4W81A

Periplasmically produced monomeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb) at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
131
structure length
131
Chain Sequence
MAEVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYVAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Single Domain Antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
total genus 25
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w81A00
1GOFA 4PGEB 2R1WB 1NLBL 4GQ9H 3U7AA 2MKWA 5JLZB 1L6ZA 1HDMB 3QXDA 3PWVA 2A9NL 3GSOB 3VW3L 2HFEA 1K5NB 1K8DA 2LTQB 3BPLB 2HT4D 4LKXA 1CGWA 4G8EB 1ZGLM 1OAXL 1IEHA 1QQDB 2E5EA 4Z7VF 1RI8A 3O6MH 1KJ2H 3QUYC 1SEBA 3MLYH 1G9EA 1OT2A 3ZDXF 5CMAB 4ZTPL 3U0TA 3G5XA 4E0RA 5CD3A 1BFTA 4RMRA 2A0LD 4XZUA 3VXTB 1JF5A 4LEOB 2R9HD 1KCVL 1NAKH 3G08A 1ADQH 4MVBD 2VDRH 2NY1B 3QAZB 2OTWB 1LO0H 5L8LB 3EO0A 5GZNC 2FRGP 3QUZA 3RVTD 3G5ZB 3SDCB 1W2KT 3HR6A 9CGTA 3BDYH 1RUPL 3LQAL 1LDPH 1TZGL 1QSEA 3BWAA 2VXUL 4PGJA 4ZUWB 1IL1A 1T22A 1G7HA 4K7PH 4KDTA 5E56A 1OAKL 4PJGE 4IRSA 1K9TA 5CEZL 3OKEB 4K8RC 4NFCA 5D93B 1F4WH 4F9LA 1NGZA 1T66C 4QRSB 5D70L 5HY9A 1NBVH 4XGZB 5GRYA 1OSZA 3GSNH 4BA8A 3GHEL 3AUVA 5DFVD 4JZJC 1Q9OB 1SM3H 4PTUA 3MRQA 3NPZB 1CFSB 4XRCA 4WUUB 1EFXD 3DHMA 1FL3A 1KPVB 4YO0A 1D6EA 2ZUUA 1NKRA 4XHQA 5F1OB 3MCKA 4LVEA 2EDXA 3LH2L 5ISZA 1I9EA 1O5DT 3N0PB 3RZCC 4ZFGH 2PTVA 5C0IB 3RQ3A 3I6KA 4D3CL 2FB4H 4Q9RH 5FKAA 2J6EA 4P23A 1SVCP 4L3AA 2D7MA 4GRWB 2E7LC 1H3XA 4JZNB 4PGBB 5GJTL 3CZFB 5HSFA 4JO3H 5IVXE 2OS7A 2P8LA 4CJ0A 4QRPE 3L3HB 3MRNA 5E70A 4QHUB 1FH5H 1HWHB 4NC1C 4LPXA 2VLRD 4G3YH 1I7UB 2HG5B 3DARA 4L4TA 3MUZ1 5DVNA 1G9MH 4NJ9H 3V79C 4NO0B 2XN9E 5I75C 1C08B 3MBED 3GMNA 3T0BA 3T1WA 1LK3L 2OTPA 4P5TB 3G6DH 4JRYD 5BO1H 1G0XA 1S7TA 2F15A 4HWBA 4BSJA 4LNVA 3GKWH 4Y16B 5C0GB 5F1KC 3O2WH 5K9QI 5ID1A 1PY4A 3PWUA 4NO3A 5B39G 3L3OB 1EMTH 3C5ZB 4OF3A 3UC0H 2R29L 4IJ3C 2IC2A 2XRAH 3LEVH 4NQEB 4WFGE 4M61A 3QDMD 4U0RB 4Y89A 3G04A 3RL2B 5MEOB 4MXQD 5C92A 4XCYB 2OR7A 1S7XA 3TCXA 3TFKC 3S3JA 4Y4KB 2ERJB 5ICZB 1CG9B 5D7LD 3OKDB 3VXQA 3GO1L 3LS4L 5SX5K 3P0GB 3QNYA 4YZFF 3OKMA 4UT9H 2V17H 4OFDA 2HP4A 1GGTA 5LCVH 4C4KT 2J4WL 3MRIA 3SO3C 1DQDL 2IFGA 4ZUUA 2X7LB 3C9NA 1QLRB 1N59A 4U6XA 4ZTOH 1CLYL 5L6YL 3BP5A 1S5HA 4HLJA 1RUKH 4FQHA 2X09A 3W9EB 1YEJL 1BQHB 4JO1H 2AVGA 1JNNL 1S7SB 4F7MB 3X3FL 1PFCA 4QTHB 4GH7B 3LKNB 1T1WB 2CXGA 2R0LH 2LU7A 2EE9A 3QO1A 4FQIL 2DQUL 1OW0A 5GSRB 1UJ3B 4P5KB 4M03A 3WUWG 2YPKA 4W81A 1HHJB 3G6JF 4MSWB 3KYMB 5CJ5A 4P5MB 4NP4H 1FNHA 1VFUA 4GO6B 4F33A 5J1AB 3VG9B 4BH8B 5FYKH 3GSXA 4DKFH 3MV11 3I3BA 2APWA 3TJEH 2Q8BL 4DN3L 5DEFB 1F4AA 4G9FB 3MRFB 5CGMA 1W0VB 3HHRB 3SDAC 3ILPB 1QA9B 2OR8A 4RGOH 2AJYL 3TJHC 4IBLT 2DLGA 3MQIA 3UTPE 1XF4A 1XGPA 1RJLA 1UWXH 1TDQA 1X5ZA 1BD2A 2G5RA 4P2OA 4J1UA 1F2QA 4C4KO 4FQXD 2QSCL 5CSGA 1EZVX 3QDJB 4KC3B 3DXAB 4MS8D 1MFAL 1I4FB 3CFKB 4EDWH 2F9BT 3PWLA 5FOBA 2PYFB 4XAWH 4MQXC 1RHHB 4XPHL 5DO2C 2C3GA 1IVLA 1GPOH 3B9VA 2R0WH 5HXMA 2WBKA 3KWWA 3BAEH 5EU3A 2HRPH 3HS0B 3QG7H 4V1DD 1G0DA 1ZT1B 5F3HB 3EOAB 5JDSA 4P2RE 3GZKA 3E8UL 3VFWB 3W2DL 1P84K 1L9NA 3C2AL 4PJFE 4WWKB 5L2KE 1XIWA 5BW7C 2AXFB 3RX7A 3X14A 1UKSA 3ULVD 1EEUA 4G9DA 4Y5VA 1XCQA 4Y19E 1RUAH 3OR6B 4I9WD 7FABH 5JXAL 1PG7W 4LNRA 2EICA 5AZEL 2MKLC 5MEQA 1RSFA 1UA6L 1R3JA 4HWUA 1DUZA 5D1ZC 3V6OE 2G75A 4MA3A 2ZUWA 4M6ML 4IMLA 4L1DA 2Z0BA 2R1YB 3EYUL 5DEGA 5GRJH 4JHWH 4NKDB 3EW3B 2CIIB 3ARQA 4RMWA 5SWZB 5CKAA 1PAMA 3SCMA 5GS1C 5F6HJ 2G60H 1SJVA 2LVEA 1B9ZA 5DJ0B 1S7RA 1I1YB 4KK6C 4P9ML 3M07A 1U3JA 4HWZB 2KDGA 3GJFH 1IQWH 1HIML 3L3KA 1OD9A 1MI5B 2V5SA 4M5YH 3AB0C 5I8CB 1VEOA 2CLVB 2OR9L 1DBBH 2Q7YA 3U83A 3JWDL 4K9EH 1H9VA 3AS2A 5ADOL 2R39A 2I5YL 4PG2A 1HHKB 1K4DA 3D2UB 4FG6C 3WNMA 1QSFE 3T2OA 2VDLH 4XCNA 5FOJA 3L9RA 3R4DA 2HMID 4ENEC 5C09E 5F7EH 5DRXB 4ODTL 1YPZA 3BH9B 4GBXC 5T3ZH 4AG4H 4X6BA 3IU3A 4WRLA 1TTGA 4JM4H 2VZ3A 4JPKH 4KKCC 1IAOA 4F3FB 1DQQB 2DL9A 3QEQB 3ARGC 4LSVH 2CMRL 2AJZB 3B9KC 4QTIL 3NFPA 2J5LC 2ENSA 5IMLB 4LLVA 1FN4A 3DX7A 3U30C 4R97C 5HHVL 4R4BA 5D2NA 1BQLH 1OHQA 4CADB 4DZBA 2BSRA 4AEIH 4UDUA 2G2RA 1RJCA 4PRIB 4Q6IA 1GL4B 4WVRA 1JTTA 2YD1A 1J18A 3RDTB 5CUSL 2Y07H 4M6OH 1T4KB 3BEVA 1KFAL 4Y8AA 1YUHB 3OKOB 4L4VD 1OY3B 4PJ7E 4RGNC 2V7NA 4MCZB 2P8MB 3SDXE 2L7UA 4PG9A 2EH7L 4WO4D 5JPMB 2R2BA 2AK1L 3LEXA 4HK3N 5D7JC 4KHTH 4FHBD 1BWMA 4RIRB 1IMHC 4Y4FD 2EDNA 5D6CB 4K7PX 5J6GB 1GGCH 5D96B 3Q6FB 1WVZA 3OF6D 5LWYH 2L4OA 5KS9B 1XGUB 4O58L 4JFDB 2CIKB 3IFLH 4FXGB 3IDMA 1EK3A 3NN8B 2NY6D 1VHPA 1T89C 1UQSB 4FFWC 1U42A 4IS6B 1KN2L 1JPST 2MPAL 5HHPA 1KJ2L 4JKMA 1JNHB 4OLUH 3HE6C 4ZS7H 2GTWA 1K3IA 4W4NA 5CBAA 1VACA 4YDVB 1YNTA 4K94H 1MCKA 1F3DH 4H25A 3MLPA 3VXUE 1X5JA 3O4OB 1NCDH 3HI5H 1H3TA 3GRWA 2ITDA 2F53A 1KB5L 4PJIE 1FC1A 3BDYL 1U58B 5B3JF 2BMKA 4J3OC 3ARBD 4HC1L 4ZXBA 5HDBF 3QNZB 4XWGL 3VFTA 3VXSA 3GMRA 1FSKB 4K7PL 3PP4L 4RISH 4MHHI 4YAQA 1GAFH 2PR4H 4MNQB 4TSBL 5HGHA 1J5OL 3KPPB 4JPWH 1CD1B 4JM2B 4M7LH 2CUMA 5I1DA 4AEFA 1ORSA 5KSAA 3I9GH 2K3TA 3BWUC 4IDLA 3LKOB 5F9WC 5E6ZA 5T5FH 5FIEA 5HHNB 2Z4QB 4GRWH 3T77B 3WDHA 5TF0A 1OT1A 4F15B 2VDMH 4GW1B 4QXUH 4U4BA 3D5OF 2RJMA 1VGEL 3IJYA 5DMGC 3AAZB 4OCWH 3HUJA 3X3GH 2OSLA 2P5WB 2FHFA 5DUBB 1N6UA 2D7QA 5D71L 4ZFZB 3CVHH 4KTEH 4POUB 4DFIA 2OBGA 1TCMA 4JO3L 1SBSL 3HB3C 1BMGA 1IAIH 2COQA 2Y6SD 5FXCH 5K9QG 3RIFK 1JF6A 4U1KA 4PP2B 1A5FH 3U48A 5DRZB 5TE6L 3NIGE 1CE6B 3BUYB 4GXUM 3O9WC 5IEKA 4Y5YB 4U6VL 4UBDC 1P2CA 1XCTB 5IQ7L 4RZCB 2VB5A 3X17A 5I16A 1IGML 3S4SA 4PRHE 3NFSL 4RCAA 5IJVB 3IYLW 3TN0B 1XGYH 1F6AB 4ZAKD 2N1KA 5J57B 3BPCB 1RJZA 3QIWD 2UWEE 5IW6A 3UC0L 4S1SL 3VCLB 1A02N 3ZYIA 5EU6E 4P46C 4EN3B 1GYAA 1GGYA 4YC2C 2BERA 2IFFH 3IFPA 1UXWA 3BXNB 4X9HA 2NXYB 3U7YL 3GK8H 2AXGA 1SBBA 3GMMB 1OM3H 3LIZL 4H8WC 4GAFB 3MMEB 1PKOA 4C56E 3V9FA 1E6OH 3TBTB 4W68A 1C5DA 4M9OA 2BY1A 2JJVA 1CQYA 1BVKA 3V8OA 1QEWB 3UYRL 2GCYB 3ILQD 1VGKA 1MVUA 1FLTX 3F7VB 4GW5B 5A1AA 1OAZL 3QI9C 1RZKL 1I1AD 1DLHA 1JF1B 4X9BA 1BQHG 2ADGB 3WUZA 5KS9F 4OGXL 3AREA 4ZTOL 4G6KH 4I5BA 2VDKH 1OGAA 3VFRA 3CX5J 5GHWL 5IW3A 4JO1L 1H3PH 4HZLA 4HIHB 2IH3B 3GKZA 4LLDA 3FOMA 2G9HA 1A6AA 2D4DA 1QRKA 1A2YB 1SY6L 5J6HB 4Y4HD 1T83A 4QOKE 3FQRA 5I19H 3DRQB 1MREL 3HI6H 4LCWE 5EOQL 5C71A 4LSUL 1W0WB 1S78D 1HSAA 1A7NH 2XWJB 1NFDF 1KTKE 1JMZA 4N5ED 4QXGL 5LGHH 4G7VL 4NP4L 2I9LB 4PBWD 3D39D 3STLB 2BNRB 4ZPVB 3ZTJH 3NH7L 1XH3A 4G6AD 4BSVA 3FRPA 1HYSC 3ULUL 2JB5H 3UTTA 1E4JA 2YOCA 4JM2F 3E3QE 2X4OA 4LPWA 4XXCC 3ZTJG 5GS0H 3KPRB 4LLMB 5GRWA 4UV4L 2BNUA 5JIKA 3EZJB 5IT2H 4WUKH 2ATKB 4U1LB 2EIEA 5IHUL 2OL3H 4XAKE 1CE1H 3V6BR 2NXZB 5D7IA 1YN7A 4YHIA 4NNYA 4H88H 1EV2E 1QHOA 3QEUA 2YRLA 3UJJH 2F74B 5MENB 3MNVB 4M1CC 1CGYA 3U79A 4PRPB 3Q48A 2R4SL 3RWEA 3QUYB 5BS0A 2EYTA 3MV8A 3SQOH 4HKJA 1S7VA 3OPZH 3HZYA 4GAGH 4KZDH 1J1XH 5A2FA 2B8OT 4Z76A 2MFNA 4LCCA 4XNXH 3HI1B 4OFYA 4N9GB 2Y9RT 4P4KC 5DJDA 1EJOH 4YXHH 2VLME 2BNQD 3QHZH 4JEGB 2M8XA 1RUAL 1F97A 5B22A 3ULSA 1OCWL 4OZFB 1I9IH 1CDGA 2WWKT 3MGTA 1FYTE 4GAYA 3JV4B 2ZUYA 4NKIL 4JPVL 1XF2B 1TVBB 5BMFH 1OWRM 3FT4B 4RBPH 4L8DB 5HHOE 3X11B 1D5XB 1DUYB 3QO0B 1HKLL 3BVNB 3N1PC 5KG9A 4JHZA 2GIYA 5E2WH 4WHYH 2K7PA 2QADD 1T0MA 3FL7A 2AABH 3MRBA 3V52L 5IMMB 2OZ4L 1XZ0A 3MLUH 1I9RH 1FNFA 3C87A 4X4XB 3LS5L 1T66D 3RZCB 1QRNA 2XV6B 1HZHL 4WHYG 4X6DA 4U33A 1QO3A 1AI1H 2OQJA 2JCCB 3VWJA 3TBSA 3QR2A 1IGCH 3ROLB 4M5YL 4MJ4A 4XC1H 5ERWB 1VERA 1J88A 2GJZA 4D8PA 4K9EL 1HNFA 3P77A 3CLFL 3BD4A 2ED9A 5F7DA 5SWQA 5I71C 1L7TH 4E41A 2VDLL 3SOBL 4HDIA 5EU4B 3CSYA 3D85A 3THMH 4JDTH 3TVMD 3K4ZA 2X4PB 5I75B 1CTOA 4HX1A 1NC4B 2JF1A 5C0BA 5DYOA 1JPGB 4MD0A 3VE0A 1ADQA 3O41A 1V7NL 3EJZC 4DGVH 2X4NA 2NX5E 4HMEA 4NZJA 4L3CB 3VG0L 4OZGB 1FGVH 2GFBA 3B9AA 4XB7A 5EB9A 4ZFFA 1AGFA 2WWKO 1JV5B 5JOFB 4IJ3B 2AEPL 3SKJL 1A1NA 4O2EB 4IIQA 1BQLL 7CGTA 4AEIL 2YEZA 4MAYC 5D7KE 5ACMA 3H0TA 4FTVD 4LRIC 2H8PA 4S2SA 4EOWL 4PJ9A 1NGWB 4JRXA 3WJJC 1QD0A 5CP7A 4PLKD 1Q94A 2W59A 3GSNA 3HNTL 2Y07L 3T0EA 1KEMH 3IJSB 3L7FB 5FYLH 3VRIA 3O8XC 3M45A 5J1SC 4G7YH 1G7LB 1TITA 4QRPD 5D1XC 1NFKA 3MREA 4BFGA 3G5YA 1Q72L 1X5IA 1IZJA 2J8UE 4P3WA 2M2DA 3A6OA 5DJYA 3SO3B 2Q8AH 2XWTA 5ITFB 4KHTL 1DQJA 3MV01 4XT1C 2XN9D 4PREA 3SDYL 2HLAB 1LDSA 2IALB 5C0CA 3BEWB 4LSQH 3GIVB 3IRZA 1GGCL 1IGIH 4Q0XH 3QRGL 3GUTB 1CLCA 3SGDI 4DGYH 4H20L 2DIBA 2HWZL 5C8JA 2VABA 3IXTA 5F3BB 5D2LE 3RWJB 2C1PA 2CD0A 1I8MA 3HFMH 5EBWB 1K85A 1MPAH 3RUGE 4MNGB 4F7TB 3EYQD 2R23A 5CEXA 1J1PH 3CFJA 2KUTA 4Z0BL 5BVJB 3D0LA 4WFGD 3SBWA 2GSIB 2ILLA 4MHHG 1ZA3B 3ZSTA 2JIXD 4Y5XC 1KGCE 2O61B 2CO6B 1TETH 1KXVC 4XNZC 1NCDL 2BHZA 5EN2B 4PB9L 3O0RH 3RVXC 3KR3H 4XI5D 3MLTA 3S7GA 2AS5M 1EXUB 3DV6A 4P49A 4ZSOE 3LV3B 4ISVB 5E5MA 3RGVA 1GAFL 2WLZA 4OD1H 4DWHA 1H5BA 2PYEE 5D5ME 1AFVH 4ZDHA 3SDAB 4JFFB 4Y2DA 1LE5A 4JPIA 6FABL 3QZWB 4EI5A 1TMCB 4GAJL 3WS6A 1SQ2N 4OSUL 4PRBB 1C5BL 1FRGL 2PNDA 3UYOD 1Y6KR 1CU4L 3CU1A 4DCQB 1R5IB 1HHGA 1JGVL 3U9UA 4UV7H 3ZKSD 2ADJB 4MX7A 1ODAA 3SJVB 4WU5B 4OV6F 5JO5A 1I7ZB 2JCCF 1AQDB 2BCKA 3BW9A 5ANME 4XNQB 2DWDA 2KL6A 3X3GL 2VISB 2Z92A 2EYSB 2IBGA 1MHPH 2I9TA 1MIEL 1T21A 4NO2A 3UEZA 1NL0H 5E00A 1IM9A 4JAMA 3F7YB 1QFUH 2HH0H 3S96A 3FFDB 4OCYH 2GUOA 3RX5A 1FBIH 1CLZL 3KDMB 3DI2B 2EH8L 4Z5RB 5JMOC 5LQBH 3NCYP 4TNWK 5CJOL 3UBXA 4U7MA 3WUWA 1MY5A 4XBEH 4MQXD 3LAFA 3QUXB 4KTDH 4YUEL 1LO5A 1SMOA 3K46A 5ELIA 4TNVF 4LIQH 5E8EA 3G6AB 4IDJL 3KPSB 3KXFA 1AXTH 5D1ZB 5FDWA 1KJ3H 1WGOA 2YPLA 4PJAB 4LU5H 5E6ID 3K2UL 1HHIB 2I26N 3PHQB 4PJEA 3SGJA 3V2AR 3UTPD 1F58H 5BV7L 4PRDA 4FRWA 5CBEA 4KDTC 1XGYL 2XZQH 4IRSC 1E27A 2IH1B 5T33L 5GS1B 4F9LC 2OK0H 5EC2B 3RI5F 3SY0A 4KY1H 4NZTH 5FHAH 5FO9B 3BHBB 3R06B 1JE6A 4HHAB 3RL1A 4YHML 3C6LD 1RK1B 1RIHH 2DKUA 4ZPTA 1Q8MA 1LO2H 5IWLA 4HWEL 4O2CB 3MRRB 5I1LB 1J10A 1MCFA 3AB0B 1P53A 4N0RA 2X41A 4P2RD 4HUXA 1M6OA 4F58H 5IVOA 1XGTA 3EYOB 1E6OL 2H3NB 1KJVB 5L7XL 5CJBA 5IB2B 5L2KD 5DRWB 2AV7A 3D3VA 1FZMB 4HS6A 4Y19D 3OG6B 2V7HA 4P23C 3WIHL 3Q5OA 3MACH 4I48A 2G5BB 4YJZL 3S5LB 4TQEH 5ILTH 5EBMA 3OQ3B 2EXYC 3V7AG 3R8BB 1N5AB 1G7PB 4RWYL 4GBXB 1UZ8A 2GTZA 2VLJB 1U8OB 3CFEB 3GMOB 2YSSA 3PHOB 3KLDA 1EEZA 5HPMA 3TWCL 3NTCH 3MJ8A 4FG6D 2VXVL 3ARGB 3MRHB 5DJ8B 3VI3E 5B38A 3B9KB 2YA2A 1A1OA 3QUML 3NZ8B 1OF2A 3HE7A 5GRVK 2BRRL 4ENED 5I19L 1EVTC 5DMIH 4R4NC 2JK5A 3H7BA 4R97B 5A40E 4X99B 1S9YB 3DROB 5HVGB 3BSZH 1AXIB 3ABZA 1F45A 4OLEA 1I75A 1KT2B 5FA4B 5BVPL 1KCSL 2X10A 1J7VR 3CFDA 3O81A 4OAWA 2NLJB 1RZJC 5F89B 2CRMA 3PL6A 4HLZH 3VH8B 2CKBH 4RGNB 4X7TA 4YQXL 3OL2A 3OR7B 5IMOA 2Z31A 1GOGA 5D7JB 2NW3B 1CFQB 4NQDB 5MEPB 3U9PL 5C09D 2ZOLB 5IBUB 3TT1L 1A6WL 4WY7H 5IT2L 4WUKL 3GJFA 1GGUA 5FF6A 1N7ML 4HS3A 5IB4A 1FORL 3FONB 3QXUA 4PBXA 5GS2H 4J7RA 3QCVH 3VRLE 3IDIA 5HDOA 5MERB 1MH5A 1YNLL 3CC5A 4P2QE 4J12A 4A6YL 1MFNA 5C0AA 1M05B 4L5FH 4MXWH 3BDBA 1HH9A 1I3VA 3FOLB 2O93L 1MRFL 3MRKA 1RIVH 4OLXH 3NCJH 3V4PL 4GAGL 2FX8H 2MHAA 4KROD 1FLRL 3BKCH 4RGMC 1AKJD 1JHTB 1EERB 4N8PA 1N6QH 2WBJB 4ETQB 4JVUA 1AO7E 1OW0C 1YY9D 1MCEA 4OZFG 5EPMA 2FJHA 5EUOB 2Y5TA 1B4JL 4JN2A 3HE6D 5ADPH 2A9ML 4FXKA 1BD2E 4X6EA 3MRPA 4WFEE 1Z0MA 1F3JA 3UTZB 1KIQB 4KI1A 3P30H 3V8CA 4XPAL 3P3YA 2ZSWB 4NO5B 4J8RB 2LE9A 4I2XE 2P5EE 1UXSB 5E4EC 5F9WB 1W0YT 1NJ9B 4M9PA 5A3IC 4NZDA 2Q76A 4WI5A 5CGTA 5JLZA 1F6LL 4NZRL 4LP5A 2XNAB 3MRMB 3SKMA 5L9DH 1M7DB 2A6DB 3ES6A 3X13A 1FVEA 1I9RL 3MLUL 2DKMA 2XTJC 5AUMB 1HEZB 1IGFL 4G8EA 2MCPL 3AY4C 1NC2B 3EAKA 3BH8B 1QQDA 4JQXA 2DQHL 4P2OC 2IEPA 3H9ZA 2ICEB 1CQKA 1RIUL 1T7XA 5T3XE 4X6CB 3B9DA 3VXUD 4XC1L 2XOTA 2D03L 1FZOB 3Q3GA 1X5XA 3MLVH 4R90H 4YDIL 1T2JA 1L7TL 2ITCB 4X8JB 2FIKB 3GSRA 1RZ8B 3I02B 1RAMA 3MBXH 3SDCA 2EO9A 1IEAA 1RD6A 2BHYA 1OAUL 3O9WB 4Z7UE 2X1XR 1XIWC 3BN3B 4GSDH 4J3TA 4Y5VC 5E2VL 3VD4A 4IRZH 3HCVB 4DGVL 3WN5A 2QQNL 5IBTH 1U8PB 3L5WB 4NCDA 4NQCB 1F4YH 2RR3A 3WNPA 4KK5D 3WO4C 3CMOH 4XGZA 1VDGA 3C8DA 2QL1A 3BGFC 1DBMH 5EA0H 3GHBH 4QHKJ 5FM4A 1Q9OA 1CFSA 3CD4A 3FCTB 4WUUA 1DBAL 1WFOA 1FNSL 2FD6L 3SGDH 1SYSB 5C0NC 5FO8B 1S9VB 4P46B 3T1FA 4BKLA 3ARDD 4G8GE 3WFCL 3OAUL 1D5BA 1WBZB 5E6YA 1MHEB 3EOTH 4X9FA 1PLGL 1YYMH 3MLSL 1UM6H 3RNQB 5IIEA 2AJSL 4RMTA 3SCMC 2Y7QB 1AIFB 3ROOB 3KYNB 4ONGL 4DKEH 5I8EB 3FTGA 4QRUB 2NTFA 4G7YL 1HCFX 5GISL 32C2B 1KELH 4OZIE 4JZNA 1A6PA 4CMHC 2CRYA 4ZUVA 5J4MA 1DQLH 2XQBH 4NZUH 3D25B 1WV7T 4MXVF 5F7MC 3QI9B 4AMKH 2IQ9H 3ESVF 3ESUF 5F1NB 4NIKB 1I7UA 4LCYA 3HAEB 3L1OH 5DHYA 1IC7L 4PG2C 4Q9CA 4DGYL 2V2TB 3KPMA 4ODHL 3CVHA 4TRPH 4PRHD 1QACA 4KK8D 1HI6B 3WIIH 2HKFH 3SDXF 1LO4L 4PRAA 1E4WH 1CBVL 2B4CL 2PW2B 4F37K 3WXWH 3MODL 4M6AA 4F2MA 5EU6D 1CXLA 3L3OA 4JZOA 1YMHB 3VA6A 3BRDA 2KQMA 3DSFL 3DMMD 4PS4L 4JANB 1CGXA 4DGIL 3VWKA 3B83A 4YPGB 3TIEB 4X4ME 5HVHC 5AWNH 3RL2A 5EUOF 5MEOA 1WITA 5I1KL 4PJ8A 4C56D 5D2NC 4NM4L 2DBLH 2YK1L 4HJJL 1A6TB 4OM0L 4Y4KA 1MCPL 4DUVA 3BT2H 5JHDE 2RCSH 5CGYD 5HYSB 1FGNH 4Q6IC 4AIXA 1G7QB 1DBJH 5EZIH 4ONFH 1N0XL 4NNPH 3KPOA 1ORQA 5CWSB 3EGSA 2ORBL 1ZWIA 4L3EA 5KVGH 4HUWA 1RPQA 5CAYB 5HYEA 2Q87A 2ESVB 4N90E 4PJIF 1RZGB 2X7LA 1LP9A 4UOJA 2C3WA 3IU4L 2DQGH 4UV7L 3E6HB 3KLAB 4Y2OA 2R0KL 2NY2B 3NA9H 1OD7A 1BQHA 4XNMA 4QOKD 3VFPA 5SWSE 4KJQC 4MQ7B 4X6CF 1CICA 1P69B 3VXPB 1U8KA 3VGBA 4U1MB 1YJDC 4HPOH 1S9WB 3S97C 5GSRA 1UJ3A 4FABH 3DETC 1NDMB 4FQ1L 4QEGA 4G6FD 4MSWA 4M1CD 1P7QB 3KYMA 1G6RB 1MAJA 1F3DJ 5E8PB 1RQ5A 1WZ1H 5CZKA 4KTDL 1DR9A 5IVZB 1MLBB 1M7XA 4PJDA 3E2HC 3EDDA 4LIQL 1NEUA 4YH6A 1ZANH 4G9FA 4UT7H 2HJFB 5BZDA 3LKSB 3VGDA 3MRFA 4TSCH 1W0VA 2P7TA 4XAKD 1F58L 1SMAA 4ZXBC 8FABA 4P4KD 4D9LL 4HJ0C 4JRWA 4JE4B 3T65B 5DHVB 1N8ZA 4LLUB 4U6HA 1OB1B 1HOCA 1WZKA 5JW3L 4KK9C 4YNYB 5KSAC 4ZG1A 2FJFA 2ZOKB 4NHCL 3LKQB 3QDJA 3GBNL 3QIUA 3VFMA 1RIHL 4HEPG 3WFHB 3CFKA 1MRCH 3VFOA 2VLKE 4XPGH 4R3SB 2PYFA 1RHHA 1LHZA 4ZS6C 1UWGH 1P4IH 2OL3A 4DK3A 2APBA 1I3RB 3TV3L 1T0NB 2PKDA 5GZOC 4YGAB 2AK4B 3AC0A 4W4OA 4JFHE 5KJRH 3W9DB 4M7LT 1ZT1A 4O4YL 1S5IL 2JJUA 2VLMD 2YXMA 2ZUQC 4XP4H 4YDJA 5C0JB 2HT3D 5I71B 3K8MA 4RQQB 3MV7E 4BSWA 1T20B 1UWEL 1Q1JL 1BF2A 4WWKA 2F58H 1I7RB 1AGCB 1WIPA 5ILTL 1MJJA 3WFDH 1WC7A 4NCC2 3TH4T 2YZ1A 2NY4C 4FMFA 5HHOD 4ERSH 4PJBA 2ZSVB 3CSPA 5GGTH 4K2UH 3V6ZB 4UQ2A 3NCFB 3IDXH 3NTCL 1MVFA 5ESAA 2J1KA 3ARWA 1KPRB 2YRZA 3A67H 3KPNB 2Z8RA 1M71B 4NKDA 3LEYL 4GMTH 4O51B 5GRUL 5SWZA 1BJ8A 3BSZL 4WTZG 4OLWH 2F5AH 2J88L 3PIQA 5DJ0A 3CZJA 5DVKA 5FHBH 5CCKH 3O4LA 3VH8G 1KYOJ 3O8XB 4Y88A 5K9JH 3B8SA 5D1XB 3Q2CA 1AR2A 3ZMRA 2EYRA 3BZEB 4JY6B 4KV5F 1KLUA 2ZCHH 4MAYD 1AE6L 1CTNA 5IBUG 1I9JH 1MAKA 2AXHA 3U36A 2QEJA 3CLEL 1RULL 4FNLH 1HHKA 4JY4B 1A4KB 4PB0L 4WY7L 2ICWI 3HLAB 3UJIH 4QRRB 1ZTXL 1MAMH 4XXDA 5C0FB 1ZOXA 3CCHB 1H8OA 2B2XL 3Q6GL 2L7JA 3ZKXC 1INQA 3MXWH 1LD9B 2NX5D 3FQNA 5DD6A 1EGJA 4PFEA 4KKLD 3P4OB 3AREC 4L5FL 4U7KA 1NBYB 4F3FA 2FEDD 1DQQA 4QHNB 5F88B 2HJLA 2AJZA 3C09B 3GSWA 5D7KD 3UTTE 1WFTA 3B9EA 4Y5XB 5IMLA 1UC6A 2HJKB 5IB1A 1B88A 2QKIB 3QIBD 3KYKH 1IJ9A 5DD1H 4CADA 4K8RL 1T83C 1FIGH 1JPTH 3TA3D 1ZEAL 2Q3ZA 4PRIA 5M94B 4HGMA 4Q7DA 2IF7A 3OJDB 5GGVY 2BXZA 3HZMB 3S98A 1NCCH 1HILB 5FB8B 3AS1A 1YUHA 4K23H 3V4UH 3G5VB 1Q9WB 5I9QC 4EI6B 1DBKL 5DJ6B 4U05A 5TE7H 4P3DB 2E27H 4MCZA 2P8MA 4CMMB 3VXRB 5JPMA 3Q1SH 4KRPD 1CFTA 2DTMH 3LQMA 4N0FB 3OXRB 2W0KA 4KJYB 2EEAA 5BS0E 4RFOH 4R7DB 3MV8E 1TENA 1YN6B 5LVEA 4IRJA 3DYOA 25C8H 5D6CA 5J6GA 1JFQL 2NY3C 3Q6FA 3MLXL 3JWOC 2FWOB 5HGAA 1A7RL 1XF1A 4K3HA 3QXDB 3PWVB 5J13C 1FNEB 2LU3A 4IS6A 4Z7QE 4LKXB 1KGCD 2AI0H 2PO6A 5EIVA 3M1BB 5TDPA 3MCLH 4OLVH 3O3BA 1CF8L 1FL6A 1BVZA 2YMXL 4KTYA 3TP4A 3WO3B 1SEBB 4OIIL 4Z95L 4E0RB 4M7JL 4MJIA 5MHSD 4XZUB 2DQTH 3RJQB 3NAAL 2AJUH 2ZCKH 5JHLH 4BFBD 5FM5M 3EO0B 4KQ3L 2HKHH 2PYED 3IFOB 4LCCC 1AHWA 4JKLA 2F8XC 3QNZA 2BX5A 5INDB 1RUQH 1UWXK 1P5VA 5FA3A 3QDGA 4MNQA 2YD7A 5IBTL 1QSEB 2YWYA 4AIOA 4EIGB 3BWAB 1IL1B 1T22B 1YYLH 1G7HB 5JR1H 3CMOL 2W91A 4UB0H 1DBML 5EA0L 2H32H 2SEBB 1MCWW 1U3YA 3LKOA 1NGZB 1BBDH 1HNGA 4H8WH 2APXA 5HY9B 5DSCA 3CUPB 5F9DC 2DQJL 3QUZD 1OSZB 3LN9A 3ARSA 1KTRL 5TDOA 4B7LA 4GW1A 4XRCB 1TJGL 3RIFF 3BISA 2FLRT 1UM6L 1FL3B 3UMTA 1CXIA 3ZHDA 3PQYB 4TUKH 4YO0B 5DC9B 1D6EB 2OJEB 2HTKC 3CU7A 3ALPA 4DKEL 3MCKB 3NABH 2V5YA 4IRSD 5LAXB 4LLWA 3WE6B 2P5WA 4NUJA 5ISZB 3GSVB 3LRSA 4ZFZA 3I6KB 4P23B 4G6MH 1DQLL 4M1GL 5C08A 3VWJC 1I7TA 4JO2H 4ZNCD 3UP1A 3QFJB 2VC2L 4AMKL 4KQ4L 4PP1D 4YIQB 3MRNB 4OD2A 1GCFA 5DRZA 2P1YA 1Z6JT 3BZ4A 3WIIL 4L4TB 2HN7B 5CJQL 1XCTA 3CXDH 2EDYA 1U95B 3GMNB 3S34L 4XC3L 1F6AA 2FYYA 1S7TB 3GJFK 4YHPA 3T4AA 4CN4A 1RZFH 4EJ1C 3BPCA 1N5YH 2YD2A 3KLHC 2YKLH 2DLFH 3VCLA 3K1KC 5ID1B 2GY7B 3PWUB 4X98B 1LVEA 4N0YL 3GDBA 3BP6B 3BXNA 5CILH 5HYSG 4IIQC 4LRNH 4YK4C 2W65B 4LARH 4L8SB 3BT2L 2RCSL 3GMMA 4OGAC 4PJXA 2D4FA 5I1IH 1S7XB 4PJ9C 1B6DA 3MMEA 3TBTA 2I60H 4MCYA 3AU1B 3VXQB 4X4YB 3ULVH 3MUJA 3T0EC 3QNYB 1J8HE 1QEWA 1WISA 2GCYA 1T0PB 4ELME 4JY5L 4GW5A 3DGCR 4DQOH 4Z7WB 1NUDA 4ZFOA 1JF1A 3QH3A 2ADGA 3OKKB 3MRIB 1ZVSB 2IPKA 2DQGL 4JREC 1NCAH 4QHLA 4ZUUB 1RUMH 3C9NB 3WKMH 4KUZH 1VFAB 4HIHA 1N59B 2IH3A 4U6XB 4PJHA 5DT1H 1DFBH 4M7KL 3BP5B 4FQHB 2NMSA 2PF6A 2XA8H 2DB8A 2LQRA 2X6MA 1L7IH 5J6HA 2GHWB 4W70A 2W9DL 5DHXB 3RWFA 3DRQA 1B2WH 3D69A 1DN0B 4FABL 1H8SA 1ZLSH 2XIDA 2ZG1A 1MQKL 3SBWC 1G9MC 1BFOB 3GMLA 2DN7A 1JMXA 1RZIA 2FECL 1NMCC 1CIUA 3OHXB 1KIPB 1MCHA 2ZZUT 5IEHB 4F33B 6CGTA 1F00I 5CEYA 1B4RA 2GAZA 1PX3A 3EDKA 5DJ2A 3H3PH 1YEKH 4GT7A 3KJ4C 2GJ6E 4PTTA 5E4EB 4LAJH 1X4YA 1CXHA 1EBPA 2R8SL 3RGVC 3ZDZF 3MC0A 4U1LA 1H5BC 2BY0A 4P2QD 2YPVL 4Y2DC 2CKBA 4K07A 4EI5C 3CMGA 2DBJA 3NIDF 3WS6C 2XTJB 2F74A 1F13A 4HKBB 1XF4B 1XGPB 3K74B 3TZVA 4UTBL 3H42L 3VXMB 4CVWA 4P2OB 4J1UB 1UYWH 3DV4B 5LBSL 2FX9L 3QUYA 3T0DA 5F7UA 4UNTA 2GI7A 2D7TL 3TLRA 4EXPX 4RX4A 4LBEB 5KJRL 4DZ8B 4OZHA 5IFJB 1AO7D 2ZPKH 5MP6H 5IFAH 3KWWB 5EU3B 2IAMA 4YDKL 3CDGA 4KKAC 4N9GA 3FO0L 1BD2D 5FYKE 4U1JB 4WFED 2DMCA 3UAJC 4ODSH 3RKDC 1FO0L 1MFBL 2Y36H 3V4VL 1XIWB 3NOIA 1NBZA 1OWWA 4NWUL 4G9DB 4Y5VB 1XCQB 2YR3A 5F93C 5GGTL 3JV4A 2AKRB 2B1HL 4LNRB 1XF2A 4RAUA 3WO4B 5MEQB 3FT4A 4F57L 4L8DA 3BGFB 1R3JB 4KZEL 1DUZB 3QO0A 5KW9H 3F58H 4G5ZH 2G75B 4MA3B 4UT6H 4IMLB 4NQSA 3WKNA 4Z7VE 3SGJC 3O6KL 2VXQH 3PWPA 4BJLA 3BN9D 5E9DA 2FX7H 3ZDXE 5DEGB 4H0HB 2X70B 3MNWA 5IMMA 3Q5TA 3H9SA 2QQQA 3OAYH 2BVEA 5T3XD 3U1SL 3SCMB 3T2QA 1YNKL 3IDNA 5F7HA 3HMWH 3OJ2C 1S7RB 1WIOA 1A6ZB 1UVQA 1JYVA 4YHLL 3LHPH 4TOYH 1KB9J 4CMHB 3MFGB 2ARJQ 5DJXA 5IWLC 5KZCD 3L3KB 35C8H 3BPOC 3HC3H 3MYJA 5C6WH 4M48L 1RURH 5GGRY 3U7WL 2F54E 2Q7YB 2LABA 2JIXB 4FQJL 1U2CA 1MAML 5AYUL 4XVTH 4WI7A 2C4FU 4XCFH 1PG7L 4XCNB 3DUSA 1PSKH 4PD4K 3DX6A 3L9RB 1E28B 3WBDA 5DA0B 2EDWA 2WUCH 4YFEA 4NGHL 2B0SL 1YPZB 2UZXB 2HTLD 5FKPB 3TBVB 5EORL 4NC0B 2FO4B 4JG1L 4OZGA 3UYPA 1KYOK 4U6YA 4G8GD 2PXYA 3EYFB 5IJKA 5B21A 2BSSA 3DIFA 3KYKL 5DD1L 3QHFH 4XCEA 2JTDA 3P9MB 3NFPB 3HE7C 4GG8B 2PUQT 1FIGL 3OX8A 5CP3H 1MWAA 1J05B 2P42B 1DLFH 1BEYL 1FN4B 3QQ9C 3DX7B 4LLVB 1BP3B 1VEPA 2PETA 4R4BB 3DUHA 5D2NB 3TH3T 1HSBB 1QKZL 4UDUB 1WIUA 2G2RB 3IJSA 4Q6IB 4YHZL 2VUYA 1YEFH 3TYGH 3NPSB 1G7LA 3EO9H 3KJ6L 5C07B 1DEEA 5HHMB 3BEVB 3PL6C 1OARH 4PUBH 4P4RA 3TO4A 1U6AL 2V7NB 3MFFA 1QLEH 4LQFH 4PG9B 4HG4J 2R2BB 4N0CC 3LEXB 2Z31C 3GIZH 3GUTA 4OI9A 5ICXB 2RBLA 5T3ZE 5IFHH 5E5UB 1TQCB 1T1ZA 4OUUB 1OTSC 3BE1L 4DVRH 5DMKB 1KC5H 2FZ3A 2Q3AA 4F7TA 1NCWH 4X0KB 3IDMB 1Z2KA 3AS0A 5BVJA 3PWJB 3MTRA 2GSIA 2ZWLT 4RA0C 4NBZB 1ZA3A 4FFZH 3QCTL 5HHPB 1FAIH 4OLVL 3RU8H 3T8XB 3TT3H 3HG1E 4YZFE 4KHXH 2GTWB 1TNNA 2DQTL 5CBAB 5JHDD 1VACB 3CDCA 3CK0H 1YNTB 4PPTA 1AXSB 1T03L 1CDHA 4H0GA 4LSTH 1A14L 4H25B 3E2HB 1JRHI 4TVPH 1EXUA 4POYA 3WFEH 2ITDB 2F53B 4Z6AT 1I1CA 4DTGL 5KAQG 5EZOL 5F97E 1A7OH 2KQNA 4DW2H 3T0AA 2BMKB 1CL7I 4ZXBB 4N90D 4YAQB 3VFTB 3GMRB 5DC4B 1EHNA 4PJFB 5T1KA 5HGHB 1IC5H 5E0QA 3HNSL 4OF8A 4H8WL 1P5UA 5H35A 5E2TL 1GC1H 5I1DB 4HUNB 1XEDA 4NNXB 5KSAB 5IESH 5SWSD 2ADJA 1D5IL 3C6SB 4TNWF 2YD4A 4WJ5A 3SJVA 3NACL 4WU5A 3MO1B 4NM8H 2W9EL 3RVWC 2H2SD 3I85A 1I7ZA 2VDNH 1HE7A 3VXSD 4AQOA 3RKPA 2CGRL 4EZMA 2ED8A 1NBQA 2FGWL 1XR8A 2VISA 2VXSL 3BPLC 3O6FB 2DI9A 4L1HA 4WFFE 1GXEA 5HGDA 1OPGH 2ZJSH 4I0PB 2ZUQB 4KK9D 2OSLB 5I2IB 4G6ML 3UDWA 1S8DA 1WCQA 4R4FH 5DD0L 5HHQA 1FDLL 4B0MM 3BO8A 1PVHA 2VDPH 2D0FA 4ZS6D 1S7WB 3QUXA 4RBPK 2OXGA 4ODVH 2NY4B 4NBXB 1EO5A 3K0WA 4U1KB 4YXKH 3G6AA 3KPSA 3SDCC 1YPZF 2ARJA 3FB7B 3U6RB 4PJAA 5E8DL 1HHIA 3IFNL 4IOFD 5IEKB 1KG0B 3EJJX 5I18L 1INDH 1QSFB 1P2CB 4K94C 4KMQA 3PGCA 3S4SB 2IH1A 3WN5C 5EC2A 1TZHB 3OKNA 2VLKD 1BGXL 4LPVA 3SKUD 1BIIA 1OL0A 4A2MA 5C2BH 1RJZB 4HHAA 5D8JL 5T1LD 1LEKB 1TQBB 4JN1H 1WLHA 1IC4H 4O2CA 4JFHD 1QFOA 4LARL 4F7EA 3N9GL 5INCB 5I1IL 1UXWB 1J1OH 2W07A 3W11D 3MV7D 3EYOA 4ZOBA 2AXGB 1KJVA 4OCSL 1NCTA 2VSDA 5IB2A 2R4RH 2LV4A 1CR9L 4GXVL 1FZMA 4GS7B 4PBVC 3FO1A 4XMKH 3GM8A 5GJSH 1C5DB 2P43B 2EEBA 4YGVB 2G5BA 4U49A 2VR9A 4WW1A 1BVKB 1WK0A 1VADB 3O3AB 3VD7A 1MRDL 3ZKXB 1KEGH 1Q0YH 5DLML 2V5TA 5J8OA 4R96B 5GRZA 3TO2B 1G7PA 4GBXA 4DVBA 4NQEE 3N1MC 4HGWA 1RFDH 1DLHB 2CK0L 3AREB 1U8OA 2JKXA 3GMOA 1QPXA 5ALCH 4N0UB 5DT1L 1OGAB 2O5XH 3VFRB 1G6RL 2C9AA 1R5VB 3ARGA 5DJ8A 2XWBA 1D9KD 4X7FC 5J11C 1WWBX 3CDFA 4LLDB 3FOMB 4UIKH 2G9HB 4QXTA 1A6AB 5FYJD 12E8L 3B2UC 4OB5L 4KPHL 5EULV 5IHLB 3T2NL 1JHLH 1ZLSL 3B2VL 3FQRB 1E0OB 1KT2A 3GGWA 5EBLA 2AEQL 3W0WB 2Z91A 4AENB 1TPXC 3VFNB 5HJ3B 1R0AH 4M43L 3BUTA 2NLJA 1IGTA 2BFVH 1IEBB 3S36H 3VWKC 1UEYA 5I9QB 2AP2A 1OLLA 5FEBA 2XQYK 2O5YL 4PJ8C 1XH3B 1Z9MA 1GHFL 2AJVH 4Y4KC 1EUTA 1KBGH 2W60B 4WU7B 4X5WA 1ED3B 2X4OB 2ZOLA 3RA7L 3S37L 3V6FB 5KSBB 1BM3L 5FUZL 4HKZA 4OGZA 4UNVA 2NY3B 1N0LA 4NKMA 4ZO7A 1FVDA 3FONA 4R2GC 3FT2B 4KRLB 1E4XI 1GIGH 1BECA 1GZQA 2NY0D 3VFUA 2V2WA 4AT6A 1M05A 3QWQB 2X89D 3UTTD 4UOW0 4XMLH 4EKXA 1YMMB 3QEUB 1ZVHA 5KVMC 4JQIH 3FOLA 5BZWA 2NTSP 4M5ZL 1S7QB 5AZ2H 4M62L 4BQBA 4D94A 4FZ8H 3HUJF 3F8UB 5GS3A 1ZE3C 4XPBH 3RWEB 1MCIA 4LOUC 4G9FE 1CICC 1DQMH 5MP6L 4P59H 2E7BA 4HKJB 1S7VB 2DYPD 1JPFB 1EFXA 2WBJA 4JDZA 4ETQA 1A3RL 5DVMA 1UJ3C 1A7QL 3H9HB 4Z76B 4LCCB 4XHJD 5C0RL 5FK9A 1KOAA 4TN9A 3MRGA 4PV9B 3MCG1 1JZ4A 2Q86B 3U0WH 3MLWH 1TCRB 5D1QD 5BS0D 4OQTH 3QDJE 2D0GA 3DXAE 3FRUA 3MV8D 1YQ2A 5GGVH 4J8RA 3P0VH 1Y18B 4TTDC 3MGTB 1UXSA 3ISWA 5DMYA 4I8DA 1C1EH 1BVLA 3BQUD 2VDQL 2VXQL 1K2DA 2XNAA 3MRMA 4NC2B 3V0AC 2A6DA 3VD5A 3KVQA 5KG9B 4RNRB 1PZ5B 5AUMA 1JHKH 3M17A 1OLZA 1T0MB 3CXHJ 1NC2A 3MRBB 4ZNEA 3BH8A 3HMWL 1YEHH 1CN4A 1INEH 4B5EA 5GS0C 3VFVA 4NSKA 4YDLB 1QRNB 3SPVA 3QIUC 3LHPL 1DSFL 4JRYA 4KGJA 1NMAH 4GMSH 4X6DB 5B3JE 1FC2D 1PYWB 2UWEB 4JB9L 2OQJB 4K3DH 3TBSB 3A6BL 4LCIL 1WJ3A 2X9WA 4GLRI 2GKIA 2GJZB 4D8PB 2H9GB 1N64H 2ITCA 3I02A 4W4OC 2BP3A 3P77B 3HRZB 4CNIA 3QDMA 4U2YA 1ZS8B 2BZDA 5IBLD 1HHHA 4E41B 3O9WA 2BVPB 1PSKL 4WWKC 2C5DC 2WUCL 3ARTA 4FP8H 5D7LA 3VWJD 3HCVA 2DQFB 4R26H 5C0BB 3UO1L 1JNLL 2XACC 4N1HB 4R8WL 3VE0B 3O41B 4EXKA 4Y0GA 1TJHH 5GGQL 1MI5E 4X83A 1U3HD 3QHFL 5FM8A 4YWGL 2QSQA 2GFBB 5FO8A 1S9VA 4WDIA 4ZFFB 3D85D 2VH5L 4YE4H 1WSST 1AD9B 4WGWB 4PJCA 1UACL 4O5LH 2IPUG 2P47B 1A1NB 1MHEA 1MCBA 4IIQB 3RNQA 2EZ0C 4YHNA 2J7LA 4YK4B 3D9AH 1I3GL 4MD5A 2H32A 4S2SB 2BY3A 2H8PB 3LDBC 4YXLL 4YHOL 5I8EA 3FMGH 4PJ9B 4HCRH 4JRXB 4QRUA 4CKVX 5CP7B 3GSNB 3ARFC 4LCWB 1ERNA 4XNUH 5E2JA 1YEEH 3T0EB 1WT5A 4S1QH 2JB6B 3VRIB 1KNOA 1QFWM 4GKZB 2MQ3A 2EDTA 4M93C 3EYVB 4F37F 3QEQE 3WNLA 5F1NA 4MMZC 5DJYB 4P3CH 4N1EA 1JRHH 2XWTB 4JREB 5T5NG 5D7IF 2V2TA 3MOAH 4PREB 1P7HL 2ZP0T 5DS8A 2IGFH 4FFVD 1J0JA 5C0CB 1F4XL 2VOTA 3MLZL 1GGIL 2NZ9D 2EC9U 1DQTA 4PRIE 2B1AL 3P4LA 1CL7H 1VCAA 5C8JB 2E7CA 5TJWK 3IXTB 2AW2A 2PW2A 2C1PB 1ZAGA 5HHXL 4PV8A 5D72H 2PW1B 3INUL 3K1DA 4FFZL 2R23B 5CEXB 3NVQA 1CFNB 2R15A 3D0LB 5E7FA 1U8MB 4JANA 3HC4H 4YPGA 5JW4N 2DLIA 3V0WL 3MUHL 1NMCB 2VWEC 3DX8A 1A6UL 3BX7C 4LSTL 1ACZA 2HYMA 4B53A 4HG4K 1WFNA 4E5XA 3FN0L 1A6TA 4FQXA 3MLRH 3REVA 5HYSA 5DEZA 5KS9E 1J8HD 4XXCA 1A7OL 4JFDE 1XGQB 5GGSY 3P11L 3DV6B 3WXVH 4QGYA 1VKXA 3BD3A 3O2DH 1OAYH 3OKLA 3RGVB 4V1DA 4HBCH 1H5BB 3VFSA 5I76A 3BKYH 1UADC 1IFHL 2K9UA 4JPIB 2C1OB 1JNJA 4FMKA 2ESVA 4EI5B 1JYNA 5FUCE 1UM4H 5HVFB 1FNGA 3KLAA 2UY7A 3RY5A 3WMSA 1FYTB 2J6EL 1V5JA 1F42A 1HHGB 4IRJC 3I84A 5IQ9A 3PV7A 4TVSa 2MOVA 4MQ7A 4U1NB 2CJUL 2WNGA 1Q9LB 1JI2A 3VXPA 3CPLA 5JO5B 4Y2DD 4G6JH 1OPGL 2ZJSL 3BW9B 2DWDB 4S10A 4MNQE 1NDMA 1T21B 3Q5YA 4NO2B 1OTUC 5E00B 1IM9B 3QCUL 4EBQL 5F96L 3FB6B 2PO6C 3S96B 2VSCA 4Z7OE 2GUOB 4LGRB 4NN6C 5KVFL 4HIJA 5ID0A 2BVOA 5ICYB 3UBXB 4O00A 2GJ6D 1E6JL 2NR6C 1JYWA 5I15H 4HWBL 4YEEA 2FBJH 1UFUA 2ZKHH 1LO5B 2HJFA 4KWUA 4XPTH 2QQLH 4G8IB 1AHWC 4IEFB 1T5WA 3KXFB 5F7FA 5FDWB 3S4SG 1RZJL 4DN4L 4YEFA 1RZ7H 2YPLB 4PJ5B 2ICCA 1MCOL 3UAJD 3C08H 4PJEB 3UBXI 2P5WE 5ITBH 1OP9A 1P84J 1S7UB 5K9OB 1KIUA 1OB1A 5C2BL 5I15L 4JFYB 1F8TL 2ZOKA 4OTXL 4JO4L 3LKQA 1ZLUH 3MV9B 4UILL 3SY0B 3VGAC 4LSSL 2JLLA 3NIFF 3RL1B 1FG9C 2WV3A 3LN5B 4UNUA 4GG6A 1T0NA 4ZPTB 2QR0A 1LO3H 3L3GA 4H26B 4ALAH 3BPOB 5FYKD 4KMTH 2VJXA 3LD8C 5C0JA 4EVNA 3FZUD 4HUXB 3F7PC 1M6OB 3S36X 5IKCB 4JR9H 3BKJH 5TE4L 4KVNH 3QJHB 4JHBA 5FGSA 1IBGH 3NCEB 1N4XH 3D3VB 4HS6B 4P57A 2MJWA 1AGCA 2IANB 4LIQE 1MUJA 4I48B 2XZAH 1CXFA 5F1SA 2ADFH 2N4IA 1S9XB 3DX9B 3RVVD 4J6RH 1AC6A 3V6ZA 4OD3L 1UZ8B 4S0SD 2C4FT 3C60B 3EFDH 5JPNB 2YSSB 4U0QB 1MJUL 4WO4A 5IF0A 1EEZB 3P4NA 1M71A 3MJ8B 5I1HL 5B38B 4O51A 1EO8L 1A1OB 1QBBA 1PBYA 1OF2B 3UXFA 3HE7B 1ZA6A 4RWHA 1LEIA 1JHLL 3QPQC 5IROA 1E4XH 2OCFD 4LRIA 4JHAH 2A6JB 4J3VA 3GI8L 5D2LB 3L5XH 1W72A 1N2RB 1DZBA 2JK5B 2OLDA 3WJJA 5I1GL 2ICWA 3SE9L 5IB3B 2GW5A 1FQ9C 3FRPG 3GBLA 2DWEA 3CFDB 1SJEB 4OAWB 3RJDA 2F54D 1RVFH 3PGFH 1QFWL 2AJVL 1G9NH 1JPSL 4X7TB 5FV2A 1II4E 1V3JA 2WMPA 4HF5H 3ZKQD 4JFZH 1KXTB 2FSEA 1R3KA 3P0YH 4LPYA 3ZTNL 2CXKA 5IMOB 2Z31B 4QRRA 4XMPH 1AY1L 1NAMA 2D7PA 5C0FA 1ZXQA 2VXTH 3GJFB 4HW6A 2X42A 2OJZH 5FF6B 3CFCL 2IG2L 3P4OA 3PL6D 4XP9L 5IB4B 4JKPL 3ARBA 4WFHE 1KN4L 2ATPB 2BNRE 3WFBH 1NBYA 1LMKA 3IDIB 4OCNC 5IGXH 4MD4A 5B4MC 4QHNA 4N0CD 5C0AB 5F88A 3F5WB 5DURD 2BDNH 1UB5A 5F9JB 1HH9B 3N85H 2YHGA 3MRKB 1ZGLP 1YZZA 4WEBH 1EEQA 2UZIH 4H1LB 5T3XL 3KPRE 1N6VA 4HS8L 1AJ7H 1F90H 2MHAB 5FUOL 3SE8H 5I0ZA 1BZ9B 3OJDA 3DHJA 2DJSA 5I17A 3HZMA 5JUEH 5I73B 5FB8A 2BJML 3G5VA 1Q9WA 2BVUA 3PDGA 2HFGL 3U0WL 5MENE 4EI6A 2Y5TB 5J3HC 4CMMA 3BRGC 4JN2B 4HIXH 3GSUB 4FXKB 4Z77A 1TNMA 4X6EB 4Z8FL 4M7ZB 4GLRH 4PJEF 4PRPE 4MLSA 5JXED 1EH9A 5T3ZD 1NLDH 2OP4H 3HPJA 4DAGL 1I8KB 1DVFD 4OI8A 2V5MA 4WWID 4WCYH 2FWOA 5FCUH 2Q76B 3S3PA 4ZD3L 1JHKL 2NXZC 4S1DD 1QOKA 4HULB 3H2WA 1MEXH 2W1NA 3RTQD 2HFFB 1FNEA 3SKMB 3IETA 3ES6B 1RMFL 4XP5H 3X13B 1FVEB 1QBLH 5A2JH 2JELH 3HG1D 3EYSH 3MUGA 4ODWB 2VE6A 4LLYA 3TZVC 5I6XB 3M1BA 1D6VH 5LG1A 5DF0A 1MNUH 1DL7L 1F5WA 1VPOH 4ZQKA 1N64L 4CU7A 3Q3GB 2PTTA 2YD8A 3S35H 3PHSA 3IFOA 3GSRB 2IAMC 5E08H 5JQHC 1IEAB 1C5CH 3FT3B 5INDA 4NQUA 4CW1A 3VD3A 4KVCL 3DVFA 5LGJB 3CXHK 5CZXD 2JCCE 3WN5B 2SEBA 2NY7L 5HI5D 5KSUB 1JZ3A 4TULL 3VFGL 2NY1D 3QEGH 2ICWJ 4OLZH 3CUPA 5DD5H 3PWNB 4AJ0A 3SDCD 2A1WL 1I1AA 4I18A 4Z9KB 1L0XA 4NC1E 4WFFD 1YEIH 1KIRA 3PQYA 3T1FB 4BKLB 5I8KH 2OJEA 3ZL4L 2A83A 2XXMB 1D5BB 3IS1X 1OQOA 3FMGL 3GNML 4HCRL 5LAXA 5GGSB 2P46B 3WE6A 4BZ1L 3JTTA 4QWWC 5GRVL 3HMXH 3GSVA 5IIEB 1G6VK 1QR4A 4XNUL 4FTVE 1FPTH 3FTGB 5EIQA 2NTFB 2VKXA 1Z0NA 3QFJA 2YZ8A 4LSRH 4WUUD 4ZUVB 3U0PB 2FEEI 1J87A 1YJDL 5D7SL 1RU9L 4YIQA 1WWAX 3MOAL 2NQCA 5DJAA 4LCYB 3TIDA 2GK0B 2HN7A 5DHYB 4FQCH 3KPMB 1U95A 3CVHB 1QSZA 3VXOB 5J11B 4OJFL 4BYHA 4FQLH 1HWGB 4HD9A 5E2UH 4OQ1A 2Y23A 4PRAB 1T7YA 5DJCB 3GRWL 1SJHA 2DQIL 2WWMC 1BLNA 1BOYA 5I1EL 5CINL 4F2MB 4JJHA 2X4QB 5EU5B 4X98A 1TPXB 4JZOB 2PXYC 4KXZI 2NYYC 5IJKC 4NO0D 3BP6A 3VWKB 1IAII 3QPXL 2W65A 2DMKA 4L8SA 3IAGC 3QRFM 5BRZB 4P5TD 4PJ8B 4F80A 4S0TD 2Y06H 2EKSA 2BC4A 1KV3A 3AU1A 3QWRA 4Y16D 3VU2A 4X4YA 5C6PB 1HINL 4JGUA 3MXVL 2C4XA 4MNGE 4YHKH 5KVEH 3O2DL 5JQ6H 3IDJA 3C5ZD 1JWMA 4OV5A 4HBCL 3KPOB 4XPFH 3BKYL 1EFQA 1ORQB 4LAQH 3EGSB 1JTOA 4NQED 4Z7WA 4I77H 1ZWIB 3BKMH 1DE4B 4L3EB 4R2GB 3OKKA 4LK4A 4LPTA 2A2QT 1CDCA 4HUWB 5IG7A 3TO4C 1RY7B 1ZVSA 4M1DL 2BNQA 4KDWA 2R2HB 3JV6A 1UZ6F 1LP9B 2PCPB 1VFAA 2F5BH 4Y4KD 3WNOA 4PLOB 5KVDL 1FFOB 4X7CC 3CFBA 4OT1L 4O02L 2R0ZL 1FCGA 2P5EB 5J0BA 4XNMB 3STZA 4KFZC 3VFPB 2JJTA 5HYJB 3F62A 4TSAL 2R56L 1CICB 5F7WC 4NOFA 3WSQL 1DN0A 1DANU 2NW2B 2VZSA 3ME0A 1U8KB 2EDDA 2D2OA 2GSGA 4JFFE 4BZ2L 3BIAX 2F19H 2QLVB 1BFOA 3UBXG 3PG2A 1JP5A 3QYCA 4F7PA 3OHXA 1T5XA 1KIPA 2ZCLH 4N8VB 1FFPA 3KPQA 3OZ9H 5IEHA 3EJYC 1EZVY 2P49B 4MNHB 3DRTA 4UU9A 2FBJL 3S9DB 2Q20A 1T7VA 5FECA 1Q0XH 2ZKHL 1BFSA 4DOHB 2C7UA 3OGOE 2DM7A 4PJDB 4XPTL 5DVOA 4BH7A 2J12B 1OAQL 2FO1A 2XY2A 1RZ7L 4FFYL 3WS3A 3QP3A 1NGPH 1IARB 2DQDH 5BZDB 2FDBP 1NGXA 1LK2A 2P7TB 2BOCA 4ZMAT 8FABB 2XT1B 2UYLA 3WLWC 3BGMA 1SEQL 1L9MA 5IR1A 3LCYA 4HKBA 3CFIC 4ONHA 4PJGA 4JFPB 3TVMA 1R3HB 1N8ZB 3AY4A 4U6HB 2QHRH 1HOCB 3VXMA 3ZYJA 1A7PH 1OTTD 2FJFB 3DV4A 4G9FD 2EIZB 3QIUB 3VFMB 1ITCA 4Q9QL 5FYJL 4MA1B 1SVZA 3VFOB 2HT2C 5DK2B 4HFUL 4LBEA 4DZ8A 4HZAA 5IFJA 1MCSA 2OL3B 4GRWF 4PJAE 4XVSH 4POZC 4KMTL 4OLYL 5KTEL 4TUOB 4MAUH 4UTAH 3SE4A 3PJSB 4KVNL 1N3NB 4B7IA 4U1JA 5HI3D 4YDJB 4UQ3A 1TIUA 4I3SH 3FQTA 2WK2A 4BSWB 1NSNL 4LF3A 3QDJD 3UDWC 1MCQA 3DXAD 5E94B 1NUGA 1U9KA 2GITA 3U4BL 3DTXA 3QUXC 1MJJB 4EEEA 1WC7B 2AKRA 4BQ6A 5H94B 5IVXA 1MFCL 1C7TA 5CD5C 4GXUN 4RMSA 4QRPA 2R2EA 4PJBB 5B38G 1A3LL 3EFDL 4XP6H 4UQ2B 3A6CH 3OJVC 4KRNA 4DFHA 5GIRB 5ESAB 5I30H 3EOYG 1NMBL 4NWTH 1G7MB 4WWKD 2XN9A 2B5IC 2X70A 4OQTA 1A0QH 2EE3A 3L5XL 2EXWD 4S1RL 1OSPL 3NZHL 1EHLL 5TQ2L 1JYXA 1YQVL 4AQ1B 3LDBB 1U8NB 3PIQB 1A6ZA 5LGKA 5C9KA 2K1MA 3ARFB 1IILE 3O4LB 3K80A 4OFIA 3JWOL 4U1IB 1QBML 1KPUB 3PGFL 5K59F 1U92B 3STBA 2VLJE 3OV6A 1ETZA 5I1CL 4M93B 2YN3A 4JFZL 5SWZD 4MWFB 2EYRB 2J3SA 1KLUB 2JIXA 4HUUA 2AJXH 4XMPL 3GBMH 3I6LE 3U36B 2VAAA 1L0QA 2A77H 1X6LA 3EBAA 3MA9H 1KSRA 3RAJH 4XXDB 3EHBD 1E28A 1MIML 3BZFB 3D0VA 4JVWA 1INQB 4H1LH 1MI5D 5IGXL 1CVSC 3FQNB 5DD6B 1TJIH 5FKPA 3FQWA 3OAZH 2E9BA 4O9HH 5ALBL 5GQBA 3TBVA 4LASH 3I50L 5BJTA 2FO4A 2EDLA 2R1XB 3MSPA 4RGNE 3N85L 3CGTA 3EYFA 4H1LG 2EC9T 3D2UD 1YECH 2HJLB 3P9MA 3GSWB 4JFEB 2M1KA 4GG8A 4BZYA 3RNKA 4NQDE 4RA3A 1J05A 4KAQH 1Q9KA 5IB1B 1F90L 1NFIB 2AGJH 4K7PY 3SE8L 1J12A 1HSBA 3IS0X 1WBXA 3LMJH 5FGBA 4MXVE 3MJ9H 4YBQD 4UIMA 3H6JA 1OP5H 3T04D 4PJDF 4HAFA 3MR9B 2DQEL 5C07A 1OVZA 3QEQD 4HIXL 1HQRB 3IKCA 2HT4C 3S35X 4O2FA 4AZ8A 4XVJH 3VGFA 1CFTB 2R69L 4BQCA 3SDDB 4HCRA 4C57C 43C9A 4N8CH 4PRID 5ICXA 1YC8A 2A0LC 3ZKND 4NJAH 4GQ9L 4JG0H 3RDTD 4IRJB 3JTSA 4ORGA 3WHXA 4OUUA 4MVBC 3IB4A 2YD6A 1BFVH 3RVTC 5HGAB 5DMKA 2FJGA 4X0KA 5EUOE 3MJ7A 3PWJA 4YFDB 2QSVA 5KN5A 3T8XA 3O6ML 1FG2A 4NN7C 3MLYL 2ZNXA 2PO6B 3S88H 5TDPB 3O3BB 1FL6B 4NN6B 4NT6A 1AXSA 3ZT5A 2VQ1B 1NAKL 1ADQL 2VDRL 2EDFA 4JFDD 4MJIB 1X5AA 1LO0L 4LEXH 1PKQE 5DFVC 3C6LA 2VIRB 4C55A 5E08L 1EVUA 1NGQH 1ZKAA 3T2PA 2WBJC 1BREA 3K2MC 1CGSH 4XX1G 4PJBF 3N06B 1EEYB 1LDPL 1AHWB 4P2RA 3U46B 4PGZA 3DURA 3QWOB 5FA3B 3QDGB 4PJFA 5HI4D 5L2KA 4L8CA 1M4KA 1F4WL 2YRPA 3QDAA 4X6CE 4Y19A 4FOMA 5EO9B 1NBVL 2OYPA 3GSNL 2ENYA 4NNXA 5CZVH 1FP5A 2VZOA 3T3ME 3C6SA 4X7SH 1SM3L 5DWUH 2KPNA 3VGAB 5JZ7C 5DSCB 3MO1A 3V6OA 3O2DA 3U4EA 5TDOB 3IJHB 2X5PA 4X6FA 5HDQH 5I8KL 4KKNA 4MNQD 3O6FA 2VL4A 4JM2D 1EAPA 2H45A 5DQJA 4ZFGL 3MUY1 4I0PA 2FB4L 3LD8B 4Q9RL 3MBEC 3ZE0F 4HXBH 4LLWB 4NUJB 5I2IA 3LRSB 2DD8H 2DDQH 5GSVB 2VUOA 4LSRL 4NQCE 4YLQT 3ZDYF 4KXZH 2O5ZH 1H3GA 2Z35A 4ACPA 1S7WA 5C08B 5C7XH 1I7TB 4QNPF 1A9BB 5DVLA 3WJLA 1FH5L 4H5SA 1IAKA 1EHXA 2VQTA 4G3YL 4HIIA 3FB7A 3U6RA 4OD2B 1G9ML 4NJ9L 4AL8H 4XP1H 2P5WD 5TDNB 3BZ4B 4LDOB 4MXQC 1KG0A 1VFBB 3MOQA 3K8LA 1QSFA 5IB5A 3OAYK 1AR1D 1MCNA 4R7NA 5TPWH 3UJTH 3G6DL 5BO1L 5CJ8A 1J86A 1HN1A 1Z9OA 5L0QB 5C09A 4UAOC 1TZHA 1KF9B 3E0GA 3GKWL 5L88H 2KZ1B 3O2WL 4YR6A 2FYYB 4YHPB 3T4AB 1EMTL 2FATH 1LEKA 1UENA 2XRAL 3LEVL 1ZT7A 1A64A 1KENH 1NGYA 5DQDH 4I13B 5INCA 4LHUB 4MA8H 5J12C 1I8IA 3M8OH 5HD8D 5DK0A 4PJXB 3TN0D 1R3IH 4LVOC 4ZUSB 5KVEL 1JGUH 1D5ZA 1MHHA 4GUPB 2XZCH 4YGVA 3ET9F 4MCYB 3DPBA 2V17L 4UT9L 3HC0B 5C6TH 1WT5C 3O3AA 1VADA 1AKJA 5LCVL 4YFLI 4EN3D 5DI8A 2DYPB 4R96A 3TO2A 3ZT7A 2YC1B 3T4YB 3JV5A 2NXYD 3WD5H 4PJ7A 4ZFOB 1CD8A 3QH3B 4N0UA 2IPKB 3TNNA 2H1PH 3GSQB 5DUMH 2VN4A 1RUKL 2WUBH 3EDEA 4QHLB 1R5VA 2GQHA 3O2VH 3BIBX 4PJHB 3VXNB 1EPFA 4K55A 4M6NH 4I4WB 2OI9C 1LILA 1MJ8H 5F8RC 4XNYH 1IKFH 5I8OH 2NY5H 2R0LL 2F19L 3RWFB 4N8VG 1X5HA 3D69B 4KV5E 5ESQA 2DKSA 3W0WA 4AENA 3VFNA 5HJ3A 5B4MD 3IRPX 1BHGA 3MOBH 4NYLA 1IEBA 2ESVE 1CGVA 1YEGH 1AGDA 3GMLB 1RZIB 1BAFH 3RWDA 2C26A 3LQZA 5FYKL 2DJUA 1VA9A 2WSKA 4DKFL 3AGVA 4FQXC 5CEYB 5F44A 3TJEL 2W60A 4MS8C 4WU7A 5E99H 4BK4A 1WAAA 2GAZB 1ED3A 5DJ2B 3V6FA 5KSBA 1IRAY 2DQDL 5T1MA 1UKQA 3JXAA 4G8FA 4Z7OF 1T1YB 4PTTB 1QVOA 1BF8A 1X5GA 4RGOL 2X4RB 3FT2A 4WFHD 3ZSSA 2BNRD 2A9NH 3DVIA 4K7FB 3VW3H 4EQ2A 2CKBB 2YD3A 5E5RB 2HVKB 1U93A 1OAXH 1YMMA 3MA7B 1S7QA 4OFPA 2NY2C 3ULVC 3TZVB 1R6VA 2X9XA 4EDWL 4NQTA 3SKOB 5JOPE 1MY7A 3KPRD 4XAWL 4ZTPH 2V2XB 4CU6A 4XTRC 1GPOL 1FNAA 5DZNA 5DQ9B 2R0WL 3BAEL 4UTAL 2HRPL 3BP4A 2NXZD 3QG7L 4M8QB 3QJFA 4OZHB 5DC0A 1JPFA 5DRNA 5ACLA 4LGPB 3QEHA 5MEND 3ARDA 3H9HA 3W39B 1RUPH 1X5FA 2IAMB 5DFWH 4U1SA 3CDGB 2O26U 5BQ7A 3LQAH 4PV9A 5DGQA 1TZGH 1WFUA 4PRPD 2VXUH 2Q86A 1JZ6A 3QUYD 7FABL 1TCRA 1YEDB 5DK3A 5CEZH 1NBZB 4EDXA 2JE8A 3DGGA 1Y18A 2DLHA 4RMUA 5D70H 4XP6L 3FN9A 5EZJA 4WTXA 3GHEH 5GZND 4RAUB 4WEMB 2AK4E 1HXYB 1X44A 1NANI 1PGRB 5GRJL 1K8IA 4JHWL 4LLAA 4NQSB 4M8VA 5JIIA 4RNRA 1PZ5A 4GKSA 3PWPB 5E9DB 2G60L 3LH2H 3MNWB 1G7JB 3QDHA 4D3CH 3H9SB 4U31A 4K8RD 4OM1H 1T80A 2HMIC 2NNAA 1S9KC 2IMMA 3RY6C 3IDNB 4PJXF 3NGBC 4E42A 1PYWA 2UWEA 5GJTH 2DS4A 1IQWL 1UVQB 1JVKA 4IHOA 1XR9A 5EU6A 1DBBL 1MCCA 3GJEB 5DJXB 2H9GA 1EGJH 3DMMA 3GBML 3HRZA 3ZE2E 3MYJB 4MA7H 1T04A 1ZS8A 4QWWD 4FQQB 4QLRA 2BVPA 4K3EH 3RZCD 4G42A 2BSTB 1RK0A 5KBNC 5F7EL 4LHQB 1CT8A 2DQFA 1TZIB 1LK3H 3DUSB 4PJHF 1R5WA 3DX6B 4AG4L 3LKPB 5T3ZL 4JM4L 4JPKL 2H41A 1ZVYA 3C8HA 2BY2A 3BESR 4LSVL 1YECL 3SGKA 4U6YB 2R29H 4PY7A 5AG9A 1QTYT 4AEHH 4DK6A 3AFLA 4WO4C 2PXYB 4U1GB 1AD9A 4KAQL 3BYYA 2WLYA 2BSSB 3DIFB 4XCEB 3BDXA 4QRRE 1NC4D 3OX8B 5IROC 1MWAB 3MNZB 3KPTA 3GO1H 2FH8A 5CKGA 1DDHA 1WWWX 4KU1A 4LCWA 4M6OL 2YUWA 2JB6A 2XI9A 4GKZA 4ELKA 2OX5A 4Z78A 2NY6C 4XVJL 2NYYD 2RQ8A 3EYVA 1DEEB 2J4WH 1NPUA 1DQDH 2DIAA 1Y0LA 1I85A 5TGBB 4P4RB 5FGCB 3TO4B 3DBXB 3HMXA 3MFFB 2DL2A 1IKNA 3GMQA 4APQB 1CLYH 5L6YH 3TFKD 2LU4A 1YEJH 1JNNH 1REIA 1BFVL 5LWYL 2FHBA 2JJWA 3IFLL 4X5LA 1T1ZB 4MJ5A 2CUIA 2XQYG 2PW1A 2FZ3B 3ARBC 3ALXA 4FQIH 2DQUH 4OLUL 1CFNA 4OZHF 3VXRE 1U8MA 5ENWB 3WIFA 4ZYKB 5EDXA 4ZS7L 3C09C 3LN4A 3WV0A 2EC8A 4RAVB 2BVQB 4ZOAA 2FIRT 4K94L 4L9LA 3HI5L 1A22B 2HRLA 5DDHA 3VI4F 1CGSL 4DN3H 2VQUA 5MHSE 2P8PA 1XGQA 1A3QA 3SKNB 5J89A 2XY1A 4LFHD 1UCBH 5A16B 2QBWA 4DEPB 4RISL 2PR4L 4JPWL 1CDJA 2C1OA 4M7LL 1QR1A 4J3UA 15C8H 3HKFA 5T1KB 1PY9A 3I9GL 4NCC1 2FR4A 3C5SA 5T5FL 4Y1AB 5H35B 1FYTA 2XKUA 2QSCH 3MGOA 1MFAH 4KDVA 2X4SA 4QF1B 5HHOA 4U1NA 4MDJB 2VDML 4WJ5B 4XPHH 4QXUL 1Q9LA 4NRYA 3SDAD 4JFFD 1MJ7H 4OCWL 3TJHD 3RBGA 3FHQA 1F3RB 1XR8B 2I25N 3IDYC 3EO1A 5HGDB 1QSEE 3E8UH 3FB6A 3CVHL 4HJGA 4KTEL 5JTWA 3C2AH 3HNVH 4GRLB 3UTSB 4TVPE 1S8DB 1IAIL 5HHQB 3SJVD 3L95B 3CSGA 5HTSA 5ICYA 3BO8B 3KAAA 3ZDZE 5JXAH 4HFWA 3WL9B 5AZEH 3QIWC 1UKTA 5DO2D 2VLLA 1A5FL 1PDKA 5IMKB 2FL5A 4POZD 1OGTA 4U1HB 3NIDE 4G8IA 2Z93B 4M6MH 3PQYE 2ARJB 1TVDA 2VMFA 3ECBB 4PJ5A 2HAZA 5TPWL 4I1NB 4OZGF 5ISZE 2EDJA 1S7UA 3OGCB 5K9OA 2B5IB 2E9WA 3QUXD 1R3LB 4JFYA 3PGCB 4RFEB 4W6WB 3QFJE 3MV9A 3GB7B 3OKNB 4P9MH 3QBTB 3O11B 1RJYA 3ILQC 4LHUG 1BIIB 2NX5A 3KPSD 3RY4A 5EOTA 3TBYA 4CVZA 5D1ZD 5DQDL 4D9QE 4XVUC 1I1AC 4I18C 3LN5A 2IFFL 4KUCF 4MA8L 3UX9B 1P4LA 3GK8L 4H26A 2OR9H 5M95B 1EJ6A 3FFCB 4L4TE 3JWDH 4F7EB 3LY6A 1E4KA 1NDGA 2P4AB 1OM3L 5ADOH 3LKRB 2I5YH 1GC1C 3KNBA 5IKCA 2F8OA 1KLGA 4M02A 3QJHA 3QIBA 2GT9A 1CDUA 5KOVC 4KK6D 3FO1B 4JKWA 2IANA 1FV1B 5DXWA 3TA3A 3D18B 4WW1B 4ODTH 4QKXB 2IPUK 1KTDB 1S9XA 1S78C 3DX9A 4G6KL 4N5EC 4JJ5B 2VDKL 2J8UA 1MELA 1X7QA 4DVBB 1H3PL 4HGWB 4LSPH 2MCG1 3C60A 5JPNA 2CMRH 4G6AC 4QTIH 2YBRB 1ONQB 2XWBB 1WUNT 1BX2A 4XNYL 5HHVH 4QXTB 2A6JA 2HFTA 4U7SA 2X1OA 3ARYA 5D2LA 3SHSA 5I1AA 3HI6L 4WI4A 1OOAA 1N2RA 4CN6A 3ZO0A 2BVYA 3RUGA 1A7NL 4GBXD 1ES0A 3CSBA 4Z7WE 5F8QC 5LGHL 1R24B 4KKCD 5CUSH 5IB3A 2VLJD 3GGWB 4PGDA 5EBLB 2Z91B 1KFAH 3SGEI 3TESA 2V5RA 1SJEA 4U6TA 1IGTB 3ARGD 4WHCA 5B3NA 4ZOCA 2VL5A 3B9KD 1Z5LA 3UROR 4UINH 3I6LD 2EH7H 2JB5L 2NZIA 4L8SC 5F72S 1ZHKA 2AK1H 4F7CA 4EUPB 2EE6A 5GS0L 4WHTB 3NA4A 4HLZG 4QY8A 4ZODA 3MRLB 4X5WB 4JFOA 3RIAK 4PR5A 2E8ZA 4ZSOA 4HKZB 2I07A 4ONOA 3AMKA 2OL3L 4O58H 1CE1L 4NKMB 1CGUA 4H88L 2PYEA 1FVDB 3E6FA 5D5MA 2ATPA 4RGND 3UJJL 2QSTA 3O3DA 1KN2H 1GZQB 2MPAH 3VFUB 1EAJA 2V2WB 4AT6B 3U82B 3F5WA 4AM0A 1C16A 2CKNA 1M7IA 5F9JA 5D7JD 4NN7B 4NQDD 5BZWB 1AGBA 1NANH 3CH1B 3SQOL 2LAAA 4H1LA 3OPZL 2JJTC 4KZDL 1J1XL 2BRQA 3G6JB 4ZO9A 1KB5H 1BZ9A 5ANMA 4XNXL 3AMLA 4FFWD 1EFXB 3KHQA 4JDZB 1EJOL 4YXHL 4HC1H 4TUJA 1NKOA 3QHZL 2QADC 2XTJE 4XWGH 4MQSB 3PP4H 4U3XA 4BM7A 5FK9B 3GSUA 1KJMA 4TSBH 4PJAF 4D0BA 3MRGB 1J5OH 3VXME 1I9IL 4RMQA 2E6QA 1U8QB 5FO7B 3QUKB 3MJ9A 3FRUB 5EUKA 5BMFL 4X80H 4WTWA 1I8KA 2WBJD 1KULA 1BVLB 1K2DB 5E2WL 4F8TA 2HFFA 2AABL 2VLRB 4ORZC 3PGDA 1VGEH 4JQVA 4HUVA 5KSVA 4HSQA 4OM1L 3M17B 4ODWA 1AC0A 3TVMC 3MBEB 3QXWA 5D71H 1AI1L 3DECA 4L8BB 2X4UA 1IGCL 3VFVB 4NSKB 3SPVB 4MGXA 5JZ7D 1SBSH 1Y6MR 4JRYB 3V7MA 1HQ4A 3OMZA 5FYJU 2DMBA 5F1IA 1EGJL 3MYZA 4MA7L 1FYHB 1YY8B 1FFRA 1BZ7B 3SE4C 5C0EA 4K3EL 5DMGD 5TE6H 3O45A 3RPIA 3MRDA 1NC2D 4CNIB 3FO2A 5FGRA 4AH2A 3QDMB 3THML 4E9LA 4JDTL 3FT3A 4U6VH 2X1PA 1HHHB 2XFXB 1ZV5A 3RVUC 5IQ7H 3BD5A 4HT1H 3ZE1F 5L8JB 1IGMH 5LGJA 1ZLUK 4QGTA 2W0FA 4PLKC 3K8KA 3NFSH 1U8HA 3HB3D 5D7LB 4QYOB 3H3BC 5KSUA 1MWAH 1BOGB 4UAOB 1NCBH 1GZPB 4R9HA 3PWNA 3GM0A 4QRTB 1FGVL 1XGRA 4S1SH 4AEHL 3V5DB 4NRXA 5HYQA 1H0DA 3O9WD 5BV7B 1KCUH 2BXYA 1DCLA 2Y5EA 4UBDD 4HAGA 4LVNC 4WDIB 5ETUB 4X9IA 3U7YH 2VZUA 4PJCB 4FN0A 1O7SA 5J12B 5GGSA 1I3UA 4YHNB 3B5GA 3LIZH 4NQCD 3H3KA 4MD5B 2H32B 4KKBC 1XT5A 1KEML 1M1SA 4LVOB 5FYLL 5EZLA 3J7HA 1YDPB 4G43A 1YPZE 2Y4SA 5DTFA 3UYRH 3EYQC 3WYRA 3U2SB 4OKVB 1KNOB 4LCUB 3U0PA 1H15A 4P46D 1OAZH 1RZKH 2Q8AL 5BOZG 4OGXH 3V5HB 1EO7A 1FZJA 2CDGA 1PD6A 4Z18A 5GHWH 1NH6A 2GK0A 1N26A 4LSQL 4Q0XL 1IGIL 2EDRA 3TYFA 4U2ZA 2XKNA 5DS8B 5D2NE 3VXOA 2EEDA 3J8F7 5DFTA 3HFML 4XI5C 1SY6H 1BJMA 3I6GA 1GH7A 1MPAL 2ADIA 5DJCA 2OI9B 1MREH 1J1PL 2EDHA 3F6LA 5EOQH 4LSUH 5C07E 3DUUA 3QI9D 4JVPA 5HHME 4IM8A 3RWGA 4GJTB 4MB4A 4PV8B 4P2QA 5EU5A 2X4QA 4QXGH 4G7VH 2RIKA 1TETL 3QUMB 5C3TA 3NH7H 4MYWB 4HMCA 5BRZA 3DX8B 3O0RL 3ULUH 3PXHA 3KR3L 5I66A 2H26A 4E5XB 4FQXB 3QA3A 2WAHA 5FGBC 4LGSB 3REVB 1UCBL 2CR6A 3NPSC 4P48A 4UV4H 4UOW1 4OD1L 5K9KA 3RZWA 1AO7A 1AFVL 5E95B 3DI3B 3VDCA 4NBYB 5IHUH 1DE4A 1VKXB 1U8IB 3OKLB 4UI2A 15C8L 4V1DB 3IAQA 1A7BA 5I76B 5CLTA 3VFSB 2C3VB 5IK3A 4EIZC 2R2HA 3QQ4B 2BK8A 2PCPA 1HYSD 4OZ4B 3S6CA 1FFOA 1PZUB 1FNGB 1JTPA 5DJZB 2IJ0C 4I0CC 4I2XA 5TFSH 2R4SH 2P5EA 3BP7B 3VGGA 1IZKA 2Z9TA 1TQCC 5IQ9B 3MRJB 4AYFA 2AEWA 2W0LA 3MRCA 4F9PA 1MJ7L 2F53E 5HYJA 2NW2A 3CPLB 4CN1A 4A6YB 1MHPL 2FCBA 5E6IC 1NL0L 2ESVD 3T3MF 3V0VB 1QFUL 3VXSE 2DI7A 2HH0L 4OCYL 3HNVL 1FBIL 2VRAA 2NY2D 4NHUB 5LQBL 4N8VA 3B5TA 4HMDA 1FJ1B 4XBEL 1OCWH 1B0RB 4MNHA 4XTRD 5E1AA 3MJGX 4HIJB 5ID0B 2BVOB 5EC1B 4NKIH 4FS0A 4JPVH 3D87B 3C6LC 5A43C 1AXTL 1KJ3L 4LU5L 4OBRA 2VKWA 3LPWA 5DD3H 1HKLH 5JMRA 1T5WB 1P7QD 1GSMA 3BPNC 3G9AB 2DOCA 3HUJE 4Z7UA 4C83A 2WIMA 2XZQL 5GRXG 1JI1A 3V52H 2OZ4H 3W5NA 4JFPA 2OK0L 1R3HA 5JOPD 4KY1L 4NZTL 3LS5H 4PJCF 1A8JH 3O3EB 5FHAL 4F8QA 5JW4Q 1T6WA 1HZHH 2EIZA 2IBZY 4CUCA 3NGBB 3V6OC 1LO2L 2WANA 5DK2A 3F65A 5F21B 3UZQA 3JUZA 4ZFOL 4GG6B 3ZHLA 1JN6B 2QR0B 4TUOA 3GMPA 4G8GA 4F58L 3CLFH 1D5MA 3L3GB 3O6FC 1X6NA 1DP0A 1RHFA 3PJSA 1N3NA 4I0PC 4EVNB 3SOBH 3TPUB 3MACL 3MROA 1UEMA 3MPCA 2A74A 1P4BH 5E94A 4TQEL 3SGEH 4L9DA 5C0DA 4P57B 4OZIA 1BQSA 3GFUA 2OMNA 1F11A 5D9SA 1FAKT 1MUJB 1V7NH 2IWGA 5H94A 3WJLC 1IC1A 4AIZA 2AK4D 4LSPL 4J4PA 3VG0H 5F9OH 5GIRA 2BOBB 5F7KC 4L4VB 2CLRB 1S3KH 1FHGA 2E6JA 2MQ0A 2AEPH 3SKJH 1G7MA 4WO4B 5IF0B 3P4NB 2N7AA 5DMIL 3QT2A 3OXSB 3CJJA 3AM8A 3B3IA 4PD4J 4EOWH 1ZA6B 2X40A 4MB3A 3RHWK 4Y4FB 1LEIB 3RWHB 4EUPH 3CIQA 3HNTH 1U8NA 1W72B 3EJZD 5FYJE 3MZGB 3ARFA 4U1IA 1KPUA 1TQBC 2ICWB 2N7BA 1U92A 2Y1VA 4EUPG 1ZSDA 1Q72H 4UINL 2NY6B 2HVJA 3D6GA 2DWEB 1OGAE 4N0UE 2CKBL 5CSZA 4X4MA 3IGAA 4MWFA 3JSSA 5HDLA 3SDYH 1J0IA 2YUXA 3QFDB 1P6FA 4GS7C 2FSEB 5JHDA 3QRGH 1R3KB 5HPOA 4NKOA 4H20H 1NAMB 3WDJA 2HWZH 4KROC 3BZFA 3O8XD 5BOPA 3ULVF 3W0WE 4PIRF 5D1XD 3QCVL 3EOBB 3QQ3A 2EE2A 1FCCA 1YY9C 2AJ3B 2V6HA 5ECJE 3N50A 4Z0BH 3ARBB 1QLFA 4MXWL 3I3DA 2R1XA 5EFIA 4MD4B 4QHMB 4OF6A 3P40A 1LEGA 1RIVL 4QRRD 2UVEA 4JFEA 4OLXL 3NCJL 1UB5B 2UUDH 3H7LA 1WAAE 2FX8L 5CJXA 3SE3A 5KSBE 1NFIA 1NFDB 5JIPA 3BKCL 4PB9H 5SWSA