4BRVA

Superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MKSFGELIYTPDRAEGEAISKAATHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRVAFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Natural Sor Mutant
rcsb
source organism Ignicoccus hospitalis
molecule tags Oxidoreductase
molecule keywords DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION
total genus 30
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4brvA00
4BFKA 1Y07A 1VZIA 1DFXA 2JI2A 3QZBA 4BV1A 4C4BA 4BFJA 2HVBA 4C4UA 1DQKA 2AMUA 2JI3A 4BFFA 4D7PA 1DQIA 2JI1A 1VZGA 1VZHA 4BGLA 1DO6A 4BRVA 4BK8A 4BRJA
chains in the Genus database with same CATH superfamily
5CZKA 2VZUA 1TTCA 2CBQA 3BZFA 3F7QA 1HSAA 25C8L 2WQ8A 4K8RL 3GXFA 4R84A 2XRAH 2F7QA 4X5WA 3TEUA 3T4YB 4Z7IA 2R69L 1SEBB 2GJPA 3U46A 1T1WB 2C9VA 2JSFA 2A6KB 3HI1B 5C0DA 3P0VL 5L0QC 4WO4B 4P46C 2GJJA 2Q8BL 3IMWA 4OQ1A 1KLUA 4BXSV 4EKXA 1D6EA 4HGWB 4H1LA 4Y4HC 3ZL4L 4NZ8A 3E8UL 5FHBL 3V52H 4G6AC 2BNRE 3BD5A 3U0WH 3CXHK 1TIUA 5EEXA 2F54B 2CGRH 2EE6A 3QFJD 1TTRA 4IBVA 3GKWL 4XNQB 3KLHC 3FO9B 4G7QB 2WXIA 4Z0BH 2Z93B 1E65A 3VMNA 5L88H 4RAUB 1J7VR 4TM9A 4F9PA 3ZW3A 3P3SA 3D7PA 3DYPA 1Q1JL 2WTRA 3WAKA 2DWDB 3BDXA 3LXBA 2YD3A 1HILA 3MRLB 5C0AE 1UWXK 4PY7B 4QF1B 4E9YA 1KTLB 4MAZA 2Y7QA 1GPOH 4OM1L 1T03H 1NKGA 3EYVB 2FSEA 4A7GF 4GI8A 4HHWA 1WBYA 5CJBA 3U36B 4TSBL 3SGDI 1FUNA 4KDVA 5KYXA 3EH2A 5HHMD 3SE4C 1WBXB 4Y8DC 2NR6A 1IFRA 4AV4A 4BUQA 4HX1A 4K71C 2NNFA 3X2QB 1G7LB 1E5UI 1USZA 5T1JA 4FXKB 5FHBH 2IO5A 1A6PA 4E41D 1JMZA 5D4QA 2DJ4A 3FQNA 2GSIB 3HMWH 5DUMH 1GXEA 1IFHH 4DP5X 5ALCH 4EI0A 5A2CA 5I1KL 4I9WE 3U1PA 4P5TD 1U42A 3E9TA 3W9EB 1M71A 1J1XL 2ESVD 3GXUB 1B88A 4Y5XC 5DHVB 3EYOB 3HI1A 1SF5A 2VXUH 2XZZA 1PIFA 3RJOA 2VABA 3PU7A 3BAJA 3CVCA 1PIGA 2Y5TB 3C8KA 5FCUL 3LSOB 4WU5B 1SYVA 4EOWH 4R97B 5JR1L 3KM1A 3LS5L 1RULH 4MDJA 5ACZB 3IJSB 3G5VB 4P2RA 3VXUB 1LEGB 4J12A 3FFDB 1JWMB 3P9LA 4ENED 3GF8A 2R1YB 3PHAA 3F6JA 1ZS8B 1HH9B 3ZZ1A 3FRPB 2FHBA 1HI6A 2OL3H 5D1ZA 3LQZB 3ULVC 1JNNH 1OF0A 4TF4A 2X2HA 1FFPA 2BWDA 4GPVA 5KAQG 2C4XA 3ROOB 1C08B 2A73A 2WXHA 32C2A 4RGNB 2P5ED 1X7QA 2IALB 5LLIC 1E5AA 4ODVH 4ELME 2ZOKA 1SMOA 5DR5H 5AAMC 4F8OA 4LHQB 1WBXA 1WWBX 2FVNA 3VG9C 5IQNA 3UEZA 4X7SL 2Y2YA 4JE4B 5LAXB 1U8CA 2WBJC 4RGOH 5H37G 1E42A 5HDBE 5IMOB 1S9XA 2R4RH 2VR5A 1MY7A 3E1F1 3HCVB 4HUXA 1I7ZB 1KLGB 3QQDA 5E5MA 3QAQA 4NHCH 1RJZA 5IW6B 1KB5B 1B3IA 3P69A 3MBEC 1HWWA 5FDWB 4PJEF 3H9SB 3D2UD 2DW5A 3HG4A 3MBXL 3QUMA 3RGVA 1NFDE 5DK0A 5IFJB 5I1CL 3Q9PA 5LBSA 4OGZA 4U1GB 1MRFL 3CZGA 4ZFGH 1NC4A 4NC1C 5MP6L 1S7UA 2YPVL 5CJOL 3ZHKA 3NMEA 3KWUA 3W2DH 3QWRD 3L2MA 2DH3A 4PRHE 4JZJC 5KJRH 1XSIA 1EUUA 5ADOL 4FXGA 4HOMA 4GIAA 4LAQH 5DRWA 2NY2C 4CN1A 5IVNA 3GBML 1YYCA 2GYSA 2UZXB 3NP4A 1SXNA 3HBGA 4YWGH 5GZNA 5I5MA 5K9JH 3SDAC 3CFQA 3IRPX 2Y1AA 4M7KH 4LHUD 3MJ7B 2CBMA 4MJ5A 2IMNA 3LNDA 4MRCA 4V2CB 5GS0L 1H0DB 3WN5A 1V55B 2YMTA 2H1PH 5B3SB 2FSDA 3B37A 3FO1B 4A2LA 2OL3B 1DUYB 1U93B 1A7QL 3CQFA 4PV1C 2R15A 4P8QA 1X7QB 2B0SL 5C0GB 5GZOC 4AGNA 3HNSL 5EC2A 3T4AB 3K2IA 4K2UH 1I9RL 2VQTA 4L23A 3WTSA 3QH3B 4E0RB 1BOYA 2C3VB 1BAFH 2OJZL 4U1IA 4MD0B 4FJ6A 1G9MC 1W0VA 2DKMA 5IVXB 1UKTA 5C70A 5L4IA 4UTAA 3T2QA 2EACA 4ZRGA 2VE6A 1DL7L 1FFOA 5I15L 5KN5B 3HNTH 4JFQB 3ZYZA 2X40A 1EHKB 4G42B 4J3OH 1E4HA 1PY9A 4HK3J 3ABZA 3LB6D 3JV4A 4K0OA 3JYBA 2Q2EB 3NH7L 3SQBA 1YEEH 1HHIA 1KSRA 4TSCL 2X1OA 1ZLEA 2F5BL 1FNSH 2NSXA 1G1KA 3KCPB 4G1MA 2X05A 3TH3T 2UWEA 3GMQB 4ODBD 3SZKC 4AGPA 3RP1A 6FABH 3G6JE 5ECJE 3SGKC 2HWZL 3U6XA 4DN4H 2GBUA 5CCJA 2N0MA 4JBSA 1OGTB 3OJDA 5AW9B 1Y6MR 1CE6B 2CBPA 2HRPL 1MAML 3KGSA 5IF0B 3RPIA 1G84A 3ALPA 1AH1A 1AZCA 4N0UB 3NJNA 4C8XA 3W82A 4XNMB 3CDGA 3EOAB 5E99H 2JKTM 3N43B 4LLMA 4OLUH 4AEEA 5MEQA 4LCYA 3NJHA 2BXZA 1GGIL 2QKSA 4N2LA 2IGLA 3HMXH 1QFWI 3EDFA 5D1ZD 3K81A 4HALA 2QGEA 3AACA 3FN0L 4CW1B 2WBKA 5FYLH 2H9GA 4L1SA 5JXEC 3ZVVA 4PS4H 3ECWA 3IETA 3KS0H 1JK9B 1J8RA 2H7WA 4PBVC 3CK0H 4Q6IC 2P5EA 4K3DH 4MS6A 4C56B 4G1EA 2HTLC 4G8GA 3V6OC 1TU2A 3K6NA 3FJTA 1HXKA 2DQTH 4R90H 3SQOL 3ZT7A 4WQOA 5FYJH 3K0YA 3AS3A 4HX1B 1JXFA 2GFBB 2VDOL 4IMKC 4H0IA 5AW1B 4U1IB 3SD5A 1SYSB 5DTFA 3N42B 5GGVL 1H3VA 2IWGA 2PR9A 3D0LA 1L9PA 4C54A 1E7UA 4DVBA 4KXAA 4A2FA 1O7SA 3NFSL 4FA6A 3GGWB 4QOKE 5L2KB 1U3NA 1L9OA 3SBPA 4PJ9C 4PR5A 4XP4L 1M71B 4LAJH 5C7XH 2FJGB 2P8LB 3L1EA 3NEXA 5FYLE 4J3OC 1GVIA 5K1JA 4XVOA 4ETQB 4M1DH 2CXKA 2J72A 3F58L 5EZIL 2VLME 4XVUC 4JFDA 4M5ZL 4LASL 4IDJH 4QRFA 3APCA 4AGQA 1G9EA 2UVEA 4FFVC 1DJWA 1QEXA 3EO0B 3NJKA 1KB5H 4KTEH 1K5WA 4L1HA 1LEGA 4YO0A 4DAGL 1JS4A 2ATPA 5HYSB 5LGJA 3T3PB 1IL1A 1EPFA 4QTIL 4RAVB 5E4IA 1HH9A 5JHAA 1FI8C 5TK4A 5B39A 5HD8D 3BWAB 5E23A 3X1NA 3UTQB 1COBA 4JUSA 2OMYB 3WHE1 5J13B 5C3IA 5K39B 1A6UL 5EFIB 1H3PH 1HCZA 1MFVA 1PD6A 1R3KB 1AI1H 1G5AA 1NCCL 2H2PC 5D1QE 5ETUA 3SDAD 2FL5A 2PTUA 3FT3B 4UB0H 2BRRL 2GIYA 2L7UA 1JSYA 2CRMA 1NFAA 2YPVH 2IANA 3Q2CA 5CJOH 2LHAA 3K6DA 3C08L 4ABWA 4EQ3A 1RFDL 1HYSD 1AXTH 1E6OL 4HH9A 3BMVA 1WK0A 2GABA 1PZ3A 1ZPUA 1EHXA 4H7VA 4BEIA 1NBQA 3BCDA 1ZHBB 3S5YA 4YIQB 2K6YA 3GS4A 4YBQD 3BP5B 5D2LB 1YAIA 1REIA 4JM4L 2E6JA 3PHSA 5AUMA 1PX4A 3ZKMD 1IGTA 1EGJA 3LZFH 1U8KA 4JRYE 1YZZA 4NO0B 4ZUWB 1CFNA 3RNKA 2XN9B 5CCGE 4Z7WB 3S3CB 3IFOB 4DP4X 2Q10A 3PWLA 5FUOH 4ETQA 4X42A 4O02L 2BVOB 4UTBL 1KIPB 3VM7A 3G6AB 4AC4A 3L7EA 3RY6A 4H40A 4D9LL 4WUUB 4ACPA 1BYPA 2I5YH 4GG6E 2BS8A 3TZVC 1A6VH 5C6PB 3JWNE 4Z95H 4HSQA 4CVZB 5J11C 1B0GA 4H25A 1MRDL 2M8XA 4X2UA 1C5BH 4A7VA 1KENL 1EZVY 5DA4A 4XX1G 4EI5A 1OZTG 3EJYC 4TS6A 3C8HA 3MZTA 1BD2E 3BWAA 2WLYA 4AQAB 4PB9L 2YPLB 3CVHH 4DNLA 3DVFA 3X1BA 4Q4EA 5I1GH 4TLKA 3FTXA 2L4OA 3GLZA 3MQIA 2WWOA 1YNTB 4AIXA 2VLRE 3FCBA 3O8XB 2E7BA 1NAKH 3LS5H 4X9GA 4D0CA 3HW7A 4EXKA 2LFEA 2WOBA 3RNQB 4KO5A 4P3WA 3TEYA 4CDHA 3TEZA 3VJ6A 4HULB 3QNFA 4QCIA 5AZ2H 1S46A 5K93A 3MRQA 4QWWC 5CEZH 5EF2A 4PJXB 1JERA 1VGKB 4GMSH 4NKDB 4G80A 4XVJH 1F6LL 4Y1AD 1J8HA 3PL6C 2X44D 4NUPA 3O2DL 1A5FL 4YAQB 4KK8D 3WL9A 4OLUL 2FIRT 3MLTA 4IBYA 2E5EA 3LVTA 1IC0A 1VF5C 3BOVA 3NSJA 1P6AB 3DURB 1D5BA 4S1DD 5JYLA 4O9HH 2OMTB 3FCGA 3IK2A 3ETBF 3P4NB 3DPBA 5GS2D 4GSDH 4YHZH 3VD5A 2LLLA 4NQSB 4A63A 4YK4C 3T65A 2YGPA 4W93A 3VXMA 3MXWH 5C07B 1Q9WA 4J3WA 2NXZD 1P84J 2X1QA 5JXAH 1RUKL 1WZKA 4ZNEA 4KK6D 2YD8A 1ET8A 4G8EA 4DOHE 5ITFA 4RZCA 2K1MA 3RIAF 4C4BA 4Y4KB 4PW9A 3IAGC 2CCVA 4HWZB 3T8MA 1GYCA 2F58L 4H1LH 3TPUB 4TVPE 3HN3A 2VDKL 3WJJA 3CLWA 1HQRB 2FBOJ 4EI6B 1VACA 2HFFA 2K6ZA 4J3OG 4CC4C 3W5NA 2W60B 2R1WA 1NUGA 1KMGA 2CDGA 4Y19B 3UIYA 1KGCE 3P3UA 2N59A 2QPFA 4YEEA 3VE0A 3T6ZA 4C56A 2FE0A 4K94L 3VG0H 2ITCA 2VDLH 5AVTB 5F1IA 3SDAB 3STLB 3FTGA 4Y4FD 5GISL 1FBIL 3PNRB 4JY6B 1GYVA 2MPVA 4Z7OB 3BQUC 5HSFA 4ZYKA 5F7LB 4KHXH 1UZ8B 4NKDA 2D0HA 4GKZA 4Z9KB 5EU6E 4HWEH 3E6FA 1NWPA 1G9ML 5FKPA 2BOBB 2QGBA 3QZWA 1YQVL 3VDAA 1QQDB 2CBTA 5C08A 1SPDA 4TMPA 2F58H 5IOPB 4HWBH 3D0AA 4PJBA 3AQDA 3CQQA 5F3BA 1BMWA 2LU5A 5D1XD 4U3CA 2X9WA 1HESA 3ARWA 1QUNA 1QRNE 3HR5A 5FPIA 4AT6A 3FDWA 1M56B 1NEZA 4DKTA 5GJTH 4U1MA 1NCWH 3MNVA 4PVLA 3EOBB 3WIIH 5DSCA 4IK7A 1IB5A 1P84K 4XH2A 4ZAKC 4BGLA 1FZJA 3BZFB 1A14H 5I1LA 5JIQA 3L54A 3AM8C 5EBMB 3A23A 1N7MH 1EVUA 4PRAB 4DETA 1DJGA 3B7SA 1HQRA 4EI6A 1X5HA 2E7LC 4L4TD 2AK1H 2EXWC 4LNRB 3AITA 1USQA 5KTEH 3O6LH 3OKEA 4IW4C 3EADA 1QFWM 3Q5TA 1ZT7B 5I17A 4E41A 4UM9A 4QYAA 2X6MA 3A6CH 5HHOB 4E9TA 5KVEH 2Z93A 4L05A 5E94A 5D7JB 1R34A 5F89A 3ZKXC 4PP2A 3KH4A 4NJAL 1IM9A 1S9WB 1JG9A 5B3JE 4O4YH 1QWNA 3IU4H 4KZEH 3VH8G 4XO9A 3VG9B 1HE8A 4Y5YA 5LGYA 4FNTA 1RHHA 3KYKL 4H8PA 1WCBA 2HPOA 1BZ9A 5ESVB 3ZZSA 2WZ0A 1NINA 3ZDXE 2JTDA 3VDBA 4IMLB 2B15A 3DROB 3QISA 1T21A 4ZAKA 1G0DA 4JHVA 5I0YA 4B0MB 5AYUH 5JIDA 3BRDA 1QKZH 2ZONA 3IPBA 4KK9C 4AG4H 4XPTH 1VCBC 3CFBB 1S78D 3VCLB 1BBJB 3B9KD 1BPLB 1E5YA 1IBZA 4D8OA 2MIZA 1V7NL 2B1HL 4PHZA 5D5MF 4G7VL 3EOBA 4R9HA 4FZEL 3UJTL 1G7PA 2FUQA 3I3DA 5CUSL 1PDKB 3ZRCC 5C07D 4WVRA 1HL5A 4TNWK 4BSWB 1QX1A 5ICUA 5CKGA 3RL1A 2XJLA 3O41A 4YPJA 2P43B 4JDVB 4TTDC 3JTBA 4K4KA 3S37L 2BHFA 2X4SA 2UYLB 2BP0A 3I2CL 1J87A 3B2VH 5FKAB 4DO4A 3WLBA 2X4RA 4KZ0A 1EAPA 1I7TA 3UTSD 2J12B 4P2OC 2YXMA 5J1AB 4M1GH 1F11A 5CGYC 3F6IA 4I18C 2XBDA 2F08A 4ODUB 3EYQC 5JIMA 1I8KB 4J27A 2WUCL 4MXQD 2F1BA 3OAWA 2ODHA 5A2LH 1BQUA 1NMAL 5GZOA 2BSTB 1Q9LA 4ZZKA 2FB4H 3C8DA 3ZK0A 4S0HA 1FYTD 4V2BA 3MRQB 4XP1L 3EH1A 4F7PA 4N22A 5HTSA 4JANB 4CC4A 4PJCE 1ZT4B 3FRPA 1XGRA 1U2HA 3RX7A 4I0PA 2RR3A 4WWKC 4MYPA 3F7LA 3L9BA 4WTQA 3VD2A 3TZVB 4LSRH 2VDLB 1LL1A 5LN4A 3I3EA 3VXOA 2X0WA 3SDXE 1K4DA 2HKHH 2YRPA 5GIRA 2B59B 1F4WH 4KJQD 2PABA 1S8DB 2ZUTA 3SIKA 1R3JA 4AYFA 3HG3A 4GQZA 3DSNB 3CC1A 3JWOH 4PS7A 3QEUB 1E4XL 1MFBH 5E1AA 3QWOB 2BNUA 4GRLB 4WTXA 4UDUA 2XWTB 2BY0A 5H35A 4QHNB 2NLJB 2PWFA 4R4BB 4W4OC 5B4MC 5F7HA 1KBPA 2Q7YB 3OR7A 3RU8H 5JHDE 4K8RH 1XH3A 1XIWC 2GIMA 2VCOA 4FXGC 3W0WE 2F54E 5GS1B 3OZ9L 3ULVE 3S37X 4G8GD 3RVXC 1TFPA 2YK1H 4MJIE 2CDGB 3O3BB 4BZ1L 4HKBA 4F24A 4DCQA 1G6VK 4I48B 4GW1A 4PY8I 2AKRA 3DUUA 4GXVH 1A7BA 4GS7B 4LB8A 4EN3C 3KPLA 3AAZA 2AS5M 2WLLB 1XL6A 1RZIA 4P2RD 1JDCA 3LKNB 4LCCB 5C0EB 3WHXA 5LNGA 2I27N 1KJVB 3PWJB 3H2PA 1UXMA 3E1ZA 4PRNB 2L04A 3FQ2A 2B5IC 1JD7A 1SFDA 1GIGL 2YXWA 4XB8A 1JNHA 4YE4H 2YAQA 4JZNB 3FOMB 3MJ7A 5F3BB 4E41E 1Z6JT 1HU8A 4PJ5A 3KWVA 2HRPH 1L6XA 4K5OA 1NAKL 4J28A 3RY6C 4AYDC 1E9PA 1NCAH 5B8CB 4FKHA 3BGMB 5HI5D 1TJIL 4NPJA 1KY6A 4N2CA 2F5BH 2HTLD 2H2PD 3S6CA 4TQEH 3PNWB 2Y2WA 3QEUA 4GRWH 4XH2B 4GKOA 1KXTB 5BQDA 4IOSD 4H26B 1E2VA 1KYUA 2IPUK 1JFQH 2DMBA 2VE6B 1SUJA 5FM8A 4J3SA 5KVFE 2JXMB 1AXIB 4JFEE 4ZMVA 3IE9A 3R06B 4JFQA 3V55A 1FO0B 3LRSB 1AHWB 4UUJA 5LUMA 3IFLH 4JO3L 3DX2A 1BFVL 1EHAA 2IPUG 2AQQA 5KBDA 1VZGA 1VZHA 3OWRA 4O58L 4UOW1 1HHIB 4JG0H 4JQIL 3SPVA 3VRJA 2FT7A 5CM1A 1F3JB 1MFCH 5FYJE 1IBHA 1AQKH 4HKBB 3K72A 3L3KB 4XNXH 4KX7A 4ES9A 5A3IC 4N2MA 2H2SD 2DM2A 4YH6A 1W8EA 1BAWA 1FG2A 1OWRM 4JRWA 2EVIA 3CHXA 1QHQA 2KQNA 2XA3A 5DS8B 1NPJA 5EOTB 5C08E 3QDGB 4Q9CA 2V3FA 4XVTH 4L4VD 3RU8L 1TVHB 2NRDA 2XWEA 3HC4L 1V3MA 3PGCB 4PW3A 5CWSB 4PJFE 4RA3A 3CDGB 2KZWA 3KPRD 2OTWA 3HHSB 2KDGA 3V0WL 4PN6A 1JRHI 3T8XA 1RZ7L 3CMOL 4XNYL 1NANI 4JHBA 1GY2A 1WCBB 4XMUA 1JPFB 1N10A 5E2UL 1NGWB 2P8MB 2Z92A 1QBMH 1HKFA 2A9CA 3TBSB 1ET5A 3DV6A 4C56E 2YLKA 5IKCA 1OKEA 4FNSA 4S1QH 4NDMA 1DBBL 3JVGC 3ES6B 3NIDE 2Z7YA 3EJYD 1BFTA 4OSUH 4Z7VB 3RA7H 1D7FA 1Z0MA 2WLJA 1E6JL 3LXCA 4PUBL 2CLRA 1G7HB 1QOKA 2NY1B 4UT6L 3WTVA 1OB0A 2FIKA 3OGCB 3ULVL 2X1PA 3NA9L 3AS1A 4GKLA 3KXFA 4NZRH 5H8DA 3HN5A 4JM2D 5KBKA 5EOCL 1IEBB 1WWWX 2NY5L 4XN1A 5MEPB 3WLBB 1L6ZA 2FLMA 1HDMB 3A22A 5IG7A 3O6FB 3CBRA 1GMEA 3C09C 1I85C 3AMKA 5JHLA 2D9CA 2IAND 3ISWA 1TTFA 1M1SA 2AJZB 1JGVH 5KBMA 1KOAA 4P5KB 4LSPH 3K72B 1C7SA 1NMCB 5E4OA 4OIFA 3BO8B 4BK5A 4G5ZH 3FB8A 1MFAL 1HOEA 5MENB 4BJLA 1INDL 1TTGA 1J9QA 3CFEB 4Q2ZA 3VYNA 1H3GA 2ERJC 3JTSA 2EC9T 4A6YL 1TUPA 5C0DB 1XFPA 5F7AA 1P4LA 4LPWA 4AW7A 1MAKA 2X4TA 1FL3B 2OW6A 3UPRB 2W38A 4JM2A 3WELA 3C60B 3MNDA 3L17A 5LKNA 5TQ2L 3VXTA 5E56A 2ZSVB 2Z8RA 4P2AA 2GK2A 3CFCL 3BP6B 3EDKA 5AW8B 3QW9A 1QKZL 2Q2LA 3B43A 2VERN 1A21A 1MDAA 4X9YA 2FYYB 3G6JF 3P77B 3QO0B 3ETTA 3LNHA 4NSKA 3VXMD 4UQBA 3CMGA 4YUEL 5FYLL 5IFHL 2NTSP 3IEAA 2Q87A 1IQDA 4YHYB 1ROWA 3QWOA 4GRLA 4XCEB 3U30C 3WUWA 5D2LE 1TEYA 2N56A 3GSUB 4Q4IA 5TF0A 2GTZB 4UINL 4PLJC 4AE1A 2ICCA 4GO9A 1IEBA 3OC5A 3OR7B 5GQBA 1T2QL 1VERA 5MEPA 4Z95L 4IGBD 2WB1A 5GS1A 4X6DF 1ITCA 5BS0A 2XN9A 2Y1VA 2IQ9H 1UWYA 4MD5A 1MIEL 2PN5A 1MHCA 1R5WB 2YAFA 4BRVA 3V95A 1U91A 4JRYA 1CLYL 4N0UE 2APSA 2YFNA 3GPEA 4HU8A 3QHFL 5A2FA 3AU1A 2MQ3A 1KV3A 4YJZL 3W3BA 3M07A 5DFAA 1FO0H 3GMMB 1B0RB 3QEHA 2EUVA 4ATWA 3GSWB 2D3VA 3KAAA 1YMMA 4GT0A 3L9EA 3W9EA 4Z3JA 5C0BD 2OS7A 3K2MC 2IXQB 3EJZD 1IILE 3GSVB 1WITA 4RX4D 2VLLB 4WLCA 3AT0A 3MGOB 3EW3B 4LVOB 3UTSE 1BVLA 1Q1JH 3HIZA 3VXTB 2XVLA 4MJ2A 4UM9D 1AXTL 1E6OH 1NAMA 3QIWC 4JRXA 4DZ8B 4N8PA 5GJTL 5I8EA 2HB0A 4M4RA 2H0EA 4ZG1A 1CF8L 4XZ4A 5EIIG 3F7PC 5GXBB 3PWNB 3I6GB 3S35H 3T0EA 1G0XA 2EXWD 3MV8D 3WTTA 3WJMB 2WB7A 3TYFB 4C4KO 1JTOA 4JQXA 2D4FA 2A0LD 2DEWX 4N87A 5CLYA 4YDVB 5AYQA 2Q8BH 2D4DA 3TA3C 1YQVH 4QXGH 4YWGL 1SBSL 4GKSB 4KI5D 3LN5B 2LFGA 3TV3H 4D0DB 3H0TB 3P9MA 2WP3T 2R8SH 5GSVA 2EIKB 1TQTA 4NQED 1OLZA 3LRSA 2Z7UA 3ESNA 4JO1H 1HNYA 5T1KD 4OZIF 2I9LA 2V5YA 2PKDA 4OZFB 1YUKB 4HOXA 1JHLH 1FBIH 2K70A 3O0LA 3P9WB 3LEVL 4MNGB 3D52A 4Q52A 4S0TD 3ALWA 3EF4A 2EDEA 1I4FB 1IAIH 4G9FD 5KANG 2IC2A 4HJGB 4ZFGL 1AQKL 4XNXL 5LAXA 1IM9D 3S2AA 3D09A 5C07A 3CU7A 2WXMA 3FUIA 1OD9A 4JX0A 1SGKA 1N4XL 3WGVB 2EDNA 3G04B 3A24A 3HNVL 4RESB 3FU5A 4J4PC 3S8FB 1J18A 1TZHA 3IMSA 4KHTL 1E2WA 2CK0L 2QPDB 4HWZA 4FFWC 1JGIA 4RMSA 1LO3L 3TEXA 4ZAKD 3NZHH 4L4TB 5J4MA 5KVGH 1BW8A 3NT0A 4TL4A 1F2QA 4TQEL 4R4NC 3TBSA 3QWNA 2EXTA 5JHLL 3CDCA 3LRLA 4J1UA 1W0WB 4OJFH 5I1EH 4L9DA 4LMQI 3INUL 3IBOA 5DZAA 5B3NA 1XV8A 3M17A 4UQDA 4M4RB 2Y7SA 2CJSA 3BVXA 3OSVA 4PRID 1J88A 1MJUL 1P7BA 2X89D 1QW8A 5HI4C 3FU8A 2AF2A 3LEXA 5TE6L 5JW4N 4OUOA 4R0LB 1TG8A 5I30H 4MYWB 2WKLA 1P7HL 1RUPH 4PHXA 5AVQB 1NIEA 3OR6B 5A40E 4MZRA 5I1IH 3VD9A 1WCQA 5F44A 3WO4B 3ARFB 3CZLA 4R7LA 2XSKA 1RH8A 5DQ9B 1JWUB 1FV1A 2ZXAA 4ODTL 4GUOA 5FGBC 2CKBL 3WJJC 2ZKWA 1A6AA 3CFTA 5CEYB 4MNGA 3NACL 2CJTA 3CFCH 4EVNA 1Z9SA 4NUGH 1FVDB 1F3RB 5DVLA 3ARBC 1E8XA 3PP4L 1EJFA 3IDGB 3SGJA 1WAAA 4Q2ZB 3KLKA 2QSCH 5I1LB 5LHDA 2ZXQA 1KENH 43CAA 1EFXD 1KXVC 1KPRA 3DHMA 4FMVA 2JELL 4G70B 1N64L 4Z0XB 2J8UB 3LNIA 5D7IE 5B7FA 4U7SA 1IC4H 4IDLA 1AQDA 4NERA 5T33H 1LE5B 3SQBB 1X5YA 3OKOA 3TGXA 2VERA 4D0BA 2Z31A 2IAAC 1IGYA 3A21A 3QAZB 3R7RA 3BSHA 1J5DA 5CILH 1KXVA 3Q2NA 3TA4D 3UX9B 3EBIA 4NQDE 5D7KD 3O8XD 5BO1L 1KACB 1CFVL 4CU7A 5CSZB 1FZKA 2VQUA 3LZFL 3EYQD 3MRGB 2QZ5A 1MPAL 3BESR 4M6NL 3TIEB 1DQKA 1E50A 4C59B 3VSUA 2LU4A 3L13A 2H0FA 5HY9A 1OL0A 1WAEA 5LCVL 4EF3A 1X5IA 4PRHA 2PO6C 4V11A 3TZVD 3F8UB 4LT7A 4ESKA 1SVZA 5FLVA 3GIZL 5T1KA 1PBYA 2MJWA 2HRHA 1M6OB 4Y16D 5EB9A 5JQHC 3P4OB 1TQCB 3GS0A 1CLZL 3BFQG 3KNBB 5E9DD 4NC1E 5D7EA 3KDMA 2ZWSA 2ESVE 3GXDA 1RK7A 1Y18B 2J2ZA 1KULA 3FQWB 4MQTB 5I9QC 4NCC2 3AVEA 4XB3A 3AC0A 4N0CD 5FCSH 4AMKH 4NEHB 3QI9A 4ODXB 4XXCC 3P0VH 4BCZA 1UEYA 5HVHB 1RZ7H 4XNYH 4DKDC 4XWGH 4F27A 2R56H 4NUMA 3Q43A 2EYSA 4N2EA 4JUTA 1MAJA 3QR2A 1EFXA 3KM2A 1KN4L 3G7TA 4YDLB 1FFRA 5EU4A 1CTMA 2FQFA 4PJ5D 1SOKA 2J55A 2C9PA 2LLNA 4GINA 5J1AA 2WGNB 4EMZA 1HL9A 3N40P 2BW4A 4PGZA 1UOLA 1NEZG 2PCPB 3HPLA 3VFOA 4Z3FA 2Q7AA 2QQKL 3BWSA 2ROXA 3FU9A 5JIHA 2OW7A 3FQTA 3GBNH 5I1JH 5SX5K 3HE7A 3VFWB 3VDCA 3ZQ9A 3HAEB 4OCSL 5I23A 1YN7B 4M7JL 3E6HA 1L7IH 3L45A 2QHRL 4GG8A 5TH2A 6CGTA 5JLZB 1G1YA 2BVUA 2YN3A 1NCHA 4LOUC 2FGZA 1EZLA 2VOTA 3IJEB 1YEKH 2NY0C 1ZT1A 4JPKH 2IPKB 5HDBF 1X4ZA 5C09A 3EYVA 2AZAA 4M48L 3ZMRA 1JD9A 4G6KL 2VSMB 4PVNA 3EBGA 3HOGA 4WI7A 3T0AA 4HIXL 1ED3A 3TA3A 4BFIA 3HFFA 3HN8A 5C0ND 2APTA 2DICA 1CI5A 4HCRA 2RQEA 3IDMA 4XGZB 4WI9A 1RZGB 4TOYL 2LGNA 3MLRL 4YFEA 3H85A 3CNKA 3KPPB 1HFUA 3MRRA 1KYDA 1RJYA 4QF1A 1AZRA 4KKLD 5C3TA 1AE6L 4NIKB 1E40A 2GSMB 2HJLB 4I89A 4LLAA 2ZX6A 3FSWA 5DC0A 1BECA 1FRGL 1MFEL 3VWJD 1M9SA 1UXLA 4NO0A 4ZUWA 4ZQKB 3RNKB 1IFHL 4WO4D 5JTWA 4YDKL 1CI3M 4WTWA 1P4BL 2WVTA 4M8UA 2LQRA 4NKQB 5IJVA 1OW0A 1PEWA 3SDDA 5LNEA 5CFHA 3KPOA 4MSWA 5I19H 4IKNA 1TTBA 5HGHA 5T1LB 1WGOA 3MR9B 1X9LA 4EKJA 2OLDA 3EO9H 3DX6B 4FQ1H 3FQTB 3FQNB 1QPPA 3MRNA 2IOIA 1AGCA 1XR9A 1OWWA 1RIUL 3C5JA 2WLLA 2WWKT 1AMXA 4X8GA 1JBJA 1FWXA 1GRWA 4M61B 4R0LA 3VTMA 4RQQA 3AQYA 3ZR5A 5LCVH 1MFDH 1TO4A 2VLJE 5BCAA 1JN6A 3M7FB 3FTWA 4PCKA 5EF0A 4AL8L 2WINA 3MUY1 3WE6B 1FFPB 2CHDA 3QNYA 4B9KC 5KW9H 4NAJA 4ILDA 4M6NH 1KWGA 3DX9A 1CJYA 3V10A 1IGCH 1K8DB 3FUHA 3GSOB 1O7DE 3ZTNL 1E28B 2GK0B 2XLLA 2WM0A 2YOCA 3GSQB 3L7FA 4Y5YC 3IJSA 2WLNA 3RFRA 2P5WE 1CK0H 4HIQA 1EXGA 3D4YA 4UOQA 1J5OL 2I26N 4OLZH 5SWZA 4U1KB 3WS6A 1EAJA 3QFGA 4KOCA 4M7KL 1VGEH 4BSVB 4ODHL 3C9NA 3C2AL 4NGHL 4NZTL 4D8PB 3OKYA 1U8IB 4XVSH 5DFVD 1EO8L 5CEXA 2K7PA 1SHXA 2V5SA 2YA1A 4EXPX 5E6UB 4KY1H 2ADIA 1L9RA 1OCCB 4JM2C 3W2DL 2XZAH 4WHYG 4Z7UB 5KJ4A 4B6ZA 3GBLA 4P2QB 3L95B 5CJQH 3SD2A 5DD3L 4I3SL 3VXRB 5J8OA 4F7KA 4ABQA 3LNGA 3PWVA 2LVEA 3V0GA 1IEHA 5EN3A 3KPMA 5T1LD 1CG9A 1IRAY 5ABDE 3K8MA 4M1GL 5BZDB 1Y1UA 3DPDA 2H0JA 3CZJA 3GM8A 1D9KD 1MI5B 1FC2D 1WE5A 5E5MB 3ROLB 4JS7A 1MHPH 3V6FA 3IMUA 1DJZA 3UTOA 5E6SB 1M57B 5DT1L 5EF3A 3PXJA 4Z7WE 1BD2A 3O2WL 4K5PA 3SYQA 5K9KB 1JRHH 4FX5A 1G9NL 3I9GL 1YN6A 3RRQA 4QAMB 3U2IA 4OLXL 2EKSB 2EEFA 4C4UA 3CIAA 2OL3A 2V37A 5FX3A 1CGWA 2YRZA 1GKOA 3HVNA 1S7UB 3SDAA 2XI9A 3RWHB 3JWDH 4FYSA 3LZOA 4FQJH 4KO9A 5GGQL 3ESOA 4RMTA 1FORH 2XIIA 2DLFL 3VAEA 1QSEB 3FQWA 2QADD 1A7NL 3OKNA 4KJPC 5BRZA 2VSCA 3GD1C 3BLPX 4HZLA 4I1RA 3O0RL 2ZKYA 5B1KA 3HFML 3ML8A 4MNQB 1Q94B 3LQMA 1NANH 5B1BB 3AROA 4HCRH 4ZFQA 2CNZA 4FD0A 1GZHA 1PJWA 2VLRB 1NH6A 5FYJU 3MLYH 1ZK5A 3G9VA 5LGKA 4CVXB 1ZS2A 4QNPE 2JI1A 2UY6B 5C0GA 1OAZL 1ORQA 4QRTB 3WO3B 1TQBC 2GCYB 3K6IA 2QKIA 1DBAL 1MI5E 2Y69B 3MBEA 1FVCB 4WJ5A 1TQVA 3HJEA 3U1QA 2XZCH 2PYEB 2YQBA 3D4ZA 2AJZA 2FEJA 3TM6A 3U1SH 4GXUN 1J8HD 3LRGA 4XMLH 3C2SA 3VFNB 2OZ4L 2JI2A 2J1KA 3JYCA 1KN4H 3ROLA 5HHVL 5D1QA 3TU6A 3WJLA 5IR1B 3IMBA 2VR3A 1V05A 2BW5A 2WVVA 5B3JF 1ZSDB 4ZJ9A 3OPZH 3RTQD 3LH9A 3IN0A 4WWPA 4DIXA 5SX4H 2MRYA 4U3SA 1LP9E 1LP9F 4JN1L 5HVWA 4XBEL 2OMBA 2P8PA 4LNRA 4W4NA 1YN6B 1A7RH 4ZTPL 3NK4A 3SKNA 1G4RA 2ZCHH 2YD1A 1LO2H 4NPKA 4NENA 4OLWH 2LAGB 4X9FA 1XGPB 5E2WH 5ECGA 4AV5A 4B53A 3BRGC 3EJZC 3MJ6A 1HL8A 4HIHB 4HBCH 4DZBB 1I3RB 3V6BR 3JWOC 2GJ6E 1RUML 1G7JB 3L81A 1S7SB 2I9TA 4ZUTB 1CD1B 3AGVA 4JFDE 4PJIE 3IDIA 1EJOL 1PTZA 1BF5A 4AEIH 3ZT6A 1A7RL 3IFPB 3AW5A 4ONGH 1B9KA 1DQMH 1EH9A 3RX8A 4XOCA 4PLOB 3HS0C 2RGSA 3Q1EA 4FHBD 1NDTA 4K8RC 3TN0B 4KQ4L 4E2OA 5HHPA 3CUPB 1OAXL 3BUYA 5IESH 1NIFA 3BZEB 3QDMA 5C71A 2I60H 1UB6B 5E6ZA 1W15A 5C3LD 1G87A 3TFKC 2MCPH 4CBZA 3GJFA 4W9ZA 2UY6A 4NQCE 3AJ7A 1QZNA 3SDDB 1KFAH 3CLEL 1JZDC 3NG5A 2EEDA 4L8BA 1OP3K 3Q8FA 4IDJL 4YNYB 4MJ4A 4PJ7F 3VRIA 3MR9A 1HEJC 3SO3B 4A6YB 4F3FA 2P5EE 1JNLH 1YEHH 2HG5A 1AKJA 3C5JB 4OLVH 3WDIA 1P1VA 4WI4A 4G43A 1T0NA 4HUUB 5T5FL 5AAWC 2ZYIA 2FX7H 3BEWB 3T0EE 3U46B 1XCWA 2F5AH 4P0DA 1T5XA 1BJMA 1LXMA 3OL2A 2DEYX 1NLBL 1AY1H 2AXJA 2ZXBA 1O0VA 3WE6A 4WUUE 1AYRA 2HP4A 3US1A 3MRCB 3ULAB 5F9JA 2CRYA 1S9YB 3ZX1A 5CJXA 3DRQB 2E76C 4ZDHA 6PAZA 4JFDB 2X53A 1X9UA 1ICTA 1GYAA 2MOGA 3CC5A 4P5RA 2BJMH 4PI2A 1AC6A 2JH2A 1XSKA 4L3AA 4K7FB 2OMXA 4MMXA 2GHZA 1M7XA 4M8QB 3BD4A 2KPWA 1T0MA 3WFBH 1IT9L 1YMME 3OQ3B 4X4ME 1CD1A 5E8DL 3A3YB 3EJPA 1FGVH 1ZT4A 5I1IL 3CX2A 3TYFA 4W9GC 2Q9OA 5T3XD 4YHNB 1HINH 2QADC 2VN7A 4Z8FH 2F7OA 3L5HA 1HHKA 2V7NB 12E8L 3DX7A 3DDGA 4X6CA 1U8KB 1AFVH 2ZUUA 1E67A 3EUUA 3EJJX 4LO9A 2OBGA 4NWTL 4BFNA 4Z7UA 5I16A 4PJEA 3ZRFC 1R17A 1MCWW 1U8PB 4UOW0 2JIXA 4HH9B 4GEIA 2DYPD 2BVQB 4U1HB 2Z35B 3QXDA 4JHWL 4X0NA 4PJ8D 3RY4A 3VRIB 4PREB 4PJ9D 5BZDA 2YSTA 2XPZA 1DBML 1H8OA 4FNRA 4P49A 4P3DA 4B9FA 2CHWA 2KC0A 1F8TH 1TJGL 2BNQB 2ZCKH 4JPIA 4FHKA 3VQLA 1IAKB 2VJXA 5AG9A 4WO4C 3AU0A 2OJ1A 5DFWH 1ZE3H 2QKIC 4XTRD 3NK3A 4GAAA 4KH9A 4OLVL 5LNDA 1XVSA 1S7TB 3VACA 5K9KA 2J5LB 4BUHA 1I9JH 3V6ZA 3NSCA 4FG4A 1BIIB 3MO1A 4JFFB 3GXIA 1X9RA 4LLVA 4A7TA 4HKXA 4DOHB 5B1AB 5HYJD 4NUJA 1OQOA 4YXLH 3THMH 3QFJB 1AC0A 3GUFA 2AKRB 3RE0A 1K5NA 4ONHB 5FUOL 1T1XA 3BKJH 3MV7A 2YR3A 4MS8C 1E4JA 3FQXA 3S4SG 1QW9A 1OAUL 4R2GC 4ZPVB 5E9DA 1ONQB 4AH2A 3O6KL 3CN3A 3AWEA 1OAXH 1KJVA 4MCZA 4HUMB 5IBUG 3NJGA 5CJ5A 1CGSL 4WGVB 3H42L 1DR9A 1AIZA 3IXTA 5ESQA 2ZP9A 4Y9BA 1M2VA 1LE9B 1TQSA 3FT2A 1E0OB 5HGAA 3U4EA 5EULV 5B21A 1TSHA 1WF5A 1UD8A 2AANA 2V7NA 4V1DB 2A73B 3OAYH 4NM4H 2DQGL 3BRFA 2O6CA 2XQBL 4FQCH 1CZ8H 4AXWA 4IKJA 3DARA 2ADGA 4OJYA 3RNQA 3FAWA 4H13C 4Q9RL 5EIIA 1ZLVH 4IJ3B 4HC1H 1B4RA 1FVEB 5F6IC 1RIHH 2F1AA 2NTFB 2HLFD 4I2XB 2QPSA 2VDKB 1MCQA 4MASA 2EE3A 4LLUA 4P3DB 3IFLL 4QMEA 4QHMB 4OFVA 2P42B 4ZX4A 1IAKA 1KB5A 4K3JH 4AGMA 1PZCA 3SGKA 1XB8A 5HPMA 4FQIH 3U79A 2VO8A 3DYMA 1R4XA 2BXYA 4B5ZA 1VADA 5C86A 1SJEA 1UWGH 2XPGA 1TMCB 3OMAB 5TDNA 2EDXA 5IHLB 3T6WA 5BZXA 2YD2A 1CIDA 1WFUA 1NC4B 4UYQA 4Y2DB 1GMIA 1PZDA 4HIXH 2N7AA 4OI9A 5KYUA 2YZ8A 3BAXA 1U3ZA 2YMXH 3O81A 2FT6A 2YJQA 4YE0A 3WFCL 1I3RA 1BOGB 3N9GH 2WC7A 5EN2B 1MCBA 3ASNB 3O6FC 4IGBC 2ZUQC 1T1ZA 1DBKL 4FF9A 4QR7A 1IU1A 2IIJA 5JW3H 3SDCD 2BIPA 4ZO8A 2Q8AH 3LKRA 3UJJH 5DHVH 5CN3A 5I0XA 4GKZB 1H3TA 1JXDA 2WCGA 1PNCA 1TZGL 2UZXA 5JO5B 5EU5B 4HOZA 2PP7A 1EEYA 5FUZL 4PRPE 4AQOA 3DO7B 2VR9A 1RSFA 1NGWA 3FN9A 4CVWA 5IQOA 4EZLA 1B2WH 4JPQA 2YD0A 3BSGA 3RILA 5ILTH 2GTWA 4RGND 2FCBA 2XBZA 4Y19A 5LGHH 2DAVA 7FABL 1OPGH 3EFDH 4LK4A 4OF8A 5C2BH 3VE0B 3MRPB 1P53A 2Y1YA 1JGLL 4ZFZB 2AAAA 2NNXA 4M7ZB 4JDEA 1T5KA 3GHEH 4Z7VA 1JJUA 3P4OA 5CD5D 4F80A 3LHPH 5D5MB 1U4FA 4MD0A 4URTB 1FE8L 2J8UE 1MCIA 5DYOA 4C57C 2HUHA 4I3RH 1QNZL 4L1DA 5FGCB 1WT5C 5M95B 3ABKB 4UV7H 2EYSB 1FPTH 4RLDA 5JDSB 5KSAC 1A3LH 1KB9J 2R56L 3PWPE 4OTXH 4R83A 3QT2A 1JPST 2YOAA 2ESVB 4R7NB 5C0AA 2V33A 1J0HA 1XQ4A 3WG7B 5JORA 2IH1B 4MVBC 4ODSL 5D6DC 1O7DC 1YY8B 4XT1C 3TA3D 1BREA 4LLQA 4DN4L 4H20L 1IM3A 5CLZA 2H45A 3LKPB 1OGAA 4P5KA 5CCKH 3HPLB 4FI8A 5HI3C 4KY1L 1SDDB 2W0LA 4TULH 5G4MA 4YBLB 1T0MB 1KJMB 2AQ3A 2WYTA 4YHOL 1I3UA 4JEGB 2BNRA 3W81A 2DJSA 2H3NB 4FQIL 3SQRA 3VD4A 3KW7A 3JTSB 4AQEB 4JFUA 2R1YA 1I3VA 2PPAA 3B7UX 4NOFA 3VA2C 1G1CA 3DGGA 2DQJH 4FGMA 3V9FA 4XPGH 4E36A 2ZWZA 4PRAA 3MLSH 1LO0H 3BVNB 1IGMH 1C1EL 2O5ZH 4XNUL 2VXQL 1KBGH 1DQML 4LCVA 1NCIA 5I76A 1LQBC 3ARED 2WAQA 3H7BA 4BKLB 3LQAL 3S98A 2X2YA 2JLLA 4N1CA 1WFNA 3OKEB 1DTUA 4JFXB 2EZ0D 4OSUL 5HHQB 3L9RA 1X4YA 4N20A 2DJMA 5I17B 3MFFB 3KBHE 3SE9L 4UTAH 5F1OB 5KG9B 1TKWA 2DL9A 1GGYA 3T0ED 1QRND 4Y7OC 1GZQA 2JIXB 2AJUL 3OX8A 2ZX8A 1Q0EA 2GFBA 3BP4B 1WC7A 5HGBA 1UC6A 3IDMB 4OFQA 4AL8H 1RZGA 3QEGH 4HZ1A 4G8FA 1H5BC 1XH0A 5JIIA 3UTTD 1WEJH 1RERA 1A9BB 5DI8A 3CVBA 4JL1A 4F33A 4NXKA 1KXQE 3T2OA 1CGSH 2JJUA 2VR7A 1WWCA 3DI3B 3BUIA 2EIDA 3NRFA 4YC2B 5FWRA 5IEKA 2X6UA 2NYYD 5FF6A 2X4RB 2ZOLB 4BFBD 2FBRA 3BQUA 4AVHA 4R7NA 4ZO7A 2F19L 5C0AB 4LPUA 1U41A 2OXHB 1K6QH 3SDXA 3NJMA 2J5LC 1Z7JA 1BBJA 3JUYA 1U8JB 1I8KA 3V4UL 3ERXA 1JK8B 2F54D 3VB8A 4ONHA 4AG4L 4J23A 1J8KA 1IQWH 1Q9LB 4M62L 2QBWA 3WS3B 1YDPB 1JHTB 1OAZH 1DQQB 1Z9LA 4H88L 5EUOF 4FXGB 3HR6A 5INCA 1HN1A 3BN3B 1SHMA 3B2UC 2ZJSL 4HIIA 4QRQA 4APQC 4WW2C 5J12C 2ATPB 5HYSA 5DUJA 1VHPA 4YZWA 3DX8B 3Q6GL 4BA8A 4XPHH 2Z9TA 1JWSB 2CO7A 5IB2A 4LBEA 4LSQL 1NFIA 1I7TB 2VLLA 4FHJA 3ARVA 1CGYA 3MGOA 1QFWH 1RIVL 1YYLH 1B3JA 3P54A 4PBWD 3E7JA 2YSSA 3T04D 3V5DB 3HBZA 5FK9B 4PJHB 1WUZA 2H8PA 2AERT 1MJUH 3ULUC 4HWBA 1VAHA 4HDIB 4EO5A 2CLVB 3MAWA 4NWTH 4TVPD 2VZSA 3MRDA 4F7MA 3X3FH 1UFUA 2NY1D 4PCSA 3ZMNA 5D6CA 1OGPA 3DSNA 2IGTA 4BE5A 5F70A 4N0RA 1EEQA 1S7VB 1M53A 3H0TA 3P9MB 4B9ZA 5CR1A 2R39A 4OR1A 2F7PA 4EUPG 5BXFA 5DMIH 4MJ6A 2AXFB 2OZNA 5E9NA 3TO4B 4P5TB 2BZCA 2JJSC 4JG9A 3TPKA 3WU1A 5DJYB 2V7HB 2AMUA 1IGTB 2AQNA 4M00A 2C4FT 3ARDA 5CMAB 4GXVL 4GI9A 2UX6A 2HJKA 3BT0A 5F7FA 3T6XA 4PJIB 2CAKA 3NAAL 3SKUD 5CGMA 2EILB 2FATL 3H3PL 4MVBD 3K6SA 1PPIA 5F7UA 3TESA 2OP4H 1BM7A 5JIPA 1OGTA 5TQ0L 1JHLL 3AAZB 3X1FA 4OGYH 1RZKC 3IGAA 4G72B 3S8GB 3VXUD 1F1DA 2VC2H 5IW1B 2MNUA 2AQSA 2B9AA 35C8L 4GXFA 4PP1D 4JLRB 1MXGA 3H3BC 4L4TA 3QK0A 3VXQB 3AT8A 4G7YH 4ZTOH 1IBDA 2R29L 3HI5H 4ZX6A 1M7DA 2ZPKL 3AABA 1ZSHA 3PLYA 1AG6A 5JW5A 2Y3AA 4YSRA 1W0WA 3GMRB 1Z66A 3FB6B 4HAFA 1U8QB 2A74A 3KYAA 4OVVA 5GGUB 2J25A 3IGLA 4PWHA 3T1FA 1BZDA 3G5YB 3LS4H 1ZV2A 3GXPA 4DHLA 3ARQA 1AGFB 2W07A 1UB5A 1CVRA 5A2KH 3ZMEA 1P7QB 1LTXA 1F42A 5BRZB 4DVBB 2VN5A 4CC1A 4MB5A 4LEOA 1C1EH 1A4JA 1P7KA 4O5LH 4ZMXA 4BCXA 3MCLL 4I77L 3FOMA 1UA6H 2VW7A 3TIDA 3H9SD 5ICZB 3AG1B 3QRGL 1WA1X 5DQ9A 1WS7A 2V7HA 1PFCA 3RZCA 3OXSA 2IH1A 1RPUA 4KX9A 2X2UA 1URZA 3D07A 1QTSA 5DJ2A 4OF0A 5CILL 1HOCB 1R47A 5C7ZA 1WAPA 1HQ4A 1VLXA 3P4NA 3K8KA 5IVZB 4YHZL 4KVPA 4MA3A 1FVDA 1T2XA 5CCKL 3O4OB 4QRRA 3QUZB 2CMRH 4LSVH 1MIEH 2XY1A 1F1GA 2FO4A 2VXVH 3GSRA 3RWCB 1DLFH 3JWNC 2BLFA 4ENZA 2QPUA 5HDQH 5I2IA 4OFIA 3I6KB 1KCSH 4Z7NF 1UJ3B 1ZD6A 3I6LD 43CAB 5EDSA 4GIOA 4RMWA 4MWFA 5HJ3A 1YPZE 2X38A 3FF7A 3MODH 4UMSA 1DVFD 2ED6A 3DGGB 3QDMD 3FYIB 4JLRA 4FADA 5B39B 4RSYA 1JV2B 2GW5A 3AB0C 2DWSA 3ILQD 1EJ6A 2D2CC 2G9KA 4JFEB 5TQ0H 5B38G 2EDDA 4GMSL 1MW1A 5F96H 4BWTA 5DRXB 4ONFH 1O5PA 4DEWA 2FL5B 3ECVA 4LOEA 5JHMA 3PV7A 4GEJA 4JRXD 4LPVA 5LQBL 3EXLA 1EZUA 3MCKB 3D6GA 2WJ5A 5AYUL 2ISDA 1DZBA 1GGUA 3K5SA 5EOTA 2O5XH 5LJYH 3S34L 5FO7B 1NUDA 1SHWA 2O61B 3G08A 2P4AB 1A02N 3ATDA 4PJ9A 5ILTL 3GBDA 3IVKB 3ZSSA 2A9DA 4KKBD 2CZNA 2BOBA 3QZWB 1P7KB 3VXME 1C5BL 3IDJB 1MWAA 2ARWA 4JKPH 1FHGA 3R8BB 2VMCA 4X6FA 3BQUB 5F93C 3U4BL 3HG1E 3KJ6L 3O9WB 4MQ7B 1MEXL 5IFAL 3FKUS 3FMGH 3P0YH 4DPBX 2AEPL 5ANMA 1YC8A 3PAVA 4LFHD 5HDRA 1BCIA 4U1MB 4QLWA 2FJHB 1JPSH 4O2FA 2CGYA 4PRIA 3QI9B 4ODXA 5CJ8A 2BNQD 1RUQH 3PWUB 3ZIMA 4QRQB 1CD8A 3ZL1A 3KPSD 3SDYH 3WI9A 4MBOA 4ADIA 1TEGA 2CO7B 5C0RH 5I6MA 1CDCA 3C09B 1I8MB 2PTTA 1Z9NA 1BWMA 3IMTA 3JT0A 4ZI8A 3ARRA 4MAUL 4XN9A 3WMPA 4KKQA 5AVYB 3WEXA 1FLRH 4PJFF 4KKAC 4TV3A 4AC2A 4OZGA 3WY4A 1QI3A 3I50L 2OMXB 2BRRH 1GZPB 4AEFA 1MUJB 5F9WC 1YN7A 5JPMA 1SN5A 4NSKB 4N9OB 2NCEA 4E42A 1Z3GH 2EYRA 2MH4A 5FIEA 5BVJA 1P7QD 2Y0SA 1V10A 4YPGA 5FGRA 4OGAC 3A4AA 3NJFA 1FNGB 4WFHD 4KK5D 5FYKH 4AIOA 3ZY7A 3ULUE 3T0WA 3ZJAA 5J1TC 2G2RA 1EEUA 1U3HC 4FC3E 4UILL 4ZOAA 4FFZL 2J6EL 2XN2A 3S35L 1IVLA 3DX7B 3GI8L 4IBQA 4PV8A 2LAAA 4U33A 3W9DA 3NZUA 3V4VA 4OJAA 1IIIA 4L29A 2ED8A 3ZTNH 3DPBB 2WJ7A 4KTDL 3VI4A 1S7XB 3RDTA 4S2SB 3GUTA 1JHKH 4PTUB 3O4LD 2Z1KA 3LZLA 3PAUA 3GHBL 4JY4B 1MJJB 3EFOA 3BGAA 2Z91A 4IOSA 2FEDC 4BDVA 4HUVA 3BVVA 4TNGA 4FNLL 2F68X 2LW3A 2IH3B 1V27A 3Q8EA 3MLSL 1DUZB 4L9LB 2NYZA 4WJG3 5INDA 4TVPL 4FFYA 5FECB 4WGWB 1BZEA 3TPUA 7PCYA 5FKAA 1QFPA 4B9PA 4GUCA 3DTXA 2XG4A 5F1SA 1NGXA 2OTUB 4XP9L 1C5DA 3VFGH 4JHWH 5DQDH 3SN6N 1D6VH 4JRYB 3HZVA 4Q14A 3ZDWA 3GSNB 2F6AA 4JFOB 4O9HL 1YSOA 4QGTA 3UZQB 1WFJA 4EDXA 4ODTH 2GAZB 4UT9L 3L3OC 4XO4A 5D96C 1JV5B 5C9JA 3LIZL 3T4YA 4U6VL 3NABL 5E6YA 1IE4A 3LEYL 4MXWH 4XCNA 5EBLA 1FCCA 5ID1A 4K55A 1T7ZA 3JVGA 1A5FH 1HHGA 4H0GA 3GSVA 3LTVA 3I6LE 3JWNH 2XXCB 5AW7B 5IFHH 3CN0A 3A6BH 5E8DH 2IVFC 4UT9H 1MCRA 1R24A 1U33A 2E3VA 3T3PF 1CBVH 4X4XA 5KOMC 3P73A 2J88H 1DSFH 3O9WD 3RWDA 2B59A 5EEZA 4UDTB 3UPAA 2DQUL 3TJHC 4X7TB 2P24A 4XP6H 4E9VA 2QL1A 3CPLB 2BSRB 1F4HA 4MJHA 1B4JL 3VFVA 1TZIB 3D51A 1JZ3A 2WNKA 2Z64C 2ZWLT 1AS6A 2EIEA 4X4ZA 4GFTB 5EWIL 2VN3A 1WP6A 2KQMA 2CCLA 3GRWA 4UU9B 4X98A 5ERWA 3VXNB 1TZHB 1LD9B 2VW6A 5C6TH 1NJ9A 5I0WA 1T4KA 3KPSB 4P23C 4PJ6A 3QUXD 4B9YA 3DK0A 5IEHB 5JW3L 1Z9PA 1DBKH 3HZYB 1XHHA 4UF7C 3LN4A 2EYTA 3M7OA 5ALBH 1JHKL 4Q9QL 1IO4C 4MMZA 4OAWA 2ZCLL 4AKPA 4MKMA 5KVDE 4AYSA 4UTBH 3OMZA 3VFMA 3K71B 3MMEB 2NW3A 5TJWK 4Y5VC 2G75B 3L5XH 5HHOA 4H44C 2QJDA 4JFOA 4IRJB 3MV7E 2KBGA 3FO2B 3BIKA 4KKAD 2AEIT 2I60L 2OQJB 2WKOF 3LV3A 5F9AC 2FZ3A 1G6RB 2G9HB 4FLQA 5I26A 3FRPG 5MENE 1UD2A 2O61A 5TK2A 4NZRL 3S9DB 3MROA 4RFEB 2KMWA 2ICWB 1HHGB 4J39A 5EU5A 3FQRA 1R5VB 1F90L 3NCCB 1I7UB 3KHQA 2YMOA 2B1AH 2GTWB 2IADA 2MSPA 2V5RA 4PJ7E 4QXUL 3N41F 4BGDA 3C8KB 2PO6B 2VJ0A 4OGXL 1SYVB 1A66A 2DMKA 3R0MA 4AJWA 4WHTB 1SY6L 4W9JC 5DD5H 1T3FB 3E9UA 1DZ0A 1LDPL 4TL5A 2LTQB 5EPMB 1WS8A 4M9OA 2VLJB 1R19A 1Q0YL 2G5UA 2O26U 4NC2B 1EQWA 5AL0A 1L0PA 1PKQB 2WQVA 1HX0A 3N85L 4GSQA 1HKLL 1U58B 1B90A 2WNWA 3NN8B 3CSBA 4IIZA 1MCHA 2ADJB 1GTNA 1GJWA 2GKIA 1RHFA 1FO0A 5IB1A 2BSDA 4DK3A 3GI9H 5LXGL 2JKNA 4MA1B 4XN4A 5JORB 4X6EB 4FQPA 1A6AB 3DX1A 3QUKB 1GW6A 3U1SL 3BDBA 5CF3A 3SPVB 3AXLB 2DTMH 4LLQB 4NP9A 4APXB 4G7RB 1EK3A 1X4XA 4X7DC 3SBRA 4IJTA 4E5XA 1U8CB 4UQAA 2JKSA 2BHYA 1WPCA 1T6WA 1J11A 1JXKA 2CU9A 1D5IH 1Z2KA 3TYGH 5J6HB 3KLAA 1FYTB 3U4BH 4KRMB 3H2WA 3RDTC 3RVTD 3ZTJH 1DEEB 1L9NA 3HG1D 2QGDA 3P0GB 5CP3A 5FDWA 2O5NA 2WWMD 1EX0A 1KJ2A 1Z1WA 4NRXA 4UIMA 2V0AA 4UINH 4ZMZA 4N2AA 3PF2A 2ZX7A 3PUCA 2DMGA 3L3JA 3VFUA 4DKEH 4LP5A 3K2UL 1OTSC 4W1TA 3QORD 2NUPB 4NJ9H 1HWGB 3V0FA 1P69B 4LQFH 3OM3B 4I0PC 4V1DD 3GLDA 3N1MC 3HRZA 4LFHG 1NFDA 3BPNC 1K4CB 1EO7A 4EOWL 1TKWB 2PYFA 1QFUH 2PW1B 1AFVL 3VI4B 4FKKA 4MNHA 4S2SA 3GUTB 2AITA 1N2RB 3JWDC 4AGOA 1F4AA 2I7OA 2AK1L 4Z8FL 5DLML 3MRFB 4MMYA 3GTNA 2WWNA 4Y2DC 5HY9B 3QNZB 1BGXH 2VZ3A 4RIRA 5B1CA 3GSXA 2VW4A 2WLMA 4L5FH 4OV5A 1B4LA 5ALCL 5I1KH 4IBSA 1QLEH 4G2AA 4XCYA 5I73C 1GY1A 1DN0B 4ELMA 3HMWL 5DUML 5HDQL 4G9DA 1AD0B 3OKLB 2Y7LA 5KEZA 4WAFA 1PU0A 4P2QD 4WCYH 4L0YA 3EKCA 2BJML 3P4LA 5FYLD 4U0QB 2D3JA 4B60A 3HZVB 2ZE0A 2Y7OA 5BJTB 3UTPE 5JQIB 1SOXA 5E2VH 1U8LA 2ED7A 5EA0H 1D9KB 1MI5D 1PZ5A 1NDMB 1QWUA 2FBJH 3VFWA 4A55A 5ABZA 4HBQA 3L4CA 4EUPA 2FYVA 1CFSA 3HUJB 1J5IA 3L1FA 4TUOA 2J73A 3MCLH 4I77H 4LCWA 5DEJA 4HG4K 4P59L 3ZGIA 3WYRA 1FZOB 3ARXA 4QUOA 4I1PA 3QQNA 5DC2A 5L8LB 3CCHA 3DOSA 4PP1C 3AREA 5DK3A 3CAFA 2UWEB 3GMQA 1EMTH 3EYSL 4L3FA 1IAIL 3P73B 5GJSL 5L88L 1K3ZA 3S4SB 3QYNA 3QNXA 4YHML 1HVXA 5GJSH 1PD1A 5DWUL 4LP8A 3WENA 2Z0BA 1JTTA 4LGPB 5FYKL 4P4KA 1JCVA 4M43H 5TGBA 3HLAA 1E4XI 3QRLA 4B3EA 2XFXA 5DJXA 3RGVC 1S7VA 4U0RC 4M03A 1NFDF 1OOAA 2JXMA 1OM3L 3SOTA 4AZ8B 4OJCA 4BH7A 5H37A 1ZJAA 1JGDA 1QO3B 5IQLA 2HVKA 3VI3B 4LLDB 4K23H 4PJGB 1ZTXH 2GTQA 2OSWA 5DJYA 3N1QC 4P2YA 3MJGX 1TU2B 1MZZA 1PFOA 4RAHA 4DGVH 5K1VA 4N2HA 1OCWH 2DBLL 4BV1A 2XTJD 5FEBA 4UAHA 1ZA3A 2C1PB 2PYED 5D1XC 5FYKD 3S8WA 1GCFA 4I13B 3NAAH 3F00A 4A37A 2NY5C 1KYOJ 3HB3B 2F18A 3BIKB 1JYNA 5HJBA 3GDBA 3GO1L 4YFDB 4YK4B 5L2KA 2XUWA 5CWSA 2BHUA 2HLAB 4LSTH 2X6BA 3CBJB 4BQCA 1GAFH 3OAUL 3HG1B 2FX9L 2FJGA 5HHVH 3FC8A 2P7TB 4IBZA 5C92A 2UUDK 2DQEL 3FQRB 5IBLC 3UGXA 4RMVA 1SQMA 3CCHB 2X3BA 4U6HB 3DX9B 3QHFH 3MUHL 2WKOA 1UVQB 1KLFB 4TNEA 3QC5X 4U4BA 4YBQC 1KN2H 1OD7A 2BDNH 3KGRA 3LX9A 5AB1A 5BMFH 2BVPB 3BWUC 3CZKA 2WBXA 4LESA 4GAYA 2V3DA 2X2JA 3RVVD 4CBPA 1ZVYA 2AJXL 4DTGH 1F58H 3T0EB 3AY4C 3DX4A 2UZPA 2YEZB 4CILA 3VFRA 2CIIB 5LWYL 3L1GA 3M6DA 3KYKH 1P7QA 3BHBB 1XR8A 4YSAA 2NY3D 4X4KA 4ZSOA 3KMDA 1XF2B 4PRHD 4JG1L 4GKSA 1XGUA 2FWOA 4LEOB 4RA0C 2AABL 2HFEA 1AACA 3MV8E 5AZEH 5KSUB 5SWSD 5AAWA 5GS0D 3SOBH 4KTYA 4YGVB 4OCNC 2EKJA 3TIDB 2AJXH 1A6VL 1FORL 2HVKB 2OMWB 3MLVL 1IE5A 3PQYD 1OAKH 5ANME 5T3ZD 1HHHB 4P46A 4F7TA 3T9WA 4LLWA 3ZYOA 3GK8H 4PW4A 3W39B 1F97A 3WIHA 4XP5L 3FULA 2YLHA 4B41A 4JFTA 4KAQL 2DKUA 4I0KA 4U1GC 5SX5H 1ZK9A 1G7MB 1QBAA 1KIQA 4FQLL 4N90E 2LV4A 4JK0D 3RBGA 5KN5A 2A74C 3RG1C 1QLEB 3SDDC 3KR3H 1EEZA 4NFDA 5F7EH 4RBPK 3CFIC 3SBWA 4NCC1 1C12A 4I88A 1DLFL 4WFGE 1A3ZA 1DYZA 2XYCA 2EIZB 2I25N 1QACA 5CIPA 5FV1L 5KSVA 1GHFH 3MXVH 5AKSA 4PGBB 2EDJA 4XAKD 4KK8C 4DGIH 4H1LG 3WY1A 3M17B 4JFYB 1SVBA 1KELH 2FYYA 3P77A 3QO0A 4NZUH 4BZ2A 4KZDL 1QSEA 3HS8A 1GPOL 4OM1H 4TVSa 1YPZA 1F90H 4HD5A 5FUCE 3V4VL 1EEYB 3DO7A 4YX2H 2EDOA 2XWXA 4GAJL 2F8IA 4PQXA 4MXVF 4DP8X 1EBAA 3NVQA 1NSNH 4OT1L 4J8RA 4UAOC 2YPLA 3ULVH 5MI0C 2XNAA 5D1QC 3R8QA 3WJLC 1DQVA 4R96A 4ALAC 3RGVD 1ZTXE 2FEEL 2DLHA 2XVKA 2ENJA 1U95A 2DIBA 3N0PB 4G9FB 3C5ZB 2J8UF 2VITB 1B6DA 4N2KA 3DK2A 3EYSH 3ZIYA 5BUAA 2P80A 3B6SB 3ATFA 5H4YA 1J9SA 3F58H 5EZIH 1P4IH 1GHFL 3BPOB 3D69A 1VGKA 4PJ8A 3JV6B 1Y6KR 1MXDA 4IRZL 4P23A 4DWHA 5K59F 4NS0A 1KYFA 2EO9A 3QHZH 4PR5B 2YGNA 1N64H 4OZFH 1LO5B 2A6KA 3KPQB 3T8VA 2WMPA 1DQTA 1XEDA 3DBXA 1KCVL 2G3MA 2I7SA 2GEEA 5SWQB 3WFZA 4CVXA 1KLUB 3Q6FB 5EV7A 4QLRA 6PCYA 2WVUA 4PGDA 2YPLD 3F12B 2Y07L 4NM8L 3BUBA 2NY2D 5CIPB 1PG7X 1V7NH 4PAZA 3RDTD 3HS0A 3RVTC 3U82B 4ZW3A 5DQJB 1Q9WB 15C8L 4OF5A 1FP5A 2YXFA 4MFHA 4K3DL 4DFIA 2CHXA 2GT9A 1QLEL 2AQPA 3O2VH 1EUTA 2P5PA 3FTUA 1MJ8L 2UV3A 3NQKA 5GGTH 3Q2WA 4HEMA 4TXVB 2Y6SD 3UAJA 2ZUVA 5AOKA 4RGNE 5KSBE 4RMRA 3D87B 5DJXB 4A7UA 1GGIH 1VACB 3X14B 2C9AA 4P2CG 3IPFA 1QI4A 4PRHB 5JPNC 3ARFD 2G2RB 4PTTA 5AZ2L 3CX5J 5F72S 1QAWA 1OT4A 3BZEA 1QFUL 5T1DL 3A67H 1MJ7L 4IS6A 1HZHL 2XZQL 3WFCH 1UACH 2E0PA 3D4CA 3FSAA 4JKKA 4WWKA 2GJZB 1HZHH 4QJ4B 1H6FA 2OX5B 1S7SA 4ZUSB 3QXAB 4OJFL 3NYKA 4ZYKB 1SZNA 3DWTA 1O9VA 3QXVA 4KTGA 5MI0B 1UWGL 4WV1A 3S35X 3KPRE 5J3HC 4G6JH 1MH5A 4GS7C 4EN3B 3FUMA 4B0MM 3UZEC 4DFHA 3HKZA 1UZ6F 2XYBA 1GAFL 3OAUH 4N6QA 4TVPH 3WEAA 2BX5A 3APNA 4KDWA 1NGYB 3FPXA 3PFQA 5AVXB 3DBXB 3L3OA 4UTBA 5I1JL 2BCKA 1RVFL 1PY0A 3WS6C 1DJXA 4AYID 4QI3A 1KZQA 2FK9A 1EGJL 3G6AA 4XR8C 3S88L 1H9DA 4HF5L 2N7SA 4G8IA 4NN6C 2R2EB 1FNEB 2R7EA 5T5NF 2F19H 3KL0A 3BJ91 1PF3A 3ESPA 2VAAA 3UTPD 3ZE1B 5GGRB 3WO4C 2F8XC 4XN5A 3OXRB 1HNFA 3T1WA 1CMOA 1QMUA 4A7SA 4WHCA 2PMZA 2VXTL 1LVEA 3MLWL 2BK8A 3CXFA 2R9HD 2IV9A 4HW6A 4M93C 3ECBA 2Q86B 5IJBC 2M26A 2VABB 3MLXL 1M6UA 1KCUH 3MGAA 1IBFA 2DM3A 1UT1A 2FWSA 1QLRB 3TVMD 3O6KH 4FCAA 3AG3B 1RZ8A 2LABA 3CC5B 1CICB 2OCJA 4CSZA 3UZVB 3QSKB 4UB0L 4WW1B 3SO5A 4IRSA 3VG0L 2LR4A 4NYLA 3R0NA 5AWNL 4PREA 2W1NA 2EVHA 3DXAA 4J2QA 4V33A 3IRCA 4XNUH 5CGYD 3EGSA 4P04A 2AK4B 5KJ7E 1RJZB 3QZOA 4ZO6A 1OTUD 2IEPA 4JQVC 4EZMA 4M3KB 2ERJB 5DMKA 4JQXC 3U7WL 3SDYL 2R0LH 5MERA 1A6ZB 4MLIA 4M4PA 2A1WL 1UOKA 1F8TL 1TJGH 4X6DB 5E5LA 4YHIB 2Z65C 1S4IA 3MBWA 3L3HA 4LLVB 4ZFOL 2AP2A 1UENA 4DPCX 1YEIL 4X80H 5BQ7B 1BQKA 4J6RL 1RZKH 4QRRD 4KKNA 2FECL 4M5TA 2WSPA 5HHOE 2YAOA 3VFMB 3K71A 5L4JA 2PYEE 3MV7B 4TSAH 3MMEA 4YHPA 1S5HA 1FNEA 1KJ2H 2R7EB 2Z6FA 3Q8CA 3RL1B 4AVJA 1NMBH 1IMHC 1LEIB 3I2CH 3GRGA 4OKVA 3B56A 1NIAA 4NKOA 5BPPA 2BOCB 3TBTB 4Q7DA 3VGHA 4KJQC 5ESQB 4G11A 2EO1A 1YY9D 2X7LB 2IQAA 1E9OB 2FHCA 4DPRA 1CB4A 2E4TA 3VX1A 3QORB 2VDOH 3TVMB 4W68A 1K8IB 2NY0B 4L3EB 1ILUA 3P40A 4QWWD 4F7CA 3EHBB 1UUSA 4PBXA 2J8OA 2VDRB 3MRHB 5LQBH 1RJCA 3L7FB 3P30L 3KDMB 1DQLL 1AGFA 4JDTL 1FVEA 1RK1A 3B8YA 4GO8A 3PWPA 4PWKA 2Z4QA 2B4CC 2Y4SA 4PJ8B 1TFHA 3K2UH 1A1NB 3GB7B 5A6MA 1CN4A 1H15A 3HMXL 3QJFA 2WXKA 4KU1A 2A38A 1LE9A 2VSKB 3HZ3A 5D5ME 1H9VA 3O3EA 3IU4L 2XN0A 4YOKA 3V5HB 1DCLA 4UIKL 4J3TA 5EZOH 3QI9C 1U93A 4OU3A 4BQBA 3P2TA 2YMXL 4XI5D 4YDLC 2OTPA 3IU3A 3BWUF 1DO6A 2VXVL 2YAPA 1RZFH 2FD6L 1KIUB 1HL4A 1Q72H 2VDNB 3BT2L 4MA3B 1LGVA 3AXLA 5F0LB 2XXGA 4KXBA 3UZEA 3R1GL 3MFGB 2DTML 1SM3H 4BHUI 1QFHA 4EUPH 4TPRH 1QZ1A 3BVDB 3S36H 4X99B 2GT9B 5JXED 4GW4B 4KXDA 4Y2LA 3HAEA 1WJ3A 3O6MH 5KVMC 1DEEA 4OIIH 2BS9A 4KQ3L 4PJGE 4U31A 2NY5H 3FCSA 4KKPA 5AAMA 2WO4A 1XSOA 1HHJA 4HJJH 1A2YB 2W0FA 1MIMH 4HHGA 1ZT1B 4YHYC 4XXCA 3ZKSD 3QIUC 3QA3A 5C97A 1CLOL 1O6SA 4YSOA 4ETYA 3G5XB 5MHSD 2IPTH 1LDPH 3FTSA 2NXYC 3ABGA 3BPCA 3FUFA 2N01B 3DC0A 1ZMYA 3VI4E 5D5MA 4N9GB 3WNJA 3QUXC 5J6SA 3DGDA 1JYVA 2DLIA 4B9JA 2GSGA 4N0UA 4MNHB 2QSTA 2B1AL 2RTTA 1N2RA 3D48R 1JGEB 2Z4QB 4G7YL 2YGQA 43C9B 3SKOA 3PAZA 1JL8A 2XN9E 1EO5A 2B4CH 3MLWH 4WI3A 4CRPA 2C9QA 2NZ9C 5CLWA 1JZHA 2V8LA 1RUAL 2YPVA 2NMSA 2JKJA 1OAUH 3PHOB 1YVLA 2UY7A 1G4MA 2WXQA 3ARUA 3DNKA 4HZAA 9PCYA 4MHHG 4G8GB 3UC0L 3DX0A 1U9KA 1QSVA 3Q06A 2XWCA 2R1XB 5D71H 2E8ZA 2OSYA 5I18H 1C9SA 1D7CA 2C5DC 3TS8A 4ZS6D 3FT0A 3ATBA 1AQMA 1PLAA 3MUZ1 4WWOA 2AEQL 3HE6D 4MBRA 1TTAA 1PAMA 4FQ2L 3MRNB 2KT6A 1XWVA 1KXHA 2BFVH 1OSPH 3B9AA 3FCTA 2I32A 1IL1B 3TBVB 3WOVA 1JZGA 4R8WL 4LOFA 4XP4H 3SEPA 1GGBL 1QBLL 1S9VA 1KCBA 3CLFL 4JY5H 1N0LA 2CDFB 4FS0A 2WAHA 2ZT9C 2HT2D 2V6HA 1VZIA 5C08D 3W56A 2BH0A 4AQ8C 4HIEB 2DTSA 4Z7WF 2A6IA 4XBPB 1SM3L 4X7SH 4S11A 3DHJA 1CLYH 3CZEA 3SKNB 3G5XA 1TJIH 2BVEA 1NL0H 3C12A 3L3KA 3UZVA 4WCYL 3S3BB 2HRGA 2XWJA 1KPUA 4HIHA 3VGAC 1AG0A 4WGKA 2YS4A 2X70A 4FKEA 5JMOC 2MTPA 3FU3A 4Y4FA 3V0HA 3G9AB 1CDJA 4JL2A 4HQQL 4AQEA 4ISVB 1P5UB 3PWPD 5I8CA 1I53A 2NY3B 4C58B 3QUYB 5DCCA 4QAWA 4W6WB 4PGCB 1JRHL 1TYRA 4CMMB 1BPVA 1A9BA 3LPGA 3MRBB 5J06A 4RZKA 2XDHA 3NCXA 3O8XC 4KITB 2COVD 4FMKA 4POZD 4UWQB 4UNIA 2BO0A 5DMJB 4JG5A 3B9KC 3CUPA 4JKMA 4N2GA 4WW2F 5CEXB 5DMGD 5IKCB 1CFTA 1WBYB 2C7FA 1ECYA 1YJDH 4Z7NE 1IQWL 1UGKA 3MBWB 4UZUA 4Z7UE 3SJVD 2NQ3A 5KG9A 15C8H 1SOQA 3BPLC 4TTGA 3V4UH 4AUYA 4QKXB 2VDML 2C1PA 2ZF8A 4X9BA 5DQDL 1E8YA 5I1HH 5DHMC 5FDYA 4FJZA 3WS3A 2F74A 4O02B 1S5HB 2BNUB 2WVSA 1AY1L 2V9TA 3L2LA 4I2XE 1UCBL 2F5AL 3S96A 2YD9A 2V2XA 2KS0A 3I84A 4FULA 4R4BA 3ZE2B 5B1JC 3BAEH 3GZOA 1DVZA 4MMZC 2ZYSA 1KEML 5EEUA 4TRPL 4X4MA 5L8KB 3WIFB 1F56A 4QT5A 4P4KC 3PWLB 4U05A 4F8TA 2CG9X 2PCFB 5GRXG 1OCRB 4WI0A 1JGVL 4I48A 4L3EA 4XAKE 2H8PB 1I1FB 3LSOA 4GAFB 3MSPA 4WU5A 1WHOA 1XD1A 3QCTH 4JM2F 4WUUA 2BVPA 4URKA 5IUSA 3FBQA 4R5XA 4W6YB 2A1WH 4WI6A 2H32B 3FHQA 4JDZA 4LARH 1R3LA 2PWGA 3EYFA 1WICA 5ELIA 2Q3XA 3H9ZA 1PG7L 3WL9B 5EO1B 3UERA 4QD2E 2OMVB 1V5JA 2FWOB 3LVEA 5E6IC 3NFNA 1P2CA 4TNVF 2G4GA 4EAEA 5E1IA 1R24B 2NYKA 1MVYA 3MTRA 4GXUM 3ZGHA 4YHOH 1RFDH 1QHOA 3HC0B 3LZNA 4AIZA 3BGFC 4HDIA 2OMTA 1A1MB 1T83A 1NBYA 1PZ2A 3RKPA 2HJKB 1YEFH 3MHZA 3FTZA 2V5MA 3UPCA 1MN4A 3OB0K 4OLWL 1RJLB 1T7VA 3QDME 3NJVA 2APFA 4YHKL 1OTSD 5C6WH 1AZNA 3PNWA 5FO8A 5IB3B 1CE1L 5D6DA 5KSBA 4P2OD 3A4FA 5GGSA 1PX3A 1J8HB 3HCVA 3DA0A 2NNAB 3P3RA 3HC2A 3MCG1 4OTXL 3MOBH 1XEUA 3GRBA 5DJ6A 3QJZA 5FLUA 3MBXH 4WI2A 3VU1A 5E70A 1UYWL 3KPSA 3QC6X 4UV7L 3BH8B 4KGJA 2VM3A 5EIQA 3BH4A 1T2JA 1UQSB 4PB0H 5J5EA 25C8H 1TF4A 4R2GD 3KPNA 4NCDA 1JYXA 2YXVA 2Y5EA 3VNYA 1O6SB 4GBXA 4J3VA 2P45B 3C5XA 4Q0XH 5E8NA 4ZOCA 2IMMA 2PCFA 5MEOA 4D9QE 3ZDYE 1I1YA 1N5AB 3VVWA 3CZSA 3QWQB 3HRPA 3BPCB 3NDYE 5I1DA 5GGTA 3DMMC 1RVFH 1YEJH 1BF2A 4ZX5A 4XAWH 3KLQA 1MEXH 1SDYA 2IFFL 3HI6H 2NDFA 2FQDA 1CL7L 2W9DH 3MREB 4MJIB 5C7XL 2HPTA 1XCTA 3SOBL 2D7QA 3D2TA 4WNJA 3CDZB 5CBEB 4HIJB 2YGOA 4KJYA 1BWWA 2EICA 4NLHA 4OD3L 4WEEA 2H32H 2X4OA 4I3GA 5SWSE 5GGVH 4A2EA 4F7EB 4M7LT 1ZWIB 3S5LG 5JW5B 4K7PY 1MRCL 5TFSH 4R96B 4NO0D 2MKLC 4GQ9L 2DQUH 5I82A 3ZHNA 3ATEA 5GGUA 3TASA 3WTYA 1A7PL 1RULL 4AXWB 2EDBA 3WNMA 3MJ9L 4RMQA 2ADGB 3I6GA 3U0PA 2C3VA 4ORGA 1DSYA 4LF3B 3UAJD 2FO4B 1PY4A 1RIVH 1HEHC 5IB3A 4YDVA 1GC1H 3ULUH 1QSEE 4MDIA 3LD8B 4XI5C 3TWCH 5E2TL 5IQ7H 4UTCA 2VC2B 2ZJSH 1EFQA 2JFCA 4LSTL 5BRZE 5FW6A 1MJ8H 1LMIA 3O2VL 5EBGA 1ZV5A 3OAYK 4JO2H 2HTKD 4MJJA 4IRJC 5CBAB 4YHKH 4X6BA 4PJCA 1KV7A 1ZT7A 4QHUA 5EOQH 1HZLA 1YEGH 3EJUA 1J5HA 2DWEB 4KI5F 4XP9H 5AAPA 4FABL 5DVKA 3TV8A 5HD8C 1NUNB 3JZYA 2G3ZA 1ZTXL 3E80A 2IGFL 5I5IA 2YPKB 3B83A 1YMMD 1HTYA 2QADB 4Z3GA 2Y06L 2NT0A 3GNML 2DQCL 2Z8SA 1IBGL 2YD4A 1IZKA 4GUPA 4RBPH 3L3JB 3UBXI 4HIJA 3WD5L 1P1ZA 2ZKHH 4KUCF 4KH2A 4LARL 3GZQA 1ZGLP 1R0AL 3HG0A 5ISZA 4J8QA 5IHUL 2UVFA 4LMQE 2UXTA 2AHIA 1ADQA 2MCAA 5IMLA 2K9UA 5F9DC 4ALAH 1I9RH 1U2CA 3QGVA 4XXWA 1NUFA 3KVDD 4M02A 3MV9E 3Q05A 5D7JA 5F89B 3MV8A 3LQAH 2PPDA 1S5IL 1JOIA 1T7YA 1W8NA 1KBWA 5DJZB 1PDKA 3ZL4H 5K59E 3KLSA 2QGCA 3MI6A 4FTDA 1R3IH 4MMYB 5GRVL 1TNNA 3QQ9D 3SGEI 3TNMB 3S96B 3UTSB 1MH5B 4EN3A 1MQKH 5G5DA 1F2XK 3ZO9A 2YUVA 3Q8BA 2IGFH 1TVBA 2JVUA 3IT8D 4XPAL 4YQXL 2PTTB 3TJPA 1T21B 3NCJL 2CH8A 1I8LA 2EDQA 4KUCD 1DBMH 1E90A 1NC2B 4HIPA 4A2GA 1F11B 2WK2A 2X4QB 4GKNB 1FAKT 4APQD 2VIRA 4ZQTA 4DP2X 5DURD 4PS3A 3RHWF 4O2FB 5AFAA 4UZGA 5DHYB 4N5EC 3L4UA 3RX9A 2DB8A 2X87A 3LDBB 3O41B 1A3LL 3AB0B 2WBJB 1FPTL 3LKQB 3OLIA 4Y16C 2OA9A 2YKLH 2Z1PA 2A4EA 2UUDH 2DV6A 4BE6A 3L3DB 4YHLH 2RALA 4I0PB 4ZD3L 3CZNA 5FO9A 4JVUA 1A4KB 1F5WA 1R3HA 4KAQH 3U48A 4RDQG 1GL4B 2B1HH 3SPGA 1QLRA 5EU6B 3N0AA 2RA1A 1A7PH 2PWEA 1UADC 1FGNH 3IF1B 1SJXA 4XE0A 3IAPA 4XCFL 2AEPH 1VFAA 1L5GA 5LN8A 5JHLH 2OYKA 5JPMB 3ZKMC 2VO5A 3GXNA 4OCXL 4XMKL 3F01A 3OF6D 4OB5L 3ZUCA 3TIEA 2E9BA 3EFOB 5GGSB 2E46A 2BIHA 3DXAB 5DJ8B 2IH3A 1JDDA 4Y19E 5D55A 5INDB 2IWEA 1F4XL 2WP3O 3U2SB 1X5JA 2QHRH 1G43A 3RTQA 4P2QE 4PJBE 2F8VA 3IDXL 4OZFA 3WSQL 5I1AA 2MPAL 2O5XL 5I71B 3W9DB 1AZZC 2OR9H 4HJ1A 3QDHA 4RWYH 4XPFH 5DU7A 3V8OA 1RURH 1MCPH 2AK4E 4HUWA 1KN2L 3R4RA 4KPHH 2F8OA 2CWRA 3CG8A 5BQ7A 3B5TA 3RPBA 1AQHA 4NQDB 5IGXH 5C09E 5DURB 4A2DA 3ZYIA 4LCWE 3BVTA 4HSAC 1N5YL 2EC8A 2B3RA 1UG9A 1MSPA 4L9LA 4Z1PA 1XB6A 2X9ZA 5H35B 1WZMA 1TJMA 2H3XC 4HK0B 3SPJA 2R0KL 3L5IA 1AKPA 4N6RB 2XG4B 2NW2A 1CGVA 3JZ7A 1CE1H 1X6NA 2RAMA 3QFDA 5EMYA 4JE0A 1LWRA 2ZF9A 1UVQA 2W9EH 3WIIL 1TZAA 4EDWH 1JDAA 4PJHA 4EJ1C 1PLBA 2LU7A 1EERB 3IJYB 4FNQA 4OJEH 5E5RB 2A0LC 5HHMB 5I8KL 4WKZB 2DS4A 3MA9L 4F2ME 3ZN6A 4XXDB 7CGTA 1JWMA 3WDJA 1X5GA 4LRIC 4PFEA 2A9BA 3ZE1F 1HCVA 4NO5A 3LCYA 3QYCA 1U3HD 3BW9B 1I1AC 4N8CL 4R5VA 1ADQL 1N12A 1H15B 2VXQH 4M5YL 1EDQA 4X6DE 5IZ7A 5DGRA 1JNHB 1CFMA 3NJLA 4JO4L 2AJSL 4EN3D 1J0JA 1UXSA 4PJBF 2MMXA 4MJ6B 1S7WA 1CYWA 1YEWA 1AHWA 4PVMA 4UT7L 2ESVA 1CGUA 4DF9A 1L9QA 1MELA 3X11B 2VWEE 1A4AA 1IIKA 1C16A 4XZUA 4AK2A 5D2LF 4YHMH 4D2NA 1UM4L 4P46B 4F7TB 3L5XL 5L0QB 3RWDB 1SUHA 2IDUA 4WW2A 3SE3C 3VXSA 4HEPA 1Q72L 2ZWKA 4YXKL 3CFUA 5JDJA 2NW3B 1S9XB 3LKSA 3MLUL 4M1DL 4EPSA 4XWOC 1KXTA 5FYJD 1MCLA 1I31A 3H1ZA 1OB1B 2MFNA 3DUSB 1DN2A 2XV0A 3RIAK 2WXFA 2XWDA 5D7LE 4ZS6C 3W11D 4KJWC 4M6OH 3Q44A 3NJIA 2FQGA 3K7UA 5C6TL 3GIVB 4NWUH 2JCCF 2G2PA 3BZ4B 4Z77A 3NFPA 3MOAH 5JW4M 1R5VA 4AI7A 4N86A 5DJDA 3P1VA 3SE8H 2EIZA 4P9HH 3SJVA 3H4HA 1BQLL 4PJAF 3EGDA 3H3PH 3NIFB 3F05A 4DW2L 2XU9A 4N26A 2VLKA 4NDMB 4JMNA 4D7PA 2CR3A 3D34A 5EORL 3RWIA 4Z7QB 5F1IB 1CICD 2J88L 3STLA 3WMQA 5FFOA 4RRPA 4WJKB 3U0TB 4WFEE 1MHHA 1F41A