2W88A

Plastocyanin variant with n-terminal methionine - open structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PLASTOCYANIN
publication title Metal-Mediated Self-Assembly of a Beta-Sandwich Protein.
pubmed doi rcsb
source organism Phormidium laminosum
total genus 24
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2w88A00
4N4YB 1A4BA 4BWUA 5I26A 3MX0B 3H4FA 1JZEA 3UABA 2UXFA 2IDFA 4KO7A 1NIAA 1V10A 2BZ7A 1T5KA 2OV0A 1A4AA 3AG1B 3CVDA 2PCYA 1RKRA 3PLYA 2GHZA 4KNTA 2IWKA 2EIJB 1BQRA 1ZIBA 1GS6X 1KCWA 1E5ZA 1E65A 5I6NA 2RACA 5B7EA 1AZCA 5A7EA 4DP5X 2QDVA 4NB7A 2PP7A 4DP4X 2R7EB 3IE9A 1JERA 4G7SB 4ZK8A 5F7AA 5LDUA 1SF5A 2UXVA 2VM4A 3SBRA 2JKWA 2BHFA 2PCFA 2HLEB 3PAUA 4E9YA 3ZX1A 1OOWA 1ZIAA 4RH4A 1X9RA 3QJRB 4YSOA 4YSSA 1KDIA 3KW8A 4E9XA 2GC7C 2FWLB 2P80A 2XX1A 3OQRA 2NRDA 2YQBA 3X1FA 1I53A 3NYKA 5TK2A 2Q5BA 1XB3A 1BXVA 2GIMA 2P80D 1E67A 1WA2X 3QJVB 3HEIB 4A2HA 1QHQA 3NJLA 2JFCA 5B1JC 1J5CA 3NP3A 3T6ZA 1X9UA 1ASPA 3EF4A 2XV3A 1ASQA 3AG2B 2XXGA 2WO2B 4A2FA 4HCFA 2AFNA 4UAHA 3CZUB 3FU7B 2VSMB 1SHXA 2R7EA 3FPYA 2IDTA 1A8ZA 3NJHA 1MZYA 3NSYA 5I5MA 2HXAA 2JXMA 1PLBA 4A66A 2FNWA 4BWWA 3AW5A 3N2JA 2BW5A 3FS9A 2H47C 4UANA 4M4RB 2H3XC 1UATA 3ERXA 2HRHA 3NSFA 1PLAA 1J9SA 1ILSA 2XYBA 5FC9A 1AZRA 3X1BA 2QPDB 2HZHA 1OCCB 2VW6A 2OCCB 1JXGA 3T6XA 1AOZA 3SQRA 1NWOA 3IEAA 2I7OA 4FA7B 1FWXA 2TSBA 4GXFA 1AANA 3CG8A 1SFDA 3S3BB 1OV8A 3QPKA 2B3IA 3FQYA 2UXTA 3FU7A 3DKHA 4G7RB 1TEFA 4YSCA 3DTUB 1JZGA 2YAOA 1NPJA 1SDDB 2HRGA 3AG3B 2BWDA 5PCYA 1OCOB 3OM3B 3ZDWA 3ABLB 2FQEA 2YAHA 4HCIA 4JKNA 1AIZA 5I6KA 1ZV2A 2IDQA 2IH8A 5E9NA 2DWSA 2GI0A 1AG0A 7PAZA 4BWTA 3T6VA 1AZBA 4GP5B 1MDAA 5I6OA 3S3CB 3S3DB 3FT0A 5B1AB 5PAZA 4DPAX 2GSMB 2DV6A 2PPEA 4TXVB 2CUAA 1PY0A 1ZDSA 1AZNA 1JZHA 2Y69B 4BXSV 2IWEA 4YSDA 4AZUA 3QJUB 1NDTA 1ASOA 3H4HA 1BQ5A 4CSPA 2BW4A 4E9VA 5AKRA 4HIPA 4E9SA 2IDSA 4G71B 3WG7B 3BVDB 4BK5C 4AKQA 2FQDA 3UADA 1JVOA 1JZIA 4L0PB 1RZPA 2VM3A 3CDZA 3FYEB 4HHGA 1HFUA 2CJ3A 4DPCX 2XLLA 3WI9A 1SDDA 2AZAA 1KBWA 3X1NA 1IUZA 1OCRB 1ZDQA 1YLBB 1WS7A 3JT2A 2PPFA 4PAZA 3NJJA 4A67A 1AAJA 1OF0A 4W9ZA 3QQXA 3ABMB 2X87A 2FT8A 2AANA 2I85A 2FT7A 2YXWA 4N8UA 1NTDA 1BEXA 4KOBA 3GXUB 2DY2A 3PCYA 3TBBA 4HAKA 3FSVA 3IN2A 2UXGA 5I5JA 1AQ8A 3OMAB 2CALA 3D12B 1VLXA 3AZUA 2PP9A 1FFTB 3NJNA 1OE1A 1WS8A 3PXLA 6PAZA 1KDJA 5F7BA 2GBAA 4X4KA 1NIBA 2YAFA 3X1GA 1RZQA 1J9RA 3EH3B 3OMIB 1L9QA 3SBPA 2BP8B 4KNUA 3WNJA 1MG2C 2I7SA 3FSWA 1PCSA 2EINB 1E30A 4DP9X 1DYZA 4E9WA 2AVFA 1AZUA 2MRYA 1OE2A 3S8FB 3NJMA 4AKOA 3AG4B 5AFAA 3KW7A 2IDUA 4F2EA 3NSCA 1PZCA 2PPCA 3N55A 3NJFA 4YVNA 2DYSB 2VW4A 1V54B 2UX7A 3JTBA 4AKPA 2ZOOA 4FAAB 4GYBA 1L9PA 1W6LA 3PAZA 1N70A 3EHBB 1ADWA 1M57B 5B1KA 1J9QA 2A3TA 3UGEA 3ZIYA 5I6LA 2GC4C 5AZUA 4HCGA 4A2EA 1BXAA 4ENZA 2IAAC 3V9CA 4A68A 1F56A 2HX7A 3NJKA 1SHWA 2EIMB 3NJIA 1CC3A 3TASA 1J5DA 2H5UA 3RYMA 2FQFA 1QLEB 2OJ1A 5ANHA 1EHKB 4KOCA 1XB8A 1V55B 1BQKA 1AS6A 4DP7X 4KNSA 2FTAA 2HX9A 4UF7C 1XMEB 9PCYA 1A65A 2XV0A 2ZXWB 1WAEA 1NWPA 3DIVA 2YAPA 2VW7A 2XU9A 2E86A 4DP8X 5I6MA 2IH9A 2J5WA 4G7QB 1AS8A 2LLNA 4KO5A 4W1TA 1URIA 6PCYA 1QNIA 1SJMA 4E9QA 1J9TA 4DP2X 1HAUA 3EH4B 1L9SA 3GYRA 4NERA 4E9TA 1XB6A 1RCYA 2PPAA 3FU8A 4A2DA 3EH5B 5IY5B 3NJGA 1ET7A 3PPSA 1L9RA 2PPDA 2ZWNA 2J57A 3GDCA 2YARA 4F2FA 5I5IA 2IWFA 3MBWB 4HALA 1CYXA 4DP1X 2QPEB 1BYPA 3ABKB 4QKTA 5I28A 3IBOA 3BQVA 4CSZA 4DP0X 4F7KA 3FU9A 5B1JA 3WIAA 1IBYA 3WKQA 1R1CA 3FSZA 7PCYA 4YSPA 3CVCA 4P5SA 1PZAA 1IBZA 1TEGA 3H56A 1DZ0A 3U25A 4HHWA 1OCZB 2WO3B 1HAWA 3G5WA 1IC0A 3TA4D 2UX6A 1ETJA 3FSAA 3IN0A 1CYWA 1PAZA 3PAVA 3WNIA 2YAMA 4K9JA 4YSAA 1AG6A 4KO6A 5TK4A 1ZPUA 2DYRB 2QT6A 4YSEA 1EZLA 4YVUA 3T71A 1L9TA 2VSKB 2BO0A 1JVLA 1MZZA 4DPBX 5B7FA 2HX8A 1SF3A 5D4JA 3X2QB 3QJQB 4YSTA 2FQGA 1KBVA 1M9WA 2VMJA 4GY4A 1GYCA 3T9WA 5D4HA 3WKPA 3FYIB 3HB3B 4P5RA 4QLWA 1GY1A 2XX0A 1E5YA 3NP4A 5B3SB 1MG3C 4EF3A 1PLCA 4WKXA 2X88A 2XVBA 1PNCA 1PF3A 4HZ1A 4E9RA 1PMYA 4BXVA 1BAWA 2DWTA 2XUWA 1BXUA 3AY2A 2WSDA 1AACA 1NIDA 3QJTB 2FT6A 3ZBMA 3OMNB 1BYOA 1NIFA 4JHVA 2N0MA 2YAQA 4M3HA 4BDVB 3ABGA 4WTQA 2YAEA 2EIKB 1AR1B 1PZBA 1NIEA 2BP8A 2CBPA 4YSRA 2W88A 1SFHA 2MTAA 1KV7A 3FQ1A 2ZONA 3V9EA 2BP0B 4Q89A 2PLTA 4YL4A 4YSUA 2QDWA 1FA4A 3C75A 4MFHA 1AS7A 3UACA 1ET5A 3NT0A 3TU6A 5I6PA 1GSKA 1TKWA 4G70B 2CCWA 2Y1AA 3NSDA 1PNDA 1L9OA 2GB2A 3X1EA 1N68A 1JOIA 2J55A 4GP8B 1ILUA 2BWIA 1JXFA 4Q8BA 5EHFA 1CUOA 1W8EA 3OD3A 8PAZA 3TBCA 1KCBA 5B1BB 4G72B 1KGYE 2XXFA 1A4CA 2EILB 4BDVA 1ET8A 2BZCA 3FPXA 4NAJA 1M56B 3FQ2A 1IKOP 4YSQA 1NICA 2B08A 2W8CA 3UAEA 4KO9A 3CDZB 4A2GA 1GS8A 1JXDA 4JHUA 1A3ZA 4GP4B 2BP0A 2FJSA 2VN3A 3UAAA 2XV2A 1NPNA 1JZFA 2TSAA 2CAKA 1W6WA 4PCYA 1GS7A 1NINA 2Q9OA 2XWZA 5D4IA 1CURA 3T6WA 5B7MA 3ASNB 3S8GB 3CVBA 1NZRA 1KYAA 3SBQA 1GR7A 1WA1X 1TU2A 3ASOB 3QJSB 2PP8A 1GY2A 1GW0A 3L45A 4AX3A 1SNRA 1B3IA 4AI7A 1WA0X 1ID2A 4DP6X 1JZJA 2YXVA 2J56A 1OE3A 2AZUA
chains in the Genus database with same CATH superfamily
1ZHNB 4WEMB 3L2MA 1Q0YL 3VFGL 3D8MA 4BWUA 1BPVA 1FNEB 1QRNE 3B2PA 3QWRD 3UABA 3Q1SH 2V7HB 1EXHA 1EFXD 2BOCA 15C8L 2Y3NA 2CH8A 1VESA 4YLBA 3FUMA 4OJFH 2YD9A 2TRYA 4KNTA 1VIWA 1BF8A 2HVBA 1VDGA 2QVTA 3VQMA 4PS4H 4QXTA 2PXYC 5E2UH 1H5BA 1EGJH 4D0DA 5AOLA 2WZAA 1A9BB 5G5DA 1AD0B 4I1PA 1ID5I 2X5PA 4RH4A 2HYMA 3QJRB 3GLDA 3GSVB 4LSUH 4YWGL 3ZDZE 4PLNC 2WSKA 3GS7A 4GKNB 3V8OA 3LKPA 4OLEA 2ARWA 3V7MA 1KLUB 4FDWA 1KTCA 2GIMA 3G6AB 4OB5H 1WA2X 3RZCA 3IFNL 4UQBA 3WNOA 1XBRA 2FHBA 5HDWA 4EQ3A 2AVGA 1WFOA 2IANB 2Q76B 3MBEB 4GSRA 2BP5M 3GBLA 4XCEB 2W65B 3L3JA 3E9UA 3T08A 3NCYS 1FNGB 5IBLD 3BQUD 3HC4H 1BQLH 4TNFA 3JWOH 4LPTA 1O6VA 1BQHB 3AJ7A 3S36L 2WXHA 2XHNA 2R7EA 3IFOA 2R2BA 2IDTA 3FCBA 4L1HA 1UQSA 2NLJA 3P11H 3NJHA 3DVGB 4XNBA 1UYWH 3WHE1 4W9FC 1BM3L 4KITB 1PLBA 2BVOA 2HVKA 1WZKA 2IF7A 2AK1L 4PRHE 2YOCA 4DZ8A 5KYUA 4M4RB 2W81C 3BN9D 2X4PB 3TEUA 4O2EB 4NAMA 5F1OB 1Z9SB 2V5TA 2DJSA 5L2KB 5F6HI 4AEEA 5HYQB 3EYSL 1H6UA 5D72L 3FRPA 3RVVD 3DX8A 4M29A 5FYKE 3SY0B 1Z3GH 3ZLQC 3WTUA 4AJ0A 3K80A 4F9PA 2I7OA 3ARZA 1E2WA 4O9HH 1O9WA 1QHPA 5E8PA 5SWSE 2I32A 1KJMA 1BAGA 4JHWH 3S3BB 2WPGA 3TA3B 2HJFA 2MCPH 4KHTH 1DVUA 1PG7H 5CU5A 3S4SG 1MH5A 2P45B 4G7RB 4U05A 4RGMC 3NH7L 3EYOB 3U0WH 3O9WD 1JGUH 3PNWB 3MGTA 3VFNA 5I82A 1IGIH 3WIIH 2V3EA 2FJHA 4AVHA 4FMFA 4JS7A 1JFHA 1F18A 3EW3B 4FHBD 4X5WA 2FHFA 3EXLA 2GI0A 3N5AA 4FLSA 5LWYH 3ATDA 5IQMA 1EDQA 4XP9L 1XIWA 3EH2A 4G9FA 3UAJD 3W0WD 3FT0A 3II2A 5GRUH 1BZEA 1JNHB 4EUPG 4TXVB 5DC9B 1C8PA 4HXBH 3G7TA 4FCAA 4NJ9H 4KI5D 3QNZB 2BNUB 5DO2C 3U36B 1U36A 3WFCH 4TLUA 2WVTA 3NPZB 4YHOL 1ASOA 4GAGL 3QSKB 1NAMH 3TGXA 3N43B 2DEXX 3PGCB 2GKIA 4PP1D 1BF2A 4W9CC 3UADA 2JH2A 4PM1A 3DGGA 3CBKB 4JPKH 1KY7A 2P4AB 1VSCA 4HIHA 4DPCX 3KCPA 4IRSD 5KSVA 3I6KA 3U83A 3PHQB 4PJ8A 1DQKA 1NUNB 4MA1C 1SDDA 5GGRB 5SX4H 1JV2A 2FEEI 3U0TB 2PTTA 4EBQH 1L0QA 2X89D 1N7MH 2Y5QA 3IXAB 3A0OA 3BFOA 1DQMH 3T1FB 3TV3H 5HHQA 3BKJL 3KS0H 3ZZLA 1E5UI 4A67A 1PY4A 1M1XA 1W80A 2XZAH 4Z7NB 2C9RA 4OGYH 1U8HA 5GJSL 5IV2A 3PY9A 3VSVA 5AG9A 4LCUA 1KIUA 4ZMLA 3GXUB 1BBJB 4DK5A 1YYLL 3I6GA 5BW7C 1IB5A 4QDGA 4F24A 3EH1A 2P7TA 2E59A 3OX8B 5KSUB 2FO8A 5I5JA 2YSSB 1KPVA 5JA9A 4PY7B 1CL7L 1WS8A 3PXLA 2BLFA 1RZJH 1T0OA 4Z95L 1AHMA 2LU5A 4M43H 3SBPA 3AS1A 4HPOL 4G5ZL 2V7HA 4UILH 2I7SA 4Q9BA 1CIUA 1M3IA 5DYOA 3QPQD 5KVMC 3ZMEA 4N1EA 2AMGA 3NJMA 4OJCA 4PJBE 1UKQA 2QGEA 2NXZC 2IDUA 3LN4B 5H4YA 5J9PB 3VXRD 2ITFA 3WFHA 4Y1AB 4YLCA 3QWOA 5H37H 4OLUL 1TKWB 1WO2A 2EYTB 3HR5A 4LNRA 4O4YH 1S9KC 1ADWA 5AW8B 1DDHA 2Z7UA 3KJ4B 4BFJA 4JM4H 2KLTA 3EAKA 1TFPA 1A9BA 3CK0L 4NNXA 5DEJA 1AD0A 1HEZB 4N0RA 4B9ZA 2HJKA 4IKJA 4XPHL 1BXAA 1KXQE 2ADYA 2EUVA 3GSVA 4HKZA 3RIFF 3HNTH 1XGRB 2ISDA 4GKNA 3B6SB 2YKKA 4OIIH 4BFRA 1D5RA 4APXA 1KLUA 4NWUL 1RZ7H 3RDTC 2JSFA 3G6AA 2JI2A 4OGXL 2O72A 4XBEL 4HG4J 4FQXA 1BQKA 1P2CB 2FEEL 1SXNA 1YNTB 2F5AH 1SLWA 1A6UH 3C5XA 4HUUA 2NY7L 2XV0A 3MKGA 4LEBA 5FOJA 3QRGL 1IKNA 5I1AA 4PWHA 1FNGA 3MJ9L 2OMZA 2E86A 5CSBA 3TT3L 2FSDA 5DTFA 2IH9A 4F1SA 1BQHA 2DQGL 5F8QC 1QNIA 3QDMD 4YHPB 4BRJA 1E2VA 4LLAA 3DHPA 4X9IA 4G80B 5FYLH 1RSYA 2BX5A 3GYRA 3J2PA 3Q6GL 4LF3B 3TF4A 2DM7A 4UM9D 5T8IA 5IHUL 5E2VL 5IBTH 2I07B 4KKBD 1HOCA 5HYQA 4UTAL 1U21A 2XN2A 5I5IA 2NY3D 3IDYB 4N90D 3U7WH 2UVFA 3SDAB 3HG3A 5I15L 3UJIH 2ZYIA 3RZWA 5AKSA 1JTPA 3S3SA 3BP4B 2VXUH 1KN4L 3CVIL 4U6HA 1XQ4A 1D5BA 4ZNCD 1FL3A 3QDHA 5T3ZE 3VXPB 5E94A 1J10A 4YFEA 4FHKA 1S7TB 5C6TL 3CFEB 3KLDA 5DJ6B 2EYSB 2ICEC 3JZYA 5ALBH 4RRPA 4DGIL 1QAWA 3RFZB 2EE3A 3IFLH 3J7HA 5B38A 4WK0B 1PZAA 3IDMA 3EYOA 4V2CB 5HHXL 1HAWA 5ESQB 3BJLA 3V0WL 3WTVA 3PF2A 4HJJH 4LVOC 1VFBB 4OSUH 4ZOBA 3ZT5A 1VENA 4DUXA 3B8YA 1RPKA 3MRRA 3WMSA 3QQDB 1P1ZB 5EV7A 1UT1A 4ZO8A 1SEBA 1AG6A 4KO6A 4RQQB 5D4QA 3HG1A 1AMYA 3M7FB 5ABDE 1KT2B 5DYFA 5EIIA 4UDTB 2WXGA 2V9UA 2QGDA 1DE4A 1E0OB 1JNHA 3MBWA 3DXAE 5I75C 1FFOB 3HI5L 3NVQA 3L9EA 1OTUD 1RUMH 1MDTA 2BNUA 2HFGH 5ICYB 2M83A 5JO5B 5TDNB 3GTNA 2E7LC 3OMZA 4JM2D 4RVBA 1DVXA 5AOJA 5D4HA 1PPIA 1A14H 2JLPA 2IAMA 1HQ4B 3BCDA 4HWEH 4XZUA 5C1MB 3F7LA 5AYTA 3ARQA 1E6OL 2YD8A 3RKDC 1LE9B 4RMBA 3GMOB 4WHYH 4HPYL 3MRIA 1BBJA 5C7ZA 1Z32X 4IKNA 4AGQA 1LXMA 2X4QB 4PTTB 3OMNB 4B27A 3CC1A 4KTDL 1KLFB 5CF3A 4UOW0 2NTFB 3MV9E 1ZHKA 5KAQG 1LEGB 2D4FA 1J18A 4APQB 5CJXA 2YAEA 2ZCZA 5GRVK 2L04A 1IBFA 4XBGB 3BAXA 3ZU8A 1HL4A 4ALAL 3WLWC 2W88A 1SFHA 3FOMA 2X9YA 4IGBB 4JM2F 1KBPA 2M2DA 3R0NA 3H1ZA 2ICWB 4BK5A 4OT1H 3LY6A 1ZVYA 1FZJA 4MFHA 3MPCA 2GJ6D 3DURB 3MACH 4DEWA 4F9LC 1MRCL 2MIZA 5JTWA 1W0YT 1AI1L 3HI1B 1TKWA 1ORSB 1UCBL 4X9YA 4Y9CA 4HCRA 2QSVA 4BZ2H 4K8RD 1HKFA 1WAAF 5KYNA 1H19A 2COQA 3MJ7A 2P5EE 3U6RA 3FO9B 2UZYA 4YHNA 5AVRB 2MSPA 2VLJB 1GGCH 2P49B 4P23D 5F72S 3B6SA 1KC5H 2VL5A 4P5TC 5E8NA 4JPIA 5KYYB 2R0LL 1MJJB 4NI6A 4UAOB 4AYID 3CAFA 43C9B 5DJDB 3WUWB 3WEXB 2XQYG 3REWA 2Z93B 4M6MH 2ED9A 1H3WM 4PV8B 2PKDA 2EADA 4A37A 1A3RH 1R3IL 2AJ3B 2IG2L 2F7OA 4H0HB 4GXVL 1PKQB 4TL4A 4I4WB 1QBLL 4N5EC 3P4NB 4OLYH 2CAKA 3B9KC 3DX1A 3WJLA 4J5VA 3RNKB 1S5IL 3K2UH 1JHKL 4IRJC 3FQTA 1KJ2A 4W9HC 5SWZB 5D4IA 5A6MA 2H3KA 3MSPA 1DBJH 4S1QH 4GIAA 1MW3A 1J1XL 1QO3A 3CMOL 4FTVD 1GY2A 4DKEH 5AW6B 4OQTA 4NFDA 1ZVHA 4LF3A 1LMKA 4I8DA 4AG4L 4JFFE 4G9DA 1QACA 4JDTH 4WI4A 5JIHA 3KMDA 3FTVA 1RK1B 4PJXF 2BNRD 3DX9B 4N9OB 4JFHE 2JIXB 1YMMB 2J20A 4FXGA 1OARH 3CNKA 4LCWA 3SYPA 5CWSB 5CEZH 5C0BD 2OYKA 2IDCA 4FKEA 1LO3H 3L3DB 3V4PH 2PR9A 3WY4A 5I0ZA 1T5KA 2EXWD 1LDPL 4MA7H 2CGYA 1FHNA 1M9SA 1UHVA 3BLBA 2GHZA 1BLIA 5GZOA 1BMGA 2IWKA 3BAWA 1TUPA 4PLJC 3IJEB 1E5ZA 1PX3A 3NRFA 2BVTA 5TDPB 1E3ZA 2BY2A 5KS9E 2E3VA 4JJOA 4WTXA 4YAQB 1AZCA 5EF2A 4P5MB 1S7TA 4DP5X 1MFDH 3CFEA 4S1DD 5DJ6A 4BFBD 4ZMPA 2X70B 5GGTH 4PGCB 1IM3B 1T21A 2CK0H 1H0DB 2R56H 2XKNB 1KCKA 5ESQA 4JPWL 5FO8B 4B5EA 5AZEL 1OIOA 1VFBA 1ECZA 4NKMA 3KW8A 5IQ7L 3D3VE 4A7QA 2DQEL 3GSNL 3QQDA 1P1ZA 1TTBA 1VZGA 2IALB 3BP6A 2BCMA 2V2WB 3OZKA 4K7PY 5C08E 3UTTE 2VZVA 5TK2A 3DTDA 2N7AA 1KIQA 1SVZA 2Q5BA 3DYOA 1FZKB 4RQQA 3STLA 1CF8H 1HXYB 3CDFA 3RWDA 3QJVB 3R7RA 1KT2A 2KT6A 5E6IC 2ZPKL 3FTGA 3RX8A 2VH5H 3I50L 4OM1L 5D1ZI 4YGVB 1SJEB 4H8WL 3TIDB 1EVTC 3U2JA 1FFOA 1ZGLB 3SE4C 4JPQA 5CNHA 3BH9A 3JWNH 1C5DA 5JO5A 5TDNA 2QQNH 3BP7A 4PV1C 3BPNC 4HLZG 3P3UA 3CZUB 4PGDB 2E7HA 4F58H 2G2PA 2JB5H 1AO7E 4HC1A 5ALCH 3P73B 4OJDH 1FYTA 2LFGA 2OJZL 2Z65C 3NSYA 2E7BA 1HQ4A 3VWJA 2JTDA 3RA7H 3I2CL 4F5CE 1CTOA 2Y07H 1ZLWK 1E27B 2NX5D 1U8KB 4GQQA 4OLZL 12E8H 4L8SB 4ZFZB 4MKTA 3MXWL 4XVJL 2Q8BH 4HWBL 2X6VA 2C1OA 1IGYA 5CN1A 2A74A 3UIZA 1GJUA 1IFRA 3DMMC 4CAGA 1VAHA 4PTTA 2YIHA 1AOZA 3Q2VA 1H3PL 2AXGB 1NWOA 1MNNA 3PYCA 4JG0H 4WW2F 3IEAA 5C0CA 1MCEA 3HC0B 3V4VB 4YHLH 5A6IA 3FN0L 4X5LA 2TSBA 4KRPB 1UOLA 1FDLH 1ZT7A 2WQ8A 3BVNA 3VUAA 2A77L 5DWPA 4XBGA 1NFIB 3V5HA 5K9OA 5I8KH 2EDWA 5GGSY 5GRZA 5LQBH 1CGTA 1HJBC 4RZCB 1NPJA 3RIKA 4WEBH 2UUDK 1FVDB 2NY0B 4XP1H 3MODL 5PCYA 1TJIH 3L3IB 4AEHH 5C09B 1Y07A 2DF3A 2YAHA 1F6FB 2VUYA 4A6YH 4YO0B 1AIZA 3TN0D 3TVMB 3PWVB 1ZLSH 3AGVA 3HI1A 3KPPB 5BQ7A 3K81A 4ELKB 2EICA 3MV01 3JVGC 3VFWB 3O4LB 1T1YB 1SDYA 4ZMZA 1QBML 2KZBA 2JQAA 2UY6B 4FQ2L 3TEYA 2IWEA 5LBVA 3LS4H 1P4IH 4XPGH 1LD9A 3QHFL 2J6EA 5MENB 3ULUH 4FQQB 4O2CA 3QHZH 3BVDB 43C9A 5DJDA 2ZNXA 1KCSL 3WEXA 2XA3A 2Z93A 4PV8A 4PYGA 1FN4A 1JPSH 3SDYL 1BZDA 1Y6MR 2ALWA 2XWJB 2AJ3A 4X9GA 3DPBA 4FABL 2JKRM 4FQHB 3P4NA 3T6QC 4MCMA 5GS3A 2NNRA 1A4KA 1XCQB 1N8ZA 4J3OD 4TQPA 3IS0X 3RNKA 3S9DB 4IOSD 1MJ7L 4CC4C 4LLVB 3L3OB 1YPZA 4JO3H 4JGNA 4JPVH 3NUKA 3WHE0 2CXGA 4KOBA 3C5ZD 2DIAA 2P9RA 3VGFA 4P2AA 5AAMA 3T4YA 1IQDB 4MB3A 2XY1A 1HZHL 3EOBA 3OMAB 2HMIC 2XVGA 1FSKB 4XWGH 5ID1B 1MFBH 4QRAA 5KJ7E 1DVSA 1FFNB 1OE1A 2ZJSH 1KDJA 3VXSD 4JFWA 3SJVA 2WZPD 2HWZL 1OGAE 1T03L 1BAFL 2XTJB 3DX9A 4S1RL 2JIXA 5DJCA 2VLKA 3AQYA 3BUIA 1J11A 3OF6D 2AQRA 3DBSA 4ZX6A 3L3DA 4E9WA 5HVFB 2WUBL 4U7KA 2GEQA 5LCVL 3U46A 3EOTH 4ODXA 5GRXG 3UYRH 1H3UA 4OFYD 4U0QB 1SY6H 2YPLE 2PNDA 4QD2E 5TDPA 3IJEA 3NJFA 2DYSB 1J1OH 3KPRD 1ZLWH 1D2OA 4LKCA 4NSKB 4LT7A 1AP2A 4YAQA 4NOBA 4J3OF 3VD1A 1C12B 3ARYA 1MCRA 2X70A 3MNZB 4WI6A 4PGCA 1IM3A 3DSFL 2YPKA 1H0DA 1JFQL 2XKNA 3B9AA 4L4VA 2H6UA 4KHXL 1U3ZA 2IMMA 3UBXG 4NQXB 4MQ7A 3NN8A 5C0NC 1P6WA 3MRLB 5JMOC 1TR7A 3UTQB 2B7DT 4D8PA 3O2WH 4Z7IA 3KVPA 3B2DC 2WXQA 5J13B 4ZOAA 1HL8A 2DEWX 1EEYA 3ZE1B 1QTPA 3OJ2C 1HOEA 2P8PB 1LLAA 2VIRA 1AH1A 2UUDH 3BUYB 3QUGA 1G4RA 4Z18A 4EDXA 4HK0B 5KBNC 1JD7A 5LBSH 4R2GC 3T09A 2Y72A 5BCAA 4G8IA 4KO5A 4WI9A 1MCLA 2ZQKA 4X8JA 1JF1B 4LVNB 3P73A 3X13A 3TWCL 2QHRH 3SKMA 2CR6A 35C8H 4ZFGH 4P4KD 2CKNA 5DXWA 4NO0D 1KTDA 5F3BB 3G6JA 3P2DA 3TTYA 4ZODA 2JKJA 1RCYA 8CGTA 1YQVH 5TE6H 4WWNA 5HYIA 1NDMB 5EU4A 3DA0A 4OD2B 3PGDA 5IVOA 3GJEB 3NJGA 4ZFZA 5J1AB 3LEXB 8FABA 2O30A 2LQRA 1UXSA 2N3JA 1G9NH 1PZ5B 3V52H 1IE4A 4L5FH 3B34A 3BT2L 2R39A 1A9EA 4UT9A 5DD3L 3TNNB 4GKSB 3RKDD 3CN1A 4YXHL 2JWYA 4UMSA 2F8VA 5DQDL 4MX7B 5HGBB 1SDAB 2HH0H 2EXYC 3K0WA 3SQOL 3CHQA 3RB7A 4RGNC 2V33A 2E74C 2VXSL 3CCHB 3QDJB 1QTYT 3BMWA 4HUVA 2OZ4H 4XN1A 3CFCH 1PS3A 3H9HB 3MGAA 3WN6A 4WF7A 2I5YH 1G7PA 1T1XA 2D2CC 1FNSL 4PJ5D 1XEDA 2GIXA 2LOEA 2WXOA 4N0UE 4WWKC 3PWVA 5HHOA 4FFYA 1MJUH 1YEKH 3KPPA 2FJUB 1MHCB 2ENJA 4EI0A 1U6AH 4JFZL 1IFGA 1NCAH 1OGPA 3I74A 4ZFOB 3SSGA 3E3QE 4MAYD 1FLRH 2WBKA 3VFWA 3ZRSA 4ZX5A 4KKAC 4J23A 1GZQA 4BD4A 4O51B 4OFVA 1JVLA 4CGUB 1JNLH 4HIEB 2N0KA 3MFFB 4E0RA 3U9PL 3QQ9C 3N85L 5CEYA 1FORH 1HU8A 4YSTA 1SBSH 1AXSB 1T2JA 2QQLH 4FQQA 5IFHH 1QSVA 5I8CB 3KYKH 3ZHLA 3TBSB 4M9OA 4PRHD 2A2QT 2JQZA 3R1GL 4B60A 2DQCH 2XWJA 3ML8A 4K5OA 4QTIL 1HWWA 3BFQG 3QO1B 3ZDZF 3HS9A 1X5JA 3Q3GB 1XCQA 4ZTPL 2A9NH 4LLVA 3L3OA 3WJMB 3ATAA 5FYKD 4Z7QE 3LZQA 2DL9A 1QFWM 5D1QC 1GYWA 3PJLA 3VXNB 2ZXGA 3SGKC 2H3NB 1VADB 4AYDC 1K8IB 1DLFH 4HA1A 1CE6B 3FFCE 5SWSD 5ID1A 1Q0YH 2GJZB 2JKXA 5JW4M 1FFNA 1RPQA 2GTZB 3T0ED 1WWAX 4ZS6D 2EIKB 3WYRA 4O5LH 3MCKA 5FKPA 2VZOA 15C8H 2ZWYA 4FI7A 2JCCB 3A5VA 2WLKA 1DCLA 2GIYA 3ZXAC 1XV8A 1P84J 4K15A 3D6GA 2ZG2A 3H3PL 3LNHA 5EPMA 3C6LC 3DDGA 3CMGA 1TSHA 3C5JB 3P9WB 4QNPE 4UV4L 2NR6D 2EIDA 1AS7A 3LKSA 4K7PX 1I4FB 2G3NA 4RISL 3LXUX 4Z7VE 4MSWA 5ESVB 5I6PA 2NY4B 3QEGL 3T2OA 2E9BA 4CADB 5CFAA 3NSDA 3EFFA 1YEJL 4AIEA 1L9OA 4XP5H 1XGPB 3MNZA 5F7DA 4I87A 1JOIA 2BWIA 2ED8A 1W8OA 4JCLA 4PLJD 2MKLC 4YWGH 5IROD 4NNPH 4HZLB 2OX5B 2OL3B 3PP3K 4NQSB 4G6JL 3UTQA 2HKFL 3SCMC 3IFNH 4M61B 5CU9A 3Q06A 3GNML 3LDBC 1XD1A 5GGVY 2HTLC 1KGIA 2Y24A 5ESAA 3K4DA 5CJOH 3W2DL 5DGRA 3LH2L 5DWUL 2VDOL 1XBDA 3S36H 2IPKB 4TVPL 1MFUA 4E5XB 3CFKA 2KQMA 2ESVD 2NQ3A 2A4CA 3AREA 1LEKA 3LHPL 4WFHD 2AK1H 3T4AA 1FVCA 4G7VH 1NMCC 1WAPA 5BS0B 1AQMA 2R2EA 2VDMB 2ADJB 3IETB 4ZMOA 2OCJA 1ID2A 2WQSA 5CJBA 1SEQH 2B1HL 2H7WA 1MVUB 4BHUA 4K4KA 4NZRH 4PLKD 5E9DB 1MAKA 2FNBA 2QVIA 3LEXA 4P2QA 4UU9B 2OSLA 1PZ5A 3AGWA 4IEFA 1H3TA 5AVTB 3B5GA 3QJZA 1UT9A 4HXAH 2YD0A 4KROD 2GTQA 4A2MA 2R0WL 5AENA 5JR1L 3FB6A 4Q6IA 4GKSA 3S35X 3BXNB 4L3AA 3QJXA 1Q4NX 4HZAA 4N0FA 5EUOB 2BIHA 2MOQA 2DTMH 2VLLB 4XHQA 1NPUA 1GSMA 4PJIB 5AVYB 5T1DL 2OQJB 1ZRUA 2PP7A 3VD4A 2NW3B 4L4TB 2WGXA 1NC4B 5FA3B 1IJNA 4FFWD 4G7SB 1J8HE 4HMEA 4BUQA 1PY9A 3D9AL 2W80C 5BV7C 4QCIA 2NY1B 3TZVD 5J8OA 4MVBD 5KW9H 4GBXB 4NKDA 4DTGH 5ETUB 3QIUD 3WOVA 1WFIA 4XP9H 5EF3A 1JXKA 3HE7A 5KWYC 3K74B 4QTFA 1KPUA 2F74A 3GXDA 2GTWA 4MWFA 4PRBA 5FM8A 1CD0A 2YA0A 4PJBF 1I3RA 2JK5B 3IDNA 3D2UB 4GG6B 3T2PA 4KXZI 4GAGH 3I6LE 3ZE0B 5T1LA 2XV3A 4JFDE 4LSDA 4R0LB 4AQ1C 5ACZA 4ZUUA 4P2RA 2AQPA 3QQ4B 2ZF8A 2AQQA 2Z34A 3BLKA 1CD1A 2P42B 5DJZB 5I8CA 2BINA 1FFRA 3RGBA 3Q5OA 1JXJA 2E4FA 4IDJL 5LAXB 1ZTMA 2H47C 4ACPA 3GFUA 2GG1A 2K7PA 1N0LB 2AJSL 4WTZA 1EVUA 3WJMA 1J9SA 1ZPLA 1K4CB 1F2QA 4PS3A 4XN5A 1F13A 4NUPA 2HZHA 3GKWL 1XH2A 3VXNA 1JXGA 2H3NA 2VDRB 2VKWA 1T04B 1KIPA 1U58B 1SLXA 2A73A 3BDYL 4QHKI 4LL9A 4XC1L 1WCQA 2YD7A 3ZUCA 1CE6A 1FG2B 4NN7C 3K6DA 2XWCA 4JDZB 1HINL 4LFHG 3WIFB 3ARFD 1U0QA 3WEMA 4ZD3H 4ANKA 4G5ZH 3US1A 3UTSB 4YFDB 2CMRL 5TH2A 3II1A 3IJYA 3VFVB 3P54A 4ANWA 3DTUB 1JZGA 2A6DB 1X7QB 4QT5B 1JHLH 1KXVA 2WWNA 3WLBB 4L37B 3JWDC 1EO8H 4RWYL 4G8GB 1MI5B 2EH8L 2XWRA 3KPSE 5CCKL 1G7HB 3R19A 1I1AB 4GPVA 4X7EC 1CWVA 3ZN6A 1EZVY 4NQDD 3EDEA 3CK0H 1BQUA 1XGPA 5LNEA 4HFWB 5J5EA 2AEOA 3QUXC 4M8QB 5H4ZA 2E5EA 3C60B 4ZSOE 4XPHH 1DFXA 1CFTA 3NIFE 3OC8A 5IVNA 1CMOA 2OFQA 3EFOA 2OX5A 2ZYSA 2OL3A 5GIRA 4DVBA 4HLEA 2KLSA 3QUML 3H9SE 1R5IA 2ATKB 3ARDB 3REVB 2A9MH 4PJCA 3JSSA 2O6DA 1KCVL 2XLLA 4XN7A 2NY7H 5C0ND 1KELL 1BVLA 1OAYL 1AKJA 1ZANH 1LEIB 4LHUB 3TT3H 5C0DB 5IT2L 2AHIA 5FDYA 4A7GA 3UZVB 4D94A 3D08A 5C0AD 2NZ9D 3SPJA 3EGSB 1LO0L 2IPKA 3S5YA 2I85A 2DQGH 4WWID 1GZPB 4JDEB 3ZZQA 4K94H 2GT9A 3I84A 3O11B 4UIMB 5I18L 3FSVA 4XPAL 1Q1JL 5JHDB 1P5UC 1H3GA 4BQBA 4LDOB 2DL2A 2AXFA 3CZGA 2RALA 5CLTA 3MV9D 1IGTB 5K33A 4KJPC 4CKQA 1F4WL 5E70A 3Q5YA 3NJNA 5IHUH 1R0AL 4I7ZC 4JM0A 3VI3A 4UTAH 1MEXH 2EDTA 2ZD0A 5FIEA 1G84A 5E9DA 2ORBH 4OF6A 5JHLA 1PQZA 4IJ3C 5D96C 3WCYA 3PDOB 1E30A 3W38A 4E2OA 1UB6B 4EXKA 3S8FB 2ZOLB 3DV6B 1ZOXA 2VT0A 3HAEH 1U4EA 1T3FB 1U8NB 1KN4H 2EC9U 2OJEB 3CVIH 4F2EA 2DJ4A 2ENSA 4PV9B 2WVSA 5EUOA 2PPCA 5C6TH 5A2KH 1HSBB 3FTSA 3W5MA 1Z9MA 4DGIH 2X1WL 4Z7OB 3GSWB 2ZUYA 4YXKL 1IAKA 2X41A 2OQJA 3M8OH 3IGFA 5HHXH 4Y5XB 1NGQL 2V0AA 4L4TA 5FA3A 1CFSB 3V0WH 2RMNA 3QJFA 5L0QC 2F8XC 2P5ED 3PWNA 1SYSA 3L4YA 4LBEA 5E0QA 1DJZA 4QYOA 1CICC 4XN9A 3DOIA 1KCRH 2MHAB 5IB2B 1B2WL 1QMUA 1HI6A 3DV4A 3QNYB 4MJ2A 5CR1A 4Y9FA 1JCVA 3N50A 4NJAH 4GBXA 1CGUA 5ETUA 4XBPB 4HGWB 5IVZA 3UGUA 2DQDH 4L9LC 3MOAL 1E2ZA 3SKNB 5C0FA 3I6SA 4JQXC 4TPRH 1OL0A 5HI3D 2H0EA 5TDOA 1JPST 3B4NA 4UOJA 4N2DA 2EZ0D 2VR6A 3AWGA 4AXWA 2N7BA 3QDGD 1V55B 3EIFA 3HI5H 3HE6B 4JRXB 4KNSA 4H8HA 5C0IB 3SEPA 1OP9A 1AXIB 4GW5B 4NGHL 4Y4FA 1FYHB 2YGPA 4N3UA 1TJHH 3EYQC 5FUOL 1T4WA 3AMKA 4R0LA 4X5QA 4ZMXA 1EX0A 5HDBE 5D7KD 3F6IA 3T3MB 2KUTA 1AS8A 4FI6A 4G8EA 4NN6C 1D9KB 1RVFL 2D8KA 3W3BA 2XC8A 1M05B 3RWHA 3NGBC 5FYKL 3IWVA 3PWJB 3SDCD 3VH8G 1BW8A 2GK0A 2VDNL 3WTWA 1A4JA 5EOTB 4D0BB 3ZHKA 3UCQA 4GQ9L 4B9IA 1GGIL 2P8LB 4WJ5B 4QLRA 4YC2B 2E4TA 3O8XB 1G7MA 5LAXA 1BDYA 1U95A 2V2XB 4E9TA 2J8OA 4JFHD 4HPYH 1T6VN 4ELMB 4X5PA 3BHBB 5EN3A 1Y1DA 1DVFB 4Z1PA 3V6BR 2MEJB 4GRLC 4MNHB 1HS6A 5KANI 5LVEA 4XNUL 3HNSL 1T04A 2CO1A 1U58A 2SODB 2G3MA 2FD6H 4L8BB 3EO0B 4MJID 1NAMB 3QGVA 4Y5YC 3GHBL 4U1MB 4Z7UA 1FG2A 3SPCA 4CSZA 1RHHB 4ALAH 1U8QB 4F7TB 4D3CL 4RBPK 5TPWH 1R1CA 3FSZA 1O5PA 2DLGA 3BW9B 3BRFA 1DN0A 3QUZC 1HHJA 1IZJA 5GZNC 2ZAIA 3IK2A 4WO4C 3KPQA 2A6DA 2WO3B 1X7QA 2FLRT 4PRDA 4BGDA 3WLBA 1XZ0A 3NCJL 4FXKB 2BS8A 4QHLB 4YDMA 2YS4A 3VU1A 4B9FA 5EEVA 3FU0A 5DZAA 1EXUB 3LRLA 4HAFA 1P7HL 3QZMA 1MI5A 3QR0A 4H20H 2CKBL 2XT1B 1I9JL 2NXYD 1S46A 5C08D 1G7HA 4JAMA 3UTTD 1I1AA 1EO5A 4G3YH 3RY4A 4FNQA 4ZW6A 5CBEA 1GZHC 2OLDA 5D9SB 2V8MA 2WXJA 3LTVA 2MTPA 1AGEA 4JVUA 1PZ3A 4OIAA 4MYWB 4ELDA 4HFWA 3RIFK 4HKJB 4Z7WE 3HC3L 3BESR 3KAAA 4GEIA 4KI1A 1T0MA 1OW0A 5DK2A 1CXIA 1LNUB 3FTZA 4L3EB 2HX8A 2R0LH 2Y5TA 3FUHA 4XCYB 3GMQB 4Y2LA 5KS9F 2UZPA 4G9FE 2VDKB 1V7NH 2FQGA 4LLUB 4NNYB 1A64A 1KB9J 1AO7D 4R26L 5DQJA 3B2VL 4LDEB 1MVYA 3RVXD 4DGVL 3MUZ1 4GXVH 5FW7A 3U2IA 1QBLH 1BBDL 1PIFA 4G6ML 2LR4A 1E5YA 1A1OA 1S5IH 1P4LB 2EEBA 3P77A 1I82A 3CIAA 3RIAK 4Z3JA 1J5IA 4HOMA 4LHUA 5C0DA 4JKPH 1F97A 1MW0A 1CDHA 1PNCA 2XVBA 5AW4B 4ZZKA 5KVEH 1NCCH 3EGSA 5D1ZB 5A3IC 4LRNH 3THML 1CB4A 4JDEA 1J1XH 3T3PE 4EDWH 3NEEA 4IOIA 4UIMA 3VJ6B 2HT4D 3GZPA 1U2YA 5F7UA 4AG4H 4G82A 1I7TB 1SOKA 2G60H 2IOOA 5EOCL 3DJSA 4BDVB 1JJUA 2FO4A 1JWUB 2JF1A 1NC2D 3B2XA 3FH7A 3SDXB 1A7NH 2G2NA 2F58L 4FD0A 1R3JB 5H35A 5DJ0A 4HUXA 1LDPH 2HG5B 1H3XA 1KFGA 2EKSA 3QI9B 3U30B 4F1ZA 2CGRH 1T3FA 4YDIH 4FXTA 1C7SA 2ZX8A 3O3DB 4PV9A 3VD9A 4YDKL 4Y1TA 3UBXI 3K2IA 1XDTT 2PR4H 1MQ8A 2IQ9L 3GSWA 4GI6A 3AY4A 2ZKWA 2BRQA 3Q0HA 4G70B 4Y5XA 1J0KA 5IFAL 1N6QH 4I9XA 1N68A 4LVHC 5AZEH 4TLKA 2YLHA 4NAQA 4I0PD 1KEGL 4BZ1H 1Y6KR 2V5RA 1A0QL 4GT7A 4UTCA 2MHAA 3GSNH 3GLZA 4Y2DD 2FDBP 5IB2A 1PZSA 2JKNA 3STZA 3IDXH 1F3RB 5B1BB 3A24A 5F70A 4Z78B 1MHPL 1WHOA 1XGTA 1WG3A 2BRRL 2ZNWA 3CU7A 2APWA 3WDHA 3MMEB 5GS0C 4RBPH 5JPNC 4YSQA 2ZPKH 4W4OC 4DHLA 3KG5A 4KGJA 3I50H 4KDTA 1IBHA 1UWEH 4OM1H 4K3DL 4A2GA 3GF8A 4HQQL 2WKOF 5IMOB 4HK3J 2FJSA 2VN3A 1KTBA 5J89A 4GW5A 5T5NF 2JTYA 3NMEA 3KWVA 1AGBA 2YEVB 4WVRA 4HP5A 4IBLT 4QR7A 3V6OA 5HYJA 1CURA 2XN9B 4X8XA 2IANE 3CSYB 2OJZH 4AW7A 1D9KA 1UG9A 4ILDA 4RWHA 1COBA 1M05A 2RIKA 3G5VA 4NM8H 4PJ9D 5L2JB 5HVHC 1PTZA 3KLHD 1CZ8H 3I2CH 4WKZB 1M6UA 4D0BA 5E1AB 1GW0A 5ICZA 3TBWB 4AYEC 3KYOA 2P8LA 2AQTA 2OMXA 2WCPA 3O8XA 1HXMA 1T7ZA 4JEGB 3OZ9H 3N1GC 5T3ZL 4TTGA 1KMGA 3MV11 4Q74A 1E8ZA 2Y06L 4F91B 4OI7A 1H3PH 3FCTA 5E2TL 3IDGB 4BQCA 5FO2A 2DTSA 4HJGB 5IK3B 5I73B 4L9DA 5DDHB 3FN0H 2XVKA 5IWLA 1IQWL 2PCYA 1NAMA 3EO0A 3HFML 4ETQA 4YUEL 1IGFL 2BNQB 4JQVA 3W81A 4UUJB 1U8QA 1FC2D 1XHHA 2NZ1A 4NQTA 1EO7A 3ARRA 5D6DC 3ZT7A 3ZDXE 1EZVX 1DQTA 3MO1B 2EDNA 4K5MA 2R23B 2BWQA 4KKRA 2BHFA 2FAUA 2YGOA 1RAMA 2N59A 3ML9A 3BUQA 4HWBA 2IH3B 2YEZA 1INEH 4YSSA 1Z5YD 4P46C 5KBMA 2DI9A 1ZLUH 2WTRB 2PWEA 4U4IA 2YQBA 2DQMA 3BSGA 2NSMA 1LWJA 4Y9BA 3I85A 4PJGA 5D9SA 2BVPB 1BXVA 3POCA 4ZQKA 1SM3H 1ZVSB 2VR9A 2QEJA 4LCYB 1TT6A 1B9KA 4Y8AA 4FQ2H 5IB3A 5IQ9B 1J5CA 1WEJL 5EU7C 3CU1A 2VRQA 1TVHB 5DMKB 3HVNA 3ARBA 1LNUA 4Y7OC 3HG1E 2Y7NA 5FAAA 1NGPL 1S78D 3G6DL 3MV7B 5LDSA 5TQ0H 4NNYA 1Z9LA 3OL2A 3SDYH 3IDJA 4E41D 3MRMA 4OKVB 1SHXA 2EUZA 4U1GC 4FABH 1MRFL 1E4KA 4LHQB 1THAA 1TTGA 3ULVC 3STBA 1WICA 1EJ6A 4WEEA 1P4LA 1KWKA 2IXQA 2BW5A 1MJ7H 3RVUC 2M26A 2EXSA 3P02A 2X4RB 4DVRL 1Q9KA 2GHWB 1TLKA 5D1ZA 4EI5B 5E99L 2CZNA 1J8RA 4JB9L 3QQNA 1RMFL 1M7DB 4KK8D 2DH2A 5T1KD 4ZS7L 5DHDA 3D0VB 2BSEA 4ISVB 4X6FB 3ARWA 4Y4KB 4R7DB 1C16B 1E6JH 2UWEA 2HWZH 3EO9H 3LSOB 4WUKH 4HHAB 1BAFH 4S1RH 5AYQA 4D8OA 3VFUB 1R3KB 5JLZB 4OFIA 1H5BC 4GRMB 1JWUA 4FZ8L 4OCSL 3SDXA 4QRFA 1YEWA 1R3JA 2WUBH 1UACL 5LCVH 3EYFB 2ZWLT 2HG5A 3F2LA 2RCSL 3AU1A 1RIVL 4Z3IA 4RX4D 3OM3B 5FYJD 4N26A 5BVPH 1EZSA 3MDJA 3O3DA 4NQUA 1RJYB 4LSSL 5GS1A 2KERA 3RZCC 3DSFH 3PL6D 5MP6L 1WZAA 2AEWA 2CO6A 43CAA 1JFQH 1RHFA 5DD1L 2J1KA 5I6OA 4WI7A 2YKLL 3HUJB 1HXKA 4POUB 1CE1H 3A4EA 5IMKA 2VQUA 4Y1AE 2W9DL 3MRHB 2WK2A 2WINB 3U1SL 2GSMB 1TTRA 2DV6A 2B14A 1YY8A 4TVUA 5HGDB 1G0DA 3SZ6A 3QJUB 4JFYB 5HGAA 4Z78A 1JHTB 1BQ5A 3V4PB 5AKRA 4S1SL 1EH9A 4XAKE 5I24A 1S8DB 1SRDA 3MRJB 3VXMB 4ZMVA 1I9RL 3NA9H 5DUPL 5CEXB 5D2NB 1X5YA 3K5RA 5C3IA 5IMOA 3WS6A 3WSQH 4ESKA 1KXTB 4JRYA 2VO5A 2P5WB 3TEWA 4J3TA 3HMXA 3D39B 4K7PL 2P24B 5KBKA 3LQZB 2J44A 3OB0K 2WXLA 3TWCH 5AQ0A 1NEZB 4XT1C 5AW3B 5BXFA 4LPUA 3TH4T 3BFWA 4U1IB 3AS3A 2ZXBA 4G42B 3FFCD 1RLWA 2DLFL 3LKQA 1L0YA 4H0LC 4R7LA 4YQXH 3TBWA 2D3VA 4N2LA 4XCCL 4XCNA 5L9DL 5F7BA 1I8LC 3NQKA 2AI0L 1FZOB 1I31A 1IEBB 1V5JA 1Y18B 2ZX9A 3MRFB 4Q9QL 1E5AA 1UM4L 3ZYOA 3MLTA 4NP4L 3I75B 3WL9A 4HJGA 5IK3A 4MA8L 3AG4B 4YE4L 1QLRB 3FRPG 5DDHA 1ETZA 1GHFL 5DQDH 1DR9A 1BZQK 3OHXC 2KL6A 2D3JA 2E76C 1OANA 4LCWE 2AK4B 5DR5L 3VQLA 2B59A 1UA7A 3SQOH 3JTBA 4UUJA 4GINA 3VWKB 4PB0H 3QUYC 5HPMB 1RIUL 1RZGB 4JZJA 3GI9L 4GG8B 4BGLA 4Z7QF 1SN5A 1OWRM 2DICA 1PSKL 1OGSA 4K8RH 4I18B 3GEFA 1XMWA 4OUUA 4TQHA 4ODTL 1RFDL 1RSFA 2IH3A 3QE5A 5EU6B 2XWXA 1FRGH 1HVXA 3JV0A 1U8OA 2CBMA 2F7IA 2WTRA 3S37X 4BE5A 2HX7A 5C6WH 5AVWB 3A23A 3TFKC 2EIMB 3NJIA 2WLLB 5DJ8B 4IBVA 4RDQG 4EN3C 3IS1X 3RYMA 3BUPA 4PWGA 5D7JD 3IDIA 2Q3ZA 2NY5C 4NT6B 1A7OL 2AQ1A 4PBWD 4RCAA 1L7TH 2NUTB 3U9PH 4JG9A 2H8PA 3N85H 3S35L 5A1AA 4YDJA 4LGRB 4POZD 4QNPF 5AAWC 2R29L 3UP1A 2BVYA 1V3MA 5I6MA 3MV7A 4Z7VF 2XN1A 3T0AA 2CPUA 3QZLA 1FJ1B 3EDDA 4OKVA 3SKJL 2HN7B 3PG2A 4A6YB 2PXYA 3G04B 2HT3C 1NQBA 5J1TC 2HLFC 3IGLA 3V55A 4GRWF 4I3GA 4PVNA 1FYTE 2O61B 2X4RA 3L3HB 5K59E 4EI5A 1IJ9A 3WO4B 4Z5RB 2WD0A 1HYRC 3FBQA 3UXFA 5C9KA 1ROWA 1M7DA 1UJ3B 3GXMA 3PDGA 4NCC2 4XB8A 2CXKA 1FNLA 3N41F 3D0VA 4ISVA 4QKTA 3AUVA 4X6FA 4R7DA 1C16A 4Y4KA 4B3VA 4F2MA 4DP0X 3LSOA 4HJEA 3DROA 3WIAA 3ZTJG 1FZMB 4GRMA 1R33A 2W91A 4PB9L 1J8HD 4FJZA 3IDUA 3OB0H 3DI2B 3DOSB 5C0CE 4LCIL 3EYFA 3H3PH 2AAVA 2VLRB 2CHXA 3FT9A 1NANH 1KBGL 2IJ0C 4AGMA 4RISH 3VMOA 2X1PA 1RJYA 2XWEA 2H2SC 5ECGA 3R4RA 5EB9A 4EOWH 5H94B 3PV6A 3FL7A 5JW3H 3C2AL 1DBML 3BD5A 5IW1B 1GCYA 1XAUA 3MBEC 3WENA 3CHSA 2Z1KA 3L4WA 4P9MH 3RGVB 3BVVA 1E8XA 1X5IA 4PJFA 4TKWA 3T2NH 3CSPA 3I6LD 1BD2A 1WGOA 2BDNL 1F58H 1Q9LB 4XXCA 3V6ZB 2IFGA 4JFDD 3ZE2B 5HGDA 4UMGA 3LKRB 4NQVA 1RJCA 1S7SB 3QJQB 2DM4A 3RLSA 1BJMA 3PHAA 2XIDA 3GNMH 4HYTB 1KGCE 2GJJA 1MIEL 2DIEA 1NKOA 2J72A 4EUPA 2WLNA 2K6ZA 5JORA 3TO2A 3W2DH 1E28A 2VLJE 5CEXA 3D0LB 5DWUH 2BSTB 3G08A 3CXFA 2PTVA 4C56A 1KXTA 2DMKA 3ZKND 1ZLDA 5I9QB 4EF3A 3Q44A 3FK3A 5B4MD 5GS0D 5IR1A 4TVPH 1OAXL 2R59A 2UYLA 4A39A 4HZ1A 3FN9A 2XG4A 2B15A 1N0XH 5I1CH 2OMBA 4PJEB 3VA6A 2WQVA 1YNLL 5T33H 3CZFA 3FT2B 1F1AA 1NEZA 5E4IA 3UTZB 4JCMA 3E8UH 3PABA 4X6DF 1QSFB 4G42A 2LU7A 5D2LA 3H0TB 4ZAKD 4AH2B 1ZGLM 1M7IB 2EUXA 1MFCH 2YR3A 3DC0A 1UZ6E 1YPZE 3O6FB 2N0MA 3TA3C 4ADGA 4WTQA 3B7UX 4HIXH 1INDL 4YHZH 3RTQB 2VDPL 3SGJA 1UJTA 3U1PA 1FZOA 1Y18A 2CBPA 2D0FA 1A1MB 2YMXH 5T3XE 2R0WH 5C0RL 2NY6D 3GUTA 2CJUL 4F33B 1MCWM 3FQ1A 2D31A 3TCTA 4RLDA 3P9LA 2YBRB 2PLTA 3QAZB 3GSQB 1QLRA 3KPSD 3U4KA 1F00I 4URTB 2VLKE 1SXCA 1YMME 2V37A 4M7LL 4CVXA 2DQUH 2LAAA 5T1DH 4LLQA 5BRPA 3UACA 4C55A 2EDHA 1U8PB 3PJSA 5HPMA 3R06A 3A4AA 4HEPG 4QRSB 2CCWA 2QTEA 3D9AH 3KCWA 3X1EA 2DQIL 4C57C 5AL0A 2RR3A 1XF4A 4XMKL 3L13A 4RRPG 1UC6A 4S2SA 2OSYA 2XA8L 4MDJB 3EOYG 5K9JL 2FJFB 2ZSVA 4QRQA 1JYVA 2XG5A 2J8UB 3ZRFC 1BFOB 3HZVB 2J8HA 1M56B 4B9KC 4XNMB 2WLLA 5DJ8A 2G75B 4O00A 4XN4A 2E6QA 2H26B 1JZ3A 4KK5C 5BUAA 4P46D 1CGVA 1NGZB 3RUGB 4U3HA 2NUTA 5J7CC 1U91A 3BCFA 3D34A 4U6XB 4UB0L 2XV2A 3PREA 2NY2B 2BMKB 3GQFA 4U31A 5TF1H 2RD0A 4NPYB 4J3OH 3RPIB 3BPLB 5K69A 4DK6A 1FL5A 5FGRA 5B7MA 3CVHL 1CLZL 4YHKH 4X80L 4W9IC 1FJ1A 1A1NA 1WYJA 4IDJH 5C07A 2HN7A 2L4OA 2PP8A 3CPUA 5FGSA 3U4AA 4AL8C 3ZKSD 4LU5L 4FG0A 4CNIB 3PHOB 1S9VB 3NIFF 4TNEA 4YHYB 3KL3A 2R8SL 2YXVA 2J56A 5CLXA 1NCDH 2I26N 2MOGA 1TO4A 4DW2L 4E9LA 2PMZA 2O61A 2EJ1A 2XQYK 3BSZL 3KH3A 5FUZL 3L3HA 3BZEB 4XOEA 1X44A 1ZHBB 3GKWH 3L4CA 3SKUD 2EUWA 5JXAL 3G6JE 1BXXA 2AJYH 1A7QL 2WLIA 3BDYH 4XC1H 3BLPX 3D33A 3BP5A 3X3FL 2N01B 4MJ6B 1U3HD 3RDTA 1EANA 4LSRH 4UIKL 2EDFA 4I1RA 1SUJA 3BO8B 4W4NA 4BFFA 4ATWA 1BQRA 4J7RA 2BC4A 2F8IA 5I2IB 2WB1A 2CMRH 1WITA 5CO1A 2YRPA 3F7VB 3KJ4C 1N59B 1NUDA 2GK2A 2YXMA 3QB7C 3DOSA 1KCLA 1YEEL 4TUKH 5DJXB 4PD4J 1YAZA 4JQIL 3MU3A 4RWYH 3SBRA 3ZTDC 2O5ZH 5HHMB 3KPLB 5DA4A 2XXMB 5F88A 3VA2C 4GQZA 1L0XA 2R83A 4QPEA 2BY0A 4P57A 1T6WA 2OMUB 2C4FT 3GSRB 4KK6D 1Q0XH 3QIBB 4XHJD 5EH1A 4JFPA 5H94A 5BRZB 2KZ1B 4MCZB 3FQ4A 1XB3A 5F0PB 3TJHD 1D5MB 5I1JL 4K2UL 5I16B 1WGVA 3QG7H 1G4MA 2O5XL 4JFOB 1KJ3H 1QHQA 5B1JC 4P05A 2VUKA 2EEAA 1MCWW 4KZDL 4Z6AT 3RZCD 1X9UA 4KK9C 1GYAA 2ZZUT 3LKRA 4TLSA 3EGDB 4DIXA 3AG2B 1GC1H 1EHXA 2PO6D 3QFDB 3O4LE 2XKUA 2DJUA 3BVWA 3FB5A 1GIGH 2D73A 3QCVL 2RFXB 1I3GL 1OAYH 2HKHH 4CVWA 5D7LB 1E9OB 2ZG1A 4UT6L 2J1YA 5DD6B 4QHUB 5DLML 5IT2H 4YPJA 2QADD 2XZCH 4ZPVA 1UFGA 1XL6A 3BYTA 4U1KA 4JBSA 1KCUL 2HCZX 2VDLH 4DERA 1BWWA 1X9QA 4NO5A 5I17A 2P43B 3IJ8A 1QATA 3LKOB 1RJLA 5BZDA 1T80A 4MMZC 1N12A 5ITFA 1Q1JH 4GSQA 5GGVL 3F5WB 1A5FL 2W60B 3SDAC 3HKFA 4V2BA 3T6XA 1F4WH 1IO4C 2K8QA 3MQIA 3QUMA 1QSFA 4AH2A 2B3RA 5DEFA 1Q8MA 5IB1A 1WBZB 3UIYA 2C9PA 1DVZA 2YRZA 4K3GA 4Z8FH 1D5IL 3RFZC 5L4JA 1CDCA 5J6GB 3F85A 3RB5A 5IZ7A 3D69B 3FQYA 3IU4L 3L9YA 1A1MA 4ACTA 2E7LA 1Z9NA 2UZXA 4IK6A 4KX8A 1OCOB 4GO9A 1W2KT 5E6RB 1WFNA 5AW5B 4TUUA 1JZ4A 1QVOB 3ZY7A 5HJ3A 1NGQH 1AD9B 3QXAB 1ZT4A 2DWSA 5T5FA 3L1OL 5AW0B 2Q2EB 4QRSA 4XP4L 2ZUXA 1F4XL 1GYVA 1HH6A 3FQXB 3T6VA 5EZLB 1FAKT 5AALA 3CHXA 1B2WH 5IQNA 5ISZA 3UPRB 1DFBL 4WU5A 2BCKB 1XIWD 4G9FD 4MDJA 3DECA 1JUFB 1HTYA 3FO2B 3MOAH 4W93A 3QFJA 1E9QA 3W5NA 5DJ2B 4XXDB 1QFWL 1MWAL 4XNMA 2D7MA 4E9SA 1J0JA 3K4AA 4QRBA 1HDMA 4BZYA 3EZJB 3O3AA 5CD5D 4PJDB 2H26A 2VM3A 4X8GA 2YUXA 2YWZA 1YECH 5ECJE 3SGDI 1NCIA 3S96B 4NGHH 3CSTA 4EO5A 1NGZA 3A21A 3RUGA 4LXFA 1XH0A 1E8YA 3TPUB 4X9BA 3RWGB 4HOZA 3BPOB 4I2XB 4PJ8D 4P9HC 2MOVA 3ZE1E 2XQYA 4MGXA 1RVFH 3ABMB 5A7BA 4ZUVB 4B5ZA 1IC7H 3B5HA 2B1AL 5FYKH 2YPVA 2VDNH 5EU3A 2NDGA 5LGYA 3WE6B 2IBGA 1MXDA 2X2HA 2DBLL 4JJHA 3VE0B 5D70L 4N0YH 4APQC 5LGJB 4CNIA 5EEZA 1MIML 2X4NB 4KRMB 1S5HB 2IADA 4XNYL 3ZSTA 4K7FB 1S7QB 3FOLB 3E8VA 1TG8A 2EEXA 5CGYC 4IGBC 2HUEA 3MJGX 3QARA 2EACA 2X40A 1TF4A 2KPNA 3B9EA 3RWEA 1I8KA 3N44B 4IKIA 5FV2A 3TYGL 5DI8B 3BAEL 5HHNB 3HNSH 4UQ3B 5CJQH 4P5TA 4UQCA 2VC2H 5IVXB 4Y2OB 3GHBH 3QUHA 3FQRB 4B9GA 2GBUA 2PWGA 2X2YA 1E4XL 4P2QE 1G0YR 5E5MA 3BO8A 4D3CH 4HEMA 2ZXEB 5FECA 5E6ZA 5DZOA 3OG4B 2MNWA 4QO1B 1S7WB 1AE6L 3HPJB 4LSQL 1P7KB 5DFAA 3T3PF 3NCJH 4IRJA 5DJXA 5EIQA 1N5AB 1IAOA 4NIKB 5DRZB 3FZUD 3KPLA 1FBIL 1I9JH 2AEPL 2VXTL 5AZUA 3RX5A 4ZNEA 2VTFA 1IVTA 5ANMB 2WWKT 1F02I 4YBQC 2OMUA 3GSRA 2CRMA 4UAOC 5BZXA 4P3CL 5IQLA 1CI3M 5EEUA 2KQNA 5BRZA 5DEGB 1X5XA 3GDBA 5AUMB 2X3AA 4NRXB 1XB8A 4JFOA 5I0VA 4UF7C 3WY1A 4JGMA 3F58H 1CG9A 3F7PC 3SHSA 4U3CA 4FQXD 3EGDA 2Q3AA 2QSCL 5GS0L 5F1NA 4Q6YA 4XNDA 4I3SL 3EDJA 4KZ0A 5JHBA 4DGVH 3ATBA 2CRYA 2A6IA 5C70A 3GXTA 4W1TA 1RY7B 2RFXA 5C0JB 2CKBA 3G5XB 4G6MH 2BSDA 2H1XA 5DD6A 3WUWG 4UTBH 1ZWIA 2E6JA 4W70A 3EH4B 5FO7A 4RAVB 4P2RE 4AV0A 4PW3A 5JNYB 1OP5K 1RZ8B 2YGQA 1X5FA 3CN0A 3KYMB 1I85C 2OR9L 1EMTH 5IIEB 4RZKA 1IM9B 3OXSB 3H7BB 3F5WA 2E7DA 4PREA 4U1HB 4PRAB 4A63A 3MVSA 1CXEA 3CLEL 5EOCH 4DP1X 2FIKA 4XO3A 1WBZA 3BQVA 4Y9EA 4HFUL 2BSSB 1VZIA 4IHOB 5DURB 4R97B 1JYWA 2Z31B 3FU9A 4LAJH 4ODUB 3N1FC 4ZUWB 2F58H 1Q94A 3OKKA 3HG2A 4NWTH 7PCYA 2FYYA 2A9CA 3MAWA 5EDXA 2VR3A 4ABUA 2DLHA 4KH2A 4L4JA 4MA3A 5KEZA 4B0MM 3UZQA 4DFHA 1DZ0A 1ZHLB 1MFAH 4TSAL 1YEFL 1VGKB 4FFVC 4YDKH 2FBOJ 3MV8A 4XO4A 2IPTL 3MYJB 4N2HA 4BFIB 3TF7C 3PAVA 4CVZA 1QVOA 3QVAA 1AD9A 5IFAH 3WTSA 3FTXA 4HGKC 4YSAA 3WKYA 5CKAA 4S10A 1KB5B 2C3GA 4JFEB 5EZLA 4XRCA 1XTMA 4FN0A 5EBWB 3TBYB 5K9QG 5DRWB 1MLCA 2XRAL 3HG1D 3HNVL 3O4OB 4Q2ZB 4PP2A 2ADIA 2BRRH 2C3HA 3IJHA 5CMAA 1YEIH 1JUFA 1CO1A 2NZIA 1DBBL 3IMUA 5DHVH 4FYTA 2LGNA 5EZJB 1MQKL 2EIBA 3TPKA 3ZDXF 2PN5A 3HAEB 1HSAA 1V8HA 3UP6A 4LLDB 1NJ9B 4KFMA 4PJDA 3FYIB 4OCWL 4X7TB 4AMWA 1II4E 3CC5B 4LL4A 3S96A 3ZMNA 4KBPA 1YHPA 3X3GH 5DVPA 2XX0A 2P8MB 1A21A 4L8SC 5AZ2L 4PUBH 4WCYH 1Q1PA 4H88L 3B7YA 5C7XL 1JRHH 4I2XA 3NBNA 2WMPA 4H25A 2EIZA 2IAMD 4QJ4B 1KN2H 4ZUVA 3AB0B 4GXUM 3TURA 3CQPA 5B22A 4G7YH 4TQ8A 4RAUB 3WS3A 2DYPB 3ULVL 5E2JA 3VGGA 5C2BL 2XPGA 4FQLL 3RJQB 4PJ6A 4AIOA 4KRPC 5G4MA 2AJVL 3JVGA 2OTUA 1BPLB 4TM9A 4AMXA 3DSNB 4D7BA 4AEFA 4K7FA 3GBDA 4ZMWA 1QW8A 1U8CA 2J71A 3MA7B 2VISA 3ALXA 3V6FB 4J3VA 1TJXA 4F57L 3ECBB 2NY0C 5HHNA 4M48L 4UQ3A 4H1LH 1IQWH 1GW6A 2VABA 5IVXA 5LNGA 3PWPB 1A3LH 3PU7A 3V5KB 5EG6C 1IGFH 3TVMC 1DCEA 1ED3B 1ICTA 3HJEA 5E9DE 1FO0H 1RUKH 3LB6C 3N6YA 4L2LA 3MXVL 3AVEA 1G1YA 2RA1A 1RZKC 3H53A 4V1DB 5IEKB 3P4OB 5E2WL 1SMOA 3BVXA 3QT2A 2L8AA 1K85A 4KKNA 1N5AA 5EUOE 5DRZA 3N04A 1MPAL 5EHFA 1CUOA 3DO7B 3BKYL 2X9XA 3KDMB 4PJIE 3HG4A 4F7MB 1JV5B 1YUHB 5C92A 4L4TE 1DEEA 2ID5A 4LARL 4OQ1A 1A4CA 1EFXB 4WGKA 1WTGT 4MMYB 2EDJA 1T5XA 2FB4H 2B1OA 4OCMC 2R15A 3ZTEA 4HWNA 3VDAA 2CDEB 5DEGA 2JB6B 2P46B 2BERA 5AUMA 1W0WA 4TNWK 4BEIA 3LKNA 3BGFB 1A3ZA 4OTXL 3UBXA 1M71B 4GKOA 3ZVVA 4P5KB 3HHRB 4NM4L 2GFBB 3PNRB 1QFHA 4WHCA 1NGPH 3WMQA 4DEPB 4A2LA 1OGTA 3L3OC 5DC4B 5EUKB 1R47A 5GXBB 1SQMA 1C5CL 1NGYB 1MHHA 3L1EA 3ZDYB 4ONFL 1P5VB 2Z91B 1MRFH 4KZEL 1F3JA 2XBTA 3LEVL 2X05A 3Q01A 3IPBA 5CIPH 1FSKC 4KK9D 3ZE0E 1ODUA 3QJSB 1QFUL 5HI4C 3MCLL 3VU2A 3LQAC 4AQEB 1HL9A 5J11B 3UROR 1WA0X 4OCRL 2XTJC 1J9CT 3S37L 4NHCL 4PG2C 1OE3A 3KBHE 1FGNH 4JGJA 1RMFH 1XXDC 3MLXL 5DF0A 2Z8RA 3H7BA 5F0LB 2IDFA 5F7KC 4U1HA 5E9AA 1V10A 4X42A 3EG9B 3K0YA 1S7XA 3QEQA 2VCOA 4IKLA 2ATAA 4LCWD 4OJAA 5MHSE 2VAAA 4IW4C 3ULAB 1JNNL 1DJYA 2RACA 4FLRA 2Q8AH 1KF9B 3ESMA 5GZOD 1UACH 4HJ0C 2ATPB 3GRWL 4Z7UE 1G7IB 2RCSH 4Y8DC 3IXTB 2WB7A 2WXFA 5KYWA 3UYPA 2F5BH 1VGKA 3DX6A 3UTSE 1WUNT 5DJAA 5JIKA 1AFVH 3MYJA 4BFIA 1NMCB 1JP5A 3MJ6A 5J13C 1FNHA 4N8VB 2Z7WA 4L1BA 4XMVA 5DD1H 4LOEA 2ZCHH 4JRFA 5G2NA 1BIIB 3CHPA 1KB5A 4WHTA 1W0VB 1QZNA 1MI5E 2APXA 1R5WB 1UD4A 2XTSA 3MUJA 4JFEA 4KQ3L 2AABH 5IBUB 1NL0L 4WI0B 5BZWB 2KC0A 3NJLA 3WFBL 2XFXB 5EBWA 2LU3A 2YZ8A 4J28A 3TBYA 3ATFA 3NP3A 5DHYB 3T6ZA 4BV1A 4Q2ZA 1J12A 1LJMA 4M7KL 1RURL 4DF9A 5E8DH 1FPTL 4OFPA 3IFPB 4LVNC 3JUZA 4FFZH 4UAHA 3L7FA 2NY5L 3CH1A 1IL1B 3QCUL 2QPFA 2BIOA 4X99B 3TP4A 5IUSA 1T83C 4LLDA 1ZKAA 1NJ9A 4LASL 3WNMA 2DOCA 4JO5A 1XWVA 2VWEC 3NEOA 5ADOL 4F80A 2WIMA 4ZG1A 4AE1A 1QZ1A 3L5WB 1FYTD 4QRUB 5BV7B 4U1JB 4MJ5B 2QVFB 1QOKA 2HJLA 3INUL 3V4LA 3W0WB 5JOFA 1S7VB 3NRQA 3VWJD 2BP3A 3GHEL 1XCXA 4XVTL 1SZNA 1ZE3H 4WWKA 2B4CH 3GSNB 3O45B 4Y5VB 3EJZC 3MROB 5HDQL 3MYZA 1CGWA 1NCWH 3KJ6H 3NFSL 4X0NA 1QSEA 4JUSA 2R4RH 2ZP9A 5L9DH 5F7HA 2HLAB 1QI5A 2AI0H 4NCDA 4C59B 1RD6A 4HUKB 5EO1B 2QVMA 4IRSB 1UM4H 2ZX5A 3NZ8B 5C0CD 3MA7A 1MAML 4MB4A 3H42L 2HVJA 4FLQA 2WN2A 5IOKA 4JFFA 3DKHA 4YE4H 2F1EA 3EUDA 1L6ZA 3HW7A 1GHFH 5JOEA 1U30A 2WBJC 3QDAA 4H26A 5JQIB 5ILTL 3F7QA 4IRZH 3VSQA 1UUNA 2R0ZL 3V5KA 3ZDWA 3ABLB 4DN4H 2FQEA 2NNAB 3B1UA 3AADB 4KRNA 5JYMA 3RX7A 1X4YA 3GI9H 5E9NA 1DQJB 1PSKH 3WIHL 5AD0B 5K59F 2ZSWB 4DO4A 5IEKA 3P4OA 5LXVA 1JZ8A 1MFNA 4HJUA 3VFMB 4O02H 4KNQA 3PXJA 1RFDH 4GW4B 5FGBC 5E08H 3EZ8A 3GI8H 4WDIB 5B8CB 3DO7A 2K6WA 4Z7OE 1RUQH 5D1QA 3H85A 3SGKA 5J57B 1MW2A 5GHWH 2CLVA 3DBXA 1KGCD 3WDIA 3H4HA 2DQTL 1A7OH 3P69A 4OGAD 5IJKC 5JW5B 3VXRB 1N2RB 2X7LA 3HHSB 3S35H 3PIQA 4M1CD 4V11A 1M71A 3HRZB 4KXDA 1KBWA 4NC2B 3X1NA 2R29H 1YJDC 3JV4B 2BHYA 1WS7A 2UZIL 4PAZA 4PTUB 4B96A 2FX7L 3S5ZA 3EHBC 1QUNB 1T7YA 1MCBA 2FWSA 4UBDC 3C6LA 4DPRA 5LKNA 3ETBF 3JT0A 5D7IB 5HYSG 1BVOA 1P5VA 1TVBA 3SKJH 3FFDB 5MI0B 4HJSA 1RERA 2YUWA 1F4YL 1AOHA 3IMTA 3KZ8A 3CXHJ 1YZZA 1ZS8B 2WKLA 3ARUA 4L2YA 1AQ8A 3QJHB 2I9TA 3L7EB 5HYJE 1J0IA 1FFPA 3D12B 3T3ME 4AQEA 5GGSA 2I60H 1LE5A 2H4EA 4XOBA 3FQWA 1JRHI 4ONHB 4EI6A 3EO1B 4H13C 5T3XD 3EYVA 3IPFA 3CHRA 1A6ZA 4KJWC 3IGAA 1KXVC 3DVNB 3O0RL 3QRBA 4P99A 5IB4B 3SJVD 5FF6B 1AZUA 3SCMA 2JIXD 3D85D 2B9AA 2VLKD 3BAIA 4HIQA 5FKAA 4ELME 3UDWC 2X4UB 3ARTA 2OM5A 2CWRA 3PS6A 4Q52A 3TTSA 3V9FA 1DVQA 2NY4C 4XI5D 4ERSH 1KYUA 2PYEA 3GXNA 1FCCA 4NQEB 4X4XA 4RMRA 1OO2A 4ZXBC 4KJYA 5JUEL 3HIZA 5GRYA 1KENL 3IXTA 5E7BA 4CN6A 1OPGH 2MPVA 4YDNA 1SPDA 4CA4A 4ABQA 3CFBA 4UYPA 2ZX7A 4FYQA 1I7ZB 1B4JL 1N6VA 4A2EA 1UZ6F 1YPZF 5F1KC 2LFEA 2IAAC 4RNRB 4L4VD 1PG7W 3FRUA 2NY3B 3C2AH 1DBMH 3VTAA 1YEGL 3TASA 4Y0GA 3N3EA 2FQFA 2OJ1A 1BGXL 4AENB 2FSEA 1W0VA 5HHVL 2PCPB 1GAFL 1GH7A 1R5WA 4NUMA 1NLBL 2DDQL 1OKEA 3C2SA 2XFXA 4R8WH 4ZI8A 2J5LC 5D96B 5DHYA 4ANUA 4POYA 5E24E 3KBEA 1Q9WB 1CFNB 1N10A 1AC6A 3Q48A 2YZ1A 2JKSA 1MIEH 3TCLB 3UL4A 4M5TA 4DP8X 1TQTA 1J0ZA 1K2DB 2OTWB 4GUCA 1I8MB 2ADFH 2AGJH 3UCRA 4OD3L 4YXLL 1YN7B 1IL1A 4AW4A 2H32H 5FA4B 4LKXA 2DBJA 4WTWA 3TJEL 1WC7A 1OTTC 4HISA 1ACZA 3NFPA 3UBGA 3N0AA 1OAXH 5AKTA 3ZPDA 3SDDD 1EAJA 2IV8A 5INCA 5KVFE 1L7IL 1SHMA 2BFGA 4XH2B 4U1JA 4IU3B 2F18A 3EH5B 2FX8L 3UAJA 1T22B 5JW4R 4AGNA 3MCYA 1SXAA 2APVA 2CCVA 3FCGA 3H9ZA 5DZJA 5K93A 2IWFA 4Y5VA 3MROA 5AYUL 4E5XG 5GRJH 2SEBB 1CYXA 4G6KL 3T65A 3ABKB 4PQXA 2HLAA 3KPMB 1YVLA 2EVJA 2HTKC 3WKQA 2R0KL 4QIRA 4IRSA 1D2PA 4IKKA 2YWYA 3BOVA 4BQ9A 2CJUH 4P5SA 4S11A 4U2YA 5AVQB 2VR8A 3W9EB 3TT1L 2NY1C 5EZPA 5L4FA 5IOPB 3CZKA 1KYOK 3N42F 4S0SD 1QEXA 5HP5A 1G9MH 2Q86B 1OGAA 3RURA 5IMMA 1OB0A 4M7LH 4ODSL 2VGLM 4HMCA 4GBXC 3SDXE 2NNAA 5JXEC 4YEFA 3OKMA 3IN0A 4HCRL 1BZ9B 3CDYA 3GWJA 3M07A 4A7TA 5BOPA 2DQIH 5FS5A 5AD0A 1AY1L 2MNJB 3KEDA 4GQRA 3G6JF 4U1NB 5JQ6L 3WD5L 4HMDA 1IRAY 4JFUA 1G6RH 5I76B 5HHOD 4GW4A 2XA8H 5CP3H 4YSEA 1F3DJ 2F08A 4YVUA 1CFMA 4WDIA 5DT1H 4R0LC 2VAJA 4WY7H 1R19A 1B0RB 5FYLE 5B7FA 5HHPB 5T1MA 1VFMA 4BFEA 3L4VA 5EORL 3UPAA 3CJJA 3X12B 1W9XA 1M9WA 3Q8FA 3VCLA 3BVTA 2BVQB 4XPBL 2QKSA 5HVWA 1K6QH 2GJ6B 3HHSA 1B0GB 4UB0H 4N87A 4YX2H 2XTLA 1FH5L 3DX0A 4JJ5A 5E51A 2AV1B 2FGZA 3FAXA 3F12B 3BVUA 3HRZA 1NDGB 1ZA3B 2Z4QB 3JV4A 3NP4A 1V3KA 2CHZA 4EJ1C 2IH1A 1QUNA 3CVHH 3GB7A 3W82A 1M42A 3QG6A 2WNGA 3VFTB 5D7IA 1BXUA 4WGWB 5EZIH 1EZUA 4JRYE 4PJXB 3U2SB 5EO0A 5GSRA 3F83A 4WW1B 2WWMC 4ZUTA 1I1CA 3QJHA 2NYYC 3IRZA 4MXQC 4IMKA 4X0KA 3QUXA 1U8JB 4JHVA 4KMTH 4DW2H 2ERJB 3BSZH 4M3HA 4R5TA 5FUZH 4R5XA 2F8OA 4MNGB 4UT7H 5AOIA 3FUEA 4FI8A 3LNIA 2EDEA 1A6AB 1R3LA 5E8OA 2NSXA 1Z2KA 5E0FA 1H9DA 3DVNA 5IB4A 2E27L 1XL4A 4E42B 1JGIA 3CQFA 4WO0A 1S9YA 5E00A 1GMIA 4JN2A 1EPFA 3UGXA 4U6YB 5FYJH 1Z1WA 2QMKA 2X4UA 3IJ7A 2CDGA 1I1AC 1FA4A 2ZF9A 1ZA6A 4OVVA 2GUOB 2Y7SA 3HB3D 4JL2A 1JGLH 4WI2A 3QNFA 5FW6A 5MEQB 5HBBA 3QCTH 3UJJH 1YEEH 1JZ2A 2ICWI 4FTVB 4NQEA 2R9HD 3OGCB 3C60C 2Y1ZA 4JZOA 4MZRA 2VMEA 2VXQL 4MXWL 1SJHA 4KTGA 5BO1L 1BM7A 3KPOB 4XO5A 2L7UA 1IGJA 3W11C 4C4KT 1T0NA 2XQ0A 5JW4N 5TGBB 4CW1B 2ROYA 3ARDC 1H15A 4TRPL 2JKLA 2O5XH 3RFRA 4D0CA 2CM6A 5IJDC 3N40P 1CGSL 3EFDH 4ENEC 4AENA 3CDZB 3GHPA 2PCPA 4GKZB 3UG5A 3GM0A 4GMTL 1AR1D 5KSAD 1HHIB 4OLVH 1LP9A 4J8RB 3D4ZA 1LK3H 4PHZA 2ZOWA 3O2VH 5JHMA 1KACB 2TSAA 2QELA 1CFNA 1W6WA 2J73A 4JQIA 2XZQH 3VRJA 1P53A 3QCVH 3V0VB 1I3GH 1F6LL 2FBJL 1I8MA 3NQIA 3GMLB 2Z1PA 3I9PA 3JYBA 2E47A 3AAZA 3OAUL 4Q14A 1E9PB 5FDWB 1T5WB 5L6YL 1KYAA 1LILA 3P0YH 1OTSD 1XGQB 1E3XA 1HYSC 2VJ8A 3MV7E 3ARED 1CICA 4YDZA 3VXUB 3F6JA 4IU3A 2A99A 1A4BA 4WW2B 4U1LB 3VGAB 3C6SB 5DEZA 1I7UB 1A5FH 4LHUG 1XXFC 5CZVL 3VH8A 2JKTM 1YC7A 1XO8A 3VVVA 3TO4D 4GJTB 4PBDA 4YH6A 4UYQA 3ZGHA 1Q0EA 4L9LA 3ZJAA 3VO0A 3JWOC 3O6LH 3W1ZA 4HBQA 4JQXA 4P2QD 1HL5A 2NQCA 25C8L 4MS6A 1D5IH 3CN4A 5CSZB 3L5XH 4LMQI 4BA0A 4UT6A 5MEOB 2TRHA 3MRGB 2CU9A 1CF1A 4PPTA 1JERA 1KZYA 4F2ME 3RWFA 1CDJA 1U92A 1ADQL 2NX5B 3QNXB 2Q86A 4ZPTB 4IHBA 4X98A 2I24N 1GKEA 4YN3A 4GRWH 2X28A 4F7PA 2K70A 1J88A 4P3DA 4C58B 4G6AD 4ZX4A 5K9QI 3L1OH 2P80A 2B77A 3O6KL 4IOFD 4XP4H 2JMRA 1F4XH 3D4YA 3C9NB 3PFUA 7FABH 4KDTC 3FF8A 1P1VA 3MR9A 3RVTD 3HE6C 4QAMB 2YOAA 4NDMB 4GAYB 5DO8A 1DFBH 4C4BA 3VQ1C 4GRLA 2JFCA 2J6EL 4R4NC 4F37F 3HE7D 3ZL4L 3BEWB 4XNAA 4DH2A 1B0RA 2ILLA 4XVOA 1N64H 3ARXA 3EF4A 3RU8L 1VHPA 4FG6C 4Y5YA 4FNLL 1G7LB 2XXGA 5GGQL 4HS3B 2CIIB 4PJFE 3X12A 1BFTA 2GW5A 4TUJB 1BD2E 1K72A 5T1LD 1D7DA 1EK3A 4M5SA 5CBAB 3TN0B 4YC2C 5EBMA 4P2RD 5CEZE 3BDXA 3QUZA 5DMGC 2VZTA 1ROCA 4I85A 5GZNA 4OJEH 3N2JA 2Z4QA 3FS9A 4WO4A 3ESOA 1DVFC 2YLKA 3IBEA 3VXME 2B1AH 3IJSA 3ERXA 4YDVB 2CBTA 5D2NE 4E36A 1PLAA 4C56E 3SE9H 3BDBA 4PLOB 3SO3C 2CLRB 4NENB 2DBLH 4N6QA 1AZRA 5IWLC 5D70H 5EBLA 3SODB 1GZHA 2NCMA 4IQHA 2B2XL 5J1SC 1RULL 2FLMA 3FXIC 5GJTL 4B3EA 4JQVC 1IFHL 1MWAA 1QR1A 5SV4A 2VITB 2H1LM 3SQBA 4QF1B 4OIBA 2FATL 3HN3A 3B3IB 1O6SB 3L95A 1H8OA 2CGZA 5JQHC 1QSZA 3C5SB 4Q58C 2UXTA 3FU7A 3MRCA 4FXKC 5TE7L 4E42A 2ZKXA 1MCPL 4N2CA 1E4XH 3AG3B 4GT0A 2D03H 1UADC 1YMHB 4U6YA 4D2NA 4PR5A 1RUAH 2BVUA 1B2YA 4P4RB 5D7HA 4BFGA 5I1HH 3C8KA 3BYYA 3RI5K 5F7EH 4LSQH 5MEQA 2CG9X 3BT0A 4CDGC 4NUJA 7PAZA 2FCBA 4UOW1 2L0DA 1TITA 1RZJC 4GP5B 1F1GA 3FAWA 4NBXB 3NAAL 4AT6B 4X50A 1FBIH 1NMAL 2AEPH 2Y2TA 1U9KA 1AGFB 1YG9A 3CX5J 1D6VH 1KTJA 3BZ4A 1MUJA 5DD5H 4ABVA 1CDBA 1K5NB 1PD0A 3DX7A 3CLFL 1BOGB 3OR6B 4YHIA 5I0DA 4CMHB 4PJHA 3BWUF 2D7TH 3TV8A 4GLRH 1H9VA 1QX1A 1DSFL 3AXLA 1E4KC 4FRWA 4AKQA 1Y0LA 3MRKB 3CDZA 4HHGA 5IHZB 4GKZA 2C1PA 1U93B 4JHZA 1N67A 3K6FA 2YSTA 5D7SL 3IMBA 3L6FB 2QSCH 3L9RB 5GS0H 2EVGA 3OPZL 4LLWB 5KBDA 2APFA 4I3SH 4ORGA 1WZ1L 4W9ZA 4KY1L 3FQUA 1AKJD 1WE5A 3LIZL 5I1DB 1XTLA 2B9BA 3RAJL 4M6OL 2AANA 1HHKA 5FHAH 1EBAA 3SPGA 2FK9A 1YSOA 1T4KA 4AZ8B 2C7UB 4QHNB 1I9IL 1TCRA 3BISA 3F00A 4ODWB 5GISL 3RWJB 3WKML 2EDOA 5FR3A 1K8DB 1INQA 3TIEB 4BSJA 1YDPB 2OR9H 3AZUA 2PP9A 4WUUB 4WENB 5FCUL 5H37G 3VXUA 1NEUA 5HXMA 2XACC 2OMVB 4U1LA 1BZ8A 2Y6SC 3C6SA 2K9FB 1I7UA