4BRVA

Superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MKSFGELIYTPDRAEGEAISKAATHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRVAFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION
publication title Structure of a Natural Sor Mutant
rcsb
source organism Ignicoccus hospitalis
molecule tags Oxidoreductase
total genus 30
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4brvA00
1DQIA 1VZIA 1DQKA 2JI3A 4D7PA 1DO6A 4C4UA 4BV1A 1DFXA 4C4BA 1VZHA 4BFJA 2JI1A 4BFKA 1Y07A 4BFFA 4BRVA 3QZBA 4BK8A 4BRJA 1VZGA 2AMUA 2JI2A 4BGLA 2HVBA
chains in the Genus database with same CATH superfamily
1CVSC 4ZPVA 4JN2B 2BRQA 4K7FA 2E7MA 1W15A 1T0MB 3V4PB 4KV5E 3EO0B 3UADA 4WKXA 4WEBH 3VXSD 1Z5LB 4BBWA 5EBMB 2DQJH 4N8PA 3SDXA 4KZDH 3VG9B 1DBJH 1XF2A 1WUNT 4HIIA 4M02A 4PRHD 4PP1C 5MEND 4LZKA 1LE9B 5E8PA 2NY4D 3K81A 5B8CB 1WZ1H 3JVGA 5I6LA 3EDDA 4DN4H 1PLGL 4EAEA 4BK4A 3KL5A 3DX3A 4X4XB 1T03H 3IDNA 3S5YA 5I1IL 4JFXB 2C7FA 4KXCA 5EIIA 4HC1A 3LH8A 4QJ5B 3WBDA 3V6OE 1IJ9A 4L1TA 3LN4B 3VFSB 4M5ZH 3DX8B 3Q1EA 1NEZB 3VFUB 2UUDH 1A6AB 1OB0A 5F9OH 1OAXL 3DUHA 4M3KB 2NNAA 3TA4D 4GRWE 2CO2A 2I07A 1A7PL 3U0WL 1H6UA 3GZPA 5JHMA 4WV1B 3LYRA 2OXGB 3CFBA 3GMRB 4RVBA 3TJHC 1RK0A 3ULVL 3QORD 4FC3E 1MJ7H 2GC4C 4MMZB 1A2YA 4XHJC 2P5WB 2APSA 3NIGB 4FLSA 2EDRA 1DE4A 3R8BB 4L8DA 5CD3A 1VSCA 1SHXA 2LV4A 3QXDB 4HH9B 2OMXA 2V8MA 3FU7A 5K39A 4F27A 4LSVH 3QIBB 4IMKA 4OBRA 2E7HA 4U1IA 4XPBH 1HEJC 1CT8B 5HVHB 3HRZB 3P9LB 1VGEL 1DZBA 4JRYD 1RMFL 5EBWA 3HI6H 3QPXH 4YHML 1RAMA 1AGBB 2BY2A 3T4AA 4RWYH 2BC4A 1H8NA 1ZLWH 3FO1A 2ADFH 2Q7NA 2VXSL 5EA0H 1CFSB 3KYKH 1I7RB 3HMXL 5IKCA 4IRJC 5E4OA 1CK0H 3I9GL 3RVWC 3BZDA 5F89B 4WI5A 1D9KD 2XWTB 5DT1L 1A8ZA 4QHNB 3X3FL 3B37A 5HYIA 2CBOA 3KLHD 3L3KA 1T83A 4HJJH 5E2TH 1G7MB 3NFSH 2UXGA 5FGRA 3V6ZB 1EAJA 3C6LC 4FOMA 2Y22A 3SDDD 5F71A 1SDYA 3QZWA 3CZFA 2NTFA 2A6JA 1V3MA 4PVNA 3AY4C 1SVBA 3QUZC 3T3MF 3EAKA 3ARGD 1WDAA 4ENEC 1BLNA 3KBFA 1S5HA 3IGFA 2QL1A 2FX7L 1MVUB 4PJIA 2XRAL 2BNRA 4HCIA 1JWMA 1M2OA 5KUKA 3DURB 2JXMA 3ZJAA 2VYRE 3VFTB 1S7VA 4UQ9A 2DM4A 2BVYA 1OWRM 1CICD 1UD6A 3MLUL 2UY6A 2C9UA 3NP3A 1D5BA 4X9HA 5AOZA 5DMJB 5J6HA 4OCLC 3UZEA 4MZRA 5J0BA 4M62L 4ZNEE 1C08A 1UJ3B 4LARH 2VTFA 5I9QB 1O75A 1Q90A 3N1GC 2CIIB 5FK9A 1RK1B 1N5YL 2P46B 35C8H 4ZTPH 2E4TA 1TQBC 3V55A 5T8IA 1CXIA 3QJQB 1LEIB 3D85B 2LTQB 3KYMB 2PN5A 2ZNWA 4QOKB 3FTVA 1YLBB 1UT1A 3FFDB 3NTCL 4MXWL 3RVTC 3H6JA 4X4YB 3DBXB 3ATBA 5AW7B 4HUUA 2WJ7A 1I1FA 4D0BA 3PFQA 4OCRL 4YX2L 4K3DH 2IF7A 1NAMA 1DTUA 3FUJA 4AW7A 2AJ3A 3MMEA 1WHOA 2V7NB 1CGXA 2DWYA 5GXBB 3KW8A 2EEBA 1SUHA 1OAUH 2OSLA 3W57A 2AEQL 2NY3D 5AVSB 2VAAB 1SYSA 5FAAA 3SGJA 3T2LA 1PG7X 5A43C 5FO8A 3FO0H 4OTXL 4IOFD 1B4RA 4W68A 5LCVA 2OCJA 1B2YA 1ZWIA 1WT5A 2W0FB 3SODB 3DC0A 3HZKB 4ZUWB 3BN9D 2YXFA 3WS3A 5HHOD 2ZSWA 4KXAA 1SXZA 4I3RL 2CCVA 5ACMA 3ZKSD 4YHPB 3DBSA 2CA3A 2EDKA 4L29B 2P5EA 2G3NA 1OTTD 4IRZL 2MCG1 3OXRB 4HJ0C 3FB8B 1JHKH 4XVUD 3EYOA 4IK7A 4N2FA 5HY9B 1A4CA 1W72B 3SJVE 2DQTH 5I30L 4JO4H 3VUAA 3Q48A 1IKFL 3RTQB 3ARZA 3TZVD 1MIEL 3BUIA 1JTPA 1U3NA 4JFFB 2CKBL 4Q2ZA 5JW4R 3HMWL 4LU5L 1G6VK 5LVEA 1VFBA 1DZ0A 4KKCD 1RUMH 3BUPA 4K7FB 1JOIA 3HPLB 5JOFA 1IGML 3MU3A 3S8FB 4N0FB 3RPBA 2EXYD 3AXLB 4L3ED 4E9SA 1JTOA 1XF2B 5LAXA 1DVFC 4PWHA 3ARYA 2CK2A 2P24B 4HIIB 3RWEA 4UMSA 3HJ0A 2YRLA 3QI9C 2APVA 1T04A 1ZLSL 3UEZA 2WQAA 3GI8L 4AZUA 4EIZC 4HGKC 5CIPH 2CO7B 5A2JH 1AG6A 5HDQL 4FG6C 4LT7A 3EF7A 1OPGH 3M6DA 2J1KA 1RI8A 1YJDC 4XE5B 4I88A 3EJJX 1AQMA 3IDNB 4YH6A 5T3XE 3QWNA 4IBQA 4KMTL 4K8RL 5E2WH 1M1SA 4QRUA 3ZZ1A 5AKSA 5F7MC 3S2AA 5I1DB 4R26H 1JK8A 3MV8E 1CL7H 4D7PA 2BIMA 2F1EA 1YYMH 2J5LC 1EJ8A 3QCVH 3KWUA 3SYOA 1UWXH 1NEUA 4W4NA 5DRWA 4F58L 4L9LA 3LKOB 3EFDH 4AM0Q 1FORH 5D70H 3CFBB 3BE1H 5E2VL 2B1OA 1HKFA 1RK0B 1UD2A 4U3HA 4Z7UE 3QJRB 3RWIB 2VLJA 3ZKXB 1FRGH 4OI9A 1INDL 4KUCD 1FZOB 1ED3B 4R4BB 4L8DB 4YR6B 1ZGLP 1IGFL 2OMXB 2X1QA 3FU7B 3N1MC 5HJGA 1XTMA 3DHMA 1JYNA 4M48L 5GGTH 4U1IB 4N68A 3EH4B 2R69L 1FLTX 1H5BC 2WLMA 5M94B 1WAAF 4KI5C 4M93B 4W9HC 1I7UA 1OW0C 1TQTA 2YBRB 4K7PH 4FCAA 1HXMB 4MZIA 3QUYC 3WJLC 5DHYA 4FYSA 3CTTA 4QRSB 3GXMA 3ARFB 3HC4L 3QEQD 3U82B 4XX5A 2KT6A 1IBFA 4Y16C 2CLZA 4MAYC 3FQ2A 2VH5L 5KVMC 3ZY7A 1URLA 5DZOA 1NLDH 3D2UD 2FGWL 1XH3B 3K7UA 2JIXD 4MCYB 2YAFA 1II4E 3L3KB 3ARBA 4X9FA 3W0WD 4Z77A 3RNQA 4IU2B 3L5XL 3OHXA 3CZFB 3DRQB 4AMKL 5PCYA 1FFPA 1JVLA 2A6JB 3M1OA 4RLDA 4WI7A 2A6DB 1FNSH 4WHDA 3UIZA 4LOUD 1RZGA 2VDOH 3VGFA 1JGIA 3O8XA 4PJIB 1JWMB 2JXMB 3TO2A 3RX7A 3L9BA 4C54A 1S7VB 2Z8VC 3DSNA 5GRJL 2YGVA 3E0GA 4TTDD 2UY6B 2COVD 1DQMH 5F72S 5EO9A 4YC2C 5L2JA 4OY9A 2E47A 1CE6B 2X4RB 4N3UA 3G6DL 1OPOA 1HSBB 4MJ2A 5SX5K 1C08B 2ZCLH 1YPZA 2RBLA 3IAQA 1KT2B 1NCOA 5H2BA 1NBVL 3HMXA 4L4VA 2TRHA 5EMYA 4G11A 2EH8H 1GJUA 1HNYA 1KYUA 3I6KB 3MYJB 1I1FB 2X3BA 3OKYA 4D0BB 4XPHL 5D1ZI 1SY6H 2WBKA 4JFUA 3QULB 5DEFA 3MLZH 2AJ3B 2ZWZA 5E5UB 4AVHA 3MMEB 5LGKA 4N5UA 1RUKL 5I1CH 3OX8A 1EXUB 2OSLB 4OIIH 1GGCH 1SYSB 4WAFA 3AREC 3OR7A 1AZUA 5ABAA 4XT1C 3IU4H 4HCRL 4PYHA 4UT6L 1W6LA 5C08E 1CDUA 5E2UL 4BRVA 1UZ6E 4HWZA 2D03H 1LP9E 3BCDA 1W6WA 4NNPH 3GHBL 4QXUL 3TBYB 3WS3B 4PB0L 1HJBC 2ZSWB 4OI7A 4OKVA 4J5VA 4M43L 5J56B 1OOAA 3UBFA 3RP1A 4JO3L 1MCOL 2P5EB 4JY4B 1O9ZA 4IRSB 4UCFA 3GJFH 4BV1A 1QRNA 2F7PA 1JFHA 3EYOB 1INEL 3V5DB 1NLBL 4HT1L 4DUVA 5CJ5A 4Q2ZB 4IBVA 1DBAH 3A67H 3D4YA 1LWHA 2P5WD 3QNYA 4J28A 1UT2A 3KPPA 4FTVA 1CC3A 2O6CA 2LLLA 3SCMC 5JOFB 1XEDA 3QDGE 3B9KC 4TUOB 2ZX5A 1ZLUH 4Z8FH 2YQGA 1KELL 3QIBD 4PJ9A 3MI6A 2AJVL 2BP8A 4W1TA 3TVMA 2R29L 1NANI 3VRLF 3A4AA 3H9ZA 5LAXB 3FT4A 4BFGA 5FUCC 5DJZB 4F7TB 3WNOA 1CDJA 4B0MM 1UM5H 3MBXL 1M6UA 5HJBA 3TFBA 1GYAA 4AGQA 4AEIL 3T0DA 4QF1B 5J7CC 1U3ZA 5CKGA 2H6PA 3QPQC 2PR4L 4HJGB 5SWZE 3VO0A 4AEHL 1QA9B 3S35L 2Q86A 4G82A 3B2DC 4ZQKA 3S0PA 4F7CB 3Q05A 4XP1H 3QA3B 2FQGA 1BZ7B 1FL3A 3BVWA 4IRZA 4D0DA 5ADOH 1DJIA 1IC4H 4WDIB 5GRVK 2UXVA 1NPNA 4K0OA 5H94B 5IK3B 4MB5A 1A7RL 3L81A 3V0VB 4L9LB 2CKBA 4WZ9A 2CJUL 3MLVL 4LRIC 3LAFA 1E9OA 2W0LA 4CMHB 5CZXC 4OFIA 2NCMA 3DROA 3HG0A 3MRHB 4N2MA 2IDCA 3Q43A 4GW5A 3Q5TA 3MUGB 1FZJA 2I5YL 3U0PA 3V52H 1BWMA 4YHIA 1PSKH 1A6UL 5CIPA 3WTYA 3ZGHA 4KAQL 3KYNA 3GMOB 4WFFE 1MPAH 1XO8A 3V0EA 1F3JA 4XMPH 4ZNCD 1I7UB 4W4OC 4A7SA 4NQUA 3IMTA 2QMJA 2F54E 5DHYB 3D85D 1CFMA 3VG0H 2WLLA 4QOKD 1I7ZA 5I17B 5DJYB 4UMGA 2N7AA 4OFVA 4PD4J 3FSAA 4AM0B 4KI5F 3Q0HA 5HYEA 5L7XL 3MCLH 5AB9A 4TRPH 4NRZA 2O26U 5KYXA 5J1SC 4GEIA 3ZYIA 3KGTA 4ZMLA 5E4AA 1OCZB 3NSDA 1YEHH 5AL8A 4O00A 4LLYB 2WOYA 3IJHA 3RNQB 1GOHA 2RQ8A 3T08A 3RE0A 1FFPB 3I2CL 5D1XE 5E00A 5IB5A 3BPCA 1WSST 1CDCA 1TDQA 5IB3B 3TEWA 4DGYL 1NEPA 4L8SA 1T5XA 3L1EA 4I4WB 4QTIL 2D3JA 2EDYA 5IBTL 3MLWH 2KLTA 1AZVA 2APXA 2HX7A 3RUGE 3TO2B 3QQ3A 1S8DA 1J1OL 3SQOL 4N6QA 4OJFL 1A47A 3UAFA 4NAMA 2R69A 3K1KC 5EO9B 1E30A 2IV9A 1HQ4B 1AS6A 3FOMA 1T6WA 2CJ3A 3VSQA 3DX0A 5DHEA 1TJHH 4D9LL 2WTOA 2XTSA 3PUCA 1NIFA 1VIWA 4LSPL 3PL6B 4E5XA 5F7DA 5T1LA 4JFFD 4P2RE 5GS1A 3IE9A 5IR1B 4CILA 4M9OA 4PJXA 3V6OC 3N50A 3PHAA 4GQPH 4M6NH 3TBBA 1P4IH 4J4PA 4YDKL 2ARJA 3LIZH 5C3IA 3VE0A 2XN2A 4NSKA 1TJGH 4MA1B 1V7NH 2K7QA 2WQXA 4UNTA 5LO7A 1G7LB 3UG4A 1LO0L 2XG5B 1W0WA 1MRFH 4JJ5A 3OX8B 4XNUL 5CGMA 1CTOA 1HXKA 4A7UA 3A23A 3NJNA 3STZA 2A6KB 2ZICA 3CQQA 1YEDB 4OGXH 4ZPTA 3EJYC 3K6DA 3SDAA 3IK2A 5DS8B 1GXEA 5ACZA 2Z92A 3WS6A 1P1VA 4JGMA 2WP3O 1VZHA 4HWZB 3C5JA 2DMGA 2WWMD 3N41F 2AQSA 2MCPL 5DD3L 5BMFL 5MERA 2J8UF 3LEVL 4U1NA 4Y1SA 1L6PA 4O58L 5ESVB 3PV6A 2DQGL 3D51A 3VH8G 1SPDA 4Y5YC 3RIFF 1NGWB 1QBLL 5D93C 3ZE2E 3HAEA 2KYIA 5CSZA 2H6OA 4JY5H 2H47C 1Y6MR 3NMEA 5CCKL 2BFVH 1QRNB 2F8OA 4OZHB 4AI7A 5DUBB 4HPYL 4HAKA 4TVUA 4B53A 3VA2C 1P9MA 1QSVA 3HE7A 3SKOA 1KYAA 2FT7A 3MV9E 2AABL 4WEMB 3EH5B 5TE4L 4XCFH 4XPFL 1CJYA 3F58H 4R5TA 1HXYA 4FTVB 2DQMA 4EBQL 2ETWA 3O6FC 4I48B 2EUXA 2DQHL 2HLEB 1XD1A 2NY1C 3IFPA 4HEPA 4LCIH 3GRWL 2VDRL 2D7MA 3TVMB 2QSCH 1UGKA 3T0EC 4FFYH 2NUTA 3OAYH 1J9SA 2QSTA 3NT0A 1QAWA 4HCRA 4UT6A 1PY0A 5H35A 3L95A 4BSWA 2D2OA 4HKZB 3ARFD 3F7KA 4OLXL 2ZUWA 3G5XB 4ES8A 3D5OF 2VJ0A 3WMPA 2IQ9H 3CPLB 3KM1A 4L3EE 5TPWH 4LHUG 4B96A 5IQMA 2NZ1A 1Q1PA 4P2OB 1BVLB 2OMWA 3HG1E 3VX1A 4LEXL 4QGTA 1FAIH 2Q86B 4ZQKB 4HEMA 1CFBA 5ABZA 2C5DC 4L37A 2A1WH 4KXDA 1KSRA 2OXHA 1FL3B 5A2BA 3KNBB 3CNKA 5A3ID 4M8RA 3MSPA 2ZT9C 2CA4A 5I5JA 3UPRA 3U1SL 3C2AL 3RGVA 3OSVA 4UV7H 2OL3H 2CKBB 3E1F1 1KN4H 2FL5B 4KK6C 1NDGB 1TQSA 1E9OB 4N2LA 2JKJA 3OQRA 4ONFH 1LDPL 3TJEL 1TJIH 2PLTA 5C86A 2BIPA 1FZJB 4HK0A 3IKKA 5DJCA 2IOOA 3U0PB 3LS5L 2YD9A 3DX6B 4OD1L 2R29A 4NRXA 4YHIB 3S6CA 3G5VB 5A6MA 3SBPA 4FLOA 4MLIA 3GSOA 3KYNB 2ZXCA 1ONQA 2J4WH 3IYLW 2EILB 3V95A 1EEUA 3DSFL 4XN2A 2YOCA 2R9HC 1RUAH 2JKWA 4I2XA 4Y5XA 4K5NA 3HE6C 3WFHA 1BFTA 1VLXA 2NR6A 1Z1WA 4PJDF 5F7WC 4PJHB 1I7ZB 3NEXA 2K8MA 1U8JA 2NSXA 5E1AA 2CO1A 2UVEA 3P4OA 4WGVB 3MRLA 1YEEH 1EO8H 1GYWA 4Y5VC 3Q9QA 3SDCA 2WXPA 4JJOA 4NRZB 3IRCA 5KYXB 4CADA 2BVUA 5G5DA 3IMWA 3U83A 4ODXA 3DO4A 3WUWA 1L0QA 1HX0A 1BD2E 3TXAA 5EULV 2B0SL 3ETBF 3PQYA 1BBDL 1FV1A 1WA0X 3QIUB 4XO9A 4K4KA 4LSUL 2BVQA 3FT3A 4AEFA 4KVCL 4P57A 2DDQL 5DJXA 5E00B 2UWEF 5IB5B 1UGNA 2XZQH 1G4RA 1FBIL 1F4XH 1T5XB 2C4XA 1G9MH 3NPSC 3ZHKA 5IROC 5JZ7C 1VENA 2WSPA 2CHWA 3QQ3B 4PS4L 4F33A 2PW1A 3FDWA 3QRFM 5BVPH 2L7JA 4KV5F 4XPTH 1E5UI 3L1OL 4I5BA 4X6EA 1G7IA 1S6NA 1TETL 4WO4C 4P59H 2P5ED 4PRAB 5B1BB 1GMEA 3BFQG 4YXHL 1EHNA 5J12C 5J3HD 3N1FC 2G0KA 5DURB 3VGAC 4BCYA 2BVPA 3WJJA 1MW0A 2YD1A 3EOBB 4HS8L 2VISB 4JM0A 5F7DB 5HVGB 3V5HA 1RUPH 4ZFQA 1DEDA 5IW1A 1YEFL 4K15A 4DO4A 2ZUTA 4F9LC 4G59C 4FCHA 4EXKA 2FIRT 1BPVA 3K6SA 1PIFA 1VFMA 3FQXA 2DWSA 1F6AB 4XI5D 1X5MA 2H4EA 3BLPX 1J12A 1MCCA 3CG8A 3FO9A 4ZUSA 1Z9LA 4DO6A 2B1AL 4GG6E 1EJ6A 1TCRB 3QEHB 2ICEC 3HB3D 5FCSH 3NFNA 3B9AA 4E9LA 3STZB 3NK4A 3IDGA 1M3JA 4L1LA 3I6SA 4KNSA 1QG3A 4OCSL 4GRWF 1I53A 1FL6A 2WVSA 3MV7E 3QDHA 4OFQA 5GSRB 5MERB 3S96A 3DUSA 3HPJB 2F9BT 3W82A 3EFFB 3EO1A 3KJ4C 1XCTA 1YECL 4HKXB 4U1NB 2FWLB 3D50A 2IC2A 3SHSA 5JPMA 5BUGA 3BP7B 5I66B 2FNWA 4JDVA 2QADB 1U3HA 3MLRH 3BKYL 3HAEB 4XP9H 1QKZH 4OD2B 1BJ1H 5C7ZA 2CE6A 2CQVA 4X8XA 3BH9A 3HE7B 3SKOB 5AVVB 4PLKC 4TVSa 5GQBA 4XBMA 1DVYA 1LGVA 5AB1A 4BFIB 4LVNC 5JDSA 5BS0A 1MWOA 6PCYA 5T5FH 1HXYB 1GH7A 1PG7H 1IGJA 1TUPA 4I18A 2N56A 1ITCA 1O9VA 3FQ1A 1UG9A 3ETSA 4QYOA 3V0WL 3VM7A 1E5BA 3N44B 4J3TA 1BZQK 3V4VH 2NUTB 3KAAA 4XX1G 5DQJB 2WXOA 3Q13A 3OPUA 5F97E 3T8XB 4ERSH 5GS0C 1NGZA 1GR7A 4FFZH 4AGPA 3W5NA 1YMME 3NRPA 1CQKA 2BSBA 1BV8A 1TVDA 3BVVA 1R47A 4Z7OE 3KDMA 4XCYA 2OMWB 4H40A 4YVNA 1QWUA 3FOLB 1FQ9C 1M3IA 3IFOB 4FZEL 1BG9A 3C6EA 4D8PA 1JGDA 4H8PA 4OUUB 4Q52A 5DD0H 1NFDE 1TVBB 1UKSA 4JPKL 3GMMB 4ZBJA 1L5GB 4DGUA 5A1AA 5B1AB 4UDTA 3L4CA 3ZQ9A 5C0BE 5EO1A 3ULVD 4IGBC 1W91A 5IJVB 4X7FC 5D4QA 2KZWA 4AJ0A 4QHMB 1KEGH 4FFYA 1FG2A 3QYMA 2H1XA 4B7LA 3O8XD 4OSUL 2YGQA 1S7WB 4HK0B 3U7AA 3O3EA 2ZXQA 3GRWA 1CLVA 4ZSOB 1CDGA 1B4LA 4LSTL 4DP1X 4YNYA 2O4EA 1A4KA 1O6SA 2WLNA 1ONQB 3TT1H 1E9QA 3JUYA 5EU5B 1EXGA 3MJ6A 4XMUA 2JB6A 2AJSL 4U05A 4LK4A 4RSYA 1KEML 1MNUH 2YJQA 1OP4A 3ATDA 1R5VA 4I2XB 2KPNA 3PL6D 4DP7X 4L4VD 3CBJB 1WYJA 4UT9L 1BVKA 3RKDD 2A9NL 4AQ1A 1DANU 2HT2C 4UT7H 2JJWA 5DD5L 3HBQA 2WUBL 3IDIA 4NJ9L 2CM5A 4HFWA 1U8JB 3T3PE 3AWEA 2YWYA 4LDLB 1QW8A 3QW9A 4HLEA 3ZE1E 2QHRH 3AXHA 4GAFB 4U1HA 3DTDA 3W5MA 2FH6A 4OLVH 2A0LC 3DHJA 3V2AR 1KBBA 4D3CL 4OM1H 2EC9U 1IBHA 4E9VA 2JH2A 5EPMA 1A7OH 3N91A 2AAVA 1A9EB 3RVXC 2GSGA 3RL2A 1N2RA 5C0JA 4QEGA 1A6PA 3H4HA 4GT0A 5C0NC 3BSHA 4KGJA 4X9IA 1UB6A 4TPRH 5E23A 3W9DA 2APFA 5L9DL 1WITA 2X38A 3ZIMA 3ULUC 4IKJA 4YDLC 4OZIB 2J8HA 4GPVA 4F33B 2PW1B 2VR9A 4MHHI 4G5ZH 4RMUA 5AVZB 4KZEH 4JFHE 3WNMA 1ZLWK 1G7IB 1K4DB 1NCTA 3E2HB 3TPUA 4DEPB 4K3EH 1DQLL 2P4AB 1QRND 1FNAA 1FGVL 5F7NC 5AEAA 5K9KB 4FNUA 1F4WL 3V5HB 2NY4C 3F2LA 3BC9A 3FFCE 4C8XA 1JGLL 3WKQA 2RB8A 4Q74A 5KS9A 3WY3A 5IW1B 4H7VA 5DJ0A 3T0AA 1CLYL 1AACA 1OAKL 4FTVD 3HNTH 1N7MH 2WZAA 1F6LL 3F8UB 4KWUA 5JO5A 1NZRA 1PJ9A 2ATAA 1ET8A 3TVMD 3FO9B 4AUYA 5IMMA 2OZ4H 2E27L 4H1LG 2JI1A 2Z65C 3QK0A 4CN1A 1A7QH 2IBGA 3AC0A 4UBDC 5E5LA 1OKEA 3P77A 1NGXB 4BRJA 1CG9A 1HL5A 4L4TB 3U36A 1OZTG 2DIJA 1B2WL 5AYUH 3SDXE 4RRPG 2CHNA 5DWPA 3ZDWA 2WHVA 1J8HE 1FVEA 1QFUL 2DY2A 5DVMA 4TTGA 1HZHH 3S96B 3WKPA 4P2OD 4Z7UF 2NNRA 4MRCA 1BXAA 4AYMC 3IJ8A 4GP4B 4HU2A 9PCYA 3HNSH 2X53A 1EAQA 3KLAA 3OWRA 2HFFA 3VRJB 4UU9B 2EUWA 2BMKB 3GXTA 4C58B 3BHBB 5JR1L 2GCYB 3BH9B 3MYZA 4OFYA 1WWCA 2PCFA 2E3VA 4RIRA 3P3RA 3RG1C 3FCTA 5C0RL 4BGLA 43C9A 2FHFA 4GS7C 2XZAL 4W9GC 2AV1A 3DA0A 4AUJA 1W80A 5BS0B 5IOPA 2KC0A 3IDJA 4I18B 3DGCR 5D1XC 3C75A 4JPWH 3P4NA 1D9KC 5MP6H 5FYKU 3LQAL 4LPXA 1DFBH 4ILDA 1WIUA 3FQ4A 1DJYA 1PZ3A 3VTAA 1Z0MA 2FX9H 1JGUL 5TQ0H 3CQPA 3IU3A 5DS1A 2WZ6A 4IBUA 4G8EB 1O7DE 5LG1A 3D06A 4PI0A 2KKQA 4ZO8A 5HHQA 3P3TA 3ESVF 5TJWK 3QG7L 3DI3B 1XGQA 3TWCL 1VDGA 2CD0A 1E4WH 4DTGH 3PP3K 4K8RD 2YSTA 5ICZA 1RHHA 1I82A 5E6RB 5DI8A 5EC2A 1RZJC 2ZP8A 4P4RA 4FQQA 3S35X 3IFNL 1CICC 1JGDB 3FQRA 1JP5A 1KB5L 4CC1A 1NCBH 3HHSA 4MNQA 3QIUD 4GMSL 4TNGA 2QBWA 4XVOA 3LOWA 4UDTB 2PO6A 1ID2A 4YDZA 5DC0A 3WNPA 2EDNA 2RCSH 3V4UH 1SHWA 4KJPC 3LHPL 3ZE0E 2C9VA 4ANXA 4N0CD 2R0ZL 4JG1H 2WZPD 2NXYD 1S7SA 3BVNA 5A2IH 3DLQR 2OMVA 4QAMB 1HL9A 1FJ1A 3C09B 4X4MA 2VDRB 1KWKA 1FC2D 4M1DL 3BVTA 1ZDSA 3H55A 1KYFA 1MCLA 4FFZA 4YNYB 2GC7C 2BNRE 2JB6B 2NY3C 3FONA 3TL5A 5DURD 4XNAA 1R5VB 3Q2LA 1HFUA 3FF7A 2X6MA 4IQHA 5T1LD 1BVKB 2BJMH 2WMPB 2EDHA 3D9AL 3IDIB 4P2QE 1JZGA 1ZA3A 4H20H 1EV2E 3BLBA 3GZOA 4J4PD 1UZ6F 1ZXQA 4LEOA 1LP9F 1ZT7B 5D5MA 4U6VL 1XT5A 2X41A 3BN9C 2CIKB 3QFJA 1PKQA 5D9SA 4XN5A 2WYTA 3B34A 4MD4A 4XPGH 5EPMB 2ED7A 4F3FA 3KLSA 5L4IA 4Z3GA 1ZPLA 1MFAL 4GSRA 2ZJSH 3UTTA 3RL2B 4GW4B 1DCEA 1EO7A 4NQDB 3ZLQC 2AK4B 4PI2A 2IMMA 2Y24A 1DL7H 5CHNA 4APQA 2P5PA 3VGDA 3HRPA 4KKRA 1ETZA 2X4OB 1UYWH 3TZVC 1HWHB 3W9DB 2GTZA 3LV3A 3GSUA 4AIOA 1MI5A 2OSYA 3IJEA 1R33A 2XWEA 4G80A 5C3LD 4CSTA 2HRHA 4HIQA 5BW7A 5SX4H 2CR6A 4NHCH 4G6MH 2QADD 4OZ4A 3X14B 5JIKA 3TPUB 1D7DA 4YHYB 1G9NH 2NY6B 4HF5L 5FM4A 2O93L 2EXYC 3DJTA 3NQIA 4UT9A 3U0TA 1FNHA 2H3XC 1OGAA 2KI6A 3HE7D 4GAGL 2XKSA 4OCWH 2P52A 4X7SH 1TT6A 2W80C 3O2WH 5CD5D 2A74B 3MOBL 5DUPL 5KS9B 4JFQA 3TEXA 5DJ0B 4HUVA 5AB0A 5CWSA 4GIAA 4NKDA 4HULB 2E74C 2V5RA 4WUKL 4GP5B 5DLMH 2PUQT 3N43B 4EIUA 2UVFA 3SO5A 5IMMB 3DJSA 2VUOA 4JG0L 3I74A 3O4OC 3VI3A 3ASWA 3D34A 2ZOKB 3P77B 2NQDA 4YDIH 4ENZA 2EP6A 2A4EA 3MRGA 4GI8A 2CUMA 5KYUA 3BPNC 4PJEF 1KC5L 3LJ3A 1AKJA 3VD7A 3WXVH 4A7TA 4PREA 5L2KB 4GMTH 3KGSA 5D72H 4YLBA 3UROR 1BAFH 1OB1B 1RPQA 4DGWC 5EBLA 1U95A 2R56H 2Y6SD 2BERA 2V5TA 1XZWA 3IRPX 5E2JA 2OYLA 4OR1A 5D96B 3SBQA 5IJKC 4F2MB 3QQXA 5A16B 4FQ1L 2BWQA 2N4IA 1AQKL 3CZLA 1UM6H 4ZMYA 1GOGA 5ICXA 3S5LB 5DCCA 2CBPA 4RIRB 4MBOA 1YEKH 4PWEA 4N22A 1PQZA 3CFMA 4IBSA 5HPMB 3OAUH 5LNEA 4F37K 4WEUD 4I9WD 1OE2A 1J5IA 1EUUA 4IOSD 5IOPB 3L6FA 4FXTA 4OB5L 4R4ND 3IDJB 4E41A 2P42B 2VO8A 3P4NB 5J6SA 3VTMA 4YE4H 5KSAA 2VLJE 5I74C 2BH0A 5FGSA 5CLWA 4FQLH 4OVUA 3IU3B 2CNYA 3OLIA 4QHKI 2FD6L 1IGCH 1NMBH 4ELDA 3HVNA 1L9OA 5JW3L 3UO1L 1PCXA 2NR6D 3PDGA 3TBSB 3OLGA 5GISH 3ZQWA 4HMDA 1SJMA 3KWVA 4NBXB 3CN3A 4JFDE 1B0IA 3KPSE 3QUXB 5BOJA 3FSZA 1NMCC 5GJTL 1U30A 5CJOH 4KK9D 2HVJB 3ETBJ 4LOUC 1RHHB 5E4EC 15C8H 4BFBD 3GJFK 1ZTXL 2VMJA 3RUGF 3T2NH 3U7YH 1PZBA 4P4RB 2E9GA 4FQQB 5C6TH 5CINH 1QO3B 3QHTC 4WU7B 5ESAA 4D9RE 1BSIA 3HHSB 4HS3A 4LCYA 4NKIL 4AQAA 4FADA 4TL4A 3HKZA 1A6ZA 2PO6B 1BYOA 4QIRA 2CNZA 1KCUH 1JZFA 3VFRB 2MH4A 2YPLB 1SFDA 3MO1A 1GMIA 4PS3A 1S7SB 3BVNB 3NCWA 2LR4A 2OYMA 2AANA 1G7QA 4TVPL 3NUKA 1FJ1B 1HWWA 2VW4A 2WSDA 4ZS7L 4O2CA 5D2NE 2CHZA 2A2QT 3GO1H 2NYKA 1IMHC 3WAKA 2GJRA 1CBVL 5JW4Q 1MEXL 2ZX7A 3QP3A 3QJHA 2EE3A 4X83A 4Y9GA 4K9EC 4WSKA 3VXTA 3T6QC 4KDVA 4OCYH 4YN3A 3NZHL 5A2FA 4YPGA 1JMXA 4MRBA 5ALBH 1JS4A 3FONB 2J88H 1B6DA 4QGYA 3TEZA 2DWTA 1LQSR 5I1IH 1LMIA 4DNLA 4P5KA 3RB7A 5B8CC 5K9OB 1UATA 3EFOA 2I25N 2J43A 6FABL 1ZA3B 2CBMA 2OTWB 1WS7A 2WAQA 1DBKL 1PBYA 2JTDA 1YPZE 3UAJA 4NDMA 5HGBA 1XB6A 3LZRA 1KB5A 4L5FL 12E8H 1PLCA 3A4FA 1HWGB 2VRAA 4OQTH 3HZMA 1IBZA 2NNCA 2BO0A 3EW3B 4MD4B 4F3FB 2EDBA 3L45A 3ZE2F 3DMMA 5LNGA 3C2SA 3ML8A 4EDWL 4L4TD 4KZ0A 1J1PL 2X4PB 5GRZA 5CHNB 5C09A 1DVUA 1TVHA 2JE8A 1USZA 1ETZB 3FN0L 4NPYB 5DMGD 1QEWA 5T1MA 4L18A 2PYEA 2FJGB 2P26A 4HMCA 4G80B 3QQ4B 3GNMH 1IZKA 5EFIA 1CGSH 2AQTA 2GY5A 3D4CA 5C07A 3QIBC 5E94A 2QHLA 3P9WB 2F1BA 3D33A 4IK6A 3EH3B 3HRZC 4TLTA 4DKDC 1UCBL 2X4NB 3U0TB 2Q7AA 1D5MA 4YBLB 4QRRB 5F44A 2FLBT 3D09A 2K4AA 1Q9LA 3AITA 4Z7NB 4FLHA 1KCVL 3AM8C 4PP2A 1T0OA 4JFQB 4HXBH 1A3LL 1OK8A 5BS0D 4HFUH 4HUVB 3Q2NA 1S9KC 2FUTA 4NKDB 4TQHA 2VDMB 2F7QA 2ZKHL 4GSUA 2GHZA 1B0RA 2A9DA 4G70B 4AIEA 4B50A 3EBGA 2HJKB 1RLBA 1FYTE 1JIBA 3HZYB 3S36L 2PP8A 3DX2A 1XB8A 3G04B 3MRGB 5HHMB 4NI3A 4N20A 4V33A 3O41A 4PREB 4RSVA 3MNZA 4XMLL 2HVKA 1L9MA 4OGAD 1G7JB 1MXDA 3KCPB 3VSVA 5I23A 1U95B 1MJUH 4FQCL 2JWYA 3NIDB 5E6ZA 4Z5RA 3HN5A 2YPKA 3BEWA 3FB6A 1TIUA 5C2UB 5JOPD 3WD5L 4ZFOB 1H3TA 2WGNB 3O2VH 1YNTA 1J1XH 1KLUB 3X1NA 4Q9QH 2F58L 3MDJA 2FEEL 4BK5C 4L3FA 3GRGA 4AMXA 2EKSB 2Y5EA 1PQZB 3CSGA 1MG3C 3CHXA 2HYMA 1GIGH 4G7YL 1H9VA 1SUJA 4W6YB 5CJQH 5SX4I 5KVEL 3ILQD 2VLKA 3C87A 3L6FB 3OKLA 3ZSSA 4MXVE 4DKAA 4UTAH 5IMOB 4M5SA 2BCMA 4XXCA 2W5PA 4ZXBC 5HHNA 3SE8L 2D4FA 2FSEB 3GBNH 5KSAB 1TU2A 3MGTA 3VWJC 1XSIA 2BSSB 3NA4A 2LU5A 2PR9A 4AQOA 1AKPA 1QYGL 1T22A 1KCSL 2GIYA 4FXKC 4DCQA 2IAMA 3NOIA 4NZFA 1L6ZA 2HCZX 1MSPA 3FW6A 5H4ZA 1ZE3C 2F1AA 5F88A 5KBLA 4DAGH 2WQVA 3STBA 3RRQA 4LBEA 2FYVA 3ESPA 2QV4A 5DVLA 2CBTA 4CC4A 25C8L 4WK4B 4F9PC 5HYQB 2VOTA 2P8MA 2HFGH 3IWVA 4NAQA 4FAAB 3JWNH 4S1DD 4G7VL 2WC7A 3BVUA 1X5GA 4JPIA 5CBAA 4X5WB 5BV7B 4LO9A 4LCYB 1HT6A 4WFGD 3LXAA 4OJCA 3QXVA 1A6ZB 1AHMA 2AK4D 4FA7B 3NRFA 5I8CA 3QEUB 3O3BA 3QXUA 3MO1B 3Q6FA 3INUL 5A2CA 5D7JB 2E75C 2Y2WA 2Z35B 1G7QB 3MXWH 3DK0A 4WJ5A 3SPHA 2ADIA 3P40A 1JF1B 2YD6A 1XR8B 4FQIH 4O2CB 4FULA 2NX5A 5D7HA 3R18A 2B4CC 2G2RA 1F42A 3NK3A 5J11B 1L7IH 5IFHH 3V0HA 4QNPE 2NY6D 3CFIC 3VXTB 2VE6A 4GG6F 3GSRB 4MJIA 2IEPA 2R27A 4FI8A 3TNMA 1ZLVH 3ATFA 2WXQA 4PMEA 3UYRH 3V8CA 4K5OA 3IRZA 1HCZA 3BP5A 1AR2A 2OJZH 3MRNA 4P5KB 4PGBA 3LMJL 1DUZB 4X99B 3JVGC 2IAAC 3DXAE 4WTZA 2G2NA 5AW4B 3T6XA 1TQCB 4LGRB 1A6WL 2XWBB 3KXFB 4NZDA 4NDMB 1HESA 2W94A 4YXKH 1Y18A 1LK3H 5D7IB 1JDCA 3P1VA 1DBBL 2OX5A 5CEYB 2XIDA 2X1OA 2AMGA 3PWPA 4BYHA 2V2TA 2OMUA 4PJXE 4OM0H 1T2QH 4LIQH 3ULAB 1KPVB 4NGHH 4LSSH 3S3JA 3PJNA 2X2JA 2IH8A 5AKRA 5B7MA 1A0QH 3MRIA 4NRYB 3II3A 1TVHB 5DZAA 3MNWB 4YDNA 3ZKXC 4MAUL 2B3IA 4U2YA 5T1MB 3ASNB 4N86A 3LH9A 2FO4A 5DR5L 5PAZA 4JHZA 3G6JB 5DXWA 5DLLA 4MQXD 4EQ2A 2HPOA 1OE3A 3GBML 5C8JB 1LK2B 4IMKC 2C26A 1MCFA 4PJBB 4Y1TA 4AQZA 4CSSA 4FFVD 3U6XA 4GOSA 3U9WA 1J11A 1HHHA 2VLLB 4Y9CA 2YS4A 2YUXA 1BPLB 4OU3A 3SDYH 1XGZA 1P4BH 3T4AC 1U8CA 3IXAB 4ESKA 1ILSA 1MAMH 3UERA 4OQTA 5I1GL 3KPLA 5AOLA 4ZYKB 4B27A 4ZAKB 4EI5A 4LRNL 2NY0B 2KQMA 4Z7OF 3AVEA 1T3FB 1J9TA 4X98B 4UM9A 3NGBB 1DQQA 5L8KB 4EPSA 4PJFB 1T83C 5TTRA 2AJYH 1ITBB 1TKWA 4C56A 4RAHA 1NFDF 5A3IC 1M53A 5GGUA 3ECBB 4XODA 1WFMA 4ELMA 2DTML 1IFHH 3FNKA 2ZNXA 1FGNL 4JMXA 2D9CA 3O41B 1AR1B 2KZBA 1I3UA 3MRCA 2UX6A 1MWAL 1A3RL 3KL0A 1FO0L 3QPKA 4ZW5A 2WYZA 5EF3A 3Q6GH 2CO6B 3LZFH 4M8UA 2ZAIA 4Z5RB 3AQYA 5GJSH 2ILLA 1IC5L 2FT8A 3BEWB 5F7LB 2F2HA 3S8GB 4MNQD 4NM4L 1S3KH 1MHHA 4N1CA 3UZEC 1ADWA 2PO6D 2R2BA 4NNYB 4XMKL 1NPUA 2YRZA 4Y2DA 3ZKND 3KLQA 2VITA 3K1DA 1Y1DA 2DMCA 1E3ZA 3HG5A 3ESUF 5TK4A 2B8OT 1HHIA 1Q94B 2WAHA 2GT9A 1BFOA 1RUKH 3BZ5A 3QC5X 1KCRH 1KTDB 1BZ9B 3OKLB 2XSKA 3GSQB 5D4JA 3T3PF 3ZE1F 4UV4L 5EUOA 4PJ5B 3PHSA 1EZVY 2YFOA 5IGXH 5HYFA 2WB7A 4N0UA 2OJEA 3CIAA 2P44B 4DIXA 1TU2B 4ONGL 3MGTB 4I9WE 3WNNA 3S2CA 3MA9H 4DCQB 1DQDL 3SGJC 2KPWA 2BIIA 4ZMVA 1JPGB 4BSVA 4PB0H 1RZ7H 1PYWA 4UOW0 1QWHA 3ARPA 4M43H 4Z7WA 1ZSDA 1WT5C 5FHBH 3CMOL 3JWOL 1M7UA 1ZEAH 4LBEB 3GUFA 5JUEL 4HJEA 4EUPB 5CN2A 2EUZA 2VR3A 1AHWA 4JLRA 1OY3B 4R7XA 1QI3A 4LBAA 2H45A 5CBAB 2NOYA 1TTGA 3FSVA 1WFUA 1Y1UA 4S1SH 4AWJC 2M1KA 4LQFH 4ODWA 2WVUA 3KPRB 2EDMA 3O6KH 4QRTB 3S48A 3DIFA 4LXFA 5J3HC 1T6BX 4F8NA 4APQD 2PXYA 1RY7B 3Q6FB 4O9HH 3IPEA 5JNYA 4X0NA 1NQBA 2ZX8A 4BUHA 2JKTM 4JDZA 2WPGA 4DF9A 4X8GA 1DBMH 2YPVL 1CU4H 4WJ5B 2ADIB 3FU8A 2WNWA 3PQYE 4PHZA 3QS3A 1EZUA 5KJRH 3TFKD 3GIZL 3K4AA 4YEFA 2J1YA 1FFNA 4JMNA 3MBXH 5D1QA 1IAKB 5HDBE 3V6BR 1QTPA 4B9CA 5ID0B 4XI5C 3U7WL 3CVDA 4DZBB 1XIWB 4U4BA 4CN4A 2VE6B 3PABB 3W39B 4TNVK 5AG8A 2YFNA 4KXZH 1RJCA 3TNMB 4BZ2H 1I9IL 3HB3C 4HJIA 5JPNA 2D7OA 2XYBA 4JCMA 4XB3A 3VYOA 3MRNB 4N9GA 1SXSA 1TSHA 3RDJA 5KVDH 3MLSL 2O5YH 4PLOB 3SDXF 4G3YH 4EZJA 3BAJA 2GQHA 2JB5L 1Y18B 1NKGA 5D6DA 1NKOA 3MRFA 2W9EH 3QJUB 2OX5B 4MA3A 1IIKA 2NY2B 2WVVA 2XQ0A 1F4YL 4M1GL 4YFLI 3D08A 3X1GA 4AENA 4AYEC 2Y9RT 3EG9B 4Z0XA 4PW4A 5HHMD 3Q8BA 1E8WA 2UZXA 4RCAA 2I5YH 4L9LC 2PPEA 2W60B 5ESQB 4CMHC 4ZX4A 4JG9A 1S7UA 4U3SA 2FECL 2X4UA 2L8AA 3AABA 3QO1B 4ISVB 4U1LA 1A22B 2IFFL 3CZKA 3E3QC 4DP6X 4YSCA 1N4XH 1S7QB 2R39A 5DC9B 4KRPC 5C0CE 5LN8A 4DOHE 4EVNB 1T7XA 3LRSA 1WAAA 4RGNE 4A63A 5IVZA 3NG5A 5EWIL 2X89A 3KPLB 1OP3K 4JCWA 1A64A 1KGJA 3WDHA 3RIAK 2F5BL 2O5ZH 3V10A 4G8GE 4NFBA 4AG4H 4E41D 3T77B 1V54B 4F20A 4V1DA 3T2OA 2P8LB 3VXRE 1XGUA 5DZJA 2W59A 4D7BA 3P9MA 1F6FB 3IDYB 5AW3B 5KSAD 1QTYT 2A9CA 5GS2D 1P84K 4NJAH 1TKWB 3ARBC 2HRPH 2F8IA 1IV8A 1QSEA 2QLVB 4C56B 5C71A 1ZLEA 3KEDA 4FQJL 3NCFB 3OHXC 5GGUB 3V5KA 1M7IB 3ZE0F 3IGLA 1G0XA 2M8XA 3ULVC 3WIFA 1XAUA 3MRCB 1UWFA 2OULB 3TN0A 3PNWA 4A1RA 5LBSH 5K1VA 3QJZA 1U92B 3FHAA 3HEIB 2TSAA 5FWRA 1ORSB 1U8PA 1ZXKA 3O8XC 3T3MB 2XXGA 2PTVA 3Q9PA 3WTTA 1XF3A 5SWSE 2CPCA 4A2GA 1NGYB 3BGAA 1TXKA 1OHQA 3SY0B 3VMPA 4Q7DA 5B1JA 2AV7A 5B39A 2E7LA 3T6WA 3O6LH 1SYVA 2WXIA 2Y5QA 2SEBA 5DHXB 2R2BB 2QVIA 5FCUH 1CBJA 3G5ZA 2WM0A 4PJIF 1H3WM 4Y2DB 4DT2A 2EXSA 4YDKH 2VWEE 5D7JD 4H13C 3RKDC 1HHIB 3GLZA 5JOPE 2A7BA 2BP5M 3E6FA 2GT9B 1F3RB 1QLFB 2R51A 3WTXA 4XNUH 4Q9BA 4MHHG 5EUOB 1EMTL 4MA1C 4N0UB 3Q8FA 2OJEB 1OGTA 2O61A 4YGAB 4A2EA 2DQUL 3BQUB 4PH8A 2ZUQB 3NSFA 3GS4A 1R3KA 2F19L 3GSWA 1YSOA 3IS0X 2HVBA 3MRBA 2WBJB 2WZ5A 4BH7A 5CKAA 1M6OA 3H53A 1UACL 5IMKA 5JXED 4BSVB 1MWAA 1Q9KA 1BFSA 1PYWB 2YOAA 4J3OH 4Z7WB 2PYFB 1DVQA 3VQ1C 4QUOA 3KXFD 3UAJD 4PGDA 3C6SB 2NRDA 1IC7L 2H7WA 1WA2X 1MFCH 3PP4H 1TR7A 1WWWX 5FPIA 4Y19A 3N55A 2XA8L 5BZDA 1UA3A 1KGIA 5HJ3A 3IVKA 1V10A 1HH6B 2BWDA 1G1YA 2AABH 3OPZH 5FKAB 4BGDA 4G8FA 4OD3H 4XB8A 4JFSA 3L3IA 4ODWB 3U46B 3UTSA 3M07A 2EO1A 3I50H 4UDUB 1MIMH 2EEAA 1KN2H 1S7RA 3NH7H 1H15A 1VACB 3OJMB 4KJWD 4I8DA 4L8BB 4RNRA 5C09D 4AV4A 5JNYB 4JB9H 1SJVA 1ASPA 4OT1L 5FA4A 3WEMA 5E6UB 2PYED 3SPIA 2XKNB 4U4IA 3GSVB 2K70A 3B1UA 1YDPA 1YEGL 3CD4A 2R4RL 3LNGA 5BRPA 1FZKA 5C07D 5H4YA 4PJ9C 3M8OH 2IGTA 3TONA 4V2CB 1HKLL 3L4UA 3X3GL 1XBRA 3TVMC 3ZR6A 2QQKH 3I3BA 4G1EB 4WHCA 5I1HH 3IDMA 2XQBH 1RZKC 1GSKA 1GYVA 3P54A 5DHDA 4BH8B 3UXFA 4CVXA 4FA8A 4MBRA 3W9EA 4LEXH 1HDMA 2NCEA 1UURA 3Q8CA 4HQQL 4N9GB 1ACZA 2G3XA 2V37A 4OZFB 2WLZA 3CVIL 1DLHB 4AVIA 3UMNA 1IEAA 4NWTH 4XC1H 3EIFA 3FT2B 4LE8A 3WDIA 3U1PA 3CFJA 1JPFB 2MOGA 4MA3B 3NAAH 2WVVB 3DETD 3RY6A 1WJ3A 4G9DB 4U6HB 1KIRA 3WFEL 5ITBL 1LDPH 4YSSA 4AYDC 1WAPA 1JNHA 2E7CA 4QHPA 4NC1E 2UZXB 2YPVA 1IU1A 5DZPA 4JANA 2W9DL 2F8VA 3BYYA 4JY6B 4JQXA 5HVWA 2F6AA 2UXFA 5EU6A 4EOWL 2OR9L 4GJTB 4BZ2A 5FUZH 2VT0A 2X4UB 2ADGA 4HGWA 4M7LL 3RURA 1UWEH 1WZKA 5B7FA 5D2LA 1KXQA 4AGMA 2R4SH 1BYPA 4RFNB 2C1OB 1MCWM 4RMSA 3RBSA 1U8OB 1YAZA 5AW9B 5LNDA 4RZCB 4Y1AA 2XU9A 4GAJH 1DANT 4HWEL 1BQLL 5I6XB 2IDUA 2XWRA 4FABL 5L6YH 3AU1A 2WQWA 4WKZA 4UYQA 5GRWA 3TBWB 4R8WL 4QCIB 3POHA 2VDLL 1OAYH 2FEJA 3FRPG 2B0SH 2C4FU 1XGRA 1AE6H 4W81A 3N40P 2EC9T 4A6YH 1P6FA 2HSIA 4KXZI 5T3ZH 3BIKA 3RWGA 1K5WA 3CFTA 4KHTH 4CGTA 1IRAY 4DEWA 1QSEB 4UINL 4CNIA 3QWRA 3I02A 2P80D 3SD2A 2IAMD 1NBYA 4KKLD 3S36X 3CFEA 4DP8X 5GRUL 5B3NA 1HCYA 1FLRH 4N0CC 1ZANL 2A4CA 3RY5A 2NXYC 3BKML 3LNEA 3C5ZA 5E8OB 2X7LA 4Q9CA 3AUVA 4R7DA 1XF3B 3SN6N 1IQWH 4F8QA 2I69A 4HUWB 2VXUH 2AV7B 5D4IA 4HZLB 3QT2A 4HS8H 1SYVB 3SKUD 1PX4A 3FYIB 2MQ3A 1UKTA 4XBEH 1KG0A 1H19A 5J13B 4MNGE 3QUZB 1JZHA 3W2DH 3G5ZB 4NLAA 1TTFA 3FAXA 1NDMB 1MREH 1UXWB 1ZIBA 1UASA 2ZOUA 3CN1A 4QYAA 3RL1B 2YEQA 2V9UA 5E08H 5IFJB 4MNQE 5GS1C 4AC2A 1NEZG 3DTXA 3E6FB 4ODTH 2B1AH 2JI3A 1OHZA 2XY2A 3DIVA 4XZUA 4J4PC 4UAOC 1YPZF 3C5XA 3QJSB 2D3NA 3WXWL 3BVDB 4G6JL 4UQ2A 4XAWL 5FYKH 1RFDL 1KB9K 1XIWD 1YN7A 1OGTB 2O61B 3DV4A 2XFXA 4MJID 1LEKA 3MLXL 3PWUB 1TQBB 3GSWB 3MRBB 4PJGA 4G8IA 4NX0A 5CEZH 3QUKB 3AACA 4KBPA 1EEYA 3SDAC 1MWAB 3NQKA 4I3SL 1KJ3L 4NNXA 5J4MA 2IGLA 3MRJB 4FNTA 1FO0B 3U4AA 1L7TH 3WS6C 1NICA 1HEZA 1RU9L 2IQAA 2R0LL 2YK1H 5TE7L 2JJSA 2ODHA 4U1GC 4Y19B 1JZ4A 5ANMB 1IBGL 2WCPA 2CUIA 32C2A 3HC0B 3HG3A 3LPFA 4S2SA 5BZDB 3E38A 1MY7A 5HJ3B 1PEWA 3IVKB 2QADC 4WEEA 3H9YA 1C1EL 1I9RL 3SKJH 1SQ2N 2DH2A 5D5ME 2ICWA 1WBYB 2VZTA 3OGOE 3UTSB 4BKLB 4U0RC 5IBUG 3BXNA 3IPFA 4RNRB 5F1KC 1H15B 3QFJE 4TVPD 2MQCA 1PKQE 1BDYA 4FNSA 1IAIL 1TQVA 4H25B 1P9MC 5AUMA 3HE7C 4BSJA 3SGEH 1FDLL 2E9WA 1YNKH 3TBVA 4CRPA 3EYSL 5FA4B 2QPDB 4PTUB 5EIQA 1QPKA 2BHZA 1A6TA 1TCMA 3UTTE 2IMNA 3TT3H 5DD6A 2H0FA 5BZWA 2VLRA 1GGTA 4G7QB 1ZK5A 2QV2A 5DO8A 4ZW3A 1ZOXA 3ABKB 3L4YA 4KMLB 4NQCA 3IDXL 3RFZA 1E8ZA 4WNQA 1MI5E 3LPGA 5DFAA 1MFNA 5CS7A 5T5NG 4UOZA 2YAPA 5CILL 1F1GA 5HYJA 2L04A 3RPIB 1PZSA 2VM4A 4UQEA 1VFAA 1D3CA 5IHZB 4CVZA 1QPPA 4LVEA 4ETQA 4EI5D 3VWKA 2FX8L 4TQPA 1YUHA 1OGAE 5DTFB 4ZOBA 2Y6SC 3FBQA 2ZP0T 3NABL 4NOFA 1RL1A 5KAQG 1JWSA 2YMOA 3L3JB 2YUZA 3O45A 4PVLA 3UC0L 2B2XL 1IFRA 4C56D 4Q9RH 1KIRB 1SOXA 4ZFFB 3VD0A 3EYFA 3FCGA 1W8OA 2F15A 1TO5A 3RGVC 1KJMA 1S9XB 3PGFL 4NFCA 5F7EH 5G4MA 3QCUL 2E9JA 3NJKA 1F97A 1F18A 4JANB 3VI3E 3TASA 2APBA 3NZSA 5ETUA 4JN1L 5HPOA 2GJ6E 5E95B 1OL0A 3U9PL 2VR4A 4R4NC 4MASA 2GTWB 4MXVF 5D2LB 2J5LB 1JZ5A 4AE0A 1EA9C 3GT6A 4AYFA 4HIHB 4R83A 3DPBA 1YY9C 4X6CA 2YGPA 2D0HA 1MCEA 1JWUB 1TNNA 4WNSA 3UDWA 4DW2L 4Q58C 4HX1A 4Y1AB 4Y2DD 4BE5A 1E50A 3BH4A 3VGHA 1WGVA 4NYLA 4Y5XC 1M1XA 4KKBD 5DFTA 2NR6C 2ZSVA 2VDMH 1U8IB 3PY9A 4ZTEA 1T6VN 2CCLA 4NO2A 4WKZB 5AW5B 5EORH 1A1MB 2H3NA 3UTQB 4GNKB 5EU3B 1GGBH 4KK9C 2KS0A 4WJG3 1LMKA 4TLUA 2AC0A 5ISZA 1IM9A 1OQOA 3SDCC 4BA0A 1H5BB 2AXGB 1KBGL 1T1ZB 4HHAB 3RWGB 3BIKB 1QTSA 3UAAA 4PJ7A 4XR8C 3BQUD 3QH3B 4JW3A 1S5IL 3F84A 3QUYB 5F0LB 4CNIB 5HYSA 4IJTA 1MNNA 2EIKB 5T3XL 2V17L 4YZFE 3F62A 1CXLA 4Y16B 4MAYB 4AL8L 1OK0A 5I1EH 1Q0XH 1BFVH 1RSYA 3WU1A 2PW2A 1ZA6A 3FCSA 3X12B 3C5ZB 4WI9A 3N9GH 1J5OL 1BZDA 1VESA 2JJUA 4JEGB 5LN4A 5C70A 2X7LB 1TMQA 2F53E 2DD8L 4WI0B 3SPCA 3FTSA 3LSOA 3V0GA 2EE9A 3EO9L 5SV3A 4QNPF 4DEPC 3VXUB 1KG0B 4WWNA 2DLFH 3PHQA 4JZJA 1CLYH 1X5KA 1OAKH 4YPJA 3EZJB 4KJYA 4TXVB 4JFPB 2PXYD 4J6RL 4WI8A 3CQFA 5LB1A 1IX2A 3WJJC 1OE1A 4R90H 1YEWA 3S3PA 2X6UA 2IH1A 3JWDH 3MJ9H 4W93A 4PB9L 1VFOA 2WXNA 1DEEA 1NCNA 4DJMA 1GC1L 4YC2B 5GS2H 2EICA 3LH2H 3BP4A 5C0DB 2OW6A 2PETA 4UQ2B 4JKNA 4AX3A 1B2WH 2YGOA 4E9TA 2V2XA 1ZVSA 4M1CD 1LEKB 4N2AA 4PJXF 5DWUL 5IP4A 1R3IL 2VB5A 4YUEL 3H9SE 4G8IB 5IESH 4NNXB 1RIUL 2F8XC 3VQLA 1GTFA 4UI2A 1PL3A 2R2EA 4XOAA 4JFOA 4N9OB 1HEZB 1E5AA 4N0YL 1JZ6A 4R7NA 5DMGC 2IQAB 5IQ7H 3VI4A 4F1SA 2DBJA 1WCBB 4ONHA 4JZNA 5BV7H 5BQ7B 2Q7YA 3RVUC 3N41B 4S2SB 3VM5A 5JPMC 2J8UB 2MTAA 4RGNC 3T0BA 1AIFA 1U3HC 1XF1A 1CPUA 3AREB 4TNEA 1BM3H 1NJ9A 2VDPL 3ZTNL 2TRYA 3BT2L 3OTTA 2H32A 4HBCH 5I15H 2CRZA 3EDEA 1Z2KA 5AUMB 2WIIA 5G4OA 3FUDA 2I9TA 3LKRA 1H8OA 3TBVB 1J0YA 5EOTA 5D71L 5EU7E 1RSFA 1A6TB 3VXOA 4OCXH 2YMXL 4DGVL 1UA6L 2JELL 5I6MA 4I18C 1UWGL 2VLRB 5C09E 2C1PA 2NW2B 3FSOA 5D55A 3RA7L 3CX5K 4KXBA 4NC2B 4YSAA 3RFZB 2PYEE 2FJUB 1YMHB 3PHOB 5CJ8A 2JFCA 5DVOA 1FI8C 3K72A 2ATPB 3BKCL 5C07E 1A3ZA 5KN5B 3H0TA 4JRWA 2X89D 2VXVL 4CVZB 2DV6A 2QPFA 4OGAC 1I8MA 1KDJA 1P6WA 4GMSH 2EDQA 1V3KA 1YUHB 4QRFA 4JRFA 4NUGH 1B3IA 3O3AB 5D7KE 4WCYL 2IXQA 1J10A 1H3GA 5CMAA 5DHVB 4YMPA 3V0IA 1QSED 2PWGA 4YHNA 1A65A 3BZFB 3HUJA 5CSBA 3DJ9A 3BRGC 3QZMA 1N70A 5HGDB 4YSEA 1RD6A 3QVAA 1QMUA 3MRPA 3TN0D 3SOBL 4I7ZC 3NACL 1U58A 3MRMA 1OARH 4AQ8A 1S7TB 3LS4L 2ZXAA 3C09C 1IILE 4LF3A 4QTHA 2H26A 5E1GA 2WXKA 3HZ3A 3QRGH 4WFHE 3SGKA 3ILQC 3SKMB 2WANA 3FC8A 2VXTH 3VU2A 3MREA 4LOFA 2JKSA 4AYFB 2A77L 4OIBA 5HGAA 4BXVA 3D9AH 5ERWB 4KNUA 3QUZD 4HX1B 3FU3A 1IC0A 4ZMNA 4XNZC 4Y4HA 3SGEI 4ENED 4P3CL 4NYLB 5F9JA 5KYYA 2J6EA 4AVKA 5E99L 1QVOA 1RZFH 2NY7L 4AQ1C 4QO1A 2ZSVB 1M05B 2MNWA 2QQNH 4WI4A 1Z5YD 3ZYJA 4MNHB 3QUMA 2M26A 3HVDA 1F00I 1S9WA 4J3VA 4PJDB 2A3TA 3QDJB 2MHAA 2VQ1B 3IETB 4X8JA 5JA8B 4OFKA 3LKNB 4HSAC 4XOBA 2QLYA 4S1DC 4W9ZA 1VADB 3ESMA 4WENB 2HJLB 2VSKB 3D25A 2CXGA 3H4FA 1QQDA 5HYSB 2VLKE 3S34H 5EOCH 1NCHA 5D8JH 1HILB 5FO7A 4OGYL 1XQ4A 4PWFA 3RVTD 1HE7A 3VNZA 3BWAA 4NM8L 1CFNB 2PW2B 3M7FB 3QFDB 2GUYA 4QXGH 5I1JL 2UWEB 4XNXL 1A4AA 4PS8A 2CRYA 2MOQA 3B3IB 3GSNH 4L8CA 4Y19D 3GMQA 1JNNL 4MMXA 3IJ7A 3WFBH 1U41A 5ALCL 5F7FA 1RVFL 2AEPL 5HDBF 3KW7A 3RJDA 1FCGA 4YHYC 3OZLA 4LCVA 5I5RA 3MOBH 3TLRA 1XGTA 1KJ2L 3UBHA 3UTSD 1CO1A 3B7RL 5IMLA 5FO9A 4KJYB 1D5XA 1YNLL 1T1WA 2I24N 4XN7A 1NCCL 5JHDA 3GLEA 5I5IA 4KK8D 2KZKA 3KDPB 3VXMA 2BSTB 4LESA 5INCA 4ZFZA 1E4JA 1T20B 4YEEA 1CXFA 4MCZA 4X2UA 2BVOA 2RFXB 1MLCA 4WW2F 4I13B 5SWQA 3RJOA 4W9LC 4AKPA 4AXWA 3OR6A 1BBJA 1T7VA 1YYCA 1ZVSB 3ILPA 4NN5C 2NX5E 1GJIA 2VL5A 3U4EA 4ZFGL 5IT2L 2EYRB 1JG9A 4P8QA 5BCAA 4XN1A 4BKSC 3LKPA 1MZYA 3T2QA 3P3YA 4HWUA 5LJYH 4NWUL 3VD9A 3IAGC 4MJIE 5ILTH 3BEVA 5HHVL 3E6HA 2IPTH 1MN4A 4GRWB 4R7NB 5K9JH 2VLMD 4ZD3H 1FSKC 2ZXEB 2B1HL 3II1A 4IDLA 2W92A 4WRLA 4QR7A 1AGEB 4M8QB 5JA9A 1HH9A 4B3EA 1NUDA 1AXTH 1EUTA 3P2BA 5KEZA 2FWUA 1DYZA 2FUQA 4W70A 2CGRH 4IDJL 5B1KA 2Y06L 5INDB 1ZV5A 1LO3L 1FPTH 1W2KT 3IF1B 1TZHB 4PIBA 1WO2A 5FGBA 2H32B 1WPCA 1U42A 1XMWA 4E9XA 4MDRA 2X12A 3PWPE 4KTEH 2WIIB 4R4FH 4A37A 1KCWA 2I9TB 3LKRB 3NESA 1XF5B 1P53A 4XO3A 1ZHNA 1AGFA 4AJVA 5C6WH 1R0AL 1OF0A 4K9JA 3ARDA 3DX7A 2OAAA 2QR0B 4FZ8L 2FD6H 4CC0A 5C0AE 1X5HA 5EDXA 3V7AG 4GKSA 2YO3A 4NQEA 4L05A 4MKMA 2GAZA 1OVZA 4X0KA 1MFMA 2YD7A 3BW9B 4M3JA 5FWQA 3QYNA 2WUCL 1CF8L 4Y1AD 4HAFA 5AVWB 2BSEA 3U2SB 4PG2A 3WHXA 2DM7A 5IW6A 4BFJA 1EGJL 2EH7L 4JJHA 4XXDB 4G1MB 3UAEA 3EDJA 3MNVA 1G7HB 3V6FB 5LLIC 3O6FB 4H8UA 1EAPA 2NY1B 4XP4L 5C2BH 2C7UB 3FF8A 3WHE0 1C16A 4XNYL 5B1CA 4CW1B 5TQ2H 4KRNA 4S11A 1AZRA 5F7YC 3ET9F 3V7AE 4AJWA 2NXZB 5GSVB 1V7MH 2PO6C 5JW5B 4Y16D 2AJXL 4UIMA 2IDTA 4MAYD 3CDZB 3ZKNC 5AWNL 3MRPB 4ZMOA 1FN4B 1NCUA 3JV6A 4PWJA 3C5ZD 3TO4A 3V79C 1IC1A 3NIFE 4XCNA 4WLCA 3DOSA 1JNLH 4XVJL 3MC0A 3CFDA 1WCQA 4ELME 3WAJA 2XN9E 2NLJA 4AYGA 2AKRA 1NUNB 1QD0A 3MREB 3UH8A 4KVNH 2GK2A 2C3VB 4ZUVA 5HGAB 5IWLA 3VXUD 2EEDA 3L5HA 3QWOA 3SD5A 1A9BB 2VMFA 5FKPA 5EG6C 5JOEA 1U4FA 2AXFB 1QRKA 2OR8A 1OF2B 2YAOA 4KQ0A 3CN2A 4AKOA 4QO1B 3NYKA 5DEGB 2G60H 3KYOA 3F05A 1PDKA 4ODUA 3UGXA 4I1RA 3MACH 1XZ0B 4EDWH 2XTLA 4X8JB 3IXTA 1LD9B 2AQ3A 4M7KH 1LP9A 3II2A 5IQ9B 4HK3J 1D6VH 1H3PH 4NQVB 3D25B 2WLYA 4ELKB 1QQDB 3HE6B 4NENB 1G7PA 2Q8BH 1TFPA 5FYJH 3WCYA 3ISWA 3CCHA 3HNVL 3CDYA 4P3DB 4PGZA 5FO7B 1GVIA 1WFNA 2IPKA 1T0NA 2YEZA 3AAZB 3BAEH 4HW6A 5F3HA 4APQC 5C3TA 2X0VA 1WEJH 2FBJL 4L3CB 1NBZA 4Y5VB 5KVFL 1WFJA 3G5WA 2YKLH 4OLYH 3O2DH 1PVHA 3TIDA 1MFEH 3SJVB 2X6CA 2OP4L 3DUUA 4GSDL 4BELD 4XC3H 3TFKC 4E42B 4W9DC 4LCUA 5BW7C 2AI0H 4WHYH 1CB4A 2LVCA 3ARED 2Z7UA 1C9SA 5H8DA 1QSFA 3WEBA 3RZWA 1HHKA 1TOXA 1TQUA 4HDIA 1PZ5A 4Y4FA 2HKFL 1XGTB 1T5WB 3KZ8A 1DSWA 3TH2T 4AV0A 3ME0B 2GITA 1T1WB 5E8EA 3MCKA 1I9EA 3NPSB 5CP3H 5IJBC 2XWJB 2CLRB 4PGEB 4AGLA 1YYLH 1JHLL 4ZFZB 5HGHA 4MCZB 1TTAA 2BVOB 2VLRD 3QARA 4WO4B 4DZ8A 4A2FA 2RH0A 5J12B 1UB5A 3OR6B 1BBJB 1CFVL 2GI7A 2YAQA 5TDOA 4ALAH 3VXQA 2FH8A 5KS9F 4D0CA 5EEZA 5DVNA 3VGAB 2UZYB 1C5BH 2BS9A 3GSNA 3H54A 1B0GA 4HPOL 5D1QE 3MV8B 2ZKMX 2DJSA 4KKZA 5SX5H 1CF1A 2ADJA 3LKPB 4BHUA 1CE1H 1MLBB 2AJZA 5KG9A 4ABUA 1E43A 4RBPH 1XH1A 4F1ZA 3BEVB 2H6UA 5ENWB 2R8SL 5KUMA 1YRKA 3F6IA 3VW3H 4GIOA 3QCTL 3JWNE 4OLZH 4WGKA 2ICEB 4XH2A 2J57A 4Z7UB 3S4SB 2ZONA 4Y9EA 5CGTA 2Z3FA 4OFDA 4WHTA 4WW1B 4YHZH 5EC1A 4DGIH 4TSBH 5ABDE 1E7VA 1WBZA 4LP4A 4ABVA 1JZJA 5KVEH 4Y8AA 4N1HB 3GK8H 2R83A 4DPCX 2R1WA 5I0XA 1MJ8L 3WIHH 5F8QC 2X2HA 2X05A 5T33H 1QFWL 1ZHNB 1N8ZA 3DX7B 4A67A 3QHFL 3PCYA 1CWVA 1RURL 3UZVA 4LL4A 4GKSB 4DESA 2XWZA 3FTGA 1U21A 4AYBA 4IHOA 3EOYG 4MMYA 3OKNA 1LL1A 5JHLL 4DHLA 5KSAC 5CBEA 4CU7A 2AZAA 2FR4A 3TH4T 1XF4A 3WHXB 2GIMA 4A38A 1LO4L 4OZFH 2EJ1A 2EAEA 4QKTA 1WP6A 4GI9A 4LVNB 4UTBH 3MNVB 5DYFA 2EIZB 1OSYA 3C8DA 2V2WB 1FG9C 2G5RA 4J3SA 4NZRH 4Z76A 1EAPB 3QDJD 3I3DA 5T1KA 1L4IA 1W16A 4XGZA 1WC7B 3FT9A 5AZ2H 2MKLC 4J8QA 3ECWA 1C16B 1IT9L 1KLGB 4UQDA 43CAB 4K9EL 2VDKH 2DBLL 2VDPB 4LIQE 4KHXH 3RUGA 1VZIA 3HLAB 2ZF8A 5F96H 2W65A 4V1DE 3D69A 3RAJH 4PM1A 1OT4A 4UIMB 3SYCA 2X4TA 1BVOA 1Z3GL 2Z0UA 4LKCB 4YK4B 1NUGA 1VPOL 2XTJE 3P11H 3RLSA 5C9KA 4XPAH 2OMYB 4XCNB 4PS7A 3K4ZA 5EEYA 4JHWL 1GGUA 1RIHH 4G72B 1E28B 4G5AA 2ZYSA 1TLMA 2NLJB 3LQAC 2NYYC 4P2RA 2AKRB 3CVHH 4KQ4H 1D5ZA 5EZOL 2GY7B 3ZL2A 3WV0A 4ZUVB 4O02H 5HTSA 1J05B 3J7HA 3L16A 2DZEA 2JQAA 4G8AC 5FKPB 5I6NA 4IGBB 3OZ9H 3PWVB 5GGRA 2CK0L 1P1ZA 2DQEL 1QBBA 4ODHH 5FOBB 3J8F7 2W38A 4NKQB 4H8WL 1A6VL 4DPAX 3MFGB 3OV6A 5I1KL 1AIZA 1P7KA 3KYOB 3GZKA 1PDKB 2AVGA 4ODUB 3MKKA 5CCJA 2VZOA 1BAWA 4GXVH 4JKPL 5F6IC 1E6JH 2EYTA 3UAJC 3ULSB 5ADPL 3DVGB 3IXTB 1F5WA 5C08B 1N3NA 3B8SA 5CR1A 5DSCB 1R24A 1EBAA 1EJOL 5F1OB 2I60L 1LP9B 1MW3A 3G08A 4TF4A 1E4XL 5EOQH 3ZTJG 4L0PB 4A7GA 4TS6A 3DMMC 2A9MH 1G7PB 4MAUH 4O5LH 5EU7C 4JFZL 5AVYB 5C0FB 4P4KA 3TTSA 4UB0L 5D5MF 3OJ2C 1TZGL 3PWNB 2IPKB 2Y7OA 4MKTA 4HWBH 1XAKA 1O5DT 3GBMH 1L0PA 1NAKL 2FJHA 3DV6A 1KZQA 3TIDB 5FHAH 4EDXB 4MB3A 3CH1B 1SLWA 5HD8D 1QPXA 1F58L 3MV9A 5DK3A 3VMOA 1ZVYA 2R2CA 1EXHA 3VXNA 4PCKA 4HV8A 1LILA 4Z6AT 1CGWA 1HHKB 4YDVA 4K23H 1PZ5B 4Y4FB 1AZBA 5ICYA 3QDGB 2YZ8A 1JPTL 4XP5L 2VDNH 2N1TE 1WIOA 2WN3A 3DVNA 5B38B 1NSNH 2OQJB 3IJSB 2CLVA 5E8EB 3MCKB 1SM3L 4LB8A 4FXGA 3B43A 1EFXB 1SOQA 1NCDH 2F7IA 5E8NA 3CLEH 3F7PC 5C0GA 3VU1A 3MRRA 4YDLB 3VH8A 2L4OA 4FHKA 4UQ3A 2ZKWA 2Y7QB 4L9DA 3B2VL 1YHPA 1OSPH 1QBML 2DTMH 3NGBC 1SMAA 4MAZA 1UB5B 5TDOB 5SWZB 2DQFB 4G6KL 3HG1A 3O2DA 4JQIL 3FB5B 4H26B 3JYCA 4MQ7A 2IWEA 5TE6L 3QNFA 4KUZL 2O6FA 4XCEA 2E8ZA 1KENL 3ZVVA 3NN8B 2H3KA 2YXVA 2ADJB 1B0WA 2ORBL 4N8VG 2AJZB 3MBWB 4J2QA 4LAQH 3SKNA 3O6FD 4XVSH 3ZYOA 5JXAH 1G9NC 3BN3B 5T5NF 4Z3FA 5IUSA 3VI3F 1MY5A 2HZHA 5I0DA 5DRZA 1NL0H 1VJSA 2NTSP 2XPGA 2J55A 4PJCA 3ZUNC 3HC3H 1WZAA 4U1JA 3S37H 1JCVA 2YIHA 2Z91A 1KJ2B 4ODBD 1FE8H 2NXZD 3EOTH 1NM4A 2J56A 3F01A 5DQ9B 5EC1B 3WE6A 3ZDZE 2XIIA 4LHUA 5KAQF 1CFQA 2X5PA 4U1SB 2R1WB 1HAUA 4NN6C 1BXUA 1SLVA 5D7SL 4DPBX 4UV4H 3EOAB 2LAGB 1N8ZB 2EO9A 4FERA 2F54B 4KKPA 4LCCA 4H8QA 4XXCC 1RJLA 2JKIS 4MGXA 3FTGB 2AF2A 2UZPA 4F7KA 4IHOB 2K1MA 5EU6E 3OKNB 4BZ1L 2FR4B 3V0DA 3CMOH 3WJMB 4N8CL 2EABA 2UY7B 2IAMC 4NHUA 1KXQE 7TAAA 4KKLC 2HP4A 1G6RL 4GS7B 3WL9B 3D52A 4YZFF 3FKUS 4ZTOH 5KVDE 1BD2A 2DYPA 4OBSA 4X7DC 1EDHA 5D1XB 1KPRA 4Z76B 2DOCA 5FOJA 3AS1A 5FYLL 1EVUA 4ZW8A 1HI6A 4XGZB 4CC4C 2HAZA 4N8UA 1REIA 4PW9A 2BS8A 5IEKA 3F3HA 2Y07L 3H7BA 3MCG1 2HT4D 1P7HL 4DK5A 2R9HD 1N59A 1MW2A 1YJDH 3D0VA 4BEIA 3RUGB 2G3MA 3QG6B 1WICA 4HETA 1NKRA 2ZWLT 4X9BA 2GJZB 4WF7A 1N26A 4LDCA 3DVIA 1AQDB 1I8UA 1ZJAA 4IYKA 4AUUA 1CIUA 3S3SA 4H2AA 5JQ6H 2G9HB 3MJGX 4GKNA 3SE9H 1BF8A 1GRWA 2XVGA 3SJVD 3VD1A 2HFEA 4ZX5A 1HVXA 2IBZX 4YXLH 4F8OA 1ORQB 3VD5A 4P2RB 4FFWD 5EN2A 2GUOA 2LU4A 1D5ZB 4Q4IA 5JHLA 3KMDA 1E6OL 1IQDB 1E5CA 1Z9SB 4HCFA 5GGRB 4Z3EA 1P1ZB 4UOJA 3WEAA 3A6OA 2AQRA 3IKCA 3VFVA 1E65A 1OCOB 5JZ7D 3A21A 3VGBA 4R0LA 1VEOA 1PZDA 3VXMD 3KJ6L 4ATTA 2B77A 2WLJA 3BWUC 3CFQA 1X3DA 5TFSH 3VB8A 1R24B 1ZV2A 4POZC 4M4RA 5T3XD 4I0CC 4I77H 3GKWL 2KH2B 4P2CG 1XMEB 3TP4A 1BZEA 4JKMA 5TF1L 1FNGB 1MVFA 3GDCA 3GI9L 5HP5A 5K59F 3ZE2B 1N64L 4JZOB 1BQHB 1UVQA 2DQCH 5C7XL 3DV6B 3SPVA 1VEPA 3CGTA 4PJGE 3ZT5A 3W56A 5JIPA 4KI1A 4GYBA 4LP5A 1AHKA 4WSJA 2QEJA 3MV9B 4CUCA 5L88H 3WG7B 1ZTMA 3QAZC 4HV8B 3MLTB 1BREA 4YDVB 2FB4H 1M71A 5ICYB 2I9LA 4J3OG 1UZ8A 3FN9A 5IBLC 2B5IC 4FQXA 5AKVA 3LKSA 3R1GH 1CLOL 4FXGB 2WOBA 4PUBL 2C4FT 7FABH 5EEUA 3RY4A 5C0GB 2WQSA 1BQKA 4OLUH 1KY6A 2N1KA 4MS8C 1ADQH 1SQMA 4UQ3B 3FUEA 5DMIH 4EI5C 1OP5K 2R0WH 3CLFH 4X80L 1G94A 1X5YA 2ZAGA 4NZTH 3L1FA 5KBPA 4LASH 2X6VA 1JXGA 1Q72L 1YMMA 4P9MH 4TYUA 3GWJA 4L3EB 3LPWA 5I8OL 3MGOB 1NIBA 2PCPB 3H3PL 3IDYC 5KVGH 4S1QL 4WNJA 2DS4A 4M5YL 1KJVA 2DMBA 3HG1B 2J1XA 4FEMA 4HIEA 4PLKD 1CS6A 1T80A 2BOLA 4MQ7B 3SQBA 4F8TA 2W07A 5I16A 4XCEB 3A4DA 1S7XA 1Q0YH 2BXYA 2ED9A 3D05A 1SDDA 3S3BB 3SKNB 1KXVA 3MKGA 4NQCE 3UFIA 5JLZA 5DUML 3FPYA 5C0BA 1IL1A 4C55A 1W8EA 2A38A 5DRZB 5HYJE 1NAML 1I3VA 1SJHA 1OAQL 3GEFA 5GS3A 1IM3A 3O4OB 3D2TA 2Z91B 4S0TD 4QRPE 3GUTA 3RWFA 3BUTA 1CXKA 4U6XB 3FO2B 4HZ1A 4YHOH 3V9CA 3WE6B 4Q6IA 4Y2DC 2ITCB 4R7VA 2PMZA 3MR9B 1Q1JH 3P30L 4KKBC 3GPSA 2ODIA 3VACA 3GMLA 1NGQH 3HA0A 1YNTF 4OLWH 4KRMB 4U1KA 4RGOL 1J9CT 3BWSA 4LCCB 4HH8A 3QHZH 4MJJA 1RJLB 1WV7T 3DDFA 5GGSB 1NMAL 3LNHA 3RU8H 2XI9A 3P0YH 1JD7A 3A6CH 5J5EA 5BRZA 5MEOB 5ANHA 4E68A 2OMBA 2MPAH 5GGVL 5ECGA 4GKLA 4NHUB 3WFZA 1HNGA 4GQ9L 2R0KH 1QHQA 1BD2B 5FR3A 4X6CE 2DYPB 3LN9A 4DUWA 4NO0B 4PRBB 3OKOA 5F1SA 3SYQA 5DHVH 2NZIA 4NZUH 1AHWC 3JVFC 5C08D 3KH3A 5I74B 5IEKB 9CGTA 3JUZA 5GIRA 3G9AB 1N59B 1CD0A 5FO2A 2C34A 5HSFA 2EC8A 2HT2D 4PYGA 3ERXA 4E0RB 2QELA 5ISZE 4JO1L 1GS8A 1GA2A 3PDDA 2XY1A 1GPOL 2PXYC 1RUQL 2R4RH 3IFLL 4WI2A 4PJ7E 1NOFA 1HKLH 3F7YB 5EUKA 4GKNB 1QNZL 1RULH 2OTUA 5HHXL 4NO3B 4DKFH 4Z7VA 3ZL4L 2HFEB 4Y88A 1HYSC 3RI5K 5D1QC 4BZ1A 4Q6KA 1QSFD 3DK2A 1MVYA 3RYMA 1HINH 1QZ1A 3WFCH 4Y4FD 2IFGA 3WEXA 5IG7A 1HSAA 1R6VA 1X5JA 5FFOA 4ZOEA 1AANA 1G6RA 3TOPA 5JPNC 2MOVA 3S7GA 3CZUB 2X28A 4XP6H 5I18H 2VJ8A 4WEBL 4GG6B 2AK1H 3JWNC 1EFXD 3I9PA 2EEXA 2IG2H 4RAUB 2DQJL 3VFNA 4KZDL 1WTGT 1JVOA 4KJQD 4R0LB 1DBJL 1UM4H 4MJ4A 2BHFA 2WXJA 3WFEH 5L8LB 3S5LG 5D6DC 1QWNA 4Y4KA 3MV7B 4LVOC 5T3ZE 1J8HA 1WZ1L 2ZG2A 5G55A 3FN3A 2M83A 2ZCZA 3B7SA 4DN4L 4ZQTA 5SWZD 5E7BA 4M4RB 5DMYA 1U8QB 4Q8BA 1T03L 2HG5A 1KXTB 3F5WA 2XXMB 3BWUF 4GSXA 4M7LH 3JZYA 1UVQB 1I8LA 1A7BA 2Y36H 3Q8EA 3Q1SH 1PZAA 3NSXA 4M5ZL 4X4KA 5F9OL 4H1LA 2EIBA 4N5EC 2AQPA 3TA3A 1ZHLB 2RR3A 2CDGA 3R06B 4M61A 4NI6A 2DIEA 3FS9A 3SE6A 4UBDD 4WVRA 5F7KC 1EHLH 3EYUH 1XGPA 1IIIA 1EERB 1ND0A 1RZPA 2OZNA 4RFNC 5EDSA 1MJ7L 4RWHA 4LSRH 3ZHNA 2XNAA 3ES6B 4RRPA 3WTSA 3VI4E 3MOAH 4IMLA 2P47B 4OF8A 4CMMA 2C9RA 2WBWB 3MRDA 2OA9A 1QHOA 4JFVA 4WFFD 1JZIA 3LKSB 1U2YA 5MEPA 5I6XC 2O5XH 4LFHD 4LSVL 4RH4A 3GB7A 1MZZA 2G4EA 1XCXA 2G30A 4PWIA 5TH2B 1HCVA 3UOAB 4XN9A 3VRIB 3VD4A 1N18A 1R3JA 2F54D 4B9JA 3KPNA 1I7TA 3HI6L 3QPXL 1N67A 2I32A 3CX2A 3BKJH 5FA3A 4RWYL 5J89A 4JDEA 1YMMB 2FJFB 5FYKE 1VKXA 4Z9KB 4KTYA 2ADFL 2Z4TA 1CGUA 2OR7A 2X09A 3KYKL 2XG4B 4Z7OB 1CXEA 2XTJC 2SODB 1CK0L 4M03A 3BKMH 4G9FA 4ORZC 3EZ8A 4XWOD 5CNHA 4HIEB 5CEZE 5LXVA 3SQBB 3BP6A 5I16B 3ARUA 1OP9A 4J7RA 1S7XB 4A2DA 1NFDB 1ZCRA 2DF3A 4HJJL 4PJAA 5E2TL 3KL3A 3WLBA 3TN0C 3NFSL 2WWKT 5D1XD 1B88A 5C0BB 4CKQA 3NIFF 3STLA 2GEEA 4ELMF 3EJRA 4B7IA 1AG0A 3BPLC 4FLQA 5JDJA 2ZWKA 5B1JC 2E7LC 1YEJH 3V0AC 4XTRD 3RWFB 4MB4A 2GYSA 4POYA 2FECI 3WKMH 3CWGA 5J13C 2WLKA 4Q6IB 3UJJH 5L8JB 1GAFH 4P23A 1VCBC 3D0LB 4ACTA 1OCWH 4E9WA 1LLAA 2XV2A 3TH3T 2LU3A 3K2UH 3GMLB 1KNOA 1ES0A 4IU3B 4W9IC 3HUJE 2BRRH 5E9DA 1FZMA 4PD4K 4LARL 4MD5A 3FQWA 5MEQA 4GRMB 4P2RD 4K3JH 3ROLA 35C8L 1XCWA 3FQYA 4ZTPL 1F8TH 2PF6A 3GTTA 2VRKA 4P2QA 5A2KH 4RFOH 3FMGL 3T3PB 2HUHA 1NANH 4KJPD 5FXCH 3ZE1B 4L1HA 4BCZA 4YLQT 4YIQA 4KO5A 2Q5BA 3POCA 3UJIH 4K3DL 5BUPA 2F5AH 3B56A 4MSWB 1LWRA 1NBQA 4TSCH 2B59A 4ES9A 3KPQA 4LVHC 5EUOF 2DWDA 2VMEA 1MCBA 2YXWA 3NCEB 3RFRA 5LGYA 4UIKH 3ZTCC 1OAUL 4ZJ9A 4ZXBB 4HUXB 1I9RH 1SJEA 5K9QI 1DO5A 3U4BH 5AW6B 3MRQA 2FO8A 3BI9X 4KKQA 4JVPA 2IGFH 4TNWF 3VWJB 4OJEH 3S88H 4AQEA 3UCQA 1DFXA 1ACXA 4FXKB 3L7FB 4Z7WF 5BJTB 3DO7A 3N2JA 3L3OA 3QDMA 1RZKL 3VCLB 3ABLB 3TV3H 3APNA 1SN0A 2Q20A 4DP0X 3OVUB 1CDIA 2Y23A 5CUSL 1RJYA 4Q0XH 5DK0A 3UMTA 4CBZA 1OD9A 2VSCA 5EUKB 3A6BH 1KPUA 1NINA 4KK8C 3DNKA 2BK8A 1JHKL 4HALA 3KPMA 2A6IA 3MV9D 4GG8B 4PV9A 3FFCB 3PP3H 2DQTL 4JO4L 4TQEL 1WISA 4TSAH 2YD3A 3WIIH 3OJDA 5I28A 2IOIA 1U93B 5IG7B 3UTZB 1HSAB 1U8MA 4MA8H 5C92A 4IKLA 1RUML 1G6RB 4YFLF 3JZ7A 4WY7H 2H9GB 1O6TA 1YAIA 4A55A 4PFEA 4F7PA 4KX7A 3M1CA 4HLJA 3VFNB 3JWOC 3PAYA 4ZPVB 1D5RA 3I6LE 3UIYA 2HFTA 4FP8H 4K71B 3HFMH 5T1DH 4Y4KB 2FK9A 3SDXB 5JHDE 3TBTA 5MHSE 1J8HB 2OMZA 1OPGL 4KGLA 3OSKA 3RY6C 3HG1D 3VXME 1EHKB 5E51A 2TAAA 5IIEA 5E8PB 2HG5B 2QTVA 1H3XA 3PGCA 5CGBA 1J5CA 3B2UD 4J8RA 3GTVA 3W11D 4ZUUA 5E2WL 3PGDA 1F1DA 3P02A 1MRDH 5I8KL 4R26L 1CL7L 4H4NA 1YYML 1YQ2A 4P46A 4JQXC 3QCVL 4UOW1 1BF5A 5HGGS 1GCYA 1EX0A 2E9IA 4H1LB 1GKOA 3MHZA 5EIIB 4FG4A 3ARVA 1DQKA 1MQKH 5AAWA 3EFDL 1FOR