2W88A

Plastocyanin variant with n-terminal methionine - open structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w88A00
2GBAA 4DP2X 1FA4A 3OMNB 2VM4A 1IKOP 1AS7A 4BWWA 2IDFA 4A2FA 2GIMA 1J9RA 2X87A 3CDZA 1OF0A 2UX6A 4PCYA 1JZGA 2HLEB 5B1KA 4CSZA 2FNWA 3PPSA 2VSKB 1KDIA 1KYAA 2PP7A 4YL4A 1OCZB 3FSWA 2JFCA 2BP0A 2P80A 4YSDA 4A66A 4E9TA 1SF3A 1WAEA 1TU2A 4WTQA 3FQ2A 3ASOB 5TK2A 3SBRA 3QJVB 2DV6A 1CURA 4A2GA 1KCWA 4YSOA 1W6WA 1AG0A 1QLEB 2BW5A 1IBYA 1ZIBA 1OOWA 3NSFA 2XWZA 2YAMA 4GP5B 1CYXA 5TK4A 1GY2A 4YSUA 3CDZB 2IWKA 4JKNA 1AANA 1JXGA 1NWPA 1HFUA 4KO9A 2PPCA 1ZPUA 2BW4A 3FQYA 2OCCB 2FT6A 1MDAA 1GR7A 1GW0A 4BDVA 2HXAA 1VLXA 2W88A 4YVUA 1RKRA 3UACA 1GSKA 1OCRB 3SQRA 1QHQA 1SHWA 3X1BA 4HCFA 1ZDSA 3ABKB 4G71B 3CVCA 2CAKA 4X4KA 1XB6A 1J9SA 2MRYA 3HB3B 4P5SA 3IBOA 3NJJA 1AS6A 3TBCA 3X2QB 3NP3A 4YSAA 2XX0A 3WG7B 4KOCA 4UF7C 1OE2A 3QJUB 2OJ1A 3NSDA 2Y69B 2XU9A 4BXSV 1QNIA 4P5RA 1PF3A 1JZIA 1NIDA 1A4AA 2IDSA 2JKWA 2H5UA 4W1TA 1SJMA 2IH9A 1AZUA 4YSEA 4G72B 2P80D 1OCOB 1NZRA 4Q8BA 1M56B 2XV3A 4UANA 3T6XA 1B3IA 2B3IA 1JZJA 2QDWA 4HALA 2YAFA 5A7EA 3DKHA 1NPJA 3X1GA 2I7OA 3V9CA 2J57A 1GS7A 2VN3A 1EHKB 1DYZA 1IC0A 3NJHA 3S3BB 1ET5A 3FPYA 4A2HA 5I6OA 3NJGA 3C75A 1PZAA 4HZ1A 3X1NA 3ERXA 2FQEA 4A67A 3NJIA 3ZIYA 2IDUA 2YAEA 5I6KA 1JZEA 3UGEA 2QPEB 1IBZA 3TU6A 1TEFA 5I26A 1JZFA 3GXUB 1SFHA 1PLBA 2PP8A 3WKQA 2EILB 2PPFA 3GDCA 3NJLA 5B1JC 1V54B 5D4IA 3FU8A 3SBPA 1SDDB 1J9QA 1SFDA 2ZWNA 3S8GB 4DP0X 5D4HA 8PAZA 1N68A 1ASQA 4DPCX 3FU9A 2BZCA 2HX8A 2Y1AA 2PP9A 2FWLB 3N55A 4HCGA 1N70A 1RZQA 2BO0A 3S3DB 1JERA 4UAHA 4NERA 3X1FA 4AX3A 4GYBA 2YXVA 5I28A 1AZCA 1E5YA 4HCIA 1SNRA 1V55B 4E9YA 1MZZA 1GS6X 2DYRB 2NRDA 3T6VA 5B7FA 3FSZA 2WO3B 2N0MA 3WNIA 2EINB 3OM3B 5I5IA 5E9NA 1GYCA 1L9SA 1NIFA 6PAZA 4ZK8A 1RZPA 1KV7A 5IY5B 2ZXWB 1UATA 5D4JA 4AKQA 3AZUA 7PAZA 1L9PA 3WI9A 3DIVA 3UADA 4A2EA 1WS7A 1X9UA 1KDJA 2PCYA 2EIMB 4YSRA 1AZNA 3S8FB 1SF5A 4DP8X 2GC7C 1A3ZA 4HAKA 3NT0A 2YAOA 3T6WA 1J5CA 5EHFA 3AG1B 1KCBA 4RH4A 2VW4A 5B1JA 4DPBX 2HX9A 1ET8A 1TEGA 1NINA 1BXAA 3ABLB 3MBWB 1E65A 4NAJA 2FT8A 4YSQA 3QJRB 1NIBA 2PPAA 4QLWA 3G5WA 4YSCA 1V10A 3JTBA 1IUZA 5I5JA 3SBQA 1PLAA 2GHZA 1ZDQA 4JHVA 4KNUA 4W9ZA 1E67A 3FSVA 3NYKA 3IE9A 2HX7A 3AG3B 1L9OA 2AZUA 1J9TA 1W8EA 4YVNA 9PCYA 1AS8A 3T6ZA 2OV0A 4HHWA 2IWEA 4KO7A 3U25A 3FQ1A 1ASOA 3S3CB 3FYIB 1J5DA 2BHFA 3PAZA 1ILUA 1NPNA 1WA2X 2DWTA 2UXFA 3WNJA 1HAWA 3TA4D 3CVDA 4QKTA 2YAQA 4NB7A 3UAEA 3NJFA 2FQDA 3AG2B 2I7SA 1EZLA 4DP4X 3NJNA 4WKXA 2IAAC 1CC3A 4EF3A 3CG8A 3N2JA 3GYRA 3L45A 3NSYA 3EF4A 3FS9A 3NP4A 3KW8A 1BYOA 3QQXA 1ASPA 1AACA 1A4BA 3OD3A 4CSPA 2W8CA 3D12B 2J56A 1BAWA 4E9SA 1M9WA 1BQKA 4E9QA 5B7MA 4TXVB 1PCSA 2CJ3A 4M3HA 2HRHA 5PCYA 3T71A 1NDTA 3DTUB 3FSAA 3V9EA 4AKPA 2BP8A 1PAZA 3CZUB 3PCYA 2EIJB 3ZX1A 4DP6X 2EIKB 4BWUA 2CUAA 4YSTA 4DPAX 2AFNA 4F2EA 5I6MA 3UAAA 4GP4B 2XV0A 3H4HA 3FU7B 4DP5X 1BXUA 3TASA 5LDUA 4KOBA 5F7BA 2XX1A 1ZV2A 2VW6A 1A65A 2DYSB 2YXWA 2WO2B 2RACA 4A68A 5I6LA 3ZDWA 4G70B 1JVOA 3QJQB 3EHBB 4A2DA 2LLNA 2YAHA 2BP8B 1E5ZA 5B3SB 1URIA 4PAZA 2PPEA 2WSDA 1AZBA 2UXTA 1CUOA 3HEIB 1OE1A 1XMEB 4DP9X 6PCYA 1SDDA 2XXGA 5PAZA 3ABMB 3ABGA 2VM3A 3EH4B 1BYPA 1CYWA 1WA1X 1WS8A 4L0PB 1MG3C 2BP0B 2VMJA 3FYEB 1BQRA 3ZBMA 2JXMA 2AANA 3IEAA 4DP1X 5I6PA 1L9RA 1XB3A 4FAAB 2R7EB 3WIAA 5AFAA 1BEXA 2GB2A 5AKRA 2ZOOA 3CVBA 2B08A 2BZ7A 1FFTB 1GS8A 4N8UA 3IN2A 4BK5C 4E9RA 4E9VA 1MG2C 1ZIAA 2HRGA 3PXLA 1JVLA 5I6NA 2QT6A 2UX7A 2R7EA 2HZHA 1PNDA 4GP8B 1WA0X 2IDTA 5FC9A 1AG6A 2H47C 3FPXA 2VSMB 3EH5B 5B7EA 1JZHA 3OMAB 2YARA 2QDVA 4GXFA 2ZONA 2XYBA 3IN0A 4AKOA 1PLCA 1M57B 2H3XC 4E9XA 1R1CA 1PZCA 2AVFA 4N4YB 1PY0A 2CBPA 3PAUA 2XUWA 4K9JA 3AY2A 2FQGA 2XXFA 2XLLA 3FT0A 3PAVA 2J5WA 5B1BB 1T5KA 3T9WA 2E86A 3KW7A 1ET7A 2FJSA 1OV8A 1AIZA 1F56A 3NJMA 1AR1B 3OMIB 2YQBA 1RCYA 2GC4C 4KO5A 1JXFA 4F2FA 2Q5BA 4AZUA 2Q9OA 1AOZA 2UXVA 4JHUA 2IWFA 4YSSA 2TSBA 1OE3A 1AQ8A 1BXVA 4HHGA 1KBWA 5B1AB 2YAPA 3TBBA 2IDQA 1L9TA 2CCWA 4KNSA 1ILSA 1NTDA 3NJKA 2PCFA 1NICA 1MZYA 1XB8A 4MFHA 3WKPA 2FT7A 1JXDA 2XVBA 1KGYE 2FQFA 1PNCA 1BQ5A 4YSPA 2I85A 5I5MA 4G7RB 3FU7A 4BXVA 2TSAA 2UXGA 3BVDB 3MX0B 1A4CA 3NSCA 3PLYA 3AG4B 2A3TA 1OCCB 1YLBB 4E9WA 1A8ZA 2IH8A 3UABA 4ENZA 2AZAA 2MTAA 4G7SB 3OQRA 4KO6A 5AZUA 1PMYA 2GSMB 1JOIA 1AAJA 4AI7A 3X1EA 2DWSA 4G7QB 4DP7X 3RYMA 3QJTB 2VW7A 3ASNB 1L9QA 5F7AA 1TKWA 4FA7B 2PLTA 4F7KA 2GI0A 7PCYA 4HIPA 3AW5A 1ID2A 1KBVA 3EH3B 2BWIA 3QJSB 2X88A 3JT2A 2XV2A 1I53A 1ADWA 4BWTA 1DZ0A 1NIAA 3H4FA 4KNTA 4BDVB 2J55A 2PPDA 1NWOA 1X9RA 1HAUA 1E30A 2BWDA 1NIEA 1W6LA 3QPKA 1FWXA 1GY1A 1AZRA 2DY2A 1PZBA 1SHXA 4Q89A 4M4RB 2FTAA 3BQVA 2QPDB 2CALA 4GY4A 5ANHA 1ETJA 3H56A
chains in the Genus database with same CATH superfamily
5DMGD 3RWHA 4O2CB 4Z7WB 3NTCH 2PO6A 2GKIA 3T0EA 1FAKT 5I8CA 3P4MB 2IDFA 4WVRA 4G9FD 1FLRL 4P59L 4RDQF 3FTYA 4HEPG 4QHMB 5DRZB 4CVZB 1A7BA 3B2UC 2QHRL 3KXFB 3VH8B 3QWNA 3D0VA 4M1GH 3VFSA 1MW2A 4OD3H 4A66A 3EDJA 5ICZA 1VZGA 4K5OA 4FZ8L 3QJHB 3RVVD 5JW5B 1K8IB 2CJSA 3SBRA 4UV4H 1WBYB 4PJDF 5JXAH 3MRLA 3ULVL 4ANVA 1AG0A 1JD9A 1R3HA 2BW5A 3IS0X 4M1DH 5ADPH 3TIDB 5KVEE 3MV7E 3F62A 3RY6A 4QOKE 4O2FB 2X6CA 4QOKA 1P4LB 3EJRA 4XMWA 4GRWB 3VRIA 5I71C 5HI5D 4Y16D 1OK8A 3ARSA 5HD8C 1NM9A 2QGDA 1CU4L 1YDPA 4TSCL 1OARH 2HT4C 3D9AL 4K8RH 4UU9A 2EYTB 2E47A 1QSEE 2W60A 2Z8RA 2VR6A 3RGVB 1RURL 1ERNA 1E40A 3KHOA 1AI1L 4DESA 1INEH 1C1EH 3AXLA 1E6JH 5TE4L 3F04A 4MD5A 3EO0B 3OAYK 1DVFC 3E6HA 3KR3L 3M1OA 3V5HA 3C60C 4FJYA 2WXFA 4X4XB 4B41A 3D09A 2G2NA 4W9CC 2OZ4L 3FFDA 4H0IA 5EZPA 4IIQA 4L9LA 1BFOB 3PNWA 4ZMPA 2VIRB 2B0SL 3P4LA 4TQEH 1KXQA 5EOQH 1M56B 3FRPB 4JKPL 2DBLL 4OGXH 1I8IA 2PXYB 3QIUB 2I7OA 4BQ8A 5F0JB 1GS7A 5IVXB 4FULA 4P3CL 1FCGA 3PHSA 4PQXA 2D3VA 2H9GB 2VLLB 4K5MA 3FBKA 3HC2A 5LAPA 5BW7A 3SDAA 3KPPB 4JZNA 2FJFA 3AY4C 1Q72H 4N90D 3X1NA 4AIZB 5I1KH 1YNKL 4UZGA 5DWUL 4NQDA 4NCC1 2O93L 4Y0GA 3D3VE 1CI5A 2I5YL 5D7LB 1WQVT 1A6ZA 3B37A 5C08D 2LLGA 4NQTA 4H0GA 2JV6A 2WB7A 3BZFA 4J2QA 4AQEA 4TUJA 4UQ2B 3RDTA 5CCHE 3NFPB 1BZEA 1ZCRA 4X7DC 2ICEB 2X4TA 3B9EA 4RGMC 4XBEL 3FAWA 3DJRA 1RL1A 2V8LA 4YIQB 4HIJA 4RVBA 1SFDA 2NYYC 5BNXD 3BCDA 3QCVH 2Q8BL 1SDAB 2BZCA 2X4QA 3PHQA 3D6GA 1L7TL 4XNQB 5T3ZL 3KYOA 4D0CA 3TO4D 1HK6A 3D69A 4WO4B 5A2AA 1XBRA 1NL0L 4YDVB 4JN1H 4I13B 3GI9L 4ILDA 2H26B 2V2WA 4PP2A 2QADD 4H1LG 2YXVA 1QPXA 2J8HA 4PM1A 5EC2B 4GQQA 2YJLA 4ICXA 3TN0D 4KH9A 4EI6A 4OM1H 2R8SL 4QRPB 4J3OD 1OOAA 4F7PA 1A6WH 1FFRA 5ID0B 1BZ8A 3KJ4B 2VR3A 4JFZL 1FP5A 1MJ8H 1OAXL 3D5OF 5JHLL 5F7WC 1RY7B 5C0ND 5IW1A 4RISH 3IJEB 4XP1L 5D7JB 4PJAB 1FFPA 2EH7H 4ETQB 5JQHC 4PGEA 1RPKA 2J72A 3MRQB 2A74C 4DKFH 1XF1A 1TVHB 3QUHA 4ODVL 4P3DB 1H5BC 4I4WA 3N06B 1BGXL 2J2ZA 3O6KL 4E42A 2VOTA 2K8QA 2QKIB 5HHNB 4LE8A 2YUZA 4DKEL 4OQTH 4MA7H 3OGOE 1HOCA 4P2OD 4H1LB 4WHTA 1B3JA 4QRTB 5K1VA 3AC0A 5DQJB 1TFHA 1OGAD 2B3RA 2I26N 3NPSC 4HJJL 3CC1A 2NLJA 4JGMA 3CHQA 4GMSH 2AQPA 4YDKH 5JDSA 1C8PA 2P4AB 2JB6A 5ICXB 1NIBA 5DEFB 3EFDH 3BW9A 1ZE3C 3GSNB 4K55A 5K69A 1ULVA 4RDBA 2NX5D 3MC0A 3S36L 5I1GL 3CZFA 1CXEA 2CSPA 4P5KA 4BA0A 4LSSH 1F11A 3BT2L 3QS3A 5KJ7E 4BSJA 3A5VA 3AUWB 5I8EB 1VFUA 2YPLB 5LG1A 2GSGA 4YBLC 4HWNA 2JCCB 1AS8A 5KBMA 4Z7VA 1QSFB 2JKTM 4LSUH 4R96A 3U0TA 3W1ZA 3F7LA 4NZDA 3LQZB 3ZQ9A 3IDIA 4GKLA 5CHNA 4HIXH 4RMRA 4FX5A 1NGQH 5EU4B 4J27A 1BWWA 4LZKA 1YMMD 3PAYA 1QRKA 3NIDB 2BOBA 4DP4X 1PIGA 1Z5LA 1OB0A 2AV7A 4WWKA 4BK4A 1XO8A 1ES0A 2Z7UA 3L45A 5CILH 3NSYA 4YE4L 2OAAA 1THAA 4PJBF 3GXIA 2VSDA 4AZ8A 1XSKA 1PLGH 3KPRA 5FUOL 3N0AA 5JMRA 2FLBT 2G3MA 3HAEA 4H1LA 1M7IB 4WHTB 4PJEF 1SEBB 3ZDXF 3MRQA 4DQAA 1GOGA 2BHZA 5IHUH 4ZDHB 3RWFB 1LO2L 3U9WA 4IDJL 5E99H 3DXAE 4JJ5A 2LQRA 1KIUA 2DQ6A 3BKJL 4QRAA 3VXRB 4Z95L 3MV9E 3ETSA 5K33A 4U7SA 1MQKL 3CZUB 3PCYA 4QHNB 2OZ4A 3U0TB 5TDOB 1XMWA 1FVCA 3MUJA 4KAQL 1BQUA 4MDIB 4RQQB 4JFOA 5IFJA 1A6VH 3UPRA 4XC3H 2N4IA 4XHQA 4OGYL 1FYTD 1SMOA 1YMHB 1JVKA 1HQ4A 2AABL 4TVPD 2TRHA 5ACZA 1S9VB 2X1XR 4M29A 5CIPH 4G8IB 3S96B 1FH5H 4Z7UB 2OJZL 5HYSA 2WUBH 2V17H 3RPIA 1NGWA 3MTRA 3WEBA 5I66B 3V0DA 3SPIA 2JB6B 5ICXA 12E8L 3N44F 2PTTA 2NXYC 1WAAF 2IXQB 4G8EA 3VRLE 3J8F7 4PSPA 3NIGB 1DQLL 4DSYA 3K2UH 3QEHA 3NFPA 3VNYA 1M71A 1F11B 4OCYH 4WHDA 1G0YR 4HV8B 3MRRB 1PQZB 2Y7QA 5HY9B 1X3DA 2XHNA 2WC7A 2C4XA 4FQHB 1JNLL 3HS0B 1AQHA 4NC0B 1UHVA 5PAZA 5CGBA 3OAZH 1ORQB 1ZOXA 4FA8A 2WO4A 2YQ2A 3X3FL 3SKOB 2EDRA 2VMJA 4EUPH 4ZAKD 3VNZA 3BD4A 3ZKNC 5JTWA 5LHDA 2OL3L 2EVFA 4Y5YB 2ZICA 1A9VA 1J0YA 1BFVL 4P2OC 3NSJA 2DI9A 3MFFB 4R90H 2UZXB 5AKRA 3A4AA 2CQVA 5ABZA 2B08A 4NQCA 3U0WL 3ZR5A 3GKZA 4OIFA 1IBHA 2XPYA 4WW1B 3RX8A 2B5IC 3ILEA 2ENYA 4E9VA 4LXFA 2PUQT 1QKZL 3KNBB 2ALAA 4FERA 1BVNT 1RUQL 3M45A 2R7EA 4XXCA 5C0AB 4Z7NE 3Q13A 2JJSA 3X3GH 2C9PA 1KGCE 1NMBH 2DIAA 3DHUA 1Q1PA 2DQGL 1FFOA 4FQQB 4JZOB 5SWSD 1PY4A 4HS6A 1XEUA 2ZONA 4C55A 5HHXH 3PJSA 2BWQA 2YEVB 1TYJA 2ORBH 1FNSH 3FT2A 1FE8L 3FUKA 3BKYL 1TZHA 2ATKB 3EJJX 4FXLA 5I30H 2CBPA 3K0YA 5JDJA 4FI7A 1HZKA 3ZL2A 4G8GA 4JJHA 2EVJA 1NCWL 4NUMA 1IAOB 4OLZH 4RMTA 1UXWB 3ZTNH 1OPGL 3CUPB 3MREB 4KQ4L 1HH6B 4U6HA 2GTZB 5KVGL 1J5OH 1J1OH 4JKLA 3GLDA 5JPNC 4CBZA 4K2UH 2R59A 4KHTL 2IWFA 5JIQA 3LKSA 4FFWC 5HBBA 3FUNA 2YOAA 1MCWM 5KG9B 5B1AB 1SXNA 4MZIA 1DQMH 1OQXA 3RWGA 1DQML 5C0RL 5J4MA 2YXMA 1E3ZA 4WI6A 1NTDA 2V9UA 4PJ7E 4FC3E 4N2KA 1MCJA 1MZYA 3T2OA 5K9KA 4AYFB 3DI2B 4HU8A 1NGYA 2BVOA 4ALAH 4RFNB 3T0EB 4Z0BL 5EO0A 3K3QA 5EZLA 2A77L 4ZPVB 1J88A 1Z9OA 4Y5XC 1BJMA 1FH2A 3WSQL 1BJ1J 3BVDB 3NGBC 1KG0B 4L8BA 5JQIB 3VRJA 4PLKC 3MOQA 3AG4B 4WI0A 4N87A 5IM7B 1DP0A 2GY5A 4NKDB 5LGYA 2A0LC 4E9WA 2DBJA 1KLGA 2AZAA 3ES6B 3TH4T 1BF2A 2J4WL 4D9LH 3EW3B 2R83A 4HUXB 5IJVB 4ZMVA 1P9MA 1C16A 1Z5HA 3SDDD 2VDKL 3BKCL 1QRND 4PJGF 4G7QB 4Z7WA 1JPGA 1HWGB 1Q0YH 1L9QA 1X5KA 4ODTL 2FCBA 4Q9QH 4R0LC 4XWOD 4BZ1L 3EFOB 4JPIA 1SRDA 1GCYA 7PCYA 3CDYA 2ZCKL 3BJLA 5C92A 5FYKE 1CGUA 2NXYD 3ESMA 4BKLA 1U3HD 2MOGA 1JRHL 2ZX6A 1MSPA 5I1IH 4BWTA 3L3DB 2DLIA 2HMID 4ZYKB 4DVRL 4O2FA 1AR2A 4XMLH 4AQ1B 4YHZH 3A6CL 4LF3B 3MJ7B 5DMKA 3D52A 3TEZA 1UWXK 3QPKA 4X7SH 2XVGA 2VDLH 1SN0A 4TSBH 1KG0A 5F6IC 4L3CB 4WWPA 1GZPB 2CR6A 4B9KC 1NL0H 3QUXD 2APBA 5KUKA 1A4KA 2W65A 2IJ0C 5F72S 5T1JA 4FNQA 3UJIH 4H26B 3QC6X 2VM4A 2Y6TE 1I3GH 1N0LA 4NHCL 2XICA 2X1WL 4KKBC 4QXWA 5BOPA 5HYJE 1Z66A 1IGFL 3IJSA 1C5CL 3V0FA 5DVKA 1K8IA 2ADIB 2IADA 3JUYA 4FE9A 2NNFA 3VFGL 2A9CA 4J8QA 4GAGL 2HLEB 4U1KA 4YDLB 5KS9F 4CSZA 1U8LA 2FNWA 4LP5A 1IFHL 4Y89A 5CD5D 5EPMB 5AAMC 3RI5K 3WV0A 4F8NA 3EJYC 1UGKA 4YEFA 3DX2A 3ZE1E 1MJJA 4O02L 1G84A 4MQXC 1KYFA 2DQDH 5SX4H 3IXAB 2WXRA 1FPTL 2V5RA 5I16B 1NGXB 1GIGH 2DV6A 1A7PL 4Z6AT 4IU2B 2P8PB 3B2DC 2PCPB 2Z0UA 1CYXA 2K9UA 4XC3L 4Z7OE 3WUWG 2EZ0C 3BT0A 3VFUA 5KVFE 4JG1L 1QFHA 1HFUA 32C2B 4HJSA 4NM4H 2X0UA 1BFTA 1RSYA 2VWEE 1IARB 3MJ9A 3VE0A 3CU7A 4YPJA 2D9QB 2O4EA 3IRCA 3RIFK 5HP5A 5EEXA 4QRBA 3QI9B 1I1AB 4AG4H 3ENEA 3TEYA 4QTFA 1OCRB 1XL6A 1EEZB 1FAIH 2A9MH 2O5ZH 4JRYE 4PS4H 5DHVB 5B22A 5HDLA 4G71B 1CN4A 3CC5A 3D69B 4ZMWA 2QADC 1XB6A 4HIJB 1HH9B 1MJJB 3RJDA 1MVUB 3LJ3A 5HJBA 1RZFH 5AOIA 4YUEH 4KOCA 3S5LB 1TIUA 1OTSC 2EDLA 3BP6B 3BVXA 4IOIB 3VX0A 1CF8H 2WOYA 3Q2LA 1JZIA 1MHHA 1TVDA 4N6RA 5E8PA 1Z0NA 3U9UA 1IC4H 2NXZD 1D7DA 1V7ML 2ZXEB 2F6AA 3GPEA 3L1EA 4GEJA 3TVMC 1KN4H 5B38G 1NZRA 2YA0A 2W65B 1TZGH 3OXSB 4XP6L 3MRLB 4OJFL 4AUYA 2C3WA 3PFUA 4E0RB 4GNKB 3ZYIA 4N2HA 4JPSA 5FA3A 2P8LB 3WEAA 3SODB 3O2WL 1DCLA 1Z9PA 1E27B 1RK1A 2Z7YA 2D3LA 1F45A 3CQPA 4FFYL 1DSFH 2AXHA 1EAJA 3NG5A 1F6AA 2AKRA 4IYKA 3UTTE 3LEVL 3B7UX 2Z93A 3LRHA 3RRQA 3MRMA 3GSRA 5D7JA 5KSBE 1HHGB 4TYUA 4TPRL 4Q0XH 1JBJA 4NSKB 1IBZA 1RJZB 2A6KB 3TU6A 3RKPA 3I9PA 3QXAB 3RZWA 3UYPA 1RMFL 1LD9A 4MASA 4IS6A 2A99A 3DOHA 1AGDA 1NANI 3LV3B 3WEMA 2KS0A 3DOSB 3U2SA 2CHZA 2GSIB 3T2PA 3H55A 5K59E 3CFDA 5HSFA 2BNQB 3VWKD 2CR3A 2WP3T 4O9HL 2F7QA 4N1EA 5DYFA 5CSZB 1GGYA 4Z7QF 32C2A 4PBVC 5DJCA 1FORL 4WENB 2Z92A 1QA9B 3GO1L 3S3DB 1LTXA 1QFWI 3ATBA 4FD0A 1CICC 3M1CA 3BFOA 4IIQC 4WCYH 1NLBH 1E5YA 4BELD 2BCKB 3QEUB 1T1YB 1ZT1A 4KDTA 1GS6X 5DWPA 4BZ1A 4TF4A 3INUH 1SJHB 2ZSWA 1S7WB 4MCYA 5BJTA 1YEDA 2N0MA 2FO4A 4R26H 4WV1A 2ISDA 1QLFA 1FL3A 5KYYA 2FATL 2RCSH 4PJHF 1BOYA 1D5XB 1A6UH 1JCKA 4PJ7A 4W4NA 4LEXL 5AEAA 4Z3IA 5IJDC 3UAJA 5HGDB 1K3IA 4IU2A 3EBIA 2C8NA 3SDAB 3V4UL 2LT9A 3SE9H 2PCYA 1F3DH 2ITCA 1FLTX 3KLLA 5JNYB 4E5XB 2VUOA 2YGOA 1S7SA 4XPFH 3OXSA 4UOZA 3BRFA 5IOPB 1ACZA 1TJIL 1XGYL 5IQ7L 3Q8AA 1RVFH 4DPBX 2QZ5A 2B4CL 4JMXA 4OZ4A 4WQOA 3CZFB 4CVZA 3UBXI 4PJCB 3SZ6A 2I9TB 3D2UB 5EU7C 2HCZX 4LPVA 2QQNH 4ZG1A 1YG9A 4PBDA 3JT0A 43CAA 1BFSA 1V10A 5FV1L 2GHZA 5E4EC 5T3ZD 4W9ZA 3K6IA 2EUWA 1E67A 5J3HC 2VYRE 3WENA 2BOLA 3D2UD 3WTVA 1VERA 4Z0XA 2HX7A 1J9TA 4WFHE 5BPPA 4PRAA 4ZQKA 3QUYC 4G80B 2EEDA 3V7AE 1ZEAL 5FEBA 3VXUD 3VQ1C 4HJGA 1DQVA 2W07A 2VJXA 3UTZA 5C07D 3C5ZB 4MRCA 4UNVA 3BGFC 4M6OL 4X8CA 2DLFH 3RI5F 4R4BB 5BVPL 5HVFB 1X7QB 5DJXB 1R5IA 3BZEB 1F8TL 3ULVE 2CRYA 2WQUA 4TMPA 1Y0LA 2ROYA 1SJEB 2E8ZA 4FTDA 1OQOA 4PRPA 3THML 5D1QE 1L7IL 4EF3A 4M48H 5DLML 2VDMH 3UIYA 3V0VA 3S34L 2IANB 4OIAA 1ZXKA 5IBUG 3V0WH 1ASPA 4N2LA 2DMKA 2XZCL 4XRCA 1WHPA 5AWNH 1ACXA 4LPUA 1NC4A 2DQUH 4KRMB 5E8NA 3VD5A 5TQ0H 1AH1A 4RLDA 3T4AA 2BVQB 3CMOL 4LAJH 4XNMA 3Q2NA 4DAGL 4YJZL 4UM9A 1KYOK 1CFTA 1PQZA 1E43A 4H13C 4XC1L 3TX4A 1FC2D 4ONFL 3ZDZE 2DD8L 2D73A 4X6CE 5EN3A 4LOUC 5E8PB 1DQJA 3U9UB 4XB3A 4UQ3B 3D30A 3FSAA 1U21A 3WIHH 2X3CA 3HPLB 1EAPB 4UNIA 1RU9L 4XPHH 5FM4A 5E56A 2WGXA 4MJ4A 4F2EA 1A6VL 2P26A 3VWKB 2JCCA 3ZR6A 3W9DA 2OXGA 5I75B 1VKXB 2YXFA 1JZ7A 3FU3A 3WAJA 2ZCLL 4AJYV 2GJJA 1CLZL 2WMPB 5D1ZD 1BOGB 3N44B 4X9IA 3OJMB 4C58B 1Q9WA 1HTYA 2VGLM 1H3TA 4R97B 2J20A 2YUXA 1FYTE 3KDPB 2CXKA 2COVD 1S9KC 3WUZA 4D9QE 5J9PB 4L8DA 5DK3A 4ABVA 1RHFA 1VB9A 1M7DB 3QORC 1XSOA 4GW4B 1ZEAH 4WW2B 5IESL 5LNDA 1JI2A 4PJFB 5CP3A 5E8EA 3QHFL 3KBPA 3FYEB 4ZDHA 1MF2H 1NGQL 1AO7A 5B1CA 5I82A 1ZV9A 4KWUA 5G4MA 3OBAA 5EUOB 5FK9A 1YC7A 3HI6H 1HSAB 5JHLA 2AJVH 4XN1A 3OGCA 4DVBA 1C12A 1NMAH 2JF1A 4P4RA 2EICA 3WIAA 5BUGA 1YY8A 2CG9X 1BEXA 4HFWA 1NBYA 3JV6B 5DHYA 5DD6B 3IJEA 3G04A 3NBNA 4AUUA 4AYDC 1PDKA 4Z7VE 3B6SA 4BK5C 1J8HB 4MNQA 3SGJC 3HB3C 5I1KL 1TXKA 5I76B 2QT6A 2HKFH 4YDJA 1PNDA 1KZYA 4GP8B 5HVGB 3AAZA 5KYWB 2CPCA 4ZBJA 4AC4A 4ERSL 3VQMA 3IDNB 1AHWA 3JBG7 2WTOA 4OR1A 3ZJAA 3RUGE 5KJRL 3UZQB 1JZHA 1DLHA 2NR6C 4FRWA 4BEIA 2J8UB 5IUCA 4HHAB 3TTSA 2CMRH 3IDYC 4NYLB 2IGTA 1WD8A 1ZWIB 1NBZB 2F7IA 3RL2A 1N26A 4R4NC 4JFPB 3L7EA 3GB7B 2Y7QB 4BFNA 3WKNA 4HT1H 4HUMB 1WBYA 4P5MA 4XX1G 4GAJH 5D72H 5MENB 3K71B 4QAMB 4PRBA 5EBGA 2Y07L 1Q8MA 4Z7QB 3W57A 3WMSA 1T5KA 1UADC 5DGQA 1OSZA 3K72A 3QJZA 4GKNA 2YQBA 4O02A 2XV6B 4XB8A 4NN6B 1BJ1H 2H3KA 5TPWH 3LNGA 1OM3H 4MAUH 2UXVA 4ONHB 4AYEC 2Q7NA 4HIHB 1KBGL 3MV8B 5T1LB 4OLWH 5A2JH 4JBSA 1NUNB 1OE3A 3H85A 4AMWA 1ZT4A 3O6FC 3BESR 3GXDA 4RISL 1MI5E 4XVSH 2AEQL 1KB9J 4MNHA 3KR3H 1IEHA 4UI2A 4HUUB 3K80A 2ESVB 2YPKA 4DVBB 3NAAH 3WELA 3GHBL 1EFXA 4EDXB 5EIIG 4PGCB 4KK9D 3KNBA 5EF0A 2OTUB 5LCVH 1NBCA 3BWUF 2JJSC 4G7RB 1JTPA 5E00A 4FQLH 2YEZA 2YKKA 3ECVA 3L13A 3WFZA 2CH8A 2V5SA 2DQHH 3B9KC 1KGUA 3EJYD 1Z5LB 3GPSA 4UNUA 4P4KB 3STLB 3U46B 1YLBB 3BJ91 4TNEA 4WJ5B 3IYLW 1GH7A 3AFLA 3PHOB 1YN7B 4PREB 2WWKO 3L3IB 4XNQA 5LQBH 2DJ4A 3BP7A 3SKNB 4ONHA 1YUKB 3TT1H 5AB2A 3H3BC 1LO3L 2XBTA 3WCYA 1XGPB 1J87A 4BZ1H 5F7AA 1Q0YL 4ODTH 1KTDA 3K2MC 3SPCA 1HYSD 1SLVA 4FTVE 1YEJH 5FGBA 3Q01A 4ZSOE 4Y9BA 3JWOL 3KWUA 5E5RB 1NOFA 1XF5B 1XGTA 1MLCB 1OSZB 1SBBA 3BLPX 3TO2B 1SVCP 3RNQA 2XJLA 1MCRA 1NBZA 5IJKA 1U8OB 1JPTL 3P9LA 5L88H 3A6BH 4URTB 2CA4A 1JWUB 3J27A 1W6LA 4JRWA 5IJBC 4AV0A 3DTDA 3ULSB 5E6RB 2QR0A 4OLXL 3FO0H 4KKCD 3OXRA 5BOJA 3NCBB 1FNHA 4P5TD 1FNFA 4N0FA 5T1DL 5HYSB 4E2OA 5FDWA 1JF1A 2E9JA 5A1AA 2NYZA 1OP5K 1AGFA 3CZSA 3CVIH 1S9WB 2JIXA 5AVQB 3T0ED 3DYMA 3MRNA 3SQOL 1FA4A 4R7NB 4MDRA 4AMXA 4K9EH 2H2PC 2ZOLB 4OLWL 3UBGA 5HHMB 4LEEA 4R7VA 4V1DB 3WMQA 1FV1A 5KSBA 1UASA 2RB8A 5IB3A 3JZYA 4Y2LA 5CEZH 2HFEB 2R0WH 2EC8A 2WLJA 3G5XB 5GGTA 1DSFL 1TJGL 4KKLD 4ZMOA 1K8DA 3HUJA 1KYAA 1P1VA 2APTA 2VDKB 3BMVA 3GEWB 2DQTH 3RVWD 4UQDA 3P77B 3RVVC 1SXAA 4E9TA 2GK0A 2R27A 4Y4HC 4ONFH 5GS0L 4AL8C 5E2VH 1RJYA 2BIQA 3E8VA 2CRMA 3Q1SL 4HK0B 4QXVA 3QJVB 4JM4L 5E2VL 3FN3A 3E6FB 4DKEH 1GIGL 4G6KH 1WBXB 3B7TA 3DURA 3KLAA 5DJ6B 1FNSL 1OOWA 4UU9B 2VQ4A 3HMWH 1G0XA 1LK2A 1RZKL 4MQSB 5E2TL 4OGYH 4GKNB 3N3EA 3NIDE 1PFOA 3P2TA 3SDXE 3UX9B 4F15C 5JHDB 3AREB 3QUMA 4POZD 3ARBA 3S88H 1TJXA 1BZOA 2ZJSH 5ITBL 3MRMB 3FQYA 3QPXL 4BDVA 5T3XD 2N59A 1QVOA 3IJHB 3QXVA 2D4DA 3CPUA 3FH8A 1VACA 1W2KT 4NJ9H 3RWEB 3LMJL 4MS6A 2BXZA 2P52A 3CFDB 3RFZC 5LXGL 3QXAA 3UACA 3JZ7A 4N1CA 5IVOA 2G0KA 5C0AD 2BS8A 4PS4L 4N68A 2PETA 4C56A 3SCMD 4FKHA 1E6JL 5TE4H 3B1UA 1LNUB 1LVEA 3NJJA 3RG1C 3FTWA 4NZRH 3GHEL 3AT8A 4OZFH 5HHPB 4NZRL 2WVUA 3ZLQC 2WIMA 3LZLA 2VDLL 4TSBL 3SYQA 3NSDA 4XOBA 1TQSA 1QNIA 4JY4B 4R7DB 3P4MA 4JNXA 5F1NB 1P84K 2DKSA 2FDBP 3O2DL 2EVIA 3EYSL 4OLUH 4XP9L 4ZAKB 2UWEA 2CK0H 1BVZA 4O4YL 1B0IA 2C7UA 2P80D 5IUSA 1G9MC 1X6NA 3VXSD 2DDQL 1KIPB 1O7DC 4LKCB 2B3IA 2YAFA 1NEUA 1A1OA 1LE9B 1UXMA 5J56B 3VI3F 1EXUB 1EHKB 1QW9A 1MWAB 4BFEA 1CFNA 3ARFC 5KAQF 4EXKA 1TZAA 3PDDA 4YHPB 5F3HB 3WUWA 1TT6A 5D2LA 4HULB 3BGFB 1KYUA 1TZIB 1Z5YD 4OUOA 2VIRA 5INCB 4LLVB 1E0OB 2P5WE 4DZBB 3VFRA 1I1AA 2DTML 1MCFA 1T66C 3QR0A 4UTAL 4J6IA 2FSDA 3PWLA 3WIHL 1X5ZA 5DHVA 4ZFGL 3GDCA 2DMGA 1J8SA 4KAQH 3H9SB 2YD8A 3W11C 4LARH 1GGIH 3FU8A 2BY2A 3SBPA 4DWHA 3G5YA 4YDIL 4OQTA 5D4HA 4XVUC 3IGKA 4HW6A 4G9DA 5E4EB 3FMGL 3V79C 2OMWB 4AV5A 1YSOA 4ZO7A 2CHNA 2YD4A 1P7BA 3GMNA 4NWUL 2WXNA 1DLFL 5HDQL 5G55A 3MNDA 5B3JE 1NLBL 1I8KB 2WUCH 5D1ZC 4MAUL 1KZQA 3BAWA 1QBAA 4PJCA 2F7OA 2I9TA 2DYRB 1GTFA 3T0XA 5FV2A 3ARGC 5B7FA 2X4TB 4RRPA 3FSZA 2WO3B 2YMOA 5JMOC 5F89A 3AU1B 4XP1H 3SOBH 3WJLC 4OV6F 3ATEA 2H6UA 2AGJH 4XAWH 4PB0L 5EF1A 5C0NC 4F9LC 4XMUA 1AQKH 3NRQA 5IB4A 1B9KA 3NH7H 2ED9A 3RA7H 1UJ3C 4LRNH 1OM9A 3CH1A 4PJGA 5KTEH 1C9SA 2V2XB 2ED8A 2WV3A 2GUOA 1GZPA 1YMMB 3MRDA 4BFIA 1XBDA 2VQUA 3AWEA 1F4WL 3LSOA 5F1NA 4JDVA 4EN3A 4ZMQA 5DS8A 2XTLA 1E8WA 2D3JA 1UACH 3WDIA 4JUTA 3MRCB 2IGFL 4PWJA 3DRTA 5LGJA 3TJPA 1KC5L 1G87A 1QW8A 2G9HB 1MAMH 2Y36L 1Z1WA 4PSRA 4AVKA 2H7WA 2YPLD 5AVZB 4C56B 2V7HB 3QFDA 4EIBA 2X4SB 3QZWB 3EG9A 5FGCE 1QA9A 3HC4H 2PPAA 4PW3A 2MCG1 1I8UA 2H26A 2Q3AA 2E7HA 1EJ8A 3QO1A 4PP2B 2YJQA 4B50A 3MRPB 2FJGB 1NFDF 1RJYB 2E7BA 4JQIA 5C6TL 1U8HA 2HG0A 3O3BB 4RFOL 4LCUA 1CD0A 4BQBA 3SCMC 2XFXB 5F3BB 5J12C 5GISL 4S0TD 3AG3B 3DSNB 3T6ZA 2IWEA 3VGHA 2Z31D 1OGAB 1J48A 1XIWB 5AOMA 3PAZA 3ZKSD 2X38A 4G1MB 5CEXB 5AVXB 3QJFA 5D5ME 2UXFA 1Q9KB 2OPCA 1ZLVH 3UJJL 4NQVB 3PIQB 4QRFA 4L1LA 1LWHA 3BQUC 2WWMD 4W93A 1EZLA 4HD5A 4L8BB 4PRHD 5CJXA 1MFBH 1RZ8B 3S35X 4URKA 4LU5H 1WTGT 4RWHA 4EIZC 4X8GA 2BFVL 2GUOB 1OW0A 2UUDK 1GW6A 1SBSL 3QQXA 2AV1A 3P4OA 3OD3A 1YVLA 4WKZB 4GW5B 2O5YH 1IC5H 3PDOA 4ZD3H 3MBED 3N85H 2APVA 2IALA 5IK3B 3GSXB 4KTDH 4JRXA 5G2NA 3RU8L 3VB8A 3HRZC 2HUHA 3PP4H 4FNUA 1BQKA 4Z5RA 4E9QA 4G1EB 5FFLA 3IU4H 4QO1A 1U3HC 4FG0A 3HZMA 5GS0H 1YNLH 4H8HA 2OMWA 4R5TA 2ZT9C 1SY6H 2EIKB 4N9GB 4U1IB 4X6BA 3AQXA 3DX8B 2XWBA 4HUVA 1RD6A 3W11D 1EHLL 4F8PA 4F8OA 1I8KA 3DMMD 1WK0A 3Q6GL 2JJVA 4MJ2A 1E9QA 3KE0A 3MLVL 5F7BA 4K94L 3PWPE 3NCJH 4ZNCD 2F68X 1EO8L 1A65A 4L29A 2F54B 1D5BA 2OSWA 3CH8A 3O41B 3EG9B 1EEYA 3QFJE 1Q9OA 1OM3L 4M03A 3GIVB 3EO1B 2JJWA 4O51B 2GTWB 4D9QD 5IHLB 4KX9A 5IFAH 5B39G 3ZKMC 1GGBH 3O6ML 3QNYA 5JHLH 3L3GA 1YC8A 5DMJB 5EIVA 3WFBL 1V5JA 5AKSA 4IOFC 1SXCA 4MHHG 4UCFA 5L88L 6FABL 4Y5YA 2XWEA 2PXYD 2H2SC 3F7PC 4PRNB 4JANB 8FABB 3O6FD 2VDRB 2P7TA 1MW0A 2OZ4H 2UZXA 1MG3C 1JTTA 1K2DA 2BK8A 3ARZA 2AEPL 3LZNA 4P5TC 4YO0A 3ZKND 5BUAA 2YPVH 3DPBB 2FX8L 1L3NA 2VDQB 3IEAA 5AW3B 1SPDA 1XB3A 3LEXA 3RNKB 4FAAB 1KIRA 5J1AA 2C34A 1IKFH 1P5VA 1QPPA 5ESQB 2BOCB 1O0VA 2P49B 4HYTB 1IGTA 3RY6C 2FGWH 2BINA 4CVXA 4NIYE 2FBJH 4APXB 4M7ZC 3GBDA 1ZIAA 2AK4A 3BWAA 5I6NA 5I8OL 5BZZA 2ADGA 3US0A 1A14H 3QSKB 1E2WA 4RIRB 4G6AD 2XA8L 3OKLA 4XVUD 4I9WD 2ZWLT 5AL8A 4XXWA 4OGAD 3DNKA 2H47C 35C8L 3W2DH 3K5RA 4U6VH 3OSKA 3EH5B 3R7QA 2IXQA 4JFFD 4AKOA 3JWNC 2ATPB 1VENA 4NNYA 3CTTA 5DK0A 4FQ2L 2X12A 2DYPA 3AJ7A 4Y16B 1PY0A 5KUMA 2ZQKA 1MUJA 4EUPA 2E9IA 3BFQG 4JG5A 3FT0A 3UH8A 3MNZB 5B1BB 2DWDB 4BE6A 5JHBA 3CIAA 4LMQE 5EZJA 4P9HL 1MDTA 2J8UA 2WHVA 4PLJC 3KS0J 4YBQD 3TLRA 4OZIB 3MLUL 5E1HB 1FG2A 1YNTF 4LLYA 1NH6A 3DETD 3RKDC 1T1XB 1XR8B 12E8H 2AQ3A 4JHUA 4Z77A 4JFSA 3INUL 2HVKA 4QNPE 1N5YL 3TFKD 4AM0A 1ML0A 4JFZH 3ESVF 3D3VB 3NUKA 5CJ8A 2NT1A 1U8KB 3PL6C 3TGXA 2FIKA 1G0DA 4H20H 4KNSA 2Y5TA 1MH5B 4E5XG 1LO5B 1V27A 3MBEC 3MJ8A 3P02A 1EK3A 2NY6B 4W9GC 5BUPA 4J3OH 2WXKA 4L0YA 4XVOA 4RFNC 1JF1B 5DI8A 3F7RA 1BV8A 1CTNA 2CDFB 3FU7A 4X7TA 3VYOA 2OS7A 3MO1A 3NK4A 1S46A 2R0ZH 5DFWH 5F1IA 3FUFA 5GSRB 2WQRA 4LB8A 4FZEH 4M93B 4MA7L 2QMJA 2SEBA 5DD5H 4PJ5E 3L5IA 4PLKD 4OVUA 4QT5B 3Q8EA 3NZ8A 5CD3B 2Y36H 4HX1B 4Y2DA 3OQRA 3RJQB 1SQ2N 4YXHL 3WFCL 4L18A 2NY1B 3VI4B 4WTZA 1E2ZA 1CGWA 1JWUA 3MZGB 3VI4E 3K71A 4XPBL 3GK8L 2WNWA 2VW7A 2XXCB 2EDQA 3BLBA 3GUTA 2AJYH 2IQ9H 3LKSB 4K3EL 5HJDA 2CLZB 4TSAH 2WD0A 3L9BA 3SKJH 1BPVA 1ID2A 4ELMA 4PJ7F 1CFVH 2OYLA 3JT2A 4POZC 2SODB 3L3IA 3GSWA 3TIEA 2JH2A 1KJMB 5BRZA 1J0HA 2BY1A 4HS8L 1DZ0A 3BWZA 5DVPA 1UT2A 4FNRA 3NFSH 4UDUA 5DLLA 4YUEL 4G8GB 1IM3B 1L6XA 3H0TA 1OSYA 4XNUH 4JFUA 2P5WB 2E4TA 2B16A 3E8UH 1HHHB 3EO9L 1PKQB 4MJIE 4MMZB 4LFHD 2NW3A 5CCGE 3PV6A 2AS5M 2Z91A 5EDXA 3P77A 4HUCA 4QKXB 1UVQA 2NY7L 2PYFA 3HBGA 2B5IB 1LO5A 4OM1L 2R8SH 3ARGD 3GM0A 4BSVA 2JI1A 1UB5A 4ORGA 4DFHA 2OSLA 4LP4A 2UX6A 1DANU 2E6JA 3KPSB 4TULL 1JMXA 1WCBB 2KZKA 3BUBA 3ATDA 4R3SB 3T8MA 4MMZC 3RU8H 1RUAL 1IBFA 4KK5D 5DO8A 3EJZC 3TPUA 1I1CA 1B0WA 4J8RA 3IU4L 3R4DA 4Y5VA 3MV11 3TTYA 3WNKA 4JM4H 2P42B 4NN6C 2VDOH 3HS0C 2DWYA 1W6WA 5HDBE 5ADPL 1XF2B 3BGAA 1PX3A 3U6XA 5E8DH 4GFXA 2HPOA 3MCLH 3EYVB 1IGJB 1BREA 1RHHB 4G82A 2D7PA 2IIJA 1QSED 4FHBD 3ZDZF 1KJMA 1HN1A 1YEWA 2XZZA 2QPSA 2QELA 3F2LA 5A2KH 4HH9A 2ICEA 4KFMA 1FHNA 1PSKL 1YEFL 1QR4A 2KDYA 5FW7A 5I1CL 2K6ZA 4KMTH 2VLLA 3ESNA 3FH5A 2G5BB 4HCFA 4G43A 4EZLA 4P9MH 3VFPB 5IG7B 3UG4A 2XZAL 4YZWA 3HB3B 4NCDA 2EEAA 2Y4SA 3D4ZA 1JXJA 4OD2B 2Y3AA 2QGEA 4L05A 5GS2H 5AOJA 5IVXA 5IFHL 4TUOB 5DRNA 2WN3A 3OV6A 3Q48A 4K7FB 1U6AL 1G1OA 2J2ZB 5JZ7C 4ZMAT 5FW6A 3BQUD 1MWAH 3BZ4B 2PW2B 1IAIL 1JZ6A 5JQ6L 2JKIS 3D34A 1FFPB 5DFVD 4PG9A 2QDWA 2VISA 2BSED 1X7QA 1E7UA 4L1TA 5AW6B 1NDMB 3X1GA 5IROC 4V1DE 1IC7L 4HGMA 3NJHA 1UWFA 2AV7B 5IHHA 2X9XA 4CC4A 2QTVA 3QFGA 4KVPA 2D0HA 5FM8A 4QJ5B 2MKLC 5DURD 4QHUA 2F19H 2K0RA 2WMPA 4JRYD 4PJEE 5ABAA 5EOCJ 4U1JB 5FUZL 3KL0A 3S5LG 1P7QD 1MRFL 4M8UA 4Z7IA 5IBTH 1SHMA 2RHEA 5GZNC 2GQHA 3OKEA 1JV5B 4I85A 3WKMH 4F7CA 1I85A 2MTPA 5IB5A 3TWCH 1WWWX 3VG9C 4S1RH 1E5CA 3F6JA 3RVXD 3IDMB 5EU6A 3TFKC 5C0EA 2GJ6D 2X4RB 2XG5B 3VWKC 1EERB 1D5ZA 1I1RA 3G6DH 3L4UA 3L1GA 5KYUA 4HCGA 1BAGA 1DLFH 2WM0A 4W4OA 5KSVB 2W38A 2CIIA 3GO1H 1UM4H 2VTFA 3SE8L 3X1FA 5D7IB 2NY7H 1AZCA 4OFYD 4RFEB 3R8QA 1IQDB 4XH2B 4NIKB 1T2JA 3UBXB 2NY6C 3FHAA 3T6VA 4WWID 1NA8A 3WNIA 3LKPB 3SPVB 4I48B 5T8IA 3L3JA 4ODUA 3MLRH 4Q9RL 1F90L 3UP1A 2X5PA 2WBJA 1RZPA 3GTVA 3ILQD 4DCQB 1HL9A 1EANA 1PYWB 1JHLL 2BDNL 4P48A 2NDGA 1E4XL 1SEBA 2MPAL 2QKIC 3MJ9L 4XNYH 4MNQE 1PBYA 4FQIH 2GEEA 3GZPA 4QJ4B 1T21A 1TCMA 1BQHB 2NW3B 1KDJA 2FK9A 4FJ6A 1RH8A 4JPWH 4XXCC 4YHOH 1FPTH 2Z6FA 4WUUE 3GUFA 5L2KD 1RIVL 4AQ8C 3RWJB 5JQ6H 4CN1A 4NO5B 2XN0A 4OJYA 3PWJA 1A2YB 1QSEB 4IRZA 5I1AB 4JO4H 4CVUA 5IVNA 1MAJA 4XTRC 4YXHH 4YDNA 4KX7A 4ZW8A 4Y16C 5KZCD 3QUYB 3ABLB 5DMIH 3W0WB 2XWTB 4DF9A 4D9RE 2DMHA 1FJ1B 2XKNB 2XBDA 3K8MA 1YQVL 3U2JA 2BSRA 4JR9H 2IQAB 5EOTB 5I1LB 4OIBA 5CFHA 2ED6A 3KVDD 4JFFE 5L8JB 3DX6A 4PRAB 4ZQKB 5C7XL 3J2PA 2QQLH 1W0YT 2DQMA 4U1SA 5L8LB 4NQSB 4L3EA 3U4EB 3KH3A 5GSVB 3FSVA 4TLUA 3M1BA 2TAAA 5I19L 3BEVA 3KPSD 3WIFA 3QUYD 4DVRH 1Y6NR 3C60D 3EH2A 2DLGA 1RZFL 2I25N 4JLRA 3VJ6B 1KWGA 3Q3GA 1ASOA 1SHSA 3BD5A 2FX9L 4NRZB 4GW5A 5DGRA 4EAEA 3NDZE 5AVUB 3CXHJ 1USZA 3HRZB 3CVDA 4IOFD 2CDGA 4GQ9L 2JLLA 2V2XA 5CEZD 3ARXA 2AJZB 2IPTL 4KTGA 2XQYK 3O8XD 4GRMB 1ORSA 4PG2A 2IAMA 1CC3A 3B7RL 1W72A 2VLKA 1RP8A 3GI8L 3L1OH 5H94A 4OGQC 1WZMA 4JZNB 5EULV 2PXYC 1Z32X 1Q9KA 1IM3D 1QLFB 3KW8A 3NP4A 4HD9A 3TV3H 3PRZA 3MROB 4MKTA 4TOYL 2NY4C 4XBGB 5E23A 1IC5L 4I5BA 2R9HC 1YEGH 1EJFA 1NC2A 1MCDA 3N5AA 4YN3A 4ETQA 1QBLL 1FGNH 2DQTL 1LWJA 4AXWA 5FO7A 4MB3A 1RUAH 5B7MA 5DS1A 4DO4A 3FFDB 3IWVA 2KLRA 3ZKXC 1NGZB 2EP6A 4QCIA 5EF3A 2G75A 2DLTA 4Z95H 1S7UA 2VXSL 4J3XA 4P2QE 4FMFA 1BM3L 1T7XA 2GTWA 4Z8FL 1MQKH 1TUPA 3ZQXA 3L6FB 4YSTA 4RZCB 2GJ6B 1DE4A 5HYQA 1ADQA 2NY1D 2VDNB 1U2HA 2XV0A 4LMQI 1QR1B 3MRGA 4NRXB 5CNHA 2BSSA 3OHMB 1UWEH 3G6DL 5IBUB 3FN0L 4Y19A 4X6FA 5HDQH 4PWHA 1INDH 3FQRB 4HGWB 3DK0A 2EXSA 4A68A 3QQ3A 4WI9A 2W91A 4JPQA 3BUQA 1NSNH 1QUPA 3FO1B 5ISZA 2VRKA 5C70A 4K2UL 2AI0L 4LCCB 2N0KA 3ZKXB 4JFDD 1KB5A 4Z3TA 4YHML 1KXTA 2WSDA 4P9ML 1L5GB 1F0LA 3V4LA 3ETBJ 1T21B 2G60H 3IFOB 3F7KA 5LUMA 3WHXB 4F33B 1ORSB 1AE6L 1XGZA 2VRAA 3LEXB 3RNKA 3SGKC 9CGTA 5EO1A 3PDOB 1CYWA 3QORD 1XV8A 4PWGA 4M1CD 3HC0A 3HRZA 3V52L 1MCHA 3GIZH 3SDDC 3I9GH 5IEHA 3BQUB 1F18A 1OGAE 1IM9B 3U0PA 4Z78B 3M07A 3UTSD 3Q0HA 4WI2A 3OHXB 1J05A 4KV5F 1HH6A 4XBMA 2WXLA 5AZ2H 3DV4B 3QDGE 2WK2A 1OB1B 3AU1A 3EZ8A 3HC3L 3U0WH 3MLTA 4ZOEA 4EQ2A 1RUML 2XIDA 4UDTA 5CS7A 3V5KB 3WN6A 1U8PB 3L6FA 3PJLA 4XAKE 3QCUH 1A14L 4LLQB 1A47A 2RFXB 1QVOB 3IJHA 1DO6A 2DH2A 3WY1A 3EJZD 1U42A 1AG6A 3CLEL 4MDJB 2NR6D 3SDCA 3SPJA 1A21A 3FPXA 5ILTH 3PWNA 2OTWB 5FHAH 3QXDB 3GRWL 4M6MH 3QUXC 5JXAL 2HWZH 2V7NB 1T2QH 2NUPB 4RMVA 5EWIH 4AT6A 1I7UA 2X09A 4W9EC 5HYJA 1KXVC 1UM5L 3GSUB 3MRBA 1EVTC 2JKJA 4JPIB 3GJFB 2AW2A 4MS8C 1ACYL 2XLLA 3MGTB 3ESPA 3ZYOA 6TAAA 5HJGA 4ICWA 2B1AL 3VFWA 2XFGB 3CN1A 1WWBX 3HS9A 1D9KA 1G7PB 2NY4B 1OPGH 3IPBA 4KO5A 5DSCB 4NGHH 1HEJC 2OW6A 5DJ2A 3HZKB 1TNNA 1L6ZA 4UMSA 3MLSH 1WIOA 1C5DB 1CGYA 1ICTA 2VR4A 3D05A 2OX5B 4N2OA 4AQAB 1NEZB 3IJSB 1KBWA 4DGVL 2GCYB 4B6ZA 3A0OA 3ZDYF 2AQ2A 2JCCF 1KB5L 1P4BH 5BV7H 4XCFH 3FRUA 1NQBA 1TCRA 2F53D 4GG6F 4N2AA 3VW3H 1XB8A 5DUML 2PR9A 2R9HD 3ARGB 3UG5A 2HH0H 5JOFB 4MMYA 3EYFA 4I77H 4FG2A 1N0LB 1KYOJ 1QQDB 4IDJH 2G4EA 3MBXL 5E99L 2GW5A 1IRAY 5I18L 5BZWA 4CW1A 1W0WA 2PYED 4FZEL 1IAIH 4ZSOB 4BZ2A 1ONQB 5SWSA 3RVTC 4R90L 1HU8A 2YRBA 5EFIB 4ZYKA 2EYRA 1L9MA 1SMDA 5IEKA 1MAML 2VKXA 2KDGA 3VG9B 2B4CH 5DUPL 4PHZA 2J12B 1TQVA 4WJKB 3QZNA 3SY0A 1V7NL 1FFQA 1UZ8B 4X0NA 1DR9A 4HIPA 1JK8A 1KBVA 2FO1A 1RZIA 3ET9F 3O45A 4HOWA 2OCJA 4LBEA 4H1LH 4J23A 4KMQA 1F1DA 2K7QA 5D96C 3WY3A 1TO4A 4R0LB 2A9AA 3MMEA 4OGZA 3BPLC 1B4TA 3VH8G 3WNLA 3PL6A 2ZYSA 4ODWA 5F7KC 5BZDA 4Y1AD 1AGCA 4YHLL 5EH1A 2J8OA 3W82A 1GXEA 2DJUA 4MXQD 4XOAA 3HAEH 4C4KT 1FV1B 5KSBB 1JYWA 4PRHB 1IE5A 1SJXA 3HBQA 2X70A 2WUCL 2R0KL 1ETJA 2YD6A 2E56A 3NGBB 3MV8E 4PJGE 4X8JA 2NY6D 3VGEA 2VITB 2X2YA 3QDMA 2B1HH 4HWBH 4QRUA 4TUUA 4MHHI 4YHYB 5GS0D 5IMKA 1A3RH 1TTAA 2Z31B 1NGPL 1J18A 3NEOA 1XGRA 4YQXH 1K9TA 3CDZA 4YAQB 2A0LD 1ZSDA 3K1KC 3D3VD 3PPSA 4HUKB 3QZMA 3BSHA 1DJZA 2DPKA 4L4TA 4AYFA 3I6GB 2AXJA 5JHDE 3S98A 5JUEH 1ECYA 3BP5A 4ALAL 5LNGA 2BVPA 3RFZB 1KSRA 1SF3A 1AP2B 1KY7A 4AL8L 3MCKB 4QD2E 2FJUB 3L2MA 1C5BL 4FZ8H 4U6TA 2UZYB 5E5MA 3ULVH 4FABL 1S3KH 3HUJF 5HVWA 1YN6A 2P5EE 4N8CH 4GIOA 2E7DA 4B9JA 4S1DC 4M7JH 3VWJA 2F5AH 3GSQA 3ULUC 2Z64C 4KO9A 2ERJB 2GTQA 1AD9A 3REVB 3QDJE 2OSXA 4X6CF 1A9EB 4JFFB 1J86A 4ODSH 3T2LA 2R23A 4Y88A 4Y4HB 3PG2A 1CFMA 1JGUH 3CFCH 3O3DB 1GSKA 2BY3A 2ROXA 3CFNA 4F2MA 5IFAL 2B9BA 4PJ9A 5F3FA 2EUVA 3OB8A 2QV2A 5HJ3B 3APNA 3BIBX 1CG9B 1TLMA 2P48B 3H42L 1B2YA 3F83A 3CN4A 4UNTA 4X7SL 4JFQA 1KELH 5CGYC 3TH2T 1HX0A 4G43B 2XU9A 4KK6C 2EE9A 2WPGA 4AMKL 2XPGA 4CNIB 4P2AA 5KSAB 4L3AA 3OKNA 4GQZA 5CD5C 2JKWA 4W1TA 4JFEE 2A7BA 4QRPA 5JYMA 2A9DA 1OCOB 3E9UA 2XV3A 1J7VR 3D39E 4PP1C 4DKAA 1U36A 2FYYA 4XPFL 4POYA 3O6FB 2O61A 3UAFA 4PJ8C 2CIIB 2CO1A 1BG1A 4HWBL 4AH2A 4JO2L 5CMAA 2CHWA 1L0PA 2QGBA 1S5IH 3HC3H 4L2LA 2QLVB 4P3CH 5DRXB 3S3BB 3SBWC 2DTSA 1G7QB 1UFUA 2NW2B 3KLSA 5E08H 4C54A 3HLAA 1HKFA 4A55A 1UGNA 4JDTL 5F6HJ 3UGUA 2VDNL 2V2WB 5FUCE 1T20A 1TEFA 3MCKA 4EBQH 4AOFA 3GXUB 1I3VA 4MA3A 4QAWA 4XTRD 2F54D 4X6EB 5C9JB 3WD5L 3FQUA 1G43A 1AGBB 1SOXA 1O6VA 4PRIE 1KCVH 3GMMB 3OSVA 1SDDB 2COQA 2PWHA 3OKOB 3V6FB 4GMTH 3ATAA 3KWWA 4PGDB 3FU9A 2MQGA 3P69A 1FDLL 4GAJL 4UZUA 2J43A 3QDAA 5EOCH 3B2VL 4NWUH 1EJOH 5H37H 4AYMC 2APFA 3KPMA 3UYRL 4JN1L 4M93C 3L3OA 3F85A 4HZLB 2R2HA 1FL6B 1S5HA 4ELMF 5IVZB 2W59A 1XEDA 2R2CA 1SNRA 3UP6A 4DZ8B 3BZ4A 3CFCL 3HUJE 3L5JA 4KX8A 4QI3A 2JQMA 3B9VA 1ZVSB 3K74B 4GG8B 3S2CA 5KSAA 3MBEB 2DQIL 1N4XH 2BVEA 4LVNB 1BVKA 2K78A 1GYCA 4WI7A 1HSBB 5E9NA 1FZOB 3BEWA 5IQ9A 3ZSTA 4HWEH 1UWGL 3VGDA 4OLVH 3MRHA 4BHUI 3PL6B 2O6EA 1Y0LB 1DUZA 1CYGA 2P5ED 4FF9A 5F7UA 2X2UA 4A2EA 1H3UA 2BXYA 1U33A 2LFEA 2O6CA 2DQDL 5GJTL 4ZW3A 3P3TA 2VXSH 4PJBE 5AVWB 3X14A 1WZKA 2BOBB 3TYFB 4JFXA 3B1TA 3MUUA 1G1CA 4H5SB 4OJDH 5CGTA 3U9PL 1A1MB 3ARED 4WDIA 5JHDD 2FWOB 5LLIC 2IH1A 4OCNC 1XIWD 3AG1B 4XCYA 5BRQA 4ONOA 2GJ6E 2VR8A 4R97C 2K45A 2HX9A 5CR8A 5F1SA 3T5WA 1QSFA 3E0GA 3ZE0F 1XCQB 1DVZA 1YJDL 4WFHD 4YBLB 5L9DL 3LQZA 3AT9A 2GSGB 4A7GF 2R0LL 2F15A 5GGSY 3FQTB 4QLWA 1X9LA 3PFQA 4Z7VB 4RX4A 1AJ7L 2AVGA 5C6TH 5E51A 4P9HC 4ZX4A 1U30A 2G5RA 2CE6A 1WC7A 3AAZB 5KYWA 5D55A 2Z31C 4YHZL 1OWWA 2GIYA 1F3DJ 5E6ZA 4HHWA 3C8DA 1CICD 3BW9B 3V10A 2NY5H 3FQ1A 3D48R 4V1DD 1NC4B 1Z2KA 2ODHA 3T77A 3HPLA 3IF1B 3VB9A 3Q8BA 5T1DH 2VXTL 3RWFA 4NB7A 5AW9B 1LO0L 4NO0D 3AG2B 1BBDL 1VJSA 1KGWA 3NFNA 5C07E 5HHNA 1M7IA 1A9BA 1KCSL 3FCBA 4P5TB 1CE6B 1R3JB 1U3ZA 1HOCB 3FF8A 3WGVB 4N9OB 2VR9A 4WSJA 2YSSB 4GRLA 1N6UA 4GFTB 3MGOA 3N85L 1XGUA 2X1QA 4ZD3L 3X17A 1XCTB 5T1KA 1SEQL 1O9ZA 1D7CA 3HG1E 3KJ4C 4M1GL 3KPRE 1UA3A 4FLRA 4JEGB 5F3BA 1A02N 2V3FA 2C4FT 3HBZA 3JWNE 1HXYB 1JIBA 2FUTA 1S78C 1NCOA 2GVYA 3KD4A 3PGFH 1N8OE 4ZTOL 2NNRA 3DGGA 3P0VL 1DJHA 2HVJB 4ZS6C 1F02I 1ZHKB 4X42A 4HGKC 5SWZD 2ZG1A 1D6VL 5I75C 3WTUA 2RALA 1LM8V 4LLDB 1XF4B 1KXQE 5J3HD 3H9SD 4UT6L 4HFUL 1L0XA 4M5YH 3H53A 3EKCA 2W0PA 1I1YA 2A83B 2OJEB 2HT2D 2WO2B 4M7ZB 3RY5A 1IBGH 5A6MA 5D7IF 1J1OL 1YEKH 5J89A 4KMTL 4JKWA 4Z78A 2XTSA 1XFPA 2VMEA 3B83A 4HJ1A 4MNQB 4OF8A 5LBGA 4MS8D 4MXVE 4ZOAA 4X80L 3GBLA 4FQXA 4U1HB 3CE1A 5F6HI 4U7MA 4GW1A 3MUZ1 3WFBH 1HCZA 1O9VA 2ESVD 1E4KC 3ARVA 2H2SD 4JY6B 4KXCA 1I1FB 3KXFA 3JWDH 3SKUD 4NPKA 2XN1A 5CWSB 1S6NA 4M7LH 4J3UA 3QYNA 2CBMA 3FB7A 3MV8D 5T1LD 2BP0B 1FBIL 3Q8CA 4IRJD 4Y9EA 5DCCA 5SX5K 1HZHH 3GGWB 5D71H 5GJTH 1BQRA 1F4WH 4R4FL 1C5DA 1EIBA 4LIQH 1F6FB 1QBML 4PJDB 4DOHE 5JLZB 1L9RA 3UYOD 2NNAB 3H8NA 4GLRH 1ZKAA 2EIZA 3MRKB 4K9EC 3FT4A 4OGXL 4X6CA 2FEEI 4GS7C 1WWAX 3VO0A 1FFTB 1TJMA 4F7TA 1ZVNA 3FQNB 5HHOA 1HXKA 1ND0A 3QXDA 5FDYA 3KWTA 2A2QT 2B8OT 5J12B 3TF7C 3SCMB 1D5RA 4XZUB 4RSYA 1OAUL 3VDAA 3C5SB 4N86A 3SDYL 2J25A 4J3WA 2VC2L 1H3WM 4TNVK 3MLTB 4Y4FD 4TNGA 3CXFA 2HN7A 1RIHH 4UUJB 2WKGA 4CKQA 1IGMH 5D7SH 3DX8A 1TETH 5DO2C 1WZ1L 2OMNA 3L4TA 1Y6MR 4S1DD 3AY2A 5SV3A 3FO0L 4X99B 4YBQC 3CFBA 1JRHI 3FKUS 3T9WA 4M6OH 3MKGA 3A6OA 1OV8A 1F56A 3DETC 1YJDC 3NPZB 4QTHA 2BOCA 3RKDD 3MYZA 1RCYA 2HJLA 2BNUB 4NFDA 3RVWC 1HDMB 3V0IA 3A3YB 3WXVL 2C7FA 1NOAA 5E8NB 5TE7L 1ZA3B 1L0QA 1SM3L 3QQDB 3UMTA 1MCNA 1UJ3B 5I8CB 1A3QA 2YS4A 1KN2H 2WP3O 2D7TL 2IDQA 2QQKH 5IHWA 3U6RB 4L5FH 3II2A 4DEUA 5J6HB 4EI5A 3H3PH 1IAMA 4GEIA 2DQCH 1OP4A 2QV4A 4OLYL 5HHMD 3WKPA 5L4MA 3DROB 3GXTA 3DJ9A 5FECA 3D7PA 2VAJA 4JFHD 1BECA 4BXVA 5D1ZB 1UOWA 1XF4A 3MX0B 3QXTA 1BM3H 3HW7A 5FYLD 3C5JA 1S78D 2VDOB 4QWWC 3SGDI 3HE7B 4PCSA 4PP1D 4XMPH 1KC5H 4AT6B 4ENZA 2MTAA 4UQCA 1R3KB 2C3VB 3QI9C 1MREL 1N0XL 3RGHA 1AKJA 1OAQL 3BUTA 3QAQA 2DWSA 3FTXA 4G9FE 4MB4A 2CBOA 2D0GA 4DP7X 1CGSL 4N2NA 3VDCA 1DN0B 1F4YH 2AJ3A 4C83A 2IPUG 1F86A 1MHPH 4CMMA 5BRZE 5TD4A 2YRLA 1T1WA 1W0VB 5EO9A 3T0WA 2C3HA 1NAML 3QA3B 3FUEA 4IU3A 1BX2A 3P2DA 4I2XA 3ES6A 3QZWG 2OQJA 5FXCH 4UT7H 3LXAA 1KCVL 1XDTT 3BI9X 3QIBD 2XPZA 1JUFB 3EAKA 2X0VA 5FPIA 5KBDA 1TO5A 4CSSA 4K7PL 4M9OA 1H19A 2WTRA 4XBPB 3UZEA 4P4KD 1AQDA 1BQSA 1XVSA 1UJ3A 5BW7C 2YC1A 3RWIB 2FTAA 3ZE2E 3GI9H 4YDLC 1QUNA 3QHZL 4QHLB 2MOVA 4ZAKC 3CFJB 4EMZA 3CVHL 2NMSA 3O9WA 5FIEA 1CXHA 2EJ1A 4KK6D 5C07B 2BNRD 4HPYL 2ADJA 4LNVA 5KSVA 2CKBL 3BO8B 4UV7L 3DX0A 2ZWKA 5FW8A 3RLSA 3VI3B 1G7IB 1P6FA 1A3RL 2VUKA 4MBOA 2NQDA 1TJGH 1XF3B 2DQEH 4S1QL 1W0VA 4ZS6D 2JFCA 4M5ZL 4Z1PA 1LO2H 1R3KA 2C3VA 3MBXH 1BGXH 1QTYT 2EEFA 1H3XA 3NRFA 2YD0A 1RIVH 5CZRA 1RLWA 1NJ9A 4HS3A 2EDOA 1JGVL 1HIML 5D2LB 4FG6C 3I6KB 4F15B 3QDJD 5MEND 3BKML 1I31A 3KM2A 3MLXH 5TK4A 3EGDA 1OB1A 1BSIA 3IJYB 3UTPE 4ZMYA 5HHOB 2Y07H 1BPLB 3K4DA 3KPOA 1NLDH 1LXMA 4DZBA 5C71A 5ID1A 1JFHA 1VDGA 3ARFB 3JTTA 4N0CC 2WNXA 4NKQB 3RAJH 2HLAB 2EO7A 3FOMA 2HXAA 4L4VE 4HOXA 5E4IA 2XQYA 3MLSL 4PJIB 2IMNA 2P24A 3DUHA 5J5EA 3SQRA 3JWOH 4PJXB 3EYUH 3TCTA 1DQLH 3VFTB 3CVCA 4R26L 5CBEB 2FEDD 3O3AA 4PJBB 4PGJA 1P1ZB 2MRYA 4P5SA 1NCCL 2VQTA 4OZGA 2AK4E 5FGRA 2DMCA 4YSAA 2BMKA 2ZAIA 4OCSL 1KPVA 3MLWL 4LSDA 1J0JA 2AQQA 1A7OL 1EAOA 5GGVH 1ZLEA 4BE5A 2PCXA 4JX0A 4N0FB 1NAKL 3PWPD 2R51A 2OMUA 3DPDA 4NRZA 4HJ0C 5DFVC 2XA3A 3ASWA 2EKJA 5AG8A 2OMZA 1BFVH 1GYAA 1HH9A 2H4EA 4QF1B 4EI0A 4P8QA 3OWRA 2F1BA 3V9FA 2FLMA 1G6RH 2BNQD 5LN4A 2VN3A 2VZ3A 1E9OA 3KYMA 3V0GA 4AGLA 1ET5A 1YZZA 1SYSA 4HAGA 3AREC 5TQ0L 1ZGLP 1WPCA 3GMRA 4ZXBD 4KI5C 3QCTH 4DAGH 2G3XA 5FA4B 3R19A 1JMZA 3FC8A 1JHKH 1T83A 3H9YA 5EU5A 4HWZA 2Q8AL 2QPEB 3NJXA 5ID1B 1FO0A 2H32B 3NIGF 1MCPH 4DW2H 5FYJL 4HKJB 3JUZA 3WD5H 5GZND 2EILB 1TQTA 5D7SL 3EDEA 4QTIL 3TJEH 4QPEA 2X3AA 4LPWA 5IQ9B 4PCKA 2F08A 5EEYA 2QPUA 2PP9A 4AYBA 2UZPA 1DJYA 4GRWE 4OY9A 3MRHB 3STZA 4UT9A 3JV4A 2YN5A 3CZEA 4HIXL 2G2RB 4YLCA 2CO7B 4TUOA 2EE3A 2WSKA 3LRMA 4P4KC 3ZE2B 4HPHA 4PYHA 3H7BA 1TOXA 2KT6A 2ITDB 4NKOB 4Y5XB 4I88A 3QEQA 1CVSC 3D9AH 4K23H 1CD1B 4WHYG 4LGSB 2AI0H 3G5XA 2A9NH 3HR5A 1IC1A 1KV3A 3HHSA 5IQNA 1DBBL 3LKRA 4D8PA 4P57A 1I9IH 1NDGB 4PJ8A 1VCAA 1N3NB 2ZSVA 2GI7A 4EPSA 2MH4A 2PWDA 1MIML 2Q20A 4KKLC 2QL1A 4RAVB 3H3PL 3WI9A 1JXKA 3MBWA 5AW8B 4I77L 4HV8A 4O5LL 4XNXH 5L2KA 3SPHA 1DBKH 1U4FA 1DVSA 2F7PA 4YHOL 3A4FA 4QNPF 1YECL 5C3LD 3MRJB 4RNRB 4H44C 2CNZA 2XZQL 3WYRA 4CADB 1UACL 3C5ZD 3ARFD 5ALBH 2A6DB 3LKQA 2ZNWA 4K94C 5DZAA 3F5WB 3VXUB 5JIPA 1MHCB 1BLNB 2WYIA 1PD1A 1VZIA 4L8CA 1G9NL 2QSVA 4X7FC 3ZOAA 5C6WH 4XP4L 5E2WL 1BXAA 4U1SB 4B0MB 3QDJB 1NOLA 3ESOA 4PH8A 3LIUA 3L08A 2FHBA 3GMOB 5DR5H 1VGKB 4PRIA 3QJRB 1JGDA 2CBQA 4IIZA 2NY2D 4PJ8B 5GGTL 1PU0A 1JHKL 3QG6A 4PGBA 3OLGA 4JHAH 2V9RA 3GKWL 1KCRH 5DQ9B 1NAMH 4FXGA 2O5ZL 1JNHB 1K5WA 1UEMA 2CJTA 1CE6A 2DMBA 2Q0ZX 1FZMA 1TG8A 5IT2L 4XMKL 2AZUA 9PCYA 5KSAC 5IT2H 5JYLA 3VFOA 5K39A 1UB6B 2FZ3B 5HGGS 4G8FA 2YK1L 2VR5A 1GCFA 1NPNA 1WA2X 3MLPA 3LKPA 5EN2A 4KRLB 1QI5A 3GMPA 4F8TA 2IANA 1FORH 4QKTA 4PGZA 4G5ZL 1LK3H 2NUTB 2R23B 3JWNG 4M7KL 2YOCA 4ETYA 1J5OL 2I7SA 2E7LC 3MOBH 5FFOA 4Z3JA 5IMOB 5IHZB 3FAXA 3LKOA 4Z3EA 2CRIA 3IS1X 3N2JA 3GYRA 1T0MA 4OZIA 1CL7L 3P11L 1XR9A 1SBSH 1EWHA 1BYOA 2E9WA 4WUKL 1AACA 3TV3L 3QIBB 2JVUA 3FB5A 3RZCA 1J8KA 4E68A 1HNFA 4DGWC 2KERA 5BRPA 4N8PA 4YHNA 3CU1A 1SEQH 1IAKB 5ICUA 3LNFA 2NXYB 2Y2TA 1RIUL 2WXOA 4JPWL 1LHZA 1B4JL 1NKOA 1CJYA 3IDYB 4RCAA 4N0CD 1YPZB 4GPVA 3I75A 4QUOA 2I24N 2A6DA 1QRNB 2X2HA 3IFNH 5C2BL 4JDEA 4LBAA 1ZLSL 3LS5H 5JHMA 3FU7B 1F58H 4X7TB 4G3YH 5FB8A 1LE5B 2FSEA 2AP2A 1E5AA 1Y1UA 2YXWA 4IMLB 4M4RA 3K6OA 3VQ2C 1CBJA 3NZ8B 1PKOA 3CXDL 4YX2L 4EXPX 2R0LH 2VR7A 3MQIA 3X12A 4JFDA 4YHYC 2VZ1A 2GFBB 3N1PC 2LLNA 3G7TA 4Q58C 4OFIA 3F58L 1X4YA 4LHUG 4WTZG 5EN2B 3V4VL 2HYMA 3BMWA 4LSPH 5CKGA 1C1EL 1M6OA 3D18A 3UEZA 4OCYL 5IIEB 5JXEC 1U8KA 1XMEB 3FT4B 3OKDA 4NT6B 1JNLH 1HHJA 3H9HB 4MXWL 5LAXB 3VFOB 4GO6B 4WEBH 2JSFA 3ABGA 2F5BH 2HRPL 1HJCA 1WA1X 5HHOE 5AYTA 5K59F 2CO7A 2F74B 3UTSA 3BPLB 3U4KA 1QSFE 1Q9WB 5D96B 1P7KB 2FNBA 4ZMLA 3F12A 1I1FA 1QBMH 4KI5D 2UV3A 3C5ZC 2ATPA 5FFGA 3NIFE 4IMLA 1CXIA 1F41A 3MRRA 2GB2A 3RIKA 2V5MA 3T3PB 2DN7A 1AIFB 4JCLA 3P2BA 3GM8A 2ZWSA 2VDPL 2FBJL 5B38B 3VM5A 3MRIA 5FYLH 4A7VA 1KBBA 5DZVA 4ZPTB 3HE7A 4DPRA 1I1AD 1MJUL 3HG4A 5CN1A 4EKXA 5CEYA 3BKJH 1KCRL 4IJ3B 5DTFA 2OA9A 5ACZB 4K3DL 1MJ7H 4GXFA 4MX7A 1O5PA 1GMEA 5E2UL 3IBEA 3V0EA 3AMKA 4N4YB 1M9SA 5MEQA 3TXAA 5IFJB 1FL5B 3NPSB 1WHOA 4Q6KA 2EDNA 2DEXX 2Y23A 2MNUA 1ZT7A 2RBLA 5F1IB 4XNUL 5CGYD 3PU7A 1UD6A 2X4OB 3HZVB 1CDBA 3WFHA 3UYRH 3I84A 4KQ4H 3ZKMD 2R1YA 1EGJH 2OCFD 3RB7A 1UD4A 4KI1A 3UO1H 2FUQA 5C0FA 2V5TA 1CDGA 4KK5C 2R2EB 2A74B 2IV8A 3K6DA 3QIUC 4FYTA 4J7RA 5ETUB 3FT3A 1I7RB 2F18A 2P5WA 4JGUA 3WJJC 2H45A 3L3GB 3MJGX 4XCNB 1YUHB 2VWEC 3S7GA 2FZ3A 3KAAA 1MIMH 3BZ5A 3W9EA 1OZUA 4TLTA 3GS7A 3JWDL 3G6AA 1H6UA 1G7JA 3OQ3B 4WSKA 2Y7SA 5JUEL 2KI6A 1EHXA 2E9GA 2R15A 1KGYE 1I7UB 2I07A 4JM2A 4MCNA 4P23A 5HDRA 3QUXB 1WT5A 4QRRA 2EDMA 4HA1A 4NO2A 3NSCA 4UMGA 4WO4C 1ED3A 3AGVA 1P6AB 1XGYH 2IH8A 5IQ7H 4UTBL 1BQLH 1FYTB 4X5QA 3ZRSA 2WVTA 1S7TA 5SWZE 2DYPD 3T2NH 4AI7A 1QWHA 2R4SH 1TEYA 2WKOF 2XT1B 5L6YH 1SZNA 5SWZB 3NESA 4H88L 1CL7I 4FL4C 5AW2B 3BUIA 4WK0B 2V2TA 1U3HB 4G6ML 2ADGB 3TIDA 3PV7A 4U3CA 2X4UB 4MNGA 4GG6E 3OZKA 1W0WB 1TTGA 1RK1B 3OHXC 3CDGB 4HIEB 1P2CA 1F3JB 2MKWA 4I18A 4K5PA 2EE0A 3U7YH 2FR4A 1F5WA 2J21A 4I0PA 3V7MA 4LSVH 2MFNA 4FTVA 5EEUA 3OPZH 1JPEA 3SDDB 2J73A 2ARWA 3TWCL 1IFRA 3CFJA 2WXIA 4GSQA 3LZOA 1UEYA 4MD0A 3SYCA 3SDAC 1FGVH 3AM8C 1AZRA 1HI6B 1R3HB 2YD1A 4WJG3 3QO0A 1WIUA 4PJXA 5TF1L 4HF5H 3R8BB 4BZ2H 5IMLA 3LRGA 4BCYA 5GHWL 5CBEA 2EECA 4NO0B 1CE1H 1JL8A 4CJ0A 4ZTEA 4A7UA 3PJNA 3F8UB 3HZKA 3CCHB 2H6OA 4DEPC 1KCSH 3BVWA 4LCCC 4MA8L 1XIWC 3VM7A 3UIZA 2ADFH 1P1ZA 3BAXA 4QXUH 1I9EA 4OZGE 4IBYA 1CICB 2WIIA 1J9RA 2X87A 3SJVB 5CEYB 2P24B 2HFFA 4NBZB 5EBLA 5B1KA 3CMOH 4U0RC 2PP7A 4NUPA 1RUQH 2CR0A 1FCCA 4XNBA 3TCLA 3BSGA 3V5HB 1RK7A 2PF6A 4JJOA 3CFEB 4XN9A 4LPTA 3LN4B 4PEEA 1IIKA 4NHUB 1HHIB 2HT3C 3ASOB 4F1ZA 2AQ1A 4GO9A 4DH2A 1N12A 3MNZA 3VSTA 1WGOA 5JO5B 3WXWL 3DUUB 4YIQA 4ZMNA 2XWZA 4I3GA 1ZLSH 4GO8A 1IGTB 5TH2B 4OZHB 4NC1E 4AQEB 5L8KB 1UZ6F 4JRFA 3RAJL 5DC9B 3ULUD 5EBMB 4EIGB 4GAFB 3UZEC 3ZMEA 1I7RA 3GLZA 3QPXH 4RIRA 1RFDH 4DT2A 2AXGA 5ANMA 1G6RB 4A7TA 4WLCA 3DDFA 4F3FB 2PCFB 5C97A 4N24A 1I7ZB 3FFOA 5IMLB 2L7UA 4R7DA 3BHBA 1ECZA 4YC2C 3Q43A 4R84A 2MNWA 2ZIDA 1I8IB 2PXYA 5EEZA 4HMCA 4R8WH 2OYKA 2XX0A 2IFFL 4GT0A 1OE2A 4AEHH 4K3JH 5GSVA 4AC2A 2C9AA 3NQKA 3PABB 4DGUA 3QWRA 5C3IA 5IB2A 2NY5C 4XCCL 4EN2A 4QRPD 1MHEA 4G5ZH 5FYKL 3IAPA 1Z9NA 4HPOL 1D7FA 2QADB 3DX9B 3KS0H 5C3TA 3VFNB 1WFOA 4U6XB 4G72B 4UANA 2X9ZA 3CHPA 3T6XA 3S5YA 2DB8A 3B3IA 4UTAA 1PZ3A 5AZ2L 2P47B 5HGHB 1AZZC 3V6OA 3D4GA 5CCJA 3CFEA 1JPFB 4MMXC 1M4KA 3EGDB 4KZ0A 1GYWA 4NC1C 4YBHA 3JYCA 4G9DB 3QK0A 5J57B 3Q5TA 1JN6B 4HMDA 1XD0A 3DUUA 1PEZA 4L0ZA 4NXKA 1Q72L 3TCLB 4U1MA 2ZWZA 3ZUNC 3GRBA 5C08B 5D7LD 1N6VA 3OZ9L 4DTGL 3MX0A 4FDWA 1LYQA 2ZUVA 5TDPB 3MFGB 3WKML 4HS8H 3T09A 5GIRA 5LGJB 3LKNA 3NFSL 3IDXH 3IDXL 1NCWH 4DP0X 1PD6A 8PAZA 3FRPG 4HT1L 4PUBL 1BAFH 2Y1AA 2XWRA 3S36X 3TNMA 3QIUD 4KC3B 5T3ZH 1PJ9A 1NLDL 5DJ8B 1EXHA 3F7QA 1IEAB 3DX7B 3UDWA 1QO3B 2BO0A 5C0CA 3KYKL 3TYGH 3HKZA 3TZVD 1QATA 2AXGB 1ZTXE 3VGFA 5GS2D 4CVWA 5C0BA 5KSAD 4K15A 2AJUL 4NNXB 3TVMA 1FAIL 2H2PD 1LQBC 2QVFB 1MHHB 1S3RA 3F00A 4IQHA 4N6RB 4WK2B 4PGBB 1FZKB 1CCZA 3IFLH 4QDGA 43C9A 3VTMA 4X0KB 1WAPA 5KOVC 2EUXA 2HJFA 5DUMH 1JYXA 2DQCL 4OLYH 2JKLA 3UADA 3BAEL 4AQ1C 2Y7NA 4JKMA 4Y4HD 5JPNB 5IROD 1YNLL 5C0JA 3IE4A 1UH3A 1VIWA 3QVAA 4WNJA 4MCZA 2P46B 1RUPL 3D07A 4JO1H 3MODL 5EHFA 1FVDA 3V8CA 4UINH 4GOSA 1QSFD 3OTTA 2ZKXA 3DVNA 1EHAA 1J8HE 3GSNL 1KCKA 2KMWA 1HQ4B 3LKOB 5FYJD 2YD5A 1T3FB 4JPVL 4FFZH 2BH0A 4FFZL 4WNQB 4JPKL 4R3SA 4X6CB 2Y72A 4KUCF 3BPNB 4ANUA 4BRJA 1CLZH 4RZCA 1J0IA 3N0PB 5DEGB 3GC3A 4L8SA 1PG7W 4JDVB 1J10A 4K0OA 2Q8AH 4UZSA 4P04A 1XGQB 3JTSA 2E9BA 3OAWA 3Q6FA 1QLRB 1W72B 2VLKB 4JFTA 4ZO9A 1DDTA 2ICWB 2ARJQ 5I19H 1S5HB 4UYPA 2GFBA 4LRIA 4KO7A 4KQ3L 3CWGA 4G8AC 4NPYA 4XN7A 4DZ8A 1QFUL 3H2PA 5CCKL 4JGNA 3VFNA 3FMGH 2BHFA 3L54A 4CSTA 4X4YA 1XQ4A 4HJTA 3Q5YA 2AJSL 4N1HB 4P2OB 4RMUA 4ZOBA 4F92B 3B43A 3CLFL 5GRYA 2H0PA 1OCWL 5EORH 4LIQL 4OBSA 1O6SB 2R56H 3ARRA 1D5MA 3NJNA 1AHWC 1T03L 3KBFA 2AXFA 2IAAC 4M62L 1WC7B 3DK2A 1HHKB 1SLUA 1A6AA 1ZHBA 1TTBA 1KACB 3FOLA 1CT8A 4KJWC 1MHCA 2VERN 1IC7H 2MQ0A 3RUGA 2KZWA 2EDXA 1WP6A 1U8JB 1D6EB 3MR9B 5CLWA 1SLXA 4BA8A 4OAWA 1YNKH 4XE5B 5TDPA 4LESA 2FRGP 4MB5A 2A6JA 3H54A 4Z18A 5B39B 2JXMB 1YA5A 3T71A 3TBVB 3M88A 4U33A 4MRBA 5E0QA 2WBKA 4NNPL