4W81A

Periplasmically produced monomeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb) at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
131
structure length
131
Chain Sequence
b'MAEVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYVAADLKMQVAAYMNQRSVDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single Domain Antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 25
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w81A00
4CN1A 5A16A 3EHBD 5KTEH 4JQIH 1A6AB 3D25B 4TSCH 1X7QA 4KZDH 2DQHL 5C0CE 4AZ8A 2W91A 4WEBL 1YYLH 2JJTA 4ZUWA 1J0IA 3L1OL 2VXTL 5HI5C 4HGMA 3RX5A 5F96L 1MOEA 2VZUA 1BBDH 4IS6B 4LNVA 5I1GL 1B9ZA 1N7MH 3QIWD 5GS1B 2J6EH 5D7LE 3BMVA 5DUPH 3BPOB 4NWUH 2O5ZH 3MV8D 3I2CL 1YPZA 4FRWA 1RJZB 4YPGA 1X4ZA 1EEZA 2CRYA 4PV9B 1HQ4B 3CDGA 5BRZB 3PWLA 1S7VA 1QKZH 2X40A 2W60B 4JQXC 4HQQH 4YHIA 1Q1JL 4QOKB 4FFVC 3EYUH 5D2NB 4ZUUB 1SJHB 1U58B 1KB5A 5C8JB 2Y06L 4YNYA 2OI9C 1CYGA 3L3KB 5CD3B 3RY5A 4DKFL 2YN5A 3Q48A 3SKMB 5JHLH 3ZDZF 5LQBL 3IJHA 1J1XL 4HXAL 5I1HL 2YR3A 4YHPA 3GSVB 4RMTA 5HD8D 3FO9B 4LCIL 3U4BL 1L0XA 3MJ8A 4OCSH 1FBIL 1WJ3A 1OF2A 2X4QA 32C2A 4QRSB 4LGPB 2QKIA 1FIEA 4NC0B 2X1OA 4GG6F 3L9RB 5D7SH 3BDYH 2DMCA 4H0GA 2XY2A 2NCMA 5KSAB 4OGYH 3ULVD 1A6VH 3UBXI 1OCWH 3IKCB 3PIQB 4O2FB 3VXME 3GUTA 4NJAL 4DGVH 3ARPA 2APBA 4M43L 3FQWB 5HYSA 3SEPA 5DMJB 5BJTB 4R90L 5FOBB 5MENA 4KKBD 2OSLA 2NY2D 5H2BB 3P77B 3EJJX 1T1WA 4NKIL 1NBZA 4PRIB 3MRBA 1RK0A 2GTZB 1WIPA 3KJ6L 1F8TL 2ADIA 5H37G 2DQTH 5CMAB 3GO1L 4P59H 43CAA 5IBTL 3SKOB 4OAWA 4PG9B 1TVBB 5FXCH 4XCYB 5D72L 1VEOA 4P2OA 4KZEL 3PL6A 3MV9A 4NCC2 4LCUB 3G6AB 3O8XD 3RBGA 2VDOL 3ARED 2I5YH 2WIIA 4GAGH 4XH2B 4DAGL 5E8OA 4H8WH 3NFSH 5DEGA 2N4IA 1K4CA 4U1KB 5AUMA 1UCBL 3G6JE 3BGAA 3O2WH 2ICEB 4UINH 3RVVC 3ZYIA 2YD5A 4JY6A 2MWCA 1YEIL 3RDTD 3GJFK 3D9AL 1J9CT 2HKHL 3GMRB 3LEYL 4IRSD 4HXBL 2KKQA 3ZT7A 4JY4A 3L3IB 4ZFFB 1FFNB 1KIPB 4GRLC 2BRQA 4HX1B 4HIJA 3JTTA 2NXYB 4MAYC 5DFVD 5HHNB 1EEYA 1PGRB 3IRPX 4JN1H 3SO3C 3CSYA 5F7MC 1VFBA 2RHEA 4OV5B 5BS0B 5C9KA 1B4JL 2P43B 3QDAA 2HLFC 4HWBH 2R1WB 4LGSB 4PJ5B 1DBBL 5EC2A 1ND0B 3OL2A 1U8QA 3IYLW 2V2XB 4AH2B 3ELAT 4F9LC 4KAQH 5ICYA 5D1XB 5INDA 3O3EA 2JJSA 1J11A 5MP6L 4OZHF 1EIBA 5C0GA 5DJZA 1HHHB 1WGOA 5D71H 2GK0B 3VWJB 5MEOA 5I1CL 3ZE0E 3O4LA 5KS9E 1DLFH 4FFYH 2ESVE 5LWYH 5EC1A 2NY6C 4JLRB 5C0AA 5T33H 3JV6A 5HHOD 1M7XA 2E27L 5AZ2H 5F89B 3ARBD 4LSSH 3T3ME 3PXHA 3GMQA 4JM2F 5A40E 1WZ1L 3SGEH 4GG6B 1MCSA 1ZTXH 4OI9A 5IBLD 5IR1B 1KULA 2P5WD 1QG3A 1GPOL 5HGAB 1NGWA 4HFWB 5IB3B 1A6ZB 3GMPA 1IC5H 1YEGH 4AQ1B 1AY1L 1KBGL 5BV7L 1AJ7H 1NGPL 5JZ7D 4HD9A 4F3FB 4B7LA 1IVLA 3BUTA 1QRNA 3UTTB 3RUGE 4L3CB 3DX6B 3A6BL 1VPOL 2NNAA 4KK8D 3MRFB 3QUYA 2NX5A 4IIQC 1MWAB 3TBSA 3F5WB 4NZDA 3ZDXF 5DLMH 5EZIH 4IDJL 3TZVD 5K9OA 2B1HH 4NNPH 4DEPB 1A6UH 5FCSH 4Y16D 1A7BA 5IEHB 5ID1B 3T2NH 3TT1L 3ARFD 2DLFH 3W9DA 4QTIH 3TN0C 5IF0A 4LKCA 3F65A 5HPMB 2X4TA 3RRQA 3ZHKA 3HI6H 4XPFH 4X7TA 3B8YA 3BP6B 2PO6C 2VB5A 2OTUA 1WQVT 4GOSA 1JV5A 1KGCD 2YRLA 1T04A 4QYOB 3LKSA 1BZ9A 2HT2C 4K3JH 4JN2A 5IWLC 1ZA3A 1NC4B 1FH5L 5DJ6B 1NDGB 3T8XB 4EQ3A 4CDHA 2IAND 1FVDA 2NY0D 4EN3D 2BOBB 4EXKA 1QR1A 4LPVA 4NP4L 1W8NA 4V1DA 4ZOCA 2D4DA 1FPTL 3AY4C 5HGGS 3QEHA 5F70A 4AIXA 3G5VA 1LNUB 4FXKB 1P6FA 2H32H 3HPLA 2HLAA 1BQHG 5GSRA 2NY7L 4M7LT 1MCQA 4YAQB 4G5ZH 4MXQD 1VCAA 2APTA 4OZHB 1RU9L 1FYTA 3BGMB 1UWGL 3SJVE 1NC4D 2AJ3B 1YY8B 3FOLA 5GISH 3MPCA 5E8PA 5DRXA 2P8PA 5I16A 3STZB 4Q9RL 5JQ6H 5E7BA 1I9EA 1BGXL 1KJVB 3WDJA 5FUZH 5MEPB 1RUKL 4XMPH 4XNYL 1JVKA 3V4UL 3UJIL 3BMWA 3P9LA 3VFUB 4P99A 4YHLL 3C5ZD 1XF2B 3QJHA 3CXDL 5J4MA 2ZOKB 4RFEA 3R06A 3FO2B 4JM2B 4RGOH 3UROR 3BX7C 1A0QL 1IAII 4F7EB 1ZSDA 5I6XC 3UTQB 2DM7A 2CIIA 3QIUB 4Y4HD 3BZ4B 3GSXB 1XGTA 4CAGA 1WFTA 3PNWB 5E2TL 4ESKA 1G7QB 2FJFB 4QHMB 5LGKA 2YEZA 2EYRA 3V6OE 3ZKMC 5DQDL 4ODXB 4Y2OA 2FX8H 2IH1A 1S9WB 4O2CB 3MUY1 3VXNB 3G04A 3BQUA 3PG2A 3STLB 2EDKA 1BWMA 2R1YA 3TM6A 2Y7QB 4QXGL 2EH7H 4PJAA 3QAZB 5A43C 1E4XL 4LNRB 5DK2B 5J3HD 3MLXL 4X9GA 4GUPB 3CUPB 3CSPA 4GKNB 5JXAL 2LTQC 5BZWB 2W9DL 2FZ3B 1YUHA 2D7QA 2VZVA 2V2WA 4GRLA 2E3VA 3QULA 5EB9A 3QCUH 4C54A 4PJFF 5DK0A 3PHSA 1AC0A 3S97C 4Y2DA 1MHCA 4LCWB 5T5NG 2VLRB 2X9YA 4M7KL 4FQQA 5JW4M 1EZVX 3WJLA 1Q94A 5GRYA 4AEIL 1TETL 4PP1D 3VFMB 3OAZH 4JRXE 3VJ6B 1AR1C 1OW0A 3UYPA 5GRJH 5IBUB 2E7LC 4HFUL 4JPWH 5DEZA 3MRRA 1IKNA 3KR3L 1ZS8B 1F6AA 2X1XR 2VH5H 5CJOH 3W0WA 5L2JA 2H1PH 1N6QL 1ZLVK 4WU7A 4S1DC 4J3WA 1NKOA 3CVHH 1N0LA 2C9AA 4WFGE 2DQGL 3IFNL 2ZZUT 4M1GL 2PYEB 1JZ6A 4JEGB 4J4PC 4MD5B 4MD4A 4JKKA 2IQAA 4HLJA 3MX0A 4DN3L 2G9HB 5HYJE 5C0BB 4TTDC 3DIFB 4DFHA 2BXZA 2DOCA 3S35X 4OZIA 3SY0A 1ZHKA 1Z0MA 5HHMB 2ATPB 5GRWA 3EYSL 4KQ4H 2A77H 2ZNWA 2NY4C 3O3AB 3BIKA 3HA0A 2A6JB 1URLA 4FQLH 1K5NB 1LD9B 2XG5A 3DUHA 4U7SA 4GBXC 4TSBH 5C9JA 3SBWA 4TN9A 3OB0K 2NYYD 4LSPH 2PR4H 4LPTA 3GHEL 4ELME 3MFGB 3V52L 3OX8A 3UJJH 3HTLX 4LIQL 4ODUB 1NKRA 2VLJE 5CEZL 2FH8A 3FRPA 4U1IA 2IMMA 5ERWA 5I1LA 1ZT7A 3LKRA 4L4VE 5DHVA 5TPWH 4WFED 3ZHDA 4X6EB 1AD9A 5CINL 1Y0LB 1FNFA 1HI6A 2PCPA 3M1BB 1P69B 4RBPK 2F9BT 5T5FL 3W11C 3M8OL 1UM5L 5FYLL 3SDCB 4M5ZL 5DD5H 2XN9B 1R3KA 2ZUQC 3MRCB 3TC9A 1SYVA 4Z7QE 2BDNH 2E6JA 3AAZB 4JJ5B 2H26B 3WBDA 1BD2B 2CRIA 4G6FB 4HWEL 1VFAB 2AK4D 2XKNB 3DURA 3GSNL 1MFBL 3CX2A 3GSWB 5IP4A 4U4BA 3V8OA 1S7WB 4MDIA 2UY6A 5IJKC 2EDEA 4YHOH 4EI5B 4NJ9H 3RX7A 4DN4L 4NBXB 4XNQA 1E6OL 3GJFA 3QXAA 5C08B 4PJFB 1D3CA 3O3DB 2XA3A 3HB3D 4HGWB 5CIPA 3PABA 1H5BA 4X6CF 1G6RA 3C60C 4D3CL 3TV3L 1N6VA 2Y6SD 1QSFB 3LH2H 4LCYA 4Z0BH 2WANA 1KXVC 2R0KH 3WUWA 1UXWA 1RJLA 1L6ZA 3EHBC 4XWGL 2AV7A 3R8QA 3L3GB 1MUJA 1XFPA 3K4ZA 2YA1A 3UJTL 4HLZG 4EI5D 3VXUA 1CGYA 4PRNB 2GJ6D 4P5TA 3KG5A 1S3KL 4QNPF 4P4KC 3QNZB 1TJIH 1YJDC 3GKWH 1RULL 2DL2A 2DTMH 1JGVH 4O58L 2C4FT 1I1RA 1MSPA 4X98B 1UM4H 5LVEA 3GIVB 3AXLA 3D2UB 4L5FH 2JIXB 4YQXL 5FV1L 1T6WA 1YPZE 1RUAL 2DQFA 2WUBL 4UTAH 5JIIA 1MI5A 4RNRB 4NM4L 3WO3B 4RMQA 4WO4D 4ODVL 1ONQA 3WKML 4HUUA 4QRPA 4NO5B 3QXDA 1U8MB 3JV4A 2X1QA 5AAMA 3V4VH 4ZTPL 1EERB 3NBNA 3OPZL 1EHNA 5GS1C 3DXAB 4Y19E 3IFOA 4G8EA 1WT5A 1H9VA 4XNMB 5CJ8A 3B5TA 1U3HD 4N8CL 4PGJA 2HT3C 5IB5B 1MPAH 4U7MA 1A7NL 1Q9WB 2NTSP 5T1KA 3JSSA 5AYUL 5HD8C 1BP3B 4WFHD 1FZKA 2IAMA 3VFOB 3O4OB 5C71A 4IMKC 3AB0B 5JNYB 5TDOB 3X12A 1F5WA 2BY0A 3FRUB 1NL0H 4PB0L 4M00A 1IAIL 2FIKA 1UWXH 2E6QA 3MODH 3LN4A 4PJIA 4RAVA 1Z9MA 1IFHH 5K9KB 2BCKA 3LMJH 5DQ9B 3GBMH 3ULVC 1X5JA 4UTBH 3MLYL 5E99H 3AU1A 2ICES 1DCLA 4MNHB 5MENE 5F1NB 3LEXA 4JRXD 1I4FA 4KKBC 1VA9A 1WCQA 2DLHA 5I19L 4JG1L 4OLUL 2NY2C 3W39B 3U36B 4ORZC 3SDXA 4UIMB 3HE7B 3WEXB 1E4JA 1RIHH 3MCKA 3RVTD 1VESA 1M71B 4NO2A 4XPHL 3U9UB 3QNYA 5FKPA 4PB9L 4WFGD 5KSAC 4YDIL 1XGUA 4ZSOB 1C8PA 2F8OA 4DTGH 5KSUA 3QPXL 4LASH 4N1EA 3L5WA 3PP3H 1XF4A 5C0EA 1KPVB 5INCB 3MV9E 5E6ID 3GBNL 3H3PL 4HCRH 1NCDH 3B3IB 3O8XC 5HYJD 3UPRB 3KPSA 1RJCA 4X6CB 2J7LA 1H3TA 2ED9A 1YEJL 4BQBA 5CJQL 5CBAB 5HDQH 3S36H 4ALAH 3O41B 1EGJA 2QLVB 4L9LB 4JO1L 5BMFH 3K46A 3FB5B 5BV7B 1XGYL 3RDTC 5I1EH 4G9FE 3WD5L 4IRSC 1KTRL 2OJZH 5I9QC 1W8OA 4GKSB 4JFDA 1LK3H 2Z35A 5GZOD 1EUUA 4C83B 5TF1L 3BVNA 4K94L 2DDQL 4KC3B 3T4YA 5IKCA 5DFVC 3T1WA 2APXA 4PGDB 2W59A 5B4MD 3I6KB 5D96B 4NM8L 2RCSH 4L4VD 4KXZH 1ERNA 3QIBB 5IW1A 5I1AB 3TFKD 3DTXA 2BVPB 4P5MA 1NC2A 1E4KA 4MQ7B 2QR0A 1NMBH 1OTTD 5FV2A 3V6FB 2ZOLB 4GRMA 3MR9A 5FYKL 1WCBB 2KL6A 1V7NH 2A73A 4DZBB 1PZUB 3ARDD 3WUWG 2NXYC 5IK3B 4ZMAT 2X10A 5TE6L 2D31B 5I1KH 5D5MA 3OJDA 2BSSA 1I9JL 3RWJA 2BHYA 2FEEI 4P2QA 3T2OA 4WDIB 3H3BC 2YD4A 3IU3B 3GSRA 3T4AB 3LSOB 5C0AE 4D9RD 2VDKL 5D7IA 1OLZA 2Z8WC 1CE6B 5D1XC 1UJ3C 4JFED 2YA2A 2AKRA 4AENB 3U0WH 1MHPL 3ARBC 2EDRA 3BIBX 2PW1B 4U3XA 3MRGA 5JW5B 1A02N 1W0YT 4H25B 3RA7H 4DK3A 4JHWH 1YNKL 3VWJC 5HHPA 4H5SA 1X5GA 1FAKT 1MFCH 4P3DB 2X70B 3SKJH 4MB5A 3IFLL 4G6KL 4YXLH 4NNXA 4HZAA 4ONFH 3P73A 5F7YC 4JG0L 2VAAB 1BQLH 1QBMH 3WFEH 3BO8A 4G9DB 4LHUB 3WFCH 1B2WL 2OXHA 5FHBL 1RURL 2BVTA 5ESVA 2ITDA 2R2CA 3I84A 1NGZA 3KYAA 4XXDA 1GC1L 2UVFA 3O6LL 1XF5B 4WNQA 4CNIB 1B0RB 3TZVC 4EZMA 5FO7B 3CZJA 1FGVH 4Y16C 4TVPH 3B2UC 3IAGC 2R8SL 1SJEB 4O02H 4MA3A 4N8VB 1ZVSA 1ES0A 1P9MC 4U1JA 4L4JA 5GGVH 3L95B 5C0JB 1KG0B 4GAYA 1S9VA 2X89A 2XA8L 4HPYH 1YQ2A 3UBXB 4Z76B 1QO3A 2HKFH 3D25A 2QSVA 5JO5A 5FA4B 1S7XB 4MQSB 5FB8A 2OMNA 4DEPC 1A7RH 3BSZL 4ODTL 2FYYB 1DQLH 1NGQH 2AP2A 3JTSB 4HV8B 3WSQL 4HMEA 4OD3H 1KEGL 4M5YL 1KPRA 1A64A 3HG1A 3U6RA 2FBJL 1I1YB 4ODHH 5F7EL 4KRPB 4UOJA 2F54B 4S1QL 3OR6B 4CUCA 4J1UB 4RX4A 4KHTH 1NMCB 5KSVB 4PV9A 3GMMA 5D2LF 3UZEA 4AK1A 1I9RL 1I1CA 3G5XB 1P7QA 4N1CA 2GSIB 2EKJA 4OZ4B 4N5ED 2AXGB 4NZTH 4HUWA 4WUUA 1P7HL 5D2NA 4A2LA 4MXQC 1SJHA 3WNOA 4JPKH 4ZO7A 1IJ9A 2EDBA 1Q9LB 4X8XA 5AWNL 4TUJB 4XVTL 5CD3A 4Q2ZB 2ENYA 3CVIH 1JZ8A 4FQJH 4XVSH 2YWYA 4MLSA 5GPRA 4RDQF 4ZXBA 3RU8L 4XNXH 2VNCA 4DCQB 3GSVA 3W82A 3BUYA 1FO0A 1H8NA 4HS6B 1N64L 1WITA 5J6GA 2CDGA 3BJLA 4JRYD 4JDVB 4QRSA 3BI9X 4RISH 1LGVA 1TTGA 1P7KB 1KFAL 3L9RA 3OKMB 2IADB 1JNHB 1CD8A 4LGRB 4UUJB 4O2FA 1UH3A 4RGNE 5J56B 1U91A 3CU1A 1RVFH 2WBJD 3ZLQC 2PXYD 2FB4H 2UUDK 1WBZA 2QSQA 1CD1B 4JAMA 4JFOB 2PYFB 1P4IL 2H8PA 1E28A 4ZO9A 3FN0L 4JDZA 1JJUA 4ODWA 4UDTB 3NIGE 2DAVA 1A1MA 2VUOA 2XZCL 4PJAE 3SGDH 3W81A 5CJXA 3SQOH 5CMAA 4OJFH 2OM5A 4JHZA 1A3LH 5JW4Q 4ONGL 4XBPA 1T2QL 5KAQF 3QIUC 4G3YL 3KS0H 5EIIA 1IT9H 3BKMH 4FQCL 1HXMB 2VXVH 3FT4B 3AM8C 5JOPE 1VADB 1FFPB 4JFPB 2VLMD 2CDFB 3TIDB 3OXRA 4LCUA 3QB7C 4C56A 3PQYB 4GS7B 1FL5B 4WRLA 5F7FA 5IFJB 2DM3A 2XRAH 5JOFB 4MD0A 4CJ0A 4U1KA 4L8SB 1I9IH 1KUMA 4HIIB 3FFCB 2DWEB 4K2UL 2VLKD 4WHCA 5GGSB 4HS8L 4I9WE 1JGUH 4BZ2L 4P4RB 4FZ8L 4G7YL 1GZQA 2FWOB 1GAFL 5D7JA 4ZS6C 3L3IA 2EC9T 4ZFFA 1G7MA 3IT8D 2DQUL 3WHXB 4OQ1A 3W0WE 3T65B 1N5YH 2VABB 5BVPL 3GSNB 2J88L 3OJ2C 4IHOB 1OD7A 2YPKB 4OV5A 4X4XB 1KLGB 4FMFA 5JUEL 3WFHB 5BS0A 1ED3A 2GW5A 4PJ5A 5D2LB 1T1ZA 2OS7A 1DFBL 1G9MH 1RQ5A 2VDML 2V2XA 1ZLWK 3F7VB 2A2QT 5I2IB 4PJ8D 5D1XA 3EJYD 3MYJA 3T08A 3UX9B 1ADQA 1IM9D 3IJSA 1CLZH 4KZDL 5HVGB 3VI3E 2UZIH 1HHHA 4MXWL 2CKBH 1JIBA 5DD1H 5F3HA 4BUHA 3P0VL 5D6DA 3DRQB 1U8IA 2CSPA 1OGTB 4GXUM 3C6LA 1SBSH 4JLRA 4KK9D 2H2PD 1A5FH 2DBLH 5DT1L 5F8QC 2J6EL 3VRLF 1WLHA 5DUPL 2Y5EA 5GS2H 2J8UF 2CD0A 5F7KC 5F89A 2NR6D 4MNGA 4NPYA 3X3FH 1K4DB 5C0FB 4ZTOL 5IFAH 1BX2A 2VN7A 1C7TA 5E9DB 4TOYH 2OK0H 1XGQA 3U2SA 4G8FA 4OCWH 3OBAA 5HGAA 4BK4A 4I5BA 5LXGL 4WIQA 4NQXB 4ORGA 4PBWD 1A4KB 2NQCA 3D3VE 3H7BA 1A6WL 3LS4H 1KN4H 1YMHA 3GNMH 3T0BA 2B7DT 4I0PA 3KYKL 7FABH 1P1ZB 3TT3H 5IG7A 5MERB 5HHXH 3Q3GA 1CGSL 2VITA 3HZYB 1J0JA 3ZKNC 4Z95L 1Z3GH 3MRFA 3WN5B 3S4SB 3OKDA 1MWAA 3CFJA 3VXRB 1MRDL 5L2KE 1B4RA 3MGAA 1LMKA 1CBVH 1I8KB 3ARRA 1WEJH 3O2VH 3IETB 1JTPA 3MBXL 4PTTA 5JHDE 3BDYL 1QR4A 5ESQA 1NAMA 5IM7A 4NN6B 4NBYB 3HB3C 5D4QA 4DGVL 4NNYB 4NQSB 4M4PA 4GLRH 2FEDC 5IB2B 2Y6SC 3ZKQD 3ROOA 2VDRL 1SEQH 3BP6A 3V0WL 1MIML 3NH7L 2EDDA 1F3JA 5EO1B 5DRNB 3MRHA 2DD8H 4PIRF 4NZUH 2ARJQ 1UXSB 2RJMA 4PR5B 4EI5C 3HAEA 2DQTL 3SKUD 3WDIA 1KIRB 4P59L 2QQNL 4X0KA 3VFPA 4M8QB 1R5WB 3MROA 1KLFA 2P8LA 3MCLL 4YHMH 1NGYB 3MXVL 1U6AL 1KJMB 2H41A 2ID5A 3QDGE 4LOUC 1H3UA 1T2JA 2O26U 5KZCD 1DL7L 2I5YL 3L5HA 2CUIA 4K23L 3C8DA 3DVNB 4OZGA 3BAEL 4MMZC 1ZLSH 1RZ7L 3FOMB 5C2UB 3MRMA 5T1LD 4DGYH 5FECB 3NFSL 4YXKH 4KTDH 1FLRH 4YAQA 3VGHA 1UB5A 1WF5A 1PG7H 3EO0B 3EGSB 1WZLA 4PJHA 1G7JB 4FQXD 5TQ2L 4KK5D 5I0ZA 1YY8A 3E2HC 3AS3A 3DX9A 3SDAD 1MQ8A 3FQNB 3EO9L 1JRHI 3MACL 3SGJA 3STZA 35C8H 5C6WH 1KJVA 4PUBH 1SEBB 2GAZB 4R8WL 1P6AB 4MCZA 2BNQD 1RZIB 3I50H 4UNTA 3PWVB 3VFUA 1BFOB 4U49A 2J8UB 1CFNB 4RWYH 5EUOA 3MXWH 5JOPD 4JZNB 3OR7B 4JM2A 4BZ1H 4Z0XB 3C8KA 4KKCD 3B2VH 1FE8L 1D5MB 3ULUL 5E94B 4OQTA 3QYCA 4TRPH 1OVZA 4DVRL 3K2UH 4O2EA 4JB9H 1T80A 1CQKA 3UTQA 5IVXE 2NY3B 4PJIE 3C87A 1AHWA 2LAGB 3UTPD 4QHMA 5D71L 3UTSE 4I9WD 2XYCA 4ODXA 3MRIA 4BZYA 4MA1B 4UQ2A 5KVFH 4HWZB 2F19H 4FG6C 1I1FA 1AO7E 1IQWH 3U1SL 1MVFA 3QQ9C 3LQAL 3DI3B 3O4OC 4BYHA 2R0WH 3AB0C 3OGCA 2DWDB 3VXSD 1XGPA 4NWTH 1H0DA 3BKYH 5DK2A 1TJHH 2YHGA 5T33L 5D1ZD 4NO3A 4AM0A 3CUPA 3EZJB 4K8RH 5D8JL 4DUXA 1AR2A 5EOQL 5HI3D 2IPTH 2HVJB 3G6JF 3HI1A 4WWKA 1A2YB 2P46B 3PGCA 5HHVH 5C0CB 4GKZB 4E9LA 3T0EE 2GTWA 1MCKA 5EZLB 3BZDA 1LEKB 1NLBL 1J05B 4RRPA 5I66B 3DOSA 4Y5VB 5EU3B 1J8HA 5TE4H 3HE7C 3RWHB 4LCWA 4P46D 2VLRA 4BFIB 2AI0L 3M45A 2AK1L 5D7LB 2Z31D 3RI5F 2GY5A 3WIHA 5GJTH 3U0TB 3VFMA 4LEXH 1C5DA 3FFDB 2C4FU 1JWUA 3O9WD 1JPFB 4U6XB 1M05B 3UXFA 3P0YL 3DHMA 3KXFA 4Y5YA 3PV6B 4E41A 1AQDB 3GM8A 4ZDHB 4M6NL 1LILA 4RFNB 4EUPG 3KYOB 2AABL 3GJEA 5CSZB 3IDIB 2R2HA 3DHJA 3ISWA 4NNPL 5DO2C 4XCCH 5CS7A 4XT1C 3KLAB 5B4MC 4I18B 4LSQL 4E5XA 1N8ZA 3BDXA 3DSNA 5EWIH 1RUML 2XWTB 2WLYA 2Q7NA 4QTIL 5A3ID 3AGVA 3TFKC 4NQDE 4ELKB 1XCTA 5BV7C 1YQVH 1RIVH 4WHTA 5C0BA 3I9GH 1OTTC 2FRGP 4JGJA 5E5UB 3IDMB 3SDYH 2AJXH 1U93B 3WV0A 5BXFB 4OM1L 5J7CC 4WGWB 3WL9B 1IBGH 4TVPD 2EDHA 2IBBA 5CJ5A 1DN0A 1GGCL 1MHHB 5D96C 5GZNC 3P4OB 4Y89A 4N0CD 3U7AA 3GI8L 3QIBC 4QRRE 3UYRH 6FABH 2ICCA 1OGAD 2IJ0C 4UMGA 1UWEH 3G5YA 2Z92A 3OJVC 1KYOJ 3QCTL 4HMDA 3VXMB 5B8CB 5KANI 3SPVB 4LARL 3D69A 5LJYH 5TDPB 3WS3B 1GGBL 3NZ8B 2YZ8A 3HMXA 4NQCE 5JHDD 5E8NB 3KYNA 5T3XD 1Q9KA 4LLQA 3Q6FB 1HZHL 4LK4A 1GIGH 4TUOB 1ZGLB 4PBVC 2IC2A 3CFCH 3RUGF 5L9DL 3MRDB 4FXGB 3NPZB 4UIKH 2GEEA 3RPIA 1FAIH 2DL9A 4L8DA 2JLLA 2X7LA 4HC1L 4M61B 4MJIA 5ILTH 1E4WH 3DX7B 3SDCA 5DI8A 2XN9A 3MRCA 4UT7L 3HMWH 2VC2L 4HW6A 2WNGA 5FUZL 3AAZA 3F8UB 1BD2A 1SY6L 2BVQA 2UWEE 4GMTL 4WEMB 1ULVA 4IRZH 1KB5L 1I7UA 3X11A 3VXPA 3QUXA 3QDGD 1QSEB 3MZGB 5F6HJ 2F53A 1TVDA 3OKKA 3G6JB 2HWZL 3D85D 4HJGB 1FZOA 3IAQA 4FMKA 2B39A 3DETC 3TESA 5C08A 1X5FA 1CLOL 4J2XA 1NH6A 2DIAA 5LCVH 1D9KB 3LV3B 4WGVB 3DVFA 3V4PL 4G6ML 1QSFA 1U3YA 3FQUA 4URTB 3V5DA 4BELD 5BZDA 3TJEH 1G84A 1ZOXA 2HRPL 1QSED 5IVZB 3INUH 3PGFL 1JYXA 1NANI 4PRNA 2H3NB 1AKJB 4AL8H 3DO7B 2E7HA 2DKUA 1OAYH 3QNZA 5EDXA 4L3EA 2BOCA 4Y4FD 3U82B 4D0DB 3GSQB 3RZCD 4X98A 4LLYB 4IMLB 5IW6B 5F21B 2FX7H 4LVEA 4XP9L 4JFZH 4PJDE 3VXTB 5FHAL 4MGXA 2DB8A 1CGTA 2YUXA 3VMNA 2C3VB 5K9JH 4RNRA 4RWHA 2YUWA 5DJXA 4PJXE 2VERN 1YMMA 2BFVL 3FO0L 2ESVB 1MFDL 5EU6B 4U6YB 5B3JE 3MGTA 4F8QA 3VI4F 1KEMH 1C1EL 5C07A 2X4UA 4N5EC 3UTSD 4MNQB 3IDNA 4TPRH 1VGEL 1DUZB 1EK3A 2R56H 4N0UB 2FSEA 1AO7D 3PGDA 1DVFB 2NTFA 3WFZA 5E00B 4WY7H 5HI4C 2XG4A 3S34H 4KRPC 2P42B 1WWCA 4JFFD 1MRFL 4HAFA 2R4SH 4X6FB 4LSUL 4M62L 3H9HB 4M6ML 5EU6D 3HUJA 1Q9WA 1GH7A 5E03A 1D5XA 2EXYD 2R9HC 4S10A 1IKFL 4GSDH 4KUCD 1F2QA 2E7BA 4N9GB 3PWJB 1ZVHA 2BVOA 2RB8A 3BD5A 1D5BB 4FHBD 4U6VL 3PWUA 3RUGB 5KN5A 3ARVA 4YDLB 1RZKL 1MJJB 1CG9B 1RK1B 4PJ9B 2HYMA 5DQ9A 4NZJA 2C5DC 3UC0L 5DMYA 2CRZA 4NGHH 1B0GA 2EIZB 3CX5J 2HFEB 2IGFH 4MNHA 4XP4H 2WBJC 1QFWH 3OAUL 1I1AB 2YD2A 2AEIT 5BCAA 4L8CA 2EIDA 1BOGA 5DQJB 4HBQA 1G9NL 3QO0A 4FQ1H 4TSBL 4NHUA 5I75B 3BEVB 4EBQH 3D48R 3U9UA 2GFBA 1FZMB 1RHFA 1R3IH 2PR4L 3UJJL 3VD7A 1FIGH 4ZSOA 4DQOL 4KUZH 1EAJA 1MEXH 3FB7B 5INCA 4LLMB 3PWPA 2WQ8A 1MIEL 2VAJA 1UH4A 3BPLC 1JPSL 3OZ9H 3B3IA 3NIFE 3QI9B 4C56E 4KWUA 3RGVD 1JE6A 4DKEH 4JCMA 3UPRA 1FHGA 2XOTA 4J3UA 4I77L 4WEUD 3QWRD 2QJDA 3VDCA 1OP3H 3ULUF 3ROLB 4YXHH 5GS2D 5D70L 3L3OB 2IALA 2Q86A 3HE6B 3O41A 5DMIH 3E8UH 3FB6B 3O6FB 4L9LA 2EYSB 4M7LH 2DF3A 5MHSE 4RIRA 3NN8B 2LE9A 1UYWH 4NKOB 3VXQB 1G7PB 1DBKL 1S9XA 3WHE0 4GKSA 1BVZA 3CNKA 3MJ9A 3D6GA 4GS7C 1BEYH 4NQCD 1LO5A 3SJVB 4CN6A 2HN7B 1LEIB 2YA0A 1PKQA 4YDKL 5B38B 1ZGLM 1MCCA 5FYJU 4M93C 4MQ7A 4LCCB 4AMKL 1V05A 1T1XA 5ADOH 4QKXB 1AFVL 1DQJA 2R0KL 1NGXB 1LO4H 2EE9A 3WE6A 3TPUA 4PJ8C 3EJYC 1ZE3C 1BVLA 5AG9A 2R23B 4ENEC 1UEYA 4XTRD 5E0QA 5IK3A 4ELMF 4XP6H 3ZTNL 2XTJE 3UEZA 1R3HA 3QUZA 4DGIH 4KTEH 3VGAB 4NN7B 2DTML 4L4TD 4ZO6A 3IU3A 3MFFB 1A9BB 4OZFH 4KK9C 1CL7I 1HYRC 2DI9A 1FL3B 3O0RH 1QTYT 1CDYA 4LP4A 1CE6A 4MNGE 3WFBH 1EHLL 5FFLA 4AENA 4UTAL 2R15A 2NR6C 4M9OA 5ACLA 5JW5A 3RWIB 4PJ7F 2Z4QB 1PX3A 4Z7QF 1QLRB 3P11L 1NEUA 4R4BB 1RFDH 4N0YH 3B9KD 2CLZA 3S96B 4OIIL 5IEKB 3C9NB 1OM3H 4WI3A 1HINH 3MJ6A 4GAJH 3S5LG 3V4VL 1KJ3H 4OLZH 1TZHB 4BSVA 4C55A 4M7ZB 1KELL 3T1FA 3G08A 2FHCA 2VAAA 3E3QE 4NKDA 4HK0A 4G9DA 1Y6KR 5ISZE 3AS1A 1MPAL 1YY9C 3KPLA 4P23B 1BM3L 1HXYA 1YEEH 3MUGB 4NSKA 4P2RA 1C5CH 1DUYB 5EZOH 4U1NB 1UGNA 3GHBH 4H20H 1NFKA 4ETYA 1XF5A 1IGFL 4CNIA 4YZFE 1OSPH 1U41A 5FDWB 4K3DH 2XFXA 4YFLI 3N06B 5HY9B 1MLCB 3UO1H 3GK8H 3GRWH 4APQD 3S37X 3Q1SH 5SWSD 3MODL 1TZGL 2HH0L 1XIWB 4D9LH 4GW4A 3QZWB 2MKLC 3CDYA 2ZCHL 4TNVK 4PJCA 4OUUB 1H8SA 3BGFB 5C0JA 1KG0A 5TQ0L 3HZMB 4PRHE 1BZQK 1FL6A 2I27N 3WN5C 4Z76A 1Q72H 4XNUL 3QWQB 1TQCB 5FA4A 1YPZF 1A7PL 2HG5A 4IJ3B 1S7XA 5D7KE 5CZVL 4KVNH 4UDUB 4Z7UE 1J88A 5FGSA 3EDEA 4O51B 3JTSA 5SX4I 1FN4B 3MLZL 2UV3A 4FQIL 1CICA 3QDHA 1A1OB 1MHEA 3CFKA 3NFPB 4BUGA 5B39G 4NN6C 2A6DB 1JHTA 4HF5H 4YR6B 1VEMA 3ARXA 3GGWB 2F54A 3OR6A 4NO0A 3VH8G 3KYMB 1Q9OB 2QSTA 3H9SA 3VGFA 4OZGE 3DMMB 3LKQA 5DJDB 2GSIA 2ZCKH 4OZ4A 5HGBA 1N3NB 4PJGE 2YUVA 3O3UN 1BF2A 5GGRY 1K6QH 5C70A 1XGRB 4K8RD 3VFSB 4BH7B 3F58H 5IQ7L 1TQBB 2ZNXA 4X9IA 1MJUH 3AMLA 3CMOH 4FQXC 4KK5C 3OAYH 4ELMB 5BMFL 1AGDB 4LHJB 3O2DH 1F4WH 3N1GC 4TUJA 4RMUA 2VLJB 2YD1A 1NSNH 3PP4L 3KPPB 4Q2ZA 3MRPA 3K3QA 1T1YA 2OJZL 4Y0GA 5CHNB 3E6FB 2VSDA 1WAAA 1T03H 2YPLA 4GXVH 1WV7T 5KVEL 3VFTB 4DCQA 2OZ4H 5EUOE 4N90E 3LS5H 5L6YL 1A9EA 2X4SB 1QOKA 2HFFA 3K80A 5EOCJ 3K2MC 3B9VA 2AJSL 3VD3A 3QDMA 1ZLUK 3TIEB 2HTLD 3OKNA 2X4OB 4UU9B 4PJ7B 5I18L 1DE4B 4YHYC 3D39D 1INEL 2IADA 3KPRB 3U7YH 5I8KH 1CR9H 1HOCA 3MV7B 3WNKA 3FZUD 4BQ8A 4KMTH 3HNTL 3P9MB 4UUJA 4Q97A 5EU4B 1V7NL 1BHGA 3ARGA 3MV11 1U8HB 4OCLC 1FFRA 2FIRT 3TA3A 5A2LH 1RUQH 2VYRE 3IVKB 5I1KL 4JZJA 2IH3A 1JGLH 1FNSH 3DSFH 1K3ZA 2DQIH 5I15H 4UDTA 5ESAB 4U1LB 2BNUA 4K7PX 4NQED 5F7NC 3MLUH 4YBQD 3A67H 2NY3C 2DI7A 1CIDA 4B41A 4LSTH 4PY8I 1QD0A 1GOFA 5ALBH 4UILL 1VADA 4JFPA 4CDGC 3GIZL 3TIDA 2W0FA 4XRCA 1TMCB 1QBLH 4ZUWB 2F5AH 1SM3H 1FL5A 5IFJA 4S1SL 1J8HE 3SKJL 2DIJA 4OSUL 4ZNEE 5J8OA 4R0LA 4L8SA 2P5ED 1OOAA 1Z6JT 3ARYA 2GCYA 4ONFL 5ACZB 5C7XL 2XQBH 3MOAH 3N1MC 1BPVA 2XTJD 4JQVA 3TO4D 4K9EL 1HDMA 3WFEL 1YPZB 4YPGB 4P4RA 4E0RA 3O9WC 4X4YB 4X80L 1A7QL 3RVUD 2XIDA 3TYFA 3RKPA 2Z8VC 4ERSL 2IBZX 5SWZA 2VABA 2P48B 3WO4C 5H35B 1TCRA 2QV2A 2ZPKH 1KB5B 2FD6H 1REIA 1JWSA 1FV1B 1PBYA 3R0NA 4Y19B 3DV6A 1U95B 4M4RA 5DWUL 5A3IC 2CMRH 2CDEA 1RY7B 3O3BA 2P4AB 4IOFC 3VDAA 1ORQA 4WCYL 4YHPB 3TVMD 1ZAGA 4JANA 4H1LA 2HKFL 3FQXA 4RFNC 3MJ8B 3QIWA 4K3EL 1OF2B 2QKIB 2WSKA 4X5WA 1G6RL 3MV8A 1DQLL 1NGQL 5DFWH 2J1KA 3D1MC 4I18C 4F57L 1OGTA 1T6VN 2G5BA 5T5NF 4X6DE 4N0CC 1A4JB 4PJBE 3C09B 2R69H 3CSBA 1RPQA 5CIPH 4DUVA 4HIXH 2ENSA 1N26A 1HCVA 5DJ2A 5FM8A 5MENB 1CE1H 3R8BB 1I7RB 4QGTA 2OSLB 4LLUB 1T1WB 1YEFL 1NBZB 4KROB 1HQRB 1RK0B 2HJLA 1KTKE 1CDIA 4XC3L 4H0HB 3RNQB 1CL7H 4YO0A 2ADIB 3SCMD 2C7UB 4IOIA 4JY5H 4MVBC 43CAB 4NQXA 4JPKL 1FNAA 4OAWB 3QHZH 4C59B 4MJIE 1BAFL 3QQNA 2HA1A 3MOQA 4P2OB 5B8CC 1WFNA 3EYOB 5D7KD 2D2OA 3PL6B 1BQHB 5MI0B 3MV9B 3U0PB 5MERA 4MZ2A 2WIIB 4MB4A 3EYQD 4MWFA 4UBDC 3HZYA 4DVBB 5DEGB 1K4CB 3MOBH 3SE8L 4BH8A 5ALCH 1RIUL 2XWJA 1ZHLB 1KN2H 1F58L 2VDPH 5DD3H 4M6OH 4NRYB 1LDPL 1AGFB 3EDJA 3QRGH 1OAUL 2GJJA 4P2OD 2E7CA 4LSVL 5DHXB 3K7UA 4NNYA 5I8EA 4NQSA 4HIJB 1S5IH 3JTTB 4EDWH 2FB4L 1EEYB 1EMTH 1VFBB 2EIEA 2AGJH 5IT2H 3VFNB 3QG7L 1DQDL 4O4YH 1UXSA 4PR5A 4PS4H 4HH9B 3KDMB 1U8QB 1VFMA 4CBPA 4YUEL 5IVOA 3AREA 4L3EE 4BSJA 1A3LL 3B8SA 4N90D 2AW2A 4M8QA 5DMKA 5ICYB 5INDB 3VWKD 3O3EB 4NUGH 4Y4FC 4LSRL 3BKML 3RZCC 1ZWIA 2JTDA 3ZTJH 4B50A 3CLFH 4JGMA 5IUSA 5C0GB 1HN1A 2GQHA 1JPGA 2XZQL 5FAAA 3CLEH 4MJ4A 3BIAX 5SX4H 4OLYH 3FOMA 1GGUA 1BQSA 5C07E 4GRWF 1H3VA 3EGSA 5C0AB 2OBGA 2ZG2A 1EJOL 3JV6B 4P3WA 3C2SA 4GQ9H 4IOSD 2ERJB 4JZOB 1I85A 4XPGH 2NMSA 3DPBA 2NPLX 3LN5A 4X6BA 3FQNA 4OFYD 2X42A 5TGBB 3ZDYE 4K7FA 3PDDA 2BVUA 1LE5A 5FK9A 1SEBA 2GAZA 2JELH 1HHIA 3O4LD 1OP5H 1NGWB 1N5YL 4YHNB 2MOVA 1BVKB 3VFVB 1ZHNA 4FTVD 3GMPB 1AQKL 1BFOA 5DC9B 4XPAH 1FCGA 2F5BL 4JZNA 1C7SA 4OT1L 4Z0XA 1DBAL 3MRQA 1QRNB 1JGEB 1MQKH 1D5MA 5E94A 1EGJH 4IRJD 4P9HC 2PW2A 2OTWA 1FC1A 3UAJC 2PTTA 3ZHLA 4FABL 4PJAF 4OF0A 5C0IB 4J6RL 3LQMA 4P9MH 1YECL 3LDBB 3WXWH 5FUCC 4CU6A 5HHOA 4HWZA 1UEMA 4H1LG 2KPNA 2W9LA 1UFUA 1P4BH 5EIQA 1N0XL 4P3CH 1E6JH 3W9DB 2X5PA 5IF0B 4LKCB 5IHZB 1WBYB 4RSVA 5JW4R 2DWDA 2W0LA 2X4TB 1JFQL 2P5WA 1FNGA 4YDLC 2AJVL 1CGVA 3QEGH 4X7TB 5HVWA 5DA4A 4PJ9C 3UYOD 3QUYD 2NX5D 1FORH 2EEAA 4OCNC 4U0RB 2OTUB 4DW2H 1A2YA 3X3FL 3PWPE 3S7GA 1CFSA 3NZHL 1UZ6E 5HI5D 4Y1AE 2O93L 5ENWB 1J05A 3LKSB 1J1PL 1I1AC 5I66A 4RFOL 1ITCA 4WW2A 4Y5VA 5EU3A 3VE0B 3HKFA 4O9HL 1FVDB 3GNML 1SQ2N 5D7LA 5I75C 4JO3H 5GIRA 1MFNA 1NCBH 5HDBF 1D5IH 3TT3L 2APVA 4XGZA 1JPFA 1FNLA 3G5VB 3HPLB 1AQDA 3ARFA 5GSRB 4ZDHA 4OM0L 2B5IC 4U2YA 5DSCB 3L5XL 3QI9C 3BP7A 3MLWH 4OFDA 4X9BA 3U46A 3O2VL 2CR6A 3KLAA 3EDDA 5DS8B 1A21A 1PKQE 4U1HA 2R29H 3VI3F 2RR3A 3QEQD 2XWTA 4JDTH 4O5LH 3ZO0A 3HE6C 1YEDA 5DJ8A 5I16B 4V1DD 2M26A 4F80A 2MCG1 4RAUA 1RD6A 4GRWB 2XPGB 3SDDB 4XXCA 4PLNC 4KI5F 3VMOA 1KJ2H 2EH8L 3QJHB 5BXFA 3OV6A 4OUOA 5ID0B 1HKLL 4MJ5A 5C2BL 4WUKL 5EBMB 1FYTD 4EN3A 2CXGA 3WL9A 4QGYA 1MHHA 1NLDH 1XT5A 1WSST 4FFWC 5DC0A 3K8LA 4YHKL 2CIIB 1MRCH 1NFDE 1YJDH 1OAQH 3L3HB 1FC2D 5E2UH 3VXMA 2VISA 4RGNB 2YEZB 3SPVA 5C09D 2EYRB 4Z9KB 4LCCC 3L3JB 4G8GD 5TDPA 2R0ZH 3WS3A 3NZ8A 5E70A 4AT6B 1OAKH 1ZLSL 2Z9TA 4TUOA 2QADB 3H42H 3G04B 2R1YB 3C08H 4ONOA 3MRDA 5A2KH 5IHUH 4PJAB 4G7VL 4I3RL 3MUJA 3L7FB 4B7IA 1CDBA 3VGAC 1OARH 4NN7C 4ZPVB 1CZ8H 4M61A 2VOTA 5EU7E 3C5ZA 3DX7A 4Z7VE 2F58L 1YUHB 2Q20A 3JZ7A 2V2WB 3IDYB 3PDOB 1RZGA 2QSCL 5J9PB 5DK0B 3KHQA 4J3SA 4ZOEA 3BQUD 2DQEH 2KZ1B 4L8BB 4Q9QH 2O61B 2IMNA 2K1MA 1MHCB 4CVXB 1NMAL 4UT6L 4Y4HA 4FQQB 2P49B 4P2CG 1Q94B 5I1IL 3G6JA 4W4NA 3RVVD 4YGAB 2BSTA 2YK1L 4LRIC 2ZKHL 5F9JB 2V7HA 4TRPL 4YX2H 3LRSB 3K2UL 3NCCB 4JB9L 3OB0H 2R4RH 3S35L 3TBTA 1MF2L 4APQC 3P30L 1D9KA 3MRRB 3R0MA 2I25N 4GRLD 3FHQA 2BNRE 4UB0H 1FO0L 4TQEL 1F6AB 1PLGH 3ULVH 4PJCE 2SEBB 5DHYB 5CLWA 3W0WB 2CH8A 3NAAL 4P23C 4WU7B 2ARJA 1KCVL 5FA3A 4Y2DD 4GH7B 5BVJB 2F19L 1IQWL 2HLFD 5IVZA 3QFJD 2AEPL 5CD5D 2R0WL 2V5SA 4HPOL 3DYPA 1AKJA 2IQAB 3FB8A 4NC1C 2G75A 3WJJC 4QO1A 1QLEH 4EOWL 4D0DA 3GSQA 4LLYA 4IMLA 1W0VA 2YD6A 3FHAA 1F02I 3QDJE 3ULUC 1XIWC 3WFDH 1ZHKB 4HUXA 4OTXL 2J4WL 5HSFA 2C3WA 4CMMA 3IDGA 2YD9A 3FKUS 3H9SE 3EDKA 4GMSH 2Q8BL 2VXUL 5CJBA 5DJAB 5KS9A 3BIKB 3SE4A 4U6YA 1TQCC 5L0QB 4YFLF 2Q7YA 4IJ3C 4C58B 4FP8H 4KGLA 1FDLH 1U2CA 4XP1L 5C9JB 2ORBL 3TBWB 1R5IA 4LEXL 4N0FA 3LQAC 5HBBA 1DVFA 3OX8B 4NN5B 2EICA 4AEHH 1TPXC 3A6CH 1T83C 3BFOA 4KHXH 3OMZA 3KLHC 1D7FA 3LKRB 5DHVB 2KQMA 1ACYH 2XV6B 4XI5C 2DS4A 1IGTA 1WAAE 1AD9B 1DSFL 2YPLE 3WKNA 5IVXF 4PJIF 3DMMC 2OP4L 5F1SA 1HI6B 2PCPB 4JKPH 3D3VB 4XVJH 3V8CA 1GHFH 3CH1A 3HPJA 3ABZA 4N9GA 1I3GL 3QDME 4I2XE 5GGUA 4I3GA 1YC7A 1TQBC 1OB1A 3QQ4A 2P7TB 2CK0L 1OQXA 3RUGA 4Z8FH 1CK0L 2K3TA 5F88A 3GSUA 4OCXL 3WIIH 5EUKB 3DURB 2XT1B 3SDYL 5E1AB 1FGNL 4MDIB 2HFEA 2BX5A 5L2KB 1MCWW 1IBGL 3NTCL 4JHAH 2AXJA 5EBLA 4XMLL 5DD0H 3GJFB 3TN0D 1UKTA 1YEKL 1ADQL 3PABB 2W9EL 1G6RB 4PRPE 4LCYB 2IFFH 2AJZA 3KPMB 4UT9L 1KTDA 4W6WB 3WUWB 1FZMA 1RJLB 1UA6H 2BJMH 5IOPA 1IM3A 4R3SA 2AV7B 3ARWA 15C8L 1MUJB 2J6EA 1NCTA 5CGYD 3HZVB 1GIGL 4U7KA 3MRJA 4LLMA 5CUSH 2NXZD 2J2ZA 4WFFE 3CFCL 2XNAA 3OAZK 1BJ1H 4P5TB 4ZFZA 4NQUA 2G60L 4UIKL 1A7OL 2E9IA 3OHXA 5FYJE 1QNZH 4JM4H 3ROLA 3BPNB 1PW3A 4P48A 4YBLB 4X99B 1WWAX 3AXLB 1J5OL 3L3OA 2F15A 3IFPB 2M8XA 1L7IL 3O6FA 1LWRA 2DQFB 2EYSA 1DQQB 2FX9H 1JZ7A 6CGTA 2B0SH 4ODSL 4NKOA 3VXQA 4ODBD 1I3RB 1TTUA 1EEUA 3VXUD 5DJCA 2C1OB 2I07B 3WS6A 4HUUB 2YKLL 2DMBA 2JJTC 3NA4A 4QRPB 4XHJD 3QXDB 4HIHA 2MTPA 4D9QD 2FJGA 2IG2H 1EFQA 1CFQA 1DBML 1LEIA 3HR5A 1Q0YH 2VL5A 1CXKA 1WC7A 3IFOB 5LCVL 4Q0XH 4Z77A 3VCLA 3ET9F 5CGTA 3QCVL 3BDBA 1MI5D 1RZJC 4LCCA 5I30L 1A3QA 4JPVH 1EHXA 1AGBB 1MNUH 3TJEL 5T1KB 2CUMA 2R23A 1MH5A 1MFAH 1FZKB 2IAMB 3INUL 1MWAH 1NAML 3IDJA 1D6VH 5D7IF 3I75A 2A9NH 5KSBE 1OSZB 1Q38A 3EFDL 2FIKB 1OAYL 4XB7A 4HKXA 3RTQB 1DEEB 5IVXB 3LN4B 4PJIB 1RUPH 3RL2B 3MFFA 4Y88A 1DBJH 4TNWF 4WO4A 2FX7L 2KZWA 3HS0A 3FCTB 3ZKMD 2X09A 3RJQB 4EEEA 4R26H 3AU1B 1OT2A 3LEXB 4GQPH 2JB5L 3V6OA 4S11A 2Y4SA 4P57A 1CLYH 2MPAL 1A1NB 5GRVL 5FCUL 1AXTH 3TWCL 3VXOB 3RWIA 2BNRD 1UENA 1O5DT 4OCRH 4XCFH 2WLZA 5IESH 1U3HA 3C9NA 4R4ND 1ZT4A 3SO5A 5FKPB 4J3VA 3PJSA 1EA9C 3C09C 3HC4L 5KSUB 1XF4B 3BKCH 5CWSA 3S34L 4QOKE 1HSBA 2D7TH 2VR4A 3T0EB 1TJGL 4A6YL 1JZ5A 3KPSB 1FRGH 3HNSH 1LE9A 2YUZA 1MCLA 3QDJD 3LN9A 2CO6B 4XPBL 5DUBA 3ULVE 4MA8H 4M1DH 1BECA 3D0VB 5IBUG 3K8MA 4Z7OE 1AR1D 2GUOA 4Y7MA 4JRXA 5HY9A 1MLCA 1CFVH 2Q76A 4HWBA 4PLJD 4P2OC 2YRZA 3PL6C 5DURD 1HEZA 4JFDB 5MI0C 3LHPL 2W92A 2B4CH 4F58L 1PSKH 4KKNA 3BVNB 2IGFL 4S1DD 4CVZA 1QFWL 4ZD3H 3T4YB 2LFGA 4E42B 2MNUA 3IGAA 3BH9A 4PJDF 4XAWL 5IW1B 1UM6L 4J4PD 2AQ3A 4FQHB 2CGRL 3MJ7A 4P5MB 2QBWA 3I3BA 4NQDB 1H3PH 3WHE1 5E6IA 4PJXF 1F4YH 4ZAKB 1EHAA 2QR0B 1FN4A 2O5YH 3DLQR 4OQTH 5B3JF 5HYJA 1QBBA 4GRMB 2OL3L 1R3IL 1XEDA 4I48A 4TTDD 1A1OA 2A6DA 4JO2H 2A73B 1MEXL 2FL5B 3PV7A 5CKAA 3QHFH 4QWWC 3KYMA 3MBEB 3OZ9L 2NY4D 3MA9L 2BSSB 5DJDA 3RWJB 4KJWD 4P2QB 4NUJB 4YXHL 4QRRB 1N3NA 3GSRB 4GBXD 4CU8A 1NC2D 1F3DJ 1XGRA 4BH7A 1QFUL 1J1OH 5HDLA 5D7IB 4YPJA 4M7LL 2JJSC 4ELMA 1GOHA 3BZFA 5E2WL 1WWBX 2Q6WA 4BK5A 1G9NC 3UTZB 1HH9B 3HNVH 1IC4L 3KVQA 4L4VA 4PRPD 3FT3A 3LEVL 4X7SH 3VW3H 5HHPB 2J8OA 1FFOA 3VFTA 1BFSA 3T0VA 3NA9L 3FTGA 4HKZA 4OLXL 3W11D 3WNNA 4ZFGL 3P73B 3TIEA 4LBEA 3TLRA 1EO8L 3MLVL 3ARDA 3BO8B 3S36X 3WIHH 3BRFA 3O6ML 4R97B 2W0PA 5JXEA 1NCAL 5IMKA 4MAUH 5ESVB 1CU4H 3QUKA 5K59E 1GGIL 5C0RH 4M7JL 3P9MA 4QEGA 1CF8H 3G9AB 3JBG7 1S8DA 4XXDB 1YNLH 5EU4A 2VDLH 1WVZA 3RAJH 1SVZA 4XZUA 2LQRA 4CN4A 4WNQB 1U8HA 1T2XA 3EUUA 4XP6L 1C08B 5HHOE 3U7WH 1OAZH 5CILH 4HEME 5AEAA 1LO2H 5ESAA 2EDXA 3CFEA 4U1LA 3B6SB 1NAKH 4AYFA 5DK3A 1ZVSB 4UV4L 1ES0B 4KTYA 4U1JB 2E9JA 4KFZC 4GT7A 2Y36L 4GAYB 1S9VB 5GS0H 1R5VB 2NY1D 3QUYC 1QO3B 3CFDA 4NFBA 5JO5B 3LDBC 1U8JA 3CK0H 4RGMC 2AQ1A 1RFDL 5FB8B 5FGBA 2GSGA 4P4KD 2BERA 5E08L 2QQLL 1HINL 5F9WB 1H3GA 4FQ2H 1KLUA 2DQHH 3HMXL 4GG6E 1KPRB 2EC8A 3HG1B 3U6RB 1JPTL 3C6SA 5ACZA 4WEBH 3GMNA 4J8RA 4PJDB 2JB6A 2VXTH 3L1OH 8FABB 2DQDL 4HC1A 1IGCL 5I1GH 3GMMB 4X4YA 4K3GA 1ACZA 2IQ9L 4PJXB 1RMFH 1N6UA 1P7QB 5FIEA 1LO3L 3CDFA 2Z93A 4HUWB 4WUUB 1SY6A 3I2CH 5H35A 1Y18B 1UKQA 2ADGB 4K3DL 4MCYB 1FV1A 3F12A 1NQBA 5KOMC 3ES6A 5DDHA 3UO1L 3D0LA 3GK8L 2PF6A 4Y19A 1U95A 5TE7L 1QSZA 1KGCE 2HT3D 5TFSH 4D9LL 3AC0A 2Y06H 4ZXBB 5BRZD 3BT2H 5BO1H 2V7NA 5ABDE 1K3IA 2BY3A 3BUYB 4DKFH 1FO0B 2ITCA 4Q9CA 1B90A 2A0LC 3NGBB 3FQRA 3ZYOA 4QOKD 5J6GB 3LPFA 2CDGB 2IANE 3T3PE 1BZ7A 4CJ1A 5LQBH 1J1XH 4U1SA 1W72L 4HXAH 5I1HH 1XF3A 3SKNA 3VD5A 4LCIH 4GO6B 1A4JA 2VQTA 4ZYKA 2IEPA 4RMSA 1U91B 5B3NA 1WBZB 1I7RA 2DQCH 4LLUA 4JAMB 1O7VA 4XAKE 5D1QB 4OD1L 1HQRA 3UDWA 2H8PB 4Z7NF 1E28B 5E56A 1AGEA 4JDZB 4NJAH 2ZCKL 4ODWB 3RNQA 4M43H 1A1MB 1E4XI 2VZTA 2DICA 2D0GA 2C7UA 3O11A 2ZUWA 1YA5A 1NCWL 1MJUL 4NKIH 4XBPB 5DJYA 5KSAD 1ZLWH 5EIIB 1F4WL 2EEBA 3KJ6H 5EOCL 1F8TH 3EYOA 5IGXL 5IHLB 4OZHE 1VGKB 1QZ1A 1BQHA 3MNVA 3GO1H 3V6ZB 3OXRB 3U0PA 1QHPA 2VDNH 1A14L 1P5VA 2VWEC 4C56B 5IBTH 2WINA 3JUZA 4PRID 4BKLB 2JKXA 1T4KB 4DVBA 1AIFA 1GXEA 4MD0B 5D72H 4NRXA 4H88L 1XMWA 2QADC 3BQUC 1B6UA 4KZEH 5HGHB 1K8IA 1ZHLA 3PWNA 4ZOBA 2GITA 3CVHA 3OTTA 2PXYA 1UQSB 4NRYA 5IFHL 1AGFA 4Z6AT 2HVKA 4I1NB 3U7YL 2FR4B 4G9FA 1GZQB 1UCBH 2P24B 5D7JB 1KNOB 1G7MB 3IDYC 4Z7UF 1YC8A 1SBBA 2CJUL 4Q74A 4X83A 4JR9L 1YEIH 5FEBA 3LEYH 5F9AC 4HXBH 5E8EB 4Y2DC 5IROA 1UJTA 4Y5XB 5EZJA 3NABL 1FNSL 1T5WA 3VFNA 1ED3B 3WJLC 5I15L 1JI1A 4OCYH 1T1ZB 5JMOC 5CD5C 3E6HB 2P44B 4HH9A 4OZGF 3KDMA 2WBKA 2I9LA 3ZL4H 4HG4K 1OW0C 2ZUYA 2EXWC 5DA0B 3A67L 3MYJB 1MELA 1B4JH 5DRZA 1IKNC 3IJSB 3MMEB 4PJHF 1DBBH 4R7NA 3K4AA 4LMQE 2NXYD 1F42A 1HWHB 4S1RL 5F3HB 5E5RB 2F5AL 5BS0D 2DM4A 1U8IB 3VA2C 3KNBB 5MP6H 1X6NA 4PJ5D 3C2AL 4HUMB 3C6LB 2DTSA 2PN5A 1R0AH 5AZEL 1NBVH 5DFTA 1U36A 5I1CH 2CPCA 5EUOF 1IGML 5D1XD 4JZOA 3MGOA 1X5YA 1BJMA 4MNGB 1EEQA 4HZLA 4NPYB 5FYKU 5TGBA 1BX2B 1LO0H 1XGQB 3VWJD 5HPOA 3U2SB 5GSVA 1J7VR 4G8FB 3S88L 4ZO8A 2QHRH 4I5BB 4YHNA 2E27H 1BVKA 3VFVA 3HI5L 2Z8RA 4D0CB 5JDJA 4ORGB 1NCUA 2OJEB 4BQCA 3H7BB 5DYOB 3LRGA 1WZ1H 5L0QC 1YMHB 1ZK9A 1GVIA 4KI5C 4PD4J 5GRUL 1IM9A 4I0PB 4LHUG 3BYYA 5ECJE 1GPOH 1JGEA 3SBWC 1HE7A 2W1NA 5IG7B 4EUPB 5ISZB 3Q3GB 1MREL 1IILE 3MJ9L 4LRNL 5HYQA 4WI5A 2VITB 3RWEA 5M7QA 1AY1H 2XTLA 1N5AA 1NGPH 5BV7H 2PYEE 5C0IA 3OKDB 2UYLA 3CFJB 2JK5B 1XCQA 4K9EC 4MS8D 3L6FB 4TUKL 3A6BH 1VPOH 4PRAB 4PTTB 5I1JL 3VGBA 3ILQD 4W68A 4LU5L 5ESQB 3B2UD 4QCIB 4I0KA 1FNEA 4N8VG 3R4DA 1Z5LA 1NAMB 3IXTB 5EFIA 2F74B 3HRPA 4KDTA 5IM7B 1WBYA 4KJYA 4WFEE 3UTTD 5IHZA 4IDJH 4I3SL 3ROOB 1TZIA 1CE1L 1GRWA 3VGEA 5CP3H 1V7MH 5DR5L 3TYGH 1F3JB 1SYSA 5CGYC 4NQTA 3MRHB 2RFXB 2NXZC 4LPUA 1S7UA 5ENWA 1MY7A 5HGDA 3HAEB 4O00A 4Z7UB 4X0KB 3VFPB 2HFGL 2X05A 3VE0A 4JFYB 3MROB 2P8LB 2AK4E 5T1DL 1FCCA 1GZPA 1CIUA 3MA7A 1DDHB 1H5BC 1P5UA 4FNLL 3DX8A 2FECL 2X4NA 3MUHL 4QHKJ 1JPST 4OZGB 4U31A 5EA0L 2N7BA 3MRMB 5GGSY 2I60L 5JW4N 1CD9B 4XNZB 4NP4H 5DSCA 3OXSA 1UB5B 4A6YB 4P5TC 1FPTH 3CZFA 1KN2L 4XHJC 4PJHB 4UZGA 5BW7A 2E8YA 4XAKD 4CGTA 5DS8A 3DX9B 3BPNC 4TULL 4YBLC 5K9QI 2NY7H 5E5MB 2V17L 3BHBA 4OF5A 1JF5A 4BSWA 4NT6A 1RU9H 1VEPA 4R2GB 3WLWC 1UWGH 1EO7A 2GJ6E 3OWEA 4MCZB 2XPGA 4RA0C 3SDDA 1QACA 4U2ZA 4X6DF 4PJBF 2VZSA 1EMTL 4PJFE 5EUOB 1IMHC 5F97E 3FO1B 5ID0A 4Q9RH 1PZ5B 2ZJSL 5IT2L 1BGXH 1QPXA 5EBMA 5C1MB 1RUKH 3C8KB 1MCIA 4RMVA 3RWDA 3NPSC 1X5AA 4Z18A 4O2EB 4YHLH 1U92B 3EO1A 3CXDH 5DVOA 2Z8SA 1WT5C 3ME0A 3L3HA 2YPVL 3MLRH 1AHWB 5ITBL 1ZKAA 3IDXL 3L3JA 3HN3A 1A0QH 4OLVL 3MRIB 5F7DA 2OL3B 1MCNA 4AT6A 5F6IB 4UQ2B 1I1FB 3SDAA 1AGCA 5E2TH 4JM2D 2IAMC 4RZCA 4HCRA 1CN4A 3OGCB 1PG7W 4KPHL 1XGPB 4R4FL 4TNWK 5DQDH 1XR9B 5EU5B 1H0DB 1MAML 4C57C 2P1YA 3L7FA 4PP2A 3QIUD 3U4EB 2E8ZA 4NO3B 4R4NC 4ZPVA 4AM0B 5DF0A 5KJRH 4XPGL 4KQ3L 3SN6N 4W4OA 5FM5M 4FA8A 1AI1L 3HI1B 4WWKB 3MLTA 4QXUL 3B43A 4QXGH 5E2VL 3PGCB 4WFHE 4YK4B 3PDOA 2GJZB 5EULV 2GTWB 1T89A 3MLXH 4OKDA 5IB1A 3NIDE 3RY6A 3W2DH 5J9PA 5JXAH 3DXAE 2L0DA 4L8BA 2O61A 1J8HB 1KC5H 2W9DH 4CVXA 5K33A 1R3JA 4K07A 3MLSH 1JUFA 5F9JA 1PG7X 4AEFA 1C5DB 3SE3A 3LRSA 1JP5A 1JWUB 1YDPA 5FKAA 3VFRA 4ZS6D 4Y5YB 4M7KH 3KXFB 4E41B 4PLJC 3BD4A 1CI5A 2W07A 5ADPH 4AEIH 1TETH 4UNVA 3GJEB 3MRNA 5J1AA 4PBXA 2SEBA 5DHYA 3L5IA 4HT1H 2R2HB 1CDUA 4HS3A 3QA3A 3QG6B 2WWMC 3RIAK 4LCWD 4MX7B 2VLRD 4TYUA 5BVJA 1XF1A 4E5XB 4P5KA 1N8ZB 3KR3H 3FAXA 2V9TA 5L88L 2A1WH 4HDIA 1MJ8H 3NOIA 2XZAL 1H3WM 4KK6C 5IMMA 1XCTB 2J5LB 4F7CA 4WHTB 2DQGH 3IFNH 4M1GH 2V2TB 4DW2L 4P46A 5F72S 2G2RB 2Z31A 4DN3H 1JNLL 1DN0B 5DJAA 4RMRA 1CVSC 2UZXB 1Z0NA 2PYED 3ZDYF 3FAWA 4KJWC 1AE6H 4X6DB 3IU4L 5GJSL 1ZV5A 4PJBB 3G5YB 5ETUB 2Z92B 2WWKT 5J12B 3D5OF 2W38A 3QR2A 3EYSH 1E4KC 3HUJF 5GS0D 3D69B 4OF6A 5C0BD 4F15B 3TBWA 4YE4H 2KH2B 2OR8A 3I3EA 2OI9B 3KYNB 4OCMC 1Q9KB 4LLQB 2AV1A 5HHMD 5FYJL 5CZXD 3BP5A 2AXHA 3GHEH 3V52H 4WI2A 3RPIB 4LIQH 2ZSVB 5CEZH 4L8DB 3D3VA 3HC0B 2E7MA 2X7LB 4MJIB 3SE9L 1WUNT 3QUML 4O5LL 5DI8B 1ZEAL 5CINH 4YDJB 4OGXH 1PQZA 2P7TA 3VRIA 1JNNL 2ZCLH 4QRUA 3VFWA 5HVFB 3S4SG 3ZKND 2BVQB 2HRLA 3MRLA 5EUKA 1KCLA 5T5FH 4GG8A 1I7UB 2I24N 1UM5H 3X11B 1EUTA 3VXPB 3QUXB 5E1AA 1CXLA 5CCKL 5D9SA 2F53B 2OR9H 1OGAA 1HKFA 1AP2A 3OKKB 5L2KA 4D9RE 1FZOB 1JWMA 5F7WC 4HKBB 4HWEH 1A8JH 3GSNH 4JFEE 4NKMA 3TNNA 5JHDA 3RFZC 1MFBH 2M2DA 3SDCD 5KW9L 1UZ6F 4R9HA 2XN9D 4PG2A 1PY4A 1JTTA 5F1IA 1CGWA 5C92A 2FJHA 1W72B 2FEDD 4F37F 1BD2D 3KPMA 4R97C 2V5MA 4G6FD 3FQUB 3V5DB 4DN4H 2R0ZL 2NY5L 5BZDB 3VG0H 4MHHI 1T3FA 1OAKL 2NY1C 3P4LA 4NCDA 3HZVA 3RWGA 2H6PA 4QHLA 4D3CH 4U3CA 5IB4A 3SOBH 1U42A 1F3RB 2B8OT 4OB5L 4HK3J 4Z78A 5C08D 4XWGH 4L3EB 2BOCB 5EO9B 4X99A 4XBEL 4LOUD 2ZP0T 1QSFD 4JO4L 3QDGA 1R3LA 3IFPA 1IEBA 1S3KH 1DQQA 2XI9A 3DUSB 3D85A 1I7ZA 1RULH 4O58H 5DJXB 1I3RA 5JW3H 1FYHB 1YMMB 3VFGH 3ZMRA 4TTGA 2C1OA 3MGTB 2I07A 2Q87A 3LQZA 4YQXH 5C07B 2X4UB 1DLHB 1RUAH 3IDNB 2WUBH 3Q5YA 1BMGA 4MAYB 3GI9L 4NM4H 2FSEB 5FM5O 3PGDB 1KYOK 2NTFB 3LZFL 4ODVH 4Y4KA 4EVNB 3D2UD 2JIXD 2MQ0A 3P3YA 3QEUA 3BPOC 1NEZA 4Q9BA 5B21A 3IXAA 4NRZA 1IC7L 3ULVL 3UP1A 3H2WA 2MCPL 1MLBA 4X5XA 1AGBA 4ZTPH 4ACPA 5GGVY 1DANT 1MCPL 1NFDF 1Q0XL 3OPZH 2NW2B 3HUJB 3BXNB 2CR3A 1D5XB 1IEAA 1OY3B 4OLWL 1G0XA 4WHDA 2CIKA 2BVOB 2PETA 2R2EB 4N8CH 4NYLB 5D2NC 2Y23A 4QXWA 1YN7A 1WTGT 1F97A 1OSZA 3TF7C 3PWUB 4OF8A 1A7NH 2WP3O 5KN5B 1EJ6A 3DXAD 3RTQA 1JHKL 1DEEA 3JWOL 5IVXA 5AYUH 3RL2A 2WV3A 4D8PA 2R1XA 1CFBA 1IGIH 2NY6B 1B0GB 1JN6A 5FDYA 3FCTA 3GMOA 1E27B 1N4XL 4ZXBC 4XP5L 3UTSA 1IAIH 3VRJA 4FG6D 2FATL 1A1NA 4EIGB 2ADFH 4Z7VF 1AO7A 3QQ9D 3VXOA 4L8CB 1YEHL 3GDBA 5F3BA 1BOGB 5AD0A 3DVGB 3QO0B 2AJUL 4NHUB 4JFFA 5I19H 4JG1H 5E95B 4OLUH 3IJYB 1KCSL 4Z7WA 3VH8B 2GFBB 5LGHL 3RL1A 2IWGA 1KXTB 2KDGA 3P4NB 2DBJA 3U9PL 1UZ8A 3PWPB 1MVUB 4JRYE 3T0EA 4Y1AB 4XPHH 1NBYA 3ZE1E 4PB9H 4YDIH 3HE7D 4G6JL 4OKVA 3BH8B 1IGJA 4PJCF 1IAKA 4IIQB 5CJXC 1DQML 2IALB 3GBNH 3H3PH 1MY5A 3R1GH 2Q86B 4D0BA 4PREB 3RY4A 5SV4A 3D0VA 4WTXA 3DV4A 1MFEL 4RIRB 1WBXB 1DP0A 1S9XB 1YEJH 5A2FA 2C3GA 5CJQH 4YWGL 3DYOA 4JO1H 4PTUB 5DO2D 4JHAL 1LO5B 4E42A 1XGYH 2H9GA 5DVNA 1CVRA 2PO6B 3WD5H 1G1CA 1PKQB 3TH4T 2CKBA 3VG9B 4FQHA 4M3KB 3IS1X 2VLME 5TF1H 4Z5RB 4NQDA 4K94H 3ECBA 2DDQH 2OX5A 5GRVK 4LKXA 1BJ8A 4ZAKA 4LVHB 1T1XB 1X6LA 1DQJB 3RGVA 5DMGD 3DRTA 3TPUB 3WE6B 1AXIB 4NM8H 1C16A 5D7JC 4Q6IA 3QWRA 1BVLB 3FMGL 2FDBP 1U0QA 2FL5A 4KU1A 1I8IA 3MBEA 5GGTH 2VLKE 3JWNC 1R3HB 5GZND 3M07A 2DQJL 2Q3AA 3QUZB 3LY6A 1IC1A 2X41A 5FYKH 3QIBD 2C3HA 4NUJA 4HJJL 5AYQA 3CPLA 4QRRA 2YC1A 1WAAF 1NFDB 3V9FA 4U3HA 2Z91A 2VZOA 1J10A 4LIQE 5AG8A 5TE6H 3JWDL 1GSMA 1I9JH 5H94B 4NQCA 3PE9A 3CX5K 1JZ2A 2B0SL 4MA7L 3UTZA 4QF1A 1HH9A 3FFCE 2H45A 1ZHBA 3DGGA 4LHQB 2AAVA 2CLZB 3OKLB 3Q2CA 3UCRA 5D6DC 3FT2B 4FN0A 1MHPH 2AERT 1MAJA 3S37L 1F90L 4UV7L 1KIUA 3C6LC 3O6KL 5GGRB 3KJ4B 4BSVB 5I1DB 1S7TA 1YNKH 3DBXA 3G08B 4Z7VB 3T1FB 1ODAA 2R0LH 4NKDB 4HK0B 1A6TA 3RBSA 4PJEA 5KVGH 1WIUA 4V2CB 3KPLB 2DJSA 2UWEA 3IFLH 1HXYB 3NCJH 4G6KH 5L7XL 3FONB 4NSKB 1NEZG 4P2RB 5F7UA 4JG0H 4DFIA 1JMZA 1KPUB 2QQKH 2VDQH 1D6VL 5K93A 4XMKH 4MS8C 1B2WH 5FHBH 1C08A 1RURH 2XFXB 1PVHA 3DETD 3O81A 3QBTB 3VD4A 4Y8DC 1W0WB 4NZRH 3ILQC 1GC1H 4KDVA 4I0PC 1AD0B 1RUPL 3B6SA 3EOAA 4LHUD 1C5BL 3E3QC 3NCBB 4GW4B 2X6MA 4PJCB 5KVDL 3B9KA 4WI9A 1OP3K 4LAQH 2WZPD 5JQHC 1R5VA 1FL6B 4GW1A 4DKAA 2R8SH 2VQ1B 5T3XH 2HG5B 4OCRL 3U4AA 4XCFL 4F8TA 5HVHB 3EZ8A 2XA8H 5JPNB 5FUOH 1CICB 1LK2A 1MHEB 3CFKB 1JHTB 3W9EA 3QQ3B 4PJDA 3P0GB 2ZSWA 4ODTH 2RAMA 4LQFH 8FABA 4NO0B 1BFVL 2WMPA 5I76B 3H9SB 3WSQH 1KEGH 1CCZA 3LKQB 4XCEA 4PJXA 2FBJH 5EO0A 2DYPA 4MDJA 5F7EH 3LKOB 5HGBB 1CXEA 4MA8L 2EDYA 3P9WB 4S1QH 1EFXA 1Y18A 3DYMA 2ADGA 1FSKB 4MCYA 1I9RH 2PTVA 5HI4D 1A3RL 1BOYA 4KRPD 4HG4J 3MRPB 1T1YB 3S3PA 2F54D 3QPQD 2XZZA 1UG9A 5F9OL 2YPLB 5DVLA 1IQDA 4ZD3L 2R9HD 4XVTH 1PY9A 1U2HA 4U05A 1A9EB 4HH8A 2HFFB 1WWWX 4P0DA 4K7PL 4QTHB 4YHZL 3QDMB 4I2XB 5FGCE 3OKNB 3RU8H 1QVOB 5IMOA 3KGRA 1N64H 1J87A 1HOCB 1CDHA 3SGJC 2B4CC 3NACL 3K4DA 1P53A 2WM0A 1TTFA 4LFHD 3ARGB 4HAGA 3HCVA 3TA3B 2L4OA 4KRLB 4JZJB 2IH3B 5D1QA 2LABA 3ARSA 4GXUN 2VXQL 3BKJL 1S7QB 4QRQA 4JPIB 4JM2C 2BNUB 1BBJB 3Q5TA 5CBEB 2BNQE 2YZ1A 1P4IH 3RJDA 3CCHB 3FN0H 3SGEI 1AHWC 1NJ9A 3HNVL 1VGKA 4Z7OF 3V6ZA 2W0FB 4XRCB 4QHUA 3ARZA 4LQ1A 4M1CD 2X4PA 4ONGH 5F6IC 1T2QH 4WVRA 4BKLA 4PGEB 4CW1A 1T4KA 4WTZG 4FQCH 4YDVA 3KS0J 3DROA 4R0LB 5HGHA 1G6VK 3QO1B 2GCYB 2FBOJ 3QXUA 3QAZC 4CVWA 3UTPE 3N85H 4M02A 1JK8A 3JV0A 5E6ZA 1ORSB 1HDMB 3VRLE 1UQSA 2Y5TB 3CC5B 4E0RB 1QRKA 3QUMB 4WWKC 2FR4A 3STBA 2P24A 2IPKA 2MSPA 4P9HH 1KNOA 3TYFB 1EVUA 2EIBA 4YK4C 3HRZB 4ZS7L 4PFEA 2A9MH 3GFUA 4K2UH 3PQYD 5CEZD 3VXSE 5SWZB 4HS8H 3C60B 4RA3A 1TCRB 1KENL 4BZ2H 3H0TA 4FZ8H 1JWSB 5B38G 4OD2B 4G7YH 5E8EA 4CVUA 4Y5XA 3FFCD 2R2BB 2DQUH 1QLFA 3E1F1 3DV6B 4LDEB 3E6HA 4I8DA 2FO4B 2MHAA 2CDEB 4XHQA 5CAYB 3O3BB 5BVPH 1XZ0B 2J88H 1ORQB 4QT5A 1WICA 5KTEL 5JUEH 4JQIL 4Y5YC 3OQ3B 4HMCA 4CMHB 5ITFA 4JANB 4H1LB 3MMEA 3FQXB 4TSCL 1DFBH 4ENED 3QIWB 4K55A 3TEUA 2VDMH 4HULB 1L7TH 4W81A 4QHKI 1YYLL 3OAYK 4X5WB 4NHCH 3TO4A 3U79A 3MV8B 5DVKA 1QFPA 1BWWA 3KNBA 1BBDL 4PGBB 5SX5H 2G5BB 4FQ2L 1N7ML 4NFDA 4MXWH 1Z2KA 2YBRB 2CLRA 4B53A 1HH6A 5E8DH 2J5LC 3WYRA 2RGSA 1ROWA 3P0VH 5GS0C 4NWUL 2O5ZL 5DJ2B 3HFMH 4UQ3A 2JJUA 1IGYB 2HJLB 5F1OB 1RMFL 5DT1H 1QKZL 2A6IB 3BE1H 4HQQL 2BP3A 4KMLB 1S9KC 2XACC 4YO0B 5CZXC 2NZIA 2QEJA 3EYUL 3OB8A 4IOIB 4D0CA 5K59F 5ICZA 2OJEA 3V7AG 5DYOA 5A2IH 3GZKA 2ILLA 4ZTOH 1Q8MA 4LL9A 2VMFA 3TVMA 3LKNB 5J12C 3QFDA 3MJGX 5LXGH 4F15C 5JHLL 2JF1A 5TFSL 4EUPA 1YY9D 5ISZA 4TVPE 1P2CA 4MWFB 3BT2L 1A6WH 1T66C 5BO1L 1NDMA 5E9DD 2MQ3A 2JCCA 3KYKH 2JK5A 3KLDA 4BH8B 1OGAE 1MCJA 4TNVF 3EFFA 2XWJB 3UPAA 4OCSL 3L6FA 2KQNA 2DN7A 4I4WA 1WFOA 4PRAA 1CGSH 4MMXC 1IRAY 5D7SL 4R7DB 1CXFA 4Z95H 4QCIA 2NY2B 5T3XE 1MRDH 1IAOA 3IXTA 3QZWG 3SDCC 2F74A 1P4LB 4JKWA 1A6VL 4OGYL 1L0QA 2FCBA 1OCWL 5FO9A 5I8EB 4WW2F 3MBXH 5F9DC 3SCMA 3I6LE 4NIKB 5J6HA 2DQCL 2OQJA 4WWID 3VXRD 4PRHA 3QUXC 3QNXA 2RFXA 3KWWA 1DN2A 4YBHA 5DJ0A 2FGWH 2VDRH 4G42A 4Z7UA 3O8XB 3V0WH 3AREB 1MIMH 4F37K 5DMKB 3NH7H 3U83A 4JFYA 1K9TA 1ZWIB 4BFBD 2I9TA 1DDHA 1K8DA 4Q7DA 3C5JA 4HK3N 1JPGB 1FG2B 2WP3T 2VSCA 1A47A 2QQNH 4PGZA 3TCXA 2VDNL 2WW8A 1AXSB 4ETQB 12E8H 4PRBA 4GAGL 3MZTA 2WK2A 3MCLH 4H8WL 3MXVH 1U6AH 3RDTB 1T7WA 1TIUA 4IRSB 4NDMA 4OFIA 4LDLB 5I9QB 4PJGA 4A6YA 4DOHB 3CSGA 3O2WL 2EDFA 1DL7H 4LPYA 4UINL 5JPMB 4K23H 2CQVA 4MXVE 1DEDA 1V8HA 3BAEH 1RZ7H 5F1KC 2GT9B 3LN5B 4X6BB 3T3PF 5E5MA 2EKSB 1QSEE 3SGKA 3C5SB 1RJYA 4K7FB 1LE5B 4QRTA 5FK9B 1HHIB 5TQ2H 2BY1A 3EJZC 1YN6A 1ZHNB 4LAJH 4JN1L 3EO9H 5MEQA 1OHQA 2A83B 3MACH 3VWKA 1T20B 3FO1A 3T0AA 5CEYB 5J11B 1PZ5A 4HWBL 4OCYL 4R8WH 1PJ9A 1H15A 3MRQB 4RQQA 4YC2B 4EI6A 2CKNA 1FFQA 3AVEA 3ZL4L 1SJVA 1U92A 4KAQL 5IV2B 2PW2B 2EDNA 2OTWB 4HHAB 4YGVB 2PTTB 1NFIA 4WHYG 2ICWA 1FE8H 5EORH 3ULUH 1QUNA 4DVRH 3LIZH 4YEFA 2OL3A 5HHOB 2E9WA 2V5RA 5CLTA 1DLFL 1UJ3B 4FFYL 3ARBB 5LWYL 4EKXA 4OFYA 1R0AL 5TJWK 1NBVL 1XR9A 5EU5A 2HT4C 2P5WB 4JFFE 1FNGB 1R24A 2FGZA 4IDLA 3QHTC 3U4EA 1CFTA 2NY3D 4Z7WE 5AZ2L 5SWQB 3U1SH 1L9NA 4FTVA 3N1FC 5EU6E 4LSSL 5FF6A 3LQAH 5CKGA 3ZSSA 3OSKA 1ZTXL 1CFSB 4MNQE 2GJZA 1T0NA 1LO0L 3ZKXB 1B3JA 5FYKD 4N0UE 2QHRL 5D8JH 5EOQH 1I8MA 1IC5L 4WW2B 5E7FA 5H37H 4IRJA 4OGAC 4ZUVA 1YEGL 2VE6B 4ZNEA 1J12A 1AJ7L 1TVHB 2JE8A 3JVGA 1CGXA 1NLBH 5GIRB 5FUCE 4U33A 2APWA 3TZVB 3LCYA 4XGZB 3RNKB 4Y16B 5AAWA 2AI0H 2VIRA 5C0CD 4IM8A 2C1PA 3ARFB 4WV1A 2AK1H 1LP9E 1V3JA 1CD0A 3GB7B 5IJVA 1FLTX 4HKJA 5DLML 5EZIL 3BP7B 1J0KA 1QP1A 2B1HL 3WIFA 3U46B 1A6UL 1V3MA 3QG6A 4MX7A 3DVIA 3T2NL 3P0YH 4U1HB 4M6NH 5D7LD 2DLFL 3O45B 2AABH 1YEDB 5DJ8B 3ZE0F 4L9LC 5KS9F 1JHLH 4IOFD 5JDSA 4EXPX 4AJ0A 4ZUSA 4RAUB 2BRRH 3HI6L 4XPFL 2HJFB 5CGMA 4ZFOA 1O0VA 5DMGC 3X3GH 4LSQH 4ZQKA 3H9YA 1RUMH 1V7ML 4OZFA 1OTUD 2V2TA 2XWBA 4G80A 3TYGL 2NLJA 5EN2B 4MJ5B 3VGDA 2IANB 3AMKA 2NY0B 4EN3B 2G2RA 1DANU 4WHYH 5DD6B 3T3MF 2A6KB 4K3JL 5DXWA 5F44A 1RHHA 4XX1G 5I8CA 2LVCA 3VG9C 5DRWB 4X6DA 5F93C 3BEWA 4PJBA 4OM1H 5ETUA 1OP5K 4JQXA 5HYSG 2VISB 3V5KB 1S9YB 4LVHC 1GGCH 3BN3B 1D6EB 3L3DB 3GI8H 3CGTA 3BJ91 3MUZ1 2D9QB 2OYPA 4JVWA 3M17A 3QCTH 3QEQA 4LARH 1M7IA 4G5ZL 1G0DA 2GIYA 1GGBH 1IAIM 4MVBD 4XC1H 3I6LD 3QUZC 2ZSVA 3ALXA 2X2YA 4NQVB 3HC0A 9CGTA 1HZHH 4ZPTA 4LSDA 1ZA6A 5GISL 5I17A 4U1GB 3C5ZB 3VXMD 5L9DH 3E0GA 5JQ6L 1FNHA 4POZD 4YDJA 1QA9B 4PJEE 1RZGB 4XMPL 4UBDD 3CXHJ 1RZJH 3GRWA 4WENB 4HC1H 2EO9A 2V9QA 1F4XH 1HSAA 2K9UA 4L4TE 4Y4HB 2AS5M 5HYIA 2E9BA 3AFLA 5D6CA 4UT7H 2Z0BA 2VC2H 3VI4E 5FO8A 1CXHA 2LU7A 2BSTB 3WMSA 5CEXA 1SY6H 4RGOL 4GMTH 5C09A 4HKBA 4G8GA 2V7HB 1KB5H 1YNTB 1KTLB 1RV6X 1N2RB 5C6TH 4LVOB 3KJ4C 3L7EB 3TBTB 5EU7C 3GMLA 5JORA 1OLLA 1W72A 2HWZH 3MLRL 3MO1B 2YD8A 2ZUTA 3V7MA 2FX8L 4KKAD 2ARJB 4PRDA 5FA3B 2NW3A 1CLOH 1CGUA 3KPOA 1NBQA 3WDHA 5GQBA 3V4PH 4G6MH 3ZE2E 2B1AH 2EH7L 3FB8B 4W6XB 2G75B 1FVCA 2HRPH 1D9KD 2J3SA 5KJRL 5EO9A 1W0VB 3PGFH 5HHQA 5EG6C 2K7QA 2XY1A 1UB6A 4HUXB 1UT9A 2K7PA 4CMMB 3HLAA 3IDGB 3DUSA 3QCUL 1BIIB 5E4IA 3WUZA 3O2DA 3W2DL 5KS9B 3P4MA 3V7AE 2BVEA 1KC5L 4XP9H 3S5LA 5SWSE 4WJ5A 2Q7YB 2PNDA 5FHAH 1AKJD 1DLHA 5BQ7A 5HVHC 4JHBA 3MLSL 2C3XA 2OZ4A 4MAYA 3NCMA 1R5IB 4N0FB 2BFVH 3FO0H 1CICC 2DKMA 1MFDH 5GRJL 3EOTH 4JPWL 4EVNA 1C1EH 1TENA 3QFJA 1OTSD 5ADPL 1IGTB 3QPQC 2VH5L 1NMCC 1VGEH 4L29A 4NC1E 4HJ0D 5CJOL 4HT1L 2H1PL 2ADJA 2DI8A 4JFXA 5E6YA 2ESVD 2NW2A 4F9LA 3CVHL 3BXNA 3CH1B 3HPJB 1JRHH 4KXZI 3OF6A 4MNQD 2R2EA 1U8PA 2I26N 4NYLA 1S78C 3BPCA 3ULUE 5GGUB 3UPCA 1MRFH 4LSUH 4M62H 1FSKC 1GCFA 1OB1B 3QQ4B 1DVFD 2A1WL 1MJ8L 4M6MH 5GHWH 2BMKA 2L7UA 5F88B 3GSUB 3WNPA 3UAJD 1IKFH 1OAXH 3LAFA 4AG4H 2W0KA 2FHFA 1E27A 4U6VH 2RQ8A 1RZKH 5EBLB 4KQ4L 4ONHB 2UVEA 1MCEA 4OZFG 2A77L