2W88A

Plastocyanin variant with n-terminal methionine - open structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
b'METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w88A00
2DYSB 1L9RA 3FYEB 4M4RB 4GXFA 3CVCA 1PY0A 1PLCA 2YAFA 4KNTA 1SHXA 2ZXWB 4Q89A 1J9QA 1NIDA 1J5CA 3NJNA 1NPJA 4MFHA 4A2HA 2R7EA 2QT6A 4YSEA 3SBRA 1SDDB 3FYIB 4AX3A 1FA4A 3SQRA 1QNIA 3X1GA 2EIMB 2PPEA 3FU7A 1AZBA 2FT6A 3HEIB 3ZIYA 1OCRB 1URIA 1T5KA 4DPBX 1GY1A 1IUZA 4BXVA 3PAUA 4E9XA 1OCCB 2IWKA 4HCIA 3EH4B 5FC9A 2IWFA 7PAZA 3JTBA 4F7KA 4Q8BA 2BP0B 3IN2A 3S3DB 1NIEA 1MZZA 5PAZA 1BXAA 1OOWA 3QJQB 2HLEB 3T71A 3D12B 1E65A 9PCYA 4DP8X 1X9UA 4QKTA 3ZX1A 3WNJA 3FSAA 2FT7A 5IY5B 1W6WA 2TSAA 1A4BA 2VM4A 1AZNA 4W9ZA 1OE3A 2ZOOA 1OE2A 2VMJA 1ID2A 1KV7A 1JZIA 4PCYA 3EH5B 3AG3B 4YSCA 2GIMA 1PLBA 2IDQA 3H4HA 4NB7A 2NRDA 1ASQA 3FQ1A 3NT0A 1ILUA 4F2FA 1L9OA 2AZAA 5B7FA 2BP8B 3OD3A 4KNSA 4HALA 1AR1B 1GSKA 2VSMB 2PCYA 1RCYA 1A65A 3UADA 4UANA 4AKQA 4A67A 2YXVA 2BW4A 3IN0A 1DZ0A 1KCWA 2WO2B 4GP4B 4BWTA 1MG3C 1RZQA 2CCWA 2WO3B 1JXDA 2YAQA 2DV6A 1B3IA 3QJVB 1JXFA 2BO0A 2UXGA 1NZRA 3PAVA 3AY2A 5I26A 3T6VA 4BWWA 2Y69B 1FFTB 2GI0A 1OF0A 2YQBA 5I6KA 4ENZA 4DP6X 3NJLA 3S8FB 2FTAA 1QLEB 3H4FA 2VW4A 1AAJA 2EIKB 7PCYA 1SFHA 2CAKA 1WAEA 3CVDA 3X1BA 1CYWA 4L0PB 1V55B 2GSMB 1ET7A 2UXVA 1AZUA 1NPNA 2XV2A 3ZBMA 1KBVA 3AG4B 4RH4A 2W88A 1NIAA 1BYOA 1AIZA 1GS7A 2XV3A 1BQ5A 4YSQA 1SF3A 3FPYA 3T6WA 2FQDA 3FU9A 1V54B 4E9TA 1JZJA 2PPFA 4YSOA 3T9WA 3UACA 2J55A 1OCOB 3AZUA 5D4IA 3T6ZA 3FU8A 5B1JC 3IE9A 3N2JA 1WA1X 4YSDA 4A2GA 3QJRB 4DPCX 3GYRA 2UXTA 3BVDB 4G70B 3IEAA 5I6PA 1AACA 4BK5C 4KO6A 2JFCA 4NAJA 2IDSA 1XMEB 1ZDSA 3NJGA 5E9NA 1PCSA 2EIJB 1ADWA 2J56A 3AG2B 1TU2A 1KCBA 5B1KA 5PCYA 4E9WA 1KDIA 3EHBB 4KO9A 4DP0X 2Y1AA 2CUAA 5A7EA 1BXVA 2XUWA 3ABLB 1TEFA 3OMIB 3NSYA 2YXWA 2UX7A 3H56A 4JHVA 2HX8A 2P80D 2RACA 1DYZA 2ZONA 3CDZB 5AZUA 5LDUA 1IBZA 4YSUA 5EHFA 2R7EB 8PAZA 2DWSA 5B1AB 4FAAB 4TXVB 3DTUB 4AI7A 4EF3A 1JVLA 3FU7B 4JHUA 3NJJA 4UF7C 2AZUA 2VM3A 3WKQA 4P5SA 3PAZA 2X88A 4YL4A 1J9SA 1BAWA 3ABGA 1BEXA 2AVFA 1ASOA 1CYXA 1J9TA 1M9WA 3AW5A 2IDFA 2PLTA 1SNRA 1BQRA 2FQGA 3NP3A 3QPKA 1JERA 5B1BB 2IH9A 4BDVB 1V10A 4YSTA 3DIVA 5D4JA 2B08A 3WG7B 3X1NA 5F7BA 5I5IA 5I28A 4CSPA 3U25A 1ZDQA 3IBOA 3UGEA 1TEGA 2PP9A 2XU9A 2IDTA 5ANHA 3TASA 3QQXA 3KW8A 4K9JA 1WA2X 3FSVA 1AS6A 1E5ZA 3EH3B 3G5WA 1M56B 2LLNA 2Q9OA 3TBCA 3CZUB 3WI9A 4DPAX 1XB8A 1NTDA 1OE1A 1PMYA 1NWPA 2OJ1A 2I7SA 3X1EA 2I85A 3S3BB 2GHZA 4P5RA 3FPXA 4A2FA 1N68A 4G7SB 1WS8A 1AZCA 2BZ7A 2YAOA 2VW6A 3S3CB 1VLXA 4A2EA 1J5DA 4W1TA 3FSWA 2YAPA 1A4AA 1AG0A 2Q5BA 3WIAA 1JZGA 3V9EA 2IWEA 1N70A 2FWLB 4YSRA 4YVUA 4E9QA 2EILB 1BYPA 4BWUA 1E30A 1JZEA 1HAUA 2J57A 2N0MA 6PCYA 1AS7A 1KYAA 2XXFA 3X1FA 4E9VA 1QHQA 3ABKB 1GS6X 2QDVA 1PF3A 4GYBA 1RKRA 4YSSA 2E86A 1NDTA 3ASNB 1NWOA 3S8GB 3FQYA 3UAAA 3PXLA 5B3SB 1OV8A 1XB6A 4HZ1A 2I7OA 2XWZA 2HX9A 3CVBA 3TA4D 1MG2C 3FS9A 1EZLA 2PP8A 1RZPA 3NSCA 1BXUA 1L9PA 4JKNA 2MRYA 4QLWA 4KNUA 2H3XC 4HAKA 1AZRA 2CBPA 2GBAA 3OMNB 2VSKB 1MZYA 4X4KA 1MDAA 4N4YB 5I6NA 2B3IA 2VW7A 3AG1B 2BWDA 3GDCA 2GC4C 3NJIA 1NICA 3QJUB 4GY4A 4HCGA 4E9SA 2YAEA 1KBWA 1PAZA 2BWIA 3QJTB 3T6XA 1GR7A 2DWTA 1HFUA 3V9CA 1YLBB 2BZCA 3ZDWA 1WA0X 4AZUA 2XV0A 1AS8A 3NYKA 4G7RB 4A68A 4ZK8A 4GP5B 3FT0A 4HHGA 1SJMA 2FJSA 1WS7A 4WTQA 1SFDA 5I5JA 1IC0A 4FA7B 1ZV2A 3X2QB 1ZPUA 2JKWA 1E67A 2HX7A 5B1JA 5B7EA 2CJ3A 1GYCA 2IAAC 1SDDA 1NINA 3BQVA 3RYMA 5TK2A 6PAZA 4DP9X 4KOCA 2UX6A 4BXSV 1GY2A 2QPDB 2PPCA 2OCCB 4DP1X 3CDZA 4G7QB 1GS8A 2W8CA 3TBBA 1CURA 3QJSB 1M57B 1I53A 5I6OA 2HZHA 2BP0A 3PCYA 1NIFA 1ZIAA 3NJHA 3GXUB 3NSDA 4YVNA 2YAMA 3NSFA 2MTAA 1IKOP 1OCZB 2FQFA 1PNCA 3KW7A 5I5MA 1JZHA 2PPAA 4BDVA 2PPDA 4DP2X 3WKPA 5I6LA 1ZIBA 2AFNA 1AANA 2PCFA 4GP8B 1EHKB 5AKRA 5B7MA 4HIPA 3FSZA 4WKXA 3HB3B 2DY2A 1R1CA 3FQ2A 3ASOB 1ETJA 2GC7C 1W6LA 2BP8A 2H47C 4M3HA 1PZAA 2BW5A 1JVOA 2P80A 1A4CA 1ET8A 3ERXA 2TSBA 1ET5A 2YAHA 1JXGA 3JT2A 5TK4A 3PLYA 2HXAA 5F7AA 2XVBA 3PPSA 2FNWA 4AKOA 3MX0B 3NJMA 1TKWA 3OMAB 1FWXA 3NP4A 1JOIA 1SF5A 2HRHA 2XX0A 1AQ8A 1AG6A 2XXGA 4UAHA 1L9QA 1L9TA 3UABA 1NIBA 2WSDA 4G72B 4CSZA 4DP4X 2JXMA 3ABMB 3NJKA 2PP7A 1J9RA 3CG8A 1GW0A 1A3ZA 3MBWB 4F2EA 1HAWA 4DP5X 2FT8A 1CC3A 4A2DA 1PLAA 1W8EA 2QDWA 1X9RA 1KGYE 3OM3B 1UATA 1L9SA 1ILSA 2QPEB 4G71B 3L45A 4E9RA 2IH8A 3OQRA 2AANA 2X87A 2XYBA 4HCFA 2OV0A 2EINB 4NERA 1E5YA 3WNIA 2IDUA 2FQEA 2CALA 1PZCA 4PAZA 3UAEA 2VN3A 1PZBA 1IBYA 1JZFA 2XX1A 3SBQA 3C75A 2DYRB 4HHWA 5I6MA 2YARA 2J5WA 1PNDA 3EF4A 1XB3A 4KO7A 4A66A 4N8UA 3SBPA 3N55A 2HRGA 4AKPA 1ASPA 5D4HA 5AFAA 1CUOA 4YSPA 4YSAA 2BHFA 2GB2A 2H5UA 2UXFA 2XLLA 1F56A 1SHWA 3NJFA 3TU6A 1KDJA 2ZWNA 3DKHA 1BQKA 4DP7X 4KOBA 1AOZA 1A8ZA 4E9YA 2A3TA 4KO5A
chains in the Genus database with same CATH superfamily
4IDJL 2R8SH 2G3ZA 1JK9B 5KSBF 4AM0Q 2B9AA 1ECZA 4FNUA 1T1XA 5I1LA 1S9YB 3QGVA 3QDMD 4OIIH 2ZKHH 2IXQA 5A2AA 5A6IA 3VQ2C 4M1DL 3IAQA 3RX8A 1MVFA 4F8OA 1FFNA 1VHPA 1U36A 3UDWA 4B9YA 4XOEA 2V5SA 1NUGA 3QISA 3ZHLA 1YC7A 3F04A 4QAMB 3RY6C 1EGJL 1UA7A 5KSAA 3QR1A 1P7KA 4ALAC 4Z0XA 4WO4C 3ZPDA 1T3FB 3DX9A 1SN5A 2BIHA 2X4QB 2ZOLA 3N0AA 4E41A 2CQVA 7PAZA 1U95A 1YVLA 1P4UA 3VI4A 4MAYB 3LKSA 2OMZB 3SGJC 3Q8CA 1EMTH 3ISYA 3DMMA 1UKTA 4X5QA 3ZTJH 3GXIA 3OKYA 4D9RD 1FH5H 3EYVA 1CDGA 2Q6WA 3IS1X 4QKTA 3H42H 4LEEA 3L1FA 1WWBX 4OKVA 4XP4L 5DLMH 1EAJA 1EDHA 3MLUL 4BCXA 3WTYA 1N5YL 3UJTH 4L3FA 2YPLB 1I3VA 1A0QH 2DZEA 4JPSA 4Z1PA 4O5LL 1AZNA 5H94A 2H6PB 3PXJA 1OTTC 5CGBA 4JFWA 2HLAA 2H2SD 4HW6A 5FM4A 3SDXF 1MSPA 3B7SA 5LGHL 5HHXH 1QLEH 4F7PB 1QUPA 2OL3L 3BUQA 4NB7A 2PNDA 1WWAX 4Z78B 2A9AA 4HSCX 2BP8B 3O81A 4N5EC 2YEZB 3KYMA 3LNEA 1UXWA 4KH9A 3STLA 3RVWC 1I8LA 3IDIA 3MRIA 4OLVL 1KB9J 4TUJB 5CGYD 5SWSB 2AJZA 4PV9B 4X6EA 2GIYA 2F7PA 4P3DA 4GAFB 3V0DA 2H7WA 2UUDH 3CVIH 2YD3A 4YDIH 3RZWA 3UBGA 1HI6A 2C7FA 1KPUB 2R0WL 2VN4A 2MCPL 5I26A 2IGTA 2P48B 1HIMH 3ALPA 4TL4A 2G4EA 2HH0H 3CC5B 3QUKA 5AEAA 4Z7UE 3ARGA 1KJMB 5CS7A 4H8WC 3SE4A 1X5LA 1ITBB 4GW5A 3FH5A 5K9JL 5C07D 4Z76B 1JGLH 1A6AA 1NCTA 4WWOA 5B4MD 5LQBH 4AITA 1CK0H 3CLEH 4GUPA 2BXYA 4L1LA 3U79A 1NCAL 3VFMB 2Z34A 4FFWC 3ZBMA 5H37A 1MJ7H 1CTMA 1NEZG 2C3GA 1NIAA 1XF3A 2QSTA 2YUVA 3QNYA 3T2QA 3TA3C 5J4MA 4KU1A 1XEUA 2DEYX 2Z4QB 1MHEA 3GD1C 3QG6A 2HJFA 3GB7A 1I8IA 1GXEA 2IANA 2VLRD 5EUOE 4LDLB 2VLJB 2RFXB 2W38A 4L18A 4Y88A 3QUYB 4QRSB 1HE7A 1YUHB 3AZUA 3QAQA 4GEJA 4P5TA 5MENA 3FU8A 3FN3A 3EOBA 4LAQH 4WLCA 1NANI 4XZUA 1W0YT 2XT1B 3WIIH 2AJSH 1FNSH 1E28A 2VDPH 4F3FB 2ZIDA 1A64A 4JG1H 4MXVF 1A14L 4GW1A 3WNOA 3T77A 4XC1H 2AMUA 2QSQA 5E6ID 3T0EA 5E70A 3Q1SH 4GNKB 1DZBA 1T66D 3IEAA 1OSZB 3TFKD 1GGBL 4FFZH 4MAYC 5E2WL 5D6CA 1KN4L 3ULUE 4X4ME 3L13A 4C59B 1CVSC 5E9NA 2XQYA 2XWTA 5FOBA 1LE5B 4KI5F 1X4ZA 4GMSL 4L4VA 3QJFA 4NUGL 2K3HA 3O6FB 1NGYB 3F6LA 5I74B 5HDRA 1AR1D 5A7EA 4FF9A 1U6AH 3P73B 1OAKL 4ZS7H 5I6XB 3G6JF 1SYSB 3OMIB 4NOFA 4IU3B 3ZL4L 4KJYA 5GRZA 3BSZH 3RU8L 2HRPL 3DMMC 2OZNA 4XMTA 1VPOL 3L3DB 2ADJA 3E38A 3Q6GH 4RA0C 5FKPA 1GJIA 3W5NA 3NSJA 4ZMOA 3CCHB 3THML 2E4FA 3KLSA 1HESA 3DTUB 1NUNB 1DBML 2ILLA 4A37A 4HSQA 3IFLH 3KYKH 4KKLD 5KYUA 5ISZA 3GJFK 3S7GA 1IGML 2AQ2A 5EU7C 2EQDA 4N26A 2YWYA 2QEJA 3AB0B 4UQCA 5E08H 2OQJB 2QR0B 4FZ8H 1V10A 3QC6X 2MKWA 4LLDB 5CSGA 2VERN 3ZKNC 1DLFH 2A74B 2V5YA 1I8LC 2PTUA 2V7NA 3FUJA 5CHNB 2XY2A 4I18B 3WG7B 1ORQA 1BZEA 1FFPA 4KKPA 3A67L 3TJEH 4NDMA 2ADGB 4ZTEA 5I5IA 3KS0J 3OMZA 1WAAA 4QHNA 4LLVB 1P4BL 2XU9A 4IU2B 3VD2A 3Q48A 2ZCLH 2CG9X 3FSVA 5I8KL 4GG6E 5EC1A 5EU5B 5KZCB 1NWPA 4QHUA 3O3AA 4RSYA 5SX5H 1XXFC 1E5AA 1RUKH 2BNQE 2C1PB 4K5LA 3ILQD 4MD5A 2Z1KA 4TS6A 5KVDE 3BKYL 3BWAB 4GIAA 3VSQA 4NZDA 4OQ1A 5LN8A 3BP4B 3GMOA 4NKDB 4XMXA 1XH1A 4YUEH 3IDJB 4JO3H 1H3XA 4CVZB 2F7IA 4W9JC 2FZ3B 4UIMB 4PGBB 4G6FD 1SMAA 1KXTB 2F19L 1VZIA 2HPTA 1T22B 2BY2A 4CKVX 1JGUH 1R5WA 1T20A 3TX4A 5MP6H 4L8BB 4MA8H 1MIML 4P46B 1UWGL 1SLVA 1NGQH 1PF3A 1TQBC 1HQRA 3MVSA 3QIWA 3EFDH 2E59A 1WFTA 5FHBH 1CI3M 4Y89A 4ZSOA 1R46A 1VESA 4FFYA 2W91A 3ARZA 5F97E 4JM2F 5EZOH 3EBIA 4U1NA 1NFDE 2HX9A 3FT1A 4NENB 5DZVA 4KRLB 1KEGL 1X5AA 1JHKH 1H5BB 4D2NA 3JWNH 1U58B 4TL5A 4M9PA 3RTQB 1NAKH 1VSCA 5GZOA 3GIZH 2MRYA 2HG5B 2DBLH 1D7BA 3KLDA 4MMZB 1TT6A 4U31A 2I26N 4Y5YA 3DUHA 2NTFB 5AWNH 5GRYA 5KS9B 1MLBA 4NQSB 1DQVA 3BOVA 2P8LB 1MFEL 2EVJA 3N91A 3ZRFC 5B3JF 4Y16C 3ZHKA 1RZIB 4G7VL 2V17H 2PO6A 4PJXB 3K7UA 3WFZA 3D50A 5F9JB 5IOKA 5T33L 1AO7D 1OLZA 1A7RL 2QQLL 1S46A 4U1SB 4ANXA 4FQXB 3DX7B 2XIBA 1NAMB 3MNMA 3Q0HA 5HPMA 5I17B 1AYOA 5I2IA 4PJDE 5BUGA 2GKIA 4K55A 3RAJH 2FIKA 2RJMA 1WS7A 5E6YA 2OAAA 5I1JH 2WXGA 1EJOL 2X9ZA 2DQDH 3C8HA 3EJSA 1U2YA 1PD0A 3ELAT 5IR1B 2WYIA 4ONGH 5SX5K 5KVGH 2WBJD 2BIMA 3FAWA 1GL4B 1EUTA 3K80A 3DRTB 3B37A 5IQ7H 3CX2A 1T21B 3HE7B 5M7QA 1Q9WA 3RIAF 4JM0A 4DP1X 4UOQA 1KGCD 4AV5A 3CHOA 3MJ9A 4IDJH 3V4VL 1I53A 1JJUA 3QZNA 3SO5A 3I75B 5FAAA 1N8ZA 4FP8L 1FFOA 2Z91B 5DJYB 4BH8B 1THAA 5IVXF 1E5BA 4WU7A 1FO0L 4M43L 4M1DH 1I7ZA 3ZRCC 1U2HA 1N6UA 4GKLA 2MQGA 2PETA 1J48A 4FRWA 2FX9L 4PGDB 4RFNB 1ACZA 2UYLB 4HJUA 1BECA 4WTZA 1EGJH 5TDPB 1D5BA 3JV5A 4JZNB 4W9CC 2EKSA 3U48A 3RWFA 2V9QA 3DYOA 4PB9L 4GKOA 1PD6A 1KWKA 3BO8B 5HD8C 2X4SB 2I24N 2HFEA 1LK2B 3KHOA 4WHTA 4U0RB 1YYLH 1FZOA 4OUOA 3K6OA 4L4JA 3QPXL 2J8UB 3ZHNA 4F24A 4PV1C 5DQ9B 2Y2TA 5BV7B 4LOEA 4JM4L 4HCRA 3PPEA 1LP9E 2XJLA 3FCTB 5I16B 2VZUA 4XP4H 3WFCL 4BQ6A 3MLUH 2TSBA 2EXYC 1MXDA 2IPUK 2F5AL 2EIZA 1MAJA 4G43A 4C56D 3JT2A 4JGMA 5K9QG 4O5LH 2YXMA 4X6FB 4NO0D 1EAOA 4YFEA 1VA9A 4AKOA 2FSEB 4HEPA 2AV7B 1CFSA 3IF1A 4PD4J 5LKNA 4HGWB 5H37G 5CCGE 2WNKA 3TT3L 1UA6L 1WIOA 2E7CA 3RWHA 4OLWL 4V1DB 5KANI 1JBJA 4I2XB 1JOIA 1Q0YL 1H5BC 3UPAA 2G75B 3VXSE 3RTQC 4NAMA 4QHMA 3PV6A 3VNYA 3CHXA 5D2NB 3VAEA 4OLVH 3NJKA 3PUUA 4PU2A 1HHGA 1RUAL 4UWQB 3RWCB 4A2DA 3N43B 3W0WA 1FJ1B 5BO1L 1ULVA 1HH6A 4LVOB 5JIHA 2VDOL 1KGWA 2BVPB 2CJTA 2R0WH 2H2PD 2MCPH 1CDUA 1MFNA 3FTWA 4MXWL 4QRPB 1J11A 4FQXC 2BS8A 2ZE0A 2A1WL 3AT8A 2WV3A 2WZPD 4AMWA 1I9RL 3FTVA 1SVBA 4TLSA 2JK5A 3D52A 3OC5A 5K9JH 3QRLA 1Z32X 4JY4B 5DMIL 3TTYA 5CBAA 1QVOA 3UAEA 2PO6C 4PAZA 3V5KB 1ERNA 1C8QA 1NCAH 2FJGA 2V5MA 2WGNB 1KIQB 3HR5A 1A6TB 5F88A 3LCYA 4L9LB 2YARA 3HE7C 2YUXA 2J1XA 3PQYD 1P7QD 2VKXA 3QQ9D 2NT0A 5CP7B 2YSSA 3NCWA 3SBPA 3O3BB 4UQ2A 2O6EA 5IMKB 1TJGL 2K9UA 4EI0A 3WUWA 4GOSA 3DJRA 4A7UA 1FNAA 2LE9A 3HKFA 3WHE1 1AGBA 1CWVA 2HVBA 1AZZC 2XZAL 5DHEA 2NW3B 5GRVL 4DEWA 1YG9A 3N06B 5A2JH 3SDDB 1F5WA 4KO5A 1R3HB 3MXWL 3WE1A 4M4RB 4GXFA 4RFNC 4QRRB 1CDIA 1CFQB 2EO9A 3NIGF 1T1YA 5JXEA 3OVUB 1A14H 3SPIA 2PYFA 4PEEA 3ZR6A 4Y7MA 2V3FA 1X5FA 3Q2VA 4GI9A 1QI3A 1MCBA 3GRWL 4QPEA 4U0RC 4WI5A 1T5WA 1VADA 1X6NA 3QQ3B 1GGBH 3K71B 4MXQD 1KN4H 2WCPA 1XX9C 3A4DA 3QB7C 4DPRA 2ZKXA 5JHMA 4U3HA 3MLPA 1ZVNA 3S4SA 3GMRA 2ARJA 4PRNA 4OCXL 4GMSH 1RP8A 1JP5A 4NUGH 1KB5B 3REVB 2CHWA 1INEL 2JCCF 1H6EA 5I73B 1OAKH 2G2RB 4NOBA 3ZL4H 2PTTB 1U93A 3I02B 3BAKA 4ODSH 1R6VA 4P57A 3RU8H 3TS8A 1IKFL 2HRPH 4XP1L 1VPOH 2WLNA 3MCKA 4PJGB 5SWQA 1FVCA 1KTLB 4N1HB 1EV2E 2A5UA 2N4IA 1LK3L 5EO1A 4WU5B 1JWUB 3IU3B 1ZV5A 3IAPA 4MJ5A 4EDWH 2NY5L 4EUPB 3AM8C 3MJ6A 5F1KC 4M9OA 1DBMH 3OKMA 5CR8A 2ICWA 4MJIB 5BOJA 4TQPA 4M6NL 1KLGA 1O7DC 2OX5A 5LN4A 5DD6B 3LS4L 2A6IA 5K69A 1KCRH 2QV4A 2EE0A 1H3TA 1DUZA 2WVSA 2V3DA 4LVOC 2YUWA 5L2JB 1C12A 3GMMA 5K1VA 3ZE0E 3UROR 3CFBA 4FFVC 4HALA 1SEBB 3CX5J 3ESPA 3DRQB 4XGZB 3UADA 4UANA 3ARBA 3C8DA 2NR6D 3CFEB 3WIFA 1RUML 3A67H 2XIDA 5ICXA 3BAXA 2IBBA 1UCBL 4PGEA 5BRPA 1U8LA 1P4BH 1T5XA 2GITA 3GSNH 3QJVB 4HUUA 4I3GA 4OAWA 3VFVB 5I0DA 1JXFA 3FQXB 1MI5E 1ES0B 3JXAA 4UQEA 4EXPX 1NKOA 2Y69B 5I8KH 5F7KC 4HJGB 4Q6KA 1E90A 4O51B 4OCRL 5L4MA 3UCRA 1BQLL 3ARSA 2EUWA 1QEXA 2C9SA 3IPBA 4GT7A 5C09E 3BKYH 2AAAA 3FTUA 2EABA 2YMXL 3ZE2E 1ZOXA 2GJZB 2GSMB 3F01A 4FG4A 1A6WL 3GM8A 5T1MA 5TFSL 2W88A 4XNBA 4NEHB 3ULVF 3IDXL 4AK1A 2IFFL 1MCOL 5IQ9B 4AV0A 5JR1L 3H0TA 3RZCB 4DK3A 2D0GA 5D1XD 3TT1H 2XIIA 2WNXA 2F19H 3CXDL 4NZFA 4ATTA 3KG5A 4F9PA 1M3JA 4OFYA 3T6ZA 1MIMH 2Y36L 3SKNA 1UWGH 3QDJA 1GTNA 2BC4B 3IE9A 4QHLA 4R0LB 2JKNA 4R2GB 3NCFB 4AUUA 3T1FB 3GF8A 1JMXA 3U9UA 3MOBL 5JXEC 1AC6A 5DJDB 2FO4B 5I1KL 2BOBA 5IF0A 3C9NA 1L3NA 2V9RA 1OO2A 3ROOA 1KEGH 2IH1A 1IFRA 3E6FA 4K2UL 3SN6N 5I71C 5GXBB 4G70B 1E9OB 1BFVL 5AALA 3SPVB 4KX7A 3D9AL 3BKJL 3ZKXB 3OG6B 1A3QA 3PHOB 4Z7IA 3JV4A 1ZDSA 3INUL 1CQYA 3NJGA 1I75A 3NIDE 2EIJB 5AW2B 3QDGE 2W0PA 2A0LC 4I7ZC 4NZ8A 3JTTB 3QEHA 1I1AA 3MRHA 2QFRA 1ZA3B 1MFEH 1YQVL 1M7UA 3UYRH 3NIFB 4G7VH 3IFPA 5K1JA 4HIHA 2P5ED 1F02I 1F6LL 3QNXA 5HYJE 3C5SA 5T33H 1NJ9B 2QQLH 1A7RH 4N0CC 2UZXA 2VZTA 1DYZA 4Q14A 5DD5L 1HHIB 2AQTA 1G7LB 4BRJA 1EJOH 5ALBL 3U0WL 3EIFA 4AE1A 2WNGA 2VQTA 4UQ3B 4K94L 5JMOC 2ZOUA 1OARL 4JHUA 3MV7B 3FW6A 2UWEE 2IOIA 4NBYB 4UNTA 4J3OH 2E75C 5D6DC 4JY6B 4HOMA 5IBUB 3NP3A 4NKOB 3U0TB 4BKLB 2F2HA 3B2UD 1URZA 2IH9A 2B20A 3ALWA 4GG6B 2BSTA 1VENA 5CSZA 4FP8H 2GTQA 4G8FB 4HEPG 4ODHH 1FO0H 3ARBC 4M43H 5C8JB 4FXGB 4ZW5A 4ORZC 1SJEA 3HG1D 1EXGA 3BUBA 2IQ9L 3LOWA 3MNZB 5BQ7A 2FX9H 5IW6A 5KVFL 4AQZA 4Z7VB 5D70L 5J13C 5ITBL 5HJGA 3BWSA 4Y2DA 1CGTA 1GGIL 2ZWYA 1RHFA 4G6AC 4BUQA 5F9DC 2APXA 4M1CC 4X8GA 4K73A 4B50A 1WC7B 4P3CH 3QPXH 2FYYB 5E4EC 4OU3A 1BVLA 2H32H 5KAQF 5TE7L 4MNGE 4KXAA 4JM4H 5JORB 3TF4A 3HC0A 1ZHBA 1NFDA 2XN9D 12E8L 2BSDA 3D2UB 3TFBA 1HXYB 3F7LA 3VE0A 2L0DA 1FUNA 3WFCH 1RJLB 4JGNA 1OW0C 2VL5B 3ULUC 1WRFA 4XN7A 2DYPA 1SMDA 3LXBA 4PG2A 3L7FB 2R4SL 1BFOB 2YA1A 3SEPA 3X11B 4R0LC 1GPOL 4R2GC 2OSYA 4S0TD 4GKNB 1IBDA 4XN1A 3MHZA 4ZUWA 3NZUA 3TT3H 4F7CB 1UA6H 4I0KA 5HGAA 1NAML 4OLWH 1S9XB 4PG9A 1YA5A 2FL5B 1HAUA 2NXZD 4FTVD 4F9PC 1Q0YH 3IFOA 4BFKA 2NNRA 3GXPA 2R0LL 3OHXA 3NZSA 5E9DD 4UAOC 5AKVA 4OFKA 2Q20A 1W72A 1NWOA 5FA3A 4TF4A 1RUAH 1UTDA 2R23B 5B3SB 1Q1JL 4MGXA 1KXVC 2FGWH 5CJ5A 4ZFZA 4L3CA 4K7PX 5BO1H 1UXLA 4CJ1A 2ZJSL 1M9SA 2VDOH 3J7HA 3T0VA 4OUUB 2JNZA 1LEIB 2PCXA 3E0GA 2EXSA 1RZPA 3CZGA 1MREL 2X3AA 3I6GB 3LKPA 2EIDA 3NSCA 4MXWH 4WEMB 4TNWF 5DCCA 5DFWH 4QLWA 4PJAF 1QFUL 1C5CL 2A1WH 3ZZLA 1I9RH 2WIIB 4IEFB 5DHYA 3M7OA 3UEQA 4N4YB 2JJWA 2Z6FA 4IOFD 3NJIA 1U3ZA 4WUUA 3W2DL 5DMIH 1B4TA 4XB8A 3VD7A 4ELME 2YAEA 5IJBC 4HFUH 1GR7A 2PW1B 3FUMA 1YLBB 5D7LD 3S4SG 4AZUA 1C8PA 4F2ME 4Y4HB 4X83A 2W60B 5F3HA 3FMGH 3C60C 4MD0B 3PDOA 3SKMB 2VXTL 4RMRA 5I8EA 5IVNA 2WXMA 1TJGH 2ZXCA 2H6UA 1KG0B 5MHSE 1BZ7B 3CH1A 4N8CL 1KPVA 2FEEI 1MCIA 2FLRT 1ZJAA 4EOWL 5D1QB 3DBXB 2XZAH 4FXGC 1CPUA 2B5IB 5KSUB 1JZ6A 1K2DB 2AXGA 2WXLA 3MXWH 4FJYA 3BRDA 1I8MB 5I1GL 1LP9A 4Z7NE 35C8L 4Y8AA 3BZEA 3L4UA 3Q44A 5LCVA 3FCGA 2W5PA 1QR4A 5LAXA 1T0MA 2X1OA 5ADOL 2ROYA 5GGVY 1TVBA 1FCCA 4FE9A 3S9DB 5AD0A 4KAQH 1TUPA 2ALAA 1ZWIB 5JO5A 3RJQB 5F7WC 2LOEA 4PVBA 1G43A 2ZKYA 4Y2DC 5CZXC 4OCXH 1P84K 3ARUA 3HCVB 1J0IA 1K8IB 3KL0A 1QATA 2Y2WA 4BSVA 1T6WA 25C8L 4FN0A 1H3VA 1D5RA 1JIBA 1LEGB 5DTFA 1I8KA 1KOAA 2J73A 4Z23A 4JO8A 1IKFH 5LG6A 4XP1H 1G1CA 2DEWX 3OZKA 4MJHA 2M2DA 5T5NG 4RGND 3NH7L 1CFVL 4NLAA 4I9XA 2OTWA 4JPIB 4NRXB 1GVIA 2D4FA 3AXLA 4NN5B 2NY5H 2X4RA 1UD3A 3VXSB 3VVVA 1XCQB 3TESA 1U8NB 5ELIA 1NLBL 2ZQKA 4ES8A 1I4FB 3I84A 2HKFL 4FX5A 4ISVB 3LS4H 4J3BA 3IDNA 4OZGF 2DWXA 4MCMA 4QAWA 4AGNA 4JVWA 3MX0B 3S5ZA 2ESVB 5KVEE 4Y4KA 3ROLA 4GG8B 2XVLA 3L4XA 5DYOA 2HRHA 1JGVL 4A39A 1V05A 4CNIB 5LXGL 2ZUXA 2V5RA 1IAOB 1XGTB 3HHSB 2IC2A 5AW7B 3TO2A 3O45B 1A1OA 3D25A 4MRCA 5C0IA 1RUMH 4LCCA 1UCBH 2O5YH 5DYFA 3UFIA 3HMXA 1LE9B 4H44C 2Z31B 4QRBA 2R29H 3RPKA 2F7RA 4JREB 5C9JB 3BDBA 3V5DA 4E9RA 1CT8B 3LS5L 4GFTB 2R1YA 2HWZL 2X1XR 1KIRB 1CN4A 3N85L 3PXHA 3F7VA 3U7AA 2CE6A 2CLVB 4OCRH 4RZCA 4WW1B 1BQLH 4JRFA 2PR4L 5DEZA 3L4TA 5GZNA 4Y19E 4LCWE 1N8OE 1H0DB 2VN3A 1DJYA 1BD2A 2YMXH 1JVKA 2ISDA 5F7NC 1NGZB 4I89A 2F61A 4PWFA 3EF4A 4M6ML 5DUPL 2OSLA 3L3JB 1ZLUH 1R33A 2WYTA 2FWOB 4J8QA 2MHAB 1XGQA 3ET9F 1OAUL 3FRPA 3BP7A 5JR1H 3BUYA 4P2RB 2GCYB 2Y3NA 2JSFA 3CZLA 4XNDA 1F4XL 3CXDH 1O75A 4ZPVB 3DKHA 5FUOL 3IETA 4DP7X 2MEJB 5IBUG 1FYTE 4S10A 2R83A 3QUGA 4G80A 4OZHF 3ZOAA 2X4UB 4ZMYA 3FO2B 4BFIB 3LNFA 5EO0A 5C7ZA 4MBOA 4J3OD 2D9CA 3MOBH 3ZGHA 3ZUNC 3RWJB 1J1PL 5IV2B 4KQ4L 5I1KH 5IJVB 1U91B 1DVSA 2G60H 3UTSA 1NIDA 2WCSA 4K2UH 1J87A 4LVEA 3FKUS 4MFHA 3POHA 1BFVH 3RJDA 4GW4A 3D9AH 3KDMB 3BKJH 4MA7L 3ARED 4YSEA 3C6SB 3GPSA 4QMEA 3INUH 4U1KB 5IB5A 2W07B 1WLHA 2EIMB 5DMKA 2W0LA 2YGPA 1URIA 1N3NA 1YQVH 2E9WA 4NN5C 5C0EB 3B9DA 2PYED 4BZ1L 2H0JA 3LVTA 4B3VA 2WVVB 1TO5A 2WLLB 1XGZA 2B2XL 2NY6B 2E8ZA 3DYPA 5KSBE 2AF2A 4XHJD 2P8MB 3AWGA 3RDTB 3VXUE 1FL6B 3S3DB 5BW7A 5DD5H 1ROCA 3R7QA 1EVTC 4BRVA 2Y3AA 3IKCA 3BPOB 3FRUB 1BGXL 5ALBH 2E7LC 3U0WH 3EJRA 2ZSVB 1B0IA 1A1NA 3ZTCC 5GRXG 1I8UA 1XF5A 1OARH 4AQEA 2AERT 2CR6A 3X14A 2C26A 3OKDA 4LRIA 4BFOA 3Q13A 4PP2B 1G1OA 3FUEA 4MAZA 2OK0L 1Y7VA 5EF0A 4YHZL 1OM9A 3DK2A 1A6ZA 1SVZA 3MRKA 2Y7SA 3AG3B 1E6OL 1CE1L 4PIBA 1E43A 3QQ4B 1UOKA 1PLBA 3ECVA 3NT0A 4BH7B 2BINA 1ILUA 2A2QT 2ZYSA 2AZAA 3PNWB 3ZYJA 1HYSD 2FEJA 4JREC 4KKCD 2YD2A 4EIBA 5CM1A 1A65A 4TN9A 2EDMA 4F15B 5HYSB 3KWUA 3ATAA 4I1PA 1QSEE 3VXOA 4YFLI 2X6BA 4NPKA 2GBTA 3CFCL 3PGDA 2IQ9H 3CDGB 5KVFH 3PGCA 1B3IA 1RZGB 3CPUA 5D70H 5ITBH 1F97A 3FFCD 4XB7A 3PP3K 2HPOA 2WAHA 1GGIH 1NZRA 1A7OL 5HY9B 3TH2T 3P9LB 1S8DB 3BISA 3QZMA 4G11A 3SJVD 2WWMC 1JHTB 2NOYA 3KPRD 1R3JA 2JB6A 5T1LB 3SDXE 4DP6X 1RSYA 4R4FL 2NDGA 5KG9A 4XO5A 1KXQE 4MYPA 5GZNC 2EIKB 5HJ3B 3SO3C 5TE7H 4FQJL 4F8LA 1SFHA 1YQ2A 5ABDE 3FU6A 1Q9LA 4TSAL 12E8H 2YA0A 1R24A 3KPNA 1RU9L 5L9DL 2O61B 1EO8L 2CRZA 1E3ZA 3C08L 1EANA 2NW2A 4JQXC 5E4IA 5FM5M 2R4SH 1JGDB 2NUTA 3ARDA 3HC4L 3KWWB 3ORJA 3QDGA 5F1IB 1D7CA 4MB5A 1JCKA 4ZQTA 3HE6B 5LBSA 4BFBD 2J25A 1SF3A 3OKNB 3FPYA 4ZXBA 5LNDA 3T6QC 4L3EE 1WZMA 2FQDA 4MNHA 4PJ9A 4DEPB 4E9TA 5BZWA 3T9WA 1HXMA 2HFTA 2J1ZA 5IV2A 4N2EA 4AYFB 2ITFA 3TONA 1BFTA 1ZHLA 2R0LH 1EWHA 4KKBC 3WLWC 3KYNB 1KJ3L 1QSFD 3M46A 4KTEH 4N0YH 5AAWC 1Q1JH 1PDKB 1SJHA 3KXFA 2ZJSH 2YPLD 4F8TA 3WO4C 2UXTA 1CIDA 1BVKB 2OR9L 1UZ6F 1MREH 3WEXB 5CLTA 5E1QA 1IC4L 1RLWA 1VIWA 2IDSA 3RDTC 1QFUH 1C5CH 3AG2B 3S96B 4E9WA 3QULA 4HWBA 1WWWX 3W2DH 1KGJA 1UM5L 3RGVC 3GLZA 4Z77B 1BP3B 5CJBA 2L7EA 5J1AA 2QKIB 4ZUUA 2O5NA 4MSWB 2JJTC 4O2EB 3I2CL 3DV4B 3VXQB 1BF8A 4DKTA 2X12A 2DQGL 1IKNC 3VJ6A 1M1SA 2EYRA 2NY2B 2VMFA 5ETUA 2ZONA 5BW7C 3P4LA 1VKXA 3GIVB 4MXVE 4UNUA 2BVOA 3RWEA 2HMIC 2QGEA 2VXTH 5SV3A 4D9LL 2QSCL 1XCWA 1EHAA 3VH8G 4LFHG 4KI1A 4OQTA 3P4OB 2HYMA 2AABL 2HJKA 4N8CH 5GIRB 1MH5A 4KV5F 4LT7A 4EOWH 4WW2B 5T3ZL 2J6EL 4K7PY 4P5SA 3GI8L 1U8OA 2X6UA 4KI5E 5D55A 5IB1A 5HXMA 4JUTA 5MI0B 4F1ZA 2KS0A 1TCRB 2KZ1B 1J9TA 1B0GA 4JRYE 5I1GH 5AVXB 2ED7A 3IMVA 4LL1A 3KM2A 35C8H 4FL4C 2P9RA 3G6JE 1WSST 5C0FA 4EI5A 1DQQB 4NQDB 3EDDA 2JKSA 3ESUF 1QBML 4JEGB 1YPZB 3SY6A 1J8HE 5E8EA 1U8MA 3ARTA 3X1NA 2CU9A 4MJJA 3CSFA 2NUPB 2ITCA 1TTGA 1RURL 2ZX7A 2ZUYA 4PJBE 4C54A 4CBPA 4P2QE 1K4CA 3WS6A 2GTZB 4ABQA 1UJ3B 4AK2A 5FUZL 2VLJD 3VCLA 1RFDL 2F74B 2UZIL 3EFOB 1OP3H 1AQKL 3QUYD 5H4YA 2MCAA 3VX0A 3W38A 1AS6A 3LRSB 1U3NA 1CXFA 25C8H 4HULB 3EYSL 1IFGA 2FX8H 3CZUB 3WI9A 3MRDB 1A2YB 1JTPA 4ZX4A 3CFDA 5FHAL 5GQBA 2H1PL 2GHZA 1KTJA 3FPXA 3ARPA 1LEKB 4CW1A 5D2LB 3Q8EA 3NH7H 1CFVH 2H8PA 5E2TH 3NBNA 3MUJA 1P5UB 5IUSA 1UURA 2AEWA 2PCPB 5GGQL 3TWCL 4HUWA 2B16A 2N0KA 3PJSB 1DDTA 1KTCA 1NLBH 4BSWA 3P2DA 4TNEA 2HKFH 1KENL 3V9EA 4PWGA 4XPFL 1RJYB 4BEIA 1BZQK 1CL7H 3AABA 4DJMA 2FWLB 4Y2OB 2AXWA 4TUOA 4X4YA 3L6FB 1QG3A 3O6FD 4PJ9C 4ELMA 3PWVA 2EDLA 2VLKB 2NY1C 1JGVH 3D51A 4BBWA 2DBJA 4F2MA 3L7EB 5LXGH 1Y1DA 2ZAGA 2BP3A 5G5DA 4QD2E 3ZYOA 3DGGB 2CGYA 4M93B 3LJ3A 1DR9A 2IG2L 2BIOA 3GSWA 1FIGL 4U1JA 3CZNA 4CN1A 5D93B 4ZO8A 2BY1A 1P6AB 1DEEB 5FM5O 2Z93B 3IDMB 2YK1L 5EO9A 3OL2A 2BVUA 2J72A 2YN3A 2HWZH 1K8DB 3K4DA 1TETL 3NCYS 3COOA 3N85H 2FEDD 3HNTH 5INCB 1R17A 1AR2A 2VAJA 4IIZA 5T1KA 5FO8B 2VC2B 5I6NA 1AC0A 2QHRL 3QEQB 3VXNA 2PR4H 2ICWI 1XMWA 4PRIE 1FVDB 1HINH 3VFTB 4N0RA 3OB0K 2K78A 2WLJA 2BWIA 2IH3A 1D9KD 3ZDWA 1D7DA 2KLTA 2VO5A 4HLZG 2CO3A 4WW2C 4TVPE 3LRLA 1OP3K 3NZHL 4G7RB 3OR6B 4M3JA 2ADFH 5EZJB 5C2BL 4X9HA 1NSNL 5DUPH 5IBTL 1TNMA 1XF1A 5I1AB 5CZRA 4KXZH 1FLTX 1FHGA 3D06A 4UV4L 1IC0A 1OAUH 1C08A 5I1LB 1HT6A 5B7EA 1W80A 6PAZA 1F4XH 1NCJA 3CFJA 5KZCD 5FUOH 1YNKL 1C16B 3HLAA 2GY7B 4XBMA 2L04A 4KZDL 3ZDYF 4PJ8A 4LPUA 4J8RA 4ODXB 5B3JE 3CQQA 4EUPH 4HPOH 4RNRA 5J12B 4O02B 3WTXA 4Q6IC 5CP3H 1P7KB 1ZLEA 3T3MF 1J1PH 4KQ4H 3U36A 3OR7A 2A77L 3BGFC 2OMTA 3QQDA 3SIKA 5HDBB 4AJYV 1G7QA 3KVPA 4R4BB 4KY2A 1L9NA 2RH0A 1L7TL 1DVUA 2MTAA 4MA7H 3VGFA 4N1EA 4YIQA 2D73A 4NYLB 5BO0D 3O6ML 4WFHE 2Q86A 3WS6C 3B2VL 3WJLC 5I5MA 3UL4A 1WGVA 2P8PB 4IOIA 1RY7B 3CFMA 3EYVB 1XGYL 4RIRA 3JVGC 3VFNA 2JQMA 2PCFA 1EHKB 2XTJE 1IC7L 4BZ1H 1EAPA 2B15A 1XL4A 5CCKL 5A2LH 5AQ0A 2LVCA 4F37K 3OXSB 4AVJA 4PRHD 5ES4B 2YMOA 3BVTA 4K8RL 4TUKL 4OJDH 5IVXE 1BGXH 2DLTA 2ZCZA 1LO3L 1ADQL 4AQAA 3BEWA 2YAHA 2KBGA 2DI8A 3IDIB 4PLOB 2WBWB 1AXSB 1RH8A 5F7AA 4M93C 2OK0H 5HHOB 3BKCL 2YBRA 4ZUTB 2VISA 4YHZH 4Y19A 4LASL 5KWYC 3OGCB 3Q5OA 4Z3FA 1E6OH 4B3EA 1CE1H 2DQEL 4KKRA 5I76A 1U8HA 1UFUA 3OKOB 4AEHL 3FO0L 4WWKB 4NZRL 2TRYA 4G9FA 3P3SA 3ABZA 1YEGL 2JIXA 5DRNA 4NXKA 3MBWB 4NUQA 3TO4A 3D39E 4ZAKA 1E9PA 3CFCH 3E8VA 4BKTC 3HUJF 1A6AB 3D3VB 2YKLL 1B0WA 4GUPB 1ZS8B 5F0PB 3WJJA 4BHUA 2MSPA 1A7OH 3B1UA 3IMTA 3MV9D 4R26L 4LARH 2X28A 3PHQA 3MO1A 1ZHNA 2CPCA 2DMHA 1E5YA 4EO5A 1MHEB 3KYOA 2HJFB 2R15A 3QG6B 4FQJH 2P1YA 5E5MB 2R9HC 2RA1A 4H13C 1FPTH 4CJ0A 4ECNA 2F53D 4YPGA 4TSAH 1OP5H 1PG7X 3SBQA 5EDXA 1RU9H 3T8XB 5L9DH 1FYTB 1EO8H 3L9BA 5KVMC 1AHWB 3C08H 1GKOA 4XCFH 3EOBB 2DQUL 4N8UA 4XZUB 5BUAA 2MFNA 2G5BA 4X0KA 3HC4H 1UWEH 3JV6B 5J12C 4FABL 4OCMC 1T2XA 3SCMA 2XLLA 4GW1B 2I25N 2NY3C 2FVNA 1EX0A 3NJFA 2QGBA 5FO9A 4MQSB 5D7JA 3TZVB 2ZWNA 3T0EB 1GRWA 3QUZA 5KSBA 3Q8AA 5D6CB 3RVTC 1LNUB 3K6SA 5L8KB 5FECA 1KJ3H 3EH2A 5GGTA 3MRRB 4OV5A 3FU3A 3I74A 4I48A 2LQRA 5IJCC 1NQBA 1ZY9A 4S1QL 3EZ8A 3DVGB 2OR9H 2QT6A 4H1LB 3SQOH 3ZKMC 1IC4H 1IGYA 1WITA 3MRFB 4N2HA 3X1GA 2OTUA 1NANH 4AV4A 3D85B 4AH2B 2IAMB 2WJ7A 4V1DD 1OCRB 1T5KA 4OM0L 4DPBX 4U1IA 3VFRA 1VRSA 4BXVA 4TQ8A 2WYZA 4XXWA 3RG1C 4MB3A 1MXGA 2FH6A 3I2CH 5KYUB 2OPCA 3MKGA 2DQGH 4PYGA 5HVWA 5T5FL 3NIGE 4FKHA 1BXAA 1OAJA 1RK7A 2OMWA 3G6DH 3D12B 4Y4FD 5ESVB 4D9LH 1E2WA 5BJTA 2QSCH 4UT7L 1QI4A 3TJHC 3G04A 3LDBC 3FSAA 2AABH 4QRPD 1ZXKA 2ZSWA 5T3ZH 1UUNA 3SDXA 4EN2A 2J6EH 4YLBA 3GI8H 4KK6D 4NDMB 1OP5K 4ZMZA 1BG1A 4AJWA 5JZ7D 1AOHA 2E47A 5TF1H 4DN4L 2JCCE 1Y0LA 4K5MA 1XR8A 4WV1B 1QBMH 2CBQA 2WB1A 2QPUA 4HISA 5DSCB 3SGEI 3HZ3A 3QXDB 3Q6FB 2WKGA 1ACYL 3ULSA 3HA0A 1EGJA 3GWJA 4UTBH 1ZTXE 3TO4C 3GK8L 2WO2B 2YQ3A 4GP4B 4ZAKC 3S36L 3MBEA 3X12A 1RURH 4OCYL 2N59A 2CCWA 3DX8A 3MAWA 1JXDA 3VGBA 4F93B 1KWGA 3OKLA 4YHOL 4L3EA 4YBLB 4JO4L 4JANA 5FUZH 5FGBA 3VRLF 4LCUA 3WJJC 3DHUA 4LEBA 3BIKA 1J12A 4M8UA 5EBMA 3SDYL 1RFDH 4R7VA 2UZIH 3T6VA 1AQKH 3E1F1 5HDQL 5E9AA 3EYSH 1CXEA 3NDYE 1B4LA 4HBCL 4QJ3B 4QY8B 4RX4D 5E95B 3SDDD 2COQA 4YXHH 1AHWC 1TPXB 2R1WB 5FFOA 4JKLA 4PJ5A 5FHAH 3L3OA 3U4AA 3V5HB 2H1PH 4PGCB 3L1EA 3MGTA 2E9GA 2BIPA 4OIFA 5E6RB 4IHBA 3SDAA 1IQWL 3TWCH 5GGQH 3TZVC 1T20B 2XZQL 3SDCA 4EQ2A 4GQQA 1KBVA 4ODWA 5CILH 2D3VA 5SWZA 5CF3A 1GJWA 3FOLB 1OLLA 2NNCA 2RGSA 1HQRB 1KENH 2Z92A 4XPFH 4ZBJA 4LKCA 1U8PB 1KTDA 1JWSA 4IRJD 3KDPB 5F7YC 2NNXA 4EAEA 3DJZA 4I0CC 4U1NB 3JQOB 43CAA 1XTMA 4ICXA 5C9KA 3OX8A 4YSOA 3BIBX 5F8RC 3MUGA 3QUZC 5FK9B 4KQ3L 5CCHE 4IRZL 2O30A 3RWGA 4HFWA 1ZXQA 4K9EL 5CJQL 2ED6A 4ZTPL 3QFJA 2IG2H 1FIGH 5J11C 5K39A 3UTPE 5HGBB 3GUTA 2DJSA 5GISL 2YFNA 4JPKL 1BFSA 4HK0B 2X38A 4ZO7A 1XSIA 4X7SL 2C7UB 1ML0A 2YK1H 3ULVE 1WUZA 5FB8A 1KF9B 1S9VB 3BP6A 4KO6A 1BIIA 4KRPC 4BK5C 1M1XA 2YD7A 1TETH 1VFBA 1D2OA 3DETD 4F8QA 1CICD 5CEXB 2XFGB 4ALAL 3U2IA 5HHMB 1KFAL 1BQUA 4KO9A 2QHRH 3W3BA 3G6JA 1KPRA 4NQCD 4UU9A 1EEUA 3IJ7A 3OXRA 4B27A 1TZHA 2ICEB 4QKXB 1J8HA 2H3KA 3BAJA 1FN4A 1OGAE 4CU6A 1CE6A 3KPSE 4L2LA 5I75C 2YPKA 5EPMA 3O2VL 1EHLL 4IBUA 2F6AA 1AXIB 1M6OA 4AIEA 1I7UB 3NZHH 4XMWA 4IBYA 5C2BH 4JRYB 5AKSA 1NSNH 3FK3A 2CNZA 4P2QA 2CO6A 4P4KA 5IBTH 3BKML 2GFBA 1CZ8H 5J6HA 5JIIA 4JW3A 2OMXB 1SXAA 1A8JH 4UV4H 3AXIA 4FAAB 3MNVA 5G2NA 1W0WA 3CN0A 2DWYA 3B3BA 4WKZB 5CN3A 5DJCA 3DO7B 3S3JA 2AK4A 2MIZA 4GRWH 2XKUA 5C08A 5LHDA 3O2WL 3UZQB 3VYOA 1YNKH 2X88A 4YL4A 3G3LA 1J9SA 3CSYB 4GSRA 4KZDH 2Q3AA 2DI7A 3QG7L 2GSIB 3RDJA 5GSVB 3WTWA 4V33A 1MWOA 1Q8MA 2DW5A 4XBEL 3BRFA 4DQAA 3RKDC 3OZ9L 2AV1B 2A77H 1HEZB 1KLUA 3MRNA 3EZJB 2WUBL 4WHTB 1KN2L 2RR3A 1L7TH 3G08B 2V2WB 4KH2A 5I28A 5ESQB 3QARA 3LQZA 5EUKA 3O6MH 4UIKL 3TBSB 3B2VH 3RZCD 3L95A 4NRZB 3GSUA 3WYRA 4TSBH 3TASA 1WAPA 2CIIB 1UOLA 3DHMA 1XGYH 5F7MC 3MZTA 4N5UA 2L7UA 1C7SA 4XVTH 4H8WL 4IHOA 1M56B 3CPLB 4KROC 4ZQKB 1PQZB 1MRCL 2N01B 2EIZB 4G43B 4LLQA 3TBCA 5I18L 3BPCB 1AP2B 5CCKH 4AQ8A 3L4VA 1B6UA 3L3OC 4NPYA 1KYDA 4HZLB 1CFSB 4P9HL 4LSSL 4XO3A 4K8RH 3RWHB 3S3CB 1FG2A 1GZHA 3MV8B 1NOAA 4A2EA 2DM7A 1ADQH 5MEPA 2G5UA 4R9HA 3KM1A 1XGRA 2DRUA 3V0VA 4A38A 3ZSTA 4XCCH 4QHMB 3QWRA 3WIAA 2D9QB 5EMYA 5E8NA 3LRMA 1GCYA 3LZOA 3O4LB 5AVQB 1HHGB 5DHVH 3BKCH 4P2CG 4PRIA 1UH4A 4QTIL 2I5YL 2C8NA 2K6YA 4LASH 1R19A 3LY6A 2V2TB 5EF3A 1Z9PA 1YEHL 3L3GA 5EA0L 4AEHH 1A9EA 3FO0H 3NPSB 4NZRH 4IJ3C 1IFHL 4XNZC 3GMLB 2BP5M 2EDYA 1YEGH 3GSNA 4JM2A 1NDTA 2XXCB 4HOXA 4U6HA 2JK5B 3GZQA 1F3JA 3TBYA 1SY6H 4BELD 2FB4L 3CN3A 1PS3A 3PWPA 2AI0L 1IIIA 4MRBA 3VI3F 1YNTB 3T2OA 2YKLH 4P9ML 3VRJA 4DOHB 3B7UX 4H1LG 1TVHB 2BSEA 1BF2A 2JKIS 2AAVA 3MV7D 2FJGB 5D96B 1BXUA 1JGEA 5EFIA 3HR5B 3KJ4B 3VH8A 3GKWL 4R26H 4D9RE 1F11B 3HI1B 4ETQA 1FLRL 5EEXA 1CD8A 2HT3C 1A25A 1PEZA 3D4GA 1CYGA 4PJEF 1IM9A 1FGNL 4UUJA 1I9JH 1O6VA 3MC0A 1MFDH 1P0SE 3T6XA 2DWTA 4HMCA 3DGCR 5C0CA 2DPKA 1P6WA 4PRBA 4ZMPA 3TCXA 3K81A 3MRPB 4WGWB 2DQUH 2X0UA 4XXCA 5ABAA 4EIUA 5JW4R 2L7JA 1L0PA 4FABH 4B7IA 2N56A 2VDNB 4LSQL 4KJQD 4PWHA 5INDA 2PYFB 4LB8A 4JFXB 4N2KA 3JWDC 1V7ML 4PJAE 3WENA 5CR1A 3LRGA 1E2ZA 1EEZA 3BQUD 3NMEA 3B4NA 2R2EA 1WCBA 4FG0A 4WJ5B 3D0AA 1CD1A 3TPUA 4S1DD 4BCZA 3SPHA 4LVNB 1ED3B 3KNBA 4BJLA 4KC3B 4D0DA 1HOCB 4Z7OE 1A4JB 4IKNA 4EKJA 3NEOA 2YOAA 1G9NC 3E8UL 1X5KA 4I9WD 4ADGA 4ES9A 2F68X 3QUHA 4AMKL 1TO4A 3DX2A 1WH0A 5J8OA 3GEFA 3MCKB 4HJ0D 3NABL 5EO1B 3V0IA 1GZPA 4QWWD 3H9SE 1R4XA 2VSDA 3TCTA 4XWGL 3FT3B 1ZV9A 3MSPA 3FSZA 4BM7A 5FIEA 4MDJB 3MJGX 4YR6A 2A6JA 4FHKA 2VLRE 3AADB 5T5FH 3QR2A 3FU0A 4BSJA 5J3HC 1WJ3A 1ICTA 1IE5A 3DIDA 4UT7H 1NCGA 4F80A 1SN0A 3E3QE 1N26A 2ITDA 2GTWB 4RQQA 1F4AA 3CU7A 1C12B 3CFBB 3BEVA 5DHXB 3LZFH 3NPSC 4OBSA 3CAFA 2EZ0D 3DHPA 5FA4B 3BHBA 1B0RB 3D39B 5GHWH 5IB4A 1ORSA 3WIFB 3FUFA 5AVVB 2D3LA 4OCSH 2V2XB 3QI9D 4DCQB 1IAKA 2APFA 1MCPL 4NQVB 1U8LB 3U7YL 1RK1B 4M61B 4N85A 2GITB 3GHPA 5ANMA 1S7TB 1BMZA 4L4TE 3GGWA 4DN4H 4ZMWA 2XX0A 1AQ8A 3PWNB 3G9VA 1L9TA 3IJEA 5D7KD 2KI6A 4ZODA 4Y4HD 2AQQA 5D96C 1KTRL 4NRYB 3MN8A 1ACYH 1BEYL 4HJIA 4PB0L 2PP7A 3OJ2C 4JM2C 4XVSH 4Z6AT 3QZWB 1MWAA 2PABA 3GK8H 3S36H 4M62L 3SY0B 5JLZA 1SGKA 1U8QB 1HQ4B 4OCYH 2ZX8A 3KWTA 1CDYA 3H2QA 4P23B 1LXMA 5E00B 5E94A 1KGYE 3IMUA 2YO3A 3P9WB 5GRJL 2EE6A 5D1QD 3SDYH 3CXHK 1L9SA 2ENSA 43C9B 5FDWB 5DJ6A 2ZICA 3WD5L 3HZYB 5GS2D 3HS0C 4I5BB 5EZLA 2YEQA 4NZTL 5DLLA 3U4BH 3MFGB 2IBZX 1URLA 3EGDA 3F7KA 1E50A 1F3RB 1F00I 2W9DL 4JFQA 4N20A 4RAUA 5HGDB 4R5TA 4EN3C 3BGMA 4NQEA 1IQWH 2CUHA 2XZQH 4KXCA 2J3SA 1JPGB 3B2MA 3LPPA 1GIGL 5B22A 4TRPL 5BVPL 4OD2A 4K3HA 3B6SB 4XXCC 2P45B 5D1ZB 5F7DB 1JWMA 2VB5A 2NZ9D 4LVNC 2H5UA 1TQUA 1BBDL 1BZ9B 1U4FA 1I7RA 4AIZB 4QYAA 4KQ3H 2W65B 4IRZH 3TNNA 3OF6A 1Q0XL 1L9PA 3MROA 2P5WD 4K9EH 3JV4B 3FN9A 5FX3A 1D5ZA 2OJZL 5CJQH 3F7YB 4ZTPH 5H4ZA 2DH3A 4GUQA 5KJ7E 1I1AB 3UYPB 1QP1A 1DVYA 1HCYA 1VZHA 3BN9D 1AGCA 3O9WC 4NBXB 4RFEA 5GISH 4JPKH 4CMHC 4YQXL 5F7UA 4HS3A 5JHDB 3QDHA 2ZUQB 1THCA 4MA1B 1O9WA 2UZXB 2WUCL 2BVTA 1IB5A 2CPUA 3ZKSD 1FA4A 2ESVD 3DSNB 4ALAH 3OAUL 1BV8A 1KFAH 2JCCA 4YHYB 5HYEA 3B1TA 4PCKA 4JZJA 4DESA 4M29A 2HTLC 2H9GB 3EH4B 1G7PB 1I3RB 1NCBL 4OZHE 2R4RH 3DOIA 3O2VH 1EHLH 2AK1L 1GA2A 1OHZA 4J4PC 4MJ6B 5E8OA 3BKMH 2Z31D 1A22B 2IQAB 4WVRA 1KBPA 1OT4A 4Z5RA 1BLNA 5B38A 4K8RD 5CSZB 1H6UA 4KKZA 1FNFA 2ZXAA 4ZOAA 2VM4A 4JZOB 3VGHA 3O2WH 4Y1TA 3TN0A 4IRSB 4XTRC 3SKOB 1YMMB 3C09B 5I1HL 3KMDA 1YAZA 4MLIA 3VXME 4M5ZL 3VWJA 2R0KL 3A3YB 1B88A 1C9SA 4JFFD 2ROXA 3QG7H 4J2QA 3U2SA 3NAAL 3VGDA 1UEYA 5JPNA 4XBEH 3NRPA 3O11A 3QNZA 1G7JB 2J4WL 3OZ9H 1QNZH 1AGDB 2CDEA 2KZWA 3HAEH 1E5UI 2WUBH 1DVFB 4FFYL 3SQBB 4ACTA 1OAZL 5AVUB 5CJ8A 3UMTA 4Y5XA 1A7NL 3LB6D 1BVLB 1N12A 1F4YL 4X7CC 2IALA 1RZQA 4UIKH 2BNRB 1J8KA 1AO7E 1ZHBB 1X7QA 4MNQA 4AM0B 1U30A 3QUXB 3OTTA 4MASA 3JSSA 3LEYL 4H8WH 4Z3IA 3APNA 1MRCH 2OMNA 4HYTB 4IMKC 5I18H 1KGUA 2DYPB 3IPFA 2FTAA 1UZ8A 3SGKC 5D1ZC 3MA7A 1JI2A 3OAYH 2IADA 1KNOB 1M6UA 3QO1B 1LDPL 5CEZD 1F6FB 4P9HH 4ANKA 4LSSH 2WBKA 4PG9B 5HI4D 1F0LA 5TGBB 4U7KA 4F57L 1AKPA 1WQVT 2V6HA 3KPLB 4KMQA 4G5AA 3WNNA 4V11A 2KUTA 1W72B 4N87A 4B9GA 2EUVA 3QORB 4QJ5B 2HLFC 4YPJA 2MMXA 4JCMA 4QTIH 2I5YH 4WFED 3GBNL 1BVNP 2DN7A 4U6XB 2P3YA 2YKKA 5IMOA 1MFCL 3O8XA 4HA1A 5EA0H 2NY6D 3F64A 3MJ9L 5LBGA 1ZSDB 2ZUQC 4MA1C 1IFHH 3B9VA 6CGTA 3DROB 1F90L 3UG4A 2R29A 2VAAA 2GHWB 4B5EA 1J10A 1SUJA 4G42B 5DC9B 3A6BL 4A2GA 4PJXF 1ZVSB 4WUUB 2FB4H 2EYSA 2AI0H 4ZS6C 4P9MH 3KPSB 1UGKA 3RKPA 1YEWA 3ISRA 4C55A 4ODBD 2X89A 4K7FB 3ZQXA 4TMPA 1EFXA 5EN2A 3GKWH 4G9DA 3WGUB 1FLRH 4OZ4B 2WZ6A 5PCYA 1XAKA 1EDYA 2IPKA 1G7IB 5DEJA 3C8KA 2J43A 4C56E 4JDTL 1FGNH 3BP5A 5AVRB 4NO3B 4YXLL 2CUAA 4XPGL 4K5PA 3VUAA 1NC2A 1J0ZA 4HUXA 3HZKA 4HCRL 4ZX6A 4IRSC 3C09C 4LNRA 5AZUA 3APDA 4DQOH 1JPFB 4QRFA 5AW8B 4LHQB 3BMVA 1MJ8L 1ETZA 4KRNA 5CSBA 4TXVB 5C3IA 1BX2A 1CLOL 3KVQA 4LSQH 4ERSL 3UXFA 3OAYK 3QIBA 5I66B 4I0PB 2NX5A 1QW8A 1N19A 1T0MB 3C6LA 1V7MH 3MJ8B 4X5XB 5T1LD 3TN0C 3BZ4B 4QRUB 5JW3L 4WQOA 5AD0B 3CJJA 4L5FE 2EDEA 5CLXA 1EXUA 1WBZB 2VQ1B 2ZWLT 2IDFA 5DMGD 2CK0L 3FQUA 2AP2A 1J5OL 1WBXA 1RPKA 3PL6B 3QUXC 4HIIB 3ATDA 3F6IA 3QSKB 1G0XA 2J8UF 3RPIB 4PJIA 1T6VN 2GYSA 4FG6C 1KTKE 3E8UH 2CLRB 4OZIB 4Y5XC 3UO8B 4AMKH 3TEYA 2ICES 1TLKA 2Z0UA 5DEFB 3IBOA 4YHIB 1TEGA 3NABH 4KV5E 2VZ1A 3E2HC 4WTWA 4XN2A 5F9WC 3VFUA 1X9LA 3PQYE 2KZBA 1JMZA 3EH3B 4ZDHB 5IEKA 4XWGH 5LUMA 3VYPA 3QDMB 4LL9A 4AC4A 3MREA 5BMFL 1U8KA 1DUYA 3M8OH 4G5ZL 2BSSA 3QORC 4UBDC 1WS8A 5FGRA 3BH4A 4KBPA 1RZFL 4G8EB 1WE5A 5H37H 4TTDD 2Y1ZA 3ULVC 1JF6A 2K9FB 5AZEL 4D0CA 4G8GD 3ARFD 4IBVA 5DRWB 2Y6SD 1PJ9A 1T89A 2ZG3A 2H45A 3HNVH 3HPJB 4IDLA 2K70A 1N64L 3CZKA 1AD0B 5D8JL 1HC1A 5C0IB 4LCCB 3N43F 1A6UL 1PIGA 3U7WL 1RAMA 1KJVA 3SKUD 4TLUA 4Y2LA 1MCPH 3U7YH 1RZ8B 3GMPB 4OT1L 3TVMC 4M8QB 1GOHA 1V5JA 4PBXA 4OLUL 4XVUC 3B9AA 4F27A 4Y1AA 2L7QA 2Y72A 3X1FA 4N0UE 2NY2D 4QHKI 5EWIL 4YSSA 4CRPA 4DHLA 2A73B 5DI8A 4PB0H 2E86A 3F7VB 3WMQA 2JVUA 4Y9EA 4AZ8B 4JJ5B 2EDRA 5F3BA 4YDJB 1JNHB 2KKQA 1MCWM 1S9WA 2BH0A 4QXVA 3CVBA 4F91B 1JZ2A 3AY4A 1X4XA 4YLCA 5GRJH 3RL1B 3T08A 5CMAB 4H88L 4HBQA 2EJ1A 1XZ0B 5HI3C 3WD5H 3EO0A 4KNUA 4LESA 3QS3A 2H3XC 1FBIH 3OAZH 1KIPA 5GSRA 1AZRA 2CBPA 2BCMA 4HMEA 1MZYA 2TAAA 4NZTH 3UCQA 4X7FC 1IGJB 4XODA 5KYYB 1IIKA 2AQSA 4GY4A 4HCGA 4XMZA 1VFOA 1QTPA 3BUYB 4NQDD 2W9DH 3TYFA 3RVVC 1YEEL 2BZCA 4NT6A 3ZTNL 1BAFL 4A2LA 1GIGH 1Z7JA 4TRPH 4DGVL 5BVPH 1SJMA 3HPLA 3QEUA 1JZ7A 4WTQA 3KCPA 3HVNA 3NRQA 4NP9A 3LYRA 2ZF9A 1K72A 1IL1B 4JAMA 3VW3L 3JVFC 3QIBC 3CSBA 2CJ3A 3H9SA 4NQXA 3G5YA 3UTSB 4ZNEE 1UH2A 5C07B 4KOCA 1MHHA 3MI6A 1MCDA 4GW4B 4AXWA 2OCCB 5E1AB 4P2OA 1BOGA 1Q0XH 3TLRA 1FZMA 5DVMA 2W8CA 2OJZH 4LPCA 2H41A 5I6OA 1O7SA 2BP0A 2DMBA 1GMEA 4HK3J 1WTGT 1CQKA 4HKZB 5BPPA 3UBXB 3QJZA 4N5ED 5DHDA 4YQXH 1ACXA 2Q7AA 2WLMA 4ZD3L 2QKSA 1HCFX 3RVWD 3TCLA 2VLRB 2ZYHA 3N1PC 4N90D 2YAMA 4X5PA 5K9OA 4PJGF 3HG4A 5C6PB 4RFOL 2WUCH 1WHPA 3FONA 1PNCA 2Y1YA 5DJZA 4F5CE 1E27B 5FXCH 3JT0A 4CADA 3OAUH 3RWDA 4L4TA 4K23H 3SPGA 1DJSA 1A1NB 4HH9A 3N44B 5MERA 4R7LA 1OQOA 1HSBA 5HBBA 2X3BA 2JLLA 4WFGE 1VDGA 2WXJA 1H15A 1DQJA 2XG4A 1Z5YD 4AQEB 1F4HA 3OC8A 3X14B 4IBWA 5EF1A 5AVZB 4IBTA 3WHXB 3BZFB 4X4XB 1R1CA 1HHJB 4W9GC 3RBGA 4LHUA 3CVHB 2VUYA 1IBBA 3I3DA 5D1XE 3Q3GA 4DIXA 3B2PA 1A3RL 2AK1H 3L3HA 2XQYK 2VERA 3Q9QA 3MRKB 4N3TA 1G1KA 3EJJX 3OAZK 1FZKA 1P1ZB 3UTTD 3L9RA 4JN2A 4Z7UF 4DN3L 4OF5A 1ZRUA 1UQSB 3BH8A 4OZGA 4XCEA 8FABA 4JFYB 1I1FB 1T89C 1XIWD 2FLBT 3GBML 5IFAL 5EBWA 1HN1A 3GSQA 3VXOB 3TA3D 5HDOA 5I1HH 3QEQD 3PGDB 4M5ZH 1S9KC 4JFDD 4A6YA 5E99L 1H8NA 2R0KH 3OMAB 3PF2A 2P47B 3EGXA 2WBXA 1PIFA 2Y5EA 4TNGA 3KPMB 3M1BB 3NAAH 2JB5L 2BY3A 1QOKA 4J7RA 2H2SC 3Q8FA 1OTUD 1AGFB 4XMKL 1J0KA 5CBEB 3DOSA 5AYQA 1T03L 4DKFL 1IT9L 4FFYH 3CG8A 4Z7WB 4GXUM 3C87A 1A7NH 2Y7NA 3FO1A 3R06A 4OJFH 5EUOF 4DP5X 1F4YH 4JLRA 2MKLC 4A7SA 3IGAB 2P5EE 1OTSD 1BQSA 4FULA 2QDWA 4YAQA 5CGYC 3AY4C 5DQDL 3QT2A 1R5VA 1WGOA 1R24B 4TVSa 2IH8A 3GMQB 2X87A 1PZ5A 1EH9A 1KT2A 2XFXA 4HXBL 4Q2ZB 3UJIH 1OD7A 3ARQA 1SBSL 5KSAD 3IU4L 3K8MA 4GAGL 1YEDA 4FQQA 3HZVB 4AE0A 1LDPH 2Y22A 1TQCB 4OCNC 4QHPA 1QO3B 3FB7A 4MNHB 4IBLT 4K71C 4N28A 4B9FA 5BZWB 3KL3A 3ULUF 3NZ8B 4NI3A 4A63A 3FCBA 3MRJA 5IIEB 3R8BB 1QLFA 4HHWA 5HHQA 3PNRB 5L7XL 2OZ4A 5B4MC 4F57H 1KBKA 5T3XL 2APBA 2XN2A 15C8L 3HUJE 3OQ3B 4YDLB 2R2BB 2EDHA 2LTQB 3N55A 1XR9B 1NGXB 3B3IB 4JMXA 5J1TC 2CHDA 4J5VA 3ECBB 4WJG3 4JN1L 1P4IL 1SJHB 4OFDA 5C97A 2ITEA 4GKZB 2B0SL 3HG1E 1MFCH 5KBNC 5IFJB 2RCSL 3MJ9H 4YHPB 3RY4A 3GBEA 3KHQA 1AJ7L 4E9YA 2BVYA 3FYEB 3QA3A 3TOPA 4LDEB 3WN5C 1F90H 1W2KT 1Z5LB 2P49B 5JIDA 3CVCA 5DD0L 4JFEA 3NIFF 3A6BH 3E3QC 3RVXD 4G1EB 2CLZB 4L2YA 5FF6B 4BFFA 3EFFA 2QTEA 3L3IB 3GZPA 4G6FB 4ZUUB 4ZMTA 1HCVA 1J8RA 3VXTB 2EYRB 5BXFA 3VXMA 2X7LA 5E6IC 4QO1A 2BVOB 1T66C 1AZBA 2WXHA 4XN4A 3TFKC 1UYWL 3PU7A 4JDTH 4YXLH 4WWKD 1OAYL 2KPWA 4C57C 4XPGH 1QR1A 4NCC2 3ARGD 4H25B 3O0RH 2KT6A 4HEME 2EDDA 1U8OB 1WZLA 4U1LA 4HCRH 5TDNB 2E27L 4NUJB 1AR1C 1VCBC 1G1YA 1OOWA 2ZD0A 3G9AB 4YMPA 4FTVE 4HV8A 3D3VD 1RZKC 5D9SA 4GG6F 9PCYA 5KAQG 3ETBF 1MJ8H 3HZMB 4NO2B 3VG9C 1Q9KA 1EEYB 5C0FB 1CLOH 4AVHA 4PV8B 2X44D 4JE4B 2BNUB 5E8EB 1U8MB 1EFQA 3VWKA 1YECL 3GSXB 1KCLA 2R1XA 4W9ZA 1S5HA 3HRZC 3VD5A 4NP4L 2WBJA 5JW3H 5CP3A 4Z7VF 3BLKA 4FEIA 2CKNA 2X6AA 3BD4A 1JZIA 3P77A 4YH6A 3S5LA 5JQIB 5C7XL 4JFVA 2IAND 4KKLC 1MCNA 2HVJB 2CK0H 2J88L 3D7PA 3LKRB 3W9DA 4YSCA 1J5OH 1SVCP 5B39A 4CU7A 3NRFA 1X9QA 1W72L 1RCYA 4JQIA 1D2PA 1RK0A 3HJ0A 4P5TD 5A40E 5MEND 1FL3B 2D8KA 3BESR 5DJ8B 5HYFA 4DUVA 1YSOA 1WD8A 1HWWA 4E9LA 2R27A 5D7LE 1UWXK 2PUQT 4XOAA 1TQCC 3BN3B 3DIFA 4FXKC 3UZVA 4NC1E 4PUBL 2NXYD 3T0ED 5DRXB 1IJNA 4M48L 1R5IB 4HWNA 1Q9OA 3FQWA 4ENZA 2EE9A 3LXCA 2VLMD 3P4NA 5JYLA 1INDL 1Y18B 3VXPB 1G7MA 1QLEB 3GKZA 2VW4A 1N0LB 4XXDB 4EBQL 5C6WH 5I1IL 5BMFH 3LD8B 4G5ZH 4HXAH 3F5WA 4L4VD 4X4YB 3CVDA 3LH9A 1X4YA 1ECYA 1RZFH 1H19A 2OI9B 2UZYA 3PWVB 4YK4B 3ILQC 3T3PB 1BBJA 1UD5A 5AZEH 2WWNA 5HVHC 1SLWA 5ESAA 3N1GC 5G5DB 1BYOA 3FDWA 2HFGL 2YFOA 3MV11 1TTRA 2CRIA 1N5AB 5GGRB 2AJVL 3QJOA 3D85D 4EVNB 2XWBB 1A6UH 3GSWB 2IAMD 3U7WH 3VRLE 3JTSA 4A04A 1EJ8A 1EZVX 4G82A 4OT1H 3T4AB 3IJHA 4OLUH 5T8IA 1F41A 1RSFA 4HP5A 2J20A 4XNMA 4AL8L 5ISZD 3CV5A 5EWIH 4JUSA 4WENB 3RI5K 1WA1X 4MMYA 1NGPL 4PI0A 4Q9RH 1GMIA 1IGIL 5LCVL 2Y9RT 3UBXG 3H6JA 4F9LA 1WPCA 1H3GA 2X42A 2B8OT 1XCTB 2IH3B 2Q76B 3NGBC 3BVDB 3LQMA 4UZSA 5JQ6L 3V8OA 4WZ9A 2FJHA 3B9KA 4R7NA 4RMWA 4H88H 2V7HA 3EXJA 4RGNE 3AWFA 4D8PA 2VIRA 3SYAA 1PCSA 1TU2A 4FNSA 3HI5L 1UB6A 1G7HB 3EHBB 2I9TB 1EZUA 1S7QB 3DX6A 4PRDA 1C08B 1AQDA 1ZT1B 3ABLB 1YEEH 3H56A 3EO1A 1HSAB 3X17A 3ZTNH 4AGLA 1BAFH 1LWJA 3WFDH 2VDPB 1LWHA 5T1DL 3RNQB 4DGVH 1P84J 4PJ8B 3UPCA 2R51A 4YSUA 2XPGA 3M07A 1P53A 4FA8A 1HTYA 3Q05A 3TBWA 4LHUG 3VW3H 3V6FB 1P7QA 2VR4A 2MNJB 4LLWA 2G9HA 3QQDB 2VM3A 3FC8A 2WBJC 1BAWA 4MCYB 4UM9A 1CD0A 1WBYA 3ZSSA 4X6BA 2YRPA 2FQGA 3UZEA 3NOIA 1DN0A 3WL9A 4RIRB 3TV3L 5DMJB 1CTOA 4FMFA 2EDQA 1ZPLA 3HN3A 3AQDA 1EAPB 4NKIL 3V7MA 1IAIM 2HJLB 4S0SD 3QIWD 1UM4H 3HMXL 4XX1E 1NBVL 2EDNA 4RFOH 4ZFOA 1F13A 4U1HA 1VEMA 1RIHL 4HWZB 1XDTT 2BCKB 3UGEA 4H8VA 3Q2CA 1H3UA 2EEFA 3WEOA 2XG5B 1IJ9A 4YK4C 4YWGL 3KLLA 1NFIB 1ZGLA 5GZOD 2R2HA 5LGJA 1AKJA 4RGMB 5A6LA 3ZW3A 4ACPA 2FBJL 3A4EA 3N42B 4MCZA 1P5VB 4P5RA 2O72A 1Z9OA 1JSYA 4XCYA 3SBWA 4EEEA 1A3RH 4KTYA 1UFGA 4UB0L 1AMXA 5BOZG 2PN5A 3AQXA 4L37B 4G8IB 3O3DA 4Z3GA 1U8HB 1NUFA 5GRUL 2JH2A 5CXPA 1CFBA 1BZOA 2QGDA 3FSWA 1F6AA 5IFAH 1AG0A 4XO4A 5KBKA 3GBMH 5EU4A 4G9FB 2K1MA 5DQJA 1A9BB 5CKGA 4PTTA 5C0BB 5HHMD 2SEBA 2LVEA 4YSRA 3VDBA 4LIQE 5E99H 4OF6A 4UTBA 1KIUA 1SXBA 5LGYA 2XTSA 5IW1A 1VAHA 3I3EA 2JB5H 4OGYL 1EHNA 2N0MA 1AS7A 4U3SA 5IHUL 3QJHA 5KBPA 4XMKH 1QWHA 1T03H 4DKFH 1IT9H 3ASNB 1OAQL 4HS6A 4RISL 1FFRA 4CC4A 1PZ3A 4HZ1A 4DZ8B 2I7OA 5FPIA 2F54B 1SOSA 3U46A 1O6TA 4OI8A 2X9XA 4YHNA 2Y24A 5DQDH 2AJ3A 1ZT7A 2NT1A 3FUNA 4YPGB 5F6HI 3RWIB 3IJYB 3QYMA 3WDJA 5FW6A 4DVBB 3BPLC 3ZR5A 5TDOA 4HXBH 1SZNA 4WSGA 3F62A 3CFTA 2H2PC 3AUWB 3D4YA 5DJAB 3GDCA 1QLRA 3IU4H 2IVFC 2GC4C 3PIQB 4GAGH 1TQSA 3BLPX 4HD5A 2UVEA 3LZPA 1B4RA 4ZMNA 1PVHA 2XTLA 5ENWA 2YRZA 2DQTH 3T4YA 3T8VA 4TNVK 1MRFL 1GOGA 4YXKH 1WA0X 2VDRL 2RTTA 2RIKA 5IKCA 2IMMA 1AS8A 4ONFL 4WI7A 4U1GB 4ZZFA 5L7XH 4ZK8A 1GGCL 3MZGB 3QYCA 4LLYA 15C8H 3K6SB 5FECB 4R7DB 1E3FA 4OY9A 3LN5B 1YN7B 3HHRB 5JPMB 4G2AA 4JN1H 1P4IH 4KK9D 1VACA 3QQ9C 4I48B 2KMWA 5E5RB 5TK2A 2B0SH 2K3TA 1UHVA 3BXNA 4N8VA 2QPDB 4AYMC 5KYWA 2RCSH 4EKXA 1RHHA 3FN0L 4PJEE 4RAVB 4N9GA 4B0MB 3FFCE 1T0NB 4JL2A 5BRZA 3L17A 1BZDA 4ONHA 4PR5B 4H40A 4GBXA 3ZTJG 5DD0H 5ICZA 1KZYA 3SE9H 5F0JB 1NIFA 3KPRE 3VFRB 2FE0A 2XYCA 4Q6YA 5CU5A 3S5LG 4MWFB 4NBZB 2D2CC 4ANUA 4E36A 3NSFA 3O4LD 1IKOP 1OCZB 1RMFL 3D8MA 4BD4A 3AROA 4AYEC 3PABB 2DQFA 2FCBA 3L5WA 1VFAB 2OMWB 3W0WD 5BJTB 3GLAA 2I60L 4GRLA 1NOLA 4X99B 4RWHA 1UYWH 4MXQC 3L4WA 1JYVA 3UC0H 3V4PA 2BJML 3UPRA 1RUQL 3L5XL 3LSOA 4UQAA 1OAYH 4L8SA 5B7MA 2LLLA 2ZSWB 5EIIB 3VXRB 4C83A 4Q9CA 4Q97A 2BSRA 3SBWC 1DVZA 5DJ0A 1INQA 3SPCA 1FRGL 2E27H 1DJWA 2E3VA 7CGTA 2ERJB 4JRXB 4KGLA 2P5EA 5FW7A 1R3LA 1A7QH 3BVVA 1J05A 1BHGA 4HWEL 2DWDB 1M2VB 5HYQB 1ET5A 2CDFB 3BUPA 1QSFE 2X2YA 4EZMA 3DO4A 2GJ6A 4OZFG 5LBSL 3CXFA 1M7DA 3BYYA 4N1CA 2OYKA 1XH2A 4ZO6A 5J57B 2EDOA 2YPLE 4JDZB 5C7XH 4YNYB 1GGYA 1FWXA 2J88H 3CN4A 3MRBB 5C3TA 1TFPA 4QUOA 2B39A 3MRQA 3PS6A 4UAHA 2EACA 2VOTA 1T1ZA 1U41A 3QXAB 2JXMA 4PW3A 4P5KA 3E9UA 3O41B 2NSXA 3K3QA 4AC2A 5SX4H 4JFZL 3FZUD 2VJXA 3VD4A 2CDGA 5BUPA 5JXED 4E2OA 1QPXA 3M86A 5DO8A 2IJ0C 3W11D 3SE3C 4APQB 3BWZA 4XWOD 5DK0A 1AIFA 4PUBH 2DB8A 3MRCA 4NNPL 1AD9A 3SDCB 3K6DA 4M48H 4ODWB 5SWZB 3L4CA 2GK0A 3SGEH 4MB1A 4XN9A 4M8VA 2OV0A 4MD4B 1INDH 4HWBL 4EBQH 4GQ9L 5I1IH 2A0LD 1SOQA 1IGTB 1CVRA 5HDLA 4NKMA 3L5IA 4IIQB 1Q90A 3HG1B 4H4NA 4K3EL 1TITA 2FATL 5DJ2B 3RHWK 5IBLD 1UEMA 4OGZA 3RIFK 3MUGB 2WLHA 5DWPA 5E6UB 5KYNA 3DXAA 1MLCB 3GSRA 4XR8C 1PNDA 4N0CD 2WINA 32C2A 4KO7A 1P69B 2HFGH 3TWYA 2ZWKA 1O5DT 1T4KA 4OQTL 2AJVH 2WLIA 2ZKMX 5KUMA 4HKJB 2UXFA 3D18A 1F56A 1JUFA 1SHWA 5HHNA 3KS0H 2Z35A 3TU6A 4AJ0A 2X9WA 2AKRA 4HEMA 4U1MA 3BP6B 3WFHA 4AL8H 1QRNA 2XN9B 1SY6A 4FQLL 3BH9B 5D1XC 1VFBB 1HHHB 1B2WL 2EP6A 2VLJE 3EAKA 3OLIA 1DSWA 4X9YA 1ZJBA 1NGPH 1K5WA 1PLCA 3JWOC 1IGIH 3N1QC 5LCVH 3OKEA 2XWJA 3DWTA 4M5TA 5BZDB 4D0BB 3FT4B 1J5CA 3TURA 3VDAA 6FABH 2UWEF 1HILA 1JI1A 1A4KA 1TEYA 5HVFB 1NC4A 5JQ6H 3ASWA 4A2HA 2R7EA 3ALXA 2A9ML 4MMXB 4K5NA 4FQHA 3KPOB 3SBRA 3CFQA 4FTVB 4C47A 3HI5H 4ZUSA 1UD4A 2ERJC 5E9DB 3BT0A 1UXSB 2B3RA 4OF8A 3WKNA 1W0WB 1YYCA 4E5XA 5HPOA 4WTXA 3P4MA 4WW2F 2AK4B 5A1AA 4X80L 2MWCA 1NCCL 1EZVY 4P5MA 2FJFB 2OFQA 5T1DH 1JF1B 4PRPB 1ZA6B 3WIHA 4KDTA 4P23D 5D7LA 1U3HA 1YPZF 4PMFA 4L8DB 5I9QB 4NHUA 2FR4B 1EK3A 4L48A 5HHXL 4UMSA 4HKBA 3AS1A 5JNYB 1QX1A 1S7XA 4N2CA 1JNJA 1KJ2A 4ODUA 1M4KA 3EGSB 3H6AA 2VDKL 2YRLA 1UB5A 1KGXA 4N0FA 3TV3H 2EH8L 3OD3A 3MMEB 4MHHG 3A0OA 5DEGB 2K4WA 1B4JL 4OFYD 4JG9A 2Q7YB 1QFPA 3DVIA 3B2UC 3QDJD 4NKIH 4Q56A 4FYSA 5E4OA 1HIML 2BSCA 3HMXH 4OF0A 5D2LF 1NBVH 1TQWA 3O3UN 5E23A 1RIHH 5BZXA 2EC9T 1G6VK 5CCJA 1FG2B 4IIQC 1SXZA 4LLMB 4YWGH 4CGTA 4EDXB 2IF7A 1XGRB 4KZEL 3QR0A 3VA6A 5E5LA 4PW4A 5E8NB 1JDCA 1D5XA 2FBJH 2RMNA 1BJ1J 3N1FC 1SXSA 4AEFA 1I1AD 3T65B 4EPSA 2GJRA 5FYKE 1NFKA 3BVNA 4ZMLA 2ARJQ 1XGUA 4L0PB 4KXBA 5CJXC 5B8CA 1PY9A 4FLOA 3MRGA 5GRUH 3IAGC 3RY5A 3LPFA 1PD1A 4RH4A 1UWYA 4NNXA 3VD9A 1AIZA 4U05A 3GSNB 1NGWA 2AC0A 2LU4A 3L81A 3EJPA 5T3XD 3IB4A 1F3JB 5DZOA 4B6ZA 5L2KA 3VRJB 1FNSL 2CKBA 1UJTA 2PPFA 1KCKA 4OGYH 2N7SA 1VJSA 2CA4A 4NNYB 3SZ6A 5IHUH 3NSXA 5GJTL 3GRGA 4ETQB 3GJEB 1CGSL 1MCEA 2NXZC 1OAQH 4RISH 3Q01A 4N8VG 2VLLA 4UUJB 4XP5L 4UTAH 1T0OA 5C0CB 1NEZA 3KPPB 1JN6A 3G5VA 3LN4B 1YMMD 5TE4L 5KVEL 1MHCA 4FQCL 4W6WB 1BWWA 2RBLA 4GAYA 4HIEB 2CNYA 2CCVA 3CDCA