3WY3A

Crystal structure of alpha-glucosidase mutant d202n in complex with glucose and glycerol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLNTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 190
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy3A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy3A02
2QLYA 3D4YA 2WNWA 3BC9A 2ZX8A 4U33A 1CIUA 1XV8A 4LPCA 2ZX7A 3K8KA 1OB0A 1R46A 3VGHA 2GDUA 1QPKA 2BXYA 2XIIA 4FNRA 1WZMA 3ZOAA 3QGVA 1XH1A 4UQDA 1S46A 1KXQA 3D4ZA 2V3EA 1VIWA 2G3NA 3L4ZA 3WY4A 2TAAA 1UA7A 2ZX6A 1KTCA 3WY3A 2FHBA 4NXKA 1U30A 3A22A 3II1A 2YOCA 2OSXA 1KWGA 2ALWA 2E8YA 4NZJA 3DX0A 3VU2A 1HL9A 5DO8A 5HPOA 9CGTA 1GVIA 4JFUA 2OYLA 2X2IA 1VFOA 4FLSA 3ZT7A 3DDFA 2XWDA 2OSYA 2BY1A 3K1DA 3S5YA 2YIHA 2Z1KA 2E4TA 3VSUA 2Y24A 2V3FA 3AMLA 3WFZA 3VGDA 1LWHA 1MWOA 4AIEA 3IJ7A 4GQQA 3BCDA 1QHOA 2XN1A 5HXMA 2OW7A 4H8UA 3S5ZA 1MFUA 3BUDA 1E3ZA 1JXJA 1XD0A 2EQDA 3L4TA 5A6MA 1J0JA 1V3KA 1TCMA 3GXDA 1GJUA 2ZUUA 3H53A 2PWGA 2NT0A 5E70A 1G5AA 1CGYA 3VMOA 2FGZA 2PWHA 3BVXA 2ZX5A 4UOZA 1IZJA 3DX1A 3RILA 3UG5A 3BAIA 1UASA 4AW7A 1PIGA 3BUBA 4W93A 1PS3A 1M7XA 2D0HA 1CXIA 3EJRA 4BA0A 2PWDA 3CZLA 1QWUA 1OT2A 4HP5A 1KB3A 1RP8A 3OLGA 1UD3A 2ZXDA 4WF7A 3GBDA 1ODUA 1TQWA 3A21A 1PPIA 5DFAA 1KBKA 4JCMA 4AYSA 1R34A 1XSKA 4PCTA 4OIFA 1V3LA 1WE5A 3WEMA 2GUYA 4AIOA 4UNIA 3FW6A 1SMDA 2FH8A 1UKQA 3EDEA 4JL1A 3VGGA 3WN6A 4M56A 4ATWA 2ZXAA 3A4AA 4H7VA 2DIJA 4HA1A 6CGTA 1PZ2A 1KTBA 1QW9A 3LX9A 3BLKA 2DH3A 5TD4A 4B9ZA 5C8BB 4PSRA 5E6YA 1KCLA 1JFHA 1ZJAA 4KMQA 5F7UA 3L2MA 4HOWA 8CGTA 1VJSA 5BRPA 3M07A 5I23A 4J27A 1JXKA 3BUPA 3GXFA 1NM9A 1IZKA 1MXDA 2VNCA 2WCSA 1WPCA 2Y2WA 3A23A 3HG2A 2BY3A 3BVVA 1GCYA 3BLPX 3TTYA 1QWNA 2GJPA 1I75A 3BAJA 4J3SA 1NOFA 3GXIA 4MB1A 3DX2A 1CLVA 1VFMA 2EO7A 2Y5EA 4U2YA 5EMYA 1XCWA 4DO5A 1UKSA 1G9HA 1EH9A 2BHYA 2XN2A 4CVWA 2XVGA 3K8MA 2FYVA 3EJPA 3BH4A 2F7RA 2ZXQA 3GXPA 2QMKA 3BSHA 2ZUSA 1VFUA 1PIFA 1U2YA 3DDGA 2XVKA 5CLTA 3AMKA 4QAWA 4FNTA 3LXAA 1CXHA 3D52A 1CXLA 1PAMA 1QI3A 2WKGA 1HX0A 1L0PA 2D2OA 2WANA 2QPSA 3AJ7A 1T0OA 3VO0A 3WNOA 2GJRA 4FNSA 2ZE0A 1SMAA 4DO6A 5A2CA 1AQMA 2DIEA 1U33A 1JI1A 3GXMA 3CZGA 4U31A 4CN4A 3WNLA 1KWKA 2ZWYA 3WDIA 1J0IA 3KEHA 2D3NA 4UZSA 1HNYA 1UKTA 2F1BA 4J3UA 1J0HA 1HTYA 2C8NA 3KLLA 1MW2A 1Q4NX 3CGTA 3CPUA 1VAHA 4GI9A 1XSJA 1W9XA 1R7AA 3D50A 3KWXA 1V3MA 4JL2A 1JG9A 5A2BA 1JI2A 2WVVA 5E9AA 1CYGA 3WMSA 3HJEA 3BAXA 3L4WA 2BHZA 4CN1A 7CGTA 3A5VA 4NI3A 1JGIA 1JAEA 1UH2A 3UG4A 4J28A 2OYMA 3MI6A 4UZUA 4BZYA 3A47A 4TVUA 1KGWA 1UD5A 1QX1A 1UD2A 3BAWA 3IK2A 4WSJA 1E40A 4J7RA 2CHNA 1KXTA 1QW8A 2WVUA 2EADA 3BCFA 2E0PA 4LQ1A 2ZUVA 2OYKA 4JFWA 4WLCA 3EDJA 4GINA 5BRQA 3ZO9A 3KL3A 1WZAA 2YFOA 1CPUA 1HWWA 1H3GA 3OLDA 5HDRA 3UEQA 3AXHA 1TMQA 1G94A 4J3VA 3CLWA 1SZNA 1HT6A 2BY0A 5A6LA 1PJ9A 2D0GA 4OJYA 3ZSSA 2BXZA 2YA0A 1CGXA 3FAWA 5I24A 3BLBA 3WY1A 3CZEA 2NSXA 1KBBA 1EHAA 4GO8A 4LXFA 1WP6A 2ZXBA 2GVYA 2EJ1A 2PWEA 1AQHA 1OSEA 1AVAA 4E2OA 3BMWA 2F2HA 4JFSA 4M8UA 3VMNA 3D51A 7TAAA 3BAYA 1MFVA 4HPHA 3ZR6A 5E1QA 2EAEA 1R47A 2ZX9A 2XN0A 1J0KA 4KWUA 2ZUTA 1TQSA 2ZIDA 2BHUA 1WZKA 1XH2A 4J3XA 2QMJA 2YFNA 1MW1A 2YKKA 5I0DA 1HXKA 1BSIA 1JD7A 4UQBA 3TONA 3L4UA 3LRMA 4X0NA 3KE0A 1JD9A 1D7FA 4UQEA 2ZUWA 1CDGA 3L4VA 2WVTA 2ZICA 2FHFA 1UD6A 2OW6A 3CC1A 3GXTA 1OT1A 2EABA 1PZ3A 3GTNA 3ZT5A 1HVXA 1Z32X 3BMVA 1A47A 1HL8A 1RP9A 2NT1A 2VUYA 3WNMA 1EA9C 2CPUA 3ZSTA 2QPUA 3VX1A 2VT0A 1UH4A 4GI8A 3HG5A 4UQCA 4OGZA 4HOXA 2D3LA 2E9BA 3EJUA 1EO7A 2VRQA 1BPLB 1G1YA 1MXGA 2E8ZA 2WVVB 4FNQA 2X2JA 1MVYA 3ZT6A 2OSWA 1MW3A 3HG3A 1XCXA 1KXVA 3VM5A 3CZKA 3CZNA 4X9YA 2GDVA 1E3XA 4UCFA 1RPKA 2DH2A 1B2YA 1QI4A 2Y4SA 2YA2A 1WZLA 2YA1A 1JIBA 1CGUA 4MAZA 5CGTA 1OGSA 3EJSA 3GXNA 2G3MA 3VNYA 1ZJBA 4GO9A 5E6ZA 1TQUA 4NX0A 1JL8A 4JCLA 1O7DC 1UA3A 3KLKA 3L4XA 3UG3A 2F7PA 2VR5A 1CGTA 5CLWA 3ZQ9A 5CXPA 3H54A 3UCQA 1C8QA 3WEOA 3UERA 2V3DA 1E43A 3H55A 3S2CA 2WCGA 2WC7A 2D0FA 3BUIA 3LXBA 3EDFA 4AMXA 1ZS2A 5E0FA 1P6WA 3L4YA 3GBEA 3A24A 3L2LA 4WSKA 3EJTA 1KXHA 4GKLA 3RIKA 1BVNP 3DHPA 1GJWA 4AYGA 3WNNA 1KCKA 3BSGA 4PCSA 5I5RA 4PSPA 1B0IA 3A6OA 4H8HA 4H8VA 4XB3A 4JFTA 3IJ9A 4GI6A 2WSPA 3LPOA 1IV8A 2F7QA 1R75A 2F18A 1UH3A 4UOQA 1M53A 2AAAA 1DHKA 4FMVA 3HG4A 4U3CA 4B9YA 1UOKA 2WVSA 3VX0A 1BAGA 3BVTA 3IGUA 3KL0A 3TTSA 3ECQA 1QHPA 5KEZA 1XSIA 4J3TA 3DC0A 1Y7VA 3BVWA 3WDHA 1JF6A 4JFVA 1R33A 3VGFA 2YJQA 1JDCA 3LRKA 4GIAA 4NXSA 3K8LA 1V3JA 2XWEA 2IGTA 2WKLA 3TOPA 1KGXA 1XD1A 3VM7A 1UD8A 2FE0A 3HZ3A 4CGTA 3EJQA 3WENA 2VRKA 4H2CA 3VSVA 3DHUA 1JDDA 2EEXA 3LPPA 1BVZA 2FH6A 1EO5A 2QV4A 4NZFA 1BF2A 4GQRA 3BVUA 2CXGA 4AMWA 4FNUA 2ZWZA 1TQVA 1D3CA 4FLRA 4U2ZA 1AMYA 1KGUA 1JDAA 1XH0A 3VGBA 3EDDA 4FLOA 3FAXA 3DX3A 1MW0A 4OKDA 1DEDA 3EDKA 1CXKA 3LXCA 2X2HA 2J25A 4UQAA 4J3WA 3DX4A 4HOZA 1BLIA 4FNPA 4CKQA 2C7FA 1CXEA 3IJ8A 1JF5A 3WDJA 3W37A 1LWJA 2AMGA 3OLIA 3CV5A 3CTTA 3AXIA 2F1AA 6TAAA 4AEEA 4DO4A 2EACA 4UQ9A 1QI5A 1WO2A 3VSTA 3TV8A 5CGMA 3CZSA 2D73A 3BUQA 1TQTA 1BG9A 3WY2A 1XGZA 2F61A 2XIBA 1CGVA 3KL5A 2PWFA 1CGWA 2XVLA 5A2AA 1UD4A 4PEEA 3VNZA 3ZR5A 1CXFA 4AEFA 3WNKA 1VB9A 3LRLA 2FHCA 3W38A 3OLEA 1PEZA 4FLQA 2F7OA 2BY2A 3WNPA 3VMPA 1DTUA 3BAKA 2WPGA 3VGEA 2WSKA 3WELA 4CN6A
chains in the Genus database with same CATH superfamily
4BQBA 1M6OB 2H32B 1S9YB 3UYPA 3ZBMA 3JWDL 2DEXX 2HB0A 2AK4B 2MCG1 5KBDA 2BSRB 2PO6D 5CKGA 4UQDA 3MYZA 2Y1VA 1BMWA 1RZPA 2W0KA 2VZTA 3GRWL 2IPTL 2CKBB 2P80A 3CFEB 3LMJH 2YLHA 4K55A 5IHUH 1UJ3A 5FS5A 1KEGL 2AABL 2ZXCA 3FTXA 5CD3A 5IGXH 2FJFA 5HGBA 1HE7A 1HL9A 3RVVC 1QAWA 1UWXK 1HNFA 2OYLA 3L9EA 2OMXA 3LRSA 3CSTA 4N8CH 1SBBA 2AV7B 3DETD 5DJAA 4RFNB 2GEQA 1PL3A 4ZOCA 3GZOA 1U9KA 4UM9B 5B3NA 4NRXA 4LOUD 4XP6H 3DTXA 5GGQH 4OI8A 4HU2A 1N6QL 4MNQE 1XGTB 4LK4A 5I6NA 15C8L 2R4SH 2CK0L 1U8PA 4O2CB 5KVGL 4AYDC 3N50A 5DC0A 3OKLB 4LSUL 2PO6B 2FIKA 2A1WH 2DWDB 4JG0H 4PTTB 1Q1JL 1KG0A 3BUYA 3BRGC 3NABH 4BWTA 2WBJB 2VZUA 3ESVF 1NMBH 1EJFA 1KXQE 3UZQB 1TETH 3WHE1 5ANMB 1WCBB 3T6XA 1LO4L 5BV7H 1KIPB 3P4OB 2IMMA 1ZVHA 3EH4B 4FG4A 1CXIA 3GTTA 4BDVA 5I73C 5JO5A 1CFBA 4YK4C 2OSLA 4HK3J 5E6IC 2YOAA 2APXA 1HDMB 4FD0A 1GGCL 5HDWA 4X6EA 4X4ME 4F58H 1WFOA 2WWMD 1EK3A 3B7YA 1W8EA 5JHAA 3FN9A 4I4WB 5C0BB 3O4LB 3O9WC 4QXWA 2Q6WA 3DI3B 4WTZA 3IDMB 3D0LB 1KJ2B 2EYRB 1U42A 1DE4B 5ECJE 5HHVL 2GI0A 3QUMA 3GSWB 3BPLC 4LU5L 4FQ1L 5EUKB 1UACL 2A6KA 4R4FH 3UO1L 5EEVA 5EBWB 5JIHA 1JTOA 3P0VH 3GLZA 2D3JA 5KVGE 4JR9H 1ZDQA 1PQZA 1AKJB 4HF5H 3N9GH 4IJ3B 5EWIH 1A64A 4ZX3A 3GJFA 4HOWA 2AJSL 3F7KA 1SLVA 4PJFA 5AB0A 4HUXA 4P0DA 5E2VH 2VNCA 1WPCA 4Y1AD 4QY8B 5GGSA 3BVVA 3S88L 4WWID 3RPKA 3IFNL 5C0GA 2Y36L 3O81A 1AIZA 2VWEE 3H9HB 1XGYL 3GJEA 1IRAY 4KKPA 4FYTA 4KK8D 1KV3A 1VFMA 1SYSA 3INOA 1GIGL 2GW5A 5C6TL 5EO1B 2C9RA 4D3CL 3NRPA 2ZWNA 3HLKA 1NCAH 3EGSB 2R0KH 1P84K 2JCCA 3NA9H 4QRPA 5AVXB 3MCG1 3H7BA 1Q90A 3HZVA 4MNHB 1D6VH 1JGLH 3BGFC 3M7OA 3DK2A 5EBLA 5TDPB 4Z0BL 3DDGA 4A2MA 4HUUA 5T5NG 3EBGA 1ECZA 3BX7C 3LXAA 3V0VB 2PP7A 3D52A 3F58L 1PAMA 4U6XB 4RAUB 4MLSA 5F7MC 2D2OA 3I75B 1T0MA 4HEPG 2BOCB 3FN0L 5AL8A 2XU9A 4LCCB 2WQWA 5KJRL 3SBWA 2H0FA 3BDBA 4G7VL 2YBGA 5JW4Q 3IJSA 4N0RA 2DTMH 4UQ3B 1X5AA 4NO2A 1JZ6A 3O6FC 2H6OA 5LG1A 3SYOA 4HOMA 2VQTA 3CXHJ 4WGVB 1L9OA 1N68A 5C0AA 3WNLA 2V17L 1NTDA 4YDLC 1QOKA 1IX2A 5E8PB 1RURL 3FH5A 4YPGA 4GRMB 1T4KB 3CPUA 1WCQA 3GEFA 2XWTA 1MY5A 3TWCH 1R7AA 4YMPA 1AGCA 3T1WA 2VR3A 3Q5YA 4LDCA 4OCSL 5IR1B 2CWRA 2GHWB 1C5BL 5I8CA 2K9UA 1X9QA 3QHZL 3G6DH 4JCWA 2FLRT 4MMXC 4MQ7A 3FQ1A 4AC4A 5B7FA 1ORQB 1NEZA 5FGBC 4F91B 4NM4H 3B9KC 3QXTA 1WEJH 3EZ8A 2ZT9C 4YZWA 4JO1H 2DEWX 4XPFH 4Q0XL 2C26A 3RA7L 3D39D 2W0FB 3OB0H 4RGND 3FUNA 3UTSA 1S9WB 3GMQB 3AWFA 3O6KL 3CX5K 4C83A 1QP1A 1EERB 1ZEAL 1V5JA 1IGJA 5ICZB 2DDQH 2W9EH 4TTGA 2QTEA 4RFEA 1FZMA 1Z5LB 2OMZA 2Q3ZA 3WIHA 1OGTB 4HIPA 4QRRA 4FRWA 4F7PA 4JFQA 2VH5L 1E6OH 1NEPA 1J9CT 3V0HA 4YSRA 2OQJB 3L45A 2CA4A 1G6RH 2BVEA 2D0GA 2OZ4H 3O41B 4FCHA 2WXPA 4PGCA 3VXRD 1X7TA 3QQ4A 3L7EA 3WY1A 1G7QB 1R3LB 3NACH 5MEQB 3CXDH 4FXKC 2ZYHA 4WSGA 4UV4H 2UV3A 1G87A 1RMFH 2X6CA 5I0WA 2R23A 3AREA 3D39B 4C56B 3O45A 3RAJL 2CIKA 5F6IC 3FFCD 3QI9C 4RGNB 3N1FC 3UYOD 4JKNA 5HY9B 4EIUA 4HXAL 3QNXB 4ERSL 3BE1L 1IGFH 2EDHA 3DX9A 4UT6H 3V10A 2ZX9A 3KLAA 3O8XC 3N1QC 4JO2L 5EU3B 2J8UA 3NTCL 3D9AH 1RPUA 1MW1A 3G6JA 4F5CA 2J4WH 3PREA 3MO1A 1CF8L 4LDLB 4UINH 1KLUB 4NRZB 4DH2A 3FMGH 2CA3A 3KPPB 4OLVL 1JD9A 3ARRA 1KPUB 4KI5F 1FFRA 4A67A 3VXRB 2GSIA 1ZT4A 1IFHH 1N8ZB 1KPVB 3U4EB 1JNNL 1M9SA 5JHMA 1ZE3H 3U0PA 4NENA 3ARQA 1TITA 1ACXA 3MRDB 4M8QB 4EZLA 4JQXA 2P49B 2EUWA 1AGDB 1JPTH 1HK6A 3BMVA 5IKCB 5GRYA 5CEXB 3FFCB 1T20A 4PRDA 2AV1A 2YZ1A 1EA9C 1F0LA 3IDYC 4PS4H 4RISL 3RX9A 5HGHB 4XMKL 1DBBH 3LH2H 3VA2C 4TQEH 3QS3A 4H0IA 4KXBA 2EYSA 1X7QB 3PDDA 5EBGA 3EJUA 1NBVH 3X13B 3V0AC 5FO7B 2KLTA 4Y9FA 4ONOA 1FV1A 5HHOE 3IWUA 4G1MA 1MVYA 4YZFF 5DJ0B 5F9DC 5I18H 1MW3A 3PXLA 1HINH 3GK8L 4MBRA 1XCXA 1BCIA 3OC5A 1SLWA 3IF1A 3AQYA 4UT9H 4Y0GA 3NCJH 2Y4SA 3BQUC 3KWTA 3EJCA 3TBVB 5BQ7A 1FN4A 3NZ8A 4XI5C 5L2JB 2LOEA 3GXNA 4OLEA 2H41A 2LLLA 4IBWA 2AERT 2LU4A 5B39A 1LD9B 3VXMA 3TV3L 4YHLH 3DPBB 2FQEA 1SHXA 3G9VA 3KPTA 1MFCH 2W60A 3LEYL 1IAKB 3QXDB 4JDEA 3PWLA 3H54A 2NNXA 1CF1A 4J2XA 3F64A 4W9KC 2A6DA 1CK0H 3IU4L 2QZ5A 4UDUA 1MHEB 2UWEF 3E6HB 5FAAA 3H9SA 1BPVA 1EEQA 3FUMA 1MFDL 1JPGA 3ALWA 3I6GB 2QGCA 1GZPB 3L5JA 4E9RA 1HYSC 2WQSA 4JM4L 1AH1A 1D5MA 1R6VA 4A1RA 5J11B 1UXSA 4LSSH 5HHMB 3L2LA 4BM7A 3MRCB 1U3HD 3KR3H 4KTDH 4P3CH 1JGDA 1ZCRA 5SWZB 4ORZC 1T7YA 1EO8L 5D7IB 4Z7UE 5DJ6B 5HI3C 5KUKA 4KU1A 2H7WA 2ED9A 3K80A 1XIWA 5IVOA 3RVWD 1A14H 2Y1AA 4LKCB 3UOAB 4H26A 1T1ZA 1XGQA 1W0WB 2E46A 2EXYD 3KJ6H 5L4MA 4EUPG 4MLIA 4G6FD 2DLEA 1CDUA 5JOEA 2FEEL 43CAA 2LU3A 4AIZA 2FEDC 5KS9B 2VW6A 1NUFA 1T89A 3EH1A 3IU3A 3FCGA 3MV8D 3UBXB 3S3DB 4AVJA 5JYMA 3KL0A 4NQVB 3ECQA 1ZHBB 4MSWA 4ODHL 3REVA 1AY1L 2DQDL 3QQ3A 1IGCH 3LNDA 1WQVT 3TBSB 4OCRL 4Y89A 1YN6B 5IESL 4NNYB 5F72S 1C08A 1QLFA 4XOBA 1HAUA 3Q6GL 5EU4A 5C9JA 5JHBA 2FR4A 5IQ9B 3FTYA 2VZ3A 2DM4A 2NQCA 2VRKA 1HHJA 4N0CD 4NI6A 2QQKL 4ACTA 4E0RA 3TBBA 5KSUB 2R0LH 3DVIA 3P3UA 2VABB 1GRWA 3BJ91 3QIUC 4U0RB 2HMID 3HKZA 4X7SL 3TLRA 2CM6A 1W6WA 3ZE2E 4L48A 2VM9A 5I8KH 1QPPA 5J06A 1A1OA 5LGHL 4A39A 3EDKA 1NSNH 1NDGA 4HSAC 1BG1A 1S9XA 4NNXA 4UQAA 2GTWA 4I18A 3X1BA 1G0XA 4CKQA 5E8OA 1ZHKA 5JIMA 4QUOA 2DMCA 4GOSA 2V37A 5F1KC 4A7GF 3W9DB 4ZPTB 5F9OL 2F5BH 3UBGA 3K6SB 4AUUA 2YUWA 4BHUA 1PX3A 4IEFA 1BYNA 3DWTA 1W0VB 3SQRA 3OKNA 4GEIA 3WY2A 1AOZA 3K6OA 4YSEA 1CGVA 3MJ9H 3UTQB 1Q8MA 4OZ4B 1YPZB 4DGVH 3CSFA 3B6SA 3RWHB 1G6RA 2V4LA 4YL9A 1C5CL 3G6AA 5HYJA 1QA9B 5D4IA 4QO1B 5A1AA 4O4YL 3QPQD 3SDXE 3REWA 3QEHA 3OGOE 5DUPH 1MJ7L 2A3TA 2GEEA 3LSOB 3VGEA 4OIIL 1OB1B 4W68A 4N2CA 3WAKA 1WC7A 1PF3A 3AY4A 5I8EB 4ZMVA 2BNQD 4H8WH 3UDWC 1YMME 1NC4A 2BZCA 3KYMB 4M62L 2BRQA 3VFOB 4MD4A 4GG6B 3QEGL 3IWVA 4UT6A 5FA3A 5F96L 5BO0D 1BZEA 4QRFA 5D2LB 5DQ9B 1VIWA 2PTTB 1IC4L 2VAAB 3WKNA 2V8MA 4D9RE 2MRYA 5DUJA 1C1EL 5IB4B 4GAJH 5KVFH 2FSDA 2OTWB 1HQ4B 1UZGA 5BRZE 4AKPA 3QW9A 2Q1EA 2AF2A 3DX0A 4M7ZC 3CDGA 3FCTB 5DO8A 3TJPA 3VU2A 4A2FA 2X2IA 1T3FB 1WISA 4XMXA 4KMTH 4FLSA 3WS6C 2OSYA 4PG2C 5E6RB 4PRHE 1S4IA 4KI5C 3UZEA 3P2DA 2E4TA 5FYLH 2Y07H 1GMIA 3TZVC 3EBHA 5T3XE 1K3IA 4X4KA 5KBNC 4YXKL 2YGPA 4NBZB 5HXMA 3C5SB 1TSHA 1OK0A 2P8PB 3NCEB 1ZIAA 2Y3NA 3S5ZA 1OPGH 1O75A 1USZA 3X1NA 2VXSL 3L16A 1KSRA 1KJVA 5CP3A 4HWNA 3RKDD 3D48R 2APBA 4Z6AT 5F7WC 1OSYA 1KXVC 4HK0B 3SDDC 2C9QA 2NT0A 5I6MA 2AJYH 4GG8B 3C5XA 5ISZD 1Z9PA 4Q7DA 4YSAA 3FU7A 3RILA 3UG5A 3B3IB 4PB0L 4XXWA 1QVOA 3F7VA 5FX3A 2VDNB 4HFWA 4UT9A 1SUJA 2VDLB 2X89D 5I9QC 3QIBA 3WOVA 2QSQA 1YZZA 5IK3B 2KS0A 4Z7QE 3OLGA 2K1MA 1QYGL 4KO9A 3DX8A 4GP5B 2NY3B 1GGYA 2VR6A 3HN8A 3QUML 2J1XA 4PCYA 2X38A 4APXA 5B8CC 5BMFL 1UKQA 2XX0A 1BAFL 1QTYT 2O72A 1T22B 3CAFA 3GHBL 3KBEA 4NERA 4NN6B 2HLEB 4JZJC 4P57A 2DIJA 5C0EA 4MX7A 1XXDC 5FB8B 2DWEB 4FQXA 4MA1C 3N40F 4Y9BA 3TVMB 2G75A 3HIZA 3ZZLA 1ZD6A 1TOXA 2BFVL 4UB0H 5FV2A 1KCLA 1YJDC 1ZIBA 3IXAA 4JY4A 5F7UA 4CSZA 1BOGB 5KYXA 1YVLA 2NY2B 4PWFA 3GB7A 5D7JB 1JXKA 4LDEB 1DFBL 1LEKB 1C5DA 1ZV9A 3VG0H 1AS6A 3O3DA 4GAFB 4KVNL 4F7EB 5DFTA 1M7UA 2G9HA 3TO4D 1QHQA 1AI1L 1NGPH 4LKXB 3TTYA 3PWJA 3LTVA 3W81A 1E7UA 2OAAA 4QHKI 3V7MA 1FFTB 4L29B 4L1DA 3CHOA 3DTUB 5A6IA 1JNHA 3ORJA 4O2EB 2WMPB 1P7QA 2IPKB 3ZU8A 1AHMA 1T04A 3Q8CA 3E6FA 4NSKA 3KPRA 1OHZA 4P9MH 4K2UH 3H2PA 4XVUC 3HE7D 2P5ED 2ZUSA 3CFJB 3L17A 4RFNC 4CA4A 4EXPX 5HYEA 4Y4KD 4P23C 1J5HA 3Q2NA 1MUJA 2KERA 3DXAE 5K9KA 3I9PA 1DN0A 4KXDA 3C2AH 2WANA 3ESMA 4XP5H 1QFHA 3OHXC 3WTSA 3QIWA 4JFEE 3KCWA 3X11A 2PR4L 3R06A 3DA0A 1Q94B 2XBDA 5HHPB 2ZG1A 2PO6C 1UYWL 2ZE0A 4GUCA 4D7BA 2YUVA 1BM7A 3OSKA 3VFTB 3QYNA 1IEBB 4H88L 4PJFE 1GY2A 1ZSDA 5EC2A 3TO4B 1KGYE 2XFXB 4D0BB 4ZMLA 1FBIH 1AE6L 2WBJC 6FABH 3ASWA 3MACL 3C60D 1PX4A 5KG9A 4BUHA 4KKRA 5ENWB 5T3ZE 3BPCB 3HS0C 5IFAL 2RBLA 5GS1A 4L0YA 3HC0A 3BXNB 4ZW7A 2IDUA 1AFVL 4KNUA 4CMHB 5I0ZA 5IP4A 1NMAL 2HXAA 4FQCL 2QPFA 4RZCA 2JCCE 4QRPE 5DVKA 1BVKA 2XG5B 4BFIB 1CYGA 1RJLA 5FYJU 1GHFH 4HJGA 2DQJH 2EDLA 3DPDA 1DBJH 1AP2A 1DDHB 3EYOB 5ESVB 5IOKA 3A5VA 3O6LL 5BS0A 1DQVA 2Z8VC 2CLRB 4F27A 4K0OA 2OYMA 3CVBA 4BZYA 1CTNA 4X8JA 1FPTH 3VXTA 3U0TA 1E40A 2W65A 3T4AB 3AT9A 3HNTL 5JXEC 2X87A 1FNHA 3BW9B 5KJ7E 2FWOB 3GHPA 2WVUA 3WIHL 4Q9QH 3BCFA 4WU5A 2E0PA 3C60B 1AC0A 4HC1H 4ZO9A 4ES9A 3UTPD 3CN1A 4GS7B 4ONHA 3WFHA 5C0AE 4FA7B 4IJ3C 4YDJB 2B4CC 4ODBD 4W6XB 3ZKMD 3QUZB 3MROB 4HAGA 1S7VB 2HAZA 2DM2A 4OV5B 2MHAA 1COBA 1E9OB 1EFXA 5D7IF 4L05A 1MRFL 1HOEA 5SWSA 3RY6A 3AGVA 3L3IB 1CGXA 1LP9A 2J5LB 1ACYH 3CZEA 3MX0B 3UADA 1D7CA 1EHAA 4TRPH 2GCYA 2ZXBA 3G3LA 4HWEL 2JXMA 4EAEA 4CADA 5T1LD 1E4KA 3M1BA 4JJ5B 3VMNA 3NN8B 2AQ3A 2YPLD 3PAYA 1UZ8A 4R5VA 1U8NA 3QJZA 5IGXL 2ADJB 4KTEL 4U1SA 2EH8H 2NSQA 3TNNB 4IBQA 4PTUB 3UTSE 3GKWH 4KWUA 5H4YA 5K9OA 1H15A 4LRNH 1YN7B 1U8JB 5ICUA 4FKHA 2QR0B 4LCCC 1FYTA 4UAOB 1H3PH 2VERN 3PP3H 1FFNA 5IBLD 5FYJD 2AQTA 1LK2A 3T0EC 1HXKA 4E5XA 3HG0A 4LZKA 4UQBA 5I2IB 4X0NA 3NJVA 3QJFB 3N42B 1Q0YH 4QRRE 5GGQL 5A7EA 2J88L 2KLRA 3ES6B 1LEGA 2R4SL 4RQQB 2VLLA 4B5ZA 2YD0A 2V5SA 3V6OA 2XWBA 2FQFA 4KAQH 4S1QH 2ICWI 5I75B 2DWTA 3FUFA 3QO0A 5I1AA 1J1PH 4NC2B 7FABH 3VDBA 4Y19D 3MA7B 4GAGH 1GGIH 2VLRD 3GI9H 5DA4A 4WWNA 4Y4FD 3CE1A 4R97B 1Z9SA 4B5EA 2CPUA 2EEAA 2AKRA 1UWFA 3IVKB 4OFIA 4OZFB 5BV7L 3GMOB 2DJMA 2DMGA 4WFFE 4YR6A 3VYPA 5HYSA 3ZTCC 1NFAA 2XTJE 4FTVA 1JHTA 4CDHA 2FGWL 4L2LA 3CHSA 4HJ0D 1XF2A 2HA1A 4Z7VA 5KYYA 4NQSA 2ITDB 1P7KB 4N2NA 3MLTA 3UPRA 2X2JA 4NPKA 1QUPA 3X3FH 1JGUH 2J8UE 3KBFA 1WA2X 2Z92B 4IOSD 4JVUA 2OBGA 3G6JE 4KX9A 3UC0L 4F58L 4F5CE 2WLLA 3HG3A 1KENH 4K4KA 4QHNB 3U6XS 5SX5K 3VM5A 4LCIL 1RKRA 4OUOA 3ASOB 4I9XA 3LZFH 4JZOA 5F7DB 5IHZA 3QHTC 4ELKB 4EXKA 4A55A 3EO1A 4I2XB 4JRXE 3W0WD 1RJYA 1ID2A 3C75A 5IJDC 2ZSWA 4TSBH 1KBWA 3QG7H 4K94H 1YPZF 4FHKA 1YA5A 3WTVA 4S1SH 5E2TL 3QUXA 4NX0A 2OS7A 4JR9L 2UY7B 1LM8V 4L9LA 3S35H 3O6ML 3UC2A 3GDBA 3QA3A 1XGUB 4MA8L 3PS6A 1J7VR 1D5BB 3G5YB 4PWJA 3PHQB 4UU9B 2CLVA 4LLMA 4PMFA 5CN1A 1FH5H 5E2VL 4XP9L 3W2DL 1E90A 1NIBA 4KTGA 1OP3H 3S2CA 3MBEA 2I60H 4LCWD 3RX8A 4WCYH 4FXTA 1TJIL 4N4YB 5EU7E 4GG6F 4WSKA 1NINA 3NSYA 4QHLB 3SPIA 4HHWA 3AG4B 2WGNB 3I9GH 1IM9A 4JFYA 1BZ9B 4YE4L 2BNUB 2WM0A 3PWVA 3W0WB 1P5UB 1D6VL 3ZYIA 4ZD3H 2BSBA 1JGLL 1I8MB 1E9PA 2Q8AL 2NNRA 4H8HA 4HKBB 4XB3A 3RZCB 3RBGA 3TL5A 1HL4A 2VDRL 2OL3B 5IW1B 1MJUH 3KPQA 5FO8A 5TDNB 2DD8H 1L0QA 4TSCL 1RK7A 2NY6C 5JLZA 2WUCH 4NKDB 3B8YA 4NYLB 1XF1A 3CZFA 1NL0L 4R90L 3NQIA 2Z64C 4JHZA 4LCWB 1DUYA 4YHIB 5EU6D 5EFIB 4EI5A 2X4RA 4P4RB 1KGIA 3OAUL 2MOVA 3OF6A 1FJ1B 4APQC 4DP9X 3GC3A 3FHAA 3H9SE 5F6HJ 1NAMH 1XSIA 1ZLSL 2P5WA 1FUNA 1FA4A 3VG9C 2BJMH 1M05B 1W8NA 2DLIA 3GSXB 1F6AB 1UM4L 3SKOB 3T3PB 1V55B 4M4PA 3ATAA 4WO4B 1RCYA 3H7LA 3ILDA 1NGZA 5I1IH 3TWCL 5IB5A 5B38G 1SBSH 2LAGB 2VMCA 1CVRA 2AXFB 4CNIA 3X1FA 3D07A 1S6NA 1S7UA 4M1CD 4FI7A 3RVUC 3UIZA 3ZE0B 4XRCA 1CBJA 1EO5A 5CUSL 3DVNA 2J12B 1A6WL 1BF2A 3BVUA 2XWJB 3EAKA 1A4AA 3F04A 1Z0NA 4JQVA 4FNUA 2VOTA 4V2BA 5GZND 1R3HB 3EH3B 1SEQH 5C0DA 1I9IL 4XPFL 3HPJB 3VFGH 1MHPH 4FE9A 1U91A 2XRAH 3P40A 1EAPA 3UL4A 2BFGA 2AQ1A 2EDEA 5DJZA 1BXUA 1BBJA 4FFWC 3JV4A 2CRMA 3UP6A 1TVDA 1MHCB 4GBXD 4PJXE 3BZ4B 2AMGA 2C4FU 1TXKA 5TE6H 3ZIYA 1JN6A 3SYQA 4FQ2L 4HC1A 4R7DB 2UYLA 2H4EA 5F9JA 3TV8A 4PBVC 3CZSA 3U0WH 1AOHA 1NCHA 1UEYA 2YPVH 3V2AR 2FX9L 5ADPH 1YHPA 1G6RL 3LHPL 2Z3FA 3CCHA 3C8KB 3RQ3A 5J11C 5LNGA 3V52H 3NACL 2ZXEB 3CXDL 4G6KH 3R7RA 4R3SB 3VE0A 1RMFL 2MH4A 2VYRE 1DJZA 2W07A 4LLDB 4PWKA 4TNGA 4Z76B 4M6NL 3CLFH 1S5HB 4U1HA 2J6WA 5C09B 4WI0B 4MJ6A 4M6OH 3HNSH 2CH8A 2V5RA 3CH1B 3JVGC 3S96A 5LGJA 4GBXB 4QF1A 2IC2A 4UT6L 2LTQB 1O7DE 2C5DC 5KVEL 1EEUA 5CIPH 3T2PA 2X4UB 3WS3A 5FV1L 5DZOA 5IJVB 1Q9LA 2EYTB 3L4CA 4LP8A 3BOVA 4KUZH 3R4DA 4GUPA 4R4NC 5LBGA 2J4WL 4XNZB 1HSBA 3GJFK 3ELQA 2XPZA 3OQ3B 2V3EA 3CZJA 2R9HD 4UINL 2ZX6A 4DW2L 3VYOA 4Z77B 5GS0H 5A43C 2NY1B 4CW1B 4JFHE 4NQCD 3WL9A 2ARJA 1IFHL 3IPFA 1DUZA 3F5WA 2ALWA 4QYOA 1EZVX 3ARFA 3TP4A 4F9PC 3FRPG 5IW3A 3CBRA 3WSQH 3WXWH 3ECBA 4S0TD 2BP0B 5DQJA 4BSVB 4H5SA 4KO7A 3PUUA 4Q74A 1A0QL 3LN4A 1OE2A 1U8CB 3P73A 1NM4A 5HYJE 3K4DA 2IDTA 4PS4L 3ABLB 1URLA 2Z9TA 5C0IB 3FO9B 3LH2L 3PHOB 4GAAA 1A25A 2QVTA 5EZLA 1T5WB 5GGUA 1YYLH 2C9PA 5KSBB 2Z7YA 1ADQA 3DVFA 4AXWB 3ZKXB 1JGVL 4PGDB 5BOPA 1XD0A 4AQAA 1ZT1A 3D18B 5AOJA 5D1ZI 3VFNB 3VFUB 3W9EA 3CFNA 2ZUUA 4ZW8A 5KVEE 3TIDB 2XKNB 1NLBH 4UT9L 3FFDA 5AKVA 1KPRB 3JTSA 3VW3H 1DQLH 3LEXB 3NCJL 2IXQB 2DS4A 1HNGA 2PCFB 5J56B 4D8OA 1LHZA 5ECGA 1NAKL 5TH2B 4XPAH 3EJRA 4MNQD 1MCPH 4G42A 4ZX4A 1G9MH 4HKXB 1ND0B 1MFCL 3HVDA 1RAMA 4JMXA 5F0MB 2ITEA 4JCMA 5BO1H 4M61A 4NKOA 2DWSA 5CMAA 3WIFA 1CK0L 1SM3H 1ETZA 2D4DA 1V3LA 4PUBH 5AOZA 1AZVA 2W8CA 1OVZA 2YWZA 3DIDA 3GNMH 5C07E 3FTSA 5JW5B 4MAYA 3FO2B 4JS7A 2E27H 4U49A 3MTRA 4AZ8A 3KPNB 3EUUA 3MODH 3MCKB 4WEBH 4LSSL 5T8IA 1J88A 3BP4B 3B9EA 3IDIB 3KR3L 4XNMA 3CDCA 1TTAA 1I9RH 3E0GA 1I3RA 4NIKB 1SN2A 3GO1L 4AVHA 1M7IA 4WAFA 5IJBC 3U46B 4ENED 3OXRB 3VVWA 1U3ZA 4KOBA 4MNQB 4NS0A 4BRVA 4OZIB 5E6SB 4GRWH 4H1LB 5EC1A 2KC0A 4IKIA 3FU3A 2ODIA 1OP5K 4HJUA 1NCCH 1N2RA 3K0YA 3LQZA 2FLMA 2AJVL 5F7BA 3RWEB 1A8ZA 2GY5A 4DO5A 4WUKH 3N42F 5KOMC 2A4EA 1UUNA 1F3RB 1DO6A 4K9JA 1MAJA 5ETUA 1AD0B 2FYVA 1GS8A 3EJPA 2JNZA 3HHRB 5FYKH 5GRVL 2OMTA 4GSRA 1BFTA 1FG2A 1JV5B 3P3TA 3PWPA 4K71B 1YNTA 1KCUH 1T7XA 3SYCA 1IGCL 3MXVH 5DZNA 5FDWB 1D9KA 1DQIA 1ES0A 3MFFB 5EN3A 1DJHA 2EDWA 2HT3D 3CN3A 4KFMA 1SHMA 4JHVA 5KSVB 2WINB 1U21A 3ZIMA 4R26H 5B1AB 5KTEH 1JF1B 4DFHA 2VJ8A 3B7RL 1NGWB 5F1SA 5J57B 1H3WM 3GSNH 2IH3A 4P2RA 1MOEA 1HH9A 3BEVB 3WDIA 3PNWA 1B2WL 1W72A 1KTDB 5I8KL 1ORSA 1XR9A 2X0VA 4KKNA 2Q3XA 2A99A 1YRKA 3FBQA 4RAHA 1NSNL 12E8H 2R1XA 3PDOA 1XSJA 5E6IA 1ID5I 2F1EA 1IAMA 4D9LL 1UVQB 2V9RA 1KLFB 1JV2A 3KPRE 3WMSA 2WO2B 4LCYA 5IW6B 2W1NA 3JSSA 3RUGE 1GW6A 2EUXA 5I8OL 3RWIB 2NY3C 7CGTA 3PNRB 3RIAF 5F71A 1U3NA 3BZDA 2EDFA 1E4WH 5I1GL 3IMSA 2PYED 4IIZA 1L6PA 4PWHA 4ZAKB 4C58B 5TPWH 4HCRH 3BD3A 2R27A 4IS6B 3FB7A 4UNVA 2YAHA 1TZGH 1CD1B 1SOQA 4RGOL 1QASA 3W3BA 3C6LD 3ZRFC 4DGVL 2B9BA 4DUXA 3TVMC 5CJXC 4HZLB 2I27N 4KY1H 3ZO9A 2X1QA 1TYEB 4HFUH 5DRWB 4PIBA 2XQYA 3K72B 3E8UL 5ALBL 2NY2C 4BXSV 2H8PB 4BFKA 5DUPL 5ITBH 5D7JC 3GZKA 4E9LA 1X4YA 3RPIB 1MFNA 4ZW6A 2DQIL 4ZI8A 1LQBC 4FFYH 6PCYA 3QEUB 3ULSB 5JUEH 3BLBA 3PAUA 1MEXH 1JMZA 4LHUB 5I1KH 2NSXA 4NQDD 4LXFA 2N0KA 4PHXA 5CS7A 1K5NB 4MCYB 3U48A 5C3LD 3O0RH 4G72B 4K9EH 5CIPA 2E86A 1AQHA 4GXVL 1NDTA 2CHWA 4NQUA 4ZTEA 4HJEA 5BS0E 1EHLL 1J18A 4B27A 3D51A 4GAJL 3TN0D 5KVFL 1N7ML 1GOGA 2PCPA 5T33H 1G7LA 1NC2D 3RNQB 2EAEA 4FJZA 4NZUH 1RUML 4I48B 2OULB 3H1ZA 4JDVB 1KCBA 4AJYV 3CFBA 4QRQB 4U6YB 3VI3A 3ZL4H 4G8AC 4MMYB 1GPOH 5FHAH 5CP7A 4N28A 2ZOKA 4PLJD 1S5IH 3O3BB 3T3PF 3KYNA 4DWHA 2VLMD 1OAYH 4PRNA 3U7WL 1D7FA 3ROLA 1A6UH 4G1EB 2CIIA 4DKFH 2FHFA 3IDGB 1Z6JT 3FUEA 5C97A 4NQDB 3VD3A 4AL8H 3R8QA 2CJ3A 4AYMC 1LP9E 3AG3B 2WXFA 2Y2TA 2RCSH 3A4DA 4TLSA 2WIIB 1BZ8A 1AGFA 4PG9A 4TQIA 1FHGA 4RMWA 4XBPB 4CMHC 1NKRA 3L9RA 2VUYA 1QSZA 2X12A 1HEZB 1KBPA 1NC2B 1V7MH 2F8OA 4UILL 1AO7D 4LVOC 3STZA 5CBEB 4P99A 3B9KA 3SBQA 4UBDC 3SGKA 2FO1A 3CDYA 2WXMA 1WD9A 4Q6IB 5KVFE 3PGCB 1I4FB 2G30A 3S48A 1EVTC 1U93A 2WO3B 1FYTE 3T4AC 2OPCA 1ZMYA 4AENA 2XT1B 2FJHA 3BI9X 2V7NA 3MREA 3TO2A 3VAEA 4LSVL 1AD9B 1MPAL 4GLRH 4OZHA 2C3VA 1RPKA 5C7XH 1JHKH 1I1RA 1ZTMA 3PUCA 3T6WA 2JKJA 3U4AA 1G0DA 4DP0X 1UCTA 1VKXB 3MJ7A 3QZWB 1OGSA 4QOKD 5FYLE 3MGTB 3V6OE 1XXFC 4WI4A 3VNYA 5F7NC 3QUZC 2ZOOA 5E6ZA 2G60L 2X4TB 5E2WL 3N06B 4NN5B 2WLJA 4G6JH 4YFDB 4YQXH 5ESAB 1BIIA 4X6FA 5F3HA 2AXJA 3WUZA 1DLHB 1C8QA 1F2QA 3MUZ1 4M3KB 2J5LC 3HS8A 4MNGE 1FP5A 3FCBA 4WUUD 1S3KH 2ZKXA 2WCGA 1H3VA 2MNWA 2MTPA 4BEIA 4FTVE 4TUUA 3HUJA 4G5AA 2P8LA 1NGPL 3QI9A 4N1CA 4Z7VE 5E0FA 2I26N 2DQCH 5CHNA 2Q86A 1FGNH 4H40A 2HJFB 2XNAB 4JLRA 3SPHA 1HCYA 2G2RA 3O8XA 5A16A 4NNPH 3MRBA 3RKPA 5HVWA 3VXUA 1KELH 2EDQA 2XZZA 4KQ3H 5E1AB 1DP0A 4QOKB 2P44B 1PFOA 2QSCH 4OBRA 1TMCB 1QRND 5CSBA 4DVBA 1ZANH 2ROXA 1B4LA 1P4LB 3DYMA 4NQQA 3U9PH 4CL7A 3WTYA 4CVZB 5HHOB 3C2AL 2F7QA 1YECL 4B53A 2R1YB 3KDPB 1JSYA 3J27A 1SF5A 4MDJB 2AAAA 4WWKD 1PX8A 3CX2A 3HG4A 4HIEB 4U3CA 4B9YA 3GRGA 1VSCA 4KKBC 1GA2A 3MLRH 1QQDB 5KSBF 3C8DA 1FBIL 2KH2B 4ZO7A 6FABL 5DS1A 3LKOA 2YHGA 4M4RA 1VF5C 4R97C 5CILH 3BVWA 3WJMA 4YHPB 4XH2B 4ODWB 4Y16A 1R24A 3WKPA 1ITCA 1PJWA 3ILQD 4L3EE 1HIML 4C8XA 1UB6B 1Q1PA 1K5WA 4F33B 1PAZA 3DGGB 1O9VA 4OLXL 5TF0A 3RFZA 4IU2A 4YGAB 2HG0A 4TV3A 5GISH 5I5IA 3L1GA 2FATH 3PQYA 4TNWF 3L5XL 1DBJL 1MG3C 2NUTA 2QV4A 4BFFA 3L3JA 3VFSA 1UENA 2TRYA 2B1HH 3BQUA 1WYJA 4CVXB 2KYIA 2V5MA 1JWUB 4UOW1 4P2QA 4WWKB 4PAZA 3EFFB 4HIHA 1P0SE 2FVNA 5D72H 2UZYB 3CU7A 4M9PA 3DO7B 1MCWM 3PJNA 4JFOA 4L8CB 5DRZB 4B6ZA 5D9SA 4IQHA 4Z7UB 1NCNA 2V9QA 3DJTA 4HCRA 4HC1L 4R6UA 1XZ0B 2J3SA 1RIVH 3D7PA 3GM0A 4WI5A 3DOSA 1IBGH 2IO5A 2P5WE 3N2JA 4K5OA 4AMKL 1CYXA 2EEFA 5D1XD 3O2WL 4L8BA 2O61B 5IT2H 4PVNA 5I1EH 3BH9B 2NUPB 3BUQA 3PP4H 3Q2LA 5CR8A 5F1NA 1HH6B 1NA8A 1FF5A 3JUZA 4BINA 1TZIB 4OZIF 1BXAA 3SDCB 4CU6A 2DMBA 2O5ZL 3OAZH 3OXSA 5BZWB 3WN5A 1UD4A 4PRPD 2OTUA 4M3HA 1PBYA 1UOWA 1FL6B 4EDXA 4NUQA 4PR5B 4UQ2A 4NO3A 1I8IB 5FWQA 3TYGH 5I6LA 3TPUA 1P5UC 4LE8A 2EUVA 3LD8C 1Z3RA 3P54A 5FIEA 3RZCC 1X5MA 2BNRA 2Q87A 3KMDA 5AW9B 5GZOD 4KK6C 3HLAB 4DK6A 4DK5A 1TNNA 3QJQB 4P5TC 1MY7A 3UTTD 4UTAH 5EU5B 4LLVA 1H3PL 1J0ZA 3DUUA 3TT1L 1S46A 3VFPA 4WDIB 1Q0YL 5F7AA 4LRIC 2LW3A 3ZE2B 4YHYB 5T5FH 5E8DH 3ULVH 3ZMNA 4QHMB 3TWYA 1KWGA 1F6FB 2IDQA 4WWOA 4Y4HD 1L9TA 4FLHA 7FABL 4D9QE 1U8OA 4U1KB 1O6SB 3D0VA 3S4SG 1GGIL 3EZJB 4WO4C 3GI9L 1NCIA 1ULVA 2ZCLH 3LZNA 5SWQB 2BY1A 5I74C 1ADQL 3NOIA 2UZXA 4XOCA 2GUOB 2CNYA 1RZIA 1JNLH 3U1SL 4MASA 4P4KB 3BT2H 5IEKA 4PD4J 4DP6X 1XGPB 1OWWA 5CGBA 3TU6A 1TJHL 4D9RD 5JHLA 5GRVK 2ENSA 3QP3A 2COVD 1MFEH 4EUPH 5BRZD 4HJ1A 3T4YA 3FO1B 3T77A 1A7RH 1AGEA 1DSWA 2F19L 3G5WA 3GXDA 5IVZB 1VFAA 4HEPA 2QVMA 4U4BA 4Z78A 1GC1L 3SDXB 3IAGC 4CSPA 3T1FA 4DPRA 5T1MB 3D30A 2EZ0D 1RZKC 4Y4HB 3HG1D 5FYKU 4Y5XA 3BZ5A 4TSBL 4XVSL 5CCKH 3GEWB 4K94L 1YMMB 4NP4H 3B9VA 3RNKB 5DLMH 1S78C 4PV8B 2EE9A 1KCRH 3S35L 5DI8B 1CDCA 4K7FA 1WWCA 1DJXA 3GBDA 1BFVL 3P2TA 3B2UD 1PPIA 2B20A 4PREA 3BZEA 3BWAB 4PJBE 3HR6A 3OMNB 1XSKA 3GM8A 3BP5A 2VSCA 1G7MA 1N64H 2FECI 3L3KB 3GMPB 5BRZB 2P80D 1P2CA 4N2KA 4IHOA 2JVUA 2VLKA 4JPKH 1LO0H 3IFOB 4W4OC 1UFGA 1E9QA 1KTBA 2VM3A 4GT7A 4K8RC 3RGVA 1JYXA 2ITCA 4PRHB 5E6YA 2NY4D 3I9GL 4GBXC 1DLFH 2LTQC 2X70A 1GZQB 1MJ8L 3PPEA 4U1JA 1OCWL 4YDVA 5AB9A 4MYPA 4F37K 5C0JB 3L5IA 2IMNA 3FXIC 3S5LB 1MXDA 3SE4A 1PY4A 4ZUSB 4XNZC 1PCSA 2FUQA 3ETBF 3HRZB 1CYWA 2EDBA 2W91A 4P3WA 3UYPB 1MJUL 2O6FA 2EDTA 2NY1C 1CE1L 3GBNH 4M03A 3ZX1A 1OAKH 3B5HA 1UWEL 3KLQA 4BCXA 3UIYA 1EH9A 3VA6A 3D12B 1IBYA 2F8VA 4OCYH 3K8MA 4EVNA 5CLZA 3I2CH 1KFAH 4DP5X 1QLEH 1UJ3B 1F2XK 2F7RA 3GMLA 2QMKA 1W16A 4UAHA 3FC8A 1BZDA 2DF3A 7PCYA 3UJTH 5CD3B 4IDJL 5J89A 1FFQA 2VB5A 3MRQA 3TZVA 2FJFB 2GK2A 5CF3A 5HGBB 4I9WE 5FYKD 1CXLA 5HVFB 2NY4B 1II4E 2OMXB 3LRSB 4Z7QB 5DJAB 4NWUH 2R0WL 1DYZA 3NUKA 3QORB 4BSWA 3DTXB 4MD0A 1VADA 4PGJA 1MAMH 1W72L 2BS9A 3GXMA 3MRKA 4Z3TA 1A2YA 1U8PB 4RMTA 3NCCB 3IE4A 5I26A 3FN3A 2EC8A 2E59A 1YUHA 2FIKB 3EXLA 4XMWA 3VFGL 2XXGA 1MHPL 3EYSH 3AB0B 1KG0B 3BUYB 4JN2A 2X40A 4F7CA 4POYA 3QG6A 3KLLA 3QXAA 3CDZA 2XYCA 1MW2A 1A7NL 1VAHA 1XR8A 2BSTA 4JKKA 1W9XA 3KPOA 3J8F7 1CLCA 4ZMZA 4GP8B 5A2BA 2WSDA 4XMPH 3CX5J 2HTKD 3MCLL 5DS2A 2PUQT 2N01B 3DLQR 1FO0H 4F9LC 4BDVB 3E9UA 5JO5B 4IK6A 1AKPA 1MWAA 1WA0X 1BIHA 2OSLB 2XWRA 4ZYKA 5JMOC 2E6JA 1YQ2A 4YBLB 2QQQA 1BQRA 2OX5A 1K2DA 4JZJA 5F7YC 4JHAH 4X6EB 5ADPL 5EH1A 4PBDA 2JCWA 1T1XA 3BPOB 1YEFL 3HBGA 3RGHA 4HALA 4QJ5B 1P4IL 2Q6WB 2RMNA 2UWEA 3QJSB 1WIUA 5E99L 3IN2A 4QRPD 4BE6A 5B7MA 4P2RE 3QUMB 2F54D 4B60A 2A6KB 4PJEE 4P04A 5I71B 4XPGH 4M6OL 5HDRA 5LDUA 1ZK5A 1ODAA 1V05A 4I1RA 1PQZB 2CKBA 4LBAA 5D6DC 3GBML 5F9WB 3CLWA 2VXTH 1SZNA 1HT6A 3GJFB 1MJJA 3MUHL 2DJ4A 2IH8A 2X3BA 1UXLA 4PJFB 4HDIA 4FG6D 1XO8A 2BC4A 4HUXB 1W2KT 3Q2WA 1A02N 4KK5C 2VIRA 4GO8A 5A2LH 4XAKE 4NHUA 2R7EA 4M02A 1RERA 5GGSB 3JWDC 1B4RA 5C0GB 3KDMA 5DURD 4LNRA 5GS0L 1UB5A 5C86A 5C0AD 2BO0A 4P23A 3GJEB 1HKLL 1BLNA 3E9TA 2VN6A 1SYSB 4YDKH 4I7ZC 4P9HH 3BP6A 3FRUA 3OHXA 2JCCB 2W9LA 2A0LD 2K8MA 2XN0A 2YD9A 4QRPB 3H7BB 2G5BA 3HZVB 3WXWL 4C55A 3CVCA 3C6SA 4A2GA 4B41A 3PHAA 4HUUB 5F1OB 4JJHA 3FQRA 1HJBC 1QABA 2YKKA 1SOXA 2B5IB 4M1DH 1CLOH 3MLXL 4KVCL 2YEQA 3QQDB 4PV9B 4NAQA 2R8SH 1T0MB 1CDGA 4ZS6C 5KZCD 4P06A 4WIQA 1DZBA 3HS0A 1GAFH 3IJSB 2DYRB 5EEWA 4NO2B 4KHXH 1GMEA 2EE6A 1SVCP 1LO3H 5DURB 4X5RA 2K6WA 2JE8A 5C0AB 4G6AD 4YXLL 2IV9A 4QYAA 1DQLL 2HWZL 5C0CA 3BJLA 2Q9OA 3MRFA 3MRJA 4YDIH 3NBNA 4KNSA 4YPGB 1OAQH 4QRRD 4DJMA 4Z7UF 3QAQA 4XPAL 2XWTB 1HHGA 1AGCB 1KJ2A 4NGHH 2X0UA 2VWEC 3FUKA 1MXGA 4R2GB 4JHBA 5I8CB 3N41B 3D87B 4ZAKC 2FYYA 43C9A 4MQ7B 1UWGL 3IJHA 1LL1A 1NEZB 2CBPA 1AKJA 1GYVA 2O5XH 4PUBL 1N6VA 4DGUA 4WW1A 2AXHA 1BXXA 3B83A 3GNML 3POHA 1QBLH 2YA1A 4FABH 3RTLA 3BYYA 1A4JA 3UTSB 4GMSL 4NRYA 1P6AB 5G2NA 4IMLA 4CC0A 4C83B 4MHHG 5JQIB 4QY8A 4JCLA 1G9NH 5IM7A 1IGJB 2FBJL 2WQAA 1RUPL 1RUQH 4OLZH 4PV1C 1I9RL 2VR5A 1H0DA 2XACC 4RFEB 3BWZA 1FZMB 2ATKA 2OMZB 2XG4A 4QTHA 5CLWA 5F3FA 1O6VA 4QRRB 2RIKA 2R1WA 3LPWA 1YG9A 2A9AA 4LIQH 4F7PB 4TLKA 5D4JA 4JFQB 4WI2A 5KVMC 3LY6A 3BKJL 2ILLA 3AFLA 3EDFA 3EF4A 1QFPA 3L9BA 4G8GA 4PGCB 2PCYA 3QQ4B 3L7EB 1AZZC 1Y07A 3H4FA 4MKMA 2HLFD 4OGQC 3NJJA 1EANA 3A24A 1MCOL 1IGMH 3MOQA 2IQ9L 2CUIA 3ZE2F 2R23B 3AREB 3F7YA 3O45B 2CIKB 1DQDL 5FWRA 4OGXH 4MVBC 4A66A 3T0EA 4PCSA 2ENPA 1EBPA 2XTJB 1J8HD 2MCPH 4H8VA 2E9IA 4JFFD 5BW7C 1E4XI 3DX9B 2A77H 3KLAB 5D71L 1BWMA 4G8IA 4IOFC 2J8UB 3T04D 3VD9A 3G6JB 4XVOA 1E4JA 4HBCH 3MO1B 3VWKA 4QD2E 3P77A 2FX8H 4P05A 4XWGH 1M1XA 1NGQH 1UM5L 1YEJL 2JQMA 4JFXA 3H3PH 3CLEL 1NKGA 5C7ZA 2JIXA 2GSIB 1ZT4B 3FQYA 1R17A 3HUJE 1A66A 1OGAD 3V8CA 3PP3K 3U0PB 2WXJA 4FQQA 4NENB 1ZWIA 4GRWE 3WFDH 1ZLUK 1F13A 4NAJA 1V3JA 1L7TH 12E8L 3VXMD 3ERXA 3SDXF 1AQKL 3VQ1C 1T20B 2NY5C 2AV1B 3KVPA 4PRDB 2FQDA 1A4KB 2EXWC 3VXUE 1SY6H 2HFFB 3WO3B 4Q6IC 2ADIB 3QUYA 5F6HI 2WZPA 5A3IC 2EYSB 4GQRA 1NLDL 4AMWA 1CFTA 2MPVA 5HJ3A 1HSAA 3H9SD 5DEJA 5TFSL 1FV1B 3S34H 5BV7B 4G1MB 1E4WL 3THML 2HUHA 3TH2T 1H9DA 3N0PB 4HCRL 3FAXA 2JKXA 1FH2A 1KUMA 5TGBA 3IF1B 3DX4A 4CMMA 5BQ7B 4NN5C 2X41A 1FN4B 4KY1L 3NZ8B 2V7HA 1NJ9A 4HFUL 3LN5A 5ABZA 3FHEA 3QCUH 4XHQA 4FAAB 2EACA 5B39B 3VXMB 3PPSA 3RZWA 5ITBL 4HIIA 2OXGA 5EUOA 4OF3A 1SN5A 2W60B 2A9MH 2V6HA 3PWNA 3VH8G 4JDEB 4NKQB 3ZUCA 4NO0D 4TVPD 3PWLB 2AANA 4X2UA 1TIUA 1OARL 2A6DB 4OJDH 3KL5A 3A67H 4X5WA 4X7EC 1MEXL 4QXGH 4UDUB 4DAGL 3B3BA 3H9SB 3DUHA 2M8XA 3PQYE 4XAWL 4K9EL 2VMFA 1DANT 2ADFL 2OLDA 1JPGB 5DD3L 5DZJA 5CCHE 3MLWH 4Z1PA 1LEIA 4FI6A 1D5MB 2K7PA 1UXSB 4RBPH 1XMEB 2F58L 4P2QE 5TF1L 1FORH 5T33L 4FYSA 5DD5L 2LLNA 1DEEA 2ORBH 1JGDB 4BGLA 3D4YA 2ZOUA 5LVEA 4HIJA 1F3JA 2XOTA 3GIVA 2E56A 4TLUA 4UT7H 5F7EL 3QARA 1XIWB 1WZMA 1X5YA 2QADB 3A6CH 1T03L 4OLYH 2ICES 2PW1A 5DDHA 3KZ8A 1QZ1A 4O00A 2W9DL 4H26B 4YSQA 1T1ZB 1XGQB 3BAEL 3LNGA 1OZTG 3MRDA 4O02A 4APQA 4U1LA 4TTDC 4Z7QF 5E8EB 4RIRA 43CAB 1A6UL 3A22A 3II1A 4ICWA 4AIZB 2OV0A 3U1QA 2VDRB 4OF8A 1EZUA 4YX2H 4UYQA 5IBUG 1WK0A 3VYNA 1QD0A 3IU3B 4K3EL 1ILSA 2D8KA 2NY7L 4I0CC 5LQBL 4MSWB 2M2DA 3UBXG 4Q4EA 3REVB 5JHLL 5LKNA 3QQ3B 1QNZL 3LAFA 5TDOA 3S5YA 1SLXA 2YIHA 4MZRA 3VSUA 5KW9L 2V2WA 4TNFA 1HWGB 5JNYA 1QSEA 2ZAHA 4X99A 4Y5YA 1C08B 1Q0XL 1QLFB 4R7LA 4HUNB 4AKQA 5C9JB 4XGZA 5EU4B 2FR4B 3G5ZA 2BNRE 3BCDA 1CWVA 1OV8A 4YSSA 1HHJB 3WJJC 3VFWA 4E0RB 1XX9C 3SDYH 4J4PD 2O6PA 3VFRA 1X9UA 1UT9A 1SJHA 3F6LA 4EIZC 5C7XL 1DVFC 3ZZ1A 4XMLH 2AITA 1JHKL 1ZAGA 1A1OB 2ZCHH 1NDGB 2IV8A 3ILQC 1S9XB 3JWOH 5LGKA 4NNXB 5TE7H 2GTWB 2ZQKA 4I18B 1ZXQA 5E8OB 4HJSA 2OXHA 3Q6FA 3HMWH 2NR6D 1L9PA 1ZHKB 3LZOA 3O11A 4X9HA 3FZUD 2CLZA 2E74C 4YBHA 2CHDA 4FQIH 1X9RA 1BM3H 3QXWA 4ALAH 3P1VA 2YJLA 4IEFB 3WEMA 3SDCC 4DESA 2OYPA 3OKOA 5BOZG 2WGXA 5DJ6A 1K6QL 5HHQA 1FYHB 3OKNB 3D69A 4PJFF 5CWSA 3C5ZC 3JVGA 3A4AA 3BD5A 4HA1A 6CGTA 5CN3A 3D6GA 1WBYA 4H44C 4I0PA 3B1TA 3U6XA 3B6SB 1QTSA 1G6RB 3L8QA 1QFUL 3G6AB 4JHWL 1IC0A 1E4HA 1JFHA 4L4TD 3IMWA 2D7MA 4NNPL 4QGTA 5LBSA 4DN4L 1W91A 2OMUA 2D7QA 3REWB 3KW8A 3QEHB 5IEHA 4J27A 3QCVH 4XBGA 4M43H 1CGSL 1JRHH 1KN4L 5HYJB 2JCCF 2XQYK 4B9CA 1WC7B 2AXGA 5D70H 3LOWA 4HKJB 3BLPX 4JG5A 1QWNA 1EQWA 1NC4B 2H1PL 2H45A 3WMPA 3BAJA 1RIUL 4F9PA 1QO3A 4M93B 4MD4B 3QAZB 3OWEA 2WHVA 1KCVL 2CGYA 5FA3B 5DCCA 2APFA 2BHYA 3FTUA 3O0LA 3UZVA 1T5KA 1SFDA 1J9SA 2Z0BA 4KC3B 1SDAB 4NT6A 2QZQA 1JCKA 3PE9A 4JDZA 5LWYL 4XCFH 1DJIA 4JRYA 1I1AC 2LU5A 1I3GH 3FH8A 2I5YH 2VLKE 2YK1L 5C2BL 3CDGB 1MRCL 4WWPA 3BT0A 4P4KC 1E8YA 2XZAH 1QEXA 1A9BA 5KSAD 1ZLWH 1N26A 3WNOA 3HB3D 2E47A 4PJ8A 1Z5HA 2VRAA 2R2EA 2FB4H 1SMAA 5KN5A 1JZ8A 1JE6A 4AJ0A 4D2NA 1SQ2N 1SJMA 1IT9H 5J3HD 3VWJD 3ENEA 4A6YH 1SY6A 4HULB 2DQGH 5IVXA 3HEIB 3N41F 2MNJB 3KPSA 1PKQA 3MXWH 1KJVB 3N85L 1FQ9C 1U3JA 1FNGA 1TEFA 4GI9A 4DGIH 2WCPA 4K3DH 1TG8A 1JG9A 3FU7B 2Q2LA 1MWAL 4RH4A 1PLGL 3F7VB 4L8DA 1CUOA 4HFWB 4LLQA 4RRPA 4PGZA 1SOSA 2HRHA 3ML9A 3QIBB 4IRZH 4RDQF 1JAEA 1UOVA 4YHOH 5AYUH 1A3ZA 4UV7L 1F1GA 5IT2L 1YJDL 2EDOA 3IK2A 3DX8B 4NC0B 4OIBA 4OQTA 5A2FA 1AGBA 3KWUA 5AVTB 3IFPA 4APXB 5CEZH 4JFWA 3TJHD 2ADYA 1DDTA 2CKBL 4MWFA 4P57B 5C0EB 4MX7B 3L1FA 3OR6A 4YLQT 5HD8D 3VD2A 1PNDA 4FQXB 1H3GA 2G75B 1IGIL 1NCGA 3MLPA 2H9GA 3PG2A 4RX4D 1F56A 3JWNG 5DHVH 3IXAB 5BZXA 1OSZA 3TT3H 4JY4B 2KQNA 3HRZC 2AJ3A 5KYXB 4PLOB 4WEEA 1RZFL 3QIWD 4NUGH 3B2UC 3GB7B 2WQVA 1C5DB 3CSYA 3QCTH 3O3DB 1OAZH 3MA9L 2VDPL 2EJ1A 2G9HB 4PLKC 3BKYH 2IAMA 3PWJB 2J8UF 3SQBA 2FQGA 1PZBA 3G6JF 3RURA 1UJ3C 1CR9L 4J8QA 4WHCA 5CZXD 1JNHB 4DP4X 3ZR6A 3PRZA 2XWZA 1P7QB 1XB8A 4LVEA 1T04B 4OCWL 1GKEA 5DR5L 4ZMOA 4TVSa 3E6FB 4NSKB 3WV0A 3KPRB 2D7TL 4N2DA 3X1GA 4HUVA 2NYZA 2XYBA 3RUGB 4ANUA 2ZCLL 4N3UA 3P3RA 3QORC 2F0CA 1L9QA 2F53A 5K9KB 5D1QE 5AW0B 3VJ6A 1KJ3H 1MI5A 3M8OH 5BS0D 3QIWB 4LEEA 3X11B 4KRNA 3R06B 3MR9A 1MFEL 5DO2C 3W1ZA 1U0QA 2C3HA 4X5XA 3ZT5A 1FFPA 5EC2B 4YFEA 1A7RL 1CJYA 1ZSDB 3PJLA 3TBWA 3AB0C 1U58A 3CK0L 2BZDA 3OVUB 1I8UA 1KN2L 4JFDA 3FS9A 3NIDE 1XB6A 4U3HA 4JE4B 4YIQA 1KJ2L 5K1VA 4NDMA 2IOIA 1I3VA 1ZS8A 5GS1B 3HC0B 1J5OL 4AGPA 5CCKL 3U25A 2D3LA 2F8XC 4RZCB 3C8HA 3KPLA 1H8SA 5G4OA 1BVKB 3CFCL 3ULVE 4DUWA 1RJLB 4YBLC 2Y1YA 2WXOA 4X4ZA 4HJGB 5SWSD 4CKVX 2WUBL 2JELL 2B4CL 1AP2B 3BPOC 4AV4A 3WTWA 3MV7D 5BS0B 5CJXA 3BDYH 4X8JB 1CZ8L 3VXTB 5B38A 3U0TB 2W65B 1UQSA 4NFDA 2BIMA 3B2VL 5TQ0H 5CGTA 1BJ1H 3EJSA 1H9VA 1LO0L 1XDTT 1WT5A 4WU5B 1NANH 5I71C 3MNZA 2OMNA 4ONHB 3WFHB 1JNJA 1EGJH 5F9WC 4U1NA 1DLFL 4HGKC 3MCYA 4H13C 4JPWH 5CXPA 5IOPA 3IRZA 4PM1A 5D7LD 1FYTD 1CL7H 4GQ9L 5DT1H 4HPYH 1E43A 4XNYH 5C0CE 3CG8A 4JM0A 4M7JH 4ONFL 2MHAB 1CLYH 5GSVA 1TSRA 3X3GL 1ZV2A 1EFXB 4P48A 4G3YL 3ZJAA 4KPHL 2G4EA 2VXVH 4OB5H 5SWSB 3GINA 1LP9B 4GRLD 1FDLH 2F5AL 1SDYA 3BO8A 1YEEH 3EG9A 2PCXA 2GCYB 4KKCC 4MQTB 4C4UA 2YZ8A 2A74C 2JXMB 1FL5A 4HV8A 1JWMA 3RX5A 3RLSA 4CADB 5HBBA 2A38A 3M1BB 4B0MM 5ICYA 1SYVA 3I2CL 4J1UA 1KFAL 2NXYD 3VB9A 5LN4A 3UAAA 3SDAA 1UZ8B 1K85A 1JVOA 1U8NB 3V7AG 1SXAA 4M6AA 3UJTL 1GYUA 4AGOA 1U8KA 3VFTA 1I7RA 4XP4L 4LASH 1PZ5A 4U1SB 5C8JA 4PJXF 2B5IC 4RDBA 5H8DA 5E9DD 4FTVD 5K9OB 4FFZA 1H15B 2VXQH 2IDFA 1EJOH 4N22A 5ESQA 3DKHA 1FYTB 1UH3A 3OKEA 3SBWC 2DKSA 4YHML 1FFNB 4WK4B 1LK2B 2IPUK 4E5XB 4KZEL 4CU8A 3FUJA 2GBUA 3ZDWA 3SE9L 5DK0A 2NDFA 1LEGB 2P52A 1EDQA 1MRDH 2Y3AA 2XJLA 3VDCA 3ZYOA 1GW0A 2VLLB 3ZVVA 3CIAA 2AK1H 2XWBB 3DRQA 3V9EA 2DYPA 3PHSA 3WDHA 3QEQA 1MREH 3MJ6A 3QO0B 4G8GE 4XX5A 5I1AB 3BGMA 1SXBA 2OMYA 4LARH 5AAMC 5JR1H 2IJ0C 3OQRA 5T1JA 4ZZFA 1Z9SB 2DQUL 4OCXL 2AKRB 1BYOA 4R2GC 4XMPL 4Z5RA 1T1WA 1SJXA 3FRPA 4YR6B 3LPPA 5HYSB 4BH7B 4FTVB 4OZFG 1JHTB 4M7LT 1VGKA 4LEXL 3ARBC 1XF2B 3BHBA 3SPGA 1DVYA 4Z7VB 5KYYB 2RA1A 4NQSB 3UPRB 3MLTB 1LK3H 3TA3C 2XA8L 4WK2B 3POCA 5C0ND 2N56A 4WHTA 1MW0A 1RHHA 4B96A 2WLLB 3QUZA 3QK0A 1DEDA 4IRZA 1XVSA 2Y1ZA 3NFSL 3D4CA 1IAIH 1NFIA 2X2HA 1S7QA 3MUJA 5LAPA 3T08A 2FWUA 6PAZA 1G9EA 1ZDSA 1BLIA 2BDNH 4JZOB 5IHZB 2Z34A 4YVUA 2P43B 3EO1B 1IM9D 1LWJA 1RJYB 5GJTL 2ZSWB 4IMKA 4A2DA 3WXVH 4PVBA 3QUXB 4J8RA 2R56L 3RE0A 4L9LB 2E6QA 5E95B 3UAJA 3OKDA 3QA3B 3N1MC 1OTTC 4E68A 2KMWA 4OLUL 2CLVB 4LLMB 1T4WA 1XF3A 5JW4N 2MPAL 3GHEH 3MBEB 4POZC 4EI5D 3ZR5A 1FRGH 1VB9A 1ILUA 3AREC 4ZT1A 4GAYA 4G43A 4MMZA 5CU9A 2XTJC 2JI1A 1FAIH 1IM9B 2AEQH 4JFYB 3PWVB 3TH3T 5FUCE 1BQKA 4KKAC 1UFUA 4O02L 1IAIM 5MENA 5K59E 3B9AA 4CSTA 2GABA 1CMOA 3OJMB 5E08H 1XH1A 5K1JA 2WWKO 3D4ZA 4KJQD 2MCMA 1CLOL 1A22B 3QRFM 2TAAA 1UA7A 2R8SL 3NEEA 2PXYD 3KPQB 4OLWL 5AOMA 5FO8B 4GUQA 1P7BA 4QWWD 4NKIL 5EUOE 5HGAA 5JLZB 1U30A 3K6FA 5AVSB 4P2CG 1GAFL 4F7KA 3CZFB 2PYFA 4CAGA 1DUYB 3RRQA 3S3SA 4EI5B 3EH5B 4RETB 5KANG 5AVQB 2X4RB 2VZVA 1XL6A 1R5WA 2WYTA 4JQXC 4W1TA 1MF2L 5AD0A 1TENA 4ADGA 2P5WB 3MLUH 4KJWD 2K3TA 2P28B 2YXMA 3GGWA 1N9PA 1NCJA 2HG5A 2R59A 4KDWA 3X14A 5JDSA 4LL4A 4X50A 4YDIL 1H8LA 2VISA 1KDJA 3D0AA 1NGZB 2VW4A 5H37A 2NX5A 5IB5B 4KTYA 2IBZY 4ZUVA 4NGHL 5EU7C 2OM5A 3MLVH 2GJ6D 5GRUL 3VTTA 5BV7C 4CNIB 1YEKL 1S7UB 4ODUA 5IQMA 3BUDA 3FU8A 4XRCB 3QHFH 3DVNB 1EJ6A 3BDXA 4N2OA 2EDRA 5HHXH 5JW4R 1NBCA 1DVZA 2V2TA 2VKXA 1VEPA 2PWHA 3BVXA 5I17A 1YC7A 1U91B 5C71A 4BKTC 1EAPB 1QBLL 3WIIH 1I1CA 3VXSA 2YQ2A 3MRGA 3IM1A 1W8OA 4G5ZL 4EO5A 1RV6X 5B7EA 5DJZB 3GF8A 1BBJB 3MV9A 3JV4B 2PW2A 1H5BA 1QKZL 4ODTH 3QDGA 4HUWA 4RWHA 4N90D 4OLZL 3ZKNC 2ZXDA 5IFHH 1TQWA 2P42B 3A21A 1GGBH 4LT7A 5DFAA 5D1ZD 1JN6B 5PAZA 4GSQA 3H3KA 2UYLB 3DROA 4LIQL 4M3JA 5F9JB 1EGJA 1QSEE 2LLGA 4Z7NE 4NOBA 3OPUA 3WN6A 3BP7A 4JG1L 4ZFQA 3V5KA 4XMZA 3HBQA 3CCHB 2AJUH 1L9MA 5LBSL 4RMRA 3RZCA 1EAOA 2HFGH 2VMJA 5B1JA 3ARFD 2CBTA 4J3OD 3VE0B 1JPFA 1UM6H 2YAOA 5C08A 3RVTC 4P5TA 4LMQI 1VPOH 2W07B 2VLJD 1VJSA 5FGCE 4U1HB 5BRPA 5FHBL 3FSAA 4MJ6B 5AW1B 5LGJB 4Q9RL 2DMKA 1XIWC 1IARB 2MQ3A 2QADC 2XV6B 3C09B 4WK0B 1NM9A 5EFIA 2MCPL 5CR1A 4YLCA 2H2PC 3JT2A 4ZFZA 4L5FH 4QF1B 4RFOL 4OGAC 4XBMA 3U9WA 2XTLA 2YLKA 3SKMA 1YEIH 3RUGF 2Q0ZX 1Q9LB 3LKNA 2BHFA 1I75A 4E42A 5HTSA 1R3IH 4GUPB 1VCAA 2EO7A 3MMEA 1HSBB 3AQZA 1T89C 4CVWA 1FNLA 2BRRH 3EYUL 2FX8L 4XWGL 5I6OA 3DO4A 3OX8A 1F58H 2HTLD 2L8AA 1IQWH 3EOYG 3EYQC 1KB5A 3N04A 1WDAA 4F57L 1V8HA 2ZXQA 3QJHA 2JV6A 1JK8A 3WL9B 4EDWH 2ARJB 5AB2A 1DUZB 2XVKA 2NZ1A 3F5WB 4QYOB 3ARFB 3Q43A 3PU7A 4LIQE 4P5MA 4PBXA 2YQBA 3ECBB 3WFBH 2WKOA 3LN9A 1P5VA 5DQJB 4H5SB 2IFGA 3AJ7A 5F21B 1T0OA 3LN4B 1O9ZA 3AU1A 4WFGE 2BSED 2B15A 2YD7A 3P73B 2FEJA 2Y0SA 4PJ5D 3V4VH 5FM8A 3QB7C 1SY6L 4KRPD 3V4PH 4WKXA 2DIEA 5HDQH 5EZLB 4L4VE 1JI1A 4DHLA 5GGUB 3G5VA 1AXTL 4P3DA 4PHZA 2J1KA 4B95C 1FE8L 1JZDC 3VFVA 2FL5A 3MRNA 2ERJB 1I53A 2JKWA 5L2KA 3SCMA 4MAYD 4UANA 4KDTA 1B6UA 4AQAB 1ZT1B 1XF5A 4HCFA 3DIFA 4I9WD 1KTJA 1EVUA 4LGSB 1HNYA 5TE4L 4J3UA 3W9EB 1E6JH 3T0VA 2GAZA 1CDJA 3C87A 3FFDB 3JTSB 1EMTL 1OAJA 3CFQA 4I18C 4M7KH 3WLBA 3WTUA 2KKQA 2BWIA 1LQSR 3NZHL 5AL0A 3VQ2C 5DSCA 1OE1A 1WBZB 4JRYE 4ODVH 2X6VA 4HCGA 1DL7L 4IBVA 1KZYA 1WZ1H 2ZPKH 4OQTL 4G42B 5DJXA 3TXAA 3K1KC 4E41D 4F37F 2ARJQ 4ZFFA 1J86A 1ZTXH 3QZPA 4KRPB 2DL9A 3NPZB 1CFSA 4W4OA 1S5HA 2PPFA 4EPSA 4KXZI 2VDQH 4M61B 4NKOB 5CMAB 3WIFB 3A67L 3RVVD 2ZXGA 4M5YL 1ETZB 4YWGH 5FPIA 2EADA 4OI9A 3Q48A 3EHBB 1MHHA 3GRBA 3WLWC 2OYKA 3LNFA 3P69A 3EDJA 5IB1A 1FVCA 1LP9F 5F7HA 4PYGA 4AZ8B 1THAA 3NJFA 5IVXE 4ETQA 2VKWA 1YEWA 3PWPD 4L3CA 5GGTH 3KPSE 1PKQE 4RSYA 1T1YA 3SN6N 4XNMB 1XBDA 4YUEH 2ZG2A 1I3RB 3GSRA 3AY4C 5FM4A 1M7IB 3UYRL 5GSRA 3FU9A 4HIXL 3A6CL 2BIIA 3QAZC 3S37L 4OLYL 2R69A 1NFDA 5EC1B 1OCOB 3FT0A 4XO4A 4AT6A 1OSEA 1RK1A 3U4BH 5KBMA 3FO0L 2ZOWA 4WHYG 2X3CA 2Q3AA 3CQFA 3OHMB 4P2RD 4PS3A 1N2RB 3HKFA 3LQZB 4TLTA 1KJMA 3JYBA 4YX2L 4ELDA 1U6AH 3WTXA 4PGBA 4IRSC 4N0UA 3FQUB 2X1OA 3NH7L 3CHQA 4M5TA 1PMYA 5ETUB 2QHLA 3AUVA 1V10A 1N4XH 2ZUTA 2OMTB 1TNMA 1N0XH 5E6ID 4ZXBA 1INQA 5DQDL 1R0AH 4ZNEA 2DICA 1FG2B 3RJOA 5HYQA 3PWPB 3UZEC 1RIHH 1YNTB 5ABAA 1ZE3C 3LQAH 2XV3A 1D9KB 3LZPA 1ES0B 3O9WD 4WFED 4WJ5A 1RJZA 2YQ3A 1QFWH 3C12A 1SJVA 2D9CA 4JE0A 4JGUA 4LCUA 5EBMA 4PRIA 3D2UA 2EABA 5GS2H 2IXQA 1I8LC 2FBRA 2ZSVA 4LVHB 2H32H 5LLIC 1DVXA 1SGKA 1QFOA 2RB8A 1Z32X 2VW7A 3UXFA 4P2RB 2IH3B 4Z7VF 1HH9B 2ZWLT 2BOBA 4DK3A 4X80H 3OMIB 3PNWB 1W72B 5IIEA 2ESVE 4F9LA 1UH4A 3Q1SL 1ORSB 1XR9B 3I02A 4OFYA 4UUJA 4XXWC 4YDZA 4P49A 5I82A 3JWOL 2NLJA 5IV2A 2R1XB 3PDOB 5JOPD 5E6IB 5ITFA 4DEUA 5A7BA 3QIBC 1JV2B 3OZ9H 4Y88A 1ZA3A 4NFCA 3W82A 4LSTH 5ES4B 1IIIA 1HZLA 1I1FA 4FQIL 4JO5A 2F53E 1BM3L 3KM1A 4ALAL 3CZKA 5EDXA 4ZMYA 1FC1A 4N8VA 1B2YA 4V33A 1MI5E 1T21A 2YA2A 5FGSA 1RZ8A 2Y7SA 3FB7B 4FQLL 1CGUA 2XN9A 4DUVA 3DJ9A 2XZCL 2CM5A 3VGAB 5D6DA 1JP5A 1ZJBA 4FQXC 2NXZB 3EIFA 4U3XA 1X3DA 2VDKH 5JHDE 1IEAA 3HNVH 3KLKA 2X9XA 1C12A 4Y2DC 4ZTPL 1MCSA 4JFDE 5AKSA 5F88A 3P11L 4PVLA 1NGYA 1EXUA 3SEPA 3QCVL 1OIOA 4M43L 1K9TA 2H6UA 3DBXA 4JO4L 5D70L 1BGXL 1TKWA 3D06A 1ZS2A 2FBOJ 2GG1A 1ZLDA 5DYOA 5L7XH 4O58H 5FDWA 5CIPB 1KCSH 1Z9LA 5C6WH 2VQUA 3KYAA 4KH9A 3RIKA 4B0MB 2DWXA 4JGJA 4AYGA 4IRJC 1N0LA 3UAEA 1A9VA 2R4RH 2PCPB 4FFZL 1G7LB 4M6ML 1Y6NR 2WK2A 4AQOA 1DJSA 4RVBA 4AW4A 1FFOA 2I5YL 4EKXA 5AWNL 3B9KD 1X5KA 3TF4A 3CFBB 3VI3B 1I9JH 1S7RA 1HEHC 3QNYA 4PJGA 4TUKH 5CP7B 4ZTOH 3RDJA 4C57C 5PCYA 2ZOKB 1YC8A 4LLUA 5DD1H 3U7YH 4A7UA 1DHKA 1WS8A 2FB4L 3KYNB 5E5RB 4PRNB 3ROLB 3QYMA 1IT9L 2CIIB 3FFOA 3V4PA 4HJJH 3QFDA 5AB1A 4MZ3A 2DQHH 4V1DD 1JF6A 2R29A 1B9KA 3MXWL 3CSPA 3IMTA 3K2IA 3AWGA 3MGOA 3OJDA 1AGFB 4PG9B 3IB4A 3L9RB 3EGXA 4K3DL 2FE0A 5DVPA 3BPNB 2OI9B 1CVSC 4FYQA 1JZ2A 4ZDHA 1P1ZB 1CC3A 2FX7H 3STZB 4BK4A 3B9KB 2BS71 3U30B 4X7FC 2FH6A 4G11A 2QPEB 5LNEA 4PJHE 1DQMH 3S4SA 1GOHA 1OCCB 4IRZL 3G04A 4CUCA 3I6KA 1C16A 2GIYA 3QR1A 3SQOL 4AEIH 4YSPA 4MJID 3QI9D 2OJEA 2KPWA 1U93B 3ATBA 1BD2E 3WKMH 3ZDXB 4BH8A 2E7BA 3K91A 2AVGA 4AENB 3KS0H 2FJHB 4N2IA 3AZUA 3O8XD 2V7NB 3MREB 3E1ZA 4XVJH 4HWZA 3TO2B 3P0GB 4AE0A 4OZHB 4QRSA 2W94A 2C3VB 4A37A 2Z7UA 4OW6A 1ZLVK 1CXEA 1THCA 4OTXH 1ZSHA 3OLIA 3CTTA 3UJJH 3MJ7B 1KIUA 1TZ8A 4HQQH 2E7CA 2P24A 5AYQA 1IFRA 3WFEH 4K7PY 3WU1A 1BIIB 4X6FB 5F3HB 4B3VA 2BINA 2WQ8A 3B7UX 2YARA 3MUY1 1CFVH 4NUGL 2XIBA 4I3GA 1HE8A 3V0DA 3NZSA 4W9JC 3ZDZE 4S2SA 5A2AA 1OAZL 2AJZA 3HUJB 5F6IB 2P8LB 1N3NA 2Z8WC 3BKYL 3LS4H 3OLEA 4XO9A 3OD3A 1WHPA 5CHNB 2Q86B 4FLQA 1OALA 4JLRB 2E9GA 5E51A 3BAKA 2G2RB 2C7UA 3O3BA 3O8XB 4DVRL 5A16B 2J21A 5MP6L 4MJ5A 4PH8A 3MRBB 2EIMB 3TASA 1OY3B 3VXUB 4UTBA 1JZ7A 4YOKA 2UUDK 3T2OA 1QPKA 4O9HL 4XE0A 4J3OF 4DVBB 1E8ZA 1M2OA 3FL7A 3ARSA 1MNUL 2ZZUT 1O9WA 4LL9A 1T2JA 3PQYD 1ITBB 3RYMA 1KTCA 1KJ3L 4GQPH 3FSOA 3BQUD 1JK9B 4PJBF 4N26A 2CGRL 1NKOA 4GSUA 4XI5D 4P2QD 5FKAA 3V6OC 4G8FA 2V8LA 3HFMH 4XMUA 2X7LA 2E8YA 3GI8L 1B88A 2G0KA 2YRBA 4XWOC 4Q6KA 3IDYB 1SJEA 3LKOB 4M4RB 3WJMB 1J1OH 2I7OA 5CZVH 4Y16B 1R24B 2JI3A 1DBMH 3LH9A 2Y5TA 4DQAA 3AWEA 1SXZA 5EEZA 5DUMH 3QPKA 2CKNA 4QRAA 1HYSD 3RFZB 4IU2B 4PWGA 2OW7A 1NBYA 2HCZX 4G7SB 4KRLB 4KV5E 4O51A 5KJ4A 4U0QB 4MBOA 1ED3A 1E3ZA 1KGCE 3QZWA 5MENE 3PQYB 5JPMC 2NUTB 1OAXL 3L3JB 4FHJA 5JW3H 1E28A 3BQUB 1G5AA 3VMOA 4X9BA 1MKFA 3BDYL 5EORL 3BKCL 4P2QB 5HI3D 3MOBH 5FM5M 4UOZA 4HIHB 4P59L 4F93B 2H1LM 3WMQA 3R18A 2WXGA 4MA3A 4QPEA 3LH8A 1PIGA 4X9IA 3BUBA 4JFOB 1UA6L 4YHKL 5D9SB 1A6ZA 4BZ2H 3QWRD 3QE5A 3QUXC 4JVPA 4FGMA 4CC4A 4R8WH 4L9LC 1EGJL 2DTSA 2FEDD 1UD3A 3DOSB 4JPWL 1Z9NA 5DT1L 3TNMA 4HPYL 3F01A 3PLYA 1IGTA 5HGGS 1EUUA 4M7JL 4L8BB 4P46C 1CLYL 5LAXA 1HCFX 3MBEC 3W5MA 2Q8BL 4I77H 4JL1A 2XSKA 4M48H 1O6TA 5F1NB 2NX5E 1T2QH 4ABUA 3I50H 1FC2D 3Q9PA 5FFLA 4C47A 5TQ2L 3WN5B 3OXSB 3DSFH 3NJXA 5HHOA 2OTUB 3HR5A 5E00A 2YAFA 4G70B 4KMQA 4EDXB 4UQ2B