DP4X 1J5CA 3APFA 1WT5A 3PGCB 4UT6H 1RUQL 4OAWB 4KMTH 5L9DH 1CS6A 4FN0A 4WWPA 3QH3B 2BCMA 3TO2A 1R5WB 2YEZB 2UZIL 5I18H 3HC3L 2X09A 1HKLH 1HWGB 1NCDL 4PW4A 3SN6N 2IBBA 4M93B 2Y6SC 1KT2A 1K5WA 2C4FU 4F15B 2HFTA 4K2UL 2R1YA 5F72S 4BBWA 4YC2B 1CDGA 4YVNA 2B4CH 3ES6A 1DVQA 3KL3A 4DO4A 4E2OA 2WAHA 4F8QA 5DJCB 2A83A 1JV5B 1PLGH 3BFWA 3H6JA 3QRGL 2AJUH 3P11H 4JL1A 4MCYA 4OKVA 3L7EA 4NT6B 4ZSOB 4EZMA 4LDEB 2BNQB 1AOZA 4WHYH 2VDNH 4APXB 2Z9TA 3L4ZA 4FFVD 3VFPB 3BISA 1IE4A 1U8LB 2FX7H 3CVHA 4OLWH 1P0SE 5E8DL 4OFDA 1KENL 5EU3B 4ZG1A 4D8PA 4FGMA 4Y9BA 2D2CC 5KBDA 5I17A 1RQ5A 1R75A 3SPJA 4YWGL 4F5CA 4E0RB 5FW7A 1TR7A 4JRYD 1ZT1A 2HT2D 3LKRA 1BVLB 2QDVA 4B50A 5KTEL 4LLDA 4U6HB 2BFVL 2K78A 1PYWA 4WU7B 2EDKA 3OKMA 5J9PB 1GS8A 3RVVC 1A7PL 2PCXA 3F7VB 1LO2H 3SYOA 4M62L 1W2KT 2ROYA 4XCFL 2DLTA 1IBZA 4WO4B 1KJMB 3FU7A 1U8OA 1V7ML 1BGXL 3TYGH 4E41B 5DJAA 4OFKA 3T3ME 1N7ML 5LXGH 5EU7E 5LWYH 1RULL 3G5WA 3K6NA 2ZOTA 5AW8B 4CVXB 2VXSL 2CH8A 4Y5YB 4GG6F 5CJQH 1NGQH 4C56D 2VCOA 3Q2WA 4YBQD 1SY6H 1V10A 1T04A 5CN1A 1HK6A 3HNTH 4ZW8A 5F6HJ 1OM3H 3UPRB 1J8HD 1BOYA 4JO2H 2IWEA 2V4LA 4TULL 1CICB 2IOMA 3QPXH 5HHOA 3LH8A 4JFEB 3K6OA 5EU5B 3L1OH 4PS7A 5T1LA 3EDJA 3L7FA 1NGZA 4YNYA 5DJ8A 4HG4K 4M48H 3I50L 3OGCB 4ZQKB 5BQDA 3VFUA 5ADPH 3KDMA 1MWAL 5FO8B 1AXSB 1LO5B 4XN4A 3T4YB 2G0LA 3DURA 5J5EA 4F8PA 1LWJA 4FKEA 4N0FB 5JUEH 5JZ7C 2RR3A 1XTLA 1L6XA 5CSZB 2LFEA 4U6XA 4JM4H 4E9YA 1KDIA 1KF9B 2VRKA 4PRHA 5G4OA 3FSZA 3AZUA 2F8OA 2E7LC 1GXEA 5B39B 3ISRA 5KSBA 4NEHB 5GS1B 3LZNA 3UBXA 1AQDA 43C9B 1X5LA 1HNGA 3GSOA 5F7AA 3BVNA 1JNJA 3MREB 1PQZA 2EDMA 3MO1A 3NJKA 5DVPA 4IBZA 2YPLB 4APQA 1MCOL 3T8VA 3HI5L 4XPFH 3ARFA 5GGVH 4OLEA 3Q9PA 1IBGL 3TV8A 3WFZA 3EJQA 1T21B 2ADFL 5CCKH 1UZ6F 4JY4A 3NIFE 3LX9A 4HDIA 1IJNA 2GITA 3QJZA 1ID5I 1C5CL 5CN3A 4AV5A 2BSSA 5CJOH 3LNIA 4K3DH 2O72A 2YN5A 1T4KA 3S8WA 1S7VB 4Z3EA 5EN3A 3BZ4A 2AC0A 1JDDA 1NEZG 2YMTA 5TDPA 5CIPB 5KVFH 4XVSL 1J8RA 1BVZA 1KPVB 1MFAL 3LN4A 4PGZA 2RA1A 1A5FL 2PN5A 2H3KA 3EJPA 3D48R 1JGEB 5ESVA 5C0AB 1NCCL 1CMOA 3X1GA 2HKHL 3HZYB 4LCCC 3QRBA 2IALB 4MB1A 3SPHA 1TZHB 4B9FA 2YD6A 3MUY1 2ZX6A 3US0A 5EIVA 2DMHA 3TYFB 4I3RH 1S3KL 4GRWB 5D2NB 5FGRA 3DUUA 4LASH 5HVFB 4MVBC 1IV8A 4LLWB 3CHRA 3LEXB 1K4DB 1R3KB 4HWZB 2DQIL 5C0FB 3BUYA 4EN3B 3VXSE 1IARB 2APXA 4GRLB 3ZT6A 3D87B 5LGHL 2R51A 1OLZA 3GJFH 3HKFA 4FHKA 4JN1L 2Y07L 1QLRB 3MRDB 5AVWB 4ZFFA 1XH3A 4G80A 4HSQA 5D4QA 4FA8A 4Y9GA 2WN2A 1N8ZA 3ECBB 4L8SB 1JERA 3Q1EA 4PGEB 1BZ7B 3Q2LA 2P28B 1G6RL 1N8OE 4HGWB 1GYUA 2OL3L 3DXAE 2O4EA 4WV1A 1HXMB 2Z3FA 5ESQB 2LFGA 4BKSC 2V9RA 1K3IA 5I74C 3QEHB 1HXYA 2EKSA 2W60A 1OY3B 1KCSL 5EU7C 4E9VA 5F89B 2Y36H 1NDGA 4HG4J 3G08B 4W4OA 2OZ4L 3O11B 1SHMA 4P5KB 2HT3C 4HCIA 1MY7A 2GTWA 5HGAB 2XNAB 3QZOA 1JGVH 1G7PB 1IGCL 3QFJE 5FOJA 4Z3HA 2ZF9A 4MD4A 4WHDA 4MZRA 4LL4A 1M7XA 4U1KB 4WTQA 5DC2A 3S36H 4NNPH 5K9JL 2YAHA 2BOCA 1RZIB 1UWEH 3BVXA 3IEAA 2WUBL 1FG2A 3EOTL 3T65B 4PRIA 2ZAGA 3F6JA 3QR0A 4AWJC 1VFOA 2CKBA 4YHPB 4BUGA 1PG7L 1JYNA 3MBWB 4H8UA 3UZEC 1UH4A 1H3TA 1V3KA 3G6JF 4YXLL 3H56A 2V5SA 1IEAA 2VJ0A 4R90L 3HCVB 3IDIB 1LP9A 2WLJA 3BLPX 3DDGA 3INUL 1MFCH 4X4KA 4BFJA 5C09A 2VZ3A 4HFWB 1GY1A 4JVPA 4OZHE 5E7FA 1UD3A 3HMXL 4XNYH 4TS6A 3E0GA 4MNHA 1BXXA 4NS0A 4UAOC 5DFAA 1EO8H 2APTA 3FZUD 1QACA 3US9A 3HPJB 1OAXH 4TRPH 1PD1A 5D4HA 3BKCH 4HWNA 1PDKA 2YJLA 1QATA 1GCFA 2I85A 5GZNC 2BVQA 2IANE 4Q56A 2HVKA 2ESVE 5CMAA 2W95A 1A6PA 4KI5D 1MRFH 5AYUL 5FKPA 3V7AG 4G2AA 4ODUA 3O4LA 4NHCH 2X4NA 1FVCA 1IAKA 2J55A 5A6LA 2B16A 5KBPA 5ID0A 4UIKH 2BIMA 3VTTA 3D50A 2B9AA 2NY3C 1QFOA 2DWYA 1YCSA 3IJSB 3QJHA 4PP2A 4B27A 4KH9A 4MNQE 5FCSH 4WFFD 4FQ1L 2XU9A 3MTXA 4EQ2A 3HS0A 1YN7B 4PI0A 1HINL 5TH2B 4AMKL 4RRPA 5FB8B 2R56L 2WKOA 1HKFA 3N2JA 4AG4H 3CVIL 2Z4TA 1EAQA 5C0JA 1WA0X 4XVUD 1Z3GL 2V2WA 1SYVA 2QPSA 2KLTA 3MRHB 4BH8A 3G5ZA 5D5MB 4WKXA 2O6FA 3VXTB 4K9EC 3B9VA 4YDKH 1BWMA 1HHGB 2HT3D 1M7DA 2G60H 2H9GB 1JGUH 1W8NA 1P6FA 3S97C 1JZ4A 4F7TA 1P4LA 3AAZA 4FAAB 4YO0B 1TLMA 1OWWA 4KX7A 5H4YA 1DJSA 1L6PA 5FYKH 4HJ1A 1OSZA 1XSIA 4P4RA 3TVMB 5I5RA 5ITBL 3HVDA 1U36A 1IAIL 5D71L 1Z9SA 5HBBA 4LVEA 1TOXA 2Q7NA 4X6EB 2QSCL 2ICCA 5D1XA 1G7JB 3LKPA 3VFNA 3BP6A 3QG6A 5I28A 3FB5B 3FULA 1BLIA 3P9LA 1JRHH 1AHKA 1ITCA 4N9OB 5IQ9A 4E9TA 1VZHA 3QQ4A 4GT7A 4JO4L 4PJIB 4XNUL 3GSUA 4UNTA 4JFFB 3FO1B 2CE6A 3ABGA 3US1A 3VGFA 3D2UD 4XCCL 5F1NA 5TDNA 3EJCA 3MNZB 4ZS7L 3EJZC 1U8QA 2NY2C 4CW1A 1U30A 2PCPA 1A7QH 3MRRB 3BH9A 3VQ2C 2V9QA 2BVPB 3NK4A 1E6OH 1GGBL 3F2LA 2R2HB 4AH2B 8CGTA 2PR4H 5BQ7B 1KJ3H 3GJEB 1OV8A 4NHUB 5GPRA 1S8DB 3V0WL 3MDJA 4G43A 3UYRH 1RPKA 2APSA 5LO7A 3EH4B 4K9EL 3M1BA 5D4IA 4ZFZB 5JQ6H 1H15A 4KGJA 2DQTH 3MJGX 4JFHD 1MELA 1TJGL 2NY3D 4PJ5A 5E9DB 5CM1A 1VHPA 2M2DA 5LQBL 1G9HA 4IBQA 3RA7L 3C8KA 1LDPL 1A1NA 2KYIA 4X7SH 4ADIA 2WK2A 2A9AA 4N2EA 3QDJA 2IPUG 4X8JA 5EC2B 3DX4A 3WIIL 3KNBA 4R7DA 3F05A 2WMPB 4AX3A 1LE9B 1YJDL 3SQOL 2JQMA 3EF4A 3TBWA 5E6ID 3VRLF 3B2VH 1U58B 3HS8A 2ZICA 4XMLH 5T1KD 1V8HA 3FUMA 1PJ9A 3JVGC 3ML8A 1IBYA 3AG3B 3N9GL 3UADA 5D8JH 4B95C 4OJDH 4XO8A 2DQJH 1ZVYA 3ULVF 4YGAB 3QQXA 3DIDA 1OPGH 4IRSD 3B2MA 1LM8V 5LBGA 1TDQA 3PYCA 5TF0A 1U6AL 1KOAA 4QXUL 1E8WA 4YE0A 3RWDB 2P5WD 4YK4C 4BELD 4W9JC 1U2CA 4OIFA 3FCBA 3AU0A 2A74A 2XFGB 3MJ9H 4A37A 3K72B 3O6KH 1SFHA 3AWEA 3TBVA 2D3NA 4N2CA 3RAJH 4YSSA 3G6JE 1CGVA 2FEJA 5F9WC 2A0LC 1TCMA 4RZKA 3LIUA 1EFXD 2IJ0C 2PYEE 3IPFA 2ZYHA 3L3OA 4NWUH 1DBBH 1JL8A 4EQ3A 3ZYJA 4DKFH 5BVJA 3GXNA 1EXGA 3QFDB 3C60D 2FAUA 4AM0B 5EF3A 3SOBL 3ZR5A 2PP7A 4XBEL 4J1UA 3QFJD 1FL5A 4OD1L 2MSPA 1YEIL 3VI3A 4BZ2A 1H5BA 4PJ9C 3WMSA 4MKMA 1JK9B 3KYMA 4TLUA 5GGVY 5E4AA 1O6SA 1NGPL 1TTGA 2CKBH 4H1LG 4PRPA 4S2SA 3P9MB 2ZCHL 3LN9A 4F8OA 2DLHA 1AACA 3LY6A 1I8IA 4MMXB 5DHVA 4IRJA 3X13B 5L4FA 4FTVA 4G7YL 1XXDC 3EG9B 3GB7B 4ZBJA 2CBTA 1SMDA 1N0LB 1Y6MR 1VFUA 2HA1A 4TKWA 3DC0A 5E1GA 3S96A 1JN6B 4LSTH 1N2RB 2Q7YA 4XXDA 2X1WL 4K8RH 3MV8D 2AEPL 3QQ3B 1MHCA 1F5WA 1Q0YH 1ACCA 3RFRA 1Q38A 3QGVA 1RVFH 3WKML 4NYLB 1HILA 1U3ZA 1XCTA 4WFEE 4ZMXA 5DRNA 4WWKD 3VRJA 3QULA 1WK0A 4UQ3A 5FGCE 4Q9RL 3WD5L 3IJ7A 3KHOA 5D7IB 5AZEH 1F8TL 2OLDA 5LB1A 2P5ED 4JHAH 4HIIA 2AF2A 3RL1A 3Q7JA 3ILPA 1UXSA 3LEVL 1E6JH 4JB9L 3ZZSA 4YEFA 3QO1A 2EE2A 4ZW3A 2ADIB 3IFNH 2H6UA 3VFGH 5E5MB 3V79C 2CIIA 3D69A 1DSFH 3DSFL 3GBMH 2E7DA 4HS6B 4FG4A 2H2SC 1KIUB 2VABA 4MWFA 2DRUA 3T2LA 3DVNB 1G1OA 3W82A 4ABVA 4BSVB 1BQHA 1AFVH 1IU1A 3AITA 4JO3L 1UH2A 1FLRH 4L05A 4G8GE 2GT9A 1MSPA 1QMUA 1UA7A 3AG1B 3DVGB 3MLXL 1OT2A 3VWKB 2MPAH 3G5XB 2X2UA 2DLGA 3V0VB 1TEYA 3CSYB 1AKPA 3FUFA 2YXMA 1PIFA 4DGIL 1ILSA 2HWZL 4KTDL 3WIHA 3WNIA 2OI9C 1Z66A 3PQYA 1FIEA 3OB0H 4MXWH 4XN9A 4EDWL 4FNQA 5CD5D 3QIWB 4O2EA 4PJ8D 5IB4B 3A6CL 2BWDA 4GXFA 3AY2A 5JIQA 4I5BA 3QBTB 3U0PB 4AYDC 1UXLA 1I1YB 4PJ9D 4YFLI 1XSKA 3TN0A 3WL9B 1X3DA 2YBGA 3C6LB 1QLEL 3MLSH 4HP5A 4L4TE 3RZCD 4FFZL 1TO4A 1YMMB 1J0ZA 3MKKA 2DL2A 3RGVC 4E68A 4W6XB 4WW2C 4RX4D 3RI5F 4F37F 3U36B 3E6HB 2JKWA 4XC1H 1E67A 2DD8H 1EGJL 4JFQB 3HC0A 2KI6A 4GO9A 1M6OB 3BH8B 1AKJB 2W0PA 4ACPA 5LN4A 1F3DJ 2GK0A 4QRPB 5AW2B 4N9GB 5I1AB 5AAPA 5GSVA 5AD0A 1JV2A 2V33A 4LL1A 1P5UB 3H9YA 4UNVA 5FHBL 5HYFA 4TXVB 4Y9FA 5DFVC 5L7XL 3VD5A 4CMHC 1RIHL 1EZVX 5ABZA 3U7YL 3KPRE 3SGDH 1II4E 2AQNA 5MENE 2QEJA 1L9SA 1VESA 2W1NA 5SWQB 1CB4A 4O9HH 3VRLE 1Z5LA 2WXMA 4GAAA 3RL2B 5BZDA 3TEUA 4ZX6A 2CMRH 4JZOB 1Q0XL 1FFRA 1GC1H 1XB6A 3NTCH 4UZGA 4ZPTA 2WB1A 3BZDA 5IBLC 4ZO8A 4ODHH 4TOYL 2OZNA 1ZLWH 2HFFB 1DQDL 1DQQA 2CDGA 2VLJE 3CWGA 2Z7ZA 4LARL 5FLUA 4XNZB 1RK0A 4I1PA 4QRUA 1VF5C 3HTLX 4IIQA 3ULVE 1XFPA 2IH3A 4WEMB 2GSGA 1T83A 4GMSL 2H2SD 4R26H 4LHUB 1FC1A 1ZE3C 3B37A 4OZGB 5HYJD 2K45A 3HE7C 4UU9A 1E50A 3T3PB 4JQIH 3FT4A 3GSVB 2WOYA 3CFEA 3PV6A 1NCGA 1A14H 3CHXA 2HLFD 1CPUA 2Z65C 3NBNA 2B1HL 2ZKMX 1KBGH 2WW8A 3D85A 5HHQB 3VRIB 1ODAA 2PPDA 3PAUA 2XVKA 1A4CA 1Z2KA 4MAYB 4OJYA 4LPVA 2J5WA 3OHXC 1LQSR 2EEBA 1XZWA 4S1SH 3DJZA 4MJID 1GZQB 5FM5M 1I9IH 2GJ6E 3EYQC 4JE0A 5KJRL 4K55A 2FQFA 3EFDL 5F9JB 4NSKB 3HI1A 5GGUA 1VGKA 5CBEB 4L8DA 4Y4HA 2E3VA 3KPPB 4GP8B 2JK5A 1BP3B 5A40E 3HI6H 5AG8A 4Y5VC 4D0BA 3FQUA 4RZCA 3AQYA 4FQHB 1IVLA 2YEVB 2A3TA 1N5AB 2YGOA 3BP4A 3WEXB 3V52H 2QR0B 2Z4QB 3B1TA 3B2XA 1TJIL 3IMBA 4OM1L 3C09C 3CFCL 3CVBA 2HKFH 1NKGA 3KWTA 1PF3A 4UYPA 5KYXA 2TRYA 3H2QA 4ONOA 4Q9BA 5C07B 4AEFA 2WM0A 4BD4A 4WI9A 1WZLA 1BA9A 2AGJH 1CGUA 4URTB 3OC5A 3J2PA 4NP9A 4KJWD 4YHZL 2L7QA 1B0RB 4G6JH 4NQQA 1A4JA 1CLVA 3FRPA 5DZJA 1BZDA 4U1JB 3FO0H 4EI5A 1L7IL 2F2HA 3OKKA 2YMOA 5EIQA 3OJMB 4S1QL 5IBLD 3O8XD 1KXQA 1JZFA 3L5HA 5KUKA 4LLMA 2EDBA 4LSQL 4HK0A 3UG3A 1LVEA 1D5ZB 3U30C 2KQNA 3W0WE 1ZTXE 1WWCA 4FERA 5BXFA 2CO2A 2IADA 2ZYSA 5EB9A 4NAJA 3OR7A 3HE7D 5D70H 5IK3A 2DQFB 5AB1A 2ITCB 1FL3A 4A2MA 4ENZA 4AYMC 3QUYD 4MB3A 1KTDA 3MACL 1FE8H 1NLBH 4TSCH 2YFOA 2OXHA 3GMPA 4W9LC 5EEXA 1RZFL 1K8IB 5BJTB 1A3RL 1CZ8H 3QA3A 3C5SB 3V9EA 1VEMA 3N50A 2Y3NA 1RK1A 1XGQA 3MJWA 2HG5B 4CUCA 1ED3B 2ZYRA 4MD5A 3P0YH 3HPLB 1PX4A 2GB2A 3ZHDA 1TITA 4TNWF 2WLLB 5HHMB 4YSDA 2GSIA 2JKJA 1AY1L 4H8QA 4U4BA 1MFDL 4DP1X 4LPXA 2EDXA 2GABA 3MRQA 5FM5O 4HD9A 3BCFA 1LEGA 4MLIA 3UAJC 1F4YH 4O4YH 5LAPA 4ZFOL 4PJFE 3ULVC 2IPTH 4HKZA 2J4WL 2CCLA 3QZWG 1X5GA 4BWWA 3AADB 3FH5A 4X6FA 5HVHC 4YPGB 2Z0UA 4FCHA 3NGBB 5I8KL 5IZ7A 3EYFB 3G5VA 5J3HC 2NQDA 5KW9L 4G8GD 1RIUH 1UYWH 3MODH 1DVFD 3MKGA 3CIQA 4NQED 4AQZA 4OIBA 1CIUA 4J3SA 3U25A 2W80C 1S7QA 1WHOA 3V4UL 3WIHH 5IB2A 3BQUA 4R84A 3BDYH 2XN9A 3HE6A 4IMLB 1DJZA 2BPBA 2JCCA 2WXJA 4IDLA 3S4SB 1TXKA 3D3VE 3W81A 5ACLA 3ZL2A 2YRBA 4G3YH 3V0HA 3ATEA 3EO9H 3HN3A 4LSUL 2Z1KA 4U7KA 4KROD 1JZ5A 3IJYB 3IU4H 3EYUH 4Z7OF 2GKIA 4FI7A 4WTZG 3VXMA 4ELMF 2VR3A 2F7RA 3PGFH 4F2EA 3BT2L 3GSWA 1JZ2A 3KLDA 2DQHL 3DHPA 4DK5A 4FQXB 1S46A 5JHAA 4NQCE 3MJ6A 4XCNA 5BMFL 5K5YA 4AQ1C 1EQWA 4H0IA 2R29A 2WIMA 5AALA 1G87A 4CAGA 4DGWC 3ULVL 3WTYA 2I9LA 4AEIH 3O6LH 5I19H 1P7HL 1DBMH 5DO2C 5D1ZD 1HHIA 3VCLA 4NBYB 5DS2A 1T22B 5H94B 5AVYB 3BAYA 2MPVA 5F8QC 1DZ0A 1KC5H 3UH8A 2MHAB 1XV8A 3QJTB 1ACXA 4XO4A 2D9QB 2KMWA 2YOAA 3CMOL 4L4VE 5KYUB 1V7NL 3H7BA 4XMTA 1I7ZA 5J12C 1YY9C 5J6HB 1RURH 3PP3K 1P5VB 3ORJA 4FXGC 2BMKA 4M7KH 1EVUA 3ARBA 4OSUH 1SNRA 5T5NF 2R9HC 2QTEA 1FPTL 1YEFL 4OCSL 4FLOA 2BNRA 3WKPA 5B8CC 2FTAA 4HWBH 3OG4B 3MA7A 3WE6B 3WUWB 5I1EL 4R6UA 5MEPA 2PWHA 4P2QB 4QTFA 1GA2A 4XPGL 4MZ3A 4HISA 1GYVA 2VLJD 3V7MA 5I15H 3TZVA 4F8TA 1W72L 4G6AD 3FMGH 2I9TA 4Y1AA 1GY2A 3O41A 4XP5H 3WENA 5AENA 2VL5A 1F3JA 2UYLA 2X4TA 4F80A 4LCUB 2V37A 4U1MA 1KGWA 4F8LA 1XF3B 3QDGA 2P49B 3LKQB 4WIQA 4JQVC 3U79A 4H0LC 3ULSA 5LGJA 1AJ7H 5GQBA 1F97A 3Q06A 1J1OL 5EWIL 2CZNA 4NQXB 5EDSA 1KB5L 4KJYB 3ZUCA 2D7NA 2ZT9C 4OFYA 4Y0GA 1SLWA 5B3JF 1OTTD 3S3SA 3ZDXB 5B38G 1KLFB 2MQ0A 1TZ8A 3L3GA 1Y0LB 2V2TA 1NEPA 3OXSA 4UQ2A 5F6IC 4YHKL 1QFWH 1DANT 1BSIA 2QSTA 5L4JA 4L3EE 4QLRA 3SGKC 4XXCC 4WJ5B 2N4IA 4M6ML 3QXAA 2Q76B 3QAQA 2WV3A 4LIQH 3STZB 1TF4A 2OK0L 2OYMA 3NZHL 3WNJA 2JE8A 4AT6A 5C6TL 4K7FB 3IU3A 2KT6A 4RIRA 1JGLL 1DVZA 1XDTT 3PLYA 1JPSH 1ZXQA 2YLHA 3NCWA 4MJ2A 5D93C 2Y9RT 4E42B 1ZTXL 4HHGA 1ZVSB 1P2CB 4K3GA 4GKZB 3PAYA 5C0BB 3PWVA 3HBGA 3WXWH 2WYHA 2CUMA 1GGCH 3LPOA 3PY9A 6PCYA 4OR1A 3NIGE 1XBDA 4FC3E 1OEZW 4OGYL 3V5HA 4XMZA 2N1TE 3RB7A 3GIVA 4A39A 4QRTA 4QHLB 3U4BH 1HH6A 1RZJH 5LBSL 1CO1A 3FBQA 3NPZB 2NXZC 3VGEA 4J6RH 4A6YA 3D33A 1CYXA 3ZL4H 2X1OA 5DYFA 4KH2A 3MRPB 2JQAA 3MRNA 2H3XC 4A2GA 5C0EA 5I0ZA 3K6SA 3FAXA 4WUKH 3QIBC 5BZWB 3RWEA 1I8AA 5EZLA 1BCIA 3L2NA 1U3HD 2NSMA 4JFSA 3R8QA 3UTTA 2GTZB 3II3A 5JOFB 3U0TA 4R7NB 2VXQL 2F53B 3VG0L 3DX9B 5FFLA 4KITB 4X4YB 1R5VB 5LUMA 3R06A 2CRMA 4FQCH 2PYFB 4I8DA 4OLYL 5KSBF 1SN0A 4PY7B 1KCKA 1T2QL 4G8EA 3MXWH 2PPFA 5D96C 2E6PA 1H8SA 3BIKB 3MRCA 2B4CC 1X44A 3O3BB 3S35X 1FNEB 1VRSA 5CD3A 1UD4A 4GYBA 3CUPB 4CC4A 4EXKA 4LMQI 4FYQA 3TEZA 1F2QA 4NRYB 1CBVL 4GAYA 2WNWA 3FCTB 3SDAC 1DJHA 4AGNA 1ZDSA 4HJSA 4Q0XH 5CZXC 4YN3A 3JXAA 1K2DA 3P4NA 4UUJA 3ZL1A 2WHVA 3KLQA 4QOKB 2GBVA 2F7OA 2R0LL 4NO5A 4XH2A 1CXLA 3SDCD 4WQOA 5F7DB 3P4OA 3VQ1C 4B41A 1IVTA 2OBGA 2EO9A 2FR4B 5HGDA 4ZW6A 4IRZL 1WH0A 4Z7OE 1I3RB 3D0VB 3LN5B 3ZTCC 4HIJA 4ELME 4PBDA 2EUXA 3MRBB 3GUFA 1DQJA 4BHUI 2UXFA 5FECA 4KZEL 2RTTA 1F58L 5EU6A 5DUML 1MQ8A 4MA1B 1G7QB 3SD2A 1F11A 2ICEC 2VLKE 2XN1A 3BE1H 4AIXA 2YS4A 4LBEA 3F12B 4MRBA 1D5IH 4XXWC 3R7RA 3EFFB 4NKDA 3QIUB 2WSDA 2WY3B 4I2XB 3LXAA 1YAIA 4JEGB 4PJDF 1IM9B 4Y9CA 1IM3B 4PG2A 4MDIA 2FZ3A 4HIHB 1UM6L 4JFZH 4JFDA 4KPHH 3UFIA 5CJBA 3D3VD 4AITA 1QSZA 2B4CL 1GZPB 4RMQA 4ZOAA 4ZDHB 3UZQB 1LE5B 5C7XH 2Y1AA 1PLGL 4HQQL 4S0TD 3CLFL 4X6DB 4QRSB 2BHFA 5BZZA 2AJUL 3ZZQA 2A9NL 2R1XA 1QD0A 4HMEA 1WAAE 4MMZB 4UM9D 4KUCD 3ZRCC 2XIBA 4Y1SA 2FX7L 1EJ6A 4ABUA 1E4JA 1T0NA 3QDMD 5EO0A 2VLMD 1OHQA 1VB9A 4JM2D 1MCWW 2FX8L 1C08B 1M6UA 1UG9A 4DHLA 4Y2DA 2CIKA 2DW5A 1E5CA 1JZDC 2HJFA 4OLVH 1RJLA 1DYZA 3BPOC 1TZIA 5CWSB 3MCLL 4O51A 1KIRA 2WQRA 2KERA 3VFVB 1WD8A 4NCC1 2VDRL 3HAEH 1LO2L 3FOMA 5JNYA 5FWQA 4NZUH 4EO5A 2BP3A 2CAKA 2ZOWA 3LKSB 3M8OH 2ZXQA 1RD6A 1WZ1H 1LO3H 4ES8A 4DEPB 3MSPA 3OVUB 5CZXD 4JHUA 3I6SA 2WP3O 4ANXA 3FFCA 1OAQH 3KLAA 4BH7B 4F5CE 3FBKA 5JR1L 3K8MA 1JXGA 1WBYA 1LP9F 5B3JE 2NZ9C 5DEZA 4K23H 2E5EA 1OF2A 4PJ7B 1SJMA 4X4XB 1CXIA 1OGSA 5INCA 5LCVH 2VWEE 4LHQB 2NY0B 4R5VA 4Y5XB 4XBGA 5JPMA 4G1MA 1D5RA 1HHHB 2LV4A 4M48L 5DWPA 4PJIF 4LNVA 1BIIA 2XCMC 5T3XH 5KOVC 4AVIA 1AYOA 3PNWB 4DP7X 5TE4L 1DR9A 2XOTA 3HRZA 5JUEL 1KCRH 1M1SA 1NA8A 3RHWF 1EFXB 4W81A 4HHAA 4JM4L 3BWAB 1PKQA 2AABL 3DX6A 1FGNL 3BOVA 2VLRB 2W9LA 3JWNG 3QORC 4L37B 3EBIA 2VR4A 1T2JA 1VERA 4PLKC 4PJAA 3CV5A 5FYKE 5FV2A 2EINB 5HHOE 3JWDH 3UDWC 4WZ9A 3QH3A 3M7FB 5GGVL 2WKOF 2GHWB 2JTYA 4OLZL 4P46B 1J1XL 3CH1B 4N24A 4PGCB 3VGHA 4NC0B 4W9HC 5J1TC 4Y4KB 1SOKA 4RAUA 4K3DL 1FN4B 5CJOL 2EEFA 5EU4A 5I1HH 4M5ZH 1I1AC 1GOHA 3D52A 4PRHE 1FYTB 1RZ8B 3ZTJG 4NT6A 4ZSOA 2BNQA 3FB7A 5KSBE 4L18A 3GBDA 4IDJL 3V4VB 2NW2A 1U8LA 2BERA 2FQEA 4NN7C 4Z0XB 1BAWA 2BWQA 1A4KB 2H2PC 5EU3A 2Z92A 4OVVA 3PFQA 1AQKL 1WZAA 4AXWA 3X12B 1BF2A 2JJWA 5C0CA 1HN1A 1WT5C 4FHBD 4F7EA 2B2XH 4RAVB 1N26A 4XMXA 4WU7A 1FNSH 2EABA 2P80A 5J9PA 3F7VA 5DVLA 2A4CA 4GAJL 2A9DA 1SVZA 4PTUB 2X4OA 1KJMA 1ZA6B 3BVTA 4FNUA 4ZX5A 4ZXBB 3CHPA 3ZN6A 4E41A 2XWTB 3ZGHA 5BRZB 3CFMA 4D9LL 3DMMD 5HSFA 1T3FB 1PZ5A 1J88A 5DDHB 4Z8FL 1MCSA 3EH1A 3LH2H 3T6ZA 4JY5L 5ICUA 4J8RA 3ZW3A 3RU8H 5B7MA 3H42H 1F6FB 4GLRH 3GO1H 2F1AA 5DK2A 2LU3A 2DJ4A 2TRHA 3MRJB 3SGEH 2R23B 3ZHFA 3THMH 4EKXA 4PLKD 2NDGA 1ETA1 5JXAL 1E4KA 5CP3H 2C3GA 4FKHA 1TYRA 2JB6B 4BXSV 4ZQKA 3OGCA 3I75B 5C1MB 5HGGS 5AVTB 2ZD0A 3RJDA 5FO8A 1AZUA 1IC4H 1LO5A 4O02H 4YSCA 3W9EA 4XX1E 1BM3H 2Q8BH 3T77B 3RKDC 1ET5A 3S36L 1R0AH 2J5LC 2VWEC 5JHDB 3DTXB 4N0FA 4JFTA 3QDAA 4FLRA 5I16B 1GYCA 3QUZA 2P8MA 4H4NA 1UB6B 3EGDB 1DE4B 4R9HA 5I0WA 2VLKD 4Z77B 3I84A 4EUPH 1G5AA 3FUEA 3QI9B 4GUCA 4YLQT 3NABL 3C9NA 1KCVH 3IN2A 4OFIA 1KPRA 3TL5A 43C9A 1MFCL 3C5ZB 2D3LA 3N5AA 4NJ9H 2Q86B 3KPSD 3ZK0A 3RWCB 3UGEA 4JG1H 1HC1A 1WC7B 1ZHNA 3AM8A 3LHPH 4XNYL 4JDVB 5LJYH 4L5FH 1HSBB 4IS6B 4P2RB 3AY4A 5EOCJ 3VXUB 4TRPL 2CUAA 1HSAB 5FUOL 1C7SA 1AQ8A 3Q44A 5CJ5A 5GGTA 4NKIH 3JWNE 2P43B 4LVOB 3CVHL 3O0RL 4PRIE 3LQZB 1FJ1A 1MRFL 3GMQA 5GGRB 1S7VA 3OPZL 4CBZA 2O26U 4X5WA 5DQJA 5TDOA 5CIPA 2VR5A 4UIKL 1LP9E 2VR7A 1GYAA 1YNKH 3UJJH 1LD9A 3OWEA 5C09E 2WZ0A 2EE0A 3G6AB 4RESB 3OC8A 5LNDA 2E76C 1ZLSH 4LPWA 4Q9QL 4G7VH 3VG9C 1CDJA 3L3DB 3QYMA 1SM3L 3IXAB 2ARWA 2PW2A 5A16A 3B9AA 5D2NA 3VSUA 1JPGB 3SKOB 1H0DA 3DPBA 4LLWA 3EDKA 1D5BB 5HYSB 1NMCC 1K4DA 1R3KA 4YXHH 1IGMH 3LZFH 1CTMA 3FTGA 3PFUA 4MAUH 5EBGA 3B9KD 4X6CF 1RMFH 4EN3A 1U95B 4APQC 1Q9LB 3O4LE 3ARFC 3RWHB 1CURA 1JGDA 1JZEA 4ZK8A 5I66B 4JK0D 5IW6A 4UT9A 1P6AB 3FSVA 4YDKL 4H26B 1QLRA 5KYWA 3JYCA 2PWFA 3WTUA 2VZOA 4QY8A 1SGKA 5LDSA 1NMAH 2DI9A 3UJIL 4GUPB 3OZKA 4AOFA 4L8SA 4DGVH 3H8NA 5FYKL 4PGEA 4QO1B 2WINA 3QEQD 4NM8H 3H9SA 2W0KA 3LB6C 3NA9H 1WZMA 3DO7B 4RMUA 4Q4EA 2VAJA 1HXMA 1U4FA 4X5QA 2MQGA 2WVVA 3BVUA 4RFOH 3L16A 2D7TL 3QEHA 1RLWA 1BWWA 1D7DA 5D1QD 4H8HA 1ZT4B 1QSFD 5F89A 1QPXA 4X0KB 4AIZA 2R7EB 3GI9L 2DQEH 3QARA 4YIQB 3PIQA 1I9EA 5IOPB 4P5KA 2G4EA 4PRDA 4Z7VB 5I1DB 5E00A 1UA6H 1G7PA 4M03A 1PFCA 3OX8B 1MUJA 5LKNA 1YEJH 3DRTA 1RZIA 1EO5A 2N1KA 1E6OL 1SJVA 3BIBX 4R5TA 1BEYH 2PR4L 3MOAH 3IWVA 4JR9H 2AI0H 1Y6KR 3JV6B 3OKNB 4F7PA 3UYRL 2K70A 5D1XE 2VRAA 1FNLA 2OTUA 1PLCA 2DQTL 3F7QA 3T8XB 1CLYH 2VZUA 2B1OA 4WV1C 5FYKU 2C7FA 2H26B 3NSJA 5CINH 3O2WH 3IF1B 4G6MH 3CFJB 5LHDA 3NJFA 1MWOA 1RJZB 4HJJH 4W4OC 4QRBA 3K5RA 4OCWH 2VC2B 1W0VB 1NMBL 4ZRGA 3BP5B 1YQ2A 4KTYA 1GGUA 1C16B 3CK0L 1AH1A 2E86A 4P3CL 5DXWA 3DYPA 4R3SB 2DMBA 2VDLL 4Y16A 2VMCA 4APQD 5FGBA 2FEDD 4G82A 2CGRH 4LCVA 3JWNC 3WFCH 4FMFA 2F68X 3NAAH 1QHQA 4PJ5E 4EF3A 5F0MB 2V8LA 4TQEH 2EYTA 4N8UA 1FFOA 1UQSB 2YPKA 3IN0A 3V5KB 2BY1A 3IFPB 5I9QC 4I88A 5GJSH 3R18A 5GRZA 3FT9A 1NCHA 3T0DA 5F7FA 2JNZA 2P44B 2QADB 1JNHA 2CO4A 5EUOA 3H0TB 3FQNB 4XRCB 5CO1A 4YUEH 1E5UI 3JTTB 4X7TB 4K8RC 5D5MA 2CG9X 1JWUB 1S9WA 1WHPA 1S9YB 4WNSA 5ACMA 3IMWA 4YR6A 4XP6H 4Z18A 3VXTA 3E3QE 1HHGA 3MBED 5EN2A 1ZIAA 3RAJL 1XD1A 3G04B 4YE4L 5FIEA 2YA0A 1ZVHA 1MFNA 1HHJA 1AIFB 7TAAA 3MZGB 2FJHA 3X1BA 2YXWA 4DKFL 3IFOA 3TVMA 4YDIH 4ICXA 3QZLA 3KYNB 2BINA 4MSWB 5AOZA 1K5NA 1J0IA 1QFHA 5DRXB 1NC2B 1RH8A 3MA9H 3K71B 4QYAA 4Z3FA 3ZKSD 4UTBA 2XZQL 4JPWH 3HS0C 4XC3H 2CLZB 4HH9B 1DLFH 1RZGA 5E4EB 5AWNH 4K5PA 5IKCA 4PYGA 2CKBL 2BP0B 4N6RA 1L7TH 2D31A 5CKGA 3C75A 3OJDB 3MNZA 3D34A 3BAIA 5FC9A 2KBGA 2YRPA 3GMRB 5F88B 3L2MA 5GZOC 3L17A 1CYGA 1WISA 3CSBA 4DSYA 3TJEH 1XCQB 5IT2H 5EF2A 2R2HA 1T0MB 1I8UA 3D39B 3TPKA 4AH2A 1OAUL 3I9GL 1N64H 3GJEA 5I75B 1EHNA 3HRPA 3CHQA 3QUXD 4PLOB 4O2FA 4MBRA 7FABL 3FPXA 1WITA 2ED8A 1Q0YL 3B2DC 3N41F 1BEXA 1RVFL 1KEMH 4KDWA 1VZIA 3VI3E 5HJ3B 2ITDB 3B2UC 3N42F 5I6MA 3HEIB 3RE0A 3B5TA 1YA5A 4X6CE 4PRPE 2KL6A 1F90L 3NRFA 5ISZA 1HL8A 2OMUA 1SYSB 5D1XC 3ZYOA 4PVNA 3DNKA 4FTVE 1OP9A 2FO4A 1BPLB 3CSGA 3A4EA 4ZOBA 1E6JL 2WO3B 5JXEC 2OCFD 2V3FA 3HHRB 4NQVB 2AEOA 5EC2A 3VDBA 1KZYA 4U49A 5C09D 1TTUA 3GBML 1LE9A 2A6JA 3L3HB 1UFUA 4QHUA 3W57A 4BA0A 3EYSL 4Y19B 1U58A 4J6IA 1RV6X 5MI0B 3AXIA 4DOHE 2SODB 4I4WA 1DQVA 5CZVH 3L5WB 2CNYA 4U4IA 4QF1A 6PAZA 3M46A 2OYPA 4TQ8A 1GVIA 43CAA 2GJJA 1A6WL 2JH2A 1E2ZA 1OO2A 2IDUA 4H44C 4ZMYA 1QSEB 3S37X 1WBZA 1GC1C 1VACB 4HPYL 2VDPB 5C0ND 4IBWA 3RWDA 4MXWL 1Q8MA 2P7TA 4ZS6D 3O2DA 1UD8A 4L9DA 2XC8A 3UC0L 1J9CT 4XP4H 1FO0B 5DEFA 3W11C 4A2DA 5EORH 1EEYB 2X2HA 2Y4SA 2APVA 1BIHA 5K9KA 3K72A 2FEEI 3HZMA 4PG9B 4N8VB 4A68A 1G5GA 1HYSC 5F96L 3CDYA 4DERA 4JKMA 2YKKA 4MQXC 4ONFH 1U92B 1BYPA 3SJVB 2BRQA 2DWSA 1S5IH 2EDYA 1J87A 5HYEA 4AM0A 1RUMH 3L2LA 5EBWA 4IJTA 3E3QC 2AZUA 3FRPG 2AJSH 4NZ8A 4M00A 3AS3A 3REWB 2DLEA 1OGAB 3PQYE 5DZVA 3EH2A 3WNLA 2YEQA 3LAFA 1CLOH 1MHPL 2O5XH 4M7LT 1JK9A 4KNUA 3LD8C 3OKEA 5K39B 3CQPA 2N7BA 3P9MA 2AJYL 3LNEA 3VH8B 2J2ZB 3QUHA 2UV3A 5C9JB 4UOJA 3X13A 3EXLA 3T0EE 2CMRL 5DJ6B 1GC1L 3MFFB 5PAZA 2N0KA 4M7JH 3ZRFC 2A74C 1XGUA 4ODHL 5D7JA 4OIAA 5DJYB 1JN6A 4BUHA 1N2RA 1P4BL 1ZANH 4C83A 2FBRA 5JW3L 1MRDH 1CTNA 3MHZA 3JTSB 2EDFA 4NN6C 3P3RA 2Q8AH 4V1DD 3UTSD 4HUXA 1CK0H 4WNJA 4NC1E 4NYLA 3L3OC 4X50A 5TGBB 5CLYA 5BVPL 4N20A 4WEBH 5DQDH 5KJ4A 5IHZB 1O7SA 1TQCC 2D4DA 2AV7A 5DGRA 1VJSA 1DDHB 4M5SA 4YVUA 2VDML 5D7IA 2DYPA 2IV9A 5IIEB 4Q6IB 1CFMA 1KTRL 4HEPA 3IDGB 5E0QA 1M7IA 3QUKB 4M29A 5ALBL 3ASOB 5DF0A 2X5PA 1EUTA 3BJ91 3Q9QA 5IMLA 4KO9A 2YRZA 1H5BC 3BAXA 1EJOH 2O93L 1XGPB 2ADIA 3MV7A 4IMKA 4ZMVA 2ARJB 3VFTA 4UB0H 2WBWB 4RSVA 5JDJA 5EIIG 2FO1A 2O61B 2FNBA 3JWOL 2WLKA 1H3WM 4HS6A 2RQ8A 1KIUA 4IRJC 1UASA 1JE6A 3DVNA 3S5LB 4BSVA 1XF4B 2GFBB 3L4VA 2XN2A 5IM7B 2WQ8A 4PGDB 3EHBC 3RTQA 3VXQA 3DVGA 2CQVA 3QDJD 3G5XA 4MQXD 2OA9A 3EAKA 1M2OA 1YDPB 3M17B 3OV6A 1CF8L 1KCUH 3SE4A 1MDTA 3WLWC 2N0MA 4L4JA 4YHLL 2AQPA 1MLBB 3DJSA 4FXKA 3V52L 3KPQA 5E8NB 1ACYH 1U33A 3QIWA 4UQBA 2VRQA 2PWGA 3F01A 3T1FA 1QR4A 3D4YA 3TP4A 1FZOB 3ZO0A 4BZYA 4HS3A 2QQKL 1I1YA 3MOBH 4OZFA 3WJMA 3EKCA 4LNRB 1FZJA 2B14A 4NWTH 4IGBA 4R83A 5JDSA 4G6JL 5HP5A 4JFPA 1ZY9A 3W5MA 3U36A 4CNIB 4BZ2L 3E80A 3ETSA 2VDPH 3WAKA 1IAOA 4UM9B 1M6OA 1AKJA 1YEDA 3MJ8B 4PAZA 3TWYA 4QRPA 2E59A 2CO7B 4M9OA 1ASOA 5I1AA 4U1NB 4HX1A 5F44A 3QEUA 4DKAA 4F1ZA 2CR6A 2V17L 1P5UA 2MMXA 2NUPB 4WKZA 4XCYB 5KS9B 3O9WA 5DZAA 3QE5A 4UV7H 5HI3C 4DAGH 2KUTA 3ARDB 4M4RB 3VW3L 3U7WL 4NUGH 2FWLB 5G5DA 3GXTA 5DJZB 1N18A 5SWQA 4D0DB 1URZA 3RL2A 3NCCB 4H20H 5GHWH 2NXYB 4JZOA 2C9RA 1I4FB 4ZO7A 2ZG3A 1B4JH 1USQA 4KKBD 1ZEAH 4GB9A 2Y7QA 1KXTA 3WV0A 3TN0C 1KXQE 1OIOA 1G7MB 4G8FA 2J6EL 3MCKA 3COOA 4TQIA 1AP2A 4PRPD 3JSSA 1MCPH 4Z7WB 3T0EC 1CN4A 2XWBB 1XF5A 4AUYA 4ESKA 4LHUA 4UDUB 3DX7A 5CXPA 2ZONA 4G8IB 1ZRUA 2PXYA 5T5FA 3VWJD 3VSVA 3VXRD 3ESPA 2ICWI 3FHEA 4L0ZA 2WBJB 1HX0A 5GRUL 1DCLA 2Y2WA 3SE3A 1MVUA 1XF2A 4L1TA 2F8VA 3SKNB 2WXQA 4PB9H 4AGLA 4X5XB 2ZOKA 4NC1C 4NRXB 1AGFA 5HHQA 2OTWB 4KAQH 5IHWA 1MY5A 4LP5A 3MV9E 4JDEB 1TKWB 3U0WL 3MMEA 4MAYA 5FHAH 1UYWL 5L2JB 1BLNB 1XIWD 3HLKA 4HCRA 5TF1L 4HWEH 2ZJSL 2DQDL 4NI3A 4XNDA 4XWOC 2PO6B 3DGGB 3BDYL 3LS4H 5F93C 4BFRA 3WAJA 1EAPB 5CBEA 3O2DH 4JPVH 1RJYB 3KPPA 4GMTL 4K5LA 5FW6A 3RVUC 1B6DA 1MJ8L 1O7DE