4W81A

Periplasmically produced monomeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb) at ph 8.0
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
131
structure length
131
Chain Sequence
MAEVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYVAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Single Domain Antibody
total genus 25
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w81A00
2IPTL 1Q9LB 3JTSA 3C8KB 2J5LC 3NMEA 4HMEA 5DO2C 3VRJB 4ZFGL 1MAJA 1MEXH 4PJXB 1YZZA 5GGRA 4H0GA 4LSRH 5HYJB 4KAQL 2NCMA 3WNPA 5DMKB 5D8JH 1R3JB 1XF4B 1MREL 2A73B 1KT2B 3FB8A 5L0QC 3IRZA 5C0ND 3QJHB 4S10A 5FO7A 5FUZH 1NBVH 2OP4L 4AEIH 5D1XD 1L6XA 4IRZH 4Z7VF 1Y6NR 3I02A 3LPWA 1RHHA 1H15B 1GH7A 4F37K 2DQUL 1FL6B 4L3AA 4BFBD 4RGNC 2J8HA 1RURH 2UUDK 3K4DA 3U79A 4EVNA 1K85A 1FVEA 3MA7B 4H20L 3RI5K 3Q2CA 4Q0XH 2PTTB 2HA1A 4JFEE 2OJEB 4R3SA 3BMWA 4FQLL 4XCEB 1BBJB 4X5WA 1Y6KR 1ZGLP 3L7EB 3TO4A 1LEIB 1PW3A 4Y4HA 1AC6A 4KHTH 5F8QC 3HNSH 3WN5A 1CFQA 1I8KB 1QFUH 2VR9A 4R97B 3VRIA 1G84A 2VL5B 3AM8A 4U1NA 4JQXA 3IFPB 3O4LD 3UO1H 1OD9A 1K8IA 1AR2A 3BP5A 1OP9A 3ECBB 5HPMB 2R4RH 2C3VB 1FORL 3AB0C 5DJ6B 3A6BH 1T0MA 4BSJA 4LASH 1BQHA 5SX5K 3DYPA 4MA7L 3ILPA 5ANMB 2EO1A 1PGRB 4G9DB 1AQDB 4R0LB 5EUOF 4LVOC 1XCQB 3BXNA 4APQD 2LVCA 2PW1A 2C3WA 3MV8B 2AQ2A 4JGJA 3GHBH 1TTFA 2EDXA 4IS6B 4C59B 1FZKB 2VLKB 4IMKC 5IMMB 1A6WH 3QULA 4NGHL 1G7PA 4I0PD 4KJPC 1RK1B 2Q86B 4LIQH 3VJ6A 3FO1B 3QQ9C 3CFEA 3KS0H 3LEXB 5DK0B 5K9KA 1DBKL 4HKJA 1HHGB 3CLEL 2ZNWA 3L5IA 4FQ2L 4L4TA 3GMOB 4F7MA 3T0DA 4DCQA 4M8QA 2YWZA 3CNKA 3L3DA 4KUZL 3CFBA 4FABH 4DQOH 2A38A 4L3EB 1SYSA 3SE9H 3H8NA 3BQUA 2PO6C 2DKMA 1N26A 2DIBA 3MNZB 4JHBA 5CD5D 1NFDA 4RAHA 4OCMC 4ZXBA 1I3GL 3SCMB 4OZ4A 4F7EA 4X7CC 1RJLA 1TJIL 1WAAE 4NQEB 3WIIL 4KZDH 3LZFH 4L4TE 1EEUA 1TQCB 3TO4C 1LO5A 4OZHB 4IDJH 1ZLVK 3MLWH 3NCCB 5BQ7B 5KS9A 3D18B 4KK5D 4XWGH 3LN4B 1LO3L 1T1YA 4Z7UA 5B3JE 3SKJH 4LHUG 1SM3H 2VAAB 1LE9B 1KUMA 1CGUA 2NY6B 2Y07L 4RAVB 1DQDH 3EYOA 4KK8D 5L2KB 1WZ1H 2ED8A 3OR6B 1KJ2B 1YECH 4P48A 3ROLB 2BCKA 5EFIA 3QWOA 3QDAA 4Z5RB 3ALPA 1HH9A 3TVMC 4BSVB 4X6DF 2BNRB 1J86A 5C6TH 3ZDYE 1H5BB 2CDFB 4YGVA 4PGBA 4DW2L 2NX5B 2DM2A 2CKBH 1CTOA 1NMBH 4YHIB 4OV6F 3VH8A 4YX2H 3O2VH 3LB6D 1TQCC 4H1LB 4XCYA 5DA4A 3HS0A 3EFDH 2QADC 3RGHA 2CH8A 3RWJB 2HRLA 3QEHB 1B4JL 4JPVH 1YYLH 2W9DL 2PXYA 3LKRA 3GKWH 1NUNB 3MLRL 1F45A 4K2UL 4X99A 4HIXH 2DMCA 1L7TL 4U3XA 5MP6L 5DEGB 3B5GA 1KENH 3OKDA 2XV6B 3CLFH 1HSAB 3HI5L 4U3CA 3S97C 4L8CA 4LU5H 4BQ8A 3GIVA 1H8SA 5I1EL 2HJLB 4PJIE 2VDPH 4RMVA 2VSCA 2IGFL 3ARFC 1H5BA 3G6JE 3OAZH 2EYSB 4HUWA 1ADQA 5C07D 2IADB 4PRPA 1P6FA 5FGBC 5ID1B 5AG8A 3ESUF 3IDUA 4M7LT 1JCKA 1CDYA 2AABL 3WXVL 1VERA 5B3JF 3EYOB 3DJ9A 3EJZD 5DMYA 3QEQB 3K8MA 2GUOA 2D0FA 4HIJB 2JCCF 1A14L 3QFJD 3D2UB 5C0RH 4OFDA 3RQ3A 1T21B 5GQBA 3FRPA 1KXQE 5IBTH 3JSSA 1LO5B 2BXZA 4MAYA 4P4RB 5JW4M 5ITBH 3QO1A 2FR4A 2X7LA 1AJ7H 3QCUL 1QHPA 4QOKA 1JP5A 3WNMA 4JFQA 5HHVH 4BZ2H 3LQAL 3T08A 1G9EA 3PDOA 4IRJC 3ETBF 4N1EA 4FXKB 1IEHA 4DCQB 4P9ML 4TTDC 1X5LA 4NC1C 4L4TB 5H2BA 5E1HB 1HCVA 5K9KB 4ETQA 1RUML 3HB3D 4X6BA 3V0WH 4HGWB 5IBLD 3QIUC 3OJMB 5C2BL 5D5MA 4U6TA 4HJ0C 3QULB 5DVNA 3IDMA 5MERB 4O58L 1ZANH 5IMMA 2PW1B 1KTDB 1UJ3A 2ITCA 5EO1A 3WFEL 5L2KE 3BRGC 2PCPB 3MRFA 3QDGD 4Y4FB 5EU3A 5IP4A 4M9OA 3B3IB 3DVGB 5D93B 3LKNA 4A6YH 2FIKA 3O4OC 4NKMB 1T0MB 2DQFA 3TO4D 1TZGL 1NGXB 3F58H 4CN4A 4FQIL 3HZVA 2YPKA 2AJZB 4Q9BA 3DX9B 2F19H 2EE2A 4F9LC 3GJFH 3H9HB 5F97E 5IQ9B 3CXDH 2ZPKH 3V0VB 1V5JA 2FECL 3VRIB 4JZNB 1SJXA 5E8NB 4LEOB 1TZIA 1OAXL 3TO4B 1DE4B 5CGYC 1GOFA 4ODWB 1MFAL 4TUOB 3RL2B 1DANT 4YAQB 2W0PA 4K7FA 3WHE1 4R3SB 1WBZA 3UAJD 4NQDD 5IVZA 2PTTA 4XAWL 1C08A 3SY0A 4YHLH 1P7QA 3ARBB 2EEAA 5KJRL 1OAKH 1FVEB 5D2NB 2NY6C 2HT3D 3I75B 3OSKA 5D4QA 3G9VA 2CMRH 3K7UA 3MZTA 1MLBA 3P0VH 1FRGH 3JUZA 3VFMB 3LKSA 3I02B 4LLQA 5J57B 2IG2H 3SDCC 2YD5A 4MSWA 4ZSOE 1TXKA 5HHOE 2F54A 3PGCA 4JR9H 3ARWA 5HD8D 3FB8B 1BJ1H 3HC0B 3EO1A 3SGKC 3V5HB 1ZOXA 1GRWA 4M3KB 2AVGA 4HV8B 3RTQC 5DMKA 3NIDE 3TV3L 3Q5OA 4CU8A 3DURA 3EJZC 4GXUM 4PJXA 3HRZB 2CRYA 1MCIA 1HOCA 3UPRA 4ZUUA 1QLFA 4ZQKB 2QR0A 1CT8B 3TYFB 5CSGA 1RJZA 2GHWB 4U1KB 1QP1A 3IFNL 3MBEB 5BMFL 4AZ8A 4R4FH 5FKPA 3WS3B 4RFEB 4NWUH 2OZ4H 4JDVA 1C1EH 2W92A 2V17L 3S3JA 3SOBH 1MELA 5CFHA 3QFJB 3S34H 5MEQA 2GK2A 4N68A 3TN0A 5I8CA 4BH8B 1KN4H 2AJXL 2NY5C 2P8MA 4LSPH 1S9WA 3VXUA 1UH3A 3STBA 4JFYB 2ATPA 2VERN 1WZKA 2I60H 5AEAA 1YEDB 2R8SL 1Q1JH 1RZFH 4ODVH 3RGVB 2ZG1A 1FDLL 1FIGH 1U8IB 5KSAB 4LVHC 3NBNA 4I2XA 4QT5A 1VFOA 1U3YA 1B0GA 3FQTB 2HMID 2VLRE 4BFIA 4CADA 3O6ML 2FEEL 5CIPB 4D0DB 4GO6B 4M48H 1BX2A 3I6KB 4AEHH 1YY8A 4C4KO 1SVCP 1KXVC 4OLEA 2NY3C 3MLUH 1FVCA 2DQTH 4OCSH 5F3BB 3X14A 1TJGL 3GI8L 4ZPVB 6FABL 1JF5A 1DQLH 3TNNB 4XH2B 2NLJA 1EA9C 1A7RH 2CPCA 3CVIH 5K9OB 3WJLA 5ILTL 3RY6C 1KCUH 2OYPA 2JB6B 5F9JB 2X89A 3FO9A 3GNMH 1JPTH 2IAMD 4G7YL 2VLMD 5EO9B 2O61A 5F96L 1T03H 4U1GB 4LSTH 3U9PH 1LDPH 3MUZ1 1DUZA 1IC4H 3QUZA 4LSUL 4OD1L 5D9SA 5FO9A 1LHZA 4EI6A 1OARH 4TPRH 3VDBA 3HA0A 5CP7A 1XF3B 1K9TA 3V6FA 2X05A 2CK2A 4MAYC 5HHMD 4X6EB 3QCVH 4Y16B 1E4XH 3GK8H 5I66A 1WFOA 4U2ZA 2F5AL 4C56B 1CK0H 3VD3A 1FFOB 5IIEB 5CSBA 4JFHD 1Q9WA 3ULVH 1RZ7L 2DYPD 3IKKA 1BJ1J 2I24N 3W2DL 1EO8H 3QNYB 3EFFB 4HWBA 3ZT7A 3SKNB 1CBVH 4JVUA 2CKBA 2ZJSH 4RAUB 1N6VA 3MRBA 3QUXA 4WW2F 2CRMA 4BYHA 4CVUA 3WUWB 2C7UB 4ONGL 3BAEL 3FOMB 5GRJL 1X4YA 4Z7OE 3MLTB 1KPUB 2R2BB 3T8XA 4XNXL 5GGTH 1LO2L 2A83A 1XH3A 4LEXH 4HD9A 3NN8A 3WJJC 3OKNA 1J0JA 1CL7H 2WQRA 4E41B 3NIGF 3OB0K 4PJFF 5C0IA 1HYRC 1INQB 4Y16D 5IGXH 1NCNA 1JWSA 3DBXA 3BESR 3BKJL 4J8RA 1KBGL 5TJWK 2FX7L 3GMMB 2NXZC 5DGQA 2B1AL 1HYSD 3V8OA 2KQMA 4WHTB 2KKQA 2VLKD 3GMNA 5B39G 5EIIB 4NQXA 1PZ5B 4PJAF 4WUUD 4JY5L 3P11L 4GRWF 4X9HA 1PG7H 5K33A 1BQHG 4WWKD 3ARBC 1CFVL 4HGKC 5AUMA 5AYQA 3MV9A 4HIEB 3AY4C 5H35A 5IB1A 4Q74A 1FNFA 2A2QT 3O6FD 1S9VB 4LGPB 4NRXA 4Z7VE 4X9IA 1Z9MA 4L29B 3W0WA 5EN2B 4UBDC 3VFOA 1FBIL 3ALXA 5FYKL 1JF1B 3O6LL 1UB5B 5EUOB 1ND0A 4I2XE 3GI9H 3JWDL 4X7TA 4AIXA 3C60D 5K9QI 1S5HB 1Q38A 2ADGB 4YQXH 3QUYA 1SJEB 3BKYH 2R2CA 4OIIH 3PWPD 4PRAA 4XWOD 1KJ2H 4NWTH 4R2GB 4TQEH 5IW1B 2BC4B 3JVGC 5GIRA 3SPVB 3DXAE 1JTTA 3VXTB 1MI5E 2BVPB 1WWAX 5I2IA 2R2HA 1W0WA 2F8XC 2X70B 3O3AA 5DJXB 5KAQG 5TE4L 2R0LH 4BK4A 5IQ7L 1EHNA 4MLSA 2OR9L 2NYYD 2V7HA 3D85A 1KLGB 1MRFL 4P2OC 2DQHH 1Z5LB 4PRHA 5F1IB 5I8EB 1CE6A 5JZ7D 3NFSL 2A77L 1RFDH 1ZWIB 1H8OA 2YPLD 2ERJB 3BPLC 4NJAL 2PKDA 2UZIL 1CIUA 1KG0B 1ZT7A 5DJCA 2IWGA 1PLGH 4MAUH 1CXEA 2F54E 5D1ZA 1TNNA 3MOAH 3HG1B 1I8LA 5HVWA 5MENE 2YBRB 5ICYA 2D03H 3BRDA 4PGCB 3T4YA 1R3LB 2X1PA 4RA3A 2VIRB 4KY1H 1DN0B 2P1YA 3S36X 3QJFA 4GRMB 1FYTE 4Y89A 3CK0H 3LKQB 2Y36H 4GW1B 2GTZA 5DJZA 4GKNB 4G9FA 4FTVA 3GEWB 5DS8B 5E56A 2VLJB 4POUB 1KJMA 1R3HA 5DJ0B 5TGBA 1D5IL 1SJVA 5EA0L 1UC6A 4P23D 5IF0A 5I1AB 4ODSL 4YHKL 3WNOA 1EEYA 4U6VL 4YHOH 3M07A 5SWSA 1I1AD 1LP9E 1OAYL 1A21A 1JGLH 2QKIB 5MHSD 3ZDXE 1P5VA 1LGVA 5C2UB 4O51B 1XIWC 4PRBA 4A2MA 1F90H 3G5VB 3LKPB 4ZTPH 4YHPB 3E2HC 1MFCL 3VD5A 1FVDA 3V6ZB 4Q9QH 4OAWA 5ID0A 1H3XA 1AD0A 1OM3H 5L9DL 1RAMA 3IXTA 1G9NL 4KJYA 1P9MA 4G8EB 1F11B 1BOGA 1RVFL 1WAAF 4Y4KC 5IG7B 3CXHJ 4M1CD 4GS7B 4NRYA 5ADPL 3MLVL 4M5YL 1UVQB 2YN5A 2H2PD 1YEKL 3K2UL 2JCCB 3KYMB 1YDPB 5J9PA 4YNYB 2JIXA 2OSLA 4MNQB 4ZODA 4XP1H 4XCNB 1F3DH 4A6YB 2EXYD 1LO0H 4XGZB 5GGUA 1PDKA 1QR1B 2HVJB 2EDJA 5F6HI 3RVTD 1ZHLB 1JK8A 3H0TA 4HWZB 5E8DL 4O2EB 5DRXA 5JMRA 4L4VD 4UAOB 5DUPL 1Q0XH 1I3UA 3F6IA 4P5KB 5LJYH 2ITDB 4RMUA 2WBJA 2E9WA 3ZZ1A 1U8HA 1KEGH 4ISVB 3PQYE 4OCLC 3JTTB 1JPSL 3R06B 5F7KC 2IALB 4W68A 2Q6WA 2J8UB 4HFWA 3LS4L 4K7PL 5F1NB 1MIMH 2X4NA 3KLDA 4LCUA 2P7TB 4LFHG 3U4EB 12E8L 5IKCB 5A1AA 5C0CB 5EUKB 4L5FL 3CDYA 1MF2L 2WBJC 3G6JA 3RDTB 1EXUA 3P77B 1S8DB 4XMLL 3MROA 4Q2ZB 1W72B 5GGVH 3SDXE 5CCKL 3MFFA 5JHDA 1NL0H 1D7FA 4X83A 2UYLA 3VRLF 2NW2A 1B9ZA 3QXAB 4JFOB 4OGYL 3K8LA 3TPKA 3PWUA 5C09B 1II4E 1QSFA 3HC3H 4ZNEA 1RU9H 1OPGL 4I3SL 2HKFH 5K9QG 2D7OA 3C5ZA 3GM0A 1HEZB 3HZMB 3Q6GH 5EC1A 2DIAA 2X4SB 4LCIL 4LAQL 1DBJL 3FFDA 1A7QL 1G9ML 3PQYD 4C57C 1Y0LA 3H3BC 1QPXA 4CNIB 5DQJA 1P84K 5TDPA 4FQJH 1WK0A 4OF3A 1IZKA 5KVFH 4GRWH 3G04A 4Y1AB 3L3KB 4FQXC 5DWUH 4Q6IA 4JRYE 4JGMA 5JDSA 2HN7A 2NX5D 3SE8L 3WXWH 4U1MA 4JM2C 3EOBB 3HPJA 1GHFH 2GQHA 4BK5A 4NRZB 2NNAB 1ADQH 1WIOA 1T0NA 2AJUL 5GGQL 2OCFD 4P23C 1KC5H 4P4KC 4G7VL 1MJ8L 2NXYC 3QUXC 4NM8H 3G6DL 1JGDB 2UWEE 4LKCB 3THMH 4H1LH 3O2WH 3CCHA 1DL7H 3BGFC 5LBSL 2X41A 4NNYB 2AEWA 2B0SH 2AXHA 1YMMB 4KKLC 5EU6A 3RIAK 3MV11 2W9EL 2SEBB 3IDJA 5FKAB 2BSSB 2ZG3A 4O4YL 1C12B 3TCLB 4JPIA 4OQ1A 1G0XA 4HH8A 5DRZA 5JPNA 3DX8B 5I0DA 4G42A 3B2VL 1JTOA 4LLYB 4Y4FC 3KNBB 4OD3L 3IDYC 3GSVA 4S2SA 2VKWA 5T1MB 5DEFB 2VLKE 3W39A 3QQ4B 4I5BB 2VDMH 4M1CC 5EBMB 3TT1H 1IT9L 2ZCLL 3WLWD 4D0BA 5I17A 2YXFA 5F7NC 1U3HA 3RUGF 5AZEH 3SQOL 5JW3L 2R1WA 4CMHB 1DJSA 1MI5A 3AGVA 2D4FA 3STLB 4I0PB 1LNUB 4DKFL 1N59B 4F57L 2ZUQB 4JHAL 1U2CA 1KB5B 1HNFA 4NOFA 4P2OA 1JIBA 3WCYA 4XHJD 4LPXA 3U7YL 5EBLA 5JXAL 4KRPD 5JLZA 4MNGE 1LDSA 4WTZG 1XAUA 1QZ1A 2HTLD 3FFCB 2J88L 2XWJA 1IGYB 1H3TA 1W72L 4XXDB 4DEPC 1NCAL 5D1QA 5SX5H 5C3LD 1NMAL 3MRGA 5DFTA 4HCRH 3QDMA 3ARDD 2ADJB 2VDQL 5F7EH 4L9DA 2EDYA 1EMTL 2X1OA 1MAMH 5DJAB 1VENA 3V5DB 2E6PA 4R26L 3OZ9H 4JANB 2VDKL 5BZWB 2YRPA 2X6MA 3RZWA 1KCRH 1CDBA 2HFEA 1G9NC 3T4AB 4HLJA 3CX5J 5IROC 1D5MB 1XF2B 3FAXA 5EORL 1HXYA 1EFXD 2DQJL 2IAND 4D9RD 1RZGB 4QRUA 1ACZA 1CXIA 3L3GB 3O11A 3UZVB 3RZCB 2B7DT 2XN9D 1S7XB 4LCCA 5DUBB 4K3HA 2H32A 5JXED 1IC7L 3IKCB 4IOIB 5I1HH 1U8MB 3TBSA 5TDOA 3UC0H 1B4RA 3QXDB 1NANH 5D1QC 1U8OB 4QTIH 1MFBL 4GAGL 2BERA 3DWTA 1OAUH 4QY8A 2GYSA 1FG9C 3MRNB 4KH2A 5E1AA 5FO8A 5EU6D 4H25B 3REWA 5EOQL 3DIFA 3BSZH 3C60C 3DYOA 1QSVA 2PNDA 1CDHA 4HPOH 3SDDD 4Z78B 3RWHA 5A2LH 4NQCD 2J6EH 4YEEA 4X98A 4MCZA 4K8RH 1KIRA 4AY0A 4JO3L 4AIZB 1UWEL 2ZKHH 3TC9A 4O00A 2V5TA 3U46A 4X6DA 1VHPA 1BZ7A 4CBPA 3H42H 4Z7NE 4PG2A 4E0RB 3LKOA 5CMAA 5HDLA 1ES0B 3ARPA 4ZFGH 3WUWG 2XZQH 2K9UA 4F7TA 3SGEI 2YA2A 3F7RA 3FT4A 1VGKB 1FAKT 3HN3A 2PR4H 3L3OA 3CAFA 4GRWE 3VFGH 3E6HB 1D9KD 2EE9A 2Q3ZA 2WIIA 5E6IC 3GBMH 3T1FB 3C87A 1NKOA 3MMEB 5JHDD 5FA4A 1RSFA 1GYAA 1JGVH 3IGAB 3OKKB 2YOCA 3VG0L 1NBVL 5HYQB 2RJMA 4WFHD 1QNZL 4IRZL 3BKML 4HHAB 4M7KL 5A2FA 2YMXH 3OJDA 5D7LE 2JK5A 3HE6C 4FN0A 3E6FB 4OGZA 4MCYB 5HI5D 3ARDB 4NO2A 4OTXL 1B88A 5EZIL 2VXUH 4M02A 4P2RD 3SDAB 2E9JA 1Q0YH 5GRVL 5AZ2H 4DZ8B 3C6LB 2D9QB 3VXRB 3MRQB 5CZVL 4I8DA 4AQ1B 3BFOA 4KMQA 5AAWA 4PJ5B 5GS0D 5INDB 1QFUL 1ODAA 4WWKB 3WN5C 3MNWB 1T2QL 3MGTB 4OF0A 1V3KA 1I7TA 4N8VB 4I4WB 4OZHF 3ZE2E 1PKOA 4KK6D 1WCBA 2CRZA 2Y7QB 1KGCE 3CDFA 1DP0A 5DRWB 1HHIA 3ES6B 4JG1L 3C5ZC 3C08H 2DQDH 1QVOB 2WWMC 3M1BA 1HINH 1ZHBB 2BFVH 2BSTA 3TCXA 1OSZB 2WUBH 4HC1L 5HI3C 3S36H 5EC2A 2HKHH 4U1LA 2ZUSA 3F8UB 4MXWH 2EC9T 1MIEH 5ICZA 5HYIA 3LV3B 5I74B 3QPQC 2Z93B 4MQTB 3C5SA 2VRAA 1ZA3A 5KVDL 4P2QA 3CFCL 2FX8H 1CGSH 3WS6C 3NAAH 3IETA 4WDIA 1ITBB 5DJYB 4HEME 2J3SA 2ATKA 5D2LA 2NY2B 3TH2T 4UT9H 4PV9A 4JDTH 1W0VA 3DO3A 5FYKD 1FNSH 4JZJA 3LQMA 4LPVA 4LQFL 5D70L 2HLFC 3WNKA 1TJIH 3QIBC 3HG1D 3VGBA 4OT1L 4Z7VB 1FZOA 4Z8FH 3MXVH 1MCPL 1EZVY 4MGXA 5JW4Q 2NMSA 5DLMH 1NGZA 1P4IH 4K07A 4U1LB 2PN5A 2X1QA 3SKJL 1L7IL 5GZOC 4MA3B 4ZO8A 4PY7B 1EBAA 4JHWL 2OLDA 3DVIA 4CU7A 4JB9L 1YEEH 3FB6A 4GG6A 2AI0H 3OB0H 5IVXE 2AK4D 3C9NA 4GBXA 2X4RB 4MWFA 3RAJL 5IEHB 4KDVA 4QNPE 3L95A 4YK4B 3ARZA 4PJAB 3BWUC 5B3NA 4Y2DA 1IMHC 1AHWB 2BNQD 5TQ2L 4H1LG 4P2RB 3SDAD 2RCSL 2IANB 2NZ9C 4UZGA 3WSQL 1DZBA 3U36A 4PJDE 2JJUA 3WE6B 1Q94A 3KLAB 1CF8L 4K9EH 4PJ8D 1SMAA 3DO7B 4LNRB 5HDBF 1YYLL 2W9DH 4PBVC 4DN4H 5ESAA 4NQDA 2VH5L 1KELL 5SV4A 5GGRY 4IHOB 4S1RL 1RIHH 2VLRB 4XPHH 2WM0A 5B39B 4JFFD 2EO9A 4XCFL 4JQVC 4PJFA 3HUJB 4PJGE 4HH9A 2C4XA 1QHOA 1S9XA 1N6QL 1BFOA 4HPYL 3HI5H 3IVKA 1MHPL 2EDKA 4X6CE 3CPLB 4CN1A 1S7WB 4WCYL 4P59L 4CW1A 2JK5B 2VDPL 1VEOA 1RI8A 2A6IA 3I2CH 3ROOB 1CLOL 1J0YA 5FYJE 2V5RA 3AU1B 4YR6B 3OKKA 5DT1H 3PL6D 3E6HA 4YFDB 2XIDA 1REIA 1DTUA 3MV7A 3TJEL 1ERNA 1FYTB 1M7IB 3TM6A 5I1LB 2FEEI 4JM2B 1P4BH 4OM0H 3TNMB 1FFRA 1WBXA 1F13A 1CLZH 1OOAA 1IGIL 4JCMA 2DLFH 2A74B 4L4VB 4K71C 4Z95H 5CMAB 5FAAA 1R0AH 3EYVA 2R4SH 1A14H 4M8VA 4N0RA 3ULVF 3MLPA 4E0RA 4D9QD 3C6SB 1XGPB 4QWWC 3VRLE 1I8MB 3JV6B 2H41A 1JV5A 4CVWA 5C7XL 1I1YA 2CDGB 3S3PA 4C83B 3UTOA 3V52H 3MJ9L 3TNMA 4HZLB 3WUZA 4JY6A 5JOFB 4WFFD 4GRLD 1N2RA 5ERWA 5ITBL 2W1NA 4LCYA 4NPYB 1IQWL 1YC8A 1JGEB 3QCUH 5KSBE 3AU1A 1BBDH 4JE4B 2A6IB 3NFPB 4NKIH 1IAIH 3REWB 1UM4L 3CFDB 3TA3A 3ZKXB 3R0NA 1G7IA 4XC1L 5DVLA 4R90L 4X8JA 4XP4H 2FO4B 5J1AA 1IAOB 15C8L 2MQCA 1ORQB 2IPKB 3QA3A 4FQCL 1BFOB 4P2CG 1S9XB 4KPHH 4NO0A 2CD0A 1A1NA 4IRSA 3V0WL 1DLFL 1VPOL 2F8OA 3QXDA 5GZOD 3E0GA 1DSFH 4HK0B 4RGOL 1PX3A 2JELL 3IKCA 3QI9C 2VC2H 4RQQB 4TSCL 1N6UA 1MRCL 2DWDA 2IQ9H 5CGYD 3DO7A 3D39E 3PNWB 4IIQC 3QDJE 1GPOH 1IAKB 1PSKL 3P0YH 2ZZUT 4J3VA 3Q0HA 1JBJA 1NC4A 3TYGH 1ZHNA 2VDNH 1TDQA 2OQJA 4NZTH 1NC4D 2F74B 1SEBA 4C55A 5I16A 5KBNC 3F65A 4NNXB 5BZWA 1SEQH 2YN3A 2F19L 5F6IB 3V5DA 5I1IL 5SX4I 2HWZL 2PXYC 4KRPB 2X2YA 1P7QD 1FGVL 3L6FA 3QEQE 1A7OL 4XRCB 3S5LG 3NZ8A 3FB6B 4UINH 5CJQH 4KTEH 4L8DB 4FNLH 1AXTH 1WICA 5D1QB 3F12B 4OLYH 1XR8A 4JN1H 3IDYB 4HUUA 4QXGL 4F3FB 1A3RH 1YEFH 2K3TA 5KJRH 4HFUH 1E6JH 4PJBE 2APFA 4I9WD 4KRLB 3C5JA 1UZ6F 1FRGL 2OJZH 2ESVE 2X4UB 5GPRA 4JZJB 2Z8VC 4UQ2B 2VISB 3IU4L 5J13B 2BVOA 4KVCH 3RDTD 3R1GL 5LGJB 1FZJB 2ATKB 1T66D 4HS6A 1WTLA 3MRRB 2NY5L 2HFFA 5D7IE 2IFFL 4YUEL 1L0XA 3KJ4B 3WEXB 1G7QB 3FO2A 3CSPA 3Q48A 3T09A 4Z0BL 2YPVL 5INCB 4AENB 1F00I 2Z93A 3MCG1 4WFGD 1HHHB 4S1QL 4PPTA 4YBQD 1QA9A 3GUTB 3ISWA 4L8SB 3LPFA 5D5MF 1OGTB 4MNHA 4PTUB 3TT3H 4LLAA 5ELIA 4J23A 2XQBH 2HFTA 3DX8A 5C07E 4JPIB 1T89A 5EWIL 3B8SA 2V17H 4BH7B 3MBXH 3QUZC 2AGJH 1CICD 2IEPA 3S34L 3M17B 5ALBH 1YEIH 3P9MB 1HHIB 4N0CC 3RVVD 1UXWB 3VFUB 1DEEB 1KACB 2DQIL 4JKPH 4JFFA 1S7QA 1JGDA 2I60L 2DBLH 3QUMB 4LPTA 5E8OA 2R8SH 4RMWA 5I1KL 1MH5A 2YWYA 4IMKA 4N8VA 1F4YH 3TGXA 1MHHA 1DLHA 1SBBA 1YA5A 2WQ8A 2QL1A 3GIZH 3I9GL 4MDJA 3QPXH 4NQSA 1NLBL 3HPJB 4E9LA 4WEUD 3EOBA 3S96B 3PIQA 4MDJB 5J8OA 4XC3L 1I3RA 5DVMA 3SDAA 2AS5M 3UYPA 3MRDB 1BECA 3G04B 2P4AB 1K8DA 4MCYA 1UKQA 1RUQH 3ARFB 5FDYA 4LKXB 5C0AD 1IZJA 5TDPB 1GAFL 4PLOB 2BNRD 1DQLL 4NDMB 4UTBL 2XWTA 3P9MA 5E5MA 3BT2H 2GSIA 4PYGA 4N1CA 2FB4H 1TPXB 4GBXC 2APBA 3LMJL 1WT5A 3C5ZB 3VXNB 5HVHB 1Q9OA 5T5NF 4BQ9A 2O5XH 2YUWA 1OTUC 3BP7A 4OD1H 3TH3T 3VGHA 4HWUA 1OARL 2B20A 2NW2B 4KRNA 4FZ8L 1VKXB 5ADOH 5E0QA 3RJDA 5EZOH 3SHSA 4GMTH 1EAJA 4ZUWA 5FOBA 1AI1H 4AYFA 1FNHA 3FO2B 4NQED 3WEXA 3UTPE 2OMNA 2BOCB 4U1IB 4M1DH 3BKCH 1NFKA 5EBWA 1FZJA 3E2HB 1AIFB 4FOMA 3TJHC 3W2DH 2X09A 1A6PA 3BIKA 4AEIL 3A6OA 2IFGA 4OZFA 3RWHB 5DMJB 4Z7WB 2OK0H 4WFED 5BXFA 4ZFFB 1YMHA 1XGQA 1FPTH 2ORBH 4Y4HD 3DIFB 3KJ6H 2BSRA 4XMKL 4PJCF 1HYSC 1Q9KB 5IHLB 4H25A 4HT1H 3BDXA 3OR7A 1A02N 1FLRL 3MCKB 4ORZC 4DVBA 4G8GA 3UCRA 1CCZA 5C0JA 4E5XA 2YPLB 3WIFB 1PEZA 4K55A 1DFBH 1OSPH 5GJTL 4PR5B 1KFAH 4JM4H 3TBSB 4XRCA 2E8YA 4IOIA 1B2WH 2CK0L 5IGXL 4OSUH 4LQ1A 5T1DL 4GLRI 1ZA6B 4XCNA 3A6CH 3TVMA 3U48A 3KYOB 1S7UB 4PGZA 3MV9D 1E4WL 4YNYA 2JB5H 3B4NA 2JCCA 3GSWA 2A9NH 2JJSA 3I3DA 3O4LE 1CVRA 1SEBB 1XF2A 1DEDA 2CIIA 1H3PL 3AUVA 4OF6A 3UBXI 1T3FB 3MCLL 5DHVB 4CKVX 1IFHL 5IG7A 3VGAC 5IMOA 4S11A 1IGFL 1CFVH 2VZUA 4F8QA 1S7UA 1IAKA 2Z8RA 5GSRB 3TVMB 5CD3A 3PNWA 1F4AA 2DWDB 1QTYT 2LQRA 3SGKA 5CUSH 5DFVC 1X5GA 3P73B 2ADJA 2DAVA 3RGVD 2NXYD 1EJ6A 2ENYA 3FQWB 3V7AE 2E6QA 4KK5C 4YC2C 3I50L 1QBAA 1E4KA 1FBIH 5FYKH 3VXPA 3ZDZF 5HGHA 3GBLA 4E5XB 4ZNCD 1ORQA 3BPCB 4NIKB 3GI9L 3V4VL 2FO4A 3FFCA 4OQTL 4X8JB 5J1AB 5CZXC 3QNXA 3L1OH 1G7IB 1TMCB 1X3DA 2VNCA 1A6UL 2EXWD 5IEKB 3C8HA 4MLIA 2NY2C 1PQZB 3OX8A 2P5EE 1ZEAH 3NFPA 3QB7C 4OIIL 4LVNC 4I3RH 3QXTA 4DKEL 4XPBL 4BELD 4ZFFA 4N9GB 4OCWH 3S98A 2J4WH 1T66C 4DKDC 4GAJH 3P4MB 1I3GH 3BIKB 4S1DD 3OHXA 3KR3L 1YQ2A 3ILQD 2R0WL 1FFQA 4PLNC 3NACH 4HZLA 1QFHA 1A1MB 4P5TD 5KSUB 5TE4H 2E27L 3JV6A 3QIUA 5ETUB 1PY9A 4PG2C 2VIRA 2A0LC 5FOBB 3CZFB 4NKQB 3IAGC 1OP3K 2Y1VA 3W39B 3HE6D 1DQDL 1WBXB 3TA3C 4L3EE 2VLLB 4S1SL 1T7XA 3HG1A 4M6OH 5DQDH 1M7IA 4YO0A 3U83A 5J06A 1UG9A 4YK4C 4WHYH 3EYFA 5D1ZC 1J5OH 4MZ3A 4EXKA 1B3JA 1JL8A 2EIDA 1CGTA 1C5CL 1ZT7B 5ECJE 1KG0A 1MLCA 3H3KA 3QQNA 4OKVA 2BDNL 4KV5F 3I85A 4MMZC 3K8KA 1NMBL 3PHOB 1ZWIA 3Q1SH 1AP2A 3O2VL 4JVPA 4LKXA 5B21A 3SE3A 2N4IA 4PJFB 2XRAH 5B39A 3BN9C 5T5FL 4C56D 1T0NB 4XNQB 3GKWL 3O3AB 5DJXA 2X70A 3OTTA 5BV7H 3S96A 4AQOA 1AY1H 5ESAB 4BSWB 1W0WB 4G5ZL 4NQSB 4LSQL 2EZ0D 5E2VL 1GIGL 1U8QA 1F2QA 3DNKA 5D96B 3KLAA 1ACYL 2RQ8A 3VXTA 4F33B 2DJ4A 1WJ3A 5E8OB 3AS1A 4UIMA 4YHKH 2BC4A 2VZOA 1H5BC 3JWNC 4P2RA 3KXFB 4NQUA 1AHWA 5F88A 1JRHH 5BV7C 1Y0LB 3EO9H 4PJAA 2FBJL 3ZKSD 3NPSB 2YSSB 2GITA 1DBAH 4Z77B 2Y5TB 2OR8A 3M17A 4IM8A 3MUJA 5EUOA 3WS6A 4P3DA 4HKXA 3C9NB 2IBZX 1RJCA 4PRIA 3F7YB 4GG6B 1ITCA 3QG6B 3U4AA 2EDRA 1OM3L 3PWUB 4PY7A 5H35B 1KYOJ 5JW4N 3GUTA 5AUMB 3I6GA 4CMMB 3PUCA 1RVFH 1DBBL 2H26B 3ULUD 5CGTA 4Y5YA 3GSXB 3P30H 4Q2ZA 3T2NL 4D94A 3GMNB 1GJIA 5I1CH 5E8EB 2XT1B 4KJQC 2HFFB 4HS6B 3GMMA 3FZUD 3VXQB 2MPAH 3QEUA 4XP1L 4PV9B 3D6GA 5IKCA 4N1HB 3U4EA 1U3HD 4ZXBC 5MEPB 5J0BA 5AD0B 4N8VG 4LIQE 4E41A 3LQZB 2I5YH 2FZ3B 4NP4L 1OVZA 3P40A 2AV1B 5T1KD 5FM4A 5DUPH 1JHLL 3JTTA 5ICZB 1EVUA 5F9OH 3TFKD 4XTRD 3VXME 2ITDA 1XR8B 5MEOB 1ZLSL 1AFVH 1KPUA 2VLJE 4O58H 1OTTC 3ZHDA 2ICWB 2XKUA 5TE7L 4O9HH 2CKBB 5C0NC 4I1NB 1OW0A 1QR1A 5IR1A 1F5WA 1AKJB 3EFFA 1D3CA 2OSLB 3ES6A 4MNQA 3TP4A 3QFJE 1OLLA 4WI2A 4NHCL 3TLRA 43CAB 2CXKA 4L5FH 3F58L 4R4ND 1M05A 3BH8A 4FXLA 1UVQA 4FQIH 3ZYIA 5D1XA 3X17A 4F15C 4K3GA 1CIDA 1I7ZB 2H9GA 1NL0L 2DM7A 3MJ8A 3HUJE 5FGSA 2F53E 2ZPKL 3UPAA 4AM0B 4JPKH 4G6ML 2OTWB 3B9VA 4QRPB 4PJ5A 3WDHA 2GSGA 2RR3A 2V6HA 1OW0C 1FO0B 3RWDA 1UT9A 1KIPA 3HC3L 3DROA 4HCRA 5A2IH 1PKQB 1A1NB 2D9CA 4XAWH 2NXYB 3ARDA 1UCBL 3G5VA 1Z3GH 3NABL 1CG9A 2NY4B 1UEMA 3CFDA 3JWOL 5KSAD 3HG1E 1F4WH 2QKIA 1I9RL 1MCSA 1UYWH 5GS2D 4M7ZC 1GGBH 3MLYH 4JR9L 4GXVH 2V2WB 3O9WD 1YY8B 5LAXA 3O2DA 3I6KA 3ZKNC 5KSVB 1U8KB 1N2RB 3RY4A 4XPFL 2Q8AH 4R7DA 1EUTA 4IDLA 3MO1A 1VGKA 2EZ0C 1QG3A 2GTZB 3FT4B 4YHZL 3WBDA 1X9QA 2VZ1A 1XGPA 3P4NB 4H5SB 4HSQA 4K3DH 4D9LL 5MI0C 1YEDA 4NM8L 5CLWA 2WLZA 2J8UE 3T4YB 5FB8B 4X6DB 4CUCA 1OAZL 3HNVH 4P9HH 4PGCA 4ENED 3THML 4LDEB 1LP9B 1UKTA 4GW5A 4OFKA 5GJSL 3ULVC 1RULH 4QRRD 4WEBL 2W9EH 4FS0A 1MY5A 3QI9D 4OZGF 2P8PB 3DMMD 2G60L 3TIEA 4CW1B 5HGAA 5TQ0H 1Q1JL 1RZFL 1CE6B 1UM5L 3D39B 1FYTD 2XZCL 1KLGA 2MJWA 2BY1A 2JJSC 2V7HB 4M7LH 2ZCLH 4YIQB 4BUHA 4UDUB 3SQOH 5I15L 3O6MH 4LFHD 4RFNC 4XMPH 5F7MC 4M48L 4NQDB 2H32B 4QHNA 3GRWA 5E9DA 4OD2B 3UTTE 2I26N 5JA8B 2OL3A 2BVPA 5CHNA 5I2IB 1TJGH 3VDCA 2QBWA 3KPSD 4Q97A 3VFMA 1HXYB 1P4LB 1MFNA 2WLYA 3CMOH 4YDKL 1D5MA 5IW1A 3U7YH 1UWXK 4HZAA 5BV7B 5C6WH 4PREA 2P5WA 3WFDH 3SY0B 1V7NH 5GS2H 1LE5A 1JHTB 3L95B 2FGWL 3ZSTA 5C0FA 3WD5H 5FV2A 3QR2A 2OL3H 4U7SA 3S8WA 4Y1AD 1RUPL 1QBBA 4PBWD 2EECA 4J4PD 1MAML 4KC3B 2FHBA 2MQ3A 3T2OA 3TBWB 2F5AH 3TH4T 1FZOB 2J6EA 3T0VA 1ED3B 3ZT6A 3EYQD 4JFDE 5IW3A 1EK3A 1KLFA 4HDIB 2FIKB 3KHOA 1J0IA 2M26A 4Z7WE 4XB8A 4XP9H 1CBVL 4I0PA 4ZTOL 4PUBH 2FJHA 4NJ9H 4KMTL 5DJYA 1IGJB 4WDIB 1H9VA 4MA1C 1RUKH 4G6JH 4R2GC 5T3ZH 5I1GL 1FAIH 5KVEL 1ZTXL 4W70A 2LV4A 3QDJD 2YXMA 2W07A 3QO0B 1M7DA 2KBGA 4RX4A 1YUHA 1LO2H 5H2BB 2HJKB 2ZOKB 4LEXL 3I3BA 3NZHL 3N0PB 3KNBA 1CL7L 3EDFA 2NX5E 4AH2A 3OKLA 5EZJA 5CGMA 1ZHBA 5HDQH 2AJYH 5A2JH 3IJSB 4YZFF 4GSDL 3BKJH 1LQSR 5JIHA 2E6JA 4LBEB 4PJXF 5HGGS 1UWEH 2YHGA 1PZUB 4NBYB 2ZKHL 4JY5H 4HBCH 2QQKL 1PG7L 3PWNA 4WV1A 4HLZG 1U8PA 4GG6F 5F9WC 2BVQA 3VXOB 1K6QH 1DCLA 3VXSB 5DD1H 5EZLB 1YY9D 3MGTA 4X6EA 3LQAC 2XTJC 1BD2E 1UCTA 5LKNA 4P3CL 3V6FB 5J11B 2YUXA 3WDJA 2E9BA 2VDOH 3L3IB 1Q72L 2E7LC 3CMGA 1GVIA 1KCSH 3H2WA 5GRZA 1K4DA 3BGAA 1TQBC 5D2NE 5EO9A 2HH0L 1S9KC 1J05B 3L3KA 4IRJB 3ZKQD 4KVNL 4KKBC 5F9JA 2EYSA 3EJJX 4HUWB 5JHLL 4CDGC 5FDWB 3U82B 3E6FA 3BKMH 5D7SH 4TQEL 5DQJB 2NLJB 3D3VA 5FHBL 5IMLB 5HYSB 1A6AA 3VI4F 3TWCH 4WW1A 1T4KB 4L8CB 3OKOB 3QDGE 3U2SB 4RGMB 3MMEA 4X99B 3GO1L 2WIIB 1Q0YL 2XI9A 3VI3F 3L3OB 1QD0A 1ZT1A 3M8OL 4TRPL 4R7NA 4B53A 2XTJB 1BGXH 4JFPB 5CZVH 5IVNA 3QEHA 2RBLA 1TCRA 4QOKD 1V3LA 3RWJA 1FQ9C 4K7PX 1ES0A 1MRFH 4JPWL 3GSQA 2DTSA 3MFFB 1IAMA 4X9GA 4LRNL 1LWRA 3NFSH 3MROB 4DFIA 3BJLA 4XBEH 1ZLWK 2F53A 1EXUB 2DTMH 3RTQA 2H6PA 3ULUE 4PGBB 4JFYA 1YNTB 1D6EA 2FH8A 1C5BL 2BNRA 1NANI 4ZFZA 1KIRB 1MJUH 4O5LL 3SJVE 3HCVB 3QFJA 5KZCB 2I07B 4OB5H 3NTCH 4MNQE 4LCWE 4D2NA 1ZLUK 4RFEA 4OUOA 4HC1H 5L2KA 2UWEA 3K46A 4Y4KA 3R06A 5EU7C 3PWJA 5I9QC 3MBEA 5I1JL 3DI3B 2EDFA 1U8JA 3O8XA 1YEGL 1QR4A 5DRNA 3ZMRA 2K7QA 3CK0L 1U8OA 4KTDH 2WP3T 3CFCH 4PD4J 2FX8L 5TDOB 3KPRD 2QQLL 1V8HA 2D7QA 1XFPA 1D5IH 2QJDA 5GS0L 5JOPE 3MRKB 3X3FL 4ZMAT 2Y72A 3L3GA 4KK8C 3GMPB 2ESVB 4MXQC 4L4JA 1DDHB 1QSEA 4JO2H 1FNSL 3TN0C 3QYCA 4ODUB 1LEGA 4LQFH 1YJDL 2IC2A 2N7AA 4OT1H 2FJFB 1GGCL 4X7DC 2VL4A 3TBTB 1MCPH 4R97C 1IGCL 2CKNA 4S0SD 1SBSH 5LCVH 1WWWX 1F11A 3O6KL 1D6VH 2HMIC 4YAQA 1NLDL 2VOTA 5E2TH 2VDRL 3IDNA 2Z31C 3MV8A 1G9NH 4CVXA 3ZO0A 2HVKB 4LDLB 2EIEA 1X4ZA 3SDXA 4XXDA 4YHPA 5IQ9A 4PP2B 5KN5A 1T6VN 4DK3A 2FEDD 3E1F1 4PG9A 3MOBL 1Y18B 4P5TC 5C92A 3T0BA 4O51A 1VESA 2YPKB 3D69A 4POYA 5HHXL 2FNBA 1S5IL 1MCKA 4UBDD 1F3RB 1K8IB 3BP5B 4RSVA 2DQFB 1EEYB 3Q3GB 2DM3A 3GFUA 5IF0B 1HQ4B 3AXLB 1PEWA 4J7RA 2VL5A 4HUNB 5FGCE 4UNUA 1KJMB 3MRFB 3KVQA 1CF8H 1I8KA 5L2JA 4G9FB 2XZAL 4DN4L 3T0ED 3O41A 3WLBB 4KI5D 1VCAA 1U6AL 4DK6A 4PB9H 4D0BB 1NBZB 3MR9B 1JZ3A 1TVDA 2BK8A 2DD8H 1FYHB 2ED7A 1KEGL 4HXBH 3MA7A 3SQBA 4EVNB 4YHML 5DHVH 4TVPH 5DEFA 1QYGH 4P59H 5FYJU 1ZK9A 4K8RC 4APQC 5BVPL 4F7CB 3WL9B 3KPTA 3I2CL 1MHEB 2BSSA 2AEIT 4NN7B 3VI3E 5EU6B 4KWUA 2M8XA 5DT1L 2A6DB 4WW2B 2OXGA 4MAYB 2P43B 3S35L 3RHWK 1G7MB 2DDQH 2R9HD 4L3CA 4MJID 4ODHL 1HKLL 4U1HB 2R4SL 4YFLF 3QIWC 2HG5B 4Z7UE 5LGHH 4WI7A 2BP3A 4I3SH 3C09B 1PFCA 2VXSH 3D0LA 1ZS8A 4OZGB 4P57A 2J1KA 1F58H 1WAAA 4PJCE 4V1DE 5DO2D 1KPVA 1IQWH 3QUZD 3N50A 3H9ZA 4PRPB 5JORB 2KZWA 5DA0B 4Y1AA 1MCOL 2GJ6B 1YN7A 4ALAH 1J1XL 4FQJL 4N0CD 4GG6E 1IAIL 3CFKB 1SJEA 2DQEH 4QXUL 4CMHC 5KVFL 3LPGA 2IQAA 5SWZA 1MPAH 3GIVB 1T04B 4XP4L 4JZOA 1EERB 2X4SA 3RKPA 2NXZB 4KPHL 3HZMA 2ZUQC 3EO0B 5EN2A 3FFCE 3EOTL 5D7JB 4Y4FD 4NRXB 1DSFL 4UIKH 3GSUA 1KTLA 3BVNB 5FUOH 4BQ6A 5D72H 5JW5A 2MTPA 2IQ9L 1J0HA 3TZVB 5A16A 4FFZH 1MJ8H 3HTLX 2APWA 2XOTA 1ONQA 1EJOL 2FATL 2IH3B 3VXRD 3UJTL 1I9EA 1G0DA 3WFCL 3K1DA 1U8NB 3BN3B 1MVFA 2ID5A 4ODXB 5TFSL 3RDTA 4HUMB 5EUKA 5IHUL 3LS5L 4ZAKD 32C2B 2ZSVA 3MJ9A 2ZCKL 1G6VK 2CJUH 1FNGA 3CFJB 3UJJL 3DBXB 3NCBB 3FRPG 4Z5RA 2OX5A 1AQKL 4XVUC 1NAML 2BCKB 3QXWA 1FSKB 5EFIB 1FGVH 5CEXA 3LN5B 5F1NA 5ALCH 5BS0D 1NKRA 2J8UA 5JOEA 1EFXA 4KTEL 1XH3B 1IC5H 1MCNA 2VAAA 1LE9A 4OLYL 3QQ3A 4XAKD 4QXGH 1T1YB 1N0LA 3FQUB 1N4XH 4P5KA 3UAJC 1YMMD 1GOGA 5KAQF 4HJGA 3SDCB 3VXUD 1CXHA 1G1CA 4NFCA 4XZUB 2EKJA 4RAUA 4OZ4B 3SCMA 4RIRA 3TN0D 3DXAA 3LEVL 3KG5A 5CBAA 4PJDB 3IDGA 1NDGA 4M43L 2AJVL 4G8FB 3SE4A 3EYQC 1NJ9A 3HFMH 3BQUB 2JIXB 4I48B 4XAKE 4D3CH 2ICES 3DETC 3MLXH 4FQXB 1HILA 3NCMA 4BQCA 1NCWH 4LP4A 2HRPL 2OTUB 3DHJA 2IFFH 5TF1L 1HK6A 4M8QB 1BWMA 3FMGL 1I9JH 1MSPA 4XPGH 4NZUH 3MSPA 1W72H 1PKQE 1S7RA 3LEXA 5DK0A 3FO1A 4FQ1H 4M6AA 4TN9A 1WITA 4HCRL 1BD2D 1RIUL 5D9SB 2YS4A 1CXFA 1YEHL 3B9AA 5E6IA 5D7LA 2XQBL 3B5HA 5B38A 1J1PL 5M7QA 1F97A 2V9TA 1AQDA 4R0LA 2JB6A 5D7IF 5FYKU 4Z7QF 3NCYP 1F6AB 3VGDA 3QXUA 5I30L 2MCPL 1OT1A 3ARBD 2QHRL 4PJ9C 2A9MH 1QKZH 2Q20A 1BAFH 1EX0A 4XPAH 4HJ0D 3N1MC 4QYOB 5KOMC 3X14B 5HPMA 4DUVA 1XGTB 5T33H 4MB5A 4TOYH 4MXQD 3HI6H 2LVEA 1OGAE 4TULL 4K23L 1HIMH 4LK4A 5TGBB 2XWBA 1VEMA 2WBKA 2VLJA 3ARTA 3I9GH 3MC0A 3ULUC 3L7EA 3DX7A 1BBJA 4QT5B 4X5WB 4OLUL 1MFBH 4YXKH 2EDQA 1BFTA 4GRMA 1XR9A 3QJFB 3OAYH 4PJBB 1J9CT 5C0CD 3HE6A 1R3LA 1S3KL 4V1DD 1G6RA 4OCXL 5K9JH 5DZOA 4KHXH 1S9WB 3VXUB 4JJ5A 5HJ3A 1JNHA 3QIUD 5J4MA 1M1SA 5D1ZB 4KZEL 5E24E 3SBWC 5MEQB 2IPTH 4GS7C 5KG9B 4PBXA 3FOLA 2HFGL 1KT2A 4K8RL 4JO3H 4JDVB 3IFLL 4S1DC 4HK3N 5BRZE 1K5NA 3ZT5A 1AO7D 1PJ9A 1QBLL 3WFBH 3BX7C 4M7JL 3TYFA 5HYJA 1DVFD 1KEML 4N0YH 4H26B 3QAZC 4ZUUB 4XBPB 3JTSB 1H3WM 1IJ9A 5I0ZA 1F8TL 1ZSDA 4PRIE 1BZ9B 1N8ZB 1TTGA 4BA8A 1DBMH 4HV8A 3INUL 2XNAB 1QPPA 2PTVA 3UTSD 3VFGL 3V5HA 3MACL 5HGDB 3HC0A 1B6UA 1R24A 5DEZA 4LCCC 4QLRA 4XVTL 4K94L 4JM2D 1HQRB 5F89A 5KG9A 4AL8H 1MFEH 1L0YA 2UZYB 4EDWH 3VW3H 3VGFA 1X5JA 3ZKMC 2D7TH 1FJ1A 3B6SA 4JJ5B 2ORBL 1KB5H 1XIWB 5FCUL 3HNSL 1AE6H 1FNLA 4LF3A 4UUJA 4KI5E 1R5VA 3BQUC 2YD6A 1S5HA 4QRTB 3UTSE 2DN7A 1CZ8L 2D0GA 1ND0B 1FSKC 3BZFA 3RL2A 4R9HA 4ODWA 4N8CL 3HPLA 4NHUB 2GT9A 1INDL 4XX1G 5E8NA 4ZYKB 2XWBB 2FYYB 2DKUA 4FZEL 4MA7H 4Y16C 4ELMF 4Y19A 3WDIA 4PRPD 1F4XL 1S7TA 3MRJB 5IW6A 5J1TC 3C60B 1E4WH 3SKMA 3DX9A 3OQ3B 3HZVB 1ZHKA 2DI9A 3IU3B 3OAUH 2A9NL 4N0UA 3UDWC 1RZJC 5GISL 1DQQA 2HYMA 2VABA 4U1GC 3D9AL 4XP6H 1OTUD 3LKNB 3O6FB 5JA9A 3V0AC 1EFQA 4J6RH 1IAIM 3RU8L 4XBGA 5E08H 4ZOEA 2WUCH 1HINL 4JHZA 1JWSB 5B38B 1MWAH 5IMKA 1INQA 1AGDA 5C0IB 4KUZH 4K9EC 4LCWA 4LLMA 3I50H 3SE9L 4EI5C 4ETQB 4JREC 4MJ4A 4W6YB 5HDBE 4WV1C 3T8XB 5HBBA 4OI9A 4QRQB 3FOMA 3RVWD 5DC0A 4X6CB 5F9AC 5IFAH 1EHXA 1BFVL 5GGSB 5E4IA 4HS8H 4I48A 3MRBB 3MODL 5JZ7C 1FGNL 3KPMB 4G8FA 2J4WL 3SKNA 3IDGB 5IVOA 5CBAB 4MMXC 3DXAB 3QNYA 5TDNB 5FYKE 3GSRB 2Z91A 5I75C 4UV7H 1NEZG 3BDYL 1FFOA 2P44B 1PBYA 3SDDC 4M6ML 1G7LA 1JHKH 1FL3B 8CGTA 5HSFA 4KDTC 2EYTB 4JQVA 1AGFA 3NCYS 3QQ3B 1JUFB 1FFNA 7FABH 4P23A 3SCMD 2XA3A 1CD1A 1YEEL 5ENWB 4EI6B 1EFXB 4EUPH 3OGCB 1C7TA 2BNUA 4FP8H 2DYPB 3LN5A 4XNZB 2C3XA 1Z0MA 3T0WA 5E5UB 1RUAL 4OF7A 2P42B 3U0PA 5JPMB 4MD5A 1C5CH 1BREA 2BJML 4FMFA 2IADA 1UQSA 1IEAB 3O0RL 2EH7H 4WI6A 5T1LD 4NCC1 5EOCL 2AJ3B 1QLRB 1HKFA 4BM7A 3PWLA 3U7WH 2HT2D 3PGFH 2I27N 1H3VA 4QCIA 1KENL 1SMOA 2DQGL 5A16B 4N5UA 1AXSB 2GFBB 3G5XA 5CIPA 4TTGA 1E4JA 3S4SG 3LKRB 2PYFB 3ELAT 2EDDA 4PJ5D 2PXYB 1QQDB 4RMSA 1G0YR 4J3SA 4GKSA 5DJ8A 4I0CC 4OJFL 4I2XB 5IK3A 1KJVA 4HPYH 3WKML 4FQQB 3CX2A 4JZOB 4EDXB 2P5EB 2QQNL 4F58H 1DR9A 3HR5A 4YHIA 4EN3D 1MWAA 4P2RE 5B8CA 5BZDA 1R3KA 2R56H 1QLEH 2NX5A 2ATPB 1JRHL 1YN7B 1T0PB 1T1XB 2Z8SA 4BSVA 3NGBC 4KU1A 4FFWC 5DR5L 3U6RA 1E28A 3LH2L 3BHBA 3TJEH 4TSAL 4EOWL 2AKRB 1WF5A 4JY4A 3STZB 5IBTL 2EH8H 3X3GH 4V2BA 3QCTH 3RHWF 2A6JA 2R29L 4L9LC 2O5ZH 1T80A 3U0TB 5IFHL 1GGYA 1R0AL 4RRPG 4IMLB 3ARGA 3QUKA 3LN4A 1MJ7L 5D1XC 4L3CB 3C2SA 3PP3K 5T1KA 3HRZA 2DMBA 4CVZB 3VFPB 1G7MA 1JZ7A 1LEKB 2VTFA 2HT3C 2CIKA 2DI7A 3DURB 1EHAA 5DZNA 3AFLA 3QIWB 1JVKA 4NQEA 5A3IC 4QEGA 4MAYD 3FRUB 4KRPC 3RWFA 1TENA 3QPQD 2VAJA 2GCYA 2F54B 3CXHK 1E27A 4QHKJ 3UROR 5I75B 4MSWB 5C2BH 4L3EA 2BMKB 4NKIL 1NGPL 3SDDB 3U0WH 1SYVB 3TBVB 1ZANL 4NP4H 2XTJD 2B1HH 3H6JA 5D7JC 3MLSL 3BMVA 4G8IA 3ARBA 1A5FH 1C08B 5IVZB 1P7KA 3PG2A 3MJGX 4P46B 5HVGB 3PWPE 1SVZA 4UDTA 1ZLSH 5IT2H 4BKLA 4OUUA 1AFVL 2JELH 4WFHE 3MLZL 5KANI 4WU7B 1D5XA 1L9MA 4MXVE 2DMKA 3DUHA 2W91A 5L2JB 4O9HL 4GBXD 4MJ5B 2Y06L 3BXNB 5D6DA 5E99L 2XZZA 5FUCC 3V0VA 1G9MC 5KSBB 4HKBA 5E2UH 4NKDA 1ZT4A 3Q3GA 1NGQH 2ARJQ 3KJ4C 3ZSSA 3U30B 4F80A 3B2UD 4N90E 2DI8A 3D69B 2JJWA 1ZT4B 3DETD 1NGYB 5I1IH 1IM9A 4H8WC 4NSKA 2G75A 4HUXA 3FT3A 5C07A 3VD9A 4ODTH 3DX6A 2X10A 4G6MH 5FYLH 1X5HA 4NQVA 5EO1B 1N64L 1HWGB 1BQUA 1LEIA 1YNKL 1YEJL 4CDHA 2EIBA 4XCEA 3B2UC 1VFUA 4OUUB 4LPUA 2IG2L 4UDTB 4PY8I 1JE6A 1YEFL 4X6BB 3HI1A 5DHYA 3MPCA 2CR6A 4Z7OF 1UCBH 1VFAA 4XP5L 3S7GA 2YZ8A 1SYVA 5TE6L 4LAJH 5D96C 4XCCH 3SDDA 5DJ2B 4M61A 3NOIA 4OZIF 1N3NA 5F7UA 4UT6L 1QSEB 5F9DC 3HAEB 1TJHL 4PRHE 4QRSB 1GGBL 2ESVA 3GMPA 1A9EA 4HKZB 3NCJL 3RWFB 3X12B 1CLYH 3O4OB 3RWEA 3HMWH 2FIRT 2ZCHL 2I25N 2NY5H 5KW9L 3SDYH 3IF1B 4R4FL 2A6KB 3B9KC 3UDWA 1WTGT 4D8PA 4H0IA 4PP1C 1BQLH 3J8F7 3JVGA 5BRZD 2PYED 1VSCA 3V5KB 3TF7C 4OF5A 1T21A 3WMSA 3H3PL 3IJHA 3ARGB 1YN6A 3DYMA 1DVFB 1WUNT 2XFXB 3U0TA 5LGKA 1OAZH 3L5WB 4M1GL 4DGIL 3QEQA 3RL1B 5ABDE 2UWEB 3VH8G 5EWIH 4IEFB 3MREA 1BWWA 1JYNA 2AGJL 1TNMA 1BPVA 4WY7H 1UACH 3FCTA 5F3HB 5ID1A 3U6RB 4JRXB 3QDHA 4HULB 4I18C 3QP3A 1D6EB 2CRIA 3BPNB 2Q7YB 4CGTA 5HHPB 3HE7C 2DQIH 1JMXA 4Y4KD 3UPCA 2G60H 5B8CB 4YFLI 4WU5B 1JF6A 2IPUG 3RUGB 1OTSD 4M5ZH 5JR1L 4Y5XC 5DEGA 1WWCA 4ZFOL 2W38A 3B43A 4IOFC 5JUEL 4GKSB 1QQDA 5I16B 2GIYA 3BGMA 4YWGH 1GOHA 4PJ7B 3PHSA 3UEZA 3CVIL 1PG7X 2N1KA 5FHAL 1KCUL 4U6XB 4L1HA 3OKOA 2QHLA 3BYTA 2COQA 1OTSC 1OT2A 3PWLB 4H1LA 4XCYB 4JLRB 4Y5YC 1QLRA 1A6AB 3I6LD 5DTFB 1IC4L 5J6HA 1ZGLM 5DGRA 4MJ6A 4OLZH 2VITA 4YJZL 1ETZA 5HI3D 4P2YA 4QRPD 1IILE 5FM5M 1DUYA 3LMJH 4W4NA 3VFNA 3QCVL 3B8YA 4OZIB 3VU2A 2ARJA 3CU1A 5HHNB 1EO7A 2VQ1B 4F37F 3OR6A 5D8JL 3SO3C 1AGEA 2G2RB 4FZ8H 3I6LE 5DD6B 4JKMA 4R8WH 4RAVA 1ZLUH 2UVEA 1U8LA 5E4EC 2EDOA 2PW2A 3VFVB 2CLVA 1JUFA 1AKJD 3VXSA 3U4BH 3KYKH 2L7UA 2EYTA 4GG8B 4H8WH 4WV1B 5DYOB 5KS9B 2GW5A 5A3ID 5BQ7A 2YUZA 3U7AA 4ONGH 4DGYL 5GGSY 1MFDL 2YK1H 3EDJA 3TEUA 2KL6A 3VDAA 1LMKA 4X5XA 2JIXD 2Z35B 1NCBL 2MWCA 4PS4H 2PF6A 3FB5A 2YEZA 3IJSA 4YDLB 5F7HA 1QSEE 1FZMB 5BOZG 1MCBA 4X0KB 5GGSA 3KJ6L 4X6CA 4PB0H 5I71B 1BLNA 3T3ME 3CVHB 3BO8A 4WJ5B 1JPFB 2GJJA 4G6JL 4QHLB 1LD9A 1ZTXH 2B5IC 2HJKA 3GM8A 2CR3A 1YUHB 1HHGA 2BVYA 4DEPB 4HS3A 1INEH 3X13A 5BCAA 5E4EB 3T77B 1KFAL 4LVEA 4OCRL 5I19H 3N85L 3EIFA 3L9RA 2EKSA 3QSKB 2VLRD 3QDJB 1NFDF 1B2WL 2CK0H 4L8BB 2QADD 1FZKA 1IGJA 2VLKA 4OBRA 1KYOK 3SDXF 5CEZL 1AO7E 4DTGH 4Q6IC 4GOSA 3VE0A 4GQ9L 2H8PB 4XBGB 4JKWA 3QUMH 3C2AL 2G5RA 1OB1B 3GMQB 3GHBL 4HDIA 1IGTB 3DV4A 4PP1D 4LRIC 5I76A 2C3VA 3MCLH 4HBCL 4TVPD 3GB7B 4PJ8A 1A4JA 3SKMB 2CDEA 3OKMB 3AREC 1GSMA 2YR3A 4F9PC 2Y9RT 1RJYB 2ARWA 4H88H 1S7SB 3B9EA 3PJSB 4J4PC 3UTQA 1E4KC 5CUSL 4PJEA 1JPGA 3OF6A 1CFQB 5A2KH 4NHUA 3BKYL 4X4YA 3KXFD 3HPLB 5CJ8A 3VXUE 5KS9F 2AK1L 5E00B 5KVGH 2HH0H 4HIHB 4Y5VB 4I77L 4KVNH 4QRTA 3O4LB 2HTLC 3WIIH 4KZDL 1R5VB 3EGSB 1ZEAL 4NN5B 1IVLA 4G3YL 2NTFA 1CR9L 2GK0A 5GSVA 1RZKH 5IQ7H 2GJ6D 4Y19E 5F1OB 2OL3B 5CHNB 1RK0A 5F89B 2UZXB 4KK6C 3SGDI 1WC7B 4ONFH 3BIBX 1R24B 3GO1H 3LRSB 5HGDA 4M6NL 4HWEH 1R3JA 3VWKB 3RA7H 4QWWD 3LIZL 5CP3A 1ZSDB 3PP3H 4KTYA 4ZNEE 4XHJC 1GGIL 2P47B 1OAQH 3EOAA 4HWBH 3ZKMD 4XBPA 4LVHB 1VADA 4U1JA 5HHOA 3KPLB 2WANA 3CUPA 4HMCA 4LRNH 2R2EB 4DW2H 5HGAB 3T0EE 4XBEL 5CEYA 4L9LA 2E9IA 4S1SH 4WO4C 4DWHA 3TIEB 1M4KA 3T0AA 3K3QA 2P8PA 3O3EB 2Z4QA 4X8XA 1VADB 3RKDC 3KPNB 4L3ED 4JO4H 1RMFL 4JZJC 4DJMA 3KPOB 4PGDA 3NTCL 1JTPA 5E94B 1JGUH 1F2XK 1TETL 1CGXA 3VWKA 5F7FA 1RV6X 3SE3C 4EN3B 5B8CC 3D5OF 3DMMA 1L7TH 4GAYB 1P5UA 5FB8A 1G6RB 5BVJB 1UXSA 5GRXG 2MQ0A 4PV8A 2HT4D 2VXVH 2NR6D 1ZLWH 4LPWA 2R9HC 4LU5L 2XRAL 3RP1A 3WHXA 1M6OB 3P4NA 2X44D 5L8JB 4HIIB 1X6LA 4NYLA 3PQYA 4NUGL 4QNPF 3B9KD 5BV7L 3DX7B 4M9PA 3V8CA 1MQKL 2R0ZH 5E2VH 2EYRB 3VWJB 5J6GA 3NPZB 5KSVA 2D31A 4MQXD 4HUVA 5IM7B 4HQQH 3T1WA 5D71L 1OQXA 3VCLB 4ZTPL 1FO0H 4JKKA 4DAGH 1MFCH 1XGTA 5L6YH 3S88H 5JQ6L 4Z0XB 3V9FA 3ZDYF 4X4YB 1LO4H 4QRRE 3L5XL 2WBWB 2H3NA 4XPTH 1GGCH 4U2YA 3UTQB 2LAAA 1A2YB 1KIQA 4HAGA 3FT2B 2GJZB 4G8GE 3GB7A 4PJ8B 2APVA 4M03A 3QEGH 1D6VL 1WFNA 2PO6B 2EDTA 1OP5H 4ACPA 4LSSL 3F7VB 4UAOC 4J1UB 1NMCC 3GMQA 4GFTB 5MI0B 4A2LA 2YC1A 3TFKC 3IDXL 2H8PA 3LD8C 4N5EC 2OXHA 4BUGA 3BZDA 4FFVD 4KDWA 3EOYG 3JWOC 3S4SB 4NBZB 3S37H 1I7ZA 3T2NH 1J1OL 5D1XB 4WTWA 4XNZC 2BRRH 3KYNA 5LVEA 4P9MH 3EYUH 1HILB 2WBJD 4PFEA 3T77A 4JQIL 3MRMB 2MPAL 1RUMH 2MSPA 5BJTA 4AT6B 5HYFA 5IR1B 3BOVA 5LQBL 2Q87A 2UUDH 2CGRH 5DJDB 3MRLA 5EOTB 3BO8B 4WJ5A 3CVHA 2DJSA 1FFPA 1ZAGA 3SDCA 3DHMA 1VFMA 3MUGA 1I1AC 4IRSC 5IOPA 1A1OB 5MEOA 1U6AH 3S5LA 4B7IA 2J8OA 2HLAB 4J3TA 4NQCA 1B0RB 2DD8L 2EIZB 1ORSA 3MRPB 1UADC 4HXBL 4K3JH 3MGAA 3D25B 2JJTA 2YZ1A 4YHMH 5AWNL 3DGGA 2FZ3A 2WWMD 1MF2H 3LQZA 4MJIE 3W11C 2H2SC 3QIBB 2YD4A 5BVPH 1ZGLA 2RGSA 3T0EB 1FN4A 5AD0A 5HYSG 1JNJA 2FH6A 1FL5B 2AXFB 2CO7B 5DD3H 1LK3L 2XN9B 5DC9B 1EIBA 4Y2DC 1U8LB 1DQML 3QEUB 1FC2D 2ZSVB 5DD6A 1WIPA 5D7KE 1WSST 4Y4HC 1WEJL 4RNRB 1KNOA 4HGMA 1HHJB 1QFWH 5E8EA 4HLZH 1MFAH 3JV5A 2PO6D 4PJHB 5ACZA 1U8NA 1RU9L 3ZL4H 3S35H 1GGTA 3GBNH 3HMXA 3O45B 4ELME 3V4UH 4OZIA 2BY2A 3P4OB 4WUUE 2H26A 4LLVB 4RWYH 3KPSA 1G6RL 3UJIL 1OAKL 2HT4C 3I6GB 4CMMA 4EN3C 1BVKB 2YKLL 1A6TA 1DBJH 5J6HB 3BVNA 3P0VL 1MAKA 1KTLB 3E8UH 3RKDD 4XNUH 4HKXB 1N5YH 5F1KC 4XNYH 1R5WB 4P3DB 1QOKA 2Y5TA 3GJFK 5F8RC 4Z77A 4KQ3L 3T04D 5IV2B 4OI7A 3LRGA 2BXYA 5SWZB 4HF5L 1CS6A 5C6PB 5FA3B 4ALAL 2X40A 3CFKA 1F4WL 3NH7L 1T6WA 3AROA 3IFOA 4X4XB 5D2NC 2LAGB 2H32H 4AK1A 2X9WA 4UIMB 2AJUH 4GXVL 1KC5L 1U91A 4WFFE 4OM1L 1KPVB 1UH2A 2V5MA 3QG7L 1W8NA 4WU5A 3K1KC 4QTHB 3RTQD 3G6DH 3RPIA 5BMFH 1JRHI 1ZS8B 3ARSA 4OZGA 2ADIB 1AH1A 4HBQA 2W0LA 4BSWA 3WJJA 4UIKL 1I7UB 3O2WL 1DL7L 2C4FT 4P5MA 43C9B 2VDLH 4JRXA 3MBEC 2B0SL 5HY9A 4U1HA 1MNUL 1EJOH 5C1MB 4X4MA 4O4YH 2CLRB 2OBGA 1XGRB 1HDMB 3MV9E 1AP2B 4DGVH 5IB2B 3L3HB 1I3VA 3G08A 4JREB 3L5WA 3PHOA 3WIHL 1J7VR 3A0OA 1OF2B 5AYUL 2B4CL 2A1WL 3IYLW 1U93A 1YN6B 4JRXE 4WW2A 3LS5H 2A6DA 1WWBX 4K3EH 2ZCKH 1W0YT 1RULL 3LSOB 1FIGL 5EO0A 1PYWB 5BO1H 3TT1L 4YDLC 2VXTH 3EYFB 4NO5A 2A6KA 2YD8A 5ICXA 3WL9A 5ALCL 4UT7H 4GKZB 1T1ZB 5TQ0L 3RWEB 1KCVH 2X4PA 3X12A 3NIFE 1UM5H 2IMNA 2XZCH 5J56B 3QWRA 5GGTA 3CZFA 2DQTL 1UWGH 1A3LL 1NBZA 4JHAH 2P46B 5HYJD 1EGJH 3BD5A 4J3UA 4QHUB 1A1MA 1F6LL 5KSUA 5HHQB 1B6DA 2NY3D 4F8TA 4JDZB 1MCWM 5E6YA 2GJ6E 3P4MA 4G7YH 3QFDB 1CWVA 3MA9L 1HQ4A 1J18A 1YJDC 4NT6A 3QQ9D 1T03L 4OCYL 1LDPL 3MLXL 5IB5B 5IFJB 1S9YA 3KPSE 5JXEC 4OZFG 3OX8B 1PQZA 1JJUA 4MX7B 5TF1H 3QXVA 1X7QA 1EMTH 3MYJB 3QNXB 4EZMA 1E4XL 1IM9B 2FGWH 4LMQE 1NGYA 4NSKB 4HJJH 2YRLA 4PP2A 5KN5B 3OZ9L 4IRJD 3SDXB 3MYJA 2FWOA 4NBXB 4QXTB 2DL9A 4MX7A 2LU3A 1SJHA 4OLWL 3HRPA 4YFEA 1S9YB 1RIUH 1HXMB 5TH2A 3C6LC 5IROA 1EVTC 2AEPH 3FQRA 4NKDB 4HKBB 4KI1A 1F3JA 3D48R 5KSBA 3RNKB 4O2CA 4ZSOB 3VMPA 1XT5A 5IMOB 3QRFM 5DMIH 3LN9A 4OIAA 5HHQA 4QHUA 1MCEA 2MCPH 5CILH 4FG6D 1PD6A 2ICEB 2QHRH 1QKZL 3GSNH 4NQCE 4BKLB 1I4FB 3UC0L 5F9WB 3LHPH 4P46A 1P7KB 2V2XA 4RMTA 5T33L 3KYOA 1A0QH 2G5BA 2A0LD 4CAGA 4JRYD 3HNTL 3QDGB 3ZE2F 1FC1A 2NY0B 4PJEF 5F70A 4KI5F 5I74C 1T83C 2R69H 1IKNA 2GCYB 4Q9RL 3VFTB 3LSOA 2YPLA 1BEYH 2FX7H 3O8XB 1U8JB 2IMMA 3FQXA 2B1AH 4AG4L 5FK9B 3G08B 1EBPA 1KPRA 1BVLB 2BSRB 3E3QE 1EO5A 3FZUC 5LWYH 1HDMA 3N1FC 1XGQB 1TPXC 1CYGA 5EU4B 3DUUB 4GSDH 2FD6H 3QUKB 2Q76B 2PYEB 4OFVA 1XF5B 43C9A 3SKOB 2XZQL 5EBWB 1I7UA 2Z31D 1MCRA 5IHBA 2OZ4A 3WNLA 2BOCA 2AKRA 2QQKH 1D5ZA 4HK3J 3ZHKA 4U7KA 1MCDA 2F53B 3BHBB 5DHXB 3RBGA 2WK2A 3G6AA 4QRPE 4ZUWB 1KEMH 3JWDH 3GSQB 4KUCF 4F2MB 3VG0H 3ZTJG 2V2TA 4L1DA 1MEXL 3LY6A 1QNZH 1V7ML 2DQCH 1HH6A 3T2PA 3CH1A 3FN0L 4X4XA 1KJ2L 4MA8H 1A9BA 3FAWA 4JFPA 5E03A 1DBML 1MWAB 2Q1EA 5D2LF 3RWGB 5BZDB 4R7NB 1ZT1B 3HR5B 1GC1C 3UX9B 1ZVHA 1MREH 2H45A 3GJFB 1R5WA 3VXNA 2C3HA 5FUZL 4OLVH 2MOVA 5DJ8B 5JHLH 1EEZA 3KLHD 4PLKC 5D7LD 2BHYA 2E5EA 3DPBA 4Q6YA 4JFZH 1U95B 2FSEA 1CICA 4N0FB 4PRDA 4WW1B 5AZ2L 5SWSE 3CIQA 5HYSA 4I0KA 5I1DA 3D3VB 1AXSA 4PYHA 5FCUH 1AE6L 1BVKA 1NCUA 3ZTJH 2DWEA 3U1SH 2DLHA 4NC1E 3KPSB 1J10A 3TIDB 2PETA 4P4KB 1K4DB 2Y6SC 4FQLH 2A77H 4Z7UF 1NFIB 3PIQB 4Y8DC 1BGXL 3EUUA 3GSNA 3TO2B 5F7LB 4UQ3B 3HLAA 5C0AA 1VEPA 3HAEH 4JPWH 4F7PB 5EZLA 1PLGL 5IUSA 1JWMB 2VXQL 2F53D 2X1XR 4ZO6A 4NOBA 1S7QB 3OMZA 3BZEB 3OAUL 5GISH 4ZXBD 2Z31B 3VFUA 2BZDA 3A6BL 4XP6L 1F42A 3I3EA 4LBEA 4P3WA 3QI9B 5J1SC 2NY3B 4OB5L 3BE1H 4PJIF 1A1OA 1UGNA 2WUCL 3B9DA 3MRIB 5BRZB 4PJ8C 4BH7A 1QSFE 4X7SH 3MUGB 2XTJE 1X4XA 2Y36L 1SY6A 5EZJB 2Z91B 2B4CC 2VWEC 3GSRA 8FABA 3OKLB 2EDWA 3D85D 1V05A 5TDNA 3OPZH 1CL7I 2LU4A 5CINH 2QSTA 2Z8WC 3KPMA 4ZAKA 2X4OA 5D5ME 5INCA 1C7SA 3Q6FA 3DRTB 4KTDL 2DF3A 1U9KA 3V2AR 1BF8A 1EH9A 2EXWC 5IFAL 2UVFA 3S4SA 2QSQA 4PRHD 4Z8FL 5ESVB 1N0XL 5LGJA 2FJHB 3MODH 3IAPA 2FEDC 1U42A 2QSCL 4LCWB 4LLMB 1MUJA 1L7IH 3EZ8A 3L7FB 1OGAB 4KDTA 2PYEE 4J1UA 4D0CB 3LZFL 3C5JB 1UM6L 5CIPH 1Z0NA 5CLTA 3BI9X 3TBWA 2VR5A 2W9LA 5E8PB 3RAJH 4RGND 2F58H 1LO3H 4MQ7B 3O6FA 4B5EA 1ZXQA 2ZSWB 3AAZB 4NN6C 3F12A 5E6ZA 1JNNL 5ADPH 2W0FA 4L8DA 1JZ5A 5TQ2H 1ZHKB 2GEEA 5GS0C 1CTNA 4NKOB 4U6HB 3C60A 3MRJA 3WSQH 1NC2A 2IPUK 3OL2A 3REVB 3W9DB 6CGTA 5ITFB 1VACB 1KTKE 2JLLA 3CVHH 3GMRA 1IKFH 4ZYKA 4GW4A 3B9KB 4PREB 4NNXA 4EI5A 2I9TA 3NA4A 2VH5H 4MNGB 2BVTA 1K4CA 1QEWA 3EKCA 4QF1B 5EOCH 4XPHL 4YX2L 3WHXB 2Q8BH 4DUXA 4L4VE 1NC4B 3ABZA 3PGFL 5BVJA 1LVEA 4GAYA 2FDBP 4OD2A 1N7ML 3S37X 5C0DB 4JCLA 2B8OT 1XIWA 4ONOA 2O93L 2Z9TA 3LS4H 4K7PH 4M62L 3VFWB 1MIML 4HK0A 4PGDB 3PWVA 5JXEA 3HC4L 4PB9L 4XNMB 1H8NA 4TUJA 3CC5B 2RAMA 4IRSB 1I1AB 5MP6H 2P5WE 1NQBA 3CLFL 4EQ3A 4RISH 4RBPH 1I1RA 4XHQA 4TVPL 3ZTNH 3PL6A 4CU6A 1QYGL 1CLZL 4HWNA 5GGVL 1UA6L 4U1JB 5HHOB 3VFRA 1U58A 3AREA 3BH9B 2J12B 4JRXD 4H26A 2JE8A 4HXAH 2HJFB 4POZC 5DR5H 4ZFOA 4NPYA 1WBYB 5ERWB 4YBLB 4EOWH 4WUKL 5JOFA 3WXVH 3HUJF 4GW5B 5CZXD 1IGML 2NY7H 1JPST 2DDQL 1WC7A 2O5ZL 5E6ID 2C9AA 3C6SA 1I8MA 1RK0B 3EYVB 1K2DA 4LAQH 3AMLA 1YPZF 5FYLE 2FHFA 2D7NA 4L4VA 2QSVA 5GSVB 3TESA 5EOCJ 5LGHL 4R96B 1FNAA 1OP5K 1LK2A 3MO1B 3OXRB 3CGTA 5F7DA 4P5TB 4R7DB 5KS9E 5I1LA 3EDKA 3MV7B 4P2OD 4TNWF 4R90H 4Y5VA 5IJKC 1O7SA 1YYML 2VZTA 4JM2F 5LAXB 5FOJA 4ELKB 5CKAA 5E00A 5AG9A 4MDIA 1GZPB 3BDBA 3SE8H 3WXWL 2PXYD 3FO0L 1J1XH 4YDJA 5GS1C 4BZ2L 3LEYL 2ERJC 1JPGB 4PJEB 3KPPA 4MD0A 4X4ME 3CPLA 3NPSC 1RJYA 3MLSH 1GPOL 1YY9C 4V2CB 2OI9C 1CU4H 1T22A 1PKQA 3EOTH 1ZE3C 1IL1A 2VLRA 4KROD 1F6FB 4IHOA 1UH4A 1PY4A 3DV4B 1FNEB 1IGTA 5FUOL 4JQXC 3Q5TA 5SWQA 2AK4E 3BUYA 1F02I 4K71B 1W8OA 1FH5L 4AM0A 3QHFH 1CDUA 3ULSA 2FJGB 4OV5A 3OJVC 1TQBB 1K3IA 3WFCH 3BWAA 4PJ9A 1NGQL 2IANA 4L8BA 4HX1A 4Y7MA 4OD3H 5IJKA 4LCWD 4OFYD 5CJQL 3D1MC 2CLZA 1VGEL 3T3MF 3X13B 5CEZE 1R6VA 1KIUA 5IEHA 2ZUXA 4MWFB 4DVRL 3CXDL 2X4RA 2L4OA 4GBXB 3FHAA 2OTUA 1AD9B 4FQXA 1OAXH 3JV0A 1A4KB 4MA3A 4RZCB 3PV6A 4PD4K 3FB5B 5IVXF 5I73B 4F57H 4KVCL 4RIRB 3SGJA 1CICC 4XZUA 4PJGB 3IXAA 3V95A 4HJGB 3F62A 3G5ZB 1AR1C 5C0CE 1A7NL 1CFSB 4YXLL 4LHUA 5DYOA 3GHEL 4XCCL 5J12B 5MEPA 4OI8A 3BEVB 5E2WL 3D87B 4ZO7A 3VXQA 3C8DA 1ROWA 3ZDXF 1AGEB 2NY2D 2ZCHH 3IETB 5I6XB 2I9LB 4ESKA 2VQ1A 1JYXA 5HHNA 1YPZA 2NY0C 3TV3H 4P2QB 3IS1X 2P24A 5FM5O 3GSXA 3ULUL 5JO5A 3FB7B 4R26H 3NCFB 2B2XL 5GHWL 3WO3B 4EUPG 5ALBL 5EC2B 1FCCA 5LXGH 1UEYA 1OWRM 5SX4H 4KKBD 2IBZY 1GGUA 3QG6A 1TIUA 1AHWC 3PP4H 1JFQH 2OZ4L 4KK9D 4PRIB 1C1EL 3RY5A 2IH3A 3ULUF 2XACC 3SOBL 1QVOA 4Y1AE 3OXSA 4UV4H 4U6XA 5F6HJ 4CN6A 1F4YL 3A67H 4JEGB 1KN4L 5AAMA 2WW8A 4JG0L 5A43C 5I1HL 3GSUB 3PWPA 1IEBA 1MCLA 1CD9B 1OTTD 3KAAA 1E6OL 4TOYL 3RUGA 4AMKH 1OAUL 4K23H 2IQAB 1Z9OA 3MNVB 4JJHA 1FE8L 3RY6A 3WV0A 2XKSA 5DZLA 5C0EA 2Q7YA 3MRQA 4YWGL 5IJVA 4OLUH 4DZ8A 3FONA 3EYSL 5CP3H 5D6CA 4YPGA 4NQEE 1CDCA 4WHCA 2UWEF 4P57B 5HI4D 3D0LB 5EG6C 4QHMB 4MS8C 1J8HB 4WNQB 4ZD3L 1WV7T 4GH7B 4XVJL 1MJJB 3QH3A 3H42L 1NEZB 4FXGB 1HI6A 2MHAB 4OKVB 4LSVH 3T1FA 2DRUA 2YPLE 4LOUC 4I9WE 1U92A 4YO0B 1G7JB 3L3JA 2AEQL 4LSTL 4MS8D 1SY6L 5H94A 2VLLA 3BQUD 1QBLH 3QNZB 4M7JH 1WCQA 1QSED 1T1WB 1QUNA 1A9EB 3U30C 2RFXB 1JGVL 3GK8L 1HSBB 3KYKL 1A22B 4LSRL 2EC9U 2YMXL 4F7CA 4YZFE 1FPTL 1VDGA 3INUH 3H7BB 2FX9L 3PE9A 1TLKA 1VFAB 4AIZA 2HT2C 2YK1L 4MCZB 4UOW1 1CVSC 1EO8L 3HI1B 5DHYB 1NCBH 3MR9A 1MFEL 2VXUL 2V7NB 2IH1B 4ZDHB 2V5SA 3RVVC 1DFBL 1OSPL 5GJTH 3WLBA 5FYJL 1HWHB 4PB0L 1FG2B 5DF0A 4H20H 2FLRT 5E1AB 5FO8B 4Q0XL 2BRQA 3DX6B 4KQ4L 3PABA 4HUXB 3AXLA 2VQTA 3BPCA 3WO4C 2YRZA 5C0BE 4N9OB 5HGHB 3UTZB 4N8CH 4OCRH 1UZ8B 4KHTL 1Y18A 3LB6C 4PG9B 4DTGL 4WENB 3RZCA 2X89D 4GQ9H 3C08L 3TZVD 4U0RC 1RZGA 2KDGA 3HZKB 4QRUB 4MJ5A 3RX5A 3U9UB 1KBGH 3C2AH 1AGCB 1V3JA 1D5XB 1HZHH 3IDNB 1GC1L 25C8H 4LLDA 3O3BA 4UU9B 3DRQA 2DIJA 2NW3A 4HEPG 4LASL 5FM8A 1XGUB 4MXWL 1P6AB 4YE4L 4RRPA 5E08L 2WINA 3FHQA 4PGEB 4H88L 1ZA6A 2FJFA 1MWAL 2RB8A 3H7LA 3NGBB 1CGSL 1LEGB 2BMKA 2V9QA 4DOHE 3OBAA 4LLUB 3V7MA 4XWOC 2ILLA 1E27B 2XICA 3BP6B 2IF7A 2Z92A 5C0JB 3FRUA 4FQ2H 1X5IA 3MCKA 5D70H 4PGJA 4L8SC 3QIWA 3FFCD 2R0WH 3HMXL 5JLZB 4G3YH 4JN2B 2JCCE 4DQOL 2CIKB 4JO1L 5EBLB 4NWTL 3VXMD 1ZV5A 3VFPA 4HS8L 4KMLB 5DRNB 1S7VB 1P4IL 3MGOA 5GZND 4WW2C 2E7HA 3PWJB 4JHWH 5CJBA 1BFSA 1EHLH 1RZIA 2R1WB 3P9LA 2I07A 4XWGL 3HCVA 1T20B 2OR9H 4OZGE 5JNYB 4MYWB 4I5BA 4N0UE 4RDQF 3QQ4A 1MCWW 2OMBA 4LNVA 5T1MA 1AO7B 3EJYC 1HE7A 2H6PB 1RFDL 3RTQB 4FP8L 3TBYA 4NO0D 2CO6B 1YECL 1RUAH 4NO3B 2XA8H 1U41A 2AK4A 1KF9B 2Y4SA 1C12A 3TCLA 4FQQA 4EDXA 5I8OH 3DECA 5IK3B 1UKSA 1TVBB 2GSIB 3V4PH 3O0RH 4OIBA 3DLQR 4Z18A 3P9WB 3K0WA 4XVSH 3FTGA 4U3HA 1AY1L 4KKAD 3PXHA 4G5ZH 3UTSA 2R1XB 5BS0E 4M93B 5B4MD 2ZOLB 4GUPB 3EFDL 1ACYH 4QCIB 3MRDA 2BHZA 1BIIB 2E8ZA 1DANU 1T4KA 4WCYH 2FECI 3UP1A 1I3RB 1RZKC 2NNAA 4ELMA 2YD3A 5KOVC 3GMLB 4IRJA 1MHHB 1J05A 5L7XL 4FG6C 1DBAL 4MD5B 5CKGA 5E95B 3W0WD 1MH5B 4NZRL 4ODSH 5EU5A 2O5YL 2DYPA 2BNUB 3CH8A 4PJIA 4OM0L 5E5RB 5HDOA 1LO4L 2BNQB 1DEEA 4KK9C