4W81A

Periplasmically produced monomeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb) at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
131
structure length
131
Chain Sequence
MAEVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYVAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single Domain Antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 25
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w81A00
1JFQL 2JJSC 2IPUK 4GMTH 3B9EA 3QWRA 3RTQC 1FH5H 2IBBA 4DGIL 2IJ0C 3P30H 1Z9MA 5JPNB 1RZGB 1QRNE 3OKDB 4HW6A 3GM0A 1R24A 5I1GL 5IKCA 2PTTB 5HVHC 4P2RE 2A83B 5D8JH 5C09A 1PSKH 2AXGB 5E08L 4DKFL 3S4SG 2SEBA 1EO7A 1H3TA 3IDNB 3NTCL 5DF0A 3MOAL 3O41A 5TDPA 4LGSB 2VDPL 3O2VH 5FCSH 3H42H 1LD9B 5F7NC 2IALA 4GBXC 1WVZA 4ELMB 4R8WH 3PUCA 5C0CB 2OP4L 4CMMA 2PYED 4NN6B 4RIRA 2D7PA 1QNZL 2ORBL 2DLIA 3OBAA 1UFUA 3SDXA 3EO9L 2MWCA 1OT1A 2QQLH 4YK4C 3N0PB 1WC7B 5E2WL 4N0UE 1FBIL 3WYRA 2HRLA 2EZ0D 5EC1A 3VGFA 1TCRB 2E7HA 1FLTX 2AQ3A 3R06B 1NUNB 5GJSH 1ZVSB 4S2SA 4N8CL 5BVPH 1JGEB 3ULUD 1P7KA 3DSFH 1QFPA 5T3XH 3C9NB 3I3BA 3N50A 4XVUD 4BQ6A 5EZOL 4ONOA 3ULSB 2ESVD 2HT4C 1CGSH 5D2LE 4EZMA 2OZ4A 3FQRB 4OLEA 5C0IB 4OLZL 3C5JA 3QDJD 2AS5M 2PXYC 1VERA 4U1JA 1F6LL 2Q8BL 1JNHA 4YXKL 5TE6L 4L4TE 1WIPA 3OKEB 4MJ2A 1QSEA 2RIKA 4HS8H 1MJ8H 4L5FL 3T65A 1T66C 5E24E 4HZLB 1WV7T 4HT1L 4YDLC 2B8OT 1KC5H 1FJ1A 4GW4B 4IDJH 2R23B 3U82B 3PGCA 2W07A 2A74B 2HP4A 3ZKND 4M5ZL 1B2WH 4ZQKA 1DQQA 1RQ5A 4NO0B 3HPJA 5EORL 4ZUVB 1X6LA 2VDKH 3G6AB 3VG9B 3CU7A 5T1DL 3LKOA 2IPTH 5I0DA 1FNHA 5AEAA 2VR5A 2O61A 3SDCB 1AQKH 2DWEB 4XC1L 1FZJB 3UPRB 2YPKA 5KSBF 4KVNH 1CXHA 5FDWB 5C0ND 3I3EA 2BVPA 3QUYD 3CDFA 1N5AA 4ZNEA 2NCMA 4L29A 1DLHA 4LSVH 1J0YA 5IVNA 1FNEA 3SY0B 4DUXA 4WTWA 4IIQA 3KPSE 1KB9K 1JK8B 4PJAF 3S3PA 1MQKH 3LVEA 2J12B 5C3TA 4NKIH 3CSGA 1BQHB 4NHCH 4PJXB 2O93L 3QCUL 5D2NC 3VXUE 2A6IB 5GZND 1UH4A 5D72H 3W0WE 1UEMA 4OUOA 2BSSB 5ADPL 3NZHL 3QAZB 2DM4A 4P3CL 2EE9A 4L9LB 4YWGL 1IL1A 1SY6H 4JRXB 1K8IA 4AM0A 3L3KA 4Y16A 4HDIA 3SPVB 3D6GA 2VDLL 3B5HA 2CDFB 3LS5H 3MNVA 4LLQB 4KVCL 5E1HB 5HXMA 1ZEAL 4OTXL 3AY4C 3SE4C 3D2UA 3U0WH 1VGEL 4NO2A 3BYTA 5K9JL 5DJ2B 1QRKA 4JZJC 4YJZL 5GSRA 5CJ8A 1QLFA 2XN9E 2W0FB 2Z35B 4MA7H 2OTWA 4WCYL 2WNGA 1NC2A 4MAYA 2XQBH 4NQEB 2YD5A 4FZ8H 5FOBA 3KGRA 4HH8A 4K71B 4D3CH 2DYPD 4W4OA 1HWHB 3ESVF 4Z78B 1R3LA 2VDQH 2XXMB 2EIBA 1UXSA 4LGPB 3G5YA 4OZHB 1D5BB 3VFRA 4DJMA 3OGOE 1F8TL 2GAZB 4P9HH 4JKLA 1A6AB 2IC2A 3D39D 3KXFE 5FECA 2NY6B 3T3PE 3MBXH 3G5VA 4TVPH 1H3VA 4DCQA 5DGQA 4AEIL 4AIZA 3B2VL 4X6DA 1CU4H 3K8KA 1T2QH 1G9MC 3AXLB 3HE7C 2B4CH 5HHMB 4FHBD 1PLGL 4P46C 2XWJA 5ILTL 5DO2D 5C92A 5JQ6L 5IB2A 1N0XH 1F45A 1EGJH 4PJBB 4F7CA 4CVUA 5M94B 2I26N 4P23B 1WWBX 4RWHA 4ZYKB 4PJDE 1F6AA 4K3EL 4S10A 1FZMA 5L88H 2CLVB 2W65B 4O4YH 4ORZC 5DD5H 5DK2B 1LEKA 3PHQA 3C2AH 2NW3B 2YHGA 4HUKB 4QRRB 3VDCA 3TA3A 1TZHA 2UV3A 1YNTB 3W2DH 1R5IA 2WBJB 3L3GA 1PJ9A 1QBML 2FATL 2PYEE 4AQ1B 2NY2D 3HC0A 4BSVA 4PJFB 1IAKB 5FO9B 5FCUH 2JF1A 1E4JA 2IAND 1GZPA 2J6EH 5TDNA 4F7TA 3NPSC 2QADC 2BY2A 2CXGA 4OF0A 4PUBH 4N8VG 2ZSWB 4PJ8A 5D70L 5HDQL 5AYUH 4JFFA 5CHNA 3V8OA 1IC4L 3MUJA 3QXTA 3VGEA 3L7FB 1YEHL 3PP3H 4FQCH 2FEEL 3JWOC 2HG5A 5T1LB 3QIUD 1EFXD 3ULUE 5BOPA 1KELH 5JLZB 4Z7VB 4XBEL 1BQLL 4YHMH 3QRFM 2ESVE 1ORSA 1NL0L 3NCFB 2YXMA 1HHIB 4J23A 5KVFL 3UTOA 4H25A 4FQXA 4PRNA 3QDJE 4OBRA 1RZJC 3WJJA 4I5BA 3NCCB 5D5ME 5DC4B 4JKKA 1UCBH 3MRIB 2VR9A 3WHXB 3NIDF 4XMPH 2B1HL 2YPVH 3D0LB 3CFBB 4C58B 2HLFD 4P5KA 3LY6A 2X6MA 4N9OB 4WW1A 4AIXA 4J1UA 2I9TA 2VQ1B 2Z8RA 3S36L 2VZ1A 4K94C 1MCJA 1V7MH 1NAKL 3MLWH 4KJQC 4NZDA 5GRUH 4C4KT 2BHUA 1NCAH 1FVEA 3B9KC 2YUVA 5I1HL 3SCMB 2XRAL 2R9HD 3OR7A 5C0FB 3RWFA 1UYWH 3RHWF 4PIRF 2GK0A 3SE3A 2JCCA 3GMOB 1ZAGA 1YEIL 4JM4H 2WLZA 3QI9B 3SDDC 3TT3L 2P5EA 1KFAH 1VADA 5IVOA 4N8PA 3VXMB 3VFPA 1MPAH 1EHAA 3DVFA 1NGXB 1GVIA 1OHQA 1S7SB 4PRDA 3GGWB 1PYWB 3FOLA 1N2RA 3MREB 5KVGL 1IBGH 2BK8A 3VRJB 4HCRL 4LARL 3K2UL 4EUPG 1AXSB 3QUMA 5A2IH 2CSPA 5E1AA 1U8MB 3ZDXE 4P4KA 3TVMA 3REWA 2D03H 3JTTB 1Z3GH 4QF1B 4N0FB 5CZVH 3V4VL 3C60C 1Y18A 4Q0XH 3DETD 2BVYA 4JFDB 3ARDC 3E6HA 4TTGA 5DQDL 5I75C 1R5VB 3G08B 3P73A 4NBYB 2FEDD 5EOCL 5IESL 3EOBB 4NQDB 3VWKC 4U05A 3UTZB 2EXYD 4BA8A 5IB1B 1ZXQA 2HRPL 2ERJB 1DP0A 3ZKXB 3ULUL 4XP4L 1ZSDA 3NAAL 1AHWA 3IDXL 5BZWB 2NMSA 2JJVA 1CDJA 5JPNA 1RZGA 3OKDA 4WUUD 2R8SL 1B3JA 4OFPA 3FT3B 1X4YA 2NR6C 2PTTA 3HR5A 1CIDA 4PTTB 2A83A 2AXGA 3V5KB 4YBQC 4OUUB 5HI4D 3IDNA 3FTGB 4JPVH 4LSDA 1D9KD 43CAB 3RVUC 3D39E 4GKNB 4OCSH 2AEPL 2HT2D 3O8XD 4I3SH 2DD8H 2CH8A 2H2PD 1TXKA 4JFQB 5JW3H 1SEQL 2DLFH 5FYKH 5IJKA 4ELMA 3L6FA 5IW1B 5T1KD 4N68A 3QIBC 5C0CA 3RI5F 4CW1B 3C5ZB 3MV9D 5KN5B 2ENYA 5ALCH 4EQ2A 3FT4A 5TPWL 4PJ9B 4Z95L 4JHAH 2HFFB 1P6AB 1WC7A 3GRWA 1IC7H 5FM8A 1A6TB 4KRPC 4LDOB 1NBVH 4R7DB 2CIKB 1TCRA 5EU7E 2E7LC 4WI6A 1UVQB 1VEOA 2P8MB 3T1WA 3R06A 5KAQG 4MD5B 3IKCB 4EN3B 1ZVSA 1WISA 2DAVA 3GMQB 1JGEA 3KLHC 2V9TA 4K3DL 1HHKB 2IANE 5I8OH 1WWWX 4ZAKB 4EIZC 1N6QH 3C9NA 4FTVD 4Z7NF 4DVBB 4LCWB 5FYKU 1JTOA 4JVPA 3ULSA 4JFPB 4X5XB 1Q0XH 1HILB 2UWEE 4MJ4A 3ME0A 1D5XB 3PP3K 4IRZH 3KDMB 4KKAD 1YNKH 3FQRA 4R90H 2YZ8A 2F53B 1H8OA 4LAJH 1ADQA 2EDXA 3ALWA 1SJVA 3OKEA 3C87A 3QCVL 1A6ZB 2DQEL 2DIAA 2WIMA 2ZCLH 4Y5XC 1EDQA 4HZLA 1ETZA 4GW4A 3OHXB 3WXVL 3J8F7 4GG6F 1OP5H 5T33H 4W6WB 2AJXH 2A74A 4NO0A 4UOW0 1YEKL 3V8CA 4ZUVA 1OD7A 3G6AA 4WJ5B 5E95B 3VWJA 2HTKD 4KJYA 2AVGA 4XGZB 2WQ8A 5IVZB 4LAQL 5TE7L 3TBYB 3HPLB 5GZOC 1IM3B 4GXVL 3SDCA 2DWEA 4GAYB 2UYLB 3BIKA 5C08D 2VH5H 5FHAL 1AQDB 1RMFH 25C8L 3DMMA 5FDWA 1MY7A 1JHLH 5AG9A 1JYNA 3QDMA 3MJ9A 1V7NH 3MLUL 2E3VA 2EE3A 5DXWA 4LF3B 1FAIH 3A6BH 4DTGH 5J4MA 1JK8A 4HD9A 3TPUA 4ZO8A 1BQHA 1WLHA 4PJXA 4JO1L 4M00A 4POZD 4JQXC 4U0RC 3SE9L 5J9PA 4XWGH 4WU7B 5B21A 3TCLB 4H8WL 1VFAB 1OT2A 2C1OB 4Y4FC 2XV6B 4Y4KB 4NWTH 1YEFL 2BSSA 5K59F 4IS6B 4MA1B 3KYKL 4L9LA 3RDTB 1C12B 4JRXA 5GRZA 1UJTA 3TCXA 3V5DA 5EU6D 3SPVA 4OIAA 5ELIA 3SOBL 3UTTD 2CDFA 2Y5TB 4LLQA 1KACB 1MFCL 1QACA 1JRHH 4KK5D 3FZUC 5DUBB 5DJ2A 3U7YL 4HKJB 4Q9RH 4JLRB 1T1ZA 4CL7A 4JG1L 3IXAB 4MS8D 3KPPB 3ARGD 5DZOA 4DK3A 2DLHA 2Z35A 2FIKB 2R0LL 2VZVA 5CUSL 1H3XA 4ZFZB 1DFBH 2Z91B 4JDVB 2N56A 4NQEA 3HMXL 4AH2B 3EFDH 5GHWH 3IJHB 3LEVL 5IIEB 3IDYC 3A6CH 5J89A 4Z78A 1Q38A 3JZ7A 4XAWL 2I60H 1OSPL 4OZHA 3TBWB 2GAZA 4B50A 1A7QH 4F33B 4UNTA 1BZ9B 1ADQH 2XYCA 5MEQB 4WUUE 3CU1A 3BWAB 3E3QC 4KTDL 1JWMB 5D4QA 3S98A 3AXLA 4L8BB 4FOMA 2YXFA 5GGTH 1OAXL 3LKQB 2FLRT 1NMBL 4PTUB 1T7VA 5CIPB 5E94A 2Y4SA 4PJBA 4P23A 3CH1A 4ZYKA 2BY0A 3FMGL 2CLVA 5HDBE 2MSPA 2W65A 4QRSB 5DK2A 3FQTB 1KB5H 4ZODA 2NW3A 5KVDH 4QRRA 15C8L 1F2XK 4P57B 5IROA 3OF6D 1YNTA 3MYJB 3D85B 5E8DH 2WBJA 4HJGB 2XZAH 3IU3B 3MV9E 1T03H 4JZOB 4H0HB 3O81A 5FO9A 2BJML 4R9HA 5HHVH 1D5IH 3GHBH 1MF2H 4I0PD 5IQ9B 4RISL 4JHWL 5HYJD 4WO4B 3U30B 2ZSWA 1FGNL 3O4OC 2MJWA 2X1WL 2XPGB 3AC0A 3QHZL 4WW2C 4K8RD 4PJGF 1C5DB 4UNVA 5T1LA 2DQTH 4BKLA 1FC1A 1MEXH 3WD5L 5BO1H 1MNUH 2PETA 4M6AA 1GC1L 1CIUA 1LVEA 4ZXBC 2OCFD 2OJZH 5JLZA 4FTVE 4Z7VA 1GOHA 5HI3D 4M48H 5AWNH 2J2ZA 4XXCA 4JB9L 3OMZA 1Q1JL 2X7LB 1FCGA 4YFLF 1IAOB 4RFEB 1HHIA 4JFYB 1RJLB 4OKVB 1R3JB 2NY7L 1QRNB 1W0WB 4ZS6D 2Z9TA 1CICB 5DFWH 2VDRH 3GM8A 3OAZH 4X6CE 5J06A 5KSBE 3MRIA 2GSIB 2JE8A 2JB5L 4GUPB 4R4NC 1FNLA 1T0NB 4P2OD 4ZG1A 5BOZG 3CFBA 4DOHE 1JI1A 4P2RB 5T5FH 4J6RL 1OP5K 2XG4A 1UACL 4Y5YB 1E28B 1G7JB 5F1OB 5GS1C 1VA9A 4OD1L 3RAJH 3ZMRA 3ABZA 4TNVK 3TO4B 4WEBH 4ACPA 3ARFC 1NAMB 5EU5B 4OI8A 2P48B 3SCMA 5DTFB 3W11C 5C0FA 5CGYC 5FA3B 4M7JH 4GLRH 2D9CA 3SKMB 3VJ6B 2XZQH 4B53A 2UUDH 5CFHA 3EOAB 2RB8A 3GMOA 5C08E 3QI9A 3B6SA 4L8SC 4N0UB 4G8FB 5IQ7H 4OGYL 3VXMA 5DMIH 3T2NH 3UTQB 1NGXA 1G0XA 2MOVA 3MROB 5IB5B 3CLEH 1S7SA 3GGWA 1PYWA 3MREA 3UAJD 1PG7L 5JXAH 1HYRC 1CZ8H 4JPIB 3VRJA 4GKSA 4MMZC 3FFCD 1AXSA 1Q8MA 4OJFH 1U8MA 3DIFB 1O7VA 1T83A 4OGAC 3JTTA 4QF1A 4IBLT 2OSLB 3OKNB 4ONFL 1CD1B 1Q94A 5EU6E 4JFDA 3TH3T 3SO3B 4OLUL 5EZIL 5ADOL 2XWTB 1R5VA 1IGMH 2DIJA 4L4TB 3TYGH 1WBYA 4M5YL 5B3JF 4G6JL 4H26B 3EOBA 4KI1A 4NQDA 5DJXB 2GQHA 5IB1A 3O3AA 4JGUA 4KY1L 1GOGA 3X12A 5GS0C 1JPGB 3RWEA 1ZE3C 4HKZB 4HWUA 3QUXD 1UZ8A 3BWUC 5BZWA 3F7VB 5T5NF 2NZ9C 1MJUH 5IOPB 4PD4K 5CJOL 2VZOA 2FSEB 1OP3H 3I75B 2XI9A 3K46A 3LQAL 3S3SA 1P4IL 1QR1A 4R26L 2IEPA 3FT3A 4WI7A 3SKNB 4LPVA 4M4PA 1AR1D 2GKIA 4PTTA 3NH7H 1KB9J 4I3RL 3DURB 3MFFB 2IH1B 2W9DL 4OUUA 3O6MH 3L1OL 3FTGA 3PNWB 43CAA 1RIVL 2ZNXA 2ZPKL 4GKNA 1WIUA 5EFIB 1IQDA 4HFUH 1T7WA 2V2XB 2WWMD 3ARED 4V2CB 1AJ7H 3VXUB 3WUZA 4JFQA 1JWSB 5GGSA 4WWKC 3W0WB 5DURB 4LLUA 4HK0B 3N1MC 5IW1A 3U79A 3SGKC 1YMMD 4CW1A 3C5ZA 2V17H 3WNMA 4YDIH 4NN7C 3SGEI 5KN5A 3CUPA 1A6WH 5EBWB 4PJ9A 2HFFA 3ULVF 1PQZB 1L6XA 1DBAL 1CLZH 4XVTL 3WDIA 1A6TA 1FIGH 4HLZG 4R7DA 1I8MA 2CIKA 1ED3B 1VKXB 2VOTA 5CCKL 1HQRB 1UVQA 2P8MA 4KRLB 4MD5A 3QIWB 5JORB 3IKCA 4BQ9A 4EN3A 3K8LA 4Z7WF 3GMQA 1JZ6A 2GSGB 3QNXA 4UIKH 4ZAKA 2XN9B 2G75B 4LCWA 4DVBA 3IFNL 5HYJE 5CP3A 5FUCE 3VRLE 1Z9OA 4JFPA 4X5XA 1HILA 1H3UA 1WT5A 4OD2A 1J5OL 1NFDF 3M8OH 3KDMA 1IGCH 1CK0L 1UC6A 5K9QI 4AJ0A 3MBEA 4DQOL 1ULVA 4NKMB 5T3ZH 3Q6FB 5ALBL 1F13A 1Y0LB 1A6ZA 1ZHNB 1XIWB 4EDWL 3N85H 1LILA 1P1ZA 4PJCE 3OHXA 1G1YA 3KXFB 4EI5D 2V2TB 3MXVH 3OAZK 3ZSSA 1NCWH 5CJXA 5BCAA 1UH3A 3T3MF 1OM3H 4NM4L 5E6YA 4KZEL 5FUOH 1NC4D 4J3TA 4WJ5A 1C8PA 1KCVL 2E8YA 2FX9H 5I18L 3QXUA 3OPZL 1I3RB 1OTTC 4XGZA 5IVZA 4LQ1A 3TBYA 3HPLA 1IM3A 3TLRA 1LO3L 4PS4L 2VXTH 4GAYA 5LBSH 3UXFA 2UYLA 3UYRH 1JGVL 1AQDA 1J10A 2DQGL 2PTVA 3P0VL 1IKFL 4PJDB 2VXVH 1RIUL 4KI5C 3UP1A 2AI0L 4UOW1 4LF3A 2C9AA 4A6YL 3A67H 4LPYA 2PYEB 4UV7H 4P3WA 4YXLL 5FM5M 3SGDI 1DBJH 4WU7A 3BKCH 3EOTL 5SWSD 3TCLA 4WI5A 3VD3A 2C1OA 2OR9H 4Y4KA 4QYOA 1F4AA 1T7XA 1RV6X 3PWLA 5D7LD 1UWXH 1C12A 1IGIH 5DD0H 4HUXB 1JJUA 5E99H 1QD0A 2R2BB 1A9BA 3UDWA 5JXEA 3FFCE 3MXWL 3BUTA 2Y5TA 1HKLL 1Q9WB 2R56H 3D1MC 2YD4A 2ESVB 3QDAA 5DUBA 4HKJA 4JLRA 4DGVH 3QXDB 2HKHL 2YMXL 3IXAA 2EIZA 3KPPA 5ID0B 2CK0H 4QXWA 4XNYH 3QDJB 1L7TL 2FIKA 4HXAH 2EDBA 5D5MB 4P0DA 1J1XL 2Z91A 4JDVA 4TTDC 4R2GC 4GW1B 4I48A 1T5XB 1CFVH 1EVTC 2VDML 3RWJB 1MHEB 4AH2A 1IARB 4K8RL 3IJHA 1BVLB 5IIEA 3H9ZA 5TH2B 2X1OA 1NCBH 4OCYL 1EHNA 1BBDL 5EIIB 1KJ3H 1DQLL 3NFPB 1KIPA 2D0FA 3TBWA 3SBWA 1LK3H 2ZWLT 4OBSA 4F57H 5GQBA 1OP3K 3B2UC 2CJUH 2AJUH 4ODTL 4ORGB 1BZ9A 3SHSA 4P59L 1JV5B 2Q7NA 3B4NA 5GPRA 3BJ91 3EYUL 5MEQA 1JNLH 5F21B 1P53A 1G7MA 4LKXA 3SJVD 4OZGF 3BWAA 4QOKA 4IMLB 1JWMA 3QUYB 4FFWD 1RVFH 1L6ZA 3EHBC 4L1DA 3D48R 3HN3A 4GXUN 1H0DB 1XGYH 3LKQA 2UZXB 2IQ9H 3GSNH 4PTUA 4ERSL 5CIPA 2UZYB 3NCYP 4GSDH 1FFNB 4IOFC 1KCKA 1ZS8B 3V6OC 3SGJA 3DV6B 4IIQC 4MB4A 4QRSA 5EBGA 4FQIL 4MA8L 3FQTA 3HCVB 1HSBB 5BV7L 4UB0L 3KYOB 4X80L 3MYJA 3D85A 3K0WA 1CL7H 3B3IA 1OGTB 4HJGA 3IU3A 4JZOA 4HPYL 4WUKL 4XC3L 1A7RL 4NUGH 4U1GB 2NY3D 2IBZY 1ZV5A 5LXGL 4LSSH 1SQ2N 4WI2A 5HHQB 1T04B 4WO4A 3I84A 2FO1A 3RUGF 5GS0H 2XPGA 4E9LA 1FLRL 2Q20A 1WCQA 3EUUA 1PEZA 3OJMB 1C5DA 5HY9B 3TV3L 5J8OA 1OCWH 3T04D 2FX8H 3OKOB 4GG6E 4NRXB 2I9LB 3O2DA 3BPOB 1VGKB 1JGUH 4BFGA 4CNIB 5F93C 1BFTA 1WAAF 2X7LA 5IMLB 4G43B 1IAOA 1M6OB 2R1XB 4NNXB 2DTML 2P4AB 4RFEA 3FB8B 2GY7B 5TF1H 3LQMA 1RJLA 4OKVA 1R3JA 2DYPB 4MAYC 1QRNA 1W0WA 4UT7H 1CICA 1ZGLB 1JFQH 4LIQE 4CBPA 1ZGLP 4ETYA 2FJFB 1T0NA 4W4OC 1HI6A 1IGJB 3CK0L 3GMNB 3LD8C 3CLFL 4RNRB 4Y5YA 4EBQL 1E28A 1G7JA 4IJ3B 1QBLL 5I1GH 3D39B 3VXPB 2H2SD 5F9AC 4JQIL 3TO4A 4MAUL 5E08H 4DKFH 1ONQA 1NAMA 2MQCA 5EU5A 4R97B 4UDTB 3NTCH 2OL3L 2YUWA 3MOAH 5D93C 5DTFA 4UU9A 4NRZB 2VDPH 2PO6C 1OPGL 3SKMA 4ZSOE 3EOAA 5K59E 3QEGL 4ISVA 3RWIA 3BX7C 1T89A 1RJYB 5KOMC 3EYVB 4N0UA 4G8FA 3GSUB 2OP4H 1AC0A 2KQMA 1TQCB 5L0QB 1QNZH 2ORBH 4QKXB 4J4PA 3UTQA 2O26U 5FGCE 3EO9H 3LRHA 5IB5A 1DQDL 1U2CA 2UY6A 5E2WH 2NY2B 1FBIH 1OAZL 5IF0A 4JPIA 4YIQB 3RJQB 2IANB 1IQWL 2BSED 4Q6IA 4G6KL 5SWSE 5CIPH 1IVLA 2UWEB 4MD4B 1N0LA 4PBWD 5ACZB 1EMTL 4N8CH 4M6ML 1X4ZA 5D7LE 2OSLA 3OKNA 1CFNB 1CD1A 2QBWA 4XHJC 3B9AA 1KYOJ 4U6HB 2IWGA 4JE4B 3QIUB 5EZOH 4GAGL 1EFXB 2EXWD 3X13B 2WLYA 1YUHB 4KJPC 2XWTA 4JO2L 4L4TA 2R2HA 4YHYB 3V0WL 3VDBA 5DK3A 5DJXA 4ONGL 4X9GA 1Q9KB 2Q8BH 4M6OL 1JPGA 4PBXA 4YXKH 2RAMA 5TE6H 3DECA 4HKZA 4HULB 2VYRE 4L5FH 4F9PC 4HT1H 3MRMB 3QWQB 4GRWE 5GGRY 3WJJC 3O6KL 1H3GA 4XCNA 3RVVC 4PJIF 3I75A 3VXQB 5DT1L 5HVGB 4M5ZH 2J7LA 3BXNB 2J8UA 3BDYH 5EORH 4OGZA 3ULVD 4XCFH 3SKNA 1RD6A 1MIEL 5T1DH 3S35L 1QYGL 3X17A 3DURA 1Z5LB 2IH1A 3V0VA 1KIRB 4D9LL 1UJ3B 3CSYB 3R1GL 1VFUA 4G6ML 3PNWA 4UZGA 1U8IB 3WCYA 1ACYL 4PRAB 1UM6L 3QUZD 5EFIA 2V2XA 5D7KD 3VXUA 1WSST 3SJVE 3W0WA 4HK0A 3I2CL 2KL6A 3SEPA 2CRMA 3HMWL 3UEZA 4GAJL 2IGFL 3QCUH 3QB7C 3JTSB 4PJGE 5EBWA 1HHHB 2MCG1 1PQZA 1TENA 5TFSL 3ELAT 5E0QA 4QTHB 4X6EB 2LTQC 4IHOB 3TN0D 5ADPH 3KPRD 1ED3A 1VKXA 4P3CH 1LMKA 1VCAA 4YWGH 1HQRA 3T8XB 2B1AH 2EO9A 1IT9L 3O3DB 4LLWA 4LMQE 2MTPA 5JORA 4RQQB 3RWDB 1NBZA 1V3JA 2VDLH 3WJLC 2GSGA 4KVCH 4JFED 2XN9A 3HG1A 3TVMC 5FUZH 3D3VD 1ZEAH 4OTXH 1I8KB 3IT8D 5K9JH 1WZ1L 4LOUD 4YGVB 5DJYB 4KPHL 2HT3D 2VAJA 3ZO0A 2D31B 3IYLW 5IBLC 2BHZA 3ZLQC 2K7QA 3BD3A 5F6HI 4U2ZA 2O5YL 3Q6FA 1FFOB 4HUWB 5B8CC 3L5WB 2Z8WC 1Y0LA 5L7XL 1XIWA 5JHDD 2ADIB 2V2TA 4JM2D 2C1PA 1T3FB 4JRWA 2BFVL 2DKMA 4WUUB 1KXVC 4YDJB 5EBLB 5A43C 4WRLA 1F8TH 4JREB 5ITBL 5JW5B 1I7TB 1A0QL 4RFNB 2XA8L 1I3RA 4IOIB 3RVTC 1FNSL 1J86A 3G6DL 3V4PL 1QO3A 5T3XD 4KRMB 4GO6B 4AEIH 1D9KB 5F6IC 1A5FL 5JW4R 3B2VH 4ZD3H 3VD7A 2JIXD 3O8XB 3ZTNH 2QSCL 3FFDA 3LN5B 4PJDA 2DF3A 2EC8A 3LRGA 3INUL 1PLGH 5ILTH 3WDJA 5JQ6H 5EUOF 4O2CA 4HWEH 5T1KB 4D2NA 4Y8DC 2V2WB 2PYEA 3MV9B 4K3EH 3F58L 3QXAA 3I9GL 5IJKC 4MVBC 3TBSB 4BFBD 5INDB 1W72L 1NEZB 3UJTL 3QG6B 3RNQB 4Y19E 1QBMH 2FATH 2VWEE 4KUZL 4C59B 5B3JE 2Y06L 3ETBF 4HUXA 2ITDB 2ICEB 3ZKQD 4AZ8A 5D70H 2R2BA 5HDQH 1IC4H 4U0QB 1Q9WA 4FTVB 1I1RA 1S5IL 1YEHH 3BO8B 1C5BH 1ES0B 3TC9A 3FT2B 5JHLL 1FG9C 3LRSB 3QXDA 2AK1L 1UG9A 4I4WB 4G3YL 1UKQA 5ID0A 1NDGB 5EO9B 3H0TB 1BQLH 4XBEH 3FB5B 3QDJA 1NL0H 5D5MA 4X6CB 5KSBB 2FGZA 5F72S 4HK3J 4OAWB 3QCTL 5GRVK 5KVFH 2COQA 1AE6H 4DOHB 3LAFA 4YGAB 1MHEA 5LKNA 4NZRH 4TNVF 4OZIE 3MZGB 2F8OA 1BVLA 2VRAA 4KKCD 5TH2A 3HI6L 1UXWB 3N1PC 1BPVA 2B1HH 5MP6H 4APQA 2DWDB 4UV4L 5EIIA 3NFPA 1J0JA 4KDVA 2F5AL 1EO8L 5AAMA 2E6JA 3S36H 1XR9B 2NY5L 4ORGA 5FIEA 1NAKH 3I85A 1JV5A 3D18B 3PWUB 5DHVB 1TZGL 3VWJC 5F9DC 5C08B 4KKLC 3MV7A 3ULVE 4IMLA 2XRAH 4GKZB 3QUYA 3ZSTA 3JBG7 3LEXB 4BFIB 1U42A 4M1CC 2OI9B 3DMMC 1CT8B 2YS4A 3DVGB 1YEIH 4M9PA 5GGVY 1S78D 3JXAA 3TT3H 1BQHG 1N64H 2GITB 4J3WA 4CADB 1CGVA 1ZS8A 3P4OB 4Z7WE 2PYFB 4JY6B 3DV6A 4KK9C 4OFKA 3HCVA 1HSBA 1BF8A 2FRGP 1AR2A 1NH6A 2ZUQB 3WFDL 5D1QD 4JDZB 3KYOA 5MEND 3QFJD 4NP4L 5KVGH 1OGTA 4RA3A 1SHMA 3PV6A 1FL5A 4HCRH 3MUGB 4C56D 1EA9C 5F97E 3K2UH 1NGPL 3FB7B 5HHQA 1T04A 5I1KL 1WTLA 3QAZC 5EU6B 3KPRE 5ANME 4TVPD 3V4VH 5JA8B 4D9RD 4N5EC 5HY9A 4PBVC 1J88A 1QVOA 2APTA 4QHUB 3NN8B 5DQDH 3DARA 4U3CA 4NRXA 2I9LA 3ARGB 3QO1B 4JFEE 5EOCH 5IESH 3D3VE 1VGKA 3H2WA 1J0KA 1YPZF 4CNIA 3CFDB 3O6FD 4QGTA 1T7ZA 5IMLA 3RPIB 4G43A 1DZBA 1M6OA 2R1XA 5EULV 4ZUWB 2HRPH 3FB8A 3IDMB 3S88L 3A0OA 5I1AB 3ULUH 4YNYB 4XP4H 4FQ1L 2DYPA 2Z0BA 1ZGLA 3W9DB 3KWWB 3MCLL 4K71C 2FJFA 3MOBL 1IGJA 3GMNA 5JHDE 5HVFB 4A6YB 1MJJB 1F3DH 1CN4A 2R8SH 1KJ2L 1JHTB 3RBSA 1MRCL 3D39A 3VXPA 4Y4HC 4WGWB 5CZXD 1J0HA 2AQ1A 5CEYB 2NY6C 4UDTA 5H37H 3QT2A 3PL6C 4R4BB 4TPRL 4K2UL 3RTQD 1SBSH 2AEPH 1B6UA 4HJ0C 4NRZA 1A9EB 4ZFGH 5T3XE 1EEZB 1ZT4A 1SEQH 1SM3L 1YJDC 1RJYA 1HXYB 3CMOL 3HI1B 4TOYH 1KCRH 4EJ1C 3RRQA 5CILL 1WCBB 4HIJA 3AB0C 4MJ6B 4P23C 4JFXB 5TPWH 4XHQA 4Z95H 3MOQA 1LDPL 1RZIB 4C55A 1E6OL 3BDXA 4IDLA 4PLKD 4YIQA 4Z7UA 3RWCA 4QXUL 2IANA 3VD9A 2WBJC 4I0PB 4RDQG 5F9WB 2KBGA 4GBXD 5HYJB 2R2EB 2UWEA 5C0DB 3HS0B 4O00A 4MD4A 2EKSB 4POUB 4K3DH 1N7ML 4EI6B 5F71A 1BVKB 1CFNA 4PJ5D 4JHZA 4U6HA 2D7NA 3T0VA 3QIUA 1EFXA 3X13A 4GMTL 5J12B 2ARJB 1YUHA 2HVKA 4R6UA 4NC2B 1JUFB 1N59B 2X41A 4HGKC 1IM9D 1Q9KA 3BKYL 4PJCB 3DWTA 4ZDHB 3DGGB 4XXCC 1I7ZB 3QCVH 3WIFB 1RUAL 2DQEH 5D8JL 1PSKL 1WZLA 3JV4B 1ITCA 4OZGE 3QEQD 3HZYB 3MRMA 1YA5A 5JOEA 4P2OB 3WXVH 3WHE0 3VXQA 1HEZB 5BMFL 4L4VD 2AJVL 3BXNA 1YEKH 1TZIB 4V2BA 3WO4C 5EC2B 4KHTL 3EDEA 4R8WL 5BJTB 4LAQH 5TE7H 1ITBB 1Z5LA 4GXVH 1KIRA 1UJ3A 3B8SA 3CSYA 1T20B 1T66D 1CD8A 2EYRB 5FHAH 25C8H 2YRPA 4Z7QF 2F58L 1P4BL 1T1YB 1QR4A 1U8IA 4PRAA 2E7BA 4LHUD 5FKPB 4Z0XB 2NY1C 2HN7B 5T1MB 4WV1B 2K7PA 4Z5RB 3TWCH 3D69A 3RUGE 2APWA 5E7FA 4JO1H 3U7AA 4X4XB 2EO1A 3SE9H 3UJIL 3T0EC 2A2QT 3T09A 3JTSA 3L7EB 4GW5A 1BQSA 4H8WH 1HHJB 4UILH 3IGAA 4QTHA 4X6EA 4F7EB 2GJ6D 4IHOA 3BVNB 3BPCB 3FFCB 2FBOJ 3T8XA 5MENE 3W39B 3I6GB 3QFJE 2YKLL 3BUYB 1UWGL 1WAAE 5KS9F 3RWDA 4EDXB 2X05A 4C56E 5E9DE 4PJFF 3I3DA 3KPOB 3OJVC 3QQ3B 3U9UB 3S3JA 4JFOB 1MFCH 3K8MA 1T83C 4E5XB 1I8KA 4M6NL 5FGBA 1MJ8L 4WNQB 1J11A 3U7YH 3KJ4C 1TJHL 1INDH 4JG1H 3LQZA 2YA2A 3OQ3B 3KS0H 2R0LH 4QRPD 5J0BA 5CUSH 2VDKL 1CF8L 1FFOA 1LEGB 5BVJA 4JPWL 3L5WA 2AQ2A 3P4NA 4ODWB 3HMXH 1CDIA 3QUXB 1L4IA 5ENWB 2OL3B 4HGMA 1GGIL 3LEVH 4HKBB 5KW9H 4KVNL 5DDHA 4K23L 2ADIA 2RBLA 3V7AE 2CXKA 4P2QD 1T3FA 1UZ6E 4HH9B 1OSPH 4WUUA 1KPVB 4YDJA 3KYNA 5DJ6B 5EBLA 4PV9B 1DVFC 3GSQB 5JW5A 4IRJD 4IOIA 1IGTA 2IFGA 2Z93B 3RKDC 1D9KA 4NZJA 1U6AL 1ZHKB 4YHLL 4HC1A 4KTDH 3O8XA 1S7RB 4QY8B 4MD0A 1MCBA 4PV8B 3AREB 3GSXB 1OAXH 3RP1A 3TEUA 1JZ2A 1XEDA 5C6PB 1NMBH 5C0GB 1KSRA 4PP1C 5T1KA 2CMRL 4JKMA 1YMMB 4K9EC 2V2WA 3MV9A 3FMGH 1EEYB 4OM1L 2CUIA 4JR9L 3TBSA 4PLJC 1P9MC 15C8H 5J1SC 4C4KO 1NEZA 3QG6A 1ZLVH 3NVQA 3RNQA 3HE7D 4HUUB 4UIMA 2CR3A 4H0GA 5FYJL 5L6YL 1W2KT 2BJMH 4XXDB 3W82A 1KF9B 3S96B 2C26A 2WSKA 3JWDL 1QG3A 4RISH 4JHWH 2ITDA 2ICEA 3K1KC 4I0KA 1FN4B 1FGNH 4GG6B 3QHZH 2APBA 3W9EB 4FXLA 4EN3C 3BO8A 4HEME 4EVNA 1U8NB 2NNAB 3GK8L 4AEFA 1G6RL 2WANA 3FT2A 3WD5H 3LRSA 1GC1H 2D3VA 4I4WA 4KQ3H 4PJ5E 1NUFA 3S8WA 2EDDA 3H0TA 3FRPA 1QKZL 3FB5A 5IUSA 4JB9H 4FXGB 5KSBA 1Q1JH 5IW3A 1EHLL 2Y6SC 4OAWA 4ZPVB 3MBEC 4G42B 3MBXL 1NSNL 3MSPA 2NY7H 4HMDA 4LPUA 5L2JB 4N0YL 5SWZE 4POYA 1AY1L 1VHPA 2E6PA 1T2QL 1UXWA 2EDWA 4TSAH 1WEJL 4RMQA 4EI5B 1IAII 3VXNB 2Q6WB 2DWDA 1ZLWH 1Y6NR 4I1NB 4J6RH 1H9VA 1EH9A 1NC4B 3TM6A 1F58H 2XQYK 3QEQE 4S1SL 4JPKL 5E70A 1UACH 4K55A 1CLYL 1XR9A 3BIBX 4PRBB 2E7CA 3D18A 3PWUA 5DHVA 4O4YL 4H5SA 4ZSOB 1P7QD 3TO2B 2KZWA 2YD3A 2BVEA 3GFUA 3MRRB 4L4VE 5FYLL 5C08A 2PR4H 5M7QA 4B0MM 2LVCA 1AP2B 4GKZA 4XBPA 3LEXA 4BFIA 2W9LA 2AK4D 3BE1L 3OV6A 5FGCB 5FCUL 4E42B 3EDFA 4HIIB 1CT8A 3MRKB 1TPXB 3DVGA 4U6TA 4YBLC 1TCMA 2GITA 4CADA 2X70B 4KJQD 3P4OA 5B38G 4JY6A 1E4WL 1WK0A 5SWSB 3BZDA 3B9KD 4JDZA 4FQCL 2A77L 5C8JA 1HYSC 4MXQC 1PG7H 2V9QA 3MUGA 3N1QC 2P7TB 5D7LB 4AL8L 1AGCB 3FB7A 3FO9B 4NQUA 3O11B 4YHML 1U3JA 3SDDD 4ELKB 5EU6A 2GJ6E 2GY5A 4U1SB 1VEPA 2KKQA 4XI5C 4KTEL 3UTTA 3RKPA 4NCC2 1A7OL 4H1LA 2XKNB 1XF4B 4ONFH 2KDGA 4QGYA 3WNLA 1FL3B 3UX9B 4DFHA 1U8JB 3IRZA 4QHUA 4AYFA 2DICA 3NN8A 4S1DC 4OLUH 5EZIH 5ADOH 5D2NE 3ARGA 3QO1A 2DQHL 5DEGB 3RL2B 4B5EA 3CFDA 4G6JH 2Z31C 4KY1H 3RPIA 5C0AD 4GRWB 4ZUWA 3IDMA 1OOAA 4KKBC 3C60D 4O5LH 4QRPE 1KXTB 1YQVL 1A6UL 3KWWA 3ARDD 3CXHK 1NLBL 3BQUD 5TJWK 1UYWL 5CJOH 4FG6D 3WUWG 4OCMC 4HPOL 4I8DA 4A6YA 1MJJA 3LQAH 2HJFB 1P4IH 4R26H 5EUOE 3REVA 1BAFL 1N6VA 2UVFA 4P2QE 3HE6C 1MPAL 4I3RH 1W72B 4W6XB 2VLLB 3C08L 5CEYA 2W9DH 5HD8D 3SJVB 2Z92B 3L1OH 3OKYA 4R4BA 1RIVH 2ZPKH 2X10A 1A9EA 1JHKL 1ZTXH 1I3GH 1EEZA 5MI0C 1FL6B 4M93C 2YN5A 3P11L 4PJGB 5IMMB 1GAFL 4LPTA 1OLZA 3HI1A 2NR6D 2D9QB 4NNPH 3U6RB 1WCBA 4MJ6A 4PGBA 4JFXA 4YBQD 1MRFH 1QA9B 2R4RL 4LVNC 4Q0XL 4GXUM 1DBAH 1V3MA 4XVTH 4LEXL 5BS0A 4XMLL 3ISWA 2NY3B 4UOJA 3BW9B 3IB4A 1BIHA 5CCKH 4G9FE 5HYJA 4P3DA 3W5MA 2R2EA 3HS0A 5SX4I 4I2XE 2WM0A 2EKSA 2QL1A 2X4OB 3DRQB 4MA3B 4WO4C 1BVKA 3VCLB 4Z8FL 3AS0A 3IFNH 4X4ME 3IAGC 2X4NB 1IZJA 4DEPC 3LDBB 2EIDA 4KRPD 4E41D 4HAFA 5JMRA 3IFPB 1REIA 2IAMD 4DQOH 1MWAA 4OIBA 1Z9SA 1JRHI 5ALBH 5C0BD 3DGGA 3KLHD 4LQFL 1I7ZA 3OB8A 3WIFA 1E0OB 4WY7L 4EDWH 3JV4A 3DHJA 1BOYA 5GJTL 3HZYA 1MVFA 4KK6D 2DLTA 1XFPA 4P2OA 2IH3B 3RY4A 1HK6A 5I73C 3E0GA 2C3HA 1WWAX 1HEZA 2BMKA 4P5TC 5DVNA 4NM4H 5JW3L 4KZEH 3ARRA 1TZIA 3P0YH 1ZLWK 3ZTJG 1KCVH 5I18H 3OPZH 5BW7C 5BJTA 3IJSB 2DI9A 1L9NA 3EO0B 5D71L 3MLPA 3PQYA 1LO3H 2X4QB 3HAEB 4PS4H 5ALCL 1O0VA 2EDEA 5D1XD 5F96L 3P9MB 4YC2B 1T20A 4UUJB 1JGVH 2EYRA 4YHOH 2DQGH 3P0VH 5K9KA 1IKFH 3AU1B 1T1YA 3HC4L 3WHE1 1RIUH 2CUMA 2AI0H 5FKPA 4Z0XA 2HN7A 4OCXL 4TULL 5T1MA 4WV1A 5DUPL 4Z5RA 2CQVA 3WSQL 2AK4E 2ED8A 5GZOD 4JKPL 2QKIB 2CKBB 5HTSA 3OAUL 1KNOB 1T89C 2CR6A 3LCYA 4X4XA 1TNNA 2H6PA 3K4ZA 3EOTH 3PWPD 1HHJA 1DL7H 4F7EA 3AVEA 2CPCA 3F7YA 5F1SA 3BVNA 1I1CA 1JGDB 1NFKA 3BPCA 4HF5L 4JZNB 3FFCA 3ZDYE 5HHXL 1YNKL 3L3OB 1YPZE 2VZ3A 3W39A 1CFTB 2VXSL 4WU5B 3BUYA 2L4OA 4UINL 2ADGB 4LVEA 1JNJA 4Q6IC 4EDXA 3QNZB 3KPOA 3QQ3A 2DJSA 3MXWH 3U9UA 1HKLH 1R3IH 1GGYA 4JFOA 3EYSL 2Y36L 4E5XA 3DI3B 2W1NA 3MACH 4Y4FD 1XF2B 3RWGB 5LGJB 2ZP0T 4WNQA 3ARBC 2XICA 1G9ML 2ZKHH 2YMXH 4Y8AA 1I9IL 4LLYB 3ILQD 3SO3C 1KJ2B 2HWZL 2X42A 4OZIB 3V2AR 1IEBB 1L7TH 1X5AA 1FQ9C 1J1XH 4KI5F 1LEGA 2VDMH 4ODWA 3QUXA 1YN7B 2X1PA 5ENWA 4K8RH 3VD5A 4Z76B 3FZUD 2VH5L 5C0AE 5DVOA 3UTSA 1EUUA 4OCYH 1BBDH 1GZQB 4AG4L 2PF6A 3MJGX 4HH9A 2QSVA 4LRNL 1KPVA 3VFWA 3Q1SL 5DJ6A 4X0KB 3FO2B 4OZFB 4PV9A 1U3HC 5KVEH 2H1PL 4ODTH 3H7BB 1QFHA 3T0BA 4KJWC 3EYUH 1ZKAA 4XVJL 1F4YL 2Z93A 1F90L 4ODSL 1PZ5A 3RBGA 3JWOL 4WI8A 4QY8A 3QUZB 4Z7WB 4PV8A 3VXTB 1I9EA 3GSXA 4MZ3A 5C0GA 1J18A 1T6VN 3VMNA 5F7HA 1YMMA 3QR2A 3V6FB 1EEYA 3CNKA 4FQIH 4MA8H 2V7NB 3R8BB 5BV7H 2XNAB 1RZJL 4UB0H 4X80H 1ZA3A 3U4BL 4HUUA 3TN0B 4Q9RL 4HPYH 4WUKH 4XC3H 1A7RH 5C0RL 3KPRB 5ANMB 1YMHB 4XXDA 5I8KL 5LXGH 3S96A 3OXRB 3HNSL 3WIHA 3GBNL 3PE9A 4K94L 4GG6A 5SWQB 3W9EA 1S7XB 3MLVL 4JFEB 3VFMB 3D3VB 3ROOA 4UNUA 2Y1VA 1YEEL 4FMFA 2NNAA 4J2XA 3WN5B 3TV3H 4NM8L 2V5SA 5D2LF 3QQ9C 3WXWL 5EU4B 4QEGA 4FXGA 1UB6B 5C6TL 2JJUA 2DTMH 4ZPVA 4E41E 5JHDB 1IFHL 4G42A 4OFYD 3T4YB 1V3LA 1KT2B 3NACL 5L2JA 1TJGL 3X3FL 3WFCL 3OJ2C 2A6KB 4EI5A 4JM2B 5C0BE 3VXNA 4Z7QE 4KK8C 2Q6WA 4HX1B 3CK0H 5ISZD 4AENB 4R3SB 1MFBL 1B0GB 3CLFH 1MAKA 1NC4A 5HYSB 4EBQH 2OMNA 1QBLH 1IGYB 4PRBA 2BRQA 4JQIH 3BMVA 5C0EB 3UPCA 3K2MC 2H26B 4MAUH 4ZSOA 3MRRA 4C54A 5AZEL 2JIXB 4WFED 2OL3H 4WENB 5EDXA 1MCRA 4R4ND 1X5FA 3CVHA 3C2SA 1FZOB 2F8XC 2DS4A 4E42A 4GMSL 3NMEA 4HIIA 5IB3A 3QEGH 4ZPTB 1BEYL 1ZMYA 1SMAA 5KS9E 2X70A 2ZOLB 4TRPL 1MLBA 4K7FB 3ZYOA 3ARFD 4XCCL 4PGDB 1NEUA 4U6XA 5JIKA 2Q3ZA 5SWSA 1JF1B 2YZ1A 2DQTL 5FXCH 1OAZH 2ARWA 2FIRT 2ZG3A 2P7TA 5D7LA 3FO9A 1IQWH 3QFDB 3O11A 3PWPE 4G6KH 2EIEA 2WIIB 2F19L 4ELKA 3ARQA 4U1SA 2FO4B 4TUJB 1OD9A 3UTPE 1EMTH 4M6MH 1XF4A 2CRZA 1AD0B 2AEQH 1FL3A 1XGUB 1U8JA 1JZ7A 4GAGH 2VDRL 4U3HA 1J8HE 2BHYA 2Z4QB 4IEFB 5BQ7B 4PGJA 5DEGA 3U1SL 3V0WH 4WFFD 1OAKL 3F7RA 4ONGH 4OZGB 1U91B 2B39A 4M6OH 1NCCH 3MGOB 4MNGE 4OGAD 4KQ4L 2YPLE 2RQ8A 3UBXI 4F9LA 2CO6B 5E8NB 3VGDA 3R0MA 1C1EL 1A1MB 4BZ2L 2J5LB 3S97C 1UADC 3RL1B 5DT1H 4APQC 3GJFH 1QFWL 1HKFA 4MCZB 4EIGB 1MIEH 5GS0D 1KJMA 5DRZB 1XZ0B 2AV1B 4IRSC 1QYGH 2QSTA 3O3UN 3I6KB 4YHPB 3LKSA 1W72A 3FOMB 4G6FD 4D9LH 3SJVA 2Z92A 1U8LB 4G6MH 1FE8L 5I9QC 2C7UB 2NZ9D 2NY4C 2XXCB 5IVXF 3T4AB 1ACZA 1RIHL 3RUGB 1ACYH 1UM6H 4X4YB 3KPNB 3QUYC 1FL6A 4LCCC 3NZ8B 4PJGA 4XNQA 4XWOC 1MAJA 3RDTD 5IMMA 2GIYA 1JN6B 5GGUB 4UQ2B 4GAJH 4JFHD 3U6RA 3BMWA 4M7ZB 2FWOB 1VFOA 4MHHG 1QA9A 5D1QB 5MENB 5HGDB 4M7LH 5DEZA 3QFJB 5TFSH 5C9JB 5GZNC 3VE0B 2YA0A 1KCUH 4C56B 1IGML 3VFSB 5L9DL 3BW9A 2V5RA 5EZLB 4LASH 2WP3T 4WWKD 4NDMB 1DUZB 2LQRA 1NGWB 3U0TA 1U36A 2X4OA 1H3WM 3DRQA 4MA3A 5CP7B 5EOCJ 3F65A 3F12A 4OKDA 3VCLA 3UPAA 4OF7A 1IEAB 2PN5A 2X4NA 1WZ1H 1KTKE 3ULUF 1MJUL 3O4LD 4KPHH 1WZMA 4P49A 3X11B 3SQBA 3BESR 4M3KB 3O6FB 2I5YL 3EYOB 2NYYC 3O9WD 4LVOB 3BPLB 2EEAA 1U8PB 3BP6A 3BAEL 2E8ZA 5L7XH 1F3DJ 4BZYA 3NGBB 2B7DT 4UDUB 2IH3A 5F8RC 4YLQT 4HFUL 2BFVH 4ODVL 1EEUA 32C2A 3KG5A 3LKRB 1GCFA 5KZCD 5ITBH 5GGQH 1A0QH 4U1LB 5ISZE 2XA8H 3MLTB 1BMGA 3R4DA 1FNSH 3IJSA 3SDAC 4L8DB 3EO0A 4GRWH 3V4PH 3HAEA 1A5FH 3RTQB 4OCNC 3QWOB 2QSCH 1JWUB 2D4DA 3AU1A 2NLJB 3INUH 3RPKA 4PY8I 1MUJB 3QWRD 1FG2A 1FDLL 5IP4A 4WFEE 3G9AB 4FRWA 2FYYB 4NIKB 1MCFA 4F7MB 1IJ9A 3MLSL 5HVHB 1U3YA 1OTTD 3RZCC 3F58H 4KC3B 4MJID 3DHMA 3I9GH 4ODBD 2CKBA 4QRTB 1KNOA 4XPAL 1OTSD 3SQOL 2G9HB 5E6IC 1HOCA 1W72H 3UJTH 1TQCC 5L0QC 5F7UA 2YC1B 4OF5A 1ZHLB 4KI5D 4JZNA 3QEUB 2NY2C 4Y5VC 3L3OA 4KUZH 4GBXB 2Y06H 1KIQB 1CFTA 4WU5A 4LLDB 4KROC 1EJOL 3ZDXF 1FPTL 2X9XA 1Q9OB 4PJ5B 2ZG1A 1S5IH 1BLNB 3RWGA 5LGJA 5JHLH 1BECA 2AK1H 4G3YH 3MXVL 4LLYA 4P2RD 4X98B 1KJ2A 2AP2A 1OM3L 1IM9B 1IEBA 3P4MB 5FUOL 5SWZB 3SKOA 3QDHA 3QCTH 1QLRB 4XB7A 3GSWA 3FB6A 1VEMA 4X7TB 5JOPE 4WFFE 3QEQB 2JJTA 5E2VH 3MCKB 1GZQA 4UV4H 4L4VB 1BOGB 1DANT 4X0KA 3FO2A 4OZFA 4TTDD 2F5AH 2MQ0A 5DVMA 3H7BA 1DLFL 3WNNA 3GJFK 1WF5A 3BT2L 4GQ9L 4QWWC 1TZGH 4KWUA 1BJ8A 3MNZB 3BKCL 4XTRC 4NQCE 3QQNA 4AQOA 1UJ3C 5HGBB 3QUZA 4TSCL 2DQDL 4Z7WA 3VXTA 3CZJA 5F1IB 1BWMA 2HFEB 4LHUB 3PHOB 3ZYJA 2ADJB 5IK3B 3RGVA 3OX8B 3BISA 5E99L 4K7PL 3DROB 4CN6A 3V6FA 1NFDA 2EYTB 3K3QA 3FO1B 2BZDA 2FD6L 2XNAA 3WFDH 3BP4B 2GJ6B 3N06B 5FFLA 4NP4H 3EHBD 4K07A 4JFHE 3TN0A 2GTZA 4DGVL 1WIOA 3KPRA 5ANMA 1YMHA 1CXKA 2CLZB 1NGPH 3HUJF 2V7HB 5DFVD 3OXRA 5I1KH 3RVXC 2B5IC 1IAMA 5D2NB 1XR8B 1F3JB 4HFWB 5SWQA 4JFEA 3VFMA 1M7IB 3D3VA 3GJEB 3KS0J 4HIHB 4U1NB 3WN5A 3IFLL 2PUQT 3ROLB 2UWEF 3DETC 5FGBC 3CXHJ 1CDBA 1MCKA 4QRPB 5TQ2L 3RFZC 4G8GE 3CVIH 1UB6A 5LQBL 1GHFL 3L3DB 2H32H 5K9OB 3S88H 2EXYC 5JHDA 3S35X 4FQ1H 3T4YA 1G9NC 5EUOB 4X7EC 4JZJB 4HLJA 1RZFL 1CDHA 3KPSD 2A6KA 2JELH 2Y07H 4P2QB 4PRIA 4JO4H 4AENA 4R3SA 3BDBA 3CJJA 1B0GA 1J8KA 1CI5A 5HYSA 3DOSA 4Z7OF 1KJ2H 4WI4A 1IGYA 2VLJE 3VXSD 5DYOB 2A73B 3O6LL 4JREC 2H26A 3HA0A 5AD0B 1RUML 2JIXA 4TPRH 3AS2A 3ARXA 4K3JL 4NUGL 1FZOA 4YHIB 2HT2C 1BX2B 2D0GA 4QHKJ 3TP4A 1SM3H 2OX5A 4ZPTA 4OZFH 1TETL 3CMOH 2NTFB 2X1QA 4U6VL 5CGTA 2ZOLA 5GS0L 4NZUL 4K7FA 3H9HB 5CILH 4YDKL 1XGTA 3CCHB 5IV2B 4FXKB 4PGDA 4G9FB 4LKCB 2E9IA 1L0YA 2X09A 1LDPH 3HE7B 3VA6A 1E6OH 8FABB 4MJIE 4I2XB 2PO6D 4Q7DA 3MV8D 4RAUB 4RMTA 4UAOC 5IBTL 3LMJH 4HWZB 3KJ6L 3QFDA 1JPTH 1NMCB 4FA8A 5C09E 2WIIA 1A21A 4JN2B 4XNMA 5JIHA 3VI3E 4EEEA 2MNUA 2YD7A 4TUJA 4KI5E 3UROR 4Y2OA 2DN7A 1N7MH 3DUHA 1AD0A 1XGUA 3WNOA 2Z4QA 2ZZUT 3VXOA 3FRPG 3KXFD 3EJJX 5H94A 5BQ7A 4LSRL 2ARJQ 4HKXB 3SDXE 2ZUWA 4OZGA 1U91A 3BKYH 1G6VK 3MGOA 3PABB 3HZKB 2ICCA 1RUAH 2X4RB 5LVEA 3BH8A 4N8VB 3GIVB 4B7LA 1BBJB 5E8NA 2HJLA 1XH3B 4DW2L 1A1MA 1CGWA 1RFDL 1PZUB 3BGFB 3QDGD 1SY6A 3DUUB 2VZSA 3T2PA 5BMFH 2AJVH 4X9FA 3JWNC 5D96C 2ZOKB 4P99A 4KHTH 5DRZA 2Z8SA 2AV1A 4JO3L 3DLQR 2L7UA 4U31A 4YHPA 1P7QB 4XZUB 1I1FB 3FOMA 3BEVB 3LN4A 2YD9A 1U8LA 5K93A 3ES6B 2C7UA 3T4AA 4LP5A 2F58H 1P4BH 1FV1B 3RUGA 4YUEL 5D6CB 1NPUA 1QFUL 2AK4B 3VXRA 4X4YA 4OZ4B 3KPNA 4D0BB 1P5VA 1EBPA 3NZ8A 1MCNA 3KNBB 1INEL 3DYMA 1JN6A 3FQXB 1RUPL 1JTPA 1K6QL 5GGUA 4UQ2A 5LCVL 5F1KC 3GI9H 1RHHB 1D6VH 5HDBF 4IMKA 3UJIH 2FWOA 5F3BB 1YPZB 3B9KB 5D1QA 3AM8C 5MENA 3F6IA 5DA4A 4WHYG 4Z77B 4POZC 5HGDA 1XCQB 3QFJA 5C9JA 1WAAA 2YD8A 2Y5EA 3VE0A 4C56A 3GBML 3VFSA 1P6FA 4XNXL 1UCTA 3GBLA 5EZLA 1GL4B 4PR5B 3U83A 5GRVL 1L7IL 3SDDB 4YPGB 1LE5B 2D4FA 1DUZA 2YKLH 3F6LA 1NGWA 1UWGH 4H1LG 5KG9B 2WUCL 3OR6A 1MHHB 1CXIA 4LCUA 2NXYC 5ICZA 3DPBA 4M6NH 4NJ9L 3MGTB 5HSFA 3V6OE 3PF2A 1TJHH 1IKNA 5HBBA 4MXVF 3X11A 3BZEB 4OLXL 4N0CC 1EGJA 3O6FA 2VERN 2AW2A 5KBNC 3EYOA 3BDYL 3NA9L 5C0AB 4NQSB 4ESKA 1CF8H 2BY1A 4XCFL 1U8PA 1F4XL 5ESQB 4JPWH 3GUTB 1KB5B 3GSVB 3C60B 3DRTB 4PPTA 1GGIH 5E7BA 1U58B 3ARDB 3WNPA 1A8JH 4X6CF 5I75B 1MCDA 1TFHA 3BQUB 4K23H 4UDUA 3K80A 2XACC 2AJ3B 1J1OL 2J6EA 3EOYG 5I74C 5IBLD 3LKRA 1S7UB 3GSOB 1U8KB 4U1LA 5DQJB 3MLTA 4NC1C 5IWLA 5JDSB 3IETB 3BRDA 4L8DA 6CGTA 1CLCA 5I71B 3H8NA 4UI2A 5IHLB 2YUZA 1U6AH 4YHLH 4KUCF 1O5DT 3RTQA 1FO0H 4F15C 3QWOA 1NMAL 3VXSE 4M7KL 1JWUA 3WLWC 1W0VB 2NLJA 5FGRA 4BYHA 1MHCA 1MUJA 1DCLA 1EX0A 1HINL 1I7UB 5EU3B 1OWWA 1CG9B 2B1AL 1RSFA 4PB0L 3LN9A 2FYYA 2CMRH 2OZ4L 3LIZL 5EOQL 4F7MA 4FQJL 5DI8B 4JRYD 3RVTD 1MCWW 4OM1H 1A4KB 4JR9H 2G9HA 5FUZL 5ICYB 4OV5B 2Q1EA 4OLVH 3DX7B 2ICWJ 4DFIA 5IHUH 4M3JA 2YRLA 2YC1A 1ZHLA 3PP4H 2D7TL 1LO4L 5FYJH 3ZE1F 5L6YH 3IVKB 3QEUA 5F1NB 4GBXA 1E27B 4ZOBA 3MLZL 5IM7A 3JWDH 1KIQA 3S5LB 4LLDA 3MV8E 4NSKA 4M1GL 4GQPH 5F9WC 3WE6A 4MVBD 5FUCC 1ZANH 4PJ5A 1N4XL 1NDMB 4PJIA 2ED7A 1BLNA 3GK8H 1G6RH 1I1YB 4LVHC 1DQTA 4KRPB 5JIIA 4QNPF 4E41B 4XX1E 2FBJL 2HFTA 4NQTA 4NWUL 2BY3A 3LZFH 5E8PA 4X98A 2IAMB 1QKZH 4Y0GA 1IM9A 3HI5L 3P4MA 4BSJA 4PJEF 2VMFA 1EHLH 4ZOAA 5FGSA 4JN1L 2Y72A 1QLRA 5C0BB 5DMYA 1NSNH 4X7TA 5HI5D 1X9QA 1ZA6B 5DC9B 3MRQA 1GGCL 1KPUB 5I8EB 2QJDA 3QEQA 4N0YH 4GRLC 4ZD3L 1AY1H 3C6LC 1RK0A 5IVXE 3RX7A 1I1AC 3ZTNL 1WEJH 4L3CA 4M8VA 3NIFE 3MCKA 1HH9B 5IG7B 3LSOB 3ET9F 4P2OC 4JFFE 6FABL 3Q0HA 1MCOH 4S1SH 3MUZ1 1ORQB 4JPKH 5K9QG 2GTWB 4HWEL 2X4PB 1CLYH 3L9RB 3OAYH 4XMKL 4B7IA 1J1PH 3QDGE 3FQUB 5D1XB 4N5UA 5FYLH 1RU9L 2IFFL 3C09C 4J8RB 3N9GL 3TZVD 4NJAL 4Q2ZB 5HGBA 5KS9B 1OGAD 3PWVB 2VZUA 5F1IA 1MCWM 3BE1H 2C3XA 2BC4B 2HFEA 4LHUA 4RAVB 5JZ7D 3PDOB 2ADJA 5IK3A 2VN4A 3OX8A 4GOSA 3HTLX 1ZWIB 2R0KL 3DROA 4QXTA 3NIGE 1AH1A 4WV1C 3VWJD 5DHYB 2VE6B 1E4WH 5GSVB 3PWPB 4KKLD 2DBLL 2RCSL 2DMBA 1C5BL 4QHNB 3BYYA 1RZ7H 2A77H 3BP4A 2GJ6A 3OG4B 1XGPA 4NBZB 4QRUB 4AL8H 2HKFL 2V7HA 4I18C 3QDMD 4CRPA 4U6YB 3PWJB 2FLBT 4CKVX 4N1CA 4DAGL 5E8OB 4KTEH 5H35B 5D2NA 1AE6L 1XR8A 1F3JA 4HFWA 1A7OH 4U0RB 4KK9D 5EOTB 4XVSL 5F88B 3GJEA 4HIHA 4NZRL 4JEGB 4Y4FB 1KGCD 2JCCE 4S1QL 4U1NA 2N7AA 3VRLF 3ROLA 1WUNT 5MP6L 4MNGB 5BXFA 1VPOL 2YPLB 1CR9H 1C7SA 2DQHH 1QPPA 4QRPA 4XPGH 4P48A 4NHUB 5FOJA 3L3DA 5K9OA 1WFNA 1CE6B 5B4MD 4MHHI 5FKAB 1YQVH 4N5ED 3QXWA 1A6UH 1MFAL 5EUOA 1TJIH 3VFGL 3QUXC 4PJCF 4G6AC 4QRQB 1NLBH 3GI8L 4P2QA 1T2XA 3G5ZB 1INQB 4HPOH 1KV3A 1M05B 1FYTD 2H45A 3VU2A 4IRJA 1BAFH 2D7OA 1N64L 1IAIL 4LU5L 1HXMB 5FV2A 2A73A 2W60B 3HB3C 3C08H 5AD0A 1AR1C 3GMRB 3IDYB 5AYQA 1FRGL 5E5MA 5CEZD 4KMTL 3GHEL 3UBXB 5DLML 1JHKH 4YHIA 3HZVB 2VISB 1BX2A 3P11H 4PP2B 2WAHA 2VKXA 1GAFH 1RK1B 4QLRA 2ADFL 5CBEA 3U46B 4Y4HD 4AEHL 2NTFA 2EDTA 5F7FA 3H9HA 1C5CL 1GGBL 3CCHA 5IV2A 4FXKA 2R4RH 4OM0H 3QZWB 4LKCA 3PL6D 5IHBA 3DSNA 3HE7A 5CKAA 4JRYE 4LEXH 1WQVT 4OT1L 8FABA 4XMLH 4HJ0D 4I2XA 4PJHF 5IBUG 1QSZA 1P5UA 4HWZA 3VGAC 4PGEB 1K4CB 3X14B 3F5WA 1BZ7B 4QT5B 2EYSB 3ZE2E 4LDLB 4JN2A 1I4FB 3MLYH 5TQ0H 1B0RB 1T22B 3MRNB 1DN2A 1PKQE 4Z8FH 3LV3B 3RX8A 1WFUA 1YNLL 5DSCA 3MRJB 2ILLA 5F7EH 4MXWL 4R96B 2QEJA 2ZUYA 5KSUB 5LJYH 3RIFK 5FF6B 3O4OB 3OKKB 2Q76B 1SYSB 4X8JB 4ODHL 4WW2B 3PABA 4LQFH 2X4RA 3UZVB 2K1MA 1MCEA 4WY7H 3GIVA 4HBQA 4Y2DD 5GJTH 1XH3A 1SBSL 3DGCR 5ISZB 1BWWA 4OI9A 4ZFGL 4G7YL 3DUUA 3MTRA 1JZ5A 4EI5C 1LD9A 5CJQH 2P8PB 2YN3A 4JCMA 4TOYL 1KCRL 4OLYL 3QUML 5B39B 1P7QA 5D71H 4MQSB 3BEVA 3OAYK 2WUBL 4XPHL 1N3NB 5F96H 2C3VB 3ES6A 5BRZD 4CMHC 1FV1A 3LHPL 4W6YB 3HC4H 5D6CA 2AK4A 2OR7A 1XCTB 5M95B 4OZ4A 4D0BA 2BVUA 1M7XA 3HUJE 1NCUA 4HZAA 2VN7A 4OCXH 4TULH 5GS1B 3KNBA 3EZ8A 5DUPH 4Y1AD 1OGAE 5TE4H 1F02I 3WSQH 1RHHA 1KIUA 1MELA 4JKPH 3ARFB 3ARYA 3OAUH 5CINL 4ETQB 5F3BA 1YPZA 3B9KA 2AXFB 1ZVHA 4Z77A 1T1XB 3U4EB 1XCQA 4R4FL 9CGTA 4OD3L 4HF5H 5D7JD 4ZTPL 5EG6C 1DANU 4OF8A 5HHXH 4PR5A 4YE4L 2NY1D 5ESVB 5HHNB 5C0IA 3SDDA 4YPGA 1LE5A 2VXSH 4HMCA 4UINH 4WFGD 1EAJA 5KG9A 1KENL 1MHHA 4Y7MA 5IMKB 1KYOK 3QDME 3T0ED 2VLMD 3EYSH 2Y36H 2I27N 2QV2A 3MGTA 2X9YA 5CBAB 4F7PB 2MMXA 1G9MH 5CD3B 5GGTA 7FABL 3FKUS 4N90D 1I9IH 3GSNB 3DXAD 1T80A 2R23A 2OYPA 2HWZH 4CVZB 1KGCE 4Z7OE 1YYML 3IDGB 5C0AA 4NQSA 4RX4D 1QBBA 4AK1A 4KUCD 5ESQA 1AIFB 3GUTA 4PRHD 1KB5A 3GSVA 3C60A 3DRTA 4XH2B 1SJHB 3TT1H 4K7PY 1U58A 2H3NB 1FZJA 3ARDA 3UPRA 2DL9A 2BNRD 3BQUA 3ECBB 4J3SA 4CDHA 5I6XC 4F9LC 2JKXA 1HZHL 4AG4H 5IMOB 4N1HB 2AJ3A 1KUMA 3GRWL 4LRNH 5I0ZA 3ZDZE 3SY0A 3Q1SH 5I1CL 1S7UA 2MPAL 3GSOA 3DX6B 2H1PH 1U8KA 5DQJA 3TWCL 5JDSA 1D6EB 1KEML 4G6FB 4XVJH 1FYTE 4JANB 1F4YH 4OCRL 1RUKH 1B0WA 2A6IA 1F90H 3M17B 5EUKB 4ODSH 2DKUA 3E2HC 4XP6L 3JWOH 2HVJB 4PRPD 4UILL 5D1ZC 2AAVA 1W0VA 1K8DB 2PCPB 5HGHB 2XG5A 4FFWC 3RGHA 3TJEL 5EU3A 1I7UA 3B5TA 1O7SA 4BQBA 2BVOB 1CG9A 1BGXL 5CEZE 1A7NL 1DVFD 5C1MB 2IPUG 5DI8A 3LEYL 5DD6B 3DYOA 4PG9B 2P8LB 4DKEL 3TBTB 5ICYA 3RKDD 4OV5A 1RZJH 3G04B 3DX7A 3U4BH 5EIVA 1F2QA 3PHSA 3BP5B 1NUDA 5DA0B 1INDL 5C0RH 2I25N 3IVKA 3BN9C 5F1NA 4WWKB 5I8KH 2W0FA 4J3XA 3NCJL 4PP1D 5I2IB 3HNSH 3S5LA 5AUMB 4MLSA 3GBNH 4NN7B 4K94H 4RGNC 2VO5A 3MLVH 5IFAL 5TGBB 1RZKL 3O0RL 3PGDB 1YEEH 1GYAA 1KN4L 1UGNA 5KW9L 3EFFB 3FN0L 1I1YA 3O4LB 4NM8H 1ZLUK 2JLLA 4PJBE 2LU7A 4E41A 2OK0L 1QFOA 2DB8A 2J88L 2E7LA 3T0WA 3WXWH 3IAPA 4LFHG 2IAMA 3R0NA 1D5BA 2GUOB 3O9WB 3MJ9L 5C6TH 1A6AA 5C0BA 4Z0BL 1IFHH 1QPXA 1ZA6A 5I8EA 4NNYB 3NACH 1TJGH 3RA7L 3X3FH 3WFCH 3JVGC 3CDYA 4GRWF 4XB8A 1BJ1J 1MFBH 1HH9A 1R3HB 2VC2L 3IXTB 3LSOA 5IG7A 5DK0B 5KZCB 2QLVB 2GTWA 2X4PA 2Y6SD 3VD4A 1ZT1B 3HAEG 1S5HB 3MBED 2YD1A 4YXHL 3FQUA 4EUPH 5D1XA 2H2SC 5AZEH 4J8RA 1A02N 1C16B 4Q2ZA 5KS9A 3BRGC 4PJFA 3PWVA 1IAKA 4YEEA 2BC4A 4GMSH 3PDOA 2YK1L 5BRZE 1BEYH 1A47A 2A1WL 1YEJL 5FA4B 1TQBC 2OBGA 4MJIB 1ZWIA 3G6JF 4TRPH 5IKCB 3S7GA 2JK5B 2VKWA 2VE6A 4XCCH 5GSVA 1G0YR 3L7FA 3PWPA 1AGEB 4Y1AE 5C09B 4QHNA 5CEZL 1TVBB 3E8UL 1FFPB 3ZL4L 1EEQA 1HN1A 4KQ3L 4MXVE 4QRUA 5TDPB 5CGMA 5T5NG 1A4JB 2F19H 4U6YA 3PWJA 1I8IB 2NX5D 4LBEB 1U93B 4YPJA 4N0RA 5E8OA 5H35A 5EOTA 5F88A 3C8DA 5HYIA 3SDXB 4Y4FA 2VITB 4WFGE 1HYSD 4MXQD 3WHXA 4TSAL 3D0LA 4FFYL 2EXWC 4MNGA 3RJDA 1AGFB 3T0EE 2X4SB 2VLME 2O5XL 2I07B 1S9XB 4UBDD 2EDRA 5EC1B 3QULB 1F58L 3U1SH 1OAKH 1YJDL 2VQ1A 4NO5B 4G5ZL 4NHUA 4N90E 4XI5D 4WTXA 3DXAE 3BRFA 5MEPB 1R6VA 4KQ4H 5FKAA 1CGYA 5DQ9B 2PR4L 1ZVYA 5FO7B 4S1DD 5EPMB 1C1EH 4LRIC 4PRHE 4QRQA 4BZ2H 3DNKA 1INQA 3ZZ1A 2XTLA 3VFVB 1M05A 2MCPL 5J11C 2BNRE 1QFWH 2Z31D 4D94A 4AMKL 4XPBL 4RRPA 1HXMA 5E2JA 4X5WB 2W60A 4KKBD 1JNHB 3GMRA 2X9WA 3OKLB 1CQKA 5ACMA 2VUYA 1FE8H 1G9EA 1FGVH 1GH7A 5F9JB 3UBXA 3T65B 1RIHH 1OAQH 3ZE1E 3HZVA 3PV7A 2VISA 1W8NA 4JVUA 4PP2A 4PRPE 1TLKA 3BD5A 3TNMB 1DE4B 1RK1A 3RZWA 4BJLA 3D9AL 3U46A 3HPJB 3RGVC 3HE6D 5D2LB 1KCLA 1J87A 1U8OB 5CKGA 4N0FA 5DR5L 3QZWA 3Q5TA 3NABL 3QG7L 4QNPE 4L9DA 3G08A 4QOKD 3MNWB 5L9DH 3TN0C 4PGEA 1K4CA 2DIBA 5DJCB 3RY6C 3X14A 5FV1L 3TGXA 1BZ7A 2UY7A 2EYSA 4PJEE 4QT5A 1W0YT 3UTZA 3CXDL 1I4FA 4IIQB 4W70A 2E9WA 4TVSa 1T22A 3MRNA 3T77B 1ZHBB 4O5LL 3LV3A 3MRJA 3WN5C 4HUVB 4LNVA 3WKNA 3P77B 1Q72L 3MJ7B 5KSUA 2HT3C 2I5YH 1IL1B 3OKKA 2Q76A 2VL5B 1SYSA 3BAEH 2VTFA 3RI5K 3EDDA 4OFYA 3WDHA 4AY0A 5E6ZA 4V1DD 4A2MA 1GXEA 4OZIF 3V5KA 1A7PL 3MNVB 1FORL 3KPSB 4DVRL 1LO5B 3T2QA 4M1DL 5ISZA 1NCDL 1CGUA 5HYSG 1K5NB 1ZTXL 3MA7B 4ODVH 1I3GL 4GS7B 5GSRB 5LGKA 1Y6KR 4WGVB 3JSSA 2P8PA 5ABDE 1B6DA 1WITA 3VXSB 5B39A 4NNPL 4JFZL 3VFUB 4PJ7E 1CBVH 1T0PB 1MRFL 4HWBH 1K3IA 1AD9B 3LD8B 1P69B 1OSZB 2A38A 1XCTA 4QTIL 4P5TD 1FDLH 2YRZA 4XPTL 1QHPA 3MLSH 4X8XA 3BD4A 5EN2B 4BK5A 3V4UL 4WTZA 4XPAH 1HHKA 1PFCA 4C57C 3SQOH 5F7YC 4FNLL 1LHZA 2AXFA 2D7MA 1T1XA 5D93B 3V6ZB 3U4EA 3CIQA 2PO6B 3MV8B 2VXQL 5GRYA 3GSRB 1D5XA 1AKJD 1IRAY 2AJZB 4ENEC 4J3OC 5HHNA 4GH7B 1FFRA 5IB2B 3O45B 2F53A 4NZTL 4RFOL 1EJOH 5JDJA 1FPTH 4YR6B 4F7CB 5IMKA 5F7MC 1UEYA 5J1AB 3CAFA 5IW6B 3WO3B 4RGMC 2NX5E 2A0LD 5CBAA 4F7PA 1S3KL 5CD3A 1R5IB 2D7QA 3L3GB 3GSNA 4XP9L 1RZ8B 5KOVC 4CVZA 4LSQL 1KTDB 3PIQB 3QHFL 3P0YL 3IDGA 4I13B 1GZPB 5IVXB 3O3EB 4J3UA 4HIEB 4K9EL 1AIFA 3M1BB 5GS3A 3WIIH 1SJHA 3EJZC 1T1WB 1L0XA 5IFJB 2DQUL 2EDJA 3ARBD 4HIXL 4YHOL 3ECBA 3KYMB 3BH9B 1X6NA 3QDGB 3P40A 5IMOA 3LPFA 5JR1L 4JY4B 1GIGL 5FHBL 1ODAA 4FFVC 1S8DB 3CFIC 2PKDA 2OXHA 4JM2F 1X5GA 1ORSB 2P45B 1DLFH 3BT2H 4GQ9H 2HYMA 2R69L 1D6EA 2XFXB 4JANA 5EUKA 3M17A 1TTUA 3HNTL 5C0JB 1VFAA 1QLEL 2HVJA 5C2BL 1CVSC 1DL7L 3LH2H 3H7LA 4TSCH 4DKDC 2PCPA 1K8DA 2DQDH 4PJHE 5HGHA 4CDGC 2HMID 2WBKA 1MIMH 2P24B 4IS6A 4OGXH 2BVOA 3RDTA 3UCRA 1U3HD 4P5KB 3NFSL 1S9KC 4K7PH 1S78C 1KCSL 2P8LA 3CSBA 2CUHA 3LB6C 4XNZC 1R3IL 1MCPL 4JAMB 2DRUA 3TBTA 2FD6H 3G04A 3MACL 5I1DB 2VSCA 1EJ6A 4X9IA 5D1QC 3BP5A 2ZKHL 1YY9C 5DGRA 1PDKA 1A2YB 3OR7B 3MR9B 4WWKA 5DRNB 5I2IA 5AUMA 4ZFZA 2W92A 4QOKE 4P9HC 2E9JA 2R4SL 1MVUB 4F58L 5TGBA 2ZUTA 3PGDA 3IFLH 2LTQB 3O4LA 3BHBB 2HFGL 2B4CC 4URTB 2CD0A 5TQ2H 8CGTA 2GUOA 3O9WA 1QQDB 4WWID 5LQBH 5KVEL 1JYWA 1GHFH 4F33A 5E00B 4FABL 1J7VR 4LVOC 2VXUL 4NNYA 3RIAK 4ZUSB 2CRYA 1RZFH 3HG1D 4L8BA 1JF5A 1YC8A 3EYQC 5JNYB 4V1DE 3QQ9D 5I19L 3IXTA 2E27L 4Q9QL 5DK0A 3BEWB 1BP3B 3MMEB 1FYHB 5B8CB 3G5XB 1ZT1A 4KHXL 1S5HA 3V5HB 3O6LH 1RUMH 3QJHB 4NYLB 5IWLC 3RNKB 4P57A 3ZT6A 2BERA 1GOFA 3SDYL 4K3JH 1C16A 1AGDB 4KK8D 1ROWA 4ZTOL 2A9NL 2A9ML 4CN4A 1SVZA 1B4JL 5IQ9A 5FA4A 2XA3A 1TETH 4JRYB 1OQXA 4MJIA 1HSAB 2D2OA 4M9OA 4U6VH 1KLUB 4NZUH 3EZJB 4YDKH 1G7QB 2JK5A 3HR5B 4HBCL 5F6IB 4R7NB 3GKZA 3O3BB 4Y16C 5IEKB 5EO0B 1AGEA 1A3RH 4UTBL 1TVBA 1FFPA 2MKLC 5D7IF 5IBTH 1OWRM 1PKQB 3KJ6H 4PLKC 1A4JA 3HRZB 3T2OA 1I8IA 2WZPD 3RIFF 4LBEA 1U93A 5J13B 1XMWA 3L6FB 5A2LH 4JFYA 1UT9A 1SEBB 2VITA 4LSUL 3FT4B 5FAAA 5DVKA 5F7DB 2GSIA 4GUPA 3VA2C 1AGFA 2X4SA 4P2RA 5KSAD 2I07A 4LSRH 1S9XA 3QULA 2WP3O 4R0LB 1F11B 3NBNA 3CZFB 4NO5A 1OVZA 5DJDB 3O2WL 4XRCB 5MEPA 5GGRB 2NXZC 2J8HA 1H3PH 1FSKC 5DQ9A 2AGJL 1IC5L 1CS6A 5FO7A 1X3DA 4DW2H 3B9DA 5EPMA 2C4FT 4KMQA 3VGBA 5FA3A 1RFDH 4PYHA 3VJ6A 1YY8B 1FC2D 1UZ6F 1H15B 3VFVA 1K4DB 4FQ2L 1KOAA 1NGQL 4TUOB 4RMVA 4PB9L 1EZVY 1FP5A 1H5BB 4W4NA 4JO3H 4HLZH 4X5WA 1GGTA 4Y19D 5I1EL 3MROA 4DUVA 3HUJB 3L3HB 3OKLA 4F37K 3TZVB 3SKJL 2AERT 2H9GB 5LWYH 1G7PB 3ZHDA 5F9JA 1A6VH 1OGAB 4KDTA 4LHUG 3TA3C 4YUEH 1QFUH 1ETZB 1KULA 2ATPB 4APQD 3TNMA 1INEH 1DE4A 3O2DL 3DIFA 1RUPH 5LCVH 1K6QH 4IRSD 3VWJB 5D2LA 1G7HB 4KJYB 1U8OA 4DUWA 5KJRL 4PJ8C 2AEQL 1WGOA 3AS3A 1S7QB 5KTEL 4CU6A 5JUEL 2NY4D 2J8UE 3BIKB 3DMMB 3MV7D 3GBMH 4MGXA 3MNWA 4XNXH 3DUSB 1LP9F 2EE6A 2XTJD 1MSPA 3QDMB 2AABL 3MJ8B 2FX7L 1L7IH 4XWOD 5DJCA 4H26A 4Q74A 3V6OA 1AFVL 2WUCH 4CVXB 5EZJB 1NCCL 4Q6YA 3VGGA 2AXJA 3TPUB 3T77A 1ZHBA 5A3IC 4NJ9H 3F7VA 4FQXC 5J9PB 4KGLA 5ESAB 5IOPA 1NAML 1OTUC 4TSBL 1I9JL 4HUVA 1A14L 2FSEA 4OLXH 3P77A 3MJ7A 1S7WB 1FNFA 3NA9H 2OTPA 2NY0D 4OIIL 3HHRB 3QISA 3MYZA 2VL5A 1F4XH 1QUNA 3V5DB 3QNYB 3NCBB 1ZGLM 5HHOD 3MFFA 1YECL 4LMQI 4YFLI 3KPSA 4YHKH 1LO5A 3K4DA 4FZEL 1QOKA 1K5NA 3MA7A 1J1OH 1T1ZB 1FYTB 1VENA 2M26A 1JWSA 4O2FB 2NYYD 3HG1E 3U9PL 2QR0B 3SE3C 3VXSA 3G6JE 4K7PX 2P43B 3VFUA 2G2RB 4IRJC 1BFOB 3DTXB 4M8QB 2DQJL 2QQNL 1U3ZA 4M7LL 3B83A 1NMAH 1XF5B 2YD2A 4M7KH 5DD1H 1AD9A 3VW3L 1KCUL 1OSZA 1RPQA 1AGBB 1WFOA 2F8VA 1HINH 1YDPB 4LASL 3T08A 4YO0B 4PB0H 1MREH 4Y4HB 2OZ4H 3LIZH 4QCIB 5EOQH 3QIWA 4FQJH 5CAYB 5EN2A 3SDAD 2W0PA 3BIAX 3QBTB 3KPQB 4P4KC 3X3GL 2WK2A 3PL6B 3V6ZA 2G75A 2PO6A 3MV8A 2DQIH 4AEEA 3GSRA 2D7TH 1LO4H 1UQSB 2EH7L 2AJZA 1JF6A 3MLZH 1R0AH 3O45A 4HV8B 4ZMAT 1MFEL 4U3XA 4NKMA 4AT6B 3RZCD 1CYGA 4M1GH 5E94B 1NMCC 1CDGA 4YR6A 4OCLC 4XP1L 3AB0B 3CH1B 4OCWL 1ZHNA 1UM5L 1N4XH 1LO0L 5E6ID 5J1AA 4P9ML 5IW6A 1LWRA 5E4EB 3FHAA 3KXFA 1AHWC 1ERNA 2QTEA 5ACLA 3GZKA 2FBJH 4NWUH 5I1JH 3KPTA 1RZ8A 3F7QA 1KTDA 3PIQA 3HI5H 5L2KD 3ZT7A 4KROD 1WBZB 5IVXA 3O3EA 4HIEA 1E4XI 4JN1H 5GGQL 1DSFL 4ZO9A 3M1BA 2X1XR 1RURL 4UT6L 4HGWB 1T1WA 1GGCH 4Y2DB 5IFJA 5JW4M 4HCRA 3KYMA 5JA9A 1WZKA 4XP5L 3BH9A 3QDGA 2CDGB 4BKLB 3MZTA 4G9DB 5DJ0B 1M1SA 4JY4A 6FABH 4LCIL 1TVHB 2EDOA 1S8DA 3BGFC 5C07D 4XMKH 1EIBA 2J4WL 2XFXA 4P2CG 4ZFOL 4F9PA 5EO1B 1RU9H 2IFFH 5CMAB 4NN6C 5BRZB 2J3SA 5C0JA 3N9GH 1I85A 4NJAH 5J56B 1EAPB 5F7KC 3QA3B 1A6PA 1PG7W 3BGMB 2PW1B 1E6JL 2P24A 3WO4B 4I3GA 3GMLB 4Y1AB 3HZMB 4RA0C 3TFKC 2R0KH 4O9HL 1VESA 4QWWD 4JAMA 4NOBA 2DBLH 4XTRD 2RCSH 5I1LB 4MNQD 2ESVA 5I1DA 1JMXA 4OQTL 1BFVL 4FP8L 1CFSB 5D7JB 3DVIA 1A2YA 2NY1B 4BUHA 3MR9A 2HKFH 2XOTA 5DRNA 3TBVB 1PGRB 2VB5A 3VG0L 4NCC1 2X40A 3ARPA 3MV7E 1RI8A 4GW1A 4EXPX 5FB8B 4DAGH 3B6SB 1T5XA 5AZ2L 3RWJA 1MVUA 2XTJE 4XVSH 3T0EB 4LP4A 1A3LL 3P9WB 3KVQA 4M03A 1N5YL 4MQXD 4S1QH 3QH3B 5DD3L 4DN4L 5E2VL 4PGCB 4FQLL 3BHBA 2Q3AA 3DXAB 1VPOH 4XPFL 1CDCA 4GKSB 5ETUB 1YEDB 4YX2H 4OFDA 3RVXD 2FH8A 4BSWB 5F44A 1QQDA 2Y9RT 2IMNA 4PRHB 3WJLA 4HXBL 5E00A 2M8XA 3L3JB 1RZKC 3VG9C 1JMZA 1MFAH 2BNRB 3AFLA 3MODL 3KJ4B 4ZUSA 3VFGH 4ZUUB 1Q94B 3SDCC 3GI8H 5FYJD 5JNYA 4ODXB 1H0DA 2APFA 5HHOE 1N8ZB 3BQUC 1B88A 4FG6C 1WBYB 2HJKB 2ICWB 3ZT5A 3BEWA 1FFNA 1NLDL 3MMEA 5B8CA 1IAIH 1YEGL 3G5XA 4LU5H 2X4TB 3O3AB 2Y7QB 3V5HA 3X12B 2G5BB 3RWEB 4DN3L 3QJHA 4NYLA 1FRGH 4PRPB 3RNKA 4KMTH 3RQ3A 5I71C 3GHEH 5HD8C 1UZ8B 4CU8A 5DLMH 1AGDA 1FVDB 3JV0A 3NCMA 4KXZH 5C7XL 5E9DD 4LEOB 3OSKA 3D87B 5L8LB 2DJ4A 1DVFB 3U48A 4HS6B 3UZQA 1QR1B 2ADFH 5DRXB 4JRYA 4AEHH 4L9LC 1HSAA 1KLUA 4FFZL 4EKXA 4K3HA 1C5CH 1G7QA 1GGBH 1TDQA 4R7NA 3O3BA 5IEKA 2KQNA 4CN1A 5EO0A 5HGGS 4PJEB 3ZE0E 4YEFA 1WFTA 4OT1H 2XWBB 3OKOA 1RJZB 3OB0H 1EO5A 2WV3A 3CMGA 3ZDYF 1PKQA 3BKML 3S5LG 1IQDB 4H88L 3HRZA 3CVIL