3WY3A

Crystal structure of alpha-glucosidase mutant d202n in complex with glucose and glycerol
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
535
structure length
535
Chain Sequence
b'NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLNTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 190
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy3A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy3A02
1PJ9A 2XN1A 1DHKA 2YIHA 3VMOA 1CPUA 1UD6A 2VRQA 3ZOAA 2ZX9A 4U2YA 4AYSA 1E3ZA 3BAYA 3ZQ9A 4FLOA 3WY1A 3BUIA 1WE5A 4OIFA 2ZX5A 3EJTA 1UD3A 1VJSA 4HOXA 3L4ZA 1KBKA 4UQBA 2ZXBA 2ZUVA 3CTTA 1PEZA 2E8YA 2PWFA 3K8KA 1S46A 4FNPA 1PZ2A 3VGDA 2OW6A 3BUBA 1MW0A 2YJQA 1CXFA 3AJ7A 5EMYA 3VGHA 1KTCA 3WENA 1TMQA 5HDRA 4UQAA 1TQUA 1JDCA 1R46A 3KLLA 1CXLA 3GXIA 4UQDA 4GIAA 7TAAA 2EAEA 1ZS2A 1UD5A 3VX1A 5HPOA 3VO0A 1WZKA 3A21A 5A2AA 5I5RA 2ZUWA 1J0IA 2ZX8A 3WDIA 3HJEA 1HL9A 1WZLA 3WN6A 1CGVA 1CGYA 1JFHA 1KXHA 3EJQA 2GJPA 3RIKA 3M07A 2WVVA 4GQQA 3DX1A 5CGMA 3K8MA 4KWUA 1JDAA 4JFSA 3CLWA 2WPGA 2G3NA 3GXMA 4AEEA 2CPUA 4TVUA 1PPIA 3K8LA 4U2ZA 3HG5A 2QMKA 3BH4A 3WNMA 1Q4NX 1XD1A 4AW7A 1RP8A 4J3VA 3DX4A 3VM5A 1G9HA 4HPHA 2D73A 2C7FA 3BUQA 4U33A 2QPUA 1VB9A 1G94A 4WF7A 1UH2A 1PIFA 3VMPA 2BHZA 3HG3A 5A6LA 4J3SA 3WELA 5E0FA 1PZ3A 2Y4SA 5I23A 1E43A 3CGTA 2D3LA 1DTUA 1UH3A 3H53A 1CDGA 1U33A 3L4XA 1XH2A 4XB3A 2BHYA 1RP9A 4UZUA 3VSTA 1IV8A 2D3NA 3CZEA 1HTYA 1XD0A 3GXPA 3GXNA 4CN4A 2BY1A 3TOPA 2NT1A 1MWOA 4M8UA 3ZT6A 3BVTA 5E70A 3BLKA 1CXHA 1MW3A 3IJ9A 1OT1A 4NX0A 5CLWA 1L0PA 3BUDA 3EJRA 3WFZA 2PWDA 3A6OA 4JL2A 1HT6A 2EJ1A 4JCMA 1ODUA 4AIOA 2YFNA 2DH3A 5I24A 1CGTA 1R47A 4CGTA 2AAAA 1UD2A 4GKLA 1CLVA 2D0HA 2V3EA 3OLDA 3VX0A 4BA0A 1U2YA 3BAXA 3LXAA 4AEFA 2NT0A 4BZYA 1QI4A 2ZXDA 1PAMA 2VNCA 5CLTA 1BAGA 1HL8A 3CZGA 3LRLA 5CGTA 1CXKA 1JF6A 1UA7A 2WVVB 1JXJA 1G1YA 3VMNA 1V3KA 2PWEA 3S5YA 1KTBA 1VFUA 3L2LA 4KMQA 7CGTA 2XVGA 4PSPA 4FLRA 2OYKA 4GINA 1XCWA 1UKSA 2FH6A 1KGWA 1W9XA 3BAIA 3EDDA 3ZR5A 2Y2WA 3L4TA 2NSXA 1AMYA 5KEZA 3BCDA 4JFUA 4UZSA 2XIBA 1UKQA 3IK2A 3TV8A 1BG9A 2OSYA 2VR5A 4X0NA 2X2HA 3CZKA 2DH2A 1CIUA 1BF2A 1CYGA 1XSJA 3LPOA 3WEMA 4OGZA 3KL5A 4FLSA 2FE0A 6TAAA 3UG4A 3WY4A 4J3WA 1XH1A 2ZICA 3L4VA 1JIBA 2GUYA 2BHUA 4MB1A 3RILA 3S2CA 3BAJA 1B2YA 3EDKA 2VUYA 3ZSSA 3AXHA 1TQSA 3BMVA 1SMAA 1CGUA 2XN0A 3CZLA 1XH0A 3EJPA 3W37A 2F18A 2WNWA 2D2OA 1HXKA 4HA1A 1EO7A 3VGEA 1H3GA 1RPKA 2XIIA 2ZXQA 5A6MA 1TQVA 1UASA 2J25A 5C8BB 3KL0A 1R33A 2VT0A 3BCFA 2WANA 3A24A 3DX0A 4U3CA 2EO7A 1T0OA 2F1BA 1CGXA 3ECQA 4FNSA 1KGUA 3DHPA 4H2CA 1KCLA 3BAKA 3QGVA 3GXFA 2AMGA 1EO5A 2EACA 3VGGA 2CHNA 3ZO9A 3W38A 1VFOA 3EDEA 3WEOA 3KLKA 2F1AA 1JD9A 4NXKA 2Z1KA 2WVUA 4NXSA 3WY3A 4DO4A 2XN2A 1J0KA 1QPKA 4J27A 4J3UA 4PEEA 3VU2A 1DEDA 1HNYA 1QWNA 2ALWA 1MFVA 1MW2A 3GTNA 9CGTA 4AMXA 3DHUA 3WNKA 2YA1A 3EDJA 2BY3A 4H7VA 1KXQA 4B9ZA 1E3XA 2VRKA 1V3MA 4W93A 3D4YA 3FAWA 3AMKA 3A5VA 4NZFA 2YA2A 2D0FA 1KXTA 4UNIA 1NOFA 2F7PA 3AMLA 1AVAA 1EHAA 2BY2A 1Z32X 5HXMA 3D52A 1B0IA 1BVNP 4LQ1A 1JDDA 3UCQA 4PSRA 1KXVA 2ZX6A 3VM7A 1G5AA 3CZSA 2YFOA 5F7UA 4H8HA 1BPLB 4MAZA 2ZUUA 4GI9A 1D7FA 1A47A 1VFMA 3L4WA 4LXFA 3ZR6A 1OSEA 3HZ3A 2ZXAA 1UA3A 2V3DA 4CN1A 3DX2A 5DO8A 3A4AA 1MVYA 1BVZA 3LPPA 1EH9A 1TQWA 2PWHA 2ZWZA 3BVUA 2WSKA 1JI1A 2DIEA 4UCFA 5E6YA 3BUPA 1V3JA 4JCLA 4H8UA 4UQEA 4JFWA 3DX3A 1JAEA 4M56A 3OLIA 3WNLA 2F7QA 3UG5A 3EJUA 3HG2A 2XVLA 3BVVA 1JXKA 2OSXA 1TCMA 6CGTA 1QWUA 3BVXA 3ZT5A 3II1A 2WKLA 2QMJA 3D51A 4JL1A 5E1QA 3LX9A 3WY2A 4UQ9A 1J0HA 2WKGA 4GO8A 3LRKA 1AQHA 4JFVA 1SZNA 4AMWA 1IZJA 5E6ZA 3WNPA 3A22A 1M53A 1PIGA 3CV5A 2F2HA 3TTSA 4PCTA 8CGTA 2FHFA 1EA9C 4HOWA 3BLPX 2OSWA 3S5ZA 2QV4A 3VGFA 1QW8A 2QLYA 2FGZA 1TQTA 3VSVA 2XWDA 1BLIA 1C8QA 1JL8A 2FH8A 1SMDA 1HVXA 3KEHA 3VNZA 1V3LA 3A23A 1MFUA 1QHOA 3IGUA 2ZUTA 1XSKA 2Y5EA 3TONA 3DDGA 4JFTA 5E9AA 1R34A 4UQCA 3KL3A 3LXCA 3GBEA 3WNNA 5A2BA 1QI5A 1PS3A 3BLBA 3OLEA 1UOKA 3WDHA 1XSIA 4H8VA 3L4YA 1QW9A 1CXIA 5DFAA 5BRQA 2WC7A 2WVTA 4CVWA 4UOQA 1GJUA 4GQRA 3LXBA 2ZX7A 1XCXA 4WLCA 1UKTA 3ZSTA 1GJWA 1I75A 3WDJA 1KWGA 3GXTA 1UH4A 2WCGA 4FNTA 1CGWA 4GI6A 4J7RA 1MXGA 1KGXA 2ZUSA 2EABA 2TAAA 2X2JA 3LRMA 2YOCA 4J3TA 4CN6A 1QHPA 1KCKA 3OLGA 1OB0A 4LPCA 4OKDA 2XWEA 3WNOA 4UOZA 1O7DC 3L2MA 2D0GA 1KBBA 4ATWA 2WSPA 3GXDA 3BSGA 3GBDA 3IJ8A 3VSUA 1WPCA 4OJYA 2ZWYA 3BSHA 2EQDA 1VIWA 5TD4A 3H54A 3K1DA 4FMVA 3KWXA 3A47A 4J3XA 2OYMA 2FHBA 3IJ7A 1MXDA 1WZMA 3VNYA 2V3FA 3DDFA 1JGIA 1HWWA 1XGZA 4X9YA 1ZJAA 3UEQA 2BY0A 2GVYA 2YKKA 3BVWA 1JG9A 4U31A 3UERA 4HP5A 4B9YA 2FYVA 2G3MA 3FW6A 1E40A 2C8NA 1OGSA 2DIJA 2PWGA 2WVSA 3MI6A 4DO5A 2E8ZA 5A2CA 1MW1A 3CPUA 5I0DA 1D3CA 2E4TA 1VAHA 2F7RA 1CXEA 2E0PA 3BC9A 1QI3A 1LWJA 2OYLA 3HG4A 2GJRA 2QPSA 1XV8A 2ZIDA 1QX1A 3VGBA 1AQMA 1JD7A 2CXGA 1U30A 2X2IA 2E9BA 2BXYA 1KB3A 4J28A 4WSKA 2GDVA 2F7OA 1UD4A 1GCYA 1LWHA 1R7AA 1JF5A 2F61A 4FNUA 2FHCA 4PCSA 1WO2A 4GO9A 4AYGA 3AXIA 2GDUA 2YA0A 2Y24A 5CXPA 1BSIA 1Y7VA 3TTYA 5BRPA 1JI2A 3D4ZA 3KE0A 4HOZA 2ZE0A 1WP6A 3CZNA 3BAWA 1WZAA 1ZJBA 2IGTA 4FLQA 4AIEA 3FAXA 3BMWA 1J0JA 4NI3A 4NZJA 3UG3A 1P6WA 4FNQA 4E2OA 2WCSA 4CKQA 1M7XA 3L4UA 3DC0A 4WSJA 1UD8A 2OW7A 1HX0A 2BXZA 1OT2A 3EDFA 1KWKA 4DO6A 1NM9A 3EJSA 2XVKA 3WMSA 1R75A 2EEXA 1IZKA 2EADA 4QAWA 3CC1A 1GVIA 3H55A 4FNRA 3ZT7A 3D50A 4GI8A
chains in the Genus database with same CATH superfamily
4LHUG 3VAEA 5ILTH 2VCOA 5IB1A 4OZFH 3SDXE 3U4AA 4QXGH 4DZ8B 4YSQA 1RUQL 3KDMA 2VRQA 4R7DB 1HHGB 1FP5A 1S6NA 4HUXA 2E46A 1BYPA 3NZHL 2J7LA 2CDGB 4NYLB 3VXTB 4RGMB 4XBMA 3AW5A 5CM1A 1GTFA 4MRBA 1FFQA 1JV2B 3O2VL 3U9PH 3VFMB 4WWOA 3F6JA 2VJXA 1RIVH 2WK2A 4P2YA 4QT5A 1V8HA 5DUML 4LRIC 4KKBC 1BM7A 2UY7A 2DQCL 4Y1AB 1JZHA 1U91B 2F53B 2IMMA 2I07A 2YJQA 1UJ3C 1ICTA 1AHKA 2BFGA 1CXFA 4R4ND 5D7IF 5EMYA 4PVMA 2D2CC 3RFZA 2BOCB 5HDRA 4RIRB 4XH2B 4NZTH 5D71L 4Z3HA 4Y7MA 1E6JL 3QQ9D 1ODAA 1MPAH 4OT1L 1NIDA 5C0DA 7TAAA 3ULUL 4N2IA 1UD5A 4K9JA 3QPXH 3H42H 3I6LE 3QO0B 4NP4L 4B6ZA 2JXMB 2ZUWA 3V6OA 3T0EB 3RIAK 4UIMA 2YEZB 3WI9A 4M3HA 3Q43A 3BO8B 4FQCH 1TSHA 1OSZA 2NXZD 3CVBA 5D7LA 3LEVH 2QDVA 4ZFFA 3HHSA 1N5YH 2OV0A 1G9NC 3AREB 4L4TE 4M4PA 2E6JA 2DQMA 2YPLD 2Q86B 3HS0A 1RPQA 2RQEA 3EBIA 4M6OH 4AG4H 4KI5E 4AZ8A 2QVMA 4XMUA 1ID2A 2APTA 2PCPB 5IOPB 1XB3A 2R0WL 1XD1A 4P46C 3FCTB 5CLXA 4HPHA 2X4RA 5T1LD 4U33A 2H26B 2R29L 1MWAA 3QFDA 5IEKA 2X6CA 1Q1JH 3IDIA 4L48A 1FGVL 4MDRA 4PR5A 3EF7A 3MBXH 1S9XB 5IGXH 2YQ2A 3EJCA 3DVGA 5LXGH 2NXZB 1MCQA 3FRUA 4J12A 4PVLA 1RJYA 2O5XH 3RVWD 4ICXA 5CMAA 2IDUA 5I6KA 1XR8A 4Z7WA 2UV3A 4ZMYA 4G82A 1BHGA 3CZEA 2OMXA 3HC2A 3MRQA 4MRCA 3GXNA 1MIEL 3X3FH 4CN4A 2XRAH 4CBZA 2ZONA 3RKDC 3QEHA 2HTKD 2V5RA 1X5MA 2AEPH 2I07B 3A3YB 3TVMB 4IEFA 4X80H 1RU9L 1A64A 2PWDA 4EN2A 1JZEA 1BAFL 1ZA6B 3EH3B 5EC2A 3LXUX 2Y2TA 4HXAH 2D0HA 3OLDA 3RI5F 3VGAC 3LKOB 4HCFA 3T3ME 3TFKC 3W11C 4JANA 5J7CC 1SEBA 1GMIA 2ROYA 1DUYB 5BS0D 5DEJA 1SGKA 5AYUH 1NDGA 3C75A 3EFDH 3UJJL 1DUZA 3LRLA 4BINA 1KMGA 3AACA 3Q06A 2V2WB 3VTTA 4ZFFB 1LNUB 1MRFL 4PJ7A 3OKEB 4PV8B 3GLZA 1TEYA 3VTAA 3UXFA 2VOTA 4MNGE 1MI5E 3R19A 5DMIL 2ZQKA 2CO4A 3LH9A 2HFFA 3F12B 4NO3A 3ULSA 5C07E 1OK8A 2GAZA 1LO0H 3LKSB 4LHUD 4TN9A 3BHBA 1UKSA 2EE6A 2O5ZH 1USQA 3CBRA 4LSUL 1IBGH 2NSXA 5EC1B 4BFIA 3OJ2C 1FC2D 5F9JB 3TNMB 3ET9F 2K8MA 2CH8A 3IDIB 1KV7A 3O4LA 2MOGA 3H7LA 4Q8BA 3VFSB 3U36B 4QTHB 4YLCA 1CYGA 3ZDWA 4YSAA 5IHZA 2QGDA 2CO2A 3B2VL 3KPQB 5L0QB 2WNXA 3WY4A 2E75C 2FJGB 3P30H 4KV5E 5I75C 2BPBA 5AVTB 4OZIA 3SJVE 5KJRL 1T7VA 4ZW8A 2JSFA 2B9AA 1HN1A 4HGMA 1IFHH 2FIKB 4IRJD 4JFPA 2XA3A 4OZFA 2E9GA 4LHUB 3CC5A 2BS9A 5J3HD 3B6SB 4EAEA 4LOFA 3L1OL 3CFQA 4HJUA 2I27N 4FGMA 2O6EA 2AEWA 3EHBD 1N6VA 3LMJL 3GC3A 2YAFA 2P45B 2C3HA 1JK9A 4HFUL 1JWSB 3CLEL 3LHAA 3O3EB 4LSDA 3R0NA 1OAZH 1E9QB 1ZT7A 2W60B 3KL0A 1LO2L 5EC2B 3OMZA 5HJGA 1MJUH 4NUGL 4MD4A 2VL4A 4U3CA 1S7SB 3DARA 4WVRA 2WSDA 4XPHL 2HRLA 3UYRL 2XXGA 4JANB 2XYBA 4X4MA 4OLVL 1YNKL 3O3BB 5LVEA 1FIGL 5GPRA 4PB0H 3Q5OA 2NY0C 1K4CA 4XAKD 5C9JB 1OPGH 2FWLB 2GI0A 5FYKE 4NXSA 4DO4A 3QZWA 2EDHA 1RZFH 3GI8H 1LEKA 1OTUC 1QWNA 3EHBB 3L9RA 5FGRA 2AJVL 4D9LH 1VKXB 3FQ4A 9CGTA 4H44C 2CSPA 5HGBB 3PNWA 5T3ZE 2HSIA 3KLDA 2DMBA 2XWCA 2YA1A 2AXFA 3DIVA 4IIQB 3BFQG 1I7UA 3NQKA 4N3UA 3OX8A 4PP2A 3Q6FB 2JKRM 1JNNH 4R7XA 4OCSH 4F20A 2YA2A 2ORBL 3M86A 4DAGH 1MCOL 2J8OA 3KLHD 4YC2B 2OMWA 1ADQH 5HHPB 3ZUNC 5HHQB 1I8KB 4KXZI 4M6ML 1FCGA 4FKKA 4E5XA 3P02A 2Q0ZX 5IHZB 1QFUL 1O6VA 4EIUA 4XODA 3P40A 2D4FA 5ESVA 3ARBA 4CC0A 3MTXA 3P1VA 1KF9B 1SOXA 4AQ8C 2ZX6A 4K55A 5FO8B 3NJHA 4GBXC 1JZIA 1BQLH 5KYWA 4NC0B 3KW7A 3VWKA 3S9DB 2WLZA 3IRCA 4MHHG 4NKMB 3WKMH 4XTRC 1TLKA 1XB6A 4MCZA 4YSTA 1DO6A 3INOA 3KPLA 5FAAA 3WAKA 3Q5TA 4LSTH 1J0YA 3G3LA 3QQ3B 4AUYA 1ZS8A 3ML9A 4OGQC 4YXLH 3BUPA 1T7ZA 2A9NH 4WTZG 1SHXA 4N9GA 4MD4B 1KBWA 4PJIB 3LVEA 2V9RA 3FZUC 4OSUL 3TJPA 1YMHB 2D3VA 4YHYB 3HG2A 2FGWH 1N7MH 3QDGE 5AL8A 1T1ZA 5DK2B 1K4CB 1KENL 3BVXA 6CGTA 4I0PB 3HI6L 4UYQA 1NANH 3INUH 5H2BA 2VDPB 2X1XR 2Y5TB 4AM0Q 1W8EA 2Y07L 1D5BA 1RULH 5EWIL 4D0CA 1FNGB 3UBXI 3BDBA 1A6TA 1CMOA 4LK4A 3PJSA 3U7WH 3WNIA 4W70A 4IGBD 3L9RB 4M5SA 4UM9A 3QR1A 5JDSB 2BOBA 2D7OA 3ARWA 3L45A 3P69A 3A22A 5KANG 3NDZE 3RAJL 3FU7A 3GHBH 1IO4C 2F2HA 5GISH 1NGPL 1Q90A 2Z91A 3N1QC 2DQFA 2FHFA 1TTRA 2RGSA 1FZJB 4HOWA 1T03L 1KB5H 3NEEA 4IBVA 3FS9A 1ZEAL 4B3VA 4OD2A 1XQ4A 2YAHA 3BGFB 2JCWA 1Q0EA 4L2LA 5DZOA 1HVXA 1CE1H 4KXDA 1SLXA 2EDNA 3T6QC 2E9JA 2FT6A 1QHOA 3MR9A 4OF3A 3JUYA 2X10A 2BWIA 1MFNA 1Q9LB 2CK2A 4PY8I 4QYOA 3QZOA 1QFWL 3HE6A 4FXGC 3MRFB 1GAFH 3BLBA 3OLEA 3P2BA 4K3DH 5FHBH 1UOKA 1TETL 3F7PC 1P5VA 1Z7JA 3L4YA 3RY6A 3LIZA 1QW9A 3DSNB 1SJXA 4LKCA 5I15H 1W15A 5BUPA 1ZT4A 2J55A 1ZS8B 2Q3ZA 1ZLSL 3CK0L 3AM8A 3DX8A 3UO1L 4EXPX 1YDPB 5J06A 2BZCA 1UH4A 2WCGA 3AU1B 1S7TA 4YHLH 1D5ZA 4J7RA 4AEHH 1IC7L 3N43F 4TVPE 3TCTA 1IGYB 2ZWNA 2ADJA 3MDJA 3PWJB 3V9EA 4N1EA 4PJGF 2NNCA 1KLGA 5AG9A 3LPFA 3TBSB 2ZXEB 1G7PA 4FA8A 3L2MA 4ATWA 4G6AD 4IBYA 5DURD 1N8ZB 2KL6A 3E6HB 2ZWYA 4PRNA 5E6SB 1I4FB 4NQCB 5D8JH 5DD0H 1KULA 1T6BX 4XXWA 3TBBA 2OYMA 4PRHD 3PDOA 3Q3GA 1QVOA 1AJ7L 7PCYA 3DHMA 4HISA 3RGVB 5AB9A 1X5IA 4B5ZA 4MD5B 2Z91B 3KAAA 3TASA 1HXYA 4C4KO 5A1AA 2OP4H 4LCWE 1IGML 1XGZA 3WGUB 3CXHK 2R0ZH 3QXWA 4ZOCA 1ZK5A 1JHKL 3UJTH 3UEQA 4OD1H 3FXIC 4ALAH 4MNQA 4V1DA 4NZDA 4YN3A 3QJRB 2CRYA 1OQXA 4YDZA 5L7XH 1QYGH 1RK7A 3MI6A 5D2LA 3D12B 5MHSD 1KT2B 4IKLA 5I0DA 2F8OA 2FZ3B 3QDJB 3HFMH 2OYLA 3OAYH 1J1XL 3HG4A 4QYOB 4CILA 2Q10A 2F1EA 5ID1A 1QX1A 4RISL 4PRHB 1XF3B 2KPWA 4KROD 1JD7A 3LKNA 4BELD 3GZKA 2P5WA 3IFNL 1HZHH 1YPZE 4ZW6A 1DVSA 3MRCA 3JWOH 4PG9A 3VRLF 3ZL4H 4LKCB 4XP4L 5I1EL 3TWCL 4NO5A 3UC2A 3T1WA 2EDQA 4LKXA 3NRPA 4E9RA 1OW0C 1LO4H 1TIUA 4QUOA 2NNFA 3ATEA 2AZAA 4BZ1H 4GXVH 3WYRA 4A7QA 2YMXH 2GDUA 3UC0H 4ZX6A 5AAPA 3CFBA 5B1JC 5IMKA 1PLBA 4FLQA 3G9AB 1ACZA 3VXUB 1EVTC 2VLMD 3RWHB 2Q1EA 3WJMB 3N1GC 4ORGB 5C0RH 2YD8A 4KROB 1IGJB 5FYLH 3LEVL 2YC1B 5FO2A 4PRNB 1M7XA 3LRGA 2WZ0A 4JDVB 4RCAA 4L3EE 1IM3B 3TBWB 3PDOB 4HJJL 4P07A 5BV7H 1QBMH 1W80A 5F7BA 3FT1A 3ARFA 4UOW0 4KGJA 5B8CB 4Q9BA 4MA8L 4DUXA 4YAQA 5T3XE 5KW9L 2DQDH 4WO0A 4QOKB 2YD2A 3ABMB 4NDMB 2WKOA 1D9KA 4RESB 5E23A 3TO2A 5L6YH 3CN3A 4PRDA 5JW5A 1A6PA 4BYHA 3RL2A 2Y7NA 3IFLL 2NR6C 5FKAB 3RIFF 32C2A 3N1PC 4N8CH 1WHPA 1UFUA 5IVOA 5D2LB 2GHWB 4OIFA 7FABH 1KB5A 1L7TH 3OB0K 4PRIB 1YEKH 3MGTB 2IAMC 5EEZA 4WKXA 4HHGA 1NCIA 5D6CB 1KPRB 4P3DA 5IHWA 3QIBC 4B7IA 2EE9A 1K3ZA 1FZKA 4B0MB 3SGKA 2X3CA 2BMKA 2DW5A 2RA1A 2DEYX 4F37K 1WBXA 1OANA 4OB5H 1I1AB 3ROOA 4DW2H 5HPOA 1D5XB 2YD1A 3L1FA 4JFDA 3ULUE 1ZHNB 2H32H 4B9PA 1RCYA 1PW3A 1AGEA 5MERB 3WDIA 3IMTA 2AXJA 4R26L 2MTAA 1MCDA 1B9KA 1GC1C 2BC4A 2X4NB 2FQEA 3COOA 1H6TA 1KXHA 4HXAL 3QIWC 5HHXL 3BKJL 4NO2B 5A16B 4XNZC 1GC1L 2ZT9C 1Z5LB 5GGUA 4KWUA 2ZCKL 5EU7C 2R1WB 1YEGL 4PWGA 3CLWA 4BFGA 5CD5D 5JHLA 1P4BL 4Q9QH 4IBSA 4LAQL 2WP3T 4U2ZA 4FQPA 2DQJL 1N67A 1E4KA 3DX4A 1RZJC 3LHPL 2AJSH 3K72A 4PJHA 4GKNA 1VB9A 3ALPA 3KH3A 5JLZA 1S9WB 2VLLA 4MJIE 1RZJL 3IXAA 3SYCA 1SVCP 2AK1H 5SV4A 3IRPX 2RBLA 3QIUC 4PJ8D 1TT6A 2IVFC 1MHEB 5IZ7A 4X99A 4HWBA 4WI9A 1RKRA 3TO2B 4U3SB 3GM0A 4WZ9A 3GMPA 4PRDB 3DTUB 5GGTL 1CDGA 1B4LA 4AYFB 1F4AA 4K3JL 3WXVL 5L6YL 1S5IL 1FFNA 5KVGL 1ONQB 1M6OB 3HHRB 3Q05A 5E1AA 1K6QL 5IUCA 5IW1B 1U41A 2DLTA 3U30C 1T04B 5A3ID 1CD1B 4ZZKA 5HDBE 3RGHA 1PZDA 4NX0A 4Z3FA 1R19A 1WK0A 3D8MA 1T6WA 1OSPH 3IDJA 4ERSL 4PJFE 3QUYD 1FL5B 4RMQA 5I16A 2B3IA 5FX3A 1RUKH 2YFNA 1WFJA 2OMUA 5D93B 4PY7A 5DU7A 5EO0A 4DZBA 4MMZB 4L4TA 4CGTA 4GKLA 1RZPA 1MCPH 3EIFA 3VX0A 2X6AA 5D1QC 2XZQH 1VPOL 2P9RA 3IN0A 4JZJB 1AGEB 3EW3B 4KNTA 4XX1E 1GTNA 4RA3A 3WHXA 3MV01 3ZKNC 1YNLH 4Y4HA 5ETUA 4P3CH 3B9DA 5T1KD 4I77L 1T1WA 4BZ2A 2ZOUA 5FXCH 1JXJA 2JMRA 5JHDD 4TSCH 5I30L 4U1MB 4MA3A 1DSFL 3S48A 5EEWA 1NBZA 1X5YA 2CLRB 5DZNA 5J13B 1S8DB 2YZ1A 2AABH 4L8DA 4K7PL 2QQLH 3HMXL 1D5MA 2W80C 1XCWA 4YLQT 3TV3L 3BWUC 3KNBA 3EDDA 4JY6A 4LCCA 1H3PH 3SDXB 1WGOA 2JI3A 1U6AL 3UYPA 5JZ7C 2H0PA 1RZFL 3GI8L 4GKNB 5KEZA 3ARRA 4NHUA 5JLZB 1U3NA 1BJ1J 4IKNA 4QEGA 4OFPA 4HV8B 1BJ1H 3DUSB 1L5GB 3GK8L 2VR5A 2AXGB 3T0BA 4NQXB 4X6DE 4PRAB 4TYUA 5CFHA 4L18A 3ZKMD 1U92A 4EIGB 1F6AB 4UT9H 4PIRF 1A1MA 4WHCA 4XNBA 1E67A 2ZICA 2BVQB 3EG9B 3TN0A 3FC8A 3HAEG 1AC6A 1QTSA 3IE4A 3Q6GH 3V5KA 4FQJL 3MUUA 3WSQH 4M7ZC 1AKJD 3B43A 5D1ZI 4MAYC 1AD9A 1T5KA 3UTSE 2LGNA 3EJPA 3N06B 2B5IB 4DQOL 3VA2C 3FT9A 2AW2A 3A0OA 4PGZA 3DRQB 3H0TA 3SBWA 3SPVB 5GZNC 3RX9A 3M17A 4QAMB 5B38G 4I18C 3IDJB 1OGAD 1ZAGA 3LSOA 3RX7A 1M1XB 2OMYA 2BH0A 3DV6A 1ZIAA 2EH8H 3NACH 4DZBB 2YQGA 3WJJC 4MNGA 1MI5A 3EYOA 3F83A 1FNHA 1JSYA 4LLDB 3SGJC 2NNXA 5C07A 1ORSB 4YXHH 3NJKA 1A14L 4AITA 4DVRH 1XBRA 4NEHB 4RWYH 5FK9B 4IKJA 3NCCB 4GPVA 4QRRA 5I0YA 4Y19A 2R27A 2W65A 4KK9C 1G1KA 2VR8A 2XZAL 3OZLA 3JBG7 1PG7X 5DYOA 4XMPL 1IC1A 1RJLA 3Q8CA 4HGKC 1RUMH 3U1QA 5JW3H 1BQSA 1NBZB 4KHXH 1FNEB 1MFVA 1ZA3A 4BQ8A 2MTPA 4OM0H 1HAWA 1OGAB 2GJZB 3MFFB 4Y4KD 5K59F 1PD6A 4H7VA 1NKOA 3UZEC 4B9ZA 5MEND 1C08A 1RZ8B 3B2UC 5E94A 2E6PA 4ZD3L 3PV6B 1OCOB 1JHLH 1S7XA 1S7UA 2QVIA 5DJ0A 3SJVA 4Y1SA 3KHQA 5FUCC 4HJIA 1N12A 4TTDD 5FOBA 1LEIA 5DJ8B 2R7EB 2A73B 3GZOA 1T7XA 1J5CA 3OKYA 1FNLA 1C1EH 1EV2E 4PJ6A 4F9PC 5SWQB 2M26A 1OCRB 3GWJA 2WQRA 4PSRA 4BKSC 3D69B 1XAKA 2YFOA 2APVA 4UYPA 5I5MA 3MUJA 2LU4A 2ZUUA 1ZHBB 5J6HA 1AD9B 5CN1A 2IJ0C 1WRFA 1XL4A 4F2EA 1S9YB 4CN1A 4U6YB 5MENB 3QJFB 5BRZA 3LPPA 1OF0A 3F7LA 1TQWA 4LDOB 3HI5H 3LSOB 3V4VB 5ESQB 1DFBH 1EHNA 2OMYB 3LDBB 1KGYE 3NIFF 4K3DL 5FHBL 4AZUA 1PFCA 3CN1A 3GSNB 2WN2A 4L4JA 1JAEA 1MI5B 2ITDA 2ZWLT 5F7HA 3MA9L 5GZOC 2VDKL 4HIHA 4YGAB 2Y7MA 3FJTA 4Y4FD 1W0YT 3K4AA 5KYNA 1QBLH 2EDEA 1FFTB 4JPVL 1GZHC 2FO8A 3D51A 3KWUA 3TBVA 2EP6A 1JPFA 3OL2A 1IKNA 4JFVA 1I9RH 1HSBA 2A9CA 2WIIB 3UAJD 4M7KL 43CAA 1UACL 1ZHLB 3CV5A 4CVUA 1TQBB 2WN3A 3VU1A 1GS6X 1BZ8A 2IIJA 3A6BH 3H56A 5EPMB 4EN3A 2HWZH 1B4RA 2QVTA 2GK0A 2J6EH 4MMXA 4OF6A 3T4AA 1I9JH 3RWGB 4GUPB 1NGZA 3DO7A 1BLIA 1C8QA 1DDHB 4FQQB 3WUWG 3QI9C 5FYKD 2VXSH 3QJZA 3O9WC 1JNHB 3SZKC 1HYSC 5LCVH 4OD1L 1M7IA 3CVHB 5CIPA 1V7ML 2DJMA 3RDTC 3GO1H 5F93C 1BFSA 2ATKA 4JE4B 2HG0A 2VO8A 2EVJA 4GAYB 1QI5A 3N50A 3STZB 1AHMA 3TYFA 3W2DH 1KJ3L 1XSIA 1F86A 1DYZA 4HUMB 4TMPA 4U1GB 1UC6A 3SE6A 1MKFA 3KYKL 4P5RA 2Q6WA 2I24N 3HAEB 1A6VH 5EB9A 5DYFA 1Q9KA 4CMHB 5GS1B 2BX5A 1EUUA 3NA4A 1TQCB 2R1YA 1P7KA 4HZLB 2ZX7A 1T20A 5F7DB 2IBBA 4LNRA 3SOBH 3T8MA 4G8GE 3CMGA 2YR3A 2Z8SA 4R7LA 3QYNA 4C57C 4M00A 1NUFA 2ITDB 5AAMC 4FNLL 3GI9H 3E80A 5AOLA 5B38B 1SHWA 4ONHA 4IKIA 3IB4A 4G7YH 1MCWW 4AOFA 4UUJA 2J5LB 2W5PA 4U05A 4BWUA 3UAEA 3FUHA 1JCVA 2BNQE 3GBDA 2EC9U 2VJ0A 4FX5A 3OKDA 4UNUA 3TBVB 3UC0L 3U46B 4H25B 2Y7QA 5GSRB 2QT6A 5FW6A 2B59B 3WEAA 1V10A 5C0CA 5CSZA 4P23C 2NNRA 2VLRE 2ADGA 3PIQA 3R4DA 4LPVA 1NGZB 3B7RL 4IJTA 3ARVA 1Q94A 1PEWA 4KFMA 1I3UA 5E8NA 3T04D 3UGXA 2HMIC 4JFEE 3O6FD 2VMEA 2XZZA 3C6SB 3X3GL 3D39E 2NOYA 4OCYH 3Q8FA 1KCRH 4DGVL 4YX2H 2RH0A 3TJHC 3DIFA 5ACZA 4MA1B 4YE4L 4U4IA 1R24A 4X6CB 4V11A 3D09A 1J9TA 5DRZA 1G9NH 2HX7A 1PG7L 3D0VB 3JYBA 1JF5A 1I9EA 2X9ZA 1E4HA 3D4GA 2R1YB 3QDGB 1PZCA 2WO3B 4M4RB 3JWNH 2VDQB 4JM2A 5FM5M 3PL6D 4MXVF 1OP3K 3MZGB 1HI6B 1CWVA 3FU8A 4HJEA 3Q5YA 4ZFZA 3RNKA 3O6FB 4RDQG 3MRBA 5GRZA 3WN5C 2FSEA 4YK4B 1J0JA 1BVNT 2FEEI 1IVTA 1KEGL 1RZQA 3BUYA 3OKDB 3BZEA 1ACYH 2A6DA 4NUJA 4PP1D 4LCWA 3LH2L 2E74C 3OR7A 4GOSA 3PFUA 5BMFL 1JGDA 1JOIA 3H9HA 4WENB 1U3HB 4N0RA 3AT0A 1SEQH 5ICYA 3CD4A 1UZ6E 3B9KC 2XX0A 5CSZB 2GCYA 1J8RA 3H55A 3F7VB 4HSAC 5IBLD 5ISZE 4FFTA 2A3TA 5I1KL 2ZKMX 4WK0B 2N01B 5J4MA 3OC5A 4PBXA 2B08A 1ZLWK 4ODVH 1D2PA 3MRJA 4PGEB 3EGXB 3BUIA 4M8RA 1TO4A 2R56L 4OGXL 3UX9B 3ZDXE 5FCUH 1UD3A 2J6EA 1CLZL 1YPZA 3ZTNL 1KIRA 3QQ4B 1I8IB 2Z31C 1EEUA 1KBKA 2CXKA 2D7MA 3CFUA 3EOTH 5FGBC 4B60A 3WUWB 4MVBD 4LLWB 4RX4D 3L5IA 3MRKA 5HI4C 3PWNA 1QNIA 3FOMA 1RZGB 1DVFA 1FZMB 1YJDL 3KR3L 2JNZA 4HGWA 1CXLA 1I1RA 2O5YL 2BNRD 4XO8A 3MV8A 3VX1A 5GJTH 2CKBH 1S7WA 1YMMA 1GY2A 1CGSL 1RV6X 3CX2A 3DBSA 1MFAL 1TJMA 3SQBA 2F5AH 1ZY9A 5EU3A 4BFEA 4GKSA 2FBJH 4R96B 4RNRA 3AITA 3AB0C 3G6JE 2D3JA 4ZS7L 4AGQA 4L3EA 1N6QH 1J9QA 4U6HB 2LAGB 3H3PH 2FLBT 5SWZD 2YK1L 5D9SB 2G3NA 2NYKA 3WE6A 5HYSA 1UT1A 4P3CL 3BZEB 3QORB 3BH4A 4NUJB 5J56B 5E2TH 5JOPE 2HH0H 5F88B 3D3VD 1MCKA 3H9HB 1FO0H 1A0QH 4R3SA 2BNRB 1AGCA 4XRCA 4WF7A 4FI7A 4GRWF 5I66A 2QQLL 3OB8A 4MLSA 1B4JH 5CJBA 3WGVB 2XT1B 3VB9A 3DECA 5DK0B 5DJXA 3OG4B 5H37A 3ZGIA 2HX9A 4EDXA 4TUJB 4DK3A 1A2YB 5B7EA 4Z9KB 4HOMA 4HYTB 4I13B 5IHUH 3QG7H 1U33A 1ZDQA 2V8MA 3P3TA 5I18L 1L7IL 1RP9A 3DETD 4XX1G 1GZPB 5B1CA 4XAWL 5J9PA 5KVGE 4LRIA 5L9DH 2ZTBA 1MAKA 1DCLA 3B7SA 4K9EC 4QMEA 3U0WL 3P3RA 2N0MA 4NNPH 4U4BA 1DEEB 4FXKB 4GAGH 3SGEH 1YEHH 1DJGA 3FT4A 3LQAC 3D3VB 3KMDA 3LZPA 1KJMB 4LCUA 5CLWA 2YHGA 2HKFH 3BGAA 1DQML 3HC0A 2AXWA 4JFFE 3V4LA 3CSYA 5T3XD 3LQAL 3EGSB 4JCMA 4HGWB 4K8RC 3W9DB 3WFBH 1G6RL 2V7HB 3SY0B 2DH3A 1OAJA 2EE0A 3CFIC 4Y16C 1YY9C 5BUGA 5HHMD 3MVSA 2OMVB 3CIAA 1NLBL 1VGEL 3MLRH 1T89C 5TTRA 4K8RL 1BMWA 5J11C 3VCLB 3DV4A 5F71A 1HE7A 3EFOB 1QACA 4JHZA 4M7JL 3SQBB 2D7QA 4DKAA 3KZ8A 2QSCL 4LT7A 3E9TA 4OCXH 2XTJD 1MFCH 5D1QE 1JNLL 3LNGA 1H8LA 1SHMA 1UA7A 2VN3A 3M7OA 4PJXB 3US9A 4L3EB 1GR7A 2FJFA 2PWEA 2R29A 1Q72H 4WUUE 2UX7A 4MJIA 4PSPA 2D7TL 2DI7A 3F6IA 1JZ6A 4P46A 3T6VA 1CI3M 2P42B 1UEMA 1O7VA 4UINH 5E4AA 4D0DA 1SJHA 1EERB 4QIRA 4DTGH 3L4TA 4XP5H 1HSAB 3HKZA 1MLBA 4ZPTA 5DZ9A 3VFVB 4DOHE 4NIYE 5I66B 4OM0L 3RIFK 3AUWB 4AKPA 4LMQI 1HQRA 1NPNA 2X2HA 5F9DC 5D70H 3CHRA 4JFXB 3VD1A 4FLSA 2ALAA 4ZS6C 1NC2D 3N04A 4X2UA 4FFZL 1OAYL 3TL5A 2FX9L 1LE5A 1HWHB 4MS8D 3L4VA 2A38A 2DEWX 3S2CA 2VN5A 3BAJA 3QG6A 3EDKA 3AXHA 4JMNA 4PJFA 2BSED 4ISVB 2OS7A 5KSBE 4FC3E 2PN5A 3Q1SL 5TDOB 1O6SA 4H8WC 4X4YB 1E5YA 2CIIA 3QJHA 1T1YB 1OTTC 3HPJB 4GAAA 5A6MA 2DWDB 3GM8A 4GP8B 1UB5B 4I3RL 5CCKH 5INDB 1QABA 5DD5L 3PABA 1G9MH 3NIGE 1G7QB 1E9OB 1LHZA 3ARTA 2G2RB 3KBHE 1ERNA 2VR4A 4WI8A 1NC2B 2DQTL 4N1CA 2F1BA 3LS5L 2CK0H 4YDKL 2H1PL 1ZRUA 1MG2C 2FVNA 4OH2A 3ARUA 4L29A 4EVNB 3TBYA 4AMKH 3AS2A 5JNYB 1GGCH 1MF2L 2AJZA 2CKBA 1FJ1A 4LSSL 1OF2B 4HKBA 4NXKA 1PY4A 4UQ2B 2ODIA 1QLFA 1URZA 4F33B 2OX5A 5JOFA 2NPLX 1F56A 1QEWA 4I85A 1JZFA 4X6DA 3KLQA 1URIA 2JIXA 4ZG1A 5HYJA 4NRZA 4WWKC 3TPKA 2AEQL 4UQ3B 3ARYA 4UT6H 5I8OH 3LQMA 5HVGB 5C2BL 1A6UL 3VYOA 4N0YL 3U2SA 1N64H 1N59B 3BZDA 2VLKD 3AG3B 3AAZA 4YHMH 3UTSA 1FO0A 2X5PA 4YHIA 2WUBH 5FUCE 4I2XE 2JE8A 4MNHA 2HTLD 2Y7SA 1QLEL 5T5NF 1G5AA 1PX8A 2FSDA 4NQDE 4RZCB 1KGIA 4MXQD 3VXOA 1KIUA 2IG2L 1TZOA 5FFOA 2WWMC 1P4UA 1VENA 4P59L 3F65A 4PWJA 3APMA 1SN5A 4W9FC 2NZ9C 1YCSA 5DO8A 4RFNB 3FQWB 2FUQA 3L54A 4XN1A 5T8IA 5J8OA 2V0AA 3WTWA 1WH0A 4QXTB 3QJHB 3MO1A 5CJXC 2B4CL 4I9WE 5DHEA 1EAPB 2FO4A 2PTTA 4UCFA 3M46A 2OQJA 1S7VB 4MQTB 4NNYA 3PABB 1NMAH 4IYKA 5A7EA 1YQVL 1TTCA 4BKLA 1NFIB 4EQ2A 2VMDA 4JRYE 2HT4C 4QO1A 4N5ED 1DVUA 1SXZA 3RHWF 3FSZA 1I7ZB 1X5FA 1SYSA 4L1BA 2H41A 1EHLH 5I28A 1E6OH 2A4ZA 4HKBB 4X4XB 1MNNA 2R4SL 4NWTH 3F05A 3PWPE 5E1QA 1R5WB 2OMBA 4APQA 3TT3H 1WLHA 1RZKC 5IF0B 2VQTA 3FN0L 4U1IB 4OJEH 5EIIA 1KCUL 2X70B 2XLLA 4QRPD 1E9PA 1IBHA 1JPEA 2F7IA 1YVLA 5DJ2B 3RNQA 3STBA 4HIJA 3T0VA 5HI5C 5C0AA 4DHLA 4GW4A 5INCA 4LAJH 4ENEC 4ES9A 4Z77A 3DTXA 4JFQB 5IR1B 1EXHA 4P49A 1T7WA 1A7BA 1IAOB 1IGTB 1TJGH 4AQ8A 2CD0A 1V3LA 4CAGA 2GSIA 5I26A 1L6ZA 2NNAB 2FATH 4GBXA 1M1SA 1NZRA 4P2RD 5LBSH 5ADPH 3NSCA 1HNGA 4NNXB 5FC9A 4KK5C 3QH3B 1P4LB 1HK6A 3P11H 4PD4K 2IO5A 4FHKA 4PRPA 5TDPA 4S2SA 5BUAA 2NY3D 5EEUA 4M93C 1MEXL 1U8NB 3J07A 4KDVA 1B88A 2PP9A 1D5IH 4JZNB 3CFKB 2Z92A 2ZUQC 4H8VA 5K1JA 5I1JL 1GA2A 2WJ5A 5E99L 4IRZL 3QEUA 3CFCH 3MO1B 2ZJSH 4ZTOH 1E50A 5JIDA 1ROWA 1R3KA 4CVWA 4E36A 1IQDA 2FO4B 5K39A 3TPUA 3AS1A 3LY6A 5CZKA 3ZSTA 1AZNA 4KTEL 4RGNC 2P80D 5AZEH 2Y0SA 4OLXH 4UAOC 4XHJC 4P2RB 5GS0C 3LRMA 1JVOA 4YHOL 5KG9A 4X5WA 5CLZA 2CAKA 4U49A 4W9LC 3TIDA 4AXWA 5GS0L 2XWEA 2NY3B 2GFBB 1CZ8H 3BSGA 2GSGB 4G43A 4M1CD 5I5IA 1WFOA 3FB6B 3AT9A 1R3JB 1XZ0B 4J3OG 3VWJB 2EQDA 4TULH 4DJMA 5GXBB 4J39A 4WV1B 1ZCRA 2ZG2A 4GW5A 4ZX4A 3SYPA 1ZHKA 4M5YL 1GOHA 2LLNA 3WIFA 5AWNH 5HHOD 4XNQB 3BWAB 1N5AB 5I1LB 1URLA 1XF1A 4JPWL 3PXHA 25C8H 3ZIMA 3MOBH 5D7LD 5INCB 3IDXH 3AWGA 1YY8A 1AXTL 3TIEB 4DNLA 2QJDA 2X1OA 2OK0L 5L88H 4U31A 3D0LB 3ESVF 2VH5H 3PFQA 3WMPA 3J2PA 5H35A 1B0RA 1CCZA 5A2CA 2PMZA 4GG6A 2NUTA 2B7DT 2D03L 3QULA 2DWEA 4FXGA 5E6IC 3CQQA 2W0FB 3H9SA 3T2OA 2YBGA 3VXSE 4FYRA 1P2CA 4G8GA 1FYTE 1Q9WB 1XIWD 4JKMA 1KDJA 3WNJA 4HULB 3WL9B 5DJCA 4KGLA 2JKLA 5LQBL 1J1OH 1R3KB 2P8MB 3EH5B 4YWGH 4KZEH 1GYAA 3HW7A 5D7HA 5CBAA 2X28A 4LCIL 4NFDA 2JELL 4P05A 4WU7A 1GIGH 5AOMA 3SDAA 2XI9A 5EHFA 2R8SH 1F8TL 4LASL 2I60H 3T09A 5C0NC 4FQLL 3DXAD 5DEFA 4HPOL 3TGXA 1SYVB 3ME0A 5LN4A 2GBUA 2IBGA 5IB5A 4KDWA 4OLYL 2K3TA 4XB7A 4G8FA 3V0EA 4F2MB 1ZPUA 1EZVX 2AV1A 1BVKA 4ZZFA 3RUGB 1U8MA 1X5HA 1XIWB 3DX9B 1UCBH 4RSVA 3QQDB 3DMMD 1CD0A 3MGOA 3D07A 4GW5B 3FPXA 4KO6A 1XGTA 3CC1A 5CINH 2NY5C 2HJFA 2YKLH 4GW1A 2CDEA 4JFEA 1SLWA 4PJ5D 4B41A 1W2KT 2A99A 3DXAB 3FTGB 4LSQH 3D39A 1G4RA 5F44A 1TPXB 3NPZB 4XPTL 5D2LF 4G7RB 2NY6D 3ZOAA 1HHHA 2BNQD 4QXVA 2N1TE 1M71B 4FLOA 5GGVH 1UM5H 4QKTA 5JPMC 3V95A 2NUTB 3BZ4A 3RA7H 4N90D 1RURL 5I1CL 1A21A 2ZXBA 2E8YA 2PWFA 2YAMA 3DMMB 4K15A 5CILL 1FORL 2OW6A 2ZUYA 4KQ3H 2HB0A 2EIZA 1EMTH 1KPVA 3NA9L 3FTSA 5JIPA 3EGDB 4BFBD 1N8OE 1NBVL 3S7GA 4XMLL 1OW0A 4A6YL 2AMUA 4XCYB 2CO7A 2OI9B 4PJ5B 1NCDL 4FERA 3VO0A 5EN2A 4MX7B 5CBAB 1V55B 5DFVD 2XSKA 1U8QA 1AFVL 2LVCA 3VFPB 2NY6B 2YMOA 2BNQB 3PCYA 4J3OD 5B1JA 5EUKB 1IAKA 2MCAA 4AX3A 3UTTE 1UYWH 4NZRH 1PCSA 4GSQA 1U8HA 2G60H 2WLNA 2N7SA 3MROA 4GO6B 4GQQA 2FWUA 1H8SA 5GJSH 1ASPA 2MHAA 1AD0A 2IAND 4ECNA 4O5LH 4ZUTB 5MEOB 5IG7B 5L2KA 1KN4H 5ISZA 1U3JA 1P6AB 3WNMA 2VLRB 2WYZA 5HJDA 4BSVB 3FH7A 3HLAB 3MGOB 1KFAL 4ZUWB 5I1HL 4XNXH 4YDNA 1F00I 2C9VA 1PCXA 4QY8A 5BZDA 1YEFH 1YEIL 4X6BA 2PR9A 3FFDA 2QKSA 2AHIA 2C7UB 3IF1A 5FYJH 3K3QA 1YEWA 3N91A 2IWFA 3I02B 4N22A 2NR6A 1E43A 4J5VA 4AIZB 2FR4A 4G5ZL 3NCJL 1D7CA 5DDHA 1QHQA 4MDJB 4YO0A 3OR6A 3ZTJG 5C0BA 4Z18A 3V0GA 3W9EA 3FTUA 5IB2A 5ITFA 3SKUD 2IANB 2OJEB 1I7RB 2IAMA 2VDNL 3HNSL 2NX5E 2CIKA 2VZ3A 1NPUA 3WD5H 1XO8A 3QIBA 1AIZA 3LS4H 3GEFA 3ALWA 4K5NA 1L0PA 5HTSA 5LNEA 3CUPB 1FH2A 1OV8A 3IMVA 3HN3A 3B3BA 4JFZL 3X2QB 4F1SA 2HXAA 4FD0A 4TNGA 2EC9T 1AG0A 1CFNB 2V2XA 3TEYA 3WTVA 5AW4B 1BIHA 4LCYB 4PIBA 3GSOA 4YBLB 1JPGB 4PW4A 1E30A 1FRGH 4W9DC 4D9RD 2NT0A 5DQJA 1UCTA 3HZKA 2QHRH 1PAMA 1P1VA 3QIWA 4WEUD 1H3TA 4BFKA 3BPOB 2ZG3A 2Q3XA 2J4WH 4KTYA 1G9ML 5DS8B 2X6MA 5I1GH 5IY5B 4Z0BL 3FTWA 2ZXGA 4XNAA 3Q0HA 1N9PA 1H15B 5GIRB 2I26N 4OCRH 4AMKL 1B6UA 3SDXF 1P84K 2VERN 3IETB 1GGCL 4Z5RB 1TXKA 2FH6A 3ZR5A 5KS9B 1YECH 2P7TA 2NQ3A 4HFWB 4UV7L 5EU6D 1IGIL 5F6IC 2VR9A 5AZ2L 4AUUA 4HF5L 4N9OB 2EIEA 4UZSA 4AGNA 3KJ6L 3QIUA 3TV8A 3FFDB 4JQIL 1UGNA 3VW3L 1NMBL 2A77L 1HKLH 2G5RA 3FHAA 5BO0D 2NUPA 1BF2A 1ZXQA 2QR0A 4JQVC 4N0CC 5E8PA 3VXRA 5FUZL 3L5XL 2Q8AH 2WO2B 1NWPA 3X13A 5CBEB 3MLVL 5DDHB 3HE7A 2EDMA 4GRLC 4UT6L 3RVVD 2Y2YA 1JIBA 4PMEA 1X4ZA 3SO5A 4YHML 4D0BA 3VFUB 1UQSB 3CNKA 4Y2DC 1XH0A 3JTSA 3PXLA 1A9EB 1EWHA 1B0GA 2UWEA 3VXMD 3KPRE 5EU6B 1TFHA 4LDCA 1W0VB 3BJ91 4YPGA 1AGDB 2QQKH 1XB8A 4PW9A 4Y89A 1BX2A 3GLDA 12E8H 1EQWA 5D1QA 5LG1A 3BCFA 5EZPA 4X7SH 1INDH 2V2XB 4ZW7A 2YLKA 2ZP0T 3G6JB 4MQSB 5D1ZC 2BVPB 2NRDA 3PRZA 4KI5F 3VTMA 5L2JB 1FQ9C 3MRNB 3QPQC 1FVCB 4WUUA 3HZKB 1EO5A 4Z8FL 2CHNA 3HE6D 5EF1A 4FADA 4HDIA 4MQXC 4MS6A 2F1AA 3SDYL 4I3GA 3WHE1 3WJLC 1E4XI 3KW8A 5TGBA 2XG4A 3NCFB 3KLSA 2HFGL 3AG4B 1NANI 3ULVC 4JFYA 4JREB 2WTRA 4JDEB 1RIHH 1Y6NR 1KACB 1KXQA 3F5WA 3ULVL 1KELH 3IMUA 4JK0D 1MCWM 3NIDB 2VITB 4NZFA 4WAFA 3O8XC 4YGVB 4KRNA 2ZF9A 1NBYB 4L3CB 2CGRL 3OKLA 1EPFA 4NP9A 5F0LB 1HHKB 3W82A 3OF6A 4CC4C 5HXMA 1TLMA 1K85A 5KSBA 1YNTA 2HJKA 3FQRB 5IJVB 4HIEB 1OM3H 5TDNA 5GRJH 2VC2H 1A8ZA 2CCLA 1CFSB 1ZT1B 3X13B 5I76A 3LKRB 4XX5A 1TZGH 5ANME 4JFFB 2YXFA 3CMOH 4QRUB 3BGMA 1F97A 4LEEA 1KLUB 5CHNA 2DDQH 3NJMA 5FA4A 5GZNA 1NAMH 1UA3A 4LHQB 3T3MF 2K7PA 3DX2A 1CL7I 4I18A 4XT1C 3NK4A 4G6MH 2Y23A 2ZWZA 3D18A 4HPYH 3CWGA 1JI1A 3PDDA 4V1DD 3WJJA 3QPKA 3BI9X 1A6ZB 1WYJA 2B2XL 2XWXA 3SGJA 4QWWC 3I6KA 4GMTL 2H2SD 3BWSA 2Y3AA 3P77B 2V2TA 3BX7C 1INEL 1FG2A 2XVLA 4OFYD 4TOYL 5D96C 1NSNL 5E5MA 2WLIB 5CN2A 4LIQE 4B96A 4C8XA 1DJYA 4XWOD 4W81A 2GIXA 4L4VE 2WKLA 4OLXL 1O75A 1K9TA 4NN6C 3I85A 3NTCL 3X11A 3GRWH 1N3NB 3AWEA 1FBIH 2WAQA 3QUZA 3UZEA 1AZUA 4NQQA 4JFYB 2EKJA 1M53A 3F5WB 4KV5F 4PCTA 1YC8A 3BPNB 1E4JA 4I2XA 1EA9C 4EBQL 2ERJB 3ZDYE 1XH3A 3HVDA 1HC1A 2PO6D 1OSYA 1KPUA 2XXMB 4PLJC 4QJ5B 4ODWA 4NQDA 1XHHA 4CNIB 4F9PA 2E27H 1JL8A 3CXHJ 3ETTA 1QSFA 1QFOA 4YHNA 5K69A 3IJYA 4ZUSB 3AABA 3V52L 3MREB 3BH8A 2V7NA 2JCCB 5DHYA 1F3JA 3VD5A 1AY1H 4ZMWA 4X8GA 3C08H 2ZUXA 3MRHB 5A2BA 3NIGB 1GH7A 2DM2A 2G4EA 5I5JA 3SPIA 1UA6L 2E4FA 4JRYA 1REIA 3UJIL 4KAQH 1D9KD 1XGPB 4MDIA 4ODUB 1YYML 1OP5K 3V0VA 3UZQB 1EX0A 5GRVL 3RTQC 1A7NH 2W07B 5E7FA 4ODHH 3CG8A 1BWWA 2CRZA 4OVUA 3RWEA 4ZW5A 5IKCA 1EFQA 3FOLB 3QWNA 4PG2C 1K3IA 5I8CA 2ED7A 2Z4QA 1IAIH 5GZOA 5K9QI 3PWPA 1IQWL 1DQVA 4YEEA 1BM3H 3Q9PA 2EABA 3RKPA 2XQYA 3Q2CA 4G7VL 2Z8VC 4GSXA 4AI7A 2R8SL 3P4OB 2A83B 4AYDC 3V6BR 3SDCC 2EUZA 4DKDC 1M7DB 1SBSL 4MXWH 4L0ZA 5TD4A 1NTDA 3K4ZA 3QUZB 3HG0A 4U6TA 4PJ9C 2CE6A 4R8WH 4ZMLA 2YUZA 3ARXA 2MPAH 5DC4B 2WM0A 1G7MA 1THAA 1RVFH 4Z76A 2A9BA 4MCYB 4LF3B 5DJDB 3SKNA 3TA3D 4ZFGH 1F4YL 2C9SA 1W8NA 3WAJA 3GSWA 3PAYA 2AQTA 3CLFL 1YN7B 4ODWB 2DB8A 1FDLL 4OLZL 5F1SA 2QHLA 3V0JA 4A66A 2O5NA 4BRVA 2ETWA 3ESPA 2H47C 3O9WA 4JY5H 1NOAA 4ZUVB 4G6JL 1RZIA 2DIJA 2PWGA 3IJYB 5FUOL 1LO5B 2HLAA 3RDTA 4GY4A 2YN5A 4LLVB 1QI3A 1F3JB 3AADB 3D7PA 4E9SA 3S4SA 1NLDL 4PB9H 2AFNA 1JN6B 3FT2B 3MOAH 3GBMH 3GZPA 1NCBL 4L0YA 3C5JB 2TSBA 3TA3B 4WSKA 2ARJA 5JYMA 5LXVA 5ID0A 1X7QA 2GTWA 1HIMH 3EOBA 5CSGA 2VDKB 1F41A 3IBOA 3NG5A 3MRPB 4IOSA 5AKTA 3SKOA 5AAMA 2Y7OA 3RWEB 3LH8A 4OI8A 5AEAA 3CSGA 4ZOBA 4K94C 1F5WA 5HVWA 2J1WA 2YA0A 2A1WL 1NQBA 1Y7VA 3MODH 1QPPA 1LK3H 5ICZA 4LVOB 2NW2A 4E9TA 1BFVH 3ZIYA 1VZGA 2PPFA 5CKGA 5TPWH 3KBFA 2HRPL 4F8QA 3DUUB 3R1GH 4CVZB 4NSKB 4NI3A 4NZJA 1MCEA 2PP7A 1T2QH 3DJSA 3PQYE 5J5EA 4XCCL 1JK8B 4KY1H 3L4UA 5JUEH 1OE1A 1UD8A 2DQIH 1J12A 2DBLH 2OW7A 1HX0A 5T33H 3PHOB 4YS4A 3BT2L 1EJOH 2RR3A 1QLRA 2CRMA 1WZ1H 3Q13A 1Q38A 1U9KA 5CZVL 1FN4A 1P6FA 3SKNB 2WWNA 4K9EH 1BD2D 2Z7YA 2GBAA 5FF6A 3GRWA 4QD2E 5DSCA 1XF4B 4RFEA 2X88A 2JWYA 3RY4A 5HSFA 5CJQH 2H8PA 3PGCA 5D7KE 3VMOA 4UIKL 5K9OA 1TSRA 4ZDHA 3PP4L 1X5LA 4WJG3 3SDDD 1V27A 3VXSA 2V17L 3L9YA 1E3ZA 4MB3A 1IBYA 1UWEH 4QHUB 4S1SH 1FYTA 3B4NA 1WE5A 3SSGA 3VG9C 4H0IA 4NM4L 1SLVA 3RYMA 2QADB 1OXYA 3L3IB 1THCA 3L4ZA 1I3GH 1S46A 2OZNA 4P9MH 2E56A 4QKXB 1QASA 5FYLD 4J2XA 3VGHA 3OMNB 1HHJA 3DYMA 1BD2B 2A9AA 2VXUH 5DD3H 3P0VH 2V4LA 3CDFA 4JPKL 3ZMNA 1H0DA 2NW3A 4JM2F 3DURB 3QCTL 1H9VA 5SWSE 1T6VN 3UGEA 4V2BA 3KPSD 3C5ZC 2ZYRA 4MASA 2YGOA 3MMEA 1EIBA 2IFFL 4G5AA 1JRHI 4LGRB 4LLYB 2EDKA 5D7JC 5K33A 5KYYB 5LGHL 5E7BA 1CGYA 3WN5A 5ICZB 4ZMOA 1WITA 2JF1A 3CBKB 1RIUH 3M07A 4D3CL 4GUOA 1AHWB 3C87A 3K2KA 3K8MA 4PI0A 1TYRA 1C12B 2AQ2A 4QHPA 1WV7T 5CWSB 2IH1B 3JWDH 3K8LA 4OI7A 5I6MA 2B15A 2Q76A 1QSEE 1JZ3A 1X9UA 3B9KA 1ILSA 4XP9L 4O02H 1NFDE 4MZRA 5F9OH 2WXFA 2XYCA 4J3SA 4WIQA 3NEOA 1TU2A 3EJZD 2N59A 1EO8L 4RFEB 1FL3A 4XWGL 4QRRD 4Y19D 1DBKL 3U7AA 4H8WH 4RMRA 3SODB 3PGCB 4TNWK 1V7NH 3TA4D 4ZDHB 1NL0L 4PJDB 4FABH 3FMGL 3GBNL 4R9HA 3N9GL 4L1DA 1YEEL 3N6YA 4BKTC 1YPZF 4DKFH 2RB8A 4J4PC 3KVDD 1C9SA 3TOPA 3U7YL 4JKLA 2H6PB 1J5OL 4NRYA 2EH7H 3GINA 5FGBA 4L8CB 4XPAL 3BLKA 1ZGLA 1CF8L 2IADB 2C26A 3PUUA 5K1VA 3S3SA 5D2NC 4PJAB 4JG1L 3FKUS 4FFYH 2WGNB 1Z0MA 3FDWA 5EZIL 5LGJB 2HN7A 5EIVA 4AT6B 3A6OA 3SPJA 2JK5B 1HHIB 5IFHL 4JO8A 1ODUA 2BVTA 2WXOA 4ZQKB 3UTTA 4XE0A 5I24A 4DP2X 3BKYH 2BDNL 2RTTA 4G2AA 4MZ2A 3MHZA 2DQHL 1WF5A 4L8SB 5CR8A 3QRGL 2H32B 2CRIA 3CX5K 1QI4A 2BSRA 5B1KA 2AF2A 4XI5D 4WEBL 3S36H 3JVFC 3IBEA 2P24A 3TM6A 2EVHA 5BRZD 2QPEB 3L13A 1WT5C 4IQHA 3DO3A 4Q6KA 2WZPD 1KTBA 5K9KB 5IEHB 4BK8A 1EDQA 7CGTA 5G2NA 1HU8A 2IXQB 4K0OA 4RDQF 4HKZB 3VH8A 1JTTA 2NYYD 3WO4B 1L9SA 3EUUA 3PGDA 4JFOA 4UOJA 1X5AA 4WNQA 1YYLH 3AFLA 4KXZH 4NZ8A 2CNZA 4F7CB 2NX5A 3O2WL 1FIEA 1H3UA 1E8WA 2AGJH 1YZZA 5EOCJ 4DPAX 5EOCH 4TV3A 2XPYA 3UG4A 2BCMA 1DQJB 4J3WA 2ZPKL 4PJBA 5F9WB 3RU8L 3S88H 1Q1PA 4GUCA 1XGQA 3G5ZA 5I1AB 1OM9A 5TE7H 5ITBH 4A7VA 1X7SA 3O4OB 4U1KB 4W9HC 5SX5K 2ARWA 3WU1A 5F1IA 4LIQH 3ULUF 2EYSB 4RGMC 4Y7OC 3ZW3A 4JGNA 2FLMA 3DPDA 4EN3D 1MFMA 1NICA 2CMRH 4NHCH 4FJZA 1ITCA 3FT3A 1DANU 4Y16A 4IBZA 2VDRH 2B1AH 3MNVB 4KKAC 1TQVA 1OHZA 2VZOA 3W0WE 2J25A 1T89A 4F80A 3DYOA 3NEXA 4HHAA 1OAKH 5F9AC 2P1YA 1UZGA 1HYRC 2EDXA 1RZKH 4HIIA 3G08A 4FNSA 5D6DC 4H2CA 2OSLA 3T3PE 1RK0A 1SPDA 4PGBB 4U1NA 3HHMA 3WS3A 5FWQA 2C1PB 4W4NA 2XCMC 3U4BL 2ZOOA 4B5EA 3MV7E 1GZQA 3T0EC 4KKNA 4BH7A 1VFBA 4Q9CA 1HS6A 4TPRH 3WY3A 6FABH 1J1PH 1BLNB 3MX0B 3NN8A 4HJTA 3OV6A 3BIAX 4HUVB 3AREC 3GTNA 5I0ZA 1IGCH 4X9HA 5IB4A 2KI6A 4YR6A 2A6JA 2VR3A 4QRTA 2BSCA 3BVNB 4FQ1H 3PHQB 1SY6L 2GI7A 3ULVE 4A04A 2GTZA 3VQ1C 4KX7A 3KWWB 4FFZA 4X8JA 3VI4A 5J1AB 2J8UB 4XVUD 1XGUB 3REWA 4RH4A 2K7QA 4F27A 1NOFA 4FQXD 3NBNA 5KVDH 1U8OB 3CJJA 1AO7A 4NKOB 3FRPA 4H13C 1BQHG 4LFHD 3K4DA 2A7BA 2LU3A 4O02A 3KPRA 4HWUA 2XV6B 1T2XA 3BP4B 4PY8J 1DJZA 1TVHA 2NXZC 4HCIA 1IEBA 3NSYA 3N40P 4N6RB 1MQKH 1O9ZA 1MUJA 3FQUB 3PY9A 1OSEA 4PJCE 5JR1L 5C0CD 4KKRA 43C9A 1G6RB 1R5VB 5HPMB 2OULB 2DMKA 1VHPA 4G9FD 3HUJE 3FUJA 4BSWA 2CO6A 3FT3B 3WFCL 3JV4A 2BIIA 2FYYA 3O6LL 1FE8L 4M5ZL 4FQXB 2NSMA 2O6CA 3WXWH 5HYEA 3TVMC 3OD3A 5D7IA 4KRMB 4JW3A 5FDYA 3UG5A 4M6NL 2HFEA 5AOIA 1MHHA 3QDHA 4LSRL 3RFRA 2K6YA 1ZTXH 4HEPA 2DN7A 1XCQB 4O4YL 4ODHL 4G70B 1XGRA 4YSCA 3GF8A 3QA3B 1OE3A 2CDFB 1C16B 3RVWC 3ZHDA 3ZTDC 1KOAA 3D2UD 3WKYA 5GGRA 4ZYKA 3I2CL 4D7BA 3CIQA 2AKRA 4ELKA 2B16A 2W88A 4MFHA 2BIPA 4G9FB 2XWTA 4UQ9A 4X6DF 4LARH 4W4OC 4RRPM 3QQXA 2K8QA 3W3BA 1PZ5A 3NZUA 4WWKA 4BUQA 4YR6B 5DVOA 8CGTA 5AUMB 2R0LH 5ADOH 2L7QA 3OXRA 3DGGB 5ANMA 1JBJA 2K4AA 4FCHA 5I8KH 3WIHH 4B53A 2XWDA 3U79A 4KX8A 1OGTA 5CJ5A 1HZLA 3T0XA 1U8JA 2R2EB 3D2UB 3OGCA 3RVUD 2G0KA 3ABLB 4KKCD 2PXYB 5HDOA 1U93B 2XG5A 1KLFA 2Z93A 1N2RA 4BGDA 5L0QC 2VERA 2VQ1B 4JRXE 5E8DH 4TS6A 5BXFA 2APFA 4M43L 5DHVA 1PS3A 3JWNG 5CJXA 1BQHA 3RDJA 1CR9H 1JVLA 2AV7A 1YEJH 2QVKA 4G3YH 1R6VA 4AJYV 2WVTA 2P8PB 5JA9A 2H0FA 1S3KL 2X4TA 1Y1UA 3NZ8A 4FA7B 2E7MA 1E65A 4Z0XB 2NLJB 4ABQA 5IESL 3DOHA 3WG7B 1MXGA 2YGNA 3AG2B 1JWMA 4HCRH 4P99A 4TNVF 3H4HA 1MHHB 3H7BA 3NABL 1M4KA 3HNTL 1RQ5A 1K8IB 1TZIA 1TF4A 5DJ6B 4ONFH 2M2DA 2NY5H 2NZ1A 1PSKH 4NRXA 1WCBA 4B9CA 4LQFL 4ATTA 1QD0A 2AKRB 1SXSA 3VSUA 2WMPA 4HXBH 3HEIB 4OTXH 3PNRB 4OJYA 4QPEA 1RD6A 2XFXB 3MV8D 3D87B 4LRNH 3F62A 3OM3B 5F8QC 3QUMH 1Z3GH 4KUZL 4OW6A 4P2OB 2R2HA 3VNYA 4DEUA 1XDTT 3RG1C 4AKOA 3EHBC 3LPGA 3U0TA 4PLNC 1ADWA 1CG9B 4GS7B 4E41E 1LYQA 1QLEB 2QGBA 4IIQC 5D1XD 1OZTG 1EJOL 3LQZB 4QJ4B 5C0JB 4WKZA 4Z95H 2GVYA 3M8OL 3JZYA 2BIOA 3PPEA 4HZ1A 2AI0L 3FQXA 1VDGA 1PZUB 2VDOL 3VXQB 2N3JA 1BQRA 4YC2C 3TBCA 4F7KA 1ZLWH 4FP8L 1RZ7H 5JO5A 1IGFL 1DE4B 2E0PA 3EYUH 4XBEL 2XY1A 5C09E 4BFJA 1CI5A 2WXIA 4LEXH 1AIFB 2ZIDA 1AQMA 1CFTA 4NO0D 1BQHB 3ILQC 4UT7L 3GLEA 3F64A 1F3RB 2BERA 1M05B 2IWKA 5AOJA 4FL4B 4JHAH 2GDVA 1UD4A 3VI3E 5D7EA 4NN7B 2FHCA 4P9ML 3ZRSA 3IDGB 2CHWA 4RAVA 4XN5A 1ML0A 1IBZA 1UXMA 3NGBC 4L4VB 3ZO0A 2N7AA 5CXPA 3CDZB 1HJCA 1UZ8A 4P5SA 5BRPA 5IK3A 2ICEB 1G7IA 1WUZA 1AP2A 2VLJE 3QRBA 1T5WB 3PREA 1GKOA 5BQ7B 4YHYC 1L9RA 1M9SA 2IPTL 2VZSA 3SE8H 5LO7A 3MNWA 4G8IA 4HHWA 4TKWA 1W0WB 2WMPB 4NO0B 3POCA 4ZAKB 4I0PC 3ZDYB 4HKXB 5EIQA 3O45A 4OLWH 3DWTA 3VFTA 2BXZA 4F1ZA 3CVCA 1A4KB 1HAUA 3RL1A 3R4RA 3GJFH 5KYUB 2VDPL 1EBPA 2WJ7A 4R4BB 4TQEL 4EDWL 5LNGA 5ALCH 4X7CC 4H0LC 5BO1L 2CLVA 1NDTA 3F84A 4X5QA 2GUOB 3RWJA 3C8HA 1EEZB 1HCZA 2C9RA 3EFFA 4WKZB 1IM9D 5D7SL 9PCYA 1A25A 5BPPA 1NA8A 5DUBA 2RHEA 5E6IA 3BGFC 1IKFH 1NEZA 4XBGB 3KS0J 2V37A 1C5CH 5IF0A 2EDTA 3IAQA 1Z9PA 3K8KA 3KS0H 3VFNB 3WIHA 3FU9A 4UDUB 3IWVA 2YAOA 4AM0A 5CEYB 1D6EB 1JGLL 4HBQA 1J8SA 2X2UA 3BAEL 3F6LA 3ZPDA 2IGFH 1RHFA 5HI3D 3K71A 2GBTA 3KPMA 5CNHA 3C09B 3AT8A 4X98B 1TTUA 4GAJH 4M3JA 4POYA 1TVDA 1R0AH 4AQAB 1ZS2A 3MC0A 4Z3GA 5GRUL 1JJUA 3L95A 3A21A 3GMQB 4FYQA 2QZ5A 1OD7A 3FO1B 5I5RA 4JAMB 5CU9A 2ZX8A 3SQOH 1UVQA 1ZSDB 3KPOB 1WZLA 3V0DA 3HRZB 1GPOL 3LN4B 3BKYL 4ZX5A 4CVXA 4ZXBD 2ZOLA 3EJQA 2ESVE 3SD2A 1W72H 1G7IB 1QRNA 3CDGA 2WVVA 1T5XA 2ROXA 1BVLA 2DTMH 4J8RB 1A7PH 2EKSB 3FUKA 5IVXE 3X14A 1FF5A 3GIVA 4DF9A 2GY5A 3PS6A 4JO4H 5E1IA 2O93L 2DWYA 2VO5A 3VFTB 3VM5A 2C7FA 3D30A 4OM1L 2QPUA 1KCSL 1T3FA 1QUNA 2XXCB 3PE9A 5FM8A 4OKVA 4UILL 1BGXL 1F6LL 5T5FH 3VG0L 3VDBA 4MJ6A 1ZLEA 1TKWA 2CLVB 4XMKL 5E0FA 5BZXA 3RWJB 4N2DA 1QTYT 1EFXA 3FU3A 3QUMA 5EG6C 3RGVC 5F96H 4ZXBB 3WIIL 4AL8L 1HCVA 2OM5A 1A7RH 3P2TA 4G59C 3TH2T 1PJWA 2WTPA 4OBRA 3PJNA 5JPMA 3DA0A 2RACA 1E4WH 3SE9H 3IRZA 3VXNA 3GKWH 2AGJL 4AYID 3SBPA 2HP4A 4WHDA 5HYJD 4A6YA 5KTEL 4IHOA 4GMSH 3GMLA 3K6SB 4LLUB 4BXSV 4I48A 3LD8B 3PWVB 2WYHA 1CK0L 4OAWB 5ICXA 3RWDA 1N0LA 1S7QA 1U8CB 3FO2B 2W91A 5DJYB 4N86A 4ZRGA 1HT6A 2MMXA 1R5IA 3N41F 5D2NE 1ITBB 4WEMB 3D25A 4DN3L 1GOFA 1UD2A 3IGAA 4LLQB 5DZLA 3L95B 3HI1A 1C5DA 4M1GH 3OJDA 4NHCL 5DJAB 1CICD 3APNA 5C6TL 2P44B 1OAQH 1CDYA 1NAKH 5AG8A 4DVBB 4I87A 1BAGA 1ZANL 3PQYB 1CQYA 5CGTA 3AM8C 1JF6A 3H3BC 4JN2A 1WC7B 1CYXA 4AC4A 2WVVB 1J05B 1J10A 1T5XB 4WU5A 1JYVA 1UZ6F 3WEBA 2FLRT 1JXGA 3IFPB 1BYOA 3NFNA 2BP8B 1BZ9B 2X2YA 3G6DL 4NI6A 4AQEB 3P0YH 1JHTB 4IS6B 1LQSR 1OAUH 5I19H 4X6EB 5AW5B 2X87A 5I75B 1AMYA 1LLAA 4KROC 5B22A 1BPVA 2NY0D 4C56E 2AJ3A 4EPSA 1CICB 1JPTL 1QFWI 5C8JA 2G9HA 2ITFA 1IARB 4AUJA 3CCHA 2JVUA 3LPOA 5KVFL 3S34H 3U1SH 1ZTMA 1ED3A 1A3LL 5G5DB 5B8CC 1DQQA 4H40A 2FJUB 3GJFA 3BSZL 3EO1A 1P9MC 1IBFA 4APQD 3L3GB 2R23B 2IDFA 5DVMA 4JKPL 1VESA 1TQSA 3BMVA 3MCYA 1SMAA 3ZE1E 4N2CA 5K9OB 4BWWA 3APCA 1K5NA 3HN5A 1Z9MA 1MJ8L 1MHPH 1LO3H 4TL4A 2F18A 4A6YB 3T8XB 4NAJA 1PNCA 2Y6SC 1HH9A 1F90H 1YEDB 2AJXL 5C0AD 4F7MA 5SWSB 5DMYA 1WA1X 5ICXB 1UTDA 2UXFA 1RPKA 1N0LB 2X4SB 3G6JF 4N2HA 5DCCA 4EEEA 3P9WB 4QRAA 5KAQG 1P7QA 1T0OA 4HLZG 1C5DB 4BA8A 3OJDB 4F8PA 2G75B 5GS2H 3O3UN 4Y1AE 3E1F1 1JYWA 1BCIA 1KGUA 4WNJA 2F53E 3BAKA 4NKQB 3GXFA 2NDFA 1XL6A 1I1AC 4PRPD 3VFGL 3RTLA 4XTRD 3FO0H 3SKJH 5JOEA 3W38A 1JZDC 4PGCB 1VFOA 4KRPD 4Q2ZB 4C83A 4N28A 5C7ZA 1AYOA 4PTUA 1BAWA 1QSEB 1QTPA 4JO1L 2ZCZA 2WQUA 4BXVA 5LKNA 5C0IB 3SCMD 4WUKH 4DKTA 3VU2A 5EF3A 5LNDA 1ZTXL 1NFDB 5JMRA 1HNYA 3ZK0A 4HUUB 3RIAF 4Z7QE 3ARGD 4WK2B 1DBMH 1SJEB 1E2WA 1MNUH 3I6GA 2R9HD 3IEAA 1XR9A 3IXTB 3OKNB 4PGDB 3QZNA 5KSUB 3EDJA 1GGIH 3REVB 4QGTA 3C6EA 1FI8C 1JZ4A 1EZLA 3A6CL 4NM8L 3KPPB 1F4XH 3TBTA 1I82A 3QDMD 3O3AA 4JQVA 4X6FB 2F54A 2H0EA 4E9WA 1AVAA 4WGWB 2X0UA 4ELDA 2VDNB 4EI6B 1B0IA 4GRLA 4KRPB 1AR2A 2VJ8A 4RGOH 2AANA 4E9QA 2R0LL 1RUPL 4G1MB 3I3EA 5C0GA 1C8PA 4UTBH 1LQBC 3SCMB 5T5FA 5TH2B 4Y2DA 1WIPA 3TESA 4F7PB 4QRSA 2R1XA 3IFOA 3FN9A 3KGTA 1KJVB 1A47A 1VFMA 2YPKA 3ARGB 4JUTA 1FHNA 5AVRB 3ES6A 2ZXAA 1NMCB 3O3DB 4JKWA 1WDAA 4QTIH 3X1GA 2XUWA 5CD5C 5CD3B 1PZBA 2YPLE 2X0WA 3QDMB 4PCKA 5HHVH 4F7TB 5IV2B 5IUSA 3ZQXA 3NZSA 3MV7A 3GGWB 5LAXA 3GIZL 1JPSL 1MRCH 1EXGA 1BXXA 5D93C 2YPVL 1VZIA 2VQUA 4MMZC 4X8CA 4C54A 2IDQA 4FKHA 3WJLA 1TCMA 2BO0A 1CBVL 4QRFA 4JZJC 2OMZA 5EZOL 5F1OB 4PTUB 1QEXA 4A2FA 1WBYB 4XXDB 1G6VK 4M3KB 4JCWA 1A4JB 4JGUA 4HCRL 3BW9B 2Q7NA 2DLFH 4NJAH 4PPTA 2WKGA 4FLHA 3KCPA 1SZNA 2QL1A 4HG4J 1S9VA 3DBXA 4F7EA 4M9PA 5A3IC 4FZ8L 1G7LA 2X4QA 3T65A 3O8XA 3QRFM 1RMFH 3R7RA 5J13C 4XP1H 3DVFA 4OUOA 2Z6FA 4XC3L 3FO9A 3GMNB 4N25A 5EU5B 4CC4A 5EDSA 3LZRA 4KXBA 1QW8A 3VGFA 3MLZH 4L23A 2FGZA 1MAMH 1SOKA 4PJCA 3KEHA 3QEQA 1OCWL 4OZHE 1XF5A 2P48B 5E95B 1F4WL 1PTZA 2BVOB 3IGUA 2NTSP 4Y2OB 1AQKL 2UXVA 2W9LA 3HUJA 1T21A 3D05A 5GGQH 1K8DB 2A6KA 4H1LG 2Y5QA 3W0WB 3J8F7 3MJ9H 3NIGF 5BS0E 3GBEA 5DTFB 1G1OA 4K94H 4Z3EA 1G7JA 2A9MH 2E76C 3ES6B 4PM1A 4FTVE 5TF1H 4J1UB 2X7LA 5CGBA 2ZSWB 4JY4B 1PQZA 2IDCA 4X9GA 2WBJA 5CJOH 4WGKA 3T3PB 3VA6A 1FVDB 1WAPA 3QFJD 5IWLA 2B5IC 1HOEA 3VE0A 5DD6A 4A37A 5IW6B 3F7QA 3IGKA 5K9JH 4FNTA 5LAXB 5BVJA 4R7NA 1OARH 1DZ0A 3ZHNA 1JGUH 1TZHA 3N85H 1E5AA 4UTAL 4K23H 2TAAA 2WZ5A 4HCGA 3U48A 3NJGA 4OLUL 1Z9SB 5FW7A 3LZFL 2OMZB 3CHXA 3I9GL 4H26B 4RMTA 3VQMA 5EF2A 2EYTA 1IFGA 2PCYA 3KCPB 3L5WB 1IEHA 5I0WA 2FX8H 3IJ7A 3QFJB 2IV8A 1MXDA 2PR4L 2WXGA 3VDAA 3GPSA 1OWRM 3D9AL 1JYXA 5TQ0L 4JN1L 3L6FA 2HT2C 3O6KL 3CDYA 4X9IA 3BE1H 2XN9D 2P28B 4G8EB 1RSYA 1AOHA 5ABDE 2X6VA 3MCLL 5HVHB 1IU1A 2FD6H 3AQXA 4XZUA 2DLEA 2B9BA 4JRXA 4PUBL 5HHNA 1ET8A 1M2VB 3NJLA 1UM6H 4QF1B 1HINH 2OR7A 3WLBA 1DANT 4B9YA 2BCKA 4DGYH 1E40A 1AZVA 3MJ7A 4GT0A 4HC1L 4LP5A 4W68A 1B2WL 5L2KD 1MW1A 2OXGB 3T1FA 2E4TA 3IU3B 4S1QL 4U6XA 4KVCL 3T2NH 1OAXL 5FO7B 1UB6B 3EBHA 4XVOA 4N68A 2AQNA 3QXVA 5E9DA 1UM4L 5AVYB 3JSSA 4H4NA 1EJ8A 2FRGP 3UTZA 1U30A 4K7FA 1IUZA 4XAKE 5GHWL 3T6XA 3P4MB 3CH1A 3RTQA 2XN9B 2FL5A 2WBJB 2NR6D 3KYOB 3V5HB 4PLKD 4IIZA 4PG2A 3BQUB 3SBWC 1DJSA 2DKUA 3D33A 4LSPH 3VVVA 2HVJA 5MEPB 2X4UA 1ZVHA 3AXIA 1EDHA 2Z64C 2IAMD 2TRHA 1TZHB 4A63A 3GB7A 3F58H 3TTYA 5BNXD 3LDBC 4WFED 4AVJA 1DJIA 4TTDC 3QIBD 4JG0H 2KKQA 4UU9B 1AGFB 3SZ6A 3SDCA 5KVEE 1WP6A 3C5SA 4WNSA 4WHTA 3B7TA 4G80B 2IOMA 3QK0A 5LBVA 4KJWD 4PJIE 4PJ9A 2MNJB 3QCVL 1A7OH 4NQEE 3E1ZA 4E41A 3V9CA 3OBAA 1W72L 3L7FA 4N2AA 3KXFD 5L4FA 1YA5A 3GUTA 4TSBL 5JPNA 1UWXK 1R75A 3S35H 3NFPB 1DQDH 1DO5A 1N4XL 5M7QA 4F8TA 1NGWB 2K45A 1U3ZA 4OFQA 2FB4H 5C09A 3S96B 3N1MC 3TNNB 3W39A 1X9RA 1TQBC 4GG8B 2XBTA 2D9CA 1CUOA 1Q9OA 4EO5A 4K7PY 5HHNB 2DQUL 3B1TA 2ZX9A 3UAFA 4OF7A 1T0MA 3MCKA 1N0XL 5B7FA 1DBAH 5FKPA 1T1XB 5E2WL 5AENA 3BKCH 1MREL 2XZCH 1A7RL 1PEZA 2FIRT 1KBPA 4F9LA 3OKOA 3KXFB 1KIPA 2VL5B 2AK4A 2BSTA 3QIUD 5JXEA 3TT1H 1UWGL 1UXWA 2K9FB 3U6XS 1A5FL 1GGBH 5JXAH 5TE6H 3UTZB 4JHWL 1KTCA 1AOZA 1YN6A 3G5VB 1JDCA 1IC0A 2I7OA 3KM1A 3TZVA 3B3IB 4H1LB 2QQNL 4UQDA 2DM4A 4YSDA 3LN9A 3MLYL 1MDAA 4U1GC 3TYGL 1BEYL 3SE3C 4PREA 1DLHB 1OL0A 1AKPA 3ZRFC 4PWKA 4CMHC 1HL9A 1TQCC 4LBEA 4MD0A 1T22B 4ODXA 3MXVL 4XVJH 3ZKXB 3J27A 3P73A 3L7EB 1LVEA 5ELIA 2XTLA 2EDDA 2ED8A 4IU2A 3HC3L 1UADC 3MRRB 4M8QB 3RVTC 3S3CB 2CCWA 2EEBA 2JLPA 3UTPD 3G5YB 4AQOA 4OCWL 2CHZA 1PPIA 4IM8A 4L5FH 2J5LC 5EFIA 5T1DH 5F89A 3G5XA 3L7FB 4J3VA 4Q4IA 4PN6A 3GUTB 2VMCA 3BRGC 2P8LA 2N7BA 1VERA 2WLKA 2WQVA 5JPNB 3NAAL 5LBGA 4CU7A 3P4NA 1DJXA 2H3XC 2PYED 5IFAH 4KO5A 4LEOA 3L17A 2C4FU 4H20L 5IT2L 3WELA 3FPYA 3VYPA 1SMOA 2IPUG 2ICES 1WWAX 2VLJD 2Q3AA 5EN3A 4ODTL 2GSMB 3H53A 1HEZA 4XB3A 2VISB 2BHYA 4IU3B 5IFJA 1DSYA 1KGCD 4ETYA 3IVKA 1TZAA 3HC4L 4ONGL 2J6WA 3PU7A 3MFGB 4CSSA 1Z5HA 2VW4A 3S34L 2VDLH 3RZCB 5AB0A 3MRGA 4UNVA 3RPKA 3DO4A 1JTOA 4YH6A 1TOXA 3VI3B 4NOFA 4FOMA 4Y5VB 3O2DL 4YFDB 5IVZA 2BSTB 2XTSA 3I9PA 1UXWB 4RSYA 2WINB 4CMMA 1FGNH 1KN2H 2H2PC 4LPYA 2A9DA 5DS1A 2PYEB 1MJJB 3FBQA 4PV9A 4OIIL 5DMGC 3BP6B 3BYTA 2KPNA 3V5DB 1A65A 2I5YL 1C5BH 1VEOA 1FLRH 4MA1C 2ESVA 2AAAA 2XXFA 3C5ZA 3I9IA 1TDQA 2VLJB 1PLGL 2DQGL 1VACA 3ARPA 5D7JA 4MAYD 3DRTA 5FYJD 1SF5A 5CCHE 3CFJA 4NGHL 3FSWA 4PREB 2ZXDA 4MSWA 4U0QB 3VRJB 4PRHE 5CLTA 4BJLA 5IVXA 3MACH 2XBDA 2MNUA 1E28A 5GZND 4CA4A 2FK9A 3ECVA 1EGJH 3ZL2A 4KJYA 4OV5A 5KOVC 3OQ3B 1FHGA 1XCTB 4XN7A 4XXCC 4KMQA 3O41A 5EULV 3IJSB 3D08A 4JM4L 3O6FC 5A2KH 4GINA 2Z34A 5EFIB 3BPCB 4NPYB 3QWRD 2K78A 4XO3A 4GRWH 2FAUA 4G1EA 4LOVA 4QHNA 1RHHB 4YK4C 1ORQA 3KGUA 5AW1B 3HVNA 2VIRA 3RP1A 2F9BT 4U6VL 4ORZC 1PKQA 1UKQA 2DJSA 3QXAA 1SUHA 4LEOB 3MXWL 3CHQA 4KK9D 4PTTB 5LWYH 1U3HC 1TCRA 1FZOA 2DD8L 4HWEL 1NGQH 3UROR 1MFDH 2B0SH 5KVFE 3SPHA 1H3WM 4P9HC 1JF1B 4S1RH 4J4PA 1I1YA 1HEZB 1P1ZA 2W81C 3RILA 4MB1A 3IVKB 5DS2A 3FB5A 1KJ2A 1XGYH 3B2UD 5I74B 1AC0A 3VXPA 2OMTA 3FUNA 3IYLW 4BBWA 4PWEA 5D2NA 3MYJA 5FHAL 3W37A 1OP9A 4Q0XL 4UB0L