3WY3A

Crystal structure of alpha-glucosidase mutant d202n in complex with glucose and glycerol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLNTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
molecule keywords Alpha-glucosidase
total genus 190
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy3A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy3A02
3K8LA 1KXQA 2V3EA 4ATWA 1OB0A 2GUYA 5I5RA 1E40A 2V3FA 3VNZA 3IJ7A 3VGFA 2ZE0A 4LQ1A 3KLLA 4UZSA 3VGEA 4PSPA 3QGVA 4X0NA 2WKLA 1EH9A 4FLOA 5KEZA 3BC9A 3BVTA 3EJPA 4UCFA 1EO7A 2ZIDA 1XSKA 4J3VA 3VX1A 2F7RA 1ZJBA 4H8VA 1HNYA 2VR5A 2WSPA 1JI2A 1A47A 3BVVA 2BHUA 4KWUA 3VM5A 3WEOA 3L2MA 3GTNA 4X9YA 1WZLA 2WVSA 3LXBA 1QHPA 1OGSA 1JAEA 3VSUA 5C8BB 4CN6A 3WDJA 3VX0A 1TQWA 2FHBA 3BUPA 3BUBA 3GXTA 2WSKA 1GCYA 3K8MA 3BCDA 5CXPA 3ZOAA 2XWEA 1MW3A 1SZNA 3CZEA 1XV8A 1JG9A 4J3TA 4J7RA 1GJWA 1HL8A 3UERA 4FLRA 2PWFA 5F7UA 2EABA 2ZXDA 3AMKA 4J3XA 1UH4A 4NXSA 3BVWA 3EDEA 1E3ZA 2YKKA 2J25A 3HJEA 1PZ3A 1JGIA 1ODUA 1M53A 4HOWA 1EA9C 2FHFA 2WVVB 1UD4A 4GO8A 4JFTA 3LX9A 1IV8A 1J0JA 1VFMA 2ZXAA 3KL3A 2D0HA 3RILA 3BMVA 3WMSA 3ZT6A 4CKQA 3HG5A 4PSRA 3WNNA 1WP6A 1U30A 4J3SA 1BAGA 1T0OA 4AIEA 2FH8A 3A6OA 2ZWYA 2D3NA 2ZICA 3LRMA 4AYGA 3BAIA 3VMPA 4TVUA 1C8QA 4FNSA 2F7QA 1R33A 2C8NA 1G5AA 2FH6A 1XD1A 4UNIA 1JDAA 4NXKA 3EJQA 4QAWA 3ZT5A 1KCLA 1CDGA 3LRKA 1B0IA 2BY2A 2QMJA 3KE0A 4UQBA 1HXKA 1JDCA 4LXFA 1AQMA 2F2HA 6CGTA 2XN1A 1H3GA 2WKGA 1KTBA 2XVGA 3GXNA 1HWWA 2E9BA 5E6YA 2VNCA 4H7VA 3LPPA 4UOQA 4AMWA 5E70A 1G1YA 3WY4A 2F7PA 3VSVA 2FHCA 3KL0A 4HA1A 4J3UA 1BLIA 2PWGA 1D3CA 1EO5A 3HG3A 2QPSA 1HVXA 1AVAA 3A4AA 3FAXA 3GBDA 4NZJA 3EJTA 4UQEA 1XH2A 1CGXA 1CXEA 3VNYA 1CGVA 1GVIA 3CPUA 4OJYA 1CGUA 3L4YA 1AMYA 2YA2A 1EHAA 3AMLA 2NT1A 3KWXA 4GI6A 1UKSA 4J28A 2ZXQA 2ZX7A 3IJ9A 4JFUA 1WE5A 3TV8A 8CGTA 3LXAA 4CGTA 4FMVA 1PS3A 1XH0A 1KWGA 2ZUSA 3CV5A 2OSXA 3CZKA 3CTTA 4DO4A 1MW1A 4XB3A 1CXIA 1CGYA 2CXGA 1UH2A 2F18A 5A2AA 2IGTA 1UD2A 1MVYA 3BAYA 2WVUA 1OT2A 2WPGA 1LWJA 9CGTA 2NSXA 2D73A 2FYVA 1VFOA 2TAAA 3A47A 2G3NA 1JDDA 3BUDA 5A2BA 1PAMA 3OLIA 2ALWA 1CLVA 3BAKA 3KL5A 4FNTA 2GVYA 3FW6A 3RIKA 3ZT7A 5I24A 3ZSSA 1XD0A 3H53A 4AYSA 2Z1KA 3CZNA 1U2YA 3ZO9A 1QI3A 4PEEA 1MXDA 5HDRA 2ZUUA 5HXMA 1DHKA 2XIIA 2ZX6A 3UG4A 2OW7A 1HX0A 4U3CA 2YFOA 4JFWA 4UQAA 4AEEA 3EDKA 4DO6A 1QW9A 2WCGA 4BA0A 3WNPA 3GBEA 1UKTA 4BZYA 1ZJAA 1QW8A 1D7FA 2DH2A 3TTSA 1UD3A 1UD8A 4OGZA 2VUYA 2Y4SA 1DEDA 4JL1A 5A6LA 3EDDA 2QMKA 1DTUA 4J27A 1KBKA 4AEFA 4KMQA 1JXJA 1KXVA 1JIBA 4GIAA 2EACA 3IGUA 7CGTA 4PCTA 3L4WA 3AJ7A 4FLQA 1BPLB 3CGTA 3OLDA 4JL2A 5A6MA 3A5VA 1VB9A 1WZAA 3K1DA 1SMDA 1XH1A 2Y5EA 3GXPA 4CN1A 1XSIA 1HL9A 4GI8A 3WNMA 4OKDA 2BY3A 3WY3A 3GXDA 3WEMA 1XGZA 2C7FA 3AXHA 3DHPA 2D2OA 2ZUTA 3BUQA 1E3XA 3D4YA 4J3WA 3VSTA 3VU2A 2AMGA 4U33A 4FNPA 3BLBA 3M07A 2D3LA 3ZSTA 1JFHA 2BY1A 1CYGA 1QHOA 3KEHA 2WANA 2FE0A 1WZKA 2VRKA 2BXZA 2YA1A 3A22A 1MXGA 1UKQA 2F61A 3WN6A 1KTCA 1TQUA 1WZMA 3EDFA 4B9YA 2OYKA 2DIJA 5DFAA 3WY2A 1PZ2A 4DO5A 3W37A 2EJ1A 1VJSA 3GXIA 4GQRA 3BAWA 1BSIA 1MW2A 3UEQA 1E43A 5TD4A 2D0GA 3K8KA 2CPUA 4U2YA 5E1QA 5E0FA 2PWEA 1TCMA 2F1AA 1NOFA 2VRQA 2YIHA 3OLGA 2DH3A 6TAAA 2EAEA 1CGWA 1QI5A 2WVVA 3WY1A 3L2LA 4NZFA 1G94A 4CVWA 3BMWA 1JF6A 3DX3A 2BY0A 2BHZA 2D0FA 1UH3A 1MWOA 4HOZA 1MFUA 4JFSA 1QWUA 4UQCA 1J0IA 2OYLA 4AIOA 2DIEA 3TOPA 2XWDA 1U33A 1SMAA 2NT0A 2PWHA 2YOCA 2OSYA 2QPUA 2XN0A 4NX0A 4PCSA 5A2CA 3GXMA 2OSWA 1Q4NX 1V3LA 2WC7A 3DX0A 3ZQ9A 1KGWA 2Y2WA 2E8YA 1RP9A 3EDJA 4JCLA 1W9XA 2QLYA 3LRLA 3EJUA 3BSHA 2EO7A 3VGGA 2WCSA 3CZLA 4GQQA 2OYMA 1R7AA 2BHYA 2WVTA 3GXFA 3FAWA 4WF7A 4H8UA 1TMQA 1KGUA 1JXKA 3CC1A 1UA3A 1PJ9A 1TQVA 1IZKA 1CPUA 2XVLA 1ZS2A 2YFNA 1JI1A 5EMYA 4GO9A 3MI6A 1KXTA 3TONA 1KB3A 1MFVA 3D4ZA 4FLSA 3BAJA 4UQDA 3WNLA 2ZUWA 3DX4A 1CGTA 3CZSA 3H55A 3L4XA 3VMOA 3A23A 3UG5A 2ZX8A 4GI9A 3A24A 1QWNA 4H8HA 1CXLA 4M8UA 2G3MA 4WSJA 1R47A 1MW0A 4E2OA 1KWKA 3KLKA 3WENA 3CLWA 1TQTA 4FNRA 2ZXBA 2F1BA 1BVZA 1KXHA 3BVUA 1OSEA 3L4VA 5HPOA 5I23A 3DDFA 1JL8A 5CLWA 5I0DA 3D51A 1AQHA 3EJRA 4H2CA 1VFUA 3A21A 1PIFA 1BF2A 3VGHA 4FNUA 4FNQA 2FGZA 1UA7A 3D50A 1S46A 2ZX9A 1O7DC 4AMXA 1CXKA 2AAAA 2V3DA 1HT6A 2EADA 7TAAA 1KCKA 2VT0A 1JD7A 4WSKA 3VM7A 1R75A 1VAHA 3ZR5A 2ZUVA 1CIUA 1V3MA 3WELA 2QV4A 2ZWZA 3S5ZA 2EEXA 1JF5A 1L0PA 3BH4A 1UD5A 2E4TA 3S5YA 1M7XA 1UD6A 1I75A 2PWDA 3DHUA 1QPKA 1J0KA 4GKLA 3WDIA 4HOXA 2GJRA 3L4UA 1RP8A 3VGDA 1V3JA 3BSGA 1R46A 1UASA 2GJPA 3HG4A 2BXYA 3CZGA 3EJSA 3HZ3A 4U2ZA 3VO0A 4MB1A 1OT1A 3DDGA 3WFZA 1GJUA 5E6ZA 2XVKA 5BRPA 3S2CA 3BCFA 3IK2A 5CLTA 3UCQA 3ECQA 4JCMA 4U31A 3W38A 1XCXA 2F7OA 3HG2A 2YJQA 1VIWA 1Y7VA 4AW7A 4UOZA 1RPKA 1XCWA 3H54A 2XIBA 4UZUA 3DX2A 3DC0A 3WNKA 1BG9A 1J0HA 1JD9A 1QI4A 3L4TA 3BLPX 3LXCA 1KGXA 4W93A 4HPHA 2CHNA 2GDUA 1CXFA 2X2JA 1P6WA 1NM9A 3IJ8A 3OLEA 4B9ZA 3VGBA 1IZJA 1KBBA 4GINA 5CGTA 2EQDA 1PEZA 2E0PA 1BVNP 2X2HA 1B2YA 3DX1A 5DO8A 5BRQA 3UG3A 1R34A 2X2IA 1LWHA 3ZR6A 1PPIA 3BAXA 4WLCA 1CXHA 3BVXA 4M56A 3BUIA 1HTYA 2E8ZA 2ZX5A 3VMNA 2YA0A 1PIGA 4JFVA 1V3KA 4HP5A 2OW6A 2XN2A 3AXIA 3II1A 4CN4A 3WDHA 1WPCA 5CGMA 3L4ZA 4NI3A 4UQ9A 3BLKA 4MAZA 1G9HA 1XSJA 1UOKA 1QX1A 3TTYA 5E9AA 1Z32X 3WNOA 1TQSA 3LPOA 4LPCA 2WNWA 4OIFA 1WO2A 2Y24A 2GDVA 3D52A
chains in the Genus database with same CATH superfamily
1GL4B 1OB0A 3U6XA 3GIZL 3FHQA 3A4DA 3O9WD 1J7VR 1SN5A 3VGFA 1Q9KA 3FF8A 4J23A 4DP1X 1S7VA 5K5YA 4HOMA 4UZSA 4PB9L 3MOAH 3QDMA 2WKLA 5CBAA 1EH9A 1JPTL 3C9NB 4Y9FA 4A2MA 4WW2A 1DVFB 4JFDD 1FO0H 5F6IC 1HEZB 1S5IH 4JUSA 1ZGLM 1U2CA 3C6LC 4YE4H 3O3EB 1S8DB 5F6HI 5D2LA 5HTSA 4D8PA 3SE6A 35C8H 3T1FA 3PHSA 3TIDB 3VI3B 1ACZA 4PJIB 3EO9H 3W39B 3APFA 3WL9A 1J18A 4XVOA 3WTVA 5D5MF 1MHHB 2MNWA 2PR9A 4X4YB 3MJ9L 2YAOA 4LARL 1NOAA 3GXTA 5CD5D 2VL5A 5LN8A 4U05A 4F9PC 1RHHA 3FU5A 3Q6GL 5H2BA 1G7HB 1BZEA 5MENB 4V2CB 1G7PA 1S4IA 1JG9A 2W9LA 3UYRH 1RK0A 3UERA 1D7CA 3VXSA 5GS2D 4JO4L 2VSMB 2A9MH 2YXWA 5TDPA 4DGIH 4XI5D 2QFPA 3C5ZA 4K5OA 1U93B 2H4EA 5JXEC 3KNBA 3T3PB 1NCDH 5DYOB 1AKJD 4BXVA 2FHFA 5H2BB 2IQ9L 2FIKB 3ASOB 4A66A 1F11B 1Q0EA 2W88A 1E4XL 3KJ6H 1TO4A 3UJIL 4KKZA 4Q9CA 3JV4B 1U30A 4EXPX 2D7MA 1IKNA 3N85H 2J1XA 2ZAHA 1SM3H 3ULUC 3PAYA 1IGFH 2Z4QA 4OJFL 1NA8A 3BAIA 4IHOA 4TVUA 1DN0B 4V1DA 5HYJA 1M1SA 1XGPA 1MHPH 4AYSA 4CGUB 4TUKH 1AD0B 4JRYE 4ABWA 4KQ3H 5EOCL 1QRND 3AABA 3T2NH 5GQBA 1OKEA 2GTZB 4ZFOB 1I1AB 4FQXC 3VDBA 2A6DA 4LCWD 1YEJL 2KLRA 3ML9A 2A0LC 5DZ9A 4P3CH 2EO1A 1OHZA 1FLTX 2XQ0A 3P3YA 1FAIH 4LGPB 4E0RB 5FYKL 4AMWA 4I0KA 4OCMC 3CXHJ 4YMPA 3QIBA 1QBML 3WMQA 3P02A 6PCYA 4HFWA 3DVGA 1E5CA 2Y1VA 4HUXB 3LJ3A 3RZCC 5D72L 1AFVH 5BQ7B 5ISZA 2O5YH 1F5WA 4ZZKA 3MRQA 1ZLVH 5MHSE 4OM0H 2EIJB 4HZLB 4RVBA 1OGAB 3NPZB 2O6EA 3MZTA 3D39A 5EF1A 1QFUL 2BVOA 5HDOA 2YRZA 5HI3D 4R4FL 5DMGC 2IV9A 4D2NA 2C3VB 2CKBA 3X3FH 2ZYIA 2NRDA 4I3RH 4OBSA 2B3IA 3S35L 4EN3B 3VI4F 2J8OA 1BZ8A 2Z0BA 2LLNA 1L9NA 1MF2L 1WE5A 3L3GA 5IMKB 4PRPE 2ZT9C 1FNEA 1BFOA 2R56H 5J3HC 3ARED 3QFJD 4GP5B 4KDVA 1FG2A 1RPUA 4NP9A 1DUZA 2F54E 5I8KH 2JCCB 3F04A 4HHWA 2OSXA 1BQKA 1OTUD 2X3AA 3N3EA 2R7EA 5CD5C 4EJ1C 1WWAX 1KFGA 4PRIE 2CXGA 3JWOH 3PUUA 4TKWA 1SUHA 1PG7H 4PLKD 2UZYB 4I1RA 2YGNA 3S8GB 3F05A 2TAAA 3BEVB 3V5DB 5T5FH 3CBRA 3LNEA 2F74B 1A3RL 1R17A 1UC6A 3IU3B 4U3HA 4LVOC 4LLWB 3GBMH 3C6SA 3ME0A 3PV7A 5IWLA 1QI3A 5ITBL 1W0WB 4PEEA 3HG1A 4NQQA 3UDWA 3HLAA 5HDRA 3HUJB 3NSFA 5TGBB 3X11B 4CKVX 1CD1B 3LYRA 3QUMA 1CFQA 2HLFC 4HC1L 1THCA 2A38A 2OMUA 3D3VA 4GKSB 4ONFH 4U3CA 5A2FA 2W60A 4H8PA 4BSVA 4QYAA 4OCYL 5A3ID 1UATA 3IU4H 4WHTB 5J57B 5GRUL 3V5DA 1YECH 1W15A 2AABL 2D3JA 1DEDA 4HIEA 4HIIB 3G5VB 3CQPA 4R96B 3B1UA 1X6NA 4QJ3B 3O9WA 2FWOB 3SODB 2PABA 5DUML 5JMOC 3OZ9L 3OQRA 4H0HB 4ZX3A 5JIMA 1DJYA 5E8PA 3SDCA 4OKVA 1MEXH 4FJYA 3B1TA 3BPOC 4G9DA 3S2AA 1PZUB 1B3IA 4PJEE 2CKBB 4BD4A 4NWTL 3EZJB 1MNUH 2X4RA 3VQLA 5FYJU 3P0YL 3E1F1 3DHPA 2MKLC 5L2KD 3AUVA 2FWOA 1KXVC 3D4YA 1USZA 4FFYL 2HSIA 4JZJC 4UINH 4AM0Q 2W59A 3VU2A 4E5XA 2X28A 4XH2A 1E5UI 3EO1A 1H5BB 5T1LB 4ZX4A 2BY1A 2A1WL 5I15L 3ARFC 4HWEL 4YDJB 5IESH 3SGKC 1MJ8L 2VZ1A 3BWZA 1NMBL 2EE6A 3U0TA 2X1XR 3EG9A 4W9IC 1OY3B 5GJSL 3FFCD 1BZOA 1I1AD 2BSTB 4KVNL 4JRYD 1JK8A 4N2FA 5EFIB 5ID0A 1MW2A 3A3YB 3SPVB 3MLZL 5CFAA 1XZ0A 4M7KL 5LNGA 1MCWM 4JPWH 1JGEA 1LNUB 5I9QC 4MJ4A 5I0ZA 1CLOL 1P9MC 5D1QC 6TAAA 3PDGA 4LCYA 3SCMC 4FKKA 2VLJB 1G0DA 2VQ4A 2FL5B 2HRPL 4MASA 1U8IA 2FX7L 3JVFC 3F7KA 3RVWD 4XXDA 2FT7A 3KWWA 5FO9A 3BMWA 4EUPG 4JDTL 3V4PH 2PTTA 4YWGH 3TV3H 4HOZA 3VACA 4KX7A 4N0YL 4F1SA 4ZSOB 4GAGL 3REVB 1F18A 5GRWA 3HKZA 5I1EH 3BT2L 2EDHA 2QPUA 3B5TA 3GMMB 3LD8C 2VERA 4WNJA 1NPJA 4F2EA 3BH9A 2B1AL 5F89B 5J13C 1KB5L 1X5XA 4LDCA 1HHIA 4K3HA 4G8GE 1F0LA 1FVEA 1JF1A 1JNLH 3RU8L 5KYXA 5FF6A 3MODH 2AK4E 4NCC2 1KT2A 2OMTB 1J8HD 3VXSB 1U41A 4AJVA 3LDBB 5FPIA 3HFML 3TBWA 3HFFA 1OAKH 4I2XB 1LE9B 4V2BA 4ZUWA 5F7WC 1JI1A 2R4SH 4GO9A 4DNLA 2CMRL 1N26A 2AEOA 3CFDB 2EDYA 4GXUM 4RIRA 3VFVB 3TF7C 1OTTC 5TPWH 1FI8C 4FLSA 1HIML 4AL8L 2AK4A 4HS3B 1IBDA 3UG5A 1WAAF 2V4LA 4P2RA 2F19H 2EXYC 3DTXA 4MZRA 3TBWB 4WI6A 2JNZA 1T6VN 3RWHB 1YY9C 3I3EA 2CR3A 3GINA 3CLWA 1RIHH 1OM9A 5CFHA 2HFEB 1YYLH 4ZOAA 3K4ZA 1R0AL 3CUPB 4ZTOH 3EFDL 3O11B 4LPXA 1KIQA 4NFDA 4YXLH 4H2CA 2PYEB 4HJGA 1MFEL 4FQLH 3ULUE 4WFEE 3VB9A 1DDTA 1OW0A 5IVNA 1JPTH 4MD5A 4P49A 1B3JA 1J05B 3ELQA 3MJ8B 4LKXA 2WUBH 4XN2A 2EC9U 3FOLA 5HGBB 1C12A 1T1YB 1HT6A 3MACL 4U6XB 2ZCLL 3RTLA 1PX3A 2GB2A 1R75A 3ZR5A 1YQVL 2J8UA 1OAZH 3ES6B 4H20L 4YK4C 1AANA 1SJMA 5LCVA 2WKOA 4P2QD 25C8H 1S9VA 2FUTA 5C07A 1BAWA 1L5GB 4F7PB 1KLFA 3CXDL 3VD9A 4Y2DC 4L18A 2FLBT 1M7XA 2AEQH 1BGXH 3WE1A 4U1HA 4PJAF 3ULVE 1NGPH 5MI0B 3RVWC 5C0JB 3MDJA 2XBTA 4N2LA 3O0RH 4K73A 2VLLA 4PD4K 1I8IB 4LESA 2EILB 1GGUA 2K3TA 1EAPA 1HNGA 2OMXB 3T4AB 3SDYH 2H6UA 2JXMB 1WGOA 4PHZA 3ULAB 4O5LL 4NIYE 4RZKA 4U1LB 1L9MA 3PGCA 1PGRB 4PRPA 2VQUA 4NKMA 1DJHA 3SDCD 2Z35B 4NQCA 1NCHA 1NGXA 3CSTA 4UNTA 1ZDQA 5F7NC 3DOHA 4CSZA 2NYYC 1BQHA 4PFEA 1WG3A 2J4WH 1H0DA 3TXAA 2BO0A 3QISA 3DYMA 3QUXC 4N1EA 5HDBE 4NUGH 2X05A 4X6EA 1QG3A 2NX5E 5ICYA 1EDQA 3FDWA 3TCLB 4D0BA 1IIKA 3VH8G 5HDBB 4GUCA 2PW1B 4BFKA 4A2GA 2Q86B 2GDUA 2CALA 4DN4L 2A9BA 2XPGB 5IESL 4YXKH 4S10A 3TF4A 1HHIB 1P6WA 5EIVA 5JOPD 3FSZA 5IV2A 3MV8E 3MGTB 1IAIM 1AQKH 3LIZH 3QXAB 2BLFA 1SOQA 3DSFL 2GK2A 3O4LD 4H0LC 4ONGH 3DX1A 4YVUA 3GBNL 5DO8A 2ZOKA 2QV2A 2EH7L 5GGRB 5BS0A 4JRYA 2Q0ZX 5ABDE 4R2GC 4RLDA 4HYTB 1DJXA 3BYTA 1FGNL 5GIRB 2Q3ZA 2AGJH 3TA3D 4HIIA 1ETZA 4X7TB 4IOFC 3MROA 1FNSL 3HG1E 4ES9A 3QDME 5L4JA 1ZPLA 3W5NA 4LFHD 5KVGL 3GSNH 3GI9H 3BP4A 3BLKA 3M46A 4MAZA 4U1IB 4Q56A 1IC7L 1EQWA 4L4TA 2QKIA 4XNQB 2WXJA 3VYPA 4AQAA 1UM5L 1A7BA 4OIFA 1FNAA 1NEPA 2GK0B 2M1KA 1TR7A 3EFFB 4KI5F 3T77B 2UV3A 3K8LA 5D2NC 4G70B 5DLLA 1YN6B 1QRNE 3PNWA 3JQOB 4KKBC 3N9GH 1B0RA 2GTWA 2R56L 4QYOB 4ERSH 2BJMH 4QNPE 5EU6E 2CDGB 4U1IA 3LKOA 3WO4B 1DZ0A 3BZDA 1NMBH 2B59B 4Z78B 2AEWA 4LIQE 4M02A 2FWUA 2Z1PA 3VXSE 1OP4A 1AGFA 2P46B 1NIAA 1NCAL 4EN2A 3SGJA 5D4JA 4M9PA 1PTZA 5ETUA 2V9TA 5T5FL 4G8GB 1YA5A 5T1MA 4J12A 5EUOB 3D0LA 4EI5B 4M6NL 4KROC 1FV1A 3TNMB 3KDPB 2XZAL 5CXPA 2XWEA 1S7QA 4GKZB 4OFPA 3LDBC 3CZEA 3KD4A 4JGJA 3MRHA 1FYTE 4JO2L 1W8NA 1I8LA 4FFYA 3V52L 2VWEC 3QSKB 5EB9A 3B2UC 4P2QB 3UADA 4JFYB 4D3CH 2IH3A 2IQAA 3C60A 3VGAB 4XBGB 5EUKA 5HDQL 2R23A 4AKOA 3MV8A 3FRPG 3KL3A 1BVLA 1A6WH 1A4KB 3OKEB 3U4EB 1N9PA 5I1GH 3X14A 1E2VA 1WWBX 5AOMA 3CSPA 2R0ZH 5E8DL 3RDTB 4M43H 1VPOL 1KN4L 4M7LT 4J3OF 1YJDH 3NCBB 2D3NA 4AC2A 5FKPA 4MSWA 1XFPA 2VXQA 1RV6X 4AIXA 1WFNA 2VR4A 2FH6A 2P52A 4PS4L 5KBNC 2P48B 3PWPA 3TO4D 4R8WH 2WN2A 2ZCLH 3F6IA 4PJDF 4IIQA 4M8QB 1D9KA 1ICTA 2UYLB 5KJRH 2Q76B 4ABVA 1LD9B 3O2DH 2VISB 2BHFA 2NY5L 3U1SH 5IVOA 1FHGA 2JJTC 4M9OA 4FI7A 3FPYA 3K6OA 4EDWL 4HALA 3WFBL 2CH8A 3FT3B 5LCVH 4RZCA 5KBLA 2D7OA 1CWVA 4KHTH 4RIRB 5E70A 3HMXL 3VFGL 2FHCA 1EERB 3BN9C 4WGVB 3ZE2F 3NSDA 4FQPA 4NC1C 4FDWA 5C0JA 2P5EE 3D6GA 3HG3A 3QIBC 2Q5BA 3A4AA 1M9WA 3ZJAA 4X6CE 4MAUH 3O4LB 2BVQB 5HHXH 4O5LH 1RULH 2ZCHL 3BXNB 3IT8D 3VE0B 2MPVA 4B53A 1SY6A 3AMLA 4TULL 5KYYA 1T1XB 1KTRL 4X6FB 1QLRB 4HUWB 2VDQH 5DEFA 3ARGD 2ZXQA 2VXUH 3LVTA 4FHBD 4Y1AB 2HVJA 1PLGL 4KZEL 3US1A 1RHHB 2QBWA 1PS3A 3TC9A 5E4EC 2SEBA 5FYJL 1EUUA 4L4VE 1A1OB 1ADQH 1QEWB 1QSED 2BDNH 5HI3C 3T0XA 4JRXE 4NCC1 3U4AA 4MNGB 3LY6A 2Z8WC 1ZOXA 1YMHB 2IH1B 25C8L 3HZKA 5SX4H 4DO4A 4F3FA 1WFTA 1FZOB 1HHHB 1N64H 2BFVL 4MNQB 3V6OE 5TF1H 4HH9A 4P06A 4GP8B 4Z7UB 2WLNA 1AZZC 1OT2A 2I5YL 3GSQA 4MAUL 1NBVL 3BUDA 3BPLC 4CMHB 3KL5A 1XTMA 4NRYB 5KBKA 3RIKA 1GIGH 5BPPA 3BWUC 3T4YA 2X53A 3H53A 3M7OA 1ZIBA 3ARSA 3CZNA 4JQXC 3WTTA 5D7SH 1GPOL 1TTBA 2DQEL 1A4JB 2XWZA 4YSEA 4XVJL 5DZVA 1TTFA 4XPFH 5GHWL 3MQIA 3P4MA 2G2RA 2BP3A 2XYCA 3CZUB 3S37X 1P7QB 1A7PH 1X5LA 2OTUA 4FQIL 1TDQA 1U8JB 5TPWL 1QW8A 1N7ML 1CR9H 5LBSL 4FFZA 4P4KB 3PV6A 1QLEH 3GB7A 4WKXA 3W9DB 2BWDA 5HVHB 3M1CA 2VDPB 5DJYB 3N1MC 5FHAL 1U8OA 3JWNG 1BX2B 4DKFH 3VDCA 3QDJB 2COVD 3JWOC 3QYNA 4OR1A 4EUPH 4Z7VA 4EDXB 3SIKA 2BINA 1JS4A 2I9LA 1PY4A 3KS0J 5JIKA 1SMDA 3BE1H 4ZTEA 3F7PC 4QJ4B 1KXQE 3QYCA 3ZTNL 3K6IA 2A1WH 1XMWA 1EXUB 5CR1A 5I15H 3F12A 4O2FB 3BUQA 4WU7B 3D0AA 3ULVH 5E6IA 2VOTA 5CIPA 1DR9A 2G60H 4O2CA 1CYGA 4G2AA 5DXWA 1CLZL 1XZ0B 2RALA 4OY9A 3ATAA 2X4QA 2R8SH 2J2ZA 3WN6A 2HPOA 3HZMA 5I1DA 3T0EA 3QHFL 1MRCL 4G6FD 4JY5H 4W70A 5C8JA 3LH2L 2AJSH 4X5PA 1HI6A 3RPIB 4I7ZC 5T1KA 1HEJC 3FONB 4TNEA 5MP6H 1Y0LA 5F21B 5DQJB 4C83B 3TPKA 1OCCB 3GXIA 3TPUB 2K45A 4IOSD 4N9OB 5FUOL 3K8KA 5CJ5A 3ET9F 3EH2A 2PWEA 3GM0A 3V5HB 3LS5H 3K80A 5JHDA 1RU9L 5B21A 2F74A 4YH6A 4GJTB 2CLVB 5C6TH 4HWBH 1R3LB 3GMMA 4OW6A 5J7CC 3SPGA 3V8CA 3E8UH 3OB8A 4G7VH 4WEBH 1W16A 3P2BA 4HDIB 5ENWA 1QWUA 4FQHB 2E46A 1FL5B 4W9KC 4J6IA 1I3RB 2BNQB 3O4OC 1EHXA 4AYFA 1P5UC 5IB1B 3SBPA 1P1ZA 4DKEH 1XAKA 5D9SB 1Z5YD 4X5XB 1BFTA 2XDHA 1FDLH 4FKEA 1C1EH 5FA3A 1A7OH 4K2UL 4PCSA 5IMKA 4WDIA 2UY6A 3HVDA 4RCAA 1KGWA 1R6VA 5E8NA 2UYLA 3EDJA 5IKCB 1F4XH 1FSKC 5EEVA 4ZQKA 4L8DB 3L6FA 1Z66A 3HC0A 5KVDE 1KFAH 1QO3B 3IJEB 3KYMA 4RA0C 4EI6B 4C4BA 2NUPB 1IGMH 5EBGA 3V9EA 4BQCA 4AEHL 4YX2H 5JYMA 2EH7H 1Z9PA 3T3PF 2D31B 4APQD 3DIVA 4OM1L 3C6LA 1DEEA 4JO8A 4N2OA 3SDDC 1L3WA 4YIQB 3BYYA 1BQ5A 2Q6WA 5EMYA 1H15A 3UTZA 3L6FB 3H9SA 5T1JA 3D4ZA 4BELD 4JDZA 2A6IA 2EEAA 3ARGA 1H5BA 1G7MB 3L4XA 2WXKA 4K3DH 5GRZA 3UL4A 2WZ0A 3A24A 3KWVA 5TK2A 1OAUH 1IC7H 1NJ9A 1FN4A 1KTKE 2CCVA 1YYCA 4XP6L 3ESOA 4E2OA 3GUTA 3KLKA 1BQRA 1A66A 1I7ZA 1XF4A 3NP3A 4HC1H 3D69B 2Z6FA 5CJBA 2VLME 3LZNA 2GFBA 3DO4A 4Y4HA 3A0OA 1S7RB 3AY4A 3FQ2A 5E5MB 3QZOA 1IBBA 2JQMA 1ZHNB 2H1LM 3WKML 3I6LE 3IXTA 3FU6A 4OAWB 2ZSVB 5DRWB 3LZPA 5CN1A 3O81A 1YAIA 1NGQH 2WCPA 3FN0L 4POZD 1XGRA 2FBJL 4R7DB 4WKZA 1GGYA 3QPXH 1V3MA 4WI0A 1LK2B 4FP8L 1E27A 4OBRA 3S4SG 4J5VA 2GIYA 1QKZL 1PDKB 3ZK0A 5DO2C 4AM0A 4PBDA 1ZVHA 4K9EC 4P57B 5GRJL 4EQ3A 1QAWA 4LU5H 1L4IA 3EZ8A 4GKLA 5D1QD 1DVYA 1YEEH 5DQJA 4C83A 4Z7WB 1F4HA 1E7UA 1R4XA 2OTWB 3CHRA 4U1JA 3WEXB 1XIWC 2QQQA 3X1BA 5DJ2A 3WNIA 1FFOB 3UC0H 4K8RH 5ICXB 4ZUUB 3MV7E 4R26L 3BGMA 1NICA 3C60D 2EEBA 4HKZB 2CO6B 4AZ8A 1I1RA 3POCA 3QIWC 1MRDL 4XOCA 5B3JE 2OMWA 2DM7A 1QBBA 4W9EC 5ITFA 3DX2A 4FA7B 1AR1C 1SJVA 1SJHB 1N67A 1ID2A 3AQYA 3BSZL 4P46A 2DQHH 3L4TA 3IFPB 3R0MA 5HYQA 4H26A 5DRNB 5DZJA 2ENSA 1OARL 2P5WB 1WC7A 1H3PL 3IJ8A 3CFTA 2JJUA 3TN0A 2I24N 3R4RA 4A7TA 4HJEA 5H37A 5AWNH 4LDOB 3PAUA 1MFDH 2WYIA 4U6VH 4XCCH 3FUMA 1BVNP 4O02A 3QZBA 4ANVA 1Z9LA 3B83A 4NRZA 2EUWA 3HNSL 2D9CA 5ECGA 3F00A 2BS9A 5C9KA 3RWEA 1LWHA 4NQCE 4U0RB 1L6XA 1GC1H 4FQCH 1CXHA 2YXFA 2OK0H 4IKNA 4ZUVA 4RGNB 5C1MB 3HHSB 4JZNB 1VKXA 3S36H 1OAXH 3V4VB 3D3VD 2DKUA 1FIGH 2G3ZA 2FJFB 1XF1A 2X12A 2CLRA 1NH6A 1VLXA 1NGWA 2LE9A 2N4IA 3QYMA 3KXFD 5DJZB 3M45A 1R3IL 2WLJA 4IK7A 5I1LB 5JOEA 2UXVA 2VW4A 4XZUA 3H56A 4MCMA 2P8LA 5EOTB 3RWDA 2JJVA 4LHQB 5DS2A 3W57A 4N8VG 4DZ8A 3VI3A 2ODHA 5FO2A 1HINH 1WO2A 4PWFA 3BVNA 4MBOA 1IC5L 3ABLB 2Y24A 1PG7W 3FRPA 2VDOB 3WIHH 4IOFD 3BW9B 2R9HD 1A2YB 2VN5A 1MFDL 4U6VL 3L5XL 1F02I 1TU2A 4P48A 3MRKA 4LQ1A 4JO4H 3HHSA 4HUUB 4ZW7A 4MHHG 4X9IA 4XPAH 2CLRB 4Y1SA 4AC4A 1N0LB 4UCFA 3EJPA 4XP5L 4KKAC 2GCYA 2QSCL 3B8SA 2AQNA 3VI3E 2XWJA 1DQLH 4UQ2B 4PJGF 3H3PH 3C5ZB 4PRHA 4MDJA 1JI2A 3HAEG 4ZUSA 1SYSB 5F1OB 3QHZL 4QXGL 1CN4A 3GJFB 1U8KA 5DFVC 5IOKA 4JRXB 3SYPA 2X88A 2IQAB 5I1AA 4BZ2A 1JTPA 1RZGA 2Z91B 2VR8A 1BHGA 3BFOA 4KDWA 3UPRB 2VLJD 4G80B 4HMCA 5DQ9B 5EBWB 1IBGH 2JCCF 4Z7IA 3FFCA 4LF3A 4YDLC 1MW3A 2QVTA 3MMEB 1PD6A 4XOBA 3DKHA 3TIDA 4MXVE 3M1OA 5F7UA 5MEQB 4JDVB 1OP3H 2FL5A 2WJ7A 1ZLSL 3WL9B 3H1ZA 3KWWB 3LTVA 5FO9B 4KZCA 4HOWA 4HS3A 3AREB 3GJFK 4F9LC 4XMUA 5C09D 4B9PA 1QSEE 1VFMA 2ZXAA 3DK0A 4L3EE 5I1IH 1DQQB 1O9ZA 2YRPA 4JVWA 5GGSY 3MUHL 2CM5A 1DQJA 2XZZA 1NCWH 4WW1B 4FJZA 5E4OA 5DURD 5HGGS 5D7LE 4PJ9C 3VMPA 3WLBB 4P5SA 1QEXA 2P24A 5DD5H 3HI5L 5F0PB 2NUTA 3NDZE 4RMUA 3LRKA 2FECI 3UTSD 1PZAA 3HC2A 5I1CH 1TZHA 4Q6YA 1S3KH 3BZFA 3FU7B 3QFGA 5J6GA 4UQBA 1HXKA 4PJXA 5ALBH 1AQMA 4LSUL 3GBLA 4KQ4H 4XNQA 3LEYH 5FDWB 2B1AH 2CG9X 2PCPB 3H6JA 3L1FA 3X14B 4M1CC 1FO0B 2YZ1A 3DPBB 1A9BA 4LCCA 4JKPH 1AHMA 3KYKL 1NBZB 2FJGA 3CFJA 2FQGA 1EXGA 3X12A 2X89A 1I8UA 1G1YA 1CE6A 1I1FB 3NN8B 3MBEB 3KL0A 5E1AB 4JCWA 1FHNA 1QFWH 3UTOA 3DV4B 4G8FB 1D3CA 5HHPB 5MP6L 1AVAA 3GSVB 3MYJA 2GBVA 4NGHH 2JWYA 5F0JB 5ELIA 5EO0B 4AOFA 2IPTL 4I85A 2Y7MA 4QTHB 4ZG1A 1ZHKB 1NBZA 3D9AH 1JZ6A 3D69A 3OWEA 1W0YT 3TCXA 4PJ5E 3MBEA 5A16B 3IDMB 5DUPL 2R0WH 2ILLA 2AQSA 5KOMC 2MCPL 1FGNH 4L1HA 3QCTH 2DM3A 5D6DA 3E8UL 3EYVB 3JWNH 1H3UA 4FMVA 2Y1AA 5B1KA 1K5WA 5E00B 1WJ3A 4CW1B 4FMFA 5EC2A 4YHZL 1Y6NR 3K5RA 5GJTL 1ORSA 2H0EA 3SBWC 3ZTEA 5B8CB 3FTUA 3NCXA 3ZTCC 1KBGL 2XQBL 3ARGC 3BD5A 4P5TA 4PPTA 1YNTB 4YUEH 3TZVC 3WBDA 4JPIA 5IW1B 3TN0D 1NLBL 4WW1A 3MNWB 4U0QB 5DC2A 4PW9A 2FYVA 1OIOA 4BUQA 1G6RH 3FT1A 5DJ6A 2HFFB 3OGCB 4F80A 5I24A 4KDTA 4N20A 5IB5B 4AGNA 5FUCE 4OD3H 4UV7L 4QTIL 4RGMC 3VRJA 5DHYA 2C9VA 2WBJA 4GW5A 1XH3A 4LSPL 3SBRA 3SDCB 1YDPB 4YSQA 1DHKA 3UTQA 4NNYA 5CEZL 2X4PA 1SM3L 4BZ2H 1E9OB 9PCYA 2VLLB 1L3NA 3NRQA 4XX5A 5T1MB 2OQJB 2EE9A 1ETZB 2GBUA 1NGWB 1TENA 4XAKD 3RHWF 3WNPA 5C6PB 5FUCC 1UQSB 2VZOA 2XQYA 2V9UA 2WXGA 5TH2B 2Z7WA 4NKOA 2BW4A 2VKWA 4OB5H 1ZA6B 4R4BA 2QMKA 3GSNB 1XF3A 3V10A 2W1NA 3BESR 1JXJA 4FEIA 5HGDB 2E6PA 2D7QA 3FUEA 3MOQA 1AKPA 1RIUL 4PCTA 3L4WA 3LZQA 3Q8AA 3FF7A 4FLQA 1DUYB 2XJKA 3NACH 4LOVA 3ZE2E 4QRRA 1EZUA 4YHPA 2JF1A 3IBOA 2MNUA 4N90E 4K7FA 4CBPA 5BVJA 1IT9L 2HVKB 5E2VH 4CSPA 3MRKB 2VLKA 1AOZA 2Q7YB 2KUTA 4JGNA 2J4WL 1GSKA 1C5BL 3HZMB 4MVBC 4NT6A 4K23H 3TJHD 3U82B 3NFSH 4XBPB 1E3XA 2WO2B 4YNYB 4HS8L 5E8EB 3FUJA 2WTPA 2RB8A 3D85A 1ZPUA 3WIFB 1ZY9A 3UMTA 1QFUH 4ZTPH 3V9CA 1A4AA 5I5IA 1JVLA 4F92B 4CA4A 4L5FH 2ALAA 4M62H 2Y5TA 1Z2KA 1MCJA 2YGOA 4QRSB 2YD5A 2AV7B 3UPAA 3T4AA 5E8EA 4K0OA 3WY2A 1PZ2A 4XZUB 3MKKA 5FUZH 2XKUA 2GC7C 3TYFB 1HQRB 1JRHL 2YAHA 2R2CA 3O3BB 3V4VL 2CPUA 3DARA 4GRLB 2JV6A 5E0FA 3RAJH 2NZ9C 2ZPKL 4YGVB 5IF0A 4NC2B 2EDFA 1MQKL 1DVFD 1TQCC 3FZUC 1OSYA 3MGOA 4HUCA 4JFDB 1V05A 3E7JA 1CGWA 3W2DL 5HGBA 5HYFA 5EZIL 2QGCA 4HIHB 2C4FT 3FULA 3DOSB 4TSBL 1UACL 1JTOA 3RP1A 5DSCB 5K59E 1UYWH 2VXVL 2YSTA 4LMQI 4L5FE 4PRDA 3VG0L 2EXWD 4YPJA 4UQCA 3KJ4B 1Z9OA 4LSSH 4FFZH 3F7QA 4D7BA 3V0VB 1MUJB 3L3OB 2JVUA 2P8PB 5D1XA 5GISL 3I6GB 2PXYA 3MSPA 1OTSC 1JRHH 1Q4NX 2NLJB 2P1YA 1KC5L 3DX0A 4MXQD 4X0KA 2AK4B 1RP9A 3ARXA 2Z7YA 5DJCB 3STLA 5C86A 3HW7A 1AE6L 2WWMC 5I6NA 4YPGB 5EZOL 2XZCH 4Z7UF 4U1GC 3CZLA 3VFRA 4DFIA 4NLHA 4EMZA 2EDJA 3RG1C 2PPDA 4H8UA 2WQAA 4XI5C 1J5HA 2H32H 1E67A 1E3FA 1BBDL 1SHMA 4ZSOE 2VLRE 3QQ9C 4YO0B 4GFXA 4MJ6B 1OTUC 3B3IB 5FF6B 4X8JA 1DDHA 1SXNA 1GAFL 2FZ3B 5B4MD 2EUXA 3WNLA 2VO5A 2ZUWA 5AVQB 2VLKE 3MV8D 3VD2A 2WMPA 3QZMA 4YHNA 4HK3J 2G0LA 4W4OA 3D4GA 2WSDA 3AWFA 1FBIL 4D8OA 1U2HA 4HWZB 4OAWA 3FBQA 5JR1H 1KWKA 3LPWA 3T8XB 1GR7A 1HSAA 2CQVA 3T3MB 2V17H 2E59A 4FNRA 1L0QA 3TEXA 2PYED 5I1GL 3BJ91 3WE6A 1UT1A 3BVUA 5CHNA 5KS9B 1PEWA 4XO4A 3L4VA 4XO9A 2B39A 1M7DA 1NLDL 2B4CL 1ZK9A 3E6FB 1A1MA 3EJRA 2B14A 1NC2B 4Q9RL 3VXUA 3WTXA 2BIPA 2I9TA 5JHBA 1EGJH 3CN3A 3QG6B 3EH5B 5AOIA 1E5AA 2CGYA 4NJ9H 2CR0A 2HG5B 5DJ0A 3QCUH 4HJUA 4X80H 3TNMA 2AAAA 5ECJE 1HYRC 4PD4J 4R8WL 4URTB 1XEUA 2BMKB 2VISA 3IMUA 4JFEA 3RB5A 3UZQB 3VGAC 2CU9A 1P2CA 2XCMC 4F7CA 5GRJH 4JO3L 1NBYA 2VIRA 3FU8A 4FQ1L 3U1SL 4PIBA 1S7WA 1FFOA 2GSIA 3OX8A 3HEIB 4ZXBA 4WFGE 1E4KA 4A6YL 1EZVX 2CGRL 4DUVA 1UEYA 5I1HH 2YBRA 3CFMA 5D71H 4JZJB 4RQQB 3CHOA 1XL6A 3QFJB 1J8HB 2ADGB 3VXSD 4XNXL 2ZD0A 3V6BR 4PJEB 4M7JH 1N4XL 1HCYA 4ZQKB 1UTDA 2ZF9A 2W9DH 3RPIA 2BXYA 2IAMA 3CZGA 4UT7L 5F1NA 3VXNB 1IILE 2IPUK 3AREC 4DPCX 5I73C 4P99A 5K39B 1QFHA 2ITDA 4UT6L 1J8SA 5FGCB 1P53A 4GFTB 2OXHB 4LPWA 4N28A 1E2WA 2YWZA 4J3BA 5CGYC 4YUEL 2J6EH 4NPYA 4EI6A 4Y7MA 3LQAC 1BOGA 5BRPA 4LSTH 3UCQA 5EDXA 2AGJL 1C16A 3VRIB 4HEPG 5DD1L 4PLKC 2YD7A 1RPKA 1EEYB 5I6MA 3KH4A 4ANXA 2HJFB 3WV0A 3V6OA 4W9ZA 2ITEA 4M4RA 3C60C 1JK9B 4LSPH 5AW2B 1RK1A 3BLPX 5C6TL 4S1RH 3BRFA 4XNXH 5DZLA 1SHSA 5E5UB 4HPOL 1RPQA 4ZI8A 3D87B 2NNFA 5LNEA 1QHQA 3HBZA 2YD8A 4M03A 3QEQA 3ZQXA 5KYUB 1KCWA 5GRXG 1LO2L 2A74A 4I5BA 4G7RB 3JTBA 3QIUB 4FG0A 3UPCA 4HUXA 3DA0A 1QQDB 5JXAL 1ZLUK 2F5BH 2Y72A 2WLHA 3REWA 2ZP0T 1KY7A 1U92B 2VGLM 1DSWA 3MRNA 2F54D 5IB4A 3HOGA 3LKOB 4UDUA 1P7QA 2GHZA 2IO5A 2VJ0A 4IBLT 4X6CA 2J7LA 3KYMB 4P23C 1OP5K 4LEXH 5FWQA 1KDIA 1T2XA 3NH7H 1T1ZA 1QA9A 2HXAA 4MMXB 5CZKA 3OM3B 2BIHA 3I2CL 5FO7A 4FFVD 4IMKC 1OCWL 1IIIA 1AY1L 2O6FA 3D07A 3MNVA 5KTEL 1Z9MA 2VR9A 3I9AA 3W0WB 2IALB 3MROB 5DD0H 5I5RA 3CVBA 1FNGB 3IWUA 4OKVB 3BPOB 1G6RA 4YFEA 1MI5A 1SYVB 4HK0B 2BVUA 1I8IA 4X0NA 4M6MH 2KBGA 1J1XH 3I74A 2HTKD 2ZXEB 2DWTA 1XB8A 4WWKB 2ZIDA 3F12B 1NIEA 3QORC 4NQVB 4DKDC 1NC2A 5EBWA 5L8KB 2R1YB 3EJJX 4P3CL 5I5MA 1XGQB 4HSAC 1PCSA 4CC4A 2BHUA 1HYSD 3QUZC 2IGFH 2ROYA 2R27A 1VSCA 5CR8A 5I2IA 5A2JH 4IBTA 3SPIA 4CU6A 2FQDA 3GSXA 3EYQC 5DK2B 3MRMA 1AO7D 2KPNA 4RFOH 3MLWH 3B7TA 2YD3A 3P77A 2ENQA 5SX5H 5B3JF 3K71B 2NW2B 1VEOA 4JHWH 3NCEB 5FFOA 5TGBA 3RUGB 5I17B 1G84A 2QT6A 3K8MA 2R8SL 1J5DA 5CGYD 2HKHH 1RUAL 3GB7B 3NIGB 4PJXF 3SO3B 4HLZG 3ZKXC 1E90A 2B9BA 3ZKQD 4A67A 3ARUA 2GCYB 3AMKA 4LARH 2UUDH 4NNPH 4XOAA 1BBJA 5DRXB 2ZKWA 4UBDD 2VWEE 5FYJD 3BEWB 1EEZB 2WLLA 3MCYA 1OGAE 1THAA 4ZFGL 1RJYA 3A67L 2ZG3A 2X44D 2X6UA 1OANA 1O7VA 1YO4A 3FQXA 4U6HA 4OZGA 4APQB 1HXMB 1X9RA 2W92A 1EXUA 4AGLA 1U4FA 4HS6A 4G5ZH 4J3SA 1SUJA 1DCEA 1Z0MA 2OMVA 1U6AH 5SX5K 1OB1A 3A6OA 5ICXA 3B2VH 4QWWC 3IKCA 1AQDA 4FNSA 2OTPA 4FQIH 3HPLB 4O9HL 4Y4FB 2NY5C 1BBJB 2XN9D 5DRXA 5IM7B 2Y7SA 2QMJA 1LP9A 1JDCA 4PJ7A 1WEJH 1F4YH 2BVOB 5DRZB 4ATTA 6CGTA 3VE0A 2GJJA 3F5WA 4PI2A 1FO0L 3QUML 4XHJD 5LDUA 1XR9B 3U1QA 4PJ9D 1J05A 3SYCA 4W9JC 3V5KB 3HNVH 1IEBB 3DGDA 4Y19D 5HYQB 2DQ6A 3FOLB 1FZMB 3R0NA 4MCZA 4Y88A 4JHUA 3P40A 1XGQA 5GS0C 3C5ZC 1LO0H 4J3UA 2UZPA 4QGYA 2WGXA 3EBGA 5FM5M 3IRCA 1EO5A 2CCWA 3PAZA 3QUXD 4YFLF 2V7NA 2X9YA 3F5WB 5TQ0L 4B60A 5EDSA 4I1PA 3GBDA 4Q14A 5C0GB 1T21A 4ZMPA 4XXDB 3D18B 1T7XA 4IYKA 5IJCC 3FB7A 4UAHA 2IXQB 1XH2A 1CXEA 4O9HH 4QCIA 1IVLA 3HTLX 2VDML 5A7EA 4Z3EA 5K9QG 3IAQA 5LXGH 3K2MC 1HZLA 4HIJA 2H2SC 5JA8B 4G83A 4F2FA 4NRYA 1TETH 3GUTB 3HAEB 3LEXA 5I66B 5JZ7D 1MCWW 2IWFA 4DETA 1HYSC 3L3HB 5KBDA 3SGDI 3D18A 3HRZA 1WRFA 3MV9D 3UFIA 2ZSWA 5IQ9B 4XHQA 4EIGB 1BMZA 3GK8L 2WIMA 3CC5A 3O2VL 5KSUA 1F11A 2M26A 1CVRA 2YXMA 3QW9A 3P9LB 4M93C 4RX4D 5CBAB 3LV3B 3MO1A 1P69B 2CO2A 3FCTA 3RKDC 3FU3A 1KB5B 3V0JA 3BKJH 3EG9B 4IRJC 1FC2D 3SCMA 3U36A 2Y07H 5BRZD 3WKMH 3H3KA 4QTIH 3EO9L 5F7HA 1IFHL 3OLIA 2NYKA 3QJRB 5JHLA 3JTTA 3UMNA 3TN0B 4EKXA 5D6CA 3CMOH 1TFPA 4NQEE 3NIDE 4YLCA 5D1ZI 2WZPD 4LPUA 3OVUB 5E6RB 3EBAA 1U2YA 2R4RH 3VFSB 3TURA 1T1WB 3RVTC 3D33A 4YDLB 1QKZH 3QG7H 3K5SA 3VWJD 5HXMA 4Z3TA 2OPCA 2VE6B 4KY1H 5ADPH 1S7XB 1JJUA 1U3YA 3DX6A 4I1NB 1IM9A 4MCNA 3BZ5A 5H37G 1I9IL 4DAGH 5DA4A 1AZUA 1ZJAA 2FX7H 1D7FA 2R1WB 2CUAA 1UD3A 3KBFA 2JIXD 3D5OF 1OCWH 1FJ1A 3GGWB 2VLRA 1H6TA 1QPPA 1A8JH 3RZWA 2I9TB 1VADB 4ADGA 4ELMB 1A25A 5JOFB 2VE6A 4HBCH 3KGUA 1TTGA 2IWEA 3D3VB 4GKSA 1TLMA 3OLDA 5I6XC 5ICZA 4HPOH 3ZMEA 5IFJA 4OM1H 4XPTH 4X6DA 2BCMA 1AKJB 1WHOA 5I1KL 4IU3A 2NY2C 2P80D 1KYDA 2OCJA 1TZGH 4ZMWA 1T4WA 4F20A 4RMRA 2BY3A 4PYHA 4PW4A 5B39B 4NAMA 3AXHA 3QUYA 1MIEL 3PNWB 4LCIH 3P1VA 4S1DC 2AEIT 1N6VA 4KC3B 5HYSA 3BIKA 3FSWA 2F5BL 4D9QD 1W8OA 5D7IE 3DHMA 1PX8A 3ECVA 1N2RB 3BLBA 1NCWL 2F6AA 3WLBA 1JFHA 1P5VA 4XP6H 3C5JB 5GGTA 4KK8C 4X6DB 3ZSTA 1GHFH 5I2IB 1XF2A 3CFEB 4NO0D 2BNUB 4NBYB 3RTQD 2NY3C 3I9GH 5IQMA 1JUFA 4LPVA 1O7SA 1F1DA 1FVCB 5DVMA 2AXGB 4DKEL 2H2SD 1T0NA 3LXUX 4GYBA 1QRKA 5EIIA 4OJCA 3MRIB 1RXLA 1S3KL 4ZFFA 3DGCR 2FNBA 4DO5A 4M8VA 1YEGH 4W9GC 4XPTL 5IIEB 1E5BA 3I50H 5DQDH 4EIUA 2R1XB 2F08A 5E5MA 1NFIA 5JDJA 1E43A 2D0GA 2QQNL 4JM2D 2X4UA 2PYFB 4ZXBD 3VCLB 1A0QH 2J1WA 1HNFA 1SLVA 4L9LB 4B9FA 4Z3IA 5K9OB 1T1WA 1S78C 3FT0A 3MLXL 2AXGA 2ZUYA 3NOIA 2GT9B 1D2PA 4ECNA 3BPNC 1WWCA 2A99A 3NQIA 4WUUE 2HP4A 3RKDD 2BNUA 3UO1L 4TTGA 1RD6A 4PRPD 1B9KA 3MRPB 4OF6A 1WH0A 1KPVB 2BRRL 2AABH 3Q05A 2BNQE 4HKJA 1FORL 1UWXK 1I53A 2OP4L 4WHTA 1EO8H 1RJZB 2Q7NA 4KTGA 3BN9D 2YUZA 4RDQF 1N6QH 1DVFC 3G6AA 4YIQA 5B8CC 2NT0A 1TOXA 2XN0A 3K72B 3GTVA 1M1XA 4IRZA 5AL8A 5CF3A 4ADIA 4P05A 5KJ4A 2AJVH 2Y1ZA 3CDYA 4U7KA 3R19A 1U8CA 2QLYA 1JYWA 3FQWA 4I4WA 4ES8A 3RY4A 4HC1A 2ZONA 3FB5A 3E80A 3PABA 4A2LA 4WQOA 4A68A 4WF7A 4DKTA 5TQ2H 3B2UD 2MQ3A 3SOTA 1UZ8A 4NENB 3GKWH 4L37B 5T5FA 2FWSA 5GIRA 1NDTA 5AVSB 1UA3A 3NEEA 3CBKB 3D08A 4H88H 2NTFA 3GSWA 5HHPA 3BE1L 4JJHA 4O2FA 3OMAB 3VXRA 5L8LB 1KXTA 2ZCKL 3ZDXB 3BKYH 1V7NH 3IDXH 1WIOA 3TZVA 1LM8V 1SQMA 2EDQA 2IANE 2NNXA 2PETA 1F1AA 1YEHH 3QT2A 2XWBB 1F8TL 2Y6SD 5I8EA 1CU4L 4DVRL 2CCLA 1QWNA 1IJ9A 3QDGB 3DRTA 5LAPA 2J8UB 4HEMA 3QH3B 4NWUL 4FE9A 3IDGA 1WEJL 5ADOH 1BVZA 3MLVH 4MVBD 4QHNA 5GZNA 4GRLC 4F33A 4KKPA 5I23A 3T71A 3DURA 3NVQA 1NC4A 5SWZE 5DRZA 3O3BA 5FV2A 3I85A 1AGBB 2MCG1 3SE8L 3B3IA 5IROD 3IB4A 4LBAA 1YEFH 2DWDA 4LOUD 1BF2A 3OKYA 1P84J 3S6CA 3TVMD 4BH7B 1DO6A 3G5XB 1CXKA 4FI6A 4RESB 3SSGA 5L6YH 2JTDA 1YEDA 4OCXH 3RVUC 4U3XA 4IDLA 1G9MH 3EF4A 3CDCA 3G6DL 4U1LA 3L5HA 1BZ7A 2H1PL 5F8QC 2ZWZA 3R06B 2VDKH 2VSDA 1K4CA 2WOYA 4GIOA 4K9EH 4KMLB 3BQUA 2DYPD 4AY0A 1T03H 1R5WB 1RUQL 3OXRA 4WV1C 1TEGA 2YAQA 5ISZE 1I75A 3L13A 1MG3C 5AB9A 2PXYB 2O6DA 1X3DA 4OD1H 1DL7L 3U46B 1I8AA 3QWRD 1M3IA 3NFNA 1RP8A 3NCFB 1R46A 4R90H 3HG4A 4L4JA 4M1DH 3VD7A 4XCCL 4JQXA 3EJSA 3Q2WA 4M4PA 1D6EA 2GABA 5EOCJ 5KBPA 2MQ0A 5HVHC 1KUMA 3HNSH 4KK6D 1JBJA 3Q8EA 3AACA 3A6BL 4H40A 2PP8A 1QRNB 3S2CA 2XXMB 2LW3A 4BCXA 3ZZLA 1DE4A 1FZJB 1F4AA 1WUZA 2QADB 4XMPL 2XHNA 4WTZG 2IADB 2OM5A 4YHOL 3UZEA 1B0GA 3BIBX 3GEWB 3SGEH 5I1EL 3FTGA 4X5QA 5F7MC 5EBLA 4MQTB 4ODWB 4ZSOA 4BUHA 5C70A 1MJJB 1SJEB 5D5MB 4AZUA 5IGXL 4ACPA 1QI4A 2Z3FA 3GPEA 4W93A 1JNLL 3QC5X 4KTEH 3UTTA 4GRMB 1NM9A 2BNRD 4B9ZA 1ZVYA 1B2WL 3O2DL 1WLHA 4G71B 5EN3A 2K8QA 1WAPA 2X9XA 3QRBA 5BRQA 3S48A 1R34A 3WJLC 1KGCE 3Q9PA 5KS9E 2AXWA 4KTDL 5CEYA 1HOCA 1BVKA 2AJ3B 3FUKA 3VFGH 4TXVB 4BQ9A 2MSPA 2DW5A 4PRBB 4Y5YB 3APDA 1AZRA 1P7KB 4MS8D 2BOBA 4L4VD 3ROLB 1A0QL 1KBPA 5MEPB 1LE9A 4ZMAT 3SE4C 2CO7B 4MNHA 1PQZB 5EO9B 1T20B 2HFTA 1S7VB 1SJXA 2DWEB 5T33H 1GYAA 4B6ZA 5KSAB 3R4DA 4YHPB 1QX1A 2HVJB 3MFGB 5EC2B 5KW9H 1WBXB 5E6IC 1TLKA 4LPCA 2FBJH 2VLKB 1PDKA 5T3XL 4AM0B 1YEKL 3GMNA 3X1FA 4HUVB 4MFHA 2NW3B 3PIQB 4NSKA 3RIAF 4BE6A 4YBHA 5I6XB 2X4RB 2JELH 3HBGA 3QH3A 1WFUA 3BP4B 5C0CE 4PGEA 3ULUD 1UJ3A 1Z7JA 5IMOB 2MRYA 4PCYA 5CZXD 3J7HA 3JUZA 4WI9A 4PTTA 2O5ZH 4J3VA 4FFVC 3KPPB 1N18A 4HV8A 1PCXA 2OI9C 4QXUL 4AYFB 2F8IA 4J4PD 2WBJB 4GW5B 3PDDA 1GS6X 1AGCA 3OSVA 4NNYB 3P73B 3QRLA 2WVSA 4QRUB 4Y4KA 3K6SA 1BPVA 3FQWB 4R7LA 3GKWL 3IDUA 1VERA 3D0VA 2IALA 5ID0B 2FHBA 5JXEA 2BSBA 2QZ5A 3PS6A 1UM6H 2DQUH 4ZYKB 1SY6H 2IIJA 4M3JA 5IHZB 2OMUB 5L4IA 5HYEA 5ACZA 3DVNB 3QUZD 1HWHB 4BSVB 4Z8FH 2Q8AH 3GDCA 1E42A 4N0FA 1JGUL 4EUPB 4NQEA 2WIIB 2XZAH 2YKKA 3EUDA 3JSSA 5I30H 2K7PA 4FOMA 4P5TB 1DEEB 4Q58C 1S9YA 3NDYE 3RGVC 4ZO9A 3RQ3A 2YBRB 43CAA 2WVVB 2CUHA 2B1HL 3D39D 1E4HA 2X4SA 3CK0L 3IXAA 5E8OA 5KYUA 1T3FA 1QR1A 4LLDB 4Y5YC 4HKBA 4IEFA 4KJWD 4HBCL 5F3BB 5DO2D 1KMGA 4XP4H 4R6UA 4MQSB 4N24A 2ZICA 2VXTH 1IC4L 2Y1YA 3VVVA 5FXCH 3W11C 2EKJA 3AREA 2KHAA 2P45B 4UTAA 3UTQB 4YHKL 3RNKA 1PMYA 4M6OL 5I1KH 1XBRA 1JDAA 3GSVA 3D9AL 5E6IB 4GUPB 3N9GL 4UT6H 4F37K 4XOEA 5EO0A 3KE0A 4YJZL 2OX5B 4P5MB 5AW4B 1B4LA 1DFBL 1HH6A 2DQIH 4TQ8A 4W4OC 1PLAA 2VLMD 3ML8A 1T5XA 4B9KC 4Y1TA 1EEYA 4N2AA 1JNHB 2XN9B 1OWWA 1OGAA 3GXNA 2CK0H 3QIWB 5IW6B 1G7JA 4FJ6A 4H7VA 5HPMA 3UAFA 1U3HA 3MCKB 3QIUC 5JPNB 3MN8A 3PV6B 4HJSA 4IJ3B 3OJDA 5JHDB 5KANI 2YQBA 1A14L 3ZYZA 3AAZA 4AQ8A 1HN1A 3HG1D 3NSCA 2QPSA 3ZTDC 5KS9F 2VQTA 3Q6FA 3D2UB 3G6JE 4RQQA 2CO3A 2E75C 4XPAL 5I75B 2Q8BL 2V8MA 3LEVL 1BXUA 5D7KD 4TUJA 5MEPA 1KCRL 1IEHA 1UWXH 2J8UF 2WB1A 4MA7H 4EI5C 1T7VA 5J11B 2W91A 1T20A 2XKNB 1GVIA 4M5SA 2HT2D 2H6OA 1BQLH 2EEFA 3B43A 2QGDA 5EOCH 1LP9E 5SWQA 3BKCH 4DVBA 1AZBA 2O61B 4L4TB 3R1GH 2YN5A 3ZYOA 4GSDL 4IMLB 3PY9A 5JR1L 4X0KB 2Y5TB 1NAKH 3P2TA 4MNQD 5E5LA 3OKOB 4P23B 3ULVL 1IBZA 3IEAA 4LVEA 4MX7B 3FT9A 4C55A 1K8IB 4LLYA 4WWKC 4DP2X 2BCKA 3RAJL 5DZAA 4LLVB 4X5RA 5TFSL 1B88A 2F18A 1LEKB 2DQJL 3KLAA 2IWGA 4R5TA 2APFA 2C3VA 4ALAH 3F3HA 1PAMA 2HT4D 3QHFH 4EN3A 2HVBA 2OZNA 2APSA 3MTRA 4RETB 2WLZA 4OTXH 4JGMA 4NO5B 4KAQH 2DJMA 2H0PA 5I1IL 2MPAH 1XBDA 2VDNB 3KJ6L 4MQ7A 3V5HA 3EGSB 1QYGL 3TT3L 3JV6B 4IU2B 5D5ME 1XX9C 3L3JB 4PJBA 2IF7A 1BJMA 2MWCA 4NC0B 5DCCA 3GSXB 4KJWC 2DJSA 5E4AA 4V1DE 4UQAA 3CFBB 4L0ZA 5HGHA 4FG2A 1MHEA 1UKTA 4BZYA 1TJHL 2J12B 1X4XA 1NCNA 2DBJA 1OE2A 3ETSA 3EFOB 1VESA 4GAAA 4KKLD 1TZIB 5EWIH 2DIBA 1NUNB 3SDAB 3UYPA 4LKCA 2HJKA 3PQYA 3M1BB 3Q0HA 4ALAL 1ND0B 2EACA 4QWWD 4WO4B 2QTVA 2WWKT 4V11A 1ZSHA 3OAYK 4MD0B 3QNZB 4GOSA 5H94A 5EOTA 3RWDB 1RMFH 3IGAA 2NX5A 4JAMB 4NNPL 4RFNB 3K1DA 3LZOA 1LJMA 1NMCB 3IMTA 4CN1A 1HL9A 5SWQB 4RMBA 4YE4L 3SJVB 4NCDA 4OKDA 2ID5A 2A6KB 4Y4FC 1TQBC 3GXDA 4LQFH 3WNMA 4XHJC 5IB2A 4DKAA 2BC4A 3M1BA 3O6KL 3ISYA 1NL0L 1TZIA 2QPDB 3SQOH 3KXFB 1EBPA 1PZSA 3RY5A 2DD8H 3NP4A 1ZRUA 3CVCA 1E27B 1RZIB 2LAGB 5FX3A 4TL4A 3WFBH 4O02B 2Q3XA 4YK4B 1F3JA 1E9QA 4KJYA 1LDPL 1TYEB 3DHJA 5I17A 4UV4L 1OZUA 1NDGB 4G7QB 4QIRA 4HUKB 3NSYA 1JZJA 1KJ2L 4E41D 5DFAA 4HLJA 4GUQA 1F4YL 4PJ8B 3OPZL 3UEQA 2B77A 4NO5A 1RULL 2ZCHH 3ILQC 3V7MA 4OFDA 1JWSB 1UADC 2GFBB 4Y4HB 4JY4B 1X7QB 1AO7B 4U1SB 1JV5A 1QI5A 3RWIA 3MLUH 3WY1A 3T0DA 4P9MH 2D8KA 5BO1H 2E27L 4R26H 3PL6C 1EPFA 4MCYA 3UACA 4AQ1B 2O61A 1WHPA 3S3CB 1GZPA 2FB4H 4JFSA 3PXLA 4YDIH 1G6VK 2L3BA 1OGPA 3H9YA 2N59A 3CDZB 5J56B 3L3KB 4GRWH 5FW8A 1XL4A 4KNUA 4OGXH 3AW5A 3FN0H 1C08B 3PREA 5GJSH 5DFVD 3VD1A 1R3KB 2QLVB 3QXTA 1FQ9C 3BH8B 1Q1PA 3BAEH 4M29A 4UIMB 5JDSB 1RZ8B 2FIRT 3QXDB 4NHUA 4OF7A 4WI3A 5DWUL 2HX8A 4F93B 2NW2A 4JN1L 4P8QA 2XA8L 3ULVD 2NUTB 3QNXA 4C54A 2EO7A 1UWEL 4PVNA 1JYXA 1MJ7H 3MRNB 4K71B 3VWJC 1P7HL 4KROB 3ZZQA 1KPVA 3UDWC 4QRRB 4AUYA 4IBSA 3P77B 4DH2A 4P3DA 1RIUH 4FF9A 2AP2A 3MCKA 3OZ9H 4P2QA 3HN5A 2YGPA 2XV3A 5BNXD 1OF2A 4PVLA 4LK4A 4JFED 4HIXL 1UVQA 4QHMB 3S34H 3LKPB 4YC2C 2YFNA 1XVSA 5I82A 4N0YH 1A6TB 3JZ7A 4OZFG 2C9RA 4BKTC 1CGTA 4K94L 1A64A 3MLRH 5BUPA 1X9UA 2EE2A 2R2BB 3NCCB 1VHPA 3NA9L 1E9PA 3DV6A 1ETA1 2I60H 4JM4L 2WAHA 3C6LD 3C6EA 4PBXA 3SDCC 1NTDA 4YVNA 2F1BA 5JXAH 1JZ3A 2BOLA 4ENED 3UBGA 1I3GL 5BXFB 3KLDA 1YRKA 1B6DA 4N5EC 6FABH 1JFQL 2CK0L 5C08B 4MJIB 4YL9A 1UXMA 3DJTA 3GNMH 4RNRB 1AH1A 3UTZB 1CICC 1B4TA 1VGKB 5HHMD 3VGHA 1EJFA 3D3VE 1MJUL 4ZUSB 5F7YC 2EH8L 1ZXQA 3D50A 4HUNB 4AMXA 4EN3D 4ZS6C 4N87A 5IHHA 4A7GA 2V5SA 3QI9C 3L3KA 1ULVA 3COOA 3NJFA 4C4KO 3NA9H 1IE5A 1RSYA 5CS7A 4J4PA 1ZHBA 5INDB 5FR3A 5HHNB 1UD6A 4A7UA 5E8NB 4A7GF 5KVGE 1J1PH 3U1PA 1N8OE 3P0VH 1QPXA 1UM6L 2V5TA 5BS0D 2G75B 5FUOH 2OYPA 4OCYH 3ZKXB 4ODVH 3LQAL 3PWUA 3NJMA 5J1SC 1XIWA 3ASNB 4R9HA 3FB7B 2I69A 4F8LA 2AKRB 4GXVL 3BO8A 2OL3B 5IWLC 1QSVA 2RTTA 3QUZA 3QULB 4IBZA 4KDTC 3VXME 3MREA 4FTDA 1OT1A 3BP6B 3WFEH 1UVQB 2O5NA 3NESA 2PW1A 1S7TA 3PAVA 1KLFB 1BW8A 1PG7L 3HE7C 4PJFF 1ES0A 4MMYA 1XCQB 1B4JH 1PKQE 1DBAL 1T6BX 4PJXB 1NWPA 1ZV5A 1DQLL 3IKKA 1M05A 5GGUA 4XNMA 4DEWA 1BV8A 4Q2ZB 3N40F 2HA1A 1U8PA 4Q9QL 5JOPE 3BHBA 1J0HA 4W9CC 1AQ8A 2RR3A 3LV3A 5J6GB 1G43A 4P59L 1UM4L 3L7FA 1XXFC 4EXKA 4F8OA 3SCMB 3U36B 1HH9B 5FYLL 3ME0B 2HFEA 3IWVA 3MU3A 5DS8B 3QXDA 4NZRL 1D9KD 3O11A 5EEXA 3VGBA 3LRGA 1KJ2A 4UV4H 2I07A 3HBQA 5CLZA 2FATL 4M3KB 1G9NL 4AIZA 4MMZA 2AXFA 1FNFA 5CCGE 3HZYB 3UAJD 4HGWB 2QL1A 2EXWC 2QSQA 1FCGA 2ZX5A 2VN3A 4AQOA 2YA0A 3QO0A 3WJLA 4L0PB 3EFDH 4JFVA 5T5NF 1BYOA 4LSQL 1MJJA 5D5MA 5FM8A 5LBSA 3AXIA 2DS4A 4LKCB 3VD5A 1FRGH 3I6SA 4ZS7H 2WNKA 4RMTA 3L4ZA 5ESQB 1YEDB 4X4ZA 2AXJA 2OCCB 3E38A 1UFUA 1OAXL 4PUBL 3HA0A 5D1ZB 1NCGA 3KH3A 1S9VB 5C07B 5TE6L 3HNVL 4NDMB 4EN3C 2JK5B 4MS8C 4PB0L 4ICXA 4G9FB 1AGEA 2GUYA 3K71A 1AD9A 1FFPB 1D6VL 2PN5A 2OMYA 2YS4A 3IRPX 4JM2B 2XVBA 4NYLB 3QGVA 3DRTB 4HCRH 2ZYSA 3O3AB 2JTYA 4K4KA 1F8TH 2DRUA 3DVGB 3WLWC 2VW7A 2AQRA 4E9VA 3VA2C 2PNDA 2XG5A 3VX1A 3L3OC 1ILUA 1S7TB 3SKNA 3ULUF 2Z0UA 5TFSH 4K3GA 4LSQH 1A47A 4KWUA 1DLHA 3WEOA 3ETTA 1JPSL 3U83A 3H2WA 1UGKA 2X70A 3LZFL 4H25B 1E9OA 3ZUNC 1WK0A 3N1FC 3TL5A 3BZ4A 3AT8A 1N8ZB 2ICEB 1A2YA 5C09E 2KQMA 1JHKL 3MR9B 4UM8A 3JV0A 2WSKA 5DJCA 3STLB 3WUWB 2MPAL 5HI4D 3ATDA 3BCDA 4O51B 3TCTA 2E7CA 2NY1B 4TUOA 1O75A 2YLHA 5FCUH 1KEGL 1ZGLA 1URIA 4OCWH 2VABB 2GJZB 3LSOA 5DS8A 1YEEL 3HE7D 3R7RA 2HCZX 3GHEL 3QIBD 2WYHA 3LMJH 2DLFH 1KJ2B 1W2KT 4LRIC 4XCNB 3T2QA 1M57B 1FZKB 2EECA 2F7IA 1E3ZA 4MAYC 3VFOB 3KPRD 1M6UA 2RCSH 4MRCA 4M61B 1DLHB 5EF3A 5I71C 3D25B 2J3SA 4LLQB 1Z9SA 4AGOA 1ORSB 4HJ1A 1D5IL 3QUXA 3ZT6A 2HX7A 2Z8SA 1AHWA 4XCFH 2D7TL 4FC3E 3RFZC 1FLRL 1JE6A 1NCDL 2HVKA 2QELA 2E7LA 2CR6A 3NJNA 4JUTA 2NY3B 1BZDA 2MOVA 2X9ZA 4AYGA 4P04A 3RDTD 3CFCH 3ESNA 2GAZB 2WWMD 3QS2A 2MHAB 1QSEA 2UWEB 2VZSA 3EJQA 4NDMA 2BY2A 2IH3B 3C60B 2E9WA 4OFYA 3VWKA 2XI9A 2AV7A 2YKLL 3INUL 2VM4A 5BW7C 2DBLL 4JFFA 4J39A 2WKGA 4XVUD 2CWRA 1XAUA 2CDEB 2OQJA 1A14H 4D0CB 1R9FA 1NCUA 1AI1H 3W0WA 3QQDB 1KULA 3R06A 1I8MB 1AY1H 2P49B 4MDRA 1DBKH 3IDIB 3VXRB 4BKLA 2AJUH 1XF5A 3BWUF 2F7PA 4C4UA 3SCMD 3WXWH 1DQTA 4FI8A 4S11A 5LDSA 4ODVL 2AXFB 1MQ8A 3N44B 4HW6A 4L3FA 5DJXA 1TTAA 5AAPA 2J57A 5DHVA 2JH2A 2X6MA 4YZWA 2ZOLB 4GAGH 4K7FB 3QUYB 2G5RA 1CGXA 5FIEA 3BKYL 3JV5A 4GI6A 2OZ4A 4B5EA 4AYDC 1U8NB 5BXFA 1ZVNA 1IT9H 3B7YA 3EO1B 5E2VL 1RAMA 2ZX7A 3ARWA 5H4ZA 5DLML 3PPEA 3U0WH 4XE0A 3EGDB 5CGBA 4DGVL 5J1TC 3FSAA 3AS2A 3CQQA 2QKIB 4AGMA 5FA3B 3KPOB 1OGTA 2QPFA 1ZCRA 5HI4C 3V52H 2JLLA 5I8OL 5KW9L 1MRFH 5LBGA 4UMGA 1ZHKA 4UNVA 4KY2A 1KB9J 1MCBA 4EO5A 2CLZA 9CGTA 3KVQA 4ORGA 3QJFB 4G6FB 2P28B 1CFBA 3UC2A 1CLVA 3GJEA 2BWIA 4JX0A 3APMA 1OTTD 2W0KA 2GVYA 2C9SA 2XBZA 3MHZA 1ODAA 1GZHC 3KPOA 2EDXA 3LEYL 3GI8L 3T3PE 5F7AA 5JW3L 4JKMA 1NZRA 5DJAA 3BZEA 3O6MH 4YHLL 5DJDB 4ZD3H 5FDWA 1S7UB 4QXUH 4UTBA 1IQDB 1U8OB 2C1PA 4NS0A 2ETWA 2YEQA 3HPJA 4YC2B 1HX0A 1OP9A 2HTKC 3C5XA 4NRXA 2A6IB 3MA9H 3QZWB 4JW3A 5B1AB 5L2KE 5D6CB 2Y0SA 5C3IA 3QORD 4GO6B 3T9WA 3WAKA 4JKKA 2NY0D 3TTSA 4IOSA 2VAAA 2XPZA 5CD3B 1KIUA 4OUUB 2KL6A 3LPFA 3HG1B 1P6AB 1MHCA 1RSFA 4LSRL 4AEFA 3KR3H 1KXVA 1JIBA 4EIBA 3AXLB 1HE8A 4MJ5B 3QIBB 7CGTA 1FC1A 3W11D 5C0EA 1K2DA 4Q52A 1NMAL 5DJDA 32C2B 1BEXA 1I1YA 3U9WA 3UZQA 3ZX1A 4NN6C 5DUJA 5JW4Q 3I9IA 4GRMA 3QG6A 4ZX6A 3GIVA 4IIQC 1G0XA 2IXQA 1WCBA 2WINB 5JOFA 4J3WA 3GLAA 3T6XA 3EBIA 2XLLA 2HPTA 5BS0B 3P11H 3H9HB 3KPTA 4G8IB 3NIGF 2XYBA 3BP7B 3JT0A 1WFJA 1FH2A 4X8GA 4DK5A 1MXGA 4QOKB 3RUGF 5EO1B 2R39A 1KEGH 3PFQA 5CJXC 3V79C 1A9BB 4X5LA 4AYEC 5C0AA 2K6YA 5JIDA 2VDOH 5EU5B 4ZMZA 5AG8A 3KBHE 1JGVL 3H42L 4OCRH 1ZT4B 4AE1A 3W37A 1PF3A 3ZHKA 1ZGLP 2X87A 4HAGA 3FCTB 4XTRD 3MUGA 5LNDA 4EZMA 3KPMA 4ZAKA 4YSOA 4BWUA 4K8RC 5A1AA 3BP5B 1BXVA 4G8GD 4X6CF 3T77A 2F1AA 5L7XH 4C57C 5I1JH 1L6PA 2DH3A 4WUKH 1NINA 3NJKA 4P2QE 3Q2LA 4Y9CA 5D7EA 3ZVVA 5EU6B 2B4CH 1F4WH 1CFMA 1KYOJ 1BG1A 2NQCA 1ET8A 4P2AA 2JB5L 4I3SH 1XO8A 1VEPA 4PJAB 1VACB 1GPOH 3L4CA 2DV6A 3BQUB 2OYLA 5D1XC 1CICA 4X98B 3CCHB 4KRPD 1DVFA 3KBPA 4H1LG 4MB3A 3S36X 4PV9B 2YQ3A 3X3GL 5C2UB 5FO8A 1RZFL 2X70B 4NX0A 4WIQA 4DVRH 3SJVE 3PL6D 2SEBB 2WD0A 5AAMC 4FFZL 2ISDA 1WT5C 3IFNL 1XCTB 3CH1B 1AIFB 2WCSA 4KHTL 2RHEA 1ORQB 3FRUA 4EDXA 5KSBF 4OVVA 1K4DB 2WY3B 3EOYG 1GC1C 5DF0A 3JYBA 1UUSA 3GFUA 3ZYJA 2WXMA 4GAYB 1G9NH 2YPKA 3BH9B 4QY8B 4L5FL 4JPKH 4UT9L 4BHUA 1XGUA 4L1LA 2XVLA 4O58L 2WLIA 4JGUA 3RIAK 3S35X 3ULVC 2ZQKA 3MV8B 2EDKA 2EZ0D 5A2IH 1KB3A 1RZPA 5EO1A 3EGSA 2JJTA 4TULH 5IJVB 4UQDA 1WGVA 3KXFA 1SLWA 3A23A 2X3CA 4GI9A 1TJMA 4PR5B 1ZHNA 3OMIB 3U4KA 5L8JB 4E9YA 1BAFL 3O2DA 2ESVA 2X41A 3ISWA 3NZHH 2ZPKH 4L8BA 1HXMA 3WS6C 1ZWIB 5TE6H 1FNGA 3TIEB 5AD0B 2R59A 4OLEA 1C7TA 1NM4A 3UP6A 1MAJA 4IGBB 4Z77B 3S7GA 3GZPA 4FQQA 3QIWD 3ZE2B 4XN5A 4BCZA 1GTFA 5FGBA 1DQDL 4U49A 3OKOA 4P23A 3L08A 3L9BA 4TVPD 1J8RA 3NFSL 3HZKB 4BFOA 1ZHBB 5INDA 5FOBB 3UBXA 4I0PA 5F3HA 5ERWA 1KB9K 3ARGB 5ANMA 2RQ8A 1FFNB 2HMIC 2EADA 5C0FB 4R97B 4H8WH 1OGAD 3ARFB 4BH8A 4LASH 4H5SB 2BVYA 3ABKB 1E6OH 1YEIL 3V5KA 4HKJB 3ZL4L 3DOIA 4KITB 4GMSH 2XWTA 3HKFA 5FK9B 1CTMA 1O6SB 2FEEI 2H8PB 4YAQA 5MENA 4TQEL 2J88H 4J8RA 1A6WL 3MRCB 3FN3A 5IMLB 3Q44A 3ILQD 1FORH 4FFYH 4F57L 2OA9A 2R23B 3F6LA 4XO5A 4L4TE 3WFDH 2V6HA 1DVSA 1QABA 1VPOH 3QI9D 4HOXA 2AK1L 3WFEL 1KZQA 2GJRA 3PGDA 1U3NA 2A2QT 3IXTB 4AMKH 4OF3A 4PJDA 3QEGL 1TTCA 4DP5X 5JZ7C 2J56A 3CJJA 1EJ6A 1SYVA 2J73A 1XB6A 3BX7C 3V4LA 4GW4A 1BLNB 4G42A 3WFZA 4AQEA 2YUVA 3N43B 5D7IA 1TCRA 3D09A 2O1AA 3RNKB 1QZNA 4Q9QH 2ZF8A 2OMZB 4LLYB 3W82A 1KFAL 4I18A 2CBTA 4ZFQA 3CX2A 2Z7UA 3QARA 1NGYA 4JBSA 3FSOA 5E1IA 3DX8A 3MXVL 4XZ4A 4A55A 4QHMA 3SD5A 4Z3GA 4L1TA 4JPWL 4GSDH 4HK3N 3H9SD 4X9BA 4NZTH 1R3LA 3VXTA 5IHUL 3L3DB 1FN4B 4QXVA 4PYGA 1YNKH 5JW3H 5I30L 4OCSL 2OJZL 2OXHA 5F0MB 4N0FB 3RWCA 4GAJH 2X0WA 2YMXH 3RVTD 3A4FA 3HNTL 3VFUB 3PWJA 1KBBA 2B2XL 1CDUA 3IU3A 1JHTB 2DQFA 5C0AD 1PEZA 5JHAA 1TJXA 4Y8DC 1BVLB 2BSRA 1FVDA 1NPUA 3T8VA 2FBRA 5KBMA 4Z3FA 4XH2B 5T1LA 3T0EB 5I1DB 5C0AB 3QJOA 4RNRA 5KVDL 1CE1L 3E6HB 3QEUA 3L3DA 5PAZA 5IJBC 4L3ED 2AZUA 4HP5A 3I3BA 1H8NA 1NBYB 1W0VB 2VIRB 3SGKA 4FTVB 1UWGL 3T0VA 5L4MA 3F84A 3C8KB 5DMJB 1IKFL 4NI3A 5DVNA 4GQPH 1GW6A 3D39E 2OL3H 1G9HA 1ZLVK 1TVBA 5K9JL 2R1XA 2JCCA 1GZHA 3N6YA 1HHKB 2PYFA 2EUZA 1FNEB 4QLRA 5CP3H 3PGDB 4GG6F 3JUYA 2I7OA 1KXQA 3M6DA 3UTSB 4XCEA 3ULVF 1CICD 2XKSA 2V3FA 5DUMH 4ZMTA 3HUJF 4OT1H 3E6HA 2IAMB 3VXNA 4JRXA 3OAWA 4K2UH 3IDNA 2EVHA 1Q9LA 3UXFA 2XXGA 4LSTL 3BC9A 1EO7A 4GSQA 5IW1A 3G9AB 2WQUA 5KVEE 2X0UA 4X80L 4GS7C 4LOEA 1GKEA 1KY6A 3LOWA 3QDHA 5T3ZH 2B1HH 3AU0A 4OZHA 1KPUA 4KV5E 4Y0GA 2C1OB 2R83A 1CF8H 1PYWB 3L2MA 3GTNA 4PW3A 5DEGA 1W8EA 3WXVL 4N5UA 1WZLA 2CD0A 4QYOA 5AOLA 1IFHH 1O9VA 5JLZB 2WNGA 1P4IH 2G4EA 5IZ7A 3Q2NA 2DLFL 5H37H 3QDGE 5JW5A 4R7NB 1AS6A 4MA3A 3FB6B 2IOOA 4BBWA 3STZA 2GW5A 1XV8A 4U4BA 2Z34A 4HT1L 2PXYC 1ZEAL 4AG4L 2WUBL 3HS0B 4M7ZC 5D7KE 4I9WE 1ED3B 2LQRA 4NUJA 3GMQA 4PV8A 3BVWA 4XVTL 4TRPL 5IROC 2P43B 4C56E 3LRSB 3FQRB 1J9TA 1Q9WA 1JGIA 1FG2B 4YZFE 4QRQB 1SGKA 3GRWL 5T3ZE 1UD4A 3WN5B 4ABQA 1VF5C 1QSEB 2UWEA 4M93B 2K78A 3PQYE 3V4VA 2OSLB 5EZPA 4IRJB 1FNHA 4QXGH 1O5DT 1Z3RA 4WV1B 3ALXA 3DX9A 2L4OA 3FFDB 3DVIA 1IEBA 3NIDF 5IHWA 5B38A 4GKNB 4UMSA 1PBYA 3TJEL 2ZWYA 1AFVL 1U93A 1A1NA 4ZPVA 4LVOB 1MWAH 5HHOE 3UTTE 5CU9A 3RL1B 4NBZB 4ZT1A 1GOHA 4MS6A 5ISZB 2ED8A 2E9IA 1E9QB 2DQCH 3VU1A 3AWGA 2IOMA 4AQZA 3DIDA 4LXFA 3T0WA 2BOCB 1RIHL 3L48A 3ABGA 3BAEL 5T1KB 4ZTOL 4I77L 1VGEL 3LHPL 5AALA 3MJ7A 3UAJC 12E8H 3CDFA 1HWWA 2YAPA 2DEWX 4YXLL 3AM8C 1AQDB 5DI8B 5IVXE 1UB5A 2A74C 2OJ1A 4AV4A 1Q72L 3OGOE 3EYUL 4D8PB 1P6FA 5HSFA 2V5RA 3QNZA 5H94B 3BDXA 3BUYB 1N5AB 1P4LB 3MACH 1HVXA 5I76A 1SOSA 2XX0A 4OCRL 4XVSL 3U7YL 3ZXAC 1OAKL 3MV9E 3VI4A 5F9JB 3ARBB 4L8BB 2CMRH 4WI4A 1JV2B 1L9PA 2MOQA 1LO0L 5K33A 5DI8A 5BV7B 3H3PL 4Z7QE 3CPUA 4N90D 1CGUA 4PRID 1JPFB 5CBEB 5K59F 2DEXX 1I8KB 3FBKA 1R5IA 4YXHL 1J48A 1I1CA 2YAEA 3S88L 2ZOWA 2BSSB 1MRDH 3UBXG 12E8L 2LLLA 3WLWD 2ZNWA 5FKAB 1SFDA 4HZLA 4F33B 3QPQD 4XXCC 3G6AB 4TSCH 2DMHA 3GYRA 3AADB 2KLTA 4PGBA 5HDWA 3ZU8A 2YK1L 1TETL 1PLGH 1X4ZA 1HZKA 3X1EA 2ZJSL 5ANME 1MCDA 4IRJA 5F70A 4J3OH 5DR5L 1R5IB 5A2AA 3TT1L 3UJJH 4TNWF 4APQC 4E9WA 4LLQA 1T7WA 3RKPA 2IGFL 3IFPA 3VI3F 2WBJC 5J6HA 4MWFA 4FABH 1TPXB 1VFOA 2SODB 1ZS8A 1HE7A 2EDOA 3N44F 3UGUA 3UO8B 2EIBA 2X6VA 4KV5F 1S2EA 3FL7A 2G5BA 3D85D 4RFOL 5E6ID 4WTZA 1RZQA 1NANI 3ZT7A 4XMVA 1NCTA 3WGUB 4FYQA 5IB3A 3KW7A 1K4CB 3CSFA 5F1KC 1G9NC 2C3WA 2JKRM 4F5CE 4MMZB 4OZIF 2F0CA 3VXRE 1QSFD 3S37L 3H0TB 2EUVA 3FB6A 2VM3A 3LNIA 2JCCE 3RWGA 2OAAA 1RHFA 4OI7A 2PF6A 3ZTJG 3BZ4B 3MJ6A 5J0BA 5CZXC 3EDKA 5LO7A 3L7EB 1JN6A 3FJTA 4BA0A