4BRVA

Superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
b'MKSFGELIYTPDRAEGEAISKAATHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRVAFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION
molecule tags Oxidoreductase
source organism Ignicoccus hospitalis
publication title Structure of a Natural Sor Mutant
rcsb
total genus 30
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4brvA00
4BV1A 2JI3A 1VZGA 4BRVA 4BFKA 1VZIA 4C4BA 4BFJA 2HVBA 1DQIA 3QZBA 4BGLA 2JI1A 4D7PA 2JI2A 4BRJA 1DO6A 1Y07A 4BK8A 4BFFA 1VZHA 1DFXA 4C4UA 1DQKA 2AMUA
chains in the Genus database with same CATH superfamily
5CJ5A 2BFVH 2H6OA 4M4RA 5F1SA 3WMQA 4OF0A 2H5UA 4UT6L 4J5VA 1DR9A 3FSZA 1BDYA 1X5IA 2VLKD 1ZHLB 4ACTA 2R15A 2NX5E 1UB5A 1JRHH 4JKNA 5BS0B 2GW5A 4G42B 4O02B 4G9FD 4KKCD 4N5UA 5E1IA 3EGXB 3P4OB 3WLBA 4F3FA 5GGUB 4BZ1A 3B2DC 5AVWB 4FJZA 3VMOA 3Q8BA 3NIFF 3O2VL 4HCRH 5CFAA 3C5ZA 4Y7OC 3TFBA 1XBDA 1Z0NA 3IPEA 4H7VA 2QSTA 2IALA 4UV7H 5C0GA 3WOVA 4XCYB 2LR4A 5FYLH 2NUTB 4JO4L 4M8RA 1KNOB 1A9VA 5DUML 3MRGB 4QTIH 4LSTH 5DA0B 4BE5A 1VJSA 2ZXBA 3G9VA 3BJ91 2FWOA 3EBAA 3RWEB 4Z76A 5FCSH 3ZDYB 4JRFA 2PCPA 3S0PA 4TLKA 2BIQA 2CBQA 4WW1B 5IQ7H 2ZSVB 5F1NA 3VD4A 4DZ8A 4N68A 2AV7B 3MBWB 3PWUB 5ALCH 1YMHB 6PCYA 1WAAE 4R4BB 1C7SA 1JCVA 3SZ6A 2B0SH 4MXVE 4CU6A 3C60D 1U0QA 3AS3A 5C0RH 2QSCL 3UGUA 3ALWA 3ERXA 2Z8SA 4MGXA 5JPMC 3HHSA 4R8WL 4HEMA 4J3UA 1OVZA 3MRMB 5HGDA 3F65A 3ZE2E 1HYRC 2IV9A 5E23A 4FX5A 1MCFA 3UH8A 1ZT1B 1WIUA 5IROD 3F7RA 1W91A 4D9RE 2X9WA 3QUXB 5DVKA 1JGUH 4LLUA 4AEHL 4GY4A 1SLUA 1RMFH 4YJZL 2EDXA 4ZFOB 3VD1A 1LO0L 2Y6TE 1ZHBA 1DBJH 3GBLA 4WTXA 3LYRA 5JW5A 4OAWB 4S2SB 3GHPA 3NJFA 4KUZH 3ZRCC 1F6AB 5EDXA 5LKNA 3U36B 4JHWH 1FGNH 1Q1PA 2J8HA 2FK9A 2H2PD 2H0JA 4NNPL 2KDYA 2ED7A 3QRGL 4R0LA 4ZBJA 4PRBA 4OZFA 4K9EC 4ODVL 4JPIA 2DYPB 2VDRB 3ZZSA 2AQSA 3BEWA 4AYSA 2GVYA 4LBAA 1QFOA 1JGEB 1HSAB 1BZEA 1AO7B 4FTVE 2QVMA 4M3HA 4X99A 3RWIB 4DGUA 4DP8X 5IROC 2R23B 2EUVA 4BFRA 4KZDH 4DP7X 4NC2B 1URZA 5MEQB 4YVNA 1AR1D 3I3EA 2E9WA 3DX0A 1PLGL 2BNUB 4IGBB 4F57L 1M2VB 3X1BA 7FABH 3N44B 3F58H 2HAZA 1G43A 5D1XE 1SJVA 4G5AA 1TQTA 2RAMA 3OXSA 3ISRA 4XCEB 2AMUA 5T5FA 3KNBB 4XCFH 2DJMA 4BSWB 1CZ8L 3MA7A 4BA0A 5ERWB 2EILB 2JKIS 3BWAB 1NWOA 3C87A 2AJ3A 4S1RH 1T6WA 4AQ8A 4QHUA 5CJBA 3RIFK 5CP7A 3HI6L 4PP2A 4X6BB 2B08A 2HPOA 2X05A 3IDUA 3NACL 4MAYC 2W60B 1KFGA 1YEDB 3PLYA 3SYPA 1WFMA 5C0AB 3KWUA 4JGUA 3U4BH 2XZAH 3CQFA 1R3KB 4JRYA 1CE6A 1T1YB 2DMHA 2UZXA 3AROA 2Y6SC 3Q01A 1IAIM 4GP4B 2BERA 4MSWA 3OWEA 3ARDD 4WNSA 1CD8A 1EUTA 4OCRL 3W38A 1CD1A 2GSIA 4PLKC 1NCWL 3UFIA 1XF3A 4C47A 5KZCD 1DN0B 3RL1A 3OG4B 2K78A 4P4RB 4FMKA 4KWUA 4F80A 1S46A 1MREL 5JW3L 2YPKA 2CIIA 1HINL 5BVJB 5FO9A 1XX9C 1F1DA 4JZNB 4HW6A 1FYTE 3EFFA 1NDGA 2DMGA 1I9JH 4XBPB 2FL5A 4F1ZA 5D7IB 3TT1H 3V4UH 2EDBA 3I6LD 1G1YA 1CYWA 1DANU 2BOBA 3S8FB 4PRHE 5E6IB 3RLSA 1F2QA 2NX5D 1OIOA 5JZ7C 3P9MA 4RMTA 4GQPH 3GLZA 3CX2A 4AEHH 2VC2L 3CN1A 1KF9B 3M8OL 4M9PA 1FCGA 1TTUA 1KJMB 4LGPB 4O2EA 1U8IA 3BP7A 2E46A 4RH4A 1YNTF 3TA3D 4WKZA 4JFFA 4OAWA 3X1FA 3SDXE 4P4RA 2PABA 1A1NB 3QJXA 3OZ9L 2RR3A 3S37X 4EZJA 2Y7LA 1LO5B 1G9MC 2HB0A 4YPJA 3HC0B 4MMYB 3QHZH 4BZ1H 2LGNA 3HPJB 1XD1A 4EIGB 1Z6JT 1MFEH 1B6UA 1QA9B 2P5WE 3FO1B 5LGHL 4WI9A 5ISZE 2B1OA 2OXGA 4AENA 1FSKC 1GYWA 4YNYA 3X13A 3MNDA 2OL3H 2HKFH 4JL1A 2EKSB 3DC0A 3N40P 4OZ4A 1CDUA 3UTOA 3HR5B 4GO8A 3MYJA 1AS6A 4TVPH 3HNTL 2B2XH 5DHYA 1NFDB 3H3PL 2MHAB 4LPWA 4MJID 3LKRB 5KYWB 1A6PA 2EDOA 3UZEC 3ZE0B 2Q87A 1A7NL 4YXKL 3FQ4A 1X6LA 5DXWA 4QGYA 3V4LA 4MXWH 2VH5H 1RMFL 3QO1A 3LHAA 4Y88A 3FRPG 3MNZA 2OP4H 5DUBA 3VMPA 1CLZH 1QZNA 4G71B 2GJ6E 3V10A 4A6YA 9PCYA 2NNAB 4LBEA 2WW8A 2DQGH 4RMWA 4POYA 2R27A 2XZCH 1WA2X 3MFFB 5IVXA 2WP3T 3DI3B 1S7QA 3BZFB 3OF6D 4Q9QH 4YN3A 1U8KA 3WFDL 4LP8A 5IQLA 3BUYB 4NQEA 4LSVH 5F0LB 5EU6A 5DHVA 4FABL 5F7DB 5KYXA 2OLDA 1F97A 1S9WB 3HRZB 4XE5B 3QJVB 4EBQL 5I1DB 4IBUA 4L1HA 5IJDC 2IFFL 3BHBB 3T0XA 2EDWA 4CBZA 2X4RB 4G80A 5LQBL 1JK8B 1YVLA 4FD0A 3IPFA 4X9BA 4M7ZC 4N0FA 3GMPB 4LNVA 5D7IE 1QSED 3EXLA 2O61B 3QORD 1RPKA 1Q9LA 4ZMQA 3D39D 2G60L 3PNWA 5K59F 1V8HA 5CLXA 1WUZA 2VDLH 5HYJE 3OKKA 4AK1A 2A0LC 1UOLA 3MR9A 2J8UA 1PVHA 2H2SC 2DIJA 3O2WL 3U0PB 4HHWA 2BNQB 3VFSB 1CIUA 5JOPD 1SMOA 5I6PA 1HXMA 1Q90A 3PDOA 3PAZA 5LBSH 4P2OD 4FN0A 4OIIH 4XPAH 2F7QA 2WO2B 5D72L 2GAZB 1RJCA 2WKOA 2DWYA 2MCPH 3VGGA 1FAKT 3G04B 4NYLB 5DI8B 1RIUL 4Z7VA 1EEQA 3SKNA 3APCA 5CEZD 3SZKC 3V6BR 2AQPA 4PP1C 4ELMA 4OLZL 43C9A 3T3PB 3PHOA 4X4XB 2F6AA 2ENSA 4N2GA 2DTMH 1O7DC 4X6FA 4ZS7L 1XIWA 1J12A 1ADWA 4Y16C 3REWB 4MZRA 5DJ0B 3A4AA 3QPQD 1OARL 4JO1H 4PBWD 4XOBA 5DLLA 2FWOB 2FHCA 4OQTH 4J6RL 3VVVA 2BSED 3TWYA 1RUPH 4OFKA 4P9HL 2N0KA 5B8CC 2PYEE 1IUZA 4KKBC 4XPTH 1A7QH 3OGCB 2TRHA 1V05A 5ICZA 1ILUA 5I8OL 3A6OA 2YUWA 4PRNB 3WKQA 4NC1E 3F04A 2HXAA 3NSCA 2E8ZA 2VLJB 3SYOA 3G5XB 5E1GA 1I3GH 1CU4H 3WFBH 4CVUA 3B2VL 2QLVB 2JTDA 32C2A 3R7RA 5FYLE 5HYSA 5HYQA 2DLTA 3EO9H 3E8UL 4ZTOL 4FP8H 5C3IA 1IC7H 2ZWKA 3HS0A 3VWJD 2D9QB 2DQEL 5LDSA 3A24A 3IK2A 3VA6A 4TSBH 1OP5H 1I53A 4LLVB 3VXQA 2RACA 2XZCL 3N1FC 3GIZH 2VISB 5DO2D 3HE6D 4OCWH 3LPPA 1Q9KB 4MNQA 4PR5B 4R3SB 4LVEA 3CFDA 4KHXL 3NJXA 3L3HB 1U58A 3VI3A 4Y8DC 1SLXA 3BN9D 2ICEA 4Y2DB 4DVRL 2E27L 1PZUB 4OKVA 5B21A 2V33A 3O4LE 1K8IA 3RVXC 3HS9A 4FXGB 2IDQA 1VDGA 1P2CB 5L4FA 1LO4H 4YHIA 5IMLB 4N8VG 4G8IA 4KJYB 3FQNA 1FL5B 4EXKA 5LG1A 3NJGA 5CCKH 3HS0B 1FZJB 4JPQA 1AZNA 3II3A 4G82A 2CLVA 5IW3A 2XYBA 2VZ1A 1VACA 1K6QH 3BQUA 5B4MC 5EU4B 2G3NA 3ZKSD 5IG7B 1M1XA 3BW9A 4X6DF 2ZAIA 3QFJA 2MTPA 4W9HC 1VA9A 1KYUA 1B3JA 6CGTA 2OSYA 3AACA 3EH3B 3G6AA 4PREA 2D31A 2YOCA 4JKPL 3CDGA 4LEXL 3QAZC 2YIHA 2YHGA 1PX3A 4OKVB 1D5IL 1E4HA 1HL8A 3MV9B 3SJVB 3TBSB 4LPVA 1IFGA 1NBYB 3EYQC 4LMQI 1HVXA 3HBQA 5GS0H 1H3UA 2ZP9A 4WGWB 2P7TB 3OZ9H 4IMKC 5EU7E 1TVBB 5J11C 5SWQB 4EO5A 3N91A 5GRXG 3RDTB 2CDFA 4L4VA 1G7PA 1N59A 3MRDA 4GOSA 5KSAD 1GYAA 4ZFFB 4UU9B 1EHXA 5GPRA 5D5MB 3E80A 4RIRA 5HGHB 2J2ZA 4KJQD 1FDLH 2XV0A 4ZMLA 3QJZA 4UILL 1CWVA 4PS3A 5L9DL 5JDSA 1XAKA 3TT1L 1EGJH 1AS7A 4M1CD 1QNZH 5CGMA 3C2AH 3G5XA 1LGVA 2A9BA 3DYMA 5F7YC 1Q0YH 4M6OH 1IVTA 1NFDA 2OS7A 1FL3A 5CZVH 4TOYH 5E9DE 3GXUB 4PEEA 5KBKA 3KXFE 2JF1A 2EKSA 4NGHH 4RCAA 3SY6A 4PU2A 1W72A 3QISA 4OVVA 2FO1A 2C3XA 4NO2B 5T3ZE 4IRJC 4LCUA 5DURB 4YSAA 2X1PA 5GRVL 5IM7B 1I7TB 1KSRA 2E7HA 3JQOB 3MRQB 3SIKA 5F3HA 1U4EA 4PJ8B 2WAQA 1MCLA 3MJ6A 1TXKA 4ZFQA 3HLKA 4W93A 4QNPE 4V33A 1BD2D 5DS1A 5BZZA 1Y18A 4YHOH 2IH1B 4MDJB 3JUYA 3QIBB 4NAQA 4EVNB 5I28A 3JWNE 3STLA 1T66C 2Z7UA 3V0FA 1JUFA 2NNCA 1GMEA 2XQYA 5DI8A 5FHAH 4JVUA 2F0CA 2LLGA 4GRWE 4XNMB 2COVD 2KPNA 2FLRT 1ANUA 4FNLH 3ZR6A 4HGWA 2LTQB 4BKLB 3GTNA 2AJVL 4Y2OA 2YPLB 1JTTA 4HALA 1S9WA 2ZT9C 1SJMA 1E28A 3OKNA 3EOTL 1J9RA 3U79A 2EZ0C 4HBCH 3QNZA 3QBTB 3VRIA 5SWZD 5AG9A 1N3NB 2C3VB 4AQAB 3FU7B 3NK4A 1EJOH 3P4LA 1KXHA 3OKDB 4M48L 3V6OA 5T3XE 1GKEA 4U0RC 2DDQL 2WLKA 2Q1EA 3H0TA 2IDUA 4PJCE 1IBBA 2EEAA 5B3NA 2B2XL 4LOVA 1EEYA 4QRRE 3PGFL 1I9IL 3HI5H 4E41D 4U1HA 4IMLB 5B1CA 1QLRB 4U3XA 1NH6A 4D0BB 4HUVB 1PJWA 1OE1A 2ZOLB 4BYHA 1TU2B 2Q2LA 1IGCL 1H8LA 2GK0A 2X2IA 4DP0X 3HE7D 2ITCA 2ATPB 1WFUA 4Y5YA 2XBTA 4TPRL 2PCYA 4OGXH 4BKTC 5H37G 1LO3L 2HJKB 2BNRE 1N7ML 4EN3C 4IIQC 4OCYL 4R83A 4RDQF 1ET7A 1MIMH 3LZOA 4NERA 5INDB 1MFDH 5AUMA 3DVFA 2FBOJ 3RI5K 4GP8B 5EU5A 4GRMA 4WFFE 4LCWD 1I4FA 5CGBA 5KVDH 3PQYE 3T3PF 4PJIF 1N6VA 2AXGA 2CO7B 4JO5A 3T1FA 2O5ZL 2P5EB 3ARED 3MV7E 4XMPH 5DJDB 43C9B 1I82A 4OI9A 1E9PA 3PP3H 3PWNA 4OCWL 3BJLA 2FYVA 1TFHA 4XP4L 4X99B 3U30C 2X4NB 2NTFA 3HI1A 4NKQB 4P5TC 4OD2A 3BEVA 1MREH 4UMGA 4XX1G 4Z7UB 4F1SA 4AYMC 3WN5B 1DQJB 1X6NA 1ORQA 1ZT1A 3ZGIA 1XGTA 1FLRH 1KACB 1N70A 1THAA 3BPCA 4HKJB 2ESVD 3O6FB 4H20H 5D55A 3ECUA 2KZKA 4P46D 4QCIB 4Q6IC 3C6LA 1NKOA 2P5WA 4M4PA 3SKJL 5FGCB 3MPCA 2K3HA 4HLZG 1QSFD 2XPZA 3P0GB 4LEEA 1F8TL 1PX4A 1TZGH 1TVHA 4HUMB 3FYEB 5D96C 5HHMB 1XIWD 3AITA 1WBYB 4HFWA 1HT6A 4PJBB 2AGJH 1F11B 5F9DC 1P4LB 4GUCA 5DVOA 3DPBA 5ESQA 1CE6B 5F88B 3SBQA 2NY1D 1V3JA 5T3ZL 1E5AA 4A6YH 5JXED 4XHQA 5DZAA 1SY6H 3F00A 3BPCB 5E8NA 3SCMD 3MN8A 1BQHG 1JXGA 2ENQA 2E6QA 1BLIA 2VLKE 1JZ5A 5GS2D 1S9YB 1I3UA 1BZ8A 1S9VA 2XVLA 3S3CB 1BXAA 1MFUA 3V6ZB 2Q3XA 3V0WL 1UEMA 3KW8A 4J8RB 1PD6A 2F8VA 2YPKB 3LPWA 5DJZA 3STZA 3V5HB 1IC4L 2N56A 3ARBD 4E42B 5AVQB 2YBGA 1VADB 5L7XL 1M2VA 4A7UA 2XKSA 5JQHC 2OMYB 1HH6B 5DRZA 5GGVL 4ABUA 5FUZL 5CP3A 1I4FB 1FG2A 3ZE1F 4FTVD 2K70A 2WQWA 2YRBA 3MUJA 2DLEA 4LK4A 3R4RA 5LNEA 3IDIA 1A1OB 3LZRA 4LLQA 2FQEA 4R4FH 4X5LA 1Y6NR 7PAZA 4Y5VB 4PH8A 2CO1A 4ZUTA 4LOUC 1AD0B 2YKLH 5BVPH 5I16B 3KYKH 4HWBH 4R2GD 2NQDA 2AJ3B 3T4AC 1AKJD 3KPLA 4OZIA 2C3VA 2BXZA 2QT6A 2V2WA 1DYZA 3B6SA 3H55A 4KJWC 3ZHFA 1S5HB 3EZ8A 4U1IA 4OLVL 5AVUB 4PJCA 1E2VA 1UA3A 5I5RA 2VRAA 4GKOA 4DEPC 1F3DJ 4BRVA 5IUCA 5JQ6H 2FIRT 5EORL 2YPLA 1I1YA 2HJLA 1LXMA 3MA9H 2J1WA 3NPSC 2VR7A 3FU5A 3QB7C 2FNWA 4OUUA 4NJ9L 2YEQA 1QRNA 3LS5H 15C8H 2ZXQA 1DBKH 4HIHA 3CLFL 5E9DD 3KPOB 4L4TD 1L0QA 4HOXA 2SEBB 1IIIA 5SWZE 3WELA 5E2WL 1A66A 2P4AB 4U3CA 5H94B 3U4KA 2F54D 4RGMB 4EZKA 4MD0A 2QSCH 3OKDA 3HAEG 4APQD 5LBVA 4XVSL 3GZPA 1JXDA 1BJ8A 4LO9A 1L0XA 2IAAC 3A67H 2F54B 2W9EL 1J5OH 3TPUA 1CXFA 1AHKA 1NCOA 1ZE3C 1U8KB 3IDYC 2EXTA 2ZUYA 4YZWA 1QO3A 2X1OA 3X3FL 4ZT1A 3BT2H 1BAFH 4HKBB 2BOBB 1A3LH 3ZDWA 4D9RD 3GQFA 3S3PA 3U7YH 2LE9A 3W82A 4LP5A 3QA3B 4HWZB 3MGOA 4K5MA 4PGDB 3PABB 2OYLA 3OAUH 5AZEH 3Q1SH 2QHRH 2X0UA 4NSKB 4KXCA 3Q3GA 3DGGB 3ECBB 3Q2NA 4LFHG 1BIIB 3KYNA 4JQIA 4GMTL 4IBSA 2DKMA 4AG4H 1CICC 1IAII 5KYUA 3T1FB 2AV1A 1ZHBB 2BSTA 1ZHNB 4NQCA 4UZUA 1AZCA 3GBNH 3DLQR 5GGSY 3K5RA 3TZVD 4ERSH 4GAYB 1WFIA 2AEPL 3MXWL 2HRHA 4LCWE 4X5XA 3RDTA 3OKLB 1NC4D 3FOMB 4HBQA 4YBLC 3F7VB 1BQHB 4WWNA 3PWJA 1NEPA 3X13B 1IL1B 1UXWA 1PKQA 5HY9B 5LG6A 3WY1A 3VYNA 3DXAB 3K3QA 5I1EH 4JY4A 3AU1A 4GQQA 4H1LB 3HW7A 1U8LB 4N2IA 3UTPD 5B39G 4AX3A 1WICA 3EDJA 1T83C 1LMKA 5DLML 1KCKA 4U3HA 1XCXA 2RMNA 3AT8A 1T0OA 4HIEA 4OU3A 3FUMA 2PXYD 2VMFA 4RNRB 4ZO9A 1HYSC 4Z9KB 4IJ3C 4KDWA 4TPRH 1JGLL 3ZSTA 1NEUA 4I1PA 4FQJL 2IQAB 5HHOB 1GZQB 1DBBH 3QJHB 4N9GB 5IF0B 1U8HA 1Z9OA 4IDJL 3MJ7A 1XGUB 3P9MB 3UGEA 1ZD6A 5E7FA 3W39A 1XBRA 5AW0B 3FCSB 3S8WA 5BO0D 4YLCA 3LQZB 2OCJA 3HI5L 3KPRB 3K4ZA 5EBLB 3MZTA 4HISA 4HETA 4XBPA 4ZAKC 1YYML 4Q0XH 5IB1A 1A25A 1WWCA 2FDBP 1UACL 4PJIB 1EZUA 4XMLL 4FADA 2PYED 4GBXC 3LZNA 4Z7QB 2LVCA 4APQA 3KE0A 4H25A 3SPGA 1PEWA 1RZIA 2CKBH 3IS0X 5A2BA 2P43B 3I50L 1XR8B 2WXGA 1NUNB 4KY2A 4FQLL 5EOQH 3RTQB 3FZUC 3JWOH 4RWHA 2VLLB 4PWEA 4XCFL 1QTYT 1CE1H 1SY6L 4N0YL 3FT4B 3W56A 4FZ8H 4EVNA 2IQ9H 1BPVA 2VABA 2MCG1 3WJMB 4GBXD 4JHUA 4UQCA 4FNLL 3TV3H 3F58L 1DJYA 3L3DB 3MGAA 4DP5X 1HDMA 4JFZL 3DSNB 5DRXB 2DH3A 3MACH 1CN4A 2V9TA 3D09A 3ULUD 3ULVE 3MGTA 3OZLA 1JZEA 2DQMA 5DZVA 3WMSA 1N5YH 4MRBA 4NN7C 3BYYA 1IBDA 2YAPA 3CV5A 4N2KA 4XBGA 3T65A 3VJ6B 3BRFA 1YZZA 1SJHB 1U3JA 3MCYA 3TZVA 4YDKL 4CC4A 1JV2A 1MNUH 3W11C 1AXIB 4PGJA 2EDYA 5K59E 5L4IA 3T9WA 4IRZH 3HG5A 3LH8A 4E0RB 1ETZB 1ICTA 4GRLC 1KYDA 3SDDD 4AV0A 3C6LC 2CWRA 1ZHKB 1DJWA 5J7CC 1KFAL 2C4FT 4HGMA 3GLAA 1FNSH 5IJKC 2ED9A 4EIUA 5AAWA 4JFDA 4EOWL 2R8SL 3MKKA 4RETB 1RUKH 2E9IA 5CR8A 2PXYA 3DRQB 3V7AG 4NHUB 1X5AA 5LBGA 2IH3B 3LVEA 1FH5L 4LU5H 3CQQA 4OFYA 2DI8A 4CRPA 1AY1L 3G3LA 4A66A 4PJHB 4MYWB 3SN6N 2E5EA 2AK1L 5A2CA 5I17B 2DPKA 1ZVSB 2OMVA 1H6UA 1T20A 2VQ4A 1TQVA 1RUAH 2NY0C 1R33A 4GUQA 2N01B 1Z66A 2NY5L 1J8HD 5BQ7A 1J7VR 4QD2E 2JJVA 3RUGB 2BVPB 1DUYB 1QTPA 2GIMA 1OHZA 5TQ2L 3PP4L 1L9RA 2YA1A 4Z7VF 3VXUD 1T3FB 5IMLA 1KIRA 4EIZC 1W2KT 1NFKA 4LP4A 3VSTA 2GEQA 5IVNA 3BUPA 1DQLH 2AMGA 1YYCA 3QDME 5TE7L 4XXDB 3VI3B 5ANMA 2AK4E 5E8DH 4PV1C 1WBXB 1ASQA 2WXNA 2DEWX 4Z7WB 4Q9CA 5SX5K 3WJMA 2B77A 2ZX5A 1IEHA 1TEGA 2P46B 4FYTA 3LIZH 5HHVL 3TOPA 1SOXA 2G5UA 5BJTB 3TWCH 2EE2A 3AS2A 3BGAA 3I3DA 1FH5H 3NAAL 5BO1H 3QUYC 4K94C 4FZ8L 1MY5A 4NQCE 2GT9B 2K6YA 2GSGB 4G7VH 1S8DA 2BFGA 4P5KB 1RZFL 1N18A 3CBKB 5EU6B 4AH2A 2I85A 4PRNA 4UT6A 2CHNA 3VGEA 4OLUL 4TNWF 1BVLA 1BV8A 1UZGA 3BDBA 3MBED 5EOTA 1MCHA 1HAUA 4PCKA 1GZPB 5I76A 4YBQD 3L48A 2IALB 4LKXA 4F33B 4AQEB 5IHZA 5JO5A 2JKSA 4MMXB 2J88H 4OQ1A 2LOEA 5JMRA 1HHJA 5D1QC 2BFVL 2J6EA 1CYGA 4H26B 3SKUD 1XGUA 1Y0LB 4OW6A 1JOIA 4HC1H 5E9DA 3CZJA 4LCIL 3GKWH 1GZQA 5G4MA 4FG4A 3V5DB 2AK4B 3RWGA 1ZGLB 4UBDC 2VAAA 4YE4L 1J5IA 4M3KB 1YMMA 3DOSB 2XWCA 1TTRA 3IU4L 3OM3B 5DMIH 2R29H 4W81A 5AFAA 4NYLA 5IHBA 3E6HB 4MMZB 4UIMB 4AL8L 1NANI 5DZJA 3MRKA 4D0DA 1J10A 1YEIH 5DFVD 5C6PB 5D7JC 3GTVA 2XVGA 4V1DA 5DSCA 3BP7B 1JHKH 2FGWH 3GTTA 3OMIB 1BBJA 3PDOB 4WO4A 2ADGB 2VR5A 1AO7E 1U42A 4KKPA 5FGRA 4Z5RA 4KX7A 3CFKB 2J7LA 1DFBL 4Z7VE 2YBRB 4LHUA 4KQ4L 2CA4A 4ELME 5EU6E 2ZX7A 1E42A 4MKMA 4ZJ9A 1LD9B 4XN1A 3VA2C 2X89A 2YD4A 4ODTL 3AREB 5DJCB 4H8HA 4LNRB 2O1AA 3QQ3B 3QWOB 4P2RE 2QQKH 3GGWA 1PTZA 3CN0A 4G6AD 3KXFD 2IWFA 5AVXB 4PJAF 1PY9A 2XU9A 4QRQB 3Q8AA 2UY6A 3CK0H 2PUQT 5INCB 4PD4J 5E94B 5I19L 2BS71 2Z7ZA 3V52L 5D7KE 1KCRL 3VFPB 1U9KA 1IAOB 1IBYA 4ODWB 3RDTD 3SKOA 3L3KA 1MHCB 2G3MA 5CD5D 5KJ7E 4UQEA 2OAAA 3BHBA 3LQAC 4M5TA 1EBPA 3BDYL 4K3JH 2FZ3A 1J9QA 1SHSA 5HJGA 3VRJA 3VXRE 3F7YB 2DIAA 4I5BB 4WUUE 1Q9OA 1BPLB 5AZ2L 2KBGA 2VZUA 4OD1H 2HT2C 2OI9B 3H42L 2XA8L 4OSUH 1W0WB 3QS3A 3KPRA 2CHZA 4Z7OF 3D7PA 4WZ9A 3HVDA 1BAFL 3J27A 2CHWA 1Z1WA 4OM1L 4AT6A 4FFYH 2VLJD 4UYQA 1ZY9A 3BAXA 1NGXA 1AHWA 1X9LA 3S5YA 2OX5B 2EYRA 1I31A 3P9LA 5IWLA 1ESOA 4TV3A 3D51A 1QZ1A 3GZKA 2EO1A 5FGSA 4CGUB 3ZJAA 3ULSA 3OXRA 5CJOL 2BNUA 1TMQA 2VMDA 2C9PA 2VM9A 4XVJL 3RWCA 4CNIA 3PUUA 1I8KB 2KDGA 2JKWA 4QRTA 4X6CB 5EU7C 3BKML 1SN2A 4CN1A 3ARGD 5GQBA 4ZRGA 2CUAA 3FT3A 2PYEA 5IEHB 3UZEA 4HMCA 3SJVA 3TBSA 3MLUH 4OLYH 5EUOB 5FV2A 4N85A 2EZ0D 4UIMA 4JPVH 4RGNB 3AAZA 3E9UA 2J5LC 4KPHL 1GOHA 2EKJA 4QKTA 1FYTA 3BPNB 2N0MA 3L3GB 3CFJA 1WGOA 5E8PA 5EEZA 2D7NA 4J6RH 5C0DA 4UCFA 3KPPA 3GHBH 5JW4N 3GMNB 1ZJAA 4QRUB 3MODL 4N0CC 2K9UA 4LZKA 3ZZLA 5KVEH 2VSDA 4HIJB 1A3QA 1UD3A 4R2GC 2VN4A 3D85D 1CUOA 1U6AH 3TBTA 4QHPA 1Q0XH 3Q6FB 4LDOB 3G6JE 2O72A 1KBWA 2Y4SA 3GM8A 1YN7A 1HZHL 3MLRH 4R90H 4D94A 1M4KA 1D5BA 1GW0A 3TNNB 2WQ8A 1X5XA 3GBML 3KM2A 2Y1YA 1PNDA 5DRWB 1P5UA 5FHBL 1TZIA 2Q8AH 2CO2A 4FQCH 4K9JA 2VC2H 3B7UX 2EH8H 3LIZA 2XQBL 3O4OC 2YC1A 5T5NF 1R75A 4HCRA 1AR2A 2WHVA 2WNWA 4PLNC 3HUJF 5CIPA 3IETA 5E94A 3DBXB 1J87A 1AJ7L 1R0AL 5D1ZI 4LLWA 2VGLM 3CHQA 5FWRA 5LCVH 5KVGL 3VU1A 3IB4A 3MLSL 4NM8L 4KXZI 3RHWF 1T4KB 4EIBA 3T2LA 5KN5A 1JXFA 2ZNXA 5GRJL 3EJCA 2ZWLT 2VZ3A 3KBHE 2V8LA 3WXVH 1ZKAA 2IOOA 3SE3C 4NXKA 4OTXH 3MRMA 2WWMD 3MJ9A 1KIRB 1NCNA 2NZIA 1OP5K 1G1OA 5HPMA 3VQ1C 4G3YH 4S0TD 4UQIM 2EDKA 4EUPG 2Z31B 3SE6A 4JY5L 1OAKH 2X2HA 3U7WH 1R4XA 1M57B 4QY8B 4AQ1C 4MFHA 1CF8L 5E6ID 1TKWB 4Y4HB 5F7FA 3UTQB 3DIFB 2BOCB 3A6CL 3L7EA 4GI9A 3EJQA 5FA4B 4AE1A 3LKOB 3BVWA 2MOVA 4EI5B 3O6LH 1ONQA 1WC7A 4YC2B 3RVWD 4O5LH 1YUHA 5HI5D 1K5WA 4Y4FC 3MJ8B 3S34H 4HK0A 4G42A 3VFOB 2BP8A 3PHSA 4C54A 4QKXB 2MRYA 4Z76B 4JRYD 1QNIA 2O5ZH 5FS5A 2W80C 1OL0A 4R96A 4Y4FA 2PO6B 4KQ3L 4LASH 3UJTH 3RWIA 1ETJA 1EXUB 4DGIL 4NQXB 1CVRA 1GZPA 5I76B 1OB1B 3LZQA 3LD8B 3MLYL 1PLGH 4I3RL 4MQTB 2DQUH 3B5HA 5T1LD 3WLWC 2ATPA 3LV3A 4Y5YB 1AKJB 4DPBX 1HX0A 3UBXG 5C0JB 4U1NB 1KCUH 1OOWA 1C12A 2WLYA 2A4CA 3I75A 4PJDB 1E6OL 2LAGB 2GFBB 1LWHA 3IRZA 1JYXA 4PGEA 1SN0A 5EBMA 3T09A 4G1MB 2HZHA 1A6TA 4UINL 1I8IB 4XGZA 5B8CA 2IFGA 3QFJD 4KO6A 1EANA 2AAVA 4ALAC 3NN8B 1TJGL 2NX5A 4KV5E 4HFWB 2F19H 3FK3A 1F4AA 3DBXA 3T4AB 4S0SD 1E27A 3IDXH 4PWHA 4E9XA 4UF7C 3VFRB 5DRNB 3IM1A 4XE0A 1BEXA 2EEBA 4HQQH 3CUPA 2XN9B 1AR1B 2OMXB 1KEGL 3BN9C 2JK5A 4JM2A 1C08B 5J6HB 1WK0A 1F5WA 2B5IB 4KU1A 4WW2F 2ODHA 2R1XA 3TONA 2NPLX 4OBRA 4BCYA 5CEZL 1COBA 4UOZA 3N3EA 3GF8A 4X9HA 4DN3L 4P2AA 3ZKQD 3VB9A 3OAZK 4KQ3H 4LASL 3UJTL 2HFGH 2PP9A 3W0WB 3CZFA 1QOKA 2OPCA 4LRNH 4Z7UF 5AW1B 1KJ2B 1JFHA 3KYOB 5IOPB 3R0MA 2QKSA 3OJDA 3EGSB 1W16A 4H0HB 5EN3A 4LB8A 2ARJA 3OKEB 4I0PB 4MHHG 3AY4C 4P5MA 4NRZB 1HCYA 4TUOA 4ZNEA 2H1PL 3CAFA 4GSDL 4MQXD 1A8ZA 1GY2A 4YPGB 5ACZB 2BX5A 2WGNB 3EJZD 1NAMB 5SWSB 1JJUA 3DX2A 3L2LA 4JQIH 1ETA1 4KHTH 3WTTA 4HSCX 4HXAL 3MRJB 5BRZB 2N7BA 3QGVA 1D6EB 3MLTB 4KUCD 4N0UB 5HDLA 2XQYK 2Y72A 3NJVA 3QJFB 3Q2CA 1A1MA 4Z95H 5EC1A 3VO0A 1UM5L 3REVA 3OXRB 2X4TB 1G9HA 1W8NA 1CFMA 1MXDA 4MAZA 4CNIB 1FNGA 3ZIMA 2ARJB 4AYBA 2Z93A 4O02H 3GXNA 3TBCA 1DJGA 4PRPD 2V5RA 3EOTH 3INOA 3W9DB 3LCYA 3W0WA 2YC1B 1RP8A 1UJ3B 3SDAD 3ZQXA 3NFPB 3QSKB 3SDCB 5GRZA 1TZIB 3MRJA 5BRZA 3VACA 4TQPA 3WXVL 4GUPB 3BAEL 3DO7B 1NCHA 2WCPA 5D7JA 5BPPA 1PPIA 1DL7H 2P52A 2VLKB 2A1WL 4UDTA 4W9CC 3RPKA 1SLVA 1QSEA 3QXUA 1WIOA 4PSPA 4WI0B 4AVHA 1A4CA 2G5BB 3CFTA 4KI1A 3TPUB 4WFGE 1BXXA 1TO4A 4DKTA 2NQ3A 1IKNA 2NSMA 3VFRA 5HDWA 4KNUA 4L3EB 3TF7C 2BC4A 4JY5H 2AXFB 3HG1D 1XF1A 2FIKA 3HZMA 5JPMB 5J4MA 2GT9A 2J20A 1Z9SA 3FBKA 2OBGA 3P77A 3UPAA 5AB9A 3O2DA 4JJ5A 4PIBA 1NKGA 1RSYA 1H3GA 2OMNA 2A2QT 3ARSA 1U8PA 3SYCA 2H3XC 1G7QB 1M9SA 2NT0A 4WK0B 2G75A 4JHWL 1VPOL 1K6QL 3DVGB 3QDJE 3IJSA 4N25A 3WNJA 3ARTA 1HE8A 1C5CH 1WFJA 1N6UA 3GSNL 4NUPA 3BLKA 4GKNA 4MJ4A 4UT9H 3OKOA 3AY4A 1ZA3B 3N85L 2G5BA 1H9DA 4GAFB 1EGJL 2FHBA 1CICA 3SGJA 4M1DH 3U46B 1R0AH 1LO4L 2EIEA 5IVZA 4DGVL 4FNPA 4L3AA 5KBDA 3DKHA 4PRIA 1PY0A 3ILDA 5ABZA 2CCVA 3F6LA 1AMXA 3MRHA 3ZE0E 1GYCA 3RKDC 1TTCA 3FTZA 3CXDL 4XN9A 2R51A 1RZ7H 3AGVA 4AWJC 4PRHD 2MPAH 2CGRL 1E5UI 1KOAA 3JXAA 3VXOB 1N8OE 4FFZH 4JPVL 5J9PA 1ID5I 2B59A 5KUMA 1T5KA 4Z7QE 3K8KA 3I6KA 4IQHA 1KPUB 1WA0X 4ZXBD 2FWLB 5EC1B 5DJZB 1X5JA 5DWUH 3ZDYF 5E4IA 5JTWA 1NPJA 2XZQH 3BP4B 1U3HC 1RLWA 1DVFA 3WV0A 1CS6A 4NN7B 3ROOA 3V6FA 3CZEA 2Q86B 5E5LA 5F7HA 3IDIB 3NEXA 4F33A 1JPSL 3F5WA 1S78D 1DJSA 5GJSH 1ECYA 4KRPD 1NQBA 3UTSE 3BSZH 3VFOA 3IXTA 3NTCH 4NWTL 3MLUL 3B9KB 4MLSA 1CL7H 1OCWL 4LEBA 2CHDA 2Y22A 3IMRA 3Q48A 1P1ZB 4Y4HA 3FO0H 2OW6A 4AM0A 1RK7A 1QLEB 3DTXB 3S98A 3TBYB 4C4KO 1R3IL 2UVFA 5KJRH 3D3VA 4F7KA 5AYQA 4J2XA 4BFOA 4K0OA 4MCMA 4PJIE 2ZCHL 2A74A 3B2UC 4ETYA 3H9HB 5GGSA 1YN6B 4HJ0D 1EXHA 5D71H 4NO0A 4FCAA 3QFJE 2QQLH 4LSRL 2J71A 3AM8C 2K8QA 4UTBL 4MD0B 2D8KA 1CLOL 2HRGA 4IKLA 1VFBA 1J1XH 5DURD 1SEQL 2QJDA 2KMWA 4PMFA 2X4QA 3L4XA 4JFOB 1CICD 3PXHA 4N6RA 4ZOCA 2AP2A 5FFLA 2EIJB 5FK9B 1TYEB 4XMTA 4TTDD 4XAKD 1BVZA 3SJVE 1T0NB 2YGNA 4PRID 4M7LH 2YXMA 4NRXB 3C60B 4LCCC 3FF8A 1DLHA 3M17B 1IEBA 2DTML 4Z3TA 1BQ5A 4MJ2A 5LGJA 3LXAA 3GKWL 4OLZH 3V8CA 4AQEA 1F6LL 4C83A 2YD7A 5IHZB 2W9LA 2GIXA 2BVOA 5ID0A 3Q6GL 1SM3L 4EBQH 5EOTB 3TBTB 1MHHB 1BFTA 3MXVL 1XEDA 1A7RL 3QPXH 2D7QA 1NJ9B 2I24N 5DMIL 5AOMA 4N8VA 5AOLA 1QRND 1A3RH 2DD8H 3ZQWA 2JKLA 1HS6A 2CMRH 2ZOLA 3QZNA 3THMH 1DVFD 2G30A 4L9DA 3LZFH 3W81A 4ORGB 4ELKB 4PJ8D 3K91A 4K71C 4NQSA 3NIDE 4QEGA 5CGTA 1RI8A 3DIFA 3ISWA 3FT2B 3AS1A 3HS0C 5FM5M 2C1PA 5F3FA 4JG0L 5MP6L 1HCZA 4PAZA 4QXWA 4R26L 4RMVA 3V6ZA 3HE6B 4AKOA 1QG3A 3TJEL 4FZEH 1HK6A 1M7DB 4MXQC 1IC1A 1MDTA 1H5BB 3V0VB 2MEJB 5M94B 2D4DA 1NBQA 2V2XA 3E9TA 2BHYA 3US1A 4NJAL 1Q9WB 3KLAB 4NDMB 4YBQC 4E9SA 1QACA 1UCTA 3MCG1 4B9GA 5D1XC 1JNHB 3VH8G 3NZSA 3L3JB 4IOIB 1RURH 3HZVA 3P4NB 5A6IA 1ACZA 1TSRA 3NCFB 4K5LA 1DQDH 1XB8A 2ODIA 3CIQA 1WTGT 5D2NB 5HHPA 3CHXA 4IM8A 2C5DC 4YXLL 2WXHA 1B3IA 3NRFA 2MQ0A 4JFEA 5C07A 5A3ID 4Q9QL 2XTJC 1AIFB 3CLWA 4H40A 4A68A 4L0ZA 1B90A 1PKOA 2WWNA 4MJIB 5F0PB 1DQIA 3T0DA 2D4FA 3HRZC 2BY2A 3ORJA 2R2EB 3QXVA 4UAHA 4BWWA 4PFEA 5CEZE 5I73B 3WGVB 3GO1H 4U4BA 3PF2A 1KWGA 3K46A 4OJFL 1AXTL 3C6SB 3JWDL 3QJUB 4J3SA 5FFOA 4NO2A 3CE1A 4E9WA 5LHDA 3DO7A 4GAJH 3RPIB 5C9JA 4MXWL 2BS8A 4JCWA 1KT2A 1O9ZA 3CNKA 5JORA 3Q6FA 1NLDL 3RGBA 4LGRB 3G5YB 4LVOC 1MJ7L 1N5AA 1KPUA 2WB7A 1OW0C 8CGTA 2VB5A 2NXYC 4PRAB 4DT2A 1X4YA 1B6DA 4KVNH 5FKAB 2FCBA 5I5MA 1D7BA 2ZXWB 4IKKA 3HZKA 4POZC 1KFAH 4YR6A 5A6MA 4PGBA 2D7TH 1JZJA 1EMTH 2YLKA 3Q43A 1B4JH 2AANA 1USZA 3SDCD 1ND0A 3VGAC 4L4VB 3W5MA 4PWFA 3UDWC 3C12A 2KL6A 4GW4A 3FS9A 2Z35B 5EN2B 3G5WA 5DGQA 5CP7B 1E4XL 1A22B 1GMIA 1OP3H 3CVIL 4M5ZH 5ACMA 3Q44A 5JXEC 2KS0A 3IS1X 1A6AA 2WWMC 2DBLL 2F7IA 5C7XL 3RKPA 1DL7L 4ZAKA 3L9RA 2FUTA 2GITA 1WT5A 2Y7MA 5TFSH 1AZBA 3FFCA 1KN4H 1UYWL 5IQMA 4XNUL 4PUBL 2EADA 1IM3A 5FB8B 4JFUA 1KBVA 1RZJC 4XN7A 5DF0A 5G2NA 3GSWB 4XAWH 3AUVA 3S35X 3TVMA 1SNRA 3I50H 4X5PA 3ZL4L 4O02L 4YXHL 1U8IB 3LRLA 3TS8A 5AQ0A 5GRWA 3TASA 5I0ZA 4JM2B 4HDIA 4B5ZA 2HLAA 2ENJA 3L3IB 1MFBH 3MOBL 5J6GA 1JTPA 2JKTM 5F21B 3QIWB 2SODB 4IK7A 3SDXB 1FFQA 3H4FA 3CFQA 4NN6C 4AJVA 5IG7A 5DK0B 4P2RD 2CU9A 1O7SA 5FW8A 3CVHH 1FLTX 1M7XA 3F7QA 1T3FA 4E9LA 4LEOB 5JYLA 4V1DE 1TPXB 1RH8A 2H47C 2PF6A 3L1EA 1UOVA 2CAKA 2VJ8A 1NAKL 1SLWA 3MACL 3STLB 5E4EB 4PRDA 1DVSA 3GRGA 2V7HB 1DUZA 1AD9B 3MOQA 2ZCKL 5FGBC 4LRIC 3GNML 3GMMB 1C12B 2VMEA 3ZZQA 4N0YH 2ED6A 4W70A 3O6FA 4XP6H 1U91A 4UIKH 4BBWA 3IYLW 1I1FA 1ZLUK 1NGWA 4X8JB 2H26B 4OJEH 2BK8A 4IGBC 4WV1A 3W5NA 5CEZH 5B38A 5CEXA 1ZEAH 4FJ6A 4Y1AB 3OKLA 1BYOA 3RJDA 3C8DA 3HBGA 4F2ME 1AD0A 4PJEB 3BLPX 4DWHA 1L9SA 4AV5A 1QBAA 1UM4L 3MLVH 2FQGA 4YAQB 2XNAA 3NOIA 5GS1C 3UC2A 1NANH 1XCTA 4AKQA 3OPUA 5LXGH 2BSSA 2OCFD 1LE9A 5DMKA 1JV5A 3UJJL 4MWFA 3U9WA 1KJ3H 2NY4B 3RZCD 1ZSHA 3T4YB 1S9KC 2IPUK 1MJUH 2WXKA 1DFXA 5SV3A 3TEXA 4DK6A 3GZQA 4NIKB 2WLJA 3QRGH 3MLZH 4Y19D 1E5BA 5D71L 2A99A 2EXYD 5CWSA 1DZBA 4Y9GA 4HV8B 1J1OH 4P2OC 5DR5H 5F6IC 2O5NA 2QR0B 2XVBA 1RIVL 4E9RA 4DHLA 4PD4K 2BIPA 2E6PA 2X2UA 2Z1PA 2Y6SD 2Z31C 1BVNP 3N43F 1DCEA 2J72A 3OAUL 4MA3A 2AVGA 4JB9H 5CSZA 1FNEA 4O51A 1LEIA 2OXHB 3BAKA 5ETUA 3BUTA 4Y4HC 4NM4H 5F7MC 2F54A 3KPRE 3WEBA 2C7FA 4HJEA 3O3UN 1QBML 4J3OH 4X4YB 4Q9RL 2AJUH 1G9NL 1U95A 2XG4B 3HPLA 2UWEB 2Y0SA 5K39B 2H3KA 2GTQA 2VXVH 1L5GA 3FONA 4N5EC 4ZD3H 1UB5B 2JXMA 3BSZL 5E1AA 2NCMA 3MV8E 3VXPA 4QYAA 4F8OA 3IETB 1PD1A 4F93B 3QDJD 2BP5M 3Q0HA 4AMKH 2WINA 1AAJA 1DVFC 4RRPA 1MOEA 4J3WA 2XQ0A 5DK0A 4G8GE 1AQDA 3K4DA 4UQ3B 4Y5YC 3UADA 3QDJB 4PJ5A 5EORH 1ZA6A 1H0DB 3M88A 3SDXA 4JLRB 4NFCA 2ZWSA 4WTZA 1AI1L 1DQJA 4RMBA 3NJLA 4NNYB 2XV6B 2CJUH 3RNQA 2CUHA 4WNJA 1IGFL 4JM4L 3CFBA 1Q9KA 5FYLD 4D8PA 2BSCA 1YY9D 4RISL 5JIKA 2EABA 2QEJA 4BFKA 4QRPA 1OSEA 3P30L 2VDNH 3R4DA 4HT1H 4JPSA 1RJZA 5E99H 1FZMA 1JZFA 1YCSA 3DHUA 2WY3B 3K6SA 1OAQL 5TE6L 5AB2A 2AXGB 2CO7A 2EEFA 5EA0L 3UG4A 3NUKA 1BFVL 5KSBB 2B3IA 4PJ7F 2XG4A 1ASOA 3HPLB 4OGYH 2OCCB 3L7EB 4X7EC 3SE9L 3VXRB 5ILTH 5L4JA 1NCGA 2CR6A 3L9RB 1OF0A 1Y18B 1MVUA 3FXIC 1XAUA 1KBGL 3S37L 5CINL 3ULAB 4U7KA 4HU2A 4W9KC 5DYOB 3ZE1B 1SUJA 3BRDA 1UA6H 2CKBB 5A2JH 5C0CB 4GRMB 2E8YA 1T2JA 4FULA 3MRCB 1DBMH 4RLDA 4W9EC 3EYQD 5MI0B 3RZCB 4XC1L 4N90E 2ATKB 2FO8A 3U83A 3RGHA 2Q76B 3V4VH 1EZSA 4IBLT 5ITBL 3AB0B 3U6XS 5EIIA 3QJHA 4AENB 2BH0A 5C0EA 1IEAB 2V8MA 1SGKA 1A47A 1U92B 4MQXC 3LH2L 3S8GB 1AGEA 5I23A 3C5ZB 1OSYA 1M3IA 3GSQB 5GS0D 3HB3C 3GS0A 3TEWA 4BINA 4MNGB 1XGPA 5J06A 2ZUQC 4Z7VB 4N2FA 5SWZB 4YIQA 1FNGB 3H2QA 4XODA 1RIHH 1WBYA 3LPFA 5MENB 4U6VH 2X3CA 3AWEA 4N0CD 2FR4A 1XHHA 5KVEE 5I8KL 5KBPA 3WAKA 2O6DA 2V7NB 3GMQA 3VFMA 2VNCA 1X4ZA 2QPFA 4KRPC 1QWHA 4KPHH 5FO7A 4JAMB 4NP4L 2N1TE 1B88A 4NAMA 4CA4A 3VQ2C 1F90H 4GAAA 3B9KD 2CPUA 3KLQA 5E8OB 5I1KL 5KS9E 4MS8D 3HC0A 4MMYA 4OIFA 4YDLC 1AI1H 3V0WH 1XVSA 3RG1C 1S7UB 3BKMH 2VLLA 1OM3L 5SWSD 1JUFB 2G3XA 1HZKA 1ZIBA 3A4DA 3P30H 1IVLA 4AIEA 2R0ZL 1EJFA 1P6AB 4O9HL 5DJ2B 2OR9H 1MKFA 1OHQA 1R3KA 4Q6IB 1RIVH 4QRPD 4QRPB 4HJ0C 2EC9T 1MI5B 1DJXA 5INDA 1R6VA 3SDXF 3PUCA 1DLFH 1H6TA 1UGNA 3LKPB 4JPKL 4X0NA 1WRFA 1M9WA 1KYFA 3LNEA 4WO4B 3HG4A 1II4E 2CIIB 1HI6B 5LXGL 1NICA 4JFPA 2G0KA 1OT2A 3T0AA 3TBVA 4HU8A 2IAMA 3L9BA 3IFLH 3BH9A 4XHJC 4HZLA 2VWEC 3OAYH 5FF6A 1QUPA 4RFOL 4OLXL 1CI5A 5DMYA 1GCFA 4OB5H 4M6NH 2WAHA 1I1YB 1M71B 4RBPK 3IU3A 4IKJA 4NRYB 3T6QC 5ICXB 5TQ0H 1WZAA 1JVOA 1U92A 4WJ5B 1EHAA 1XT5A 1ZSDB 5GS1A 4NFBA 1HYSD 2PWEA 4YEEA 5I19H 4PWKA 4G8GA 2V2WB 3B6SB 3QWQB 4KFMA 4OJYA 5CUSH 3PGFH 4PJ6A 2X10A 4J4PD 2QBWA 4AT6B 4G59C 4YVUA 4EJ1C 5KVFL 3JV5A 3ZXAC 1C9SA 2OMUB 3I6GB 1MHPL 2B7DT 3MRFB 1EUUA 1WAEA 1CGVA 1YQVL 3RQ3A 4XMKL 1R5IA 3V9CA 5H35A 4LFHD 5FPIA 3U1PA 5F89B 5CJ8A 4A2GA 4EMZA 4FEIA 1XXDC 4PJAB 2JJUA 1DFBH 3TESA 2YWYA 3D2TA 1T0MB 1JZ3A 3APMA 4UTBA 3PU7A 3TO4B 4Z0BH 3H7BB 3LRSA 1KG0B 3MV8A 4ZUSB 4DK5A 2DDQH 2HCZX 5GXBB 5D7JD 3KYNB 2XV3A 1C16A 1FVCA 2A83A 1D5XB 1B9ZA 3X3GL 1RU9L 3R8BB 4ZMOA 2I5YL 3WIAA 3GRWL 4FXGC 4ZK8A 2ZX6A 2DLFH 1WBZA 3PJSB 3ZL1A 3GUTA 2PPDA 3ARUA 5HI3C 1JGDA 3QUXA 4XAWL 3P73A 2Y7NA 1AVAA 2F5BL 1NC2A 4YHPB 1B4RA 2E4FA 2A73A 4HH8A 4JFFD 4OZFB 4QMEA 4WFFD 5DDHB 3VFSA 3VD7A 5FYJD 1DHKA 1UTDA 4HKJA 2CBOA 3O4LA 4NUQA 1L7IH 4Y2DA 4Z8FL 1JWSB 3BPLB 4Y4KA 4CUCA 3S9DB 3D25B 2NY2C 4K15A 4L1SA 1KB5L 4KVCH 2YUXA 1DUYA 3FZUD 2VDOL 3O3DB 3VXQB 4XNBA 3D07A 3DDFA 1IQWL 3G7TA 5E6SB 3UCRA 1AYOA 4HKXA 2VLRB 4G8AC 1YEFH 2Y3NA 4PG9A 3TL5A 4FI7A 3T8MA 2YRLA 5K33A 1JHLH 3ETSA 2JQZA 3CH1A 1AGEB 2HJFB 2PTVA 4NO3A 5DRWA 4GS7B 4XNUH 3IE4A 3INUL 4ZNCD 3CZGA 5IK3A 5DQJA 3BIAX 1MHEB 4AGLA 1XZ0A 4N1HB 2WQVA 2O93L 2BMKA 5ICZB 1G94A 2ZWNA 2J5WA 1BGXH 3COOA 4WY7H 3RTLA 1NCCL 1XQ4A 3WE6A 3JTTB 3ESVF 3ARFD 1OANA 2XIIA 3FT2A 2DIBA 3UAJC 4DTGL 3MV11 2VUYA 1EWHA 3FN9A 4J1UA 2ZUUA 1JZ4A 4LEXH 4PJGB 2OMBA 2PLTA 1PFOA 1QPXA 1VGKB 5IMKA 5DRZB 4JR9H 5CCHE 2H0PA 2KC0A 4GYBA 2VIRB 3VXUB 1BXVA 3FJTA 4KZEH 2PCPB 4Z7NB 2GUOB 4Z3HA 4X98A 3NFNA 1KYAA 1G6RH 1E4XH 4PM1A 5HVGB 3FUEA 3SD5A 3DUSB 3RB5A 2VXSH 3H0TB 3CVCA 3NQIA 4FXGA 4FAAB 4B9ZA 1HDMB 4BFIA 3P3RA 2HN7A 2Z64C 5GZND 4RQQA 1E4KA 3CFDB 4MJHA 4LGSB 5IK3B 2NUPB 1JZIA 4Z7WE 2X1WL 2YQGA 1MI5A 1PAZA 3VI3F 2CDGA 2NYYD 1Z0MA 4U33A 1WTLA 3D4CA 3VFNB 1EDHA 4ZS6C 5LWYL 1I8MA 2XACC 3K71A 2QADC 4AVIA 4L1LA 3LRMA 4L0PB 2X7LA 4RGND 4CSZA 1KELL 3GD1C 2V3DA 3OB0K 1M56B 4DPAX 3VGHA 5D4QA 4I1RA 3FQUA 3ZZ1A 2ARWA 4QXUH 1TG8A 4GAJL 2VLJA 1J0JA 3KMDA 4JDEB 4PB0L 1CD9B 4L3EA 1ZJBA 1AP2A 4ZS6D 5K69A 4K94H 2WVVB 4H8UA 5C0FB 4LVNB 2G4EA 3D0LB 2ZCLH 2EDNA 2PPEA 1ORQB 2OULB 2RB8A 4D9QD 3N1GC 3QIWA 5GZNC 2IH3A 5A3IC 5D2NC 4PRIE 2KLTA 4XMUA 1ZXKA 4EF3A 2BVEA 2VR6A 3JZYA 4NUJB 4HDIB 2JQAA 1W6WA 3OR7B 3GXMA 1T80A 3MRBB 5C71A 5GJTH 1X3DA 4O4YH 4D9QE 3GEFA 3MXVH 3A22A 3TV3L 1N0LA 4ELMB 3RU8H 3IMWA 3WHXA 1EO8L 4RMQA 4YHML 2AQTA 4I48A 2DICA 5KSVA 4H44C 1PDKB 3D8MA 2GAZA 1KLFA 2VN5A 2HYMA 3HMWL 4I4WA 4PP1D 4X50A 2B1HH 4MAUH 4X0KA 2AEQL 3JV4B 5F71A 5E2JA 5BZWB 2H26A 2WBWB 3DSFL 2BVQB 2ZF9A 4JG0H 5MP6H 3D85B 5BNXD 3IF1A 1A7OH 2WP3O 1A7RH 3FPYA 4OZFH 3DSNA 4QXGL 4AJWA 3V52H 2CXKA 2Y23A 1KTLA 4NHCL 4BSWA 1FV1B 5K9JL 4HEPA 4BSJA 4WSJA 5IHLB 5ID1A 1AMYA 3THML 1RFDH 1AYRA 2D3JA 1KCVL 2Y5EA 3K6DA 1RZGB 3ZYZA 3DHJA 1YECH 1EEZA 4KAQL 4OZHF 5LN8A 3TH4T 5LN4A 2BNQD 2DBJA 1H19A 4DP6X 1FZMB 5IJVB 3LTVA 4P46A 2EACA 4LE8A 2UWEE 3VI4B 2QV2A 3JV6B 3QQNA 3QUHA 1T22B 4JE0A 2CJTA 4BD4A 3O9WA 1GPOH 4LQ1A 1Q1JH 3B2UD 3FU7A 2RALA 4WFHE 2WLMA 3L3IA 4LARL 3ZTCC 2FE0A 2Q3ZA 1OCWH 2NR6A 3D1MC 3OKNB 3U2JA 1YJDH 2XPYA 4IOSA 4F37F 4HCFA 1EAJA 1XF4B 1FA4A 1BBDH 1UZ6F 4MA1C 2KHAA 2CK2A 2VISA 4K3HA 2VSKB 4BHUA 4FA7B 5FO9B 2HTLC 5ELIA 1CVSC 5E08L 5K9JH 1QBLL 1YDPB 4L18A 2Q9OA 4U1KA 4E9YA 3AY2A 3NGBB 2UY6B 5EOCH 1OCOB 2P5EE 2ZF8A 3MV7B 4H2CA 2X87A 4TULL 4XP9H 3I3BA 4WWKC 3KGSA 4QXVA 3QNYA 3KLAA 1VZGA 3N6YA 3LNGA 4W1TA 1K4DB 4OLUH 5KSAA 1ZTMA 1OGTA 4X6BA 5ECGA 1E4WH 1CG9B 3L3JA 1AZZC 4IOIA 5D1QE 4ZQKB 3VVWA 1N8ZA 5B1AB 3FTYA 4GUPA 3ETTA 4NI3A 4BDVB 3CFKA 3ALXA 5IP4A 4PY7A 3QUYB 4MD4A 4IHOB 2DQCH 3OXSB 4X0KB 4QHUB 4UQAA 1BECA 3MU3A 3NAAH 2CA3A 4X98B 4KH2A 2L7QA 4ZPTA 5EUOF 3MRKB 5HDQH 2WYHA 5MENA 2BP8B 4LSVL 4TUOB 4AM0B 3AABA 3VQMA 1OF2B 4YXKH 4CSSA 3D39A 4NNXB 1HXKA 3RX9A 1NIAA 3WMPA 1EFXB 3WFCH 3VXNA 2DMBA 3WJJC 5BW7C 4WEMB 3GXDA 4JN2A 1D6EA 3MLTA 3PAUA 4RFEA 3MGOB 3NEOA 5BS0D 1L9TA 2VMCA 3KR3H 1EEUA 4K94L 4MTMA 1GGTA 4NCC2 3M8OH 5HPMB 2CQVA 3S36H 2UXTA 5IVXF 4GAGL 2A38A 1QHQA 3NZHL 4P49A 5E5MA 3LQMA 1F58H 4DGVH 1F6AA 4AH2B 1IM3D 3ARZA 4YFEA 1S5IH 1BFOA 3O8XB 5M7QA 5FGCE 3P9WB 1CDGA 4X7DC 5ESQB 1DLHB 5I26A 1YPZE 2F74A 3BGFC 3S4SG 3WEOA 1ZGLA 3WU1A 2OJEB 1XH2A 2CO4A 4QXTB 4A67A 5DVMA 3X1EA 3FFDA 3QZLA 1LEKB 5CJXC 1BMGA 4L4JA 1HWGB 1WZLA 3WNKA 4PVLA 5HD8C 3QS2A 3H3BC 3SPVA 1UKSA 2FVNA 3IFNL 4F7PB 3K6NA 4D9LL 4MB1A 1DCLA 4H8WH 1AOZA 2ENYA 4J8QA 4JQXA 3VXPB 3SPJA 1P4IH 4FKKA 5KVGE 1OT4A 4L3EE 5LGHH 3P4NA 1MH5A 2ICCA 1P2CA 5IB3B 4EI5C 3TH2T 1KCBA 1GTNA 3LAFA 3IJHB 3L4VA 1R34A 1UUNA 5DRXA 5C86A 3KPMA 4RGOH 2FB4L 3EYFB 1TUPA 3P73B 3WEXB 3X2QB 2GJZB 3MX0B 4E41A 3OTTA 2JB6B 2LFEA 1MQ8A 5IB5B 2BDNL 2O61A 5J3HD 1G7QA 3D12B 5CR1A 3WLWD 1L7IL 4ENED 1MNUL 2QR0A 1S3RA 2EE0A 5DJDA 3VUAA 4CMHB 4FKEA 2WIIA 4CC0A 4P23D 2NY1C 3EYUL 3RA7H 1T0MA 3QUYD 1YNKL 2E76C 1KV7A 3VXRD 1M6OB 3IJEB 4GJTB 1DVQA 2H0EA 5F9JB 1UCBH 1CMOA 1T20B 3CBRA 2WUBL 3EW3B 4J28A 4KUCF 5EC2A 3PFUA 5H35B 3MRGA 4NZRL 5ITFA 4FG6D 3G6JA 5KS9B 2YXFA 1MI5D 1S9XB 2VKXA 2H3NA 4N28A 3P54A 2ZD0A 3T0EE 1QX1A 3CWGA 1BCIA 5KJ4A 3GJFH 4C56E 4P9HC 4GSUA 1MHEA 3TN0B 5I71B 1AZVA 4M00A 4EDXA 4QWWC 3HNSL 5HDOA 2XTSA 3B34A 4Y19A 1ACYL 2V37A 3I9GH 2V9RA 3BQUD 4NZUH 5BS0A 4OZIF 1QKZL 4IDLA 1CXHA 5LBSA 2DQHH 2HVBA 5HDBE 5GGUA 2W92A 3RNKB 2J8OA 1X9RA 4ZUUB 2F53E 4FQQA 1SFDA 4QTHA 4S1SH 1T1XB 2TSBA 4F2FA 5TF1L 4AYID 4YX2L 1VENA 1RK1A 4JY4B 3G5YA 2R4SH 1FF5A 5HVHC 4X6DA 1FO0H 2BVUA 2F5BH 3VI4E 1PS3A 4FNUA 4FXKA 1FGNL 1L4IA 2VXTL 5DJXB 1TTGA 4GKNB 4M6NL 3HN3A 3VSQA 1HH9A 4B7LA 3IPBA 1MIML 2JNZA 4R97C 5KYYB 5IQOA 3E6FA 4Q6KA 1SUHA 5GZOC 4NQCB 4CN4A 2JIXD 2C9VA 2L7JA 1T2XA 4UOW0 2GABA 3NSXA 1REIA 1O9WA 3CC5A 3D69B 3OJMB 3NJNA 1TITA 4L29A 5FOJA 3FB5A 5FC9A 3MV8B 3Q3GB 1O5DT 3UG3A 1K2DB 3DARA 3KR3L 3L3GA 4WGVB 2AKRB 2HRPL 2F54E 4WW1A 5E1HB 2YJLA 3UYRH 2Q3AA 5IM7A 1QSEB 1KY7A 3W11D 3HZVB 1CCZA 3UJIL 3SQOL 1BVKB 3P11H 4LDEB 2C9AA 5IB4B 3ENEA 4L9LC 1OSZB 1G6RA 4P57A 1NDMB 2FL5B 1JYVA 4YDLB 1A6AB 1BZDA 2HJKA 2V2XB 1LO0H 4F7MB 1OTSD 43CAB 4EXPX 4QJ4B 3LPGA 1RZJH 5I75C 2C9XA 5T3XH 2X9XA 4A7GF 4JRLA 2GK0B 1GHFL 4OJCA 4AQZA 4EDWL 1MCWM 1G6VK 4KNSA 3VXME 3QQ4B 4CJ0A 3VNYA 2R69A 4CU7A 4N2CA 2IH8A 1GGCH 1HHGA 2WKLA 2ESVB 4QTIL 3CFEA 3NA4A 1FL6A 2QPDB 3VXSB 4H0GA 4AQ1B 5FO2A 4KK9D 2CXGA 1L9OA 1VZHA 3OAWA 3CZNA 5HHNA 4H1LG 1G1CA 4XCNA 5BRQA 5L8KB 3AXHA 5B22A 5E08H 2X4PB 1V7NH 3R06A 5D4IA 3WFZA 1XF2A 3X14B 1SQMA 3D3VD 1OLLA 4PJ7B 1E6JL 4R7VA 3HHMA 4NSKA 3AWGA 2NZ9C 2F18A 3Q2VA 2VN3A 3MA9L 3A6CH 2QZ5A 3QULA 1J18A 1LP9A 4FG6C 4LSTL 2PO6C 1BOGA 1N0XL 4OIAA 4DN4H 5KYUB 1QEWB 1HEHC 1U4FA 4BK5C 5DCCA 4XPGL 4FQ2L 2IH1A 1KB5B 4MDJA 5TE4L 2M2DA 3L9YA 3S37H 3U6RB 2JB6A 1W80A 1W9XA 2DQDH 1DJIA 2Z31A 2NZ1A 4FG2A 4Z7AA 4XXWC 2GBVA 5GS0C 4UOQA 5DMJB 4HLZH 4WU5B 2V17H 4H0LC 4X6CE 1HHKA 4WI2A 4BUGA 3BZDA 4FFZA 1V3KA 3NBNA 3MBEA 3S5LA 2A6IA 4NM8H 3KL5A 5AAMA 5B1JC 4MJ5B 1F3JA 1UG9A 5F88A 1AC6A 1PBYA 4YSEA 2JCCF 1OZTG 4FFTA 3UAFA 3OLEA 2HT4D 2FR4B 3SD2A 2ZSWB 1A6UL 2VDRL 4NENB 4X9FA 4R4NC 4LLWB 4AQAA 5HYQB 4B9YA 1P7HL 1N4XL 1UH4A 4MA8H 2Q8AL 4MSWB 5C0BD 3F05A 2ETWA 4QTFA 1IV8A 4MS8C 4PGEB 5IBTL 3ZTJG 5LXVA 1MWAA 5EUOE 4PJFF 5DJAA 2GG1A 2OXHA 1NGYB 4XO8A 1UD5A 4C58B 5DD0L 3QYMA 1AGCA 4G7SB 4DAGH 4F9LA 4LCVA 1FO0B 1W8EA 2V9UA 3WYRA 1HU8A 2K9FB 1OB0A 1ULVA 2ENPA 1MFCL 3LX9A 1TZHB 3TJPA 1EK3A 4AV4A 4HA1A 4FQQB 3ZOAA 4L4VE 3MJ8A 3DTDA 1EFXA 3SDDC 1RZPA 2BIIA 3BH8B 5EPMB 4QHLA 3CFJB 3V5DA 2MH4A 3KBPA 2UUDH 3CZFB 4L8DB 3LS4L 3DX9B 1AOHA 3D2UB 3FMGL 3SE3A 4U2ZA 4JY6A 1HC1A 3OBAA 2XT1B 1MVFA 2CJUL 4TQEL 5CN2A 3TZVB 3BDYH 2ZAHA 3IN2A 3P2BA 4BM7A 2IOIA 5C08D 5HHXH 1KJ2H 4YHLH 2EINB 2NY3B 4HVBA 3MLZL 1LNUA 4DKDC 2I9LA 3KXFA 1ETB1 4N2HA 2FYYB 4RVBA 1PLCA 1ZLSL 3DJ9A 1U8OB 4WLCA 2KT6A 5CJXA 1D2OA 1M7IA 3FCTB 3ZMRA 1QP1A 5E1QA 4B53A 1AGFB 3SOBL 2IGFL 1E9OB 1NGYA 1KPRA 4NWUL 1GS6X 2WN3A 4P9HH 3SBPA 1FFNA 4QAMB 3RP1A 1Z2KA 3CH1B 4O02A 5G4OA 3QUZC 3RGVD 4AC2A 2Z31D 5CILH 2NY4D 2V5SA 3P0VL 2IF7A 2XUWA 1D7DA 1JRHI 4HGKC 4RX4A 2ZG3A 4ZQTA 2JCCE 1GPOL 1IGJB 1KGCD 1NMBL 5E4AA 3DETC 1ROCA 4H1LH 2C4FU 4OD1L 3KEHA 2ICWI 3UDWA 2MJWA 2R2HA 4QCIA 3EJPA 4Q8BA 2XWRA 2GJPA 5G5DB 2QPSA 3P4MB 4H2AA 3NJHA 4CILA 5FW7A 2R56H 5HHME 5I9QB 4K3EH 4HJJL 5IB3A 5J1TC 1FRGL 1DANT 3JT2A 1MRFL 1Y07A 2YARA 1VERA 4LHUG 4Y8AA 3ARGA 2EDFA 3ZGHA 4KK5C 4JKKA 1M42A 2F7OA 4MCNA 2EIDA 1IAOA 1O7DE 1LP9E 3CFIC 1UQSB 1VFOA 1SF3A 5GGTL 4Z6AT 3WTVA 1T1ZA 4KXZH 5D1XB 1UH2A 5I1JL 3LKOA 4XBMA 4DETA 5B1KA 4YUEH 4A1RA 4IIZA 2GITB 1NCBH 5F7UA 5EZJB 4HCIA 2MTAA 4IS6B 3KGTA 5IQ9B 1VKXB 3K0WA 5J1AA 2YD1A 1D6VH 2FBJH 3MRQA 1T89A 4OT1H 1JF6A 4PG2C 1R24A 2TAAA 2GY5A 3OWRA 1LD9A 2J5LB 3TH3T 1OAYH 3TV8A 2XKUA 5L6YL 3ARGB 1YEGH 2BVQA 1BJ1J 2ZKYA 4YHKH 3WIIL 4DUWA 3O81A 4X6CA 1J11A 4G9FE 1EO5A 4H5SA 3UX9B 2WD0A 2X4UB 3UYPA 1KN4L 1UYWH 3ARBB 5F7KC 3H1ZA 2DQJH 3MR9B 4JQVC 5EBGA 3UMTA 5LUMA 1QA9A 1EVTC 3FO1A 3HOGA 3VWJA 3MC0A 4L48A 3TC9A 1VESA 2IBZX 2OTPA 2ESVA 3PQYA 3VSUA 1MAJA 4U6YB 5EZJA 3LQAH 4PLJD 5EZIH 5IY5B 1IC0A 1JNNL 3DVGA 1SDDA 4PJ5E 4PRAA 4MNQD 4MNHB 2HVJB 4TNVK 4LVOB 3NIDB 1WCQA 3NA9L 1XEUA 1XH0A 1UUSA 4MA7H 3T0WA 5HGBB 2OZ4A 4U6HB 1J0IA 3RYMA 4BFEA 2VH5L 2O6PA 4B7IA 4P2CG 3L4TA 2DL9A 2YA0A 4M6OL 5D7HA 2JK5B 4D3CH 1WIPA 4I2XB 1A14H 3B2PA 4X9IA 4ZMAT 4EZLA 2PW2B 5C0FA 1Q9OB 1T5WB 3B8YA 3O41A 4HEPG 1PYWA 3FT4A 1UGKA 2HKFL 3Q8FA 3O6FD 3QIUA 3TWCL 4PJBE 2AKRA 1MRFH 5JW4M 3OC8A 2VOTA 4RAHA 2QELA 1ZLWH 2IQAA 3PAVA 3T6VA 3DMMD 3RDTC 1PZSA 1I3RB 3QULB 1I85C 3K2KA 4G8GD 4HS8H 4XN2A 3ZKNC 2EUXA 2AXFA 3HZMB 6FABL 4PTUA 5DEJA 5E9AA 1UD4A 3U6XA 4L29B 2R8SH 2W0FB 4JJOA 3EUUA 3IDJA 5CFHA 4Z7WA 1DQLL 3AW5A 1GOFA 2YBRA 3ATEA 3OD3A 4D0CA 2WXMA 1I7RB 1HN1A 4KI5C 4XNQA 1I1AB 1RQ5A 1MJ8H 2AK1H 4G7RB 4K73A 5J13B 1NIFA 2WNXA 1XZWA 1LHZA 1MJJB 1E40A 4Y5VA 4JUSA 1L9PA 4UTAA 3MVSA 4NKIL 1H8NA 1T7YA 2Y1ZA 4FI6A 2NY5H 3NGBC 2NLJB 4JCLA 1RUKL 1O0VA 3B9VA 4FA8A 3NMEA 2YA2A 4HH9B 2XC8A 4X4MA 1IAIH 2Z93B 5ACLA 4MJ6B 1ZHNA 5ALBH 5ID1B 2VDMH 3BVVA 5FKAA 3D87B 2YJQA 4OGAD 3ULVC 4LHUD 5EIVA 4OI8A 3TJEH 5C0CD 1KJ2L 4U6TA 1KGWA 4H8PA 4WSGA 4EQ2A 4WK2B 2P24A 4HOZA 4IRZL 4XXCA 2I9TB 1WHOA 3KHQA 1CE1L 3QH3B 3PWJB 4I87A 5B3JF 4PJXF 2WXOA 2CM5A 3EJUA 5C97A 4JN1L 4L2YA 5E5RB 4DW2H 5DJ6A 2HSIA 4JM2F 4GXVH 1NUGA 1IQWH 1NBYA 4OZIE 2IADA 3NJMA 4NEHB 4ZTOH 3NIGF 4R4ND 5HHOE 1FAIH 2JJTC 4P5MB 3MJ9H 4JEGB 4ANWA 2DI9A 1CFBA 3I2CL 4C57C 2IBBA 4Z8FH 3QORC 1E9QB 3QT2A 4ORZC 5C0AD 3RVVC 1JDDA 2HG0A 4TRPL 4ODXB 1B2YA 3CTTA 2GQHA 3GHEH 5DD0H 1EHLH 1ZPLA 3C09B 4GG8A 2ITDA 3L16A 3Q5OA 2O5YH 4NZRH 4FQLH 5EOQL 2Z7YA 4XGZB 3VFNA 4GPVA 4WAFA 3QC6X 1FFPB 4PJCF 1O6SB 1AQKH 1XSKA 1RJLB 1WO2A 4WSKA 5T1JA 1QYGH 3AC0A 3RAJH 1JPST 3X3GH 2ZP8A 3WUWA 2J8UB 3U0PA 3MLXH 2YSTA 4KZDL 3RJQB 5JUEH 1BX2B 1AP2B 3BESR 3G6DL 1PZ3A 4TYUA 2I60H 1E27B 3SBWA 1C5DB 1HWHB 3QZWG 5FLVA 5K9OA 3BCDA 4QTHB 3T8XA 2VL4A 2N1KA 2ESVE 4DH2A 2PTTA 4LLQB 4PJEF 3PL6B 2CKBL 5EEXA 2EIZB 3GBEA 3II1A 1J9CT 4JFFE 3RTQA 3BUDA 2QQQA 2XXCB 5E1AB 2FB4H 3TO4A 2XX1A 3VXUA 3FQXB 3D48R 4FQJH 3CHOA 3PWPB 1DEEB 1ITCA 1P1VA 4IU3B 2NUPA 4PY8J 2ALWA 1J8KA 3ZTDC 2K6ZA 3CJJA 1QFUH 1Y0LA 1KXVC 4FQ2H 5C0JA 4UM8B 4YSOA 3IDGB 4FDWA 1MLBA 3CZSA 5D4JA 4LAQL 1KIQB 1HJBC 3ULUF 3BZEB 1ACCA 5IEHA 3RX7A 1MW3A 3RUGF 1HILA 2ROYA 1JGVL 1NINA 3TT3L 4OM0H 3ARFC 1AGCB 3K8LA 4AZUA 4L8SA 4WU7A 1SPDA 4WFEE 3S5ZA 1N6QL 1FJ1A 4ODSL 5BZDA 1XH3A 2DWTA 4L8DA 2HJFA 4NO3B 1T04A 2I32A 3EYSH 2AEPH 4WCYH 1IBZA 4NCC1 5HJDA 1CLOH 3O3AB 5D5ME 1FGVL 2PCFB 3NIGE 4Y7MA 1KBBA 1KZQA 5CKAA 3EO1A 4L3ED 3UZQA 4HKXB 3NIFB 3QFGA 5F9WC 5T1KA 4TNEA 5I8EB 4H88L 3SDAB 4QY8A 2BRRH 5D96B 3QWRD 3WE6B 4Z7WF 5K1VA 2APXA 2FJUB 2HMID 1HQ4A 2GTZA 3HG2A 2Y07L 5EO1B 1UC6A 4PVNA 4JO3H 3MBXH 3FMGH 3W9EA 3VW3L 4K7PX 1HXMB 5E2WH 3Q1SL 2EYSB 3K0YA 3V55A 3JZ7A 5DQJB 5F1OB 1K9TA 3V0HA 4TLTA 1HKLH 1I85A 3NABL 5GGSB 5H37H 4X8JA 1VCAA 1MWAB 2QFRA 4XVUD 1GAFL 2TRYA 3FQ2A 4EDWH 1D9KD 5I6MA 5C8JB 1WPCA 1GIGL 1MHCA 2JJSC 1OGAB 2W9EH 3A67L 1OD7A 1KGYE 1OP3K 3SCMC 1WBZB 4IIQA 5EIQA 1J5OL 3ZE2B 4M1GH 4M7KL 3OHMB 2CM6A 3FCUB 4N8PA 3D39E 2APTA 5HDBB 1YMHA 2ED8A 2OJEA 3AMKA 4QXTA 2BS9A 1DVUA 4KTEL 5CZXC 2Y25A 2P5EA 3DTUB 2XN0A 1FP5A 1LP9B 3IGKA 15C8L 3O4LB 3VD3A 1YC7A 4EDXB 5CO1A 3DX3A 3VFWB 1TPXC 4U6VL 4LOUD 4BQ8A 2GJJA 4LLAA 1VFMA 1HHIA 1Y6KR 3RIKA 1MUJB 3MREA 4L8BA 4NQVB 4CC4C 4EUPH 1KNOA 3GT6A 2QVTA 4HYTB 1MFAH 4BZ1L 3PQYD 2OMUA 3I6GA 2BXYA 1VEMA 4Y5VC 5HHOA 4WI6A 5C0BE 3V0VA 3LSOB 1FVEA 2D73A 3ME0A 2NY6D 4AM0Q 1BZ9B 3QE5A 3QDGA 1WGVA 5HYEA 1FL6B 5CGYC 1QI3A 4EN3D 3ZHKA 3V4VL 4ADIA 1GC1H 2DJSA 3WFEL 4L9LA 3SO3C 1F4WH 2UY7B 4XP6L 4KO7A 1BFSA 2O5YL 5FYKU 4PJAA 3WI9A 3UYOD 3H6JA 3MV9D 1FUNA 4P5SA 5C0EB 2A9MH 3RX8A 2H45A 5CINH 3UTSA 2K8MA 3TGXA 3QCUL 4GFTB 1K4CB 3O2DH 3TJHC 4FLSA 4QUOA 4I85A 2V6HA 3SE9H 1HI6A 2IJ0C 4ZUVA 4YLQT 1H3VA 1FAIL 4L4TE 4GLRH 1MLCB 4JKMA 2A0LD 5IW6B 3FULA 3BPOB 1O6SA 3C5JA 4I18B 4Z95L 1BQLL 4RMSA 3GPEA 1M1XB 4AUUA 5C0IA 3O45B 3DXAD 4QXGH 5HD8D 1XCWA 2VCOA 4HPOL 1E5YA 3K6SB 4U3SB 3GRBA 3PABA 4NO0D 1NA8A 3SBWC 1YAIA 2Z3FA 4R5VA 4U6XA 1AQKL 3GI9L 3ECBA 4Y5XA 1UCBL 4F7MA 3BC9A 2FX9H 3IRPX 5F93C 3ARQA 5CN3A 3QA3A 3OPZH 4HWZA 4GEJA 1N19A 1YEHH 4L1TA 2XN9A 4U0QB 2DIEA 4RMRA 3OLIA 4I3GA 1KCSH 3NIGB 3L3HA 3QDHA 2WZPD 4ZD3L 2NSQA 5F96L 2VXVL 2VAJA 4J3OF 3ET9F 3UCQA 4FXKB 2W91A 1XGQA 2OQJA 2AGJL 1LDSA 2D9CA 4FYSA 1FG9C 2BDNH 5IGXL 1R3LB 1EHKB 4E9TA 3QARA 2RJMA 2XETA 3W9DA 1GYVA 3FQWA 4PRHB 5INCA 2P8MB 3KL0A 4OCYH 4GXVL 4GQZA 4PJBA 2EYTB 4DJMA 1WAAA 3E6HA 4MMZA 1Y1DA 1XR9B 1L6PA 3ZVVA 4PJCB 3PQYB 1H8OA 4O2CA 1FFOB 2QGCA 5EF2A 3FU6A 3QUGA 4ONHB 4GO9A 1F1AA 1BFOB 4G83A 1EMTL 3HVNA 1RVFL 4MKTA 5DFTA 1S7RB 1VGEL 3GK8H 2OZ4H 2PWHA 3MHZA 3GMRB 3NJIA 4NQXA 1TQSA 2VDML 5C0NC 4K71B 4W9JC 5HYFA 2H0FA 5JOFB 3DGDA 4XMVA 1A02N 1N7MH 2APVA 4RA0C 4WWKD 3MV9A 3PDDA 1MN4A 1RUML 4RA3A 1MWAH 3ABGA 3SDAA 4I48B 5EC2B 5KVFE 5D6DA 3MRIA 4PN6A 3NZHH 1N64H 1H5BC 1OAUL 3MQIA 3QNFA 4RIRB 5F7AA 3BVNB 4JFWA 2NY2B 3HUJA 3VDBA 2R0WH 1N59B 3MRDB 1C5BL 5T5FH 1FO0L 4WV1C 2GI0A 1RJZB 4K3GA 5KYNA 1KEGH 2VT0A 4HQQL 4BK4A 2P26A 4JQXC 4RMUA 1PMYA 4HD5A 3K74B 2X28A 1T5WA 3B8SA 3QEUB 5C07D 2KERA 1HL9A 5DUPH 1J8HE 1OTTC 1U8CB 1UFUA 4FNQA 3NDZE 2NY3D 1PQZA 2WJ7A 4GW5A 2VITA 4U1MB 4PVMA 1E67A 4JDEA 1F86A 4R0LB 4FQHB 4YHOL 1BYNA 1NCDL 3ML8A 1S8DB 2HWZL 4MNQB 1Z3GL 5KSBA 3E2HB 5IVOA 3RHWK 2C9SA 2Y1AA 2ZXGA 5I73C 3FSWA 3M7FB 2OK0L 3F12A 1NCCH 3KPOA 4KRPB 1TETL 3BOVA 1OCZB 4ATTA 1E6OH 4K55A 4XNDA 3B2XA 4DUXA 5JHDD 4MNHA 2VSCA 1KCUL 2W07B 3F7KA 4NGHL 4PCSA 2OSLB 3AVEA 2WC7A 2JTYA 5JZ7D 4U6YA 1MCPH 1MCOL 1J86A 1XIWC 2AJSL 4JDTL 4Y16A 3I75B 4KY1L 1Z9NA 4NKOA 4TSCL 2VITB 5AYUL 1AKJA 2W9DL 2APFA 3K7UA 5IB1B 1HL4A 5D70L 2ORBL 5HGAA 1AQDB 4UQ3A 4N87A 1HOEA 1NGQL 2CE6A 5CU5A 1P4UA 3MLWL 3KBFA 3JVFC 4L8CA 4QRRD 1KDIA 5HGGS 2EH8L 1JZHA 1TQCB 3DRQA 3FT0A 4I4WB 5DUPL 2O6EA 3K4AA 3BO8B 2P80D 3CDZB 4UT6H 1R24B 4LIQL 4XO4A 4LLMA 3LMJH 5BXFB 3O3BA 5EF0A 3L3OC 2DYRB 3WIHH 4JGJA 4ZUSA 4YHKL 3BH8A 2FJFA 4FLRA 4LLYB 2YK1H 2E3VA 2IBGA 2J1XA 3B5GA 4RESB 1W0YT 4XAKE 4DIXA 3OB0H 3MRIB 2IV8A 2VE6A 3DMMB 4TF4A 2NY0B 4UYPA 2D7OA 2QPUA 1IBGL 4PJHA 1FNAA 4GIAA 5E00A 3Q5YA 1RHHA 2UX6A 4AMXA 1A9BA 3GKZA 3GRWH 4NZTL 4Q52A 3E38A 2ILLA 4P3DB 3IE9A 4GW4B 2LHAA 3HE7B 2BNQA 4YDIL 3WS3A 1KCVH 2CRIA 2X4OA 3FTSA 4Y4KC 4CVXB 1EQWA 3QHTC 2A6JB 3TURA 4LSSH 2BVYA 2CLRB 5LGKA 5I1HL 5AVZB 1QD0A 2WUCH 2QQLL 4PWIA 2F58L 4UV4H 1LE5B 5E0FA 4UQBA 3PV7A 1ITBB 2R56L 5IESH 3JWDH 4ZXBC 2QVKA 3GMPA 4OJFH 1YYLL 3ILQC 1MHPH 3RVTD 4OGQC 2AJYL 4ZPVB 2IDTA 1WD8A 4URKA 4TSBL 3KHOA 5FM5O 2O26U 5C2UB 1MXGA 2DQEH 4AUJA 3C8KA 1R5WA 2XWZA 4YHMH 1B4TA 2DLIA 4U1MA 1AACA 2WQSA 1SZNA 3ESUF 4UTAL 5B4MD 3NDYE 5DHMC 5E03A 4P2RB 3QQ9C 1LK2A 3DDGA 3RWFA 1OGAE 5DHDA 2W95A 2ZYHA 3R1GL 3CN2A 1RURL 3V0DA 2Y2YA 1HIML 1IAMA 3EBHA 3KPTA 3MRNA 4K8RC 4W9FC 4Z0XB 3O6ML 3EG9B 3K8MA 3LEVL 4P46B 3P40A 4OH2A 4MBOA 4PSRA 4XWOC 5F72S 3V5KA 4GQ9L 4IBZA 4R5XA 5F3HB 2X6UA 5D1QD 3ECVA 1E90A 1LWRA 1SXZA 2B8OT 4HKZB 5KS9F 4FZEL 3BRGC 5JW4R 1MCIA 3EIFA 4C59B 4N2AA 3RIAF 2GHWB 4TQ8A 4O2FB 4I89A 5F89A 5MEND 2OR7A 4NQEB 1KCRH 1W72B 2X4PA 1KCLA 2GSMB 3LDBC 5AKTA 4ZSOA 1S4IA 3EYOA 2NY4C 1WFTA 2J1YA 4I3SL 5D7JB 1J88A 1HQRA 1NEZA 3OAZH 1AQMA 5FX3A 4F9PA 2UX7A 5I8OH 1U3HD 5AVVB 3ZIYA 5I30L 1A6VH 4TSAH 1SEBA 4XCEA 2MFNA 2JI1A 3AFLA 3CH8A 2LU3A 2P45B 2OMTA 5T1LA 3F84A 2F08A 5JIQA 2VR9A 4MQ7B 3IU3B 4NRYA 3IFOA 2X6MA 1WLHA 5HYSB 5JPNC 3LN4A 3FSOA 4GEIA 4XOAA 1LK3L 1ZV5A 3DX6B 3HFMH 4MA1B 4RAUB 3ZKND 2QKIB 2ZX8A 4YL9A 4E42A 3S7GA 1KTLB 2M1KA 2FRGP 1N5AB 5TH2A 2FNBA 3ZDXE 5DD3L 5TK4A 1CURA 4AL8H 3Q1EA 1TDQA 4RDBA 3HG1E 3MCLH 5CEYB 4FQXC 4KAQH 1JYWA 2A6IB 1E8ZA 5I24A 4OCSH 4WWKB 3NIFE 2ATKA 5JHAA 4J27A 1XZ0B 1A6UH 3CXFA 2L7EA 5GGQL 3Q13A 3QUKB 4ZUWB 4X4KA 1Z5LA 3SYQA 2EVGA 1MFAL 2ZOTA 4P4KD 3P1VA 1OAXH 5D5MF 2ZKXA 5CJQL 2GJ6B 3H9SA 4PJHE 2BSTB 3CQPA 4KO5A 2BWDA 4LCYB 4NOFA 5D7LD 1S3KL 4P2QE 5DD1L 4XWGH 1FVCB 2A83B 5E0QA 2V17L 5CBAA 5CAYB 3BQUB 2NT1A 4Y2DC 2NYZA 3QEQD