4BRVA

Superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MKSFGELIYTPDRAEGEAISKAATHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRVAFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION
publication title Structure of a Natural Sor Mutant
rcsb
source organism Ignicoccus hospitalis
total genus 30
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4brvA00
4BRJA 1VZGA 3QZBA 4C4UA 1DFXA 1Y07A 2HVBA 1DO6A 2AMUA 1VZHA 4BFFA 4BGLA 4BFJA 1DQIA 2JI1A 1VZIA 2JI2A 4BV1A 4BFKA 4BRVA 4C4BA 4BK8A 1DQKA 2JI3A 4D7PA
chains in the Genus database with same CATH superfamily
3GHPA 3V52H 3LEYL 4UT9A 2F58H 1A64A 2ZOLA 1DBJL 2FHBA 4P5TA 3T77B 1QFWM 2H2PD 4OD3H 1M1XA 1IILE 2YFNA 1EGJA 3WUWA 1FSKC 4IJ3C 3T4AC 4Z8FH 5T5FL 1URLA 3VGDA 1U91A 3K1DA 5LG1A 2RAMA 5J3HC 2IH1B 1TJMA 4P0DA 4KMQA 3BGMB 4XAWL 3BRDA 4YL4A 4MCZB 5DHVB 1MCDA 3ARTA 3T0EC 4YDLC 2VLKB 3B9AA 2WLLA 4N26A 4P46A 4KFMA 5HHOE 1VIWA 4R7LA 3KJ4C 1MWOA 2EH7H 4GI8A 43C9B 2JCCF 1PLGH 1YZZA 4TOYL 5EOTA 1RFDH 3P11L 3SDCD 3L5XL 3QK0A 3QJHB 4AQAB 2YD4A 1COBA 3IU4L 4RBPK 1U93B 1QSED 1I9RL 3O6MH 4P2YA 4BQBA 3DBXB 4LHJB 4BK4A 5FYJH 5DYOA 1ZS8B 3RL2A 1RZ8B 1XAUA 4ZO9A 1TPXC 3O4OC 3FTUA 1EANA 3QO0B 2XQYA 3CFDA 4CADA 4G2AA 1NCCH 2Y1AA 5GRXG 1A1NA 2EDHA 4PTTA 3WKQA 1A3RH 2ZG2A 1S9WB 2WD0A 3Q2NA 4LL9A 3L3JB 3LN9A 4V11A 1SEQH 2P46B 4YDIL 3VX0A 1BAFL 4PJIF 4ZAKB 3WEXB 1TCRB 2VT0A 2RCSH 2EILB 4OCLC 5HVFB 1W72A 3T0AA 1ZLSL 3OR6B 4MQSB 4NP4L 2F53A 3FFOA 1CU4H 3V4VB 4DUVA 3W9DB 2JKXA 1JWSA 1SM3L 5BVJB 3TA3C 3MRQB 3BVNA 1CDIA 3D25A 4NUMA 3SGJA 3K6IA 4G6ML 4GSQA 4ICXA 4WKZB 4NDMB 4HIHB 1OQXA 1EGJL 4C59B 2DQJH 2NY1C 3E3QE 4PG2A 4L3EB 1R3JA 1MHPH 1L9PA 3RVTD 3SOBL 3QORA 3DPBB 3W5MA 1IL1B 1E43A 2HH0H 2P47B 4J3XA 2WZPA 3HMWL 3R18A 5CJ8A 2CH8A 3QG7L 2UY7B 1VPOL 3IDJB 5EA0H 5DURB 2DLFL 5HD8C 5CKAA 1DN0A 1FNFA 2YK1L 5E23A 3SE6A 5IOPB 2DQCH 1UZ8B 3UACA 1WBZB 1XGYL 1A0QL 5MP6L 5GXBB 3WTWA 3V0WL 4MQ7B 4R97B 2HYMA 1E8ZA 4YX2L 4OZGE 4GAJL 2X6BA 4M7ZB 2BIMA 1KGIA 1N9PA 5AVYB 1DQQA 3FJTA 4KK6C 2OYPA 4GKLA 2VXTH 1QI4A 3WNOA 1A6ZB 4U4IA 1Z9MA 5F89A 3ABKB 3AT8A 4X50A 3L3KB 4WRLA 4Z7WE 4JHVA 4JPIB 4WU5B 4MB1A 5D5MB 1J5OH 4L8SC 3SCMC 1CLOH 1KGXA 2V9UA 4ENED 2EXYD 2VC2H 1XF3B 1DQJB 2LU5A 2J7LA 2W65A 4JKWA 3ZYJA 3GSNA 3VAEA 5FM4A 3O41A 4I18C 1VZGA 1SYVA 5CNHA 4C83A 1F4HA 4Y5XA 1OCWH 2NYYD 2VITA 5HGAB 3ZE0E 4S1DC 4M3HA 4AT6B 4D3CL 2WLMA 1V05A 2XXMB 3SZKC 5HY9B 1DLHA 4PMEA 2DQIH 5EEXA 5IREA 2X89A 1IKFH 2ZF8A 3GRWA 4LCIL 1JHLL 1EMTL 1G7LA 1UCTA 4G8FA 4YHYB 2E0PA 1KN4H 1HSAA 2UZXA 1KCRL 4DN3H 1XFPA 2NQ3A 2CDFB 4PJGF 4RSYA 4EI5D 5EPMA 2NCEA 1FVEB 1I7TA 1OAXL 4HGWA 4WUUB 3DWTA 4UANA 3RTQA 1S2EA 1TG8A 3DJ9A 4Q9BA 3L13A 1QKZH 4HJJL 4RFEA 4WWNA 3FUEA 4Z5RA 1K3IA 1OGAE 1L3WA 5C0ND 2OR8A 2A74A 4E9XA 5C08E 3Q7JA 3S96A 2PXYB 2KMWA 3CAFA 5B1AB 25C8H 3JTTA 3T0EE 1JV5B 5ACMA 2DYPB 4FQ1L 1HL8A 2XVLA 5T1KB 1LEGA 2IDTA 2G3NA 1OWWA 4HK3J 4LSTL 3M17B 3RZCA 1H9DA 1C16A 3US1A 4C4BA 1SJVA 4JRYA 1I4FA 4WI0A 1XMWA 4FJYA 4B60A 1VHPA 3EJYC 1AGCB 1AI1H 3R0NA 2P3YA 4PRPA 4WLCA 1RK0B 1TLMA 3SDDA 3VXMB 4TSCH 1RZIA 2DQHL 3LRSA 3OAYK 3ZE1B 2EH8H 1E90A 2UXGA 4W9CC 2A9AA 1X5IA 3M1BA 4GKSA 4MB5A 4V2BA 3CUPB 5D6DA 1ASPA 3MBED 4MAUL 3FPYA 4LRIA 3KW8A 3D85A 5AB2A 3LN5B 1T1WA 3VXSE 1WZAA 2G9HB 1N10A 4PV9B 1WHOA 3GSNL 4Q14A 4DUXA 4X4XA 1IBGL 1A7QH 4QF1B 3EYOB 3EXLA 3EOBB 1RUPH 3GSVB 2G0KA 3DK2A 5HTSA 3LZFL 2P8PA 1XXDC 2CZNA 1KNOB 1GC1H 1OANA 1KY7A 3GRWL 2H6OA 2GTWB 1LM8V 5ACZB 4PU2A 2Y6SC 5CAYB 3VNYA 1CICA 1XQ4A 5JQ6H 4A55A 3P3TA 1YNKL 2FJGA 3P0VL 4K7FA 5IBUG 1CC3A 1G84A 3FSOA 1PVHA 1OT2A 1BQLL 5FW6A 5HDQL 1T5WB 5DD0H 3CSFA 3BQUC 4ALAH 3OAUH 5HI4D 4PH8A 4MVBC 3PHQB 5ESVA 4X83A 5DD6A 5F7BA 5GIRB 5C9KA 2HCZX 3GUTB 1E5BA 4U3SB 2CK0H 5IF0A 1MJ8L 1QYGL 3ARYA 3DJRA 3FQTB 2XN9D 3EYVB 3P40A 3KHOA 3S37L 2WXOA 1WUZA 4KU1A 4IBSA 5FYLE 3AW5A 1BEYL 1ES0B 4UQ3A 4QXGH 4FL4B 1FBIH 3C6LC 2F7RA 4GXUM 4N0FB 4FG0A 4D8PA 2YR3A 4XP6H 1YECL 3ZE1F 3HNVL 3UCRA 4WFHE 1GGCH 1ZA3A 4LK4A 3BVVA 1MRCH 3F6LA 2F54E 4Y89A 3K8KA 4NKIH 4APQB 1UFUA 4Z7VA 3NFPA 2YEZB 4CC4C 3ZKND 2G30A 5E6SB 1UUSA 5IVXB 4AL8C 4WHYG 2X1OA 4R5XA 1DVTA 1MFCH 3FCSA 2YSSA 1YVLA 1MKFA 3ESPA 4HBQA 3MJ9A 3VNZA 4ZO6A 2IAMB 3PWPA 3DX7B 4XNMA 4M1DL 3KZ8A 4WFEE 4Z7UF 4XOEA 4KRPB 5HYIA 4MJID 2X1WL 2FGWL 2CUHA 2QADC 3GKWL 3HVDA 3LZNA 2IH3B 1EEZB 3IDUA 1E4JA 3GO1H 4JLRA 2P49B 2ITDA 4XPBH 3CVHA 3ZY7A 2DM4A 1P1ZB 1L9SA 3TBVA 2OQJB 6TAAA 1CCZA 1MW1A 2DQDL 4BSJA 2WZ6A 1T2XA 3LVTA 3DVNB 2IGFH 4XVJL 3OXRB 1N5YL 1PD6A 3H9SA 2WC7A 4LKXA 3CQPA 4HCGA 4HEME 1QACA 3QWOA 1AR1D 4H0GA 2VXVH 3OKYA 5EF0A 2MPVA 2ZOLB 2RFXB 4IBQA 1NLBH 1MFEH 4P5TB 4PFEA 2I07B 1J1PL 4ZO8A 4L18A 3AXHA 3MRKB 1QBAA 2VSMB 4DKFH 5FW7A 5DGRA 4F3FB 4FP8H 3GM8A 3U7WL 1OK8A 1UEMA 5TPWH 2YPVA 1YEGL 1ZVYA 1PW3A 5AWNH 4JE0A 1TLKA 4P46B 4HJIA 4DQOH 4PS8A 1DJSA 4UOW0 4XN4A 3AWGA 3QEUA 3QNXA 5AZEL 2ZQKA 1ACYL 1QATA 2OSXA 1V7NH 5CP3A 3EH2A 4X6DB 1KDJA 5DLML 2B39A 2WTRA 1ZLWK 1QBLL 4I48A 2WXFA 2ZX7A 1KCSL 3BT2H 3U7AA 3AABA 4PCYA 3MXWL 5DYOB 4M8QA 3RL2B 3MJ9L 4OTXL 2VR9A 5BZWA 3CFDB 4HA1A 3BVDB 3QCVL 4P2RE 3ZYIA 8PAZA 2EICA 2OTUA 3A5VA 5EORH 2PP8A 5C0AE 4NT6B 1E6JH 1TZ8A 2MSPA 3RPBA 1PX4A 4OF3A 1N3NA 1ZGLP 2EVHA 3CVHL 15C8L 1UOVA 3H4FA 1WE5A 4CVXB 1BECA 3G5YA 5HYJD 5GS0C 5CMAB 5KW9H 3QJVB 1IGCL 4N2DA 1J5HA 1BAWA 1UM5H 2ARJA 2ZF9A 4XXDA 4G9FD 1F4XL 4UV4H 5E2VH 1JPSH 3ATDA 1KMGA 3BVNB 1UACL 4WSGA 1T0NA 3D25B 4NJAH 4PHXA 4PJXE 4NO3B 3L7EA 1QFUH 2UVFA 4H8QA 2GK2A 5FECB 1T89A 4QHUB 3L4VA 5DZVA 2LVCA 3FS9A 4FHBD 2FCBA 3LXUX 1UFGA 4JKMA 1AZVA 1R3JB 5D1ZD 1KIPB 3NJKA 3X17A 2LQRA 1CDHA 4HWZA 3QORB 3ZTEA 4LCWE 2PYEB 5KAQG 2YPVL 4HIXL 4NNYA 2CO7A 3VH8G 4F1ZA 4JFQA 3PL6D 3VFUA 1AFVH 1UB6A 1X9RA 4ABUA 4JPVH 4POZC 1CK0H 2DW5A 5DJCA 1DN0B 2QHLA 5KVGH 2WTPA 5MENA 3MLUL 2OR9H 3VXRE 5HHOD 4Y8DC 5A2AA 1BQHA 1E40A 1A4JB 2YIHA 3HE6A 1LLAA 3B2DC 1CFSB 3VDCA 5GRWA 4KHXH 4LSSL 1DQQB 2DZEA 3RY5A 2BP5M 1L3NA 5LCVH 1QW8A 5E2TH 4E9VA 3WTSA 5IB4A 2Y24A 5F89B 4EDXA 3SO3B 1QO3B 2MOQA 4GRWH 1MJ7H 4AQ8C 1AZBA 1BXAA 2TRYA 2BRQA 2BHZA 1AHKA 3FONA 4DERA 5I1DB 2H32A 2IWEA 2G2PA 2MQGA 3UJTL 2W65B 5B4MC 3E6FA 1MREH 5C0BE 3GSNB 1YG9A 5FO8A 4FXGC 5L8LB 2IQAA 1AHMA 1MOEA 5CGMA 4C83B 1I3RB 3UYPA 4X5XB 3IDMA 4Y5XB 3AS2A 3HR5B 3H0TA 4EDWL 4X6EA 4U1GC 1DLHB 3KLLA 3QWNA 2WZAA 1U58B 1G7LB 5ADPL 5GGTL 1RUML 4L4VA 4UQIM 3BHBB 4F7PB 2GITB 2UZXB 1YJDL 4KH9A 2FATH 2PYFA 4PRBA 5EPMB 2IF7A 1I7TB 2P8LA 3RX8A 4HGWB 2B9AA 4HU2A 4XOBA 3RTQB 3PAUA 4NN7B 2P80D 3U4BL 4DOHB 1R9FA 4RFEB 2GTZB 3FHQA 1FRGL 2A74B 5D4JA 3TFKD 3QUMB 1P7KA 3IJHA 1WCQA 1JPGA 4PMFA 2KLTA 7FABH 4F8TA 5LBGA 3FT2B 4HHAB 3WHE1 1EFXA 1C16B 2QTVA 3BAKA 1NFIA 3SDAD 1FNAA 2ICEA 5D7SH 3T3MB 4JRYB 3HE7C 4WI0B 1DVQA 3LZOA 3TOPA 3ARPA 1LD9A 2TSBA 4XPFL 3SDDB 3O6LL 1T1XA 4FQQB 1MELA 3ILQD 4X98A 3A6BH 4IEFA 4U6TA 4JDEB 3TIDB 4RGMB 4GKSB 3F05A 5LXVA 1XBDA 3MA9L 5I6PA 1GW6A 2J5WA 1S8DA 5DI8A 5IIEB 1I3UA 1TQCC 5MEOB 1REIA 1T1WB 3L45A 2JB6A 2FX9L 1GGTA 3SBWA 2DLIA 4X4XB 1BBJA 2ZPKL 3GPSA 5I1CL 2VSDA 4Z0XA 2HFGH 1AC6A 4MKTA 1OP5K 2ETWA 3GMLA 2BHFA 5K59F 1MFUA 4RMWA 2DLEA 2P8PB 4LIQH 3FT3A 4XNZC 3UJIL 4PWGA 3TA4D 1NGQH 4FHJA 3J8F7 4QMEA 3VB8A 3W1ZA 4KPHL 2DDQH 1CICB 4MQXC 2YGQA 3T0WA 3U1SH 2FJGB 2FWUA 4W68A 4P2QB 1LL1A 1GHFL 5DJ2B 4XB7A 3NTCL 3NIDE 3VGBA 1QRNE 2V5MA 5GS1A 1O7DC 4WNJA 1EJOH 5LGJA 4FNQA 5C07B 3ARGD 1SUHA 1BP3B 1NCBH 5ESVB 5DD6B 4K07A 3JV6A 1X5LA 3W81A 4ZFOL 1BHGA 1BWWA 1AOZA 4LPXA 1I8IB 1OSEA 3D2UB 4FQXD 1ZANL 4PJFA 5D93C 1NBVL 1QI3A 4TL5A 1OGAD 2V2TB 5J3HD 2C9PA 5C08D 4HEPG 2BFVL 3L9EA 5E56A 1HI6A 4DTGH 3T0ED 5K9OA 1P69B 4YWGH 1SBBA 1JPEA 3ETSA 2IPTH 3IDNA 3Q2WA 4KKAD 3IKKA 3BPNC 1EPFA 3VG0H 1NZRA 1ZA3B 2HLAA 1BPVA 2BJMH 3CDZA 1LJMA 3FSVA 4PGCB 5LG6A 1L7IH 1WEJL 2WBWB 4PJ5E 1F58L 4JFVA 4W1TA 1UM6L 4Z7VB 4ACTA 2B7DT 3GFUA 3G9AB 2ZT9C 5JOFA 3NSCA 5E1QA 3VH8A 5DD3H 3E1ZA 2R0ZL 2EDEA 3FCSB 1U30A 2VMCA 1OB1B 3BN9C 3RE0A 2NY7L 1JZ4A 3ML9A 5KSBA 2EJ1A 2ZX9A 3CDYA 4PY8I 3FRPG 4ZPVA 4BE6A 2BIHA 2H1XA 1QBBA 3VXSD 2HXAA 3SD2A 3PWPB 4RAUA 2E7LA 1LQSR 3FNKA 2DQEL 3KBFA 1OAUL 1VAHA 3WO4C 4G8GA 2K0RA 3ALXA 1N64L 4L0ZA 2BVOA 5HVGB 3JWNG 2ITDB 2R8SL 5FO9A 5AAMA 1FAIH 2P8MB 3CVHB 3GSRA 4LNRB 4IU2A 3N0AA 2FSEA 3PGFL 1ZJAA 1P2CA 3NN8A 2WMPA 2WNXA 5AW8B 3QG6B 1V7MH 2V5RA 3ARWA 2GABA 3LN4A 1Q9WA 3TPUB 5IHZA 3KLQA 5DJ6B 1PKQA 4BA0A 5CO1A 3QWOB 3GHEH 4BJLA 2CHDA 4GQZA 4OGXL 4OGYH 4UT7L 3WFEL 4YAQA 5E6ZA 5B38A 5MERA 4G82A 1DFXA 4PAZA 4PBDA 3NQIA 5GZNA 2VN5A 5ANHA 3BO8B 3MA7A 3PXLA 2MWCA 2VZUA 2FUQA 1BCIA 4M7LH 3O0RH 5B1CA 2NY1D 4MJHA 1WWAX 5AW5B 3O3BB 4OCXL 5JR1H 4ETQB 2C3XA 3HZKA 1SDYA 4MA7L 2EC9U 2HJFB 3W57A 5IG7B 3S34L 5I0WA 5E8NA 5EUKA 2B1OA 4KX7A 4Y5YB 4CVZA 4P5KA 5FYLD 3FU7A 1GS8A 4KQ4H 2IANE 5HD8D 1Z3RA 5CEXB 3M1CA 5E8OA 3II3A 5HHQA 2D7TH 3NH7H 3CHOA 3VFSA 4IRJA 4YQXH 1CDBA 5IROC 3KGRA 2Z7WA 2WTRB 4WFHD 3RA7L 1T04A 3D5OF 4L8BA 1FVCA 4AVKA 2F54D 1CIDA 2F18A 4IBTA 5B8CA 1D5MA 1TTCA 5F3HA 3GRBA 3H42H 2IWFA 2FIRT 2JLLA 2QPSA 4KK6D 4WUKL 1OCZB 1BM3L 3WJMA 4R4BB 2X9XA 3RURA 3KWVA 2VDPL 2YD2A 2MHAA 2ZAHA 4G80A 4WQOA 5BZWB 5TGBB 3V6ZA 3CFUA 2OTUB 2FB4L 3DMMA 5FYJU 1MPAL 5IK3A 3F01A 3SCMD 3W37A 1QLEL 1O7SA 2B1AL 2F5BH 4JDZA 4M7ZC 4X4YB 2BS9A 1EO7A 4ORZC 1OAZL 4WFED 3FFCB 3G5YB 4N87A 4GO8A 1UVQA 3SKMA 2JCCE 1YMME 1E2VA 1S7UB 3IRCA 3NCMA 3O9WD 3F65A 4OGAD 3CH8A 4EEEA 2EUWA 2ARJB 2QPEB 1SF5A 5DUMH 2HX8A 3DROB 4S1DD 4I0PB 4S1SH 2J3SA 4TNWK 2QHRL 4A7QA 2GG1A 2WWKT 4EOWH 5D72H 2ITEA 1DJHA 3T2LA 1ESOA 4OUUA 5LAPA 3SKJH 1GGBL 5GRUH 1DE4A 4KUZH 4L0PB 4HWZB 1UD4A 4PP2B 4XWOC 1N4XL 4NNYB 3QUXA 1RUKH 2XBTA 3MACL 4LARL 4PJIE 3VFUB 2DKUA 5KYNA 2IDSA 5I74B 1SMDA 2W95A 4YHYC 3D50A 5DJCB 4B5ZA 4ZOAA 1TKWA 5E2UL 4G11A 4FA8A 2EIEA 5EOQL 1LO3L 2EUVA 1NANH 1BQHB 3H6JA 4PJDA 4X9BA 3K6SA 5DJZB 5I0YA 4KX9A 4YHIA 1ASOA 1GIGH 3I2CH 3LJ3A 2VM9A 1UH4A 4P05A 4KJQC 4D9LL 1I9JL 1NLDL 4ODVH 3X3FH 5K5YA 4GMSL 3KYOB 1EAPB 3CQQA 2VDMH 1YEJL 3NSJA 1MQKL 3A23A 1JAEA 3OQ3B 6FABL 2NSMA 5KBMA 2O6EA 5HHMB 4AKOA 1UXMA 4HEPA 2H32B 1AG6A 3CZUB 4EZMA 3TNNA 2VDQL 1NA8A 1QSFA 4NOFA 2QQLH 4P2RD 2V33A 1SOKA 5C0AD 3TT3H 4EBQH 3HFML 3E6FB 2GCYA 4XCNA 2DEWX 3CSBA 3VQ1C 1BQ5A 5EU6A 5CWSA 3DK0A 2VSCA 2ICWJ 3E38A 1WGVA 3EBIA 3OJVC 4G72B 3U48A 3UYPB 3QJSB 4LSVH 4R8WL 2NY5C 5HYSG 3FQNA 3MXVH 3VA2C 2X6UA 1XH0A 3QJFA 3F7PC 4JJOA 5I17A 4I3SH 1YYLL 3N5AA 4IK6A 4GLRH 1AQDA 4QY8A 1RUQH 3SKNA 2X4OB 2Y6SD 3IAGC 2E75C 2K8QA 1EO5A 2Y3NA 1YEEH 2XIIA 4QHKJ 5FO7A 3U0PA 3FRPA 4MAYB 2PYFB 4PRBB 3U82B 5IEHA 3CMOL 3NJGA 4ZX6A 3ZYOA 2P8LB 3CFJA 3MBWA 3TL5A 5TDPB 1QPPA 2Q87A 3IMVA 3Q5YA 1BOYA 1IVLA 1PAMA 2YRZA 4J1UB 1EDYA 4MVBD 2R29L 1U8QA 3GJEA 4LCWD 4N8CL 5AZ2L 5C70A 3KVQA 5B1BB 2EEAA 2Q5BA 3HUJA 4IKJA 4HPYL 3WIFA 4IDJL 2YKKA 2VABA 3J07A 4ZFOB 3MPCA 1JPGB 3SB3A 4GW1A 1PQZA 3NJJA 5F9AC 4HUMB 1TT6A 3REVB 5GGRA 1EFXB 1NWOA 1L9TA 1KYDA 2ICEB 4M7JH 2YQ3A 3D8MA 4B95C 1JDDA 2F8IA 3WE6B 2DL9A 3T71A 3VXRD 1W6LA 3KLAA 2V7HA 2DAVA 4WI8A 5C0CE 5TF1L 4MS8C 1B0RA 4PJGE 1T1XB 3ZE2B 1JGIA 1KBGH 3MROA 4X98B 1A3ZA 4IEFB 3D4YA 1S5IH 4N0CC 2O26U 4FYTA 1KLFB 5DZOA 3UTSA 2IG2L 1S8DB 3S2CA 2J2ZA 4FL4C 1CIUA 2JB6B 2AI0L 4NUGH 1SZNA 4Z0XB 3EGSA 3IFOA 3MQIA 4HUWB 4Y19E 5TK4A 4AV0A 1G9MH 2W81C 4APQC 2DY2A 3QZOA 3MLSH 4K3DH 5FV2A 5B7EA 5C0BD 1A7BA 2DL2A 4IS6A 1YNTF 1Y07A 1ACZA 1DUZB 5JMRA 3LS5L 1M2VA 1IE4A 2ZSWA 3GWJA 2QADD 2HVJA 2HN7B 4YK4C 3LKRA 2YRPA 1HZKA 1JGUL 2XZZA 4M3JA 5EWIL 3V5HA 4DGUA 4F7KA 1FNEA 5E4IA 3WAKA 5I1IH 4OM1L 4BZ1L 4Z76A 3QFJD 4N8VG 1TJXA 3ARDB 5GS1B 4AMXA 2GW5A 5CGYC 3EBHA 3V0VA 5CGBA 1TTRA 3Q3GA 1NFKA 2GJZA 3JV6B 3T04D 4QNPF 4UQ2A 3V55A 1M7IA 1EEQA 4JY4A 4HIEA 3TV3H 1UJ3A 1QUNA 4NNXA 4FQCH 3JUZA 3QDJE 1PDKA 1AZRA 3EDJA 1RIUH 4OF6A 4PR5A 1HI6B 2E7HA 4H2CA 3S3PA 3PYCA 5K9OB 3HG3A 1FVDA 4JRXB 3OHMB 5BMFH 3IDNB 1IVTA 1E3XA 4R2GB 4CAGA 1I1YA 3GTNA 4HS3A 2HLAB 3BPCA 2C9QA 4LGRB 3CDZB 3ZDXF 1HVXA 1J9TA 1IIKA 5IGXH 4JFOA 2XCMC 1TJIL 4K5MA 5E00A 3MLVH 5GSVA 3PP3K 1FGVH 1J8HE 5JOFB 2Z64C 5DTFB 3VH8B 1MVYA 1J87A 3TBYA 4XP5L 1AHWA 4P46C 4KXBA 4OCNC 5CLYA 3V10A 5KSBB 1AXSA 1N19A 4ZPVB 4U6XB 2VDPB 4HOMA 2CMRH 3MNWB 2E4FA 2I7OA 2Z0BA 4ODHH 4ZS7H 2AQTA 3WAJA 3ARFA 3F6JA 3G5ZA 3MOAL 1CDCA 5I15L 4AEIH 2O72A 3G04B 4GQ9H 1QLEB 2IXQA 3GSRB 3ZE1E 4XO5A 4IU2B 3BSZA 4AYFB 2H26A 4AZ8A 2V0AA 1P2CB 2WMPB 2VW4A 2A7BA 3JTBA 3F7LA 3RGHA 4FAAB 5IHZB 1Q9WB 4FS0A 3I50L 1ZHKA 5LVEA 2GT9A 4OLYH 5IUCA 5B38B 3B8SA 4TSBL 5MERB 4OR1A 2ITCA 3BDXA 4JFZH 4TXVB 3IKCA 4PJFF 1FZKB 1QRND 5D6CA 2NR6D 2FBOJ 1BFSA 2H6PA 1DBBL 4CBZA 2G5UA 2XWBB 3QH3A 2CIIA 3HZKB 1RZFL 4GYBA 1JN6A 4Z7UE 1NAMA 1BVZA 5HYSA 1M71B 2C3GA 3MLRH 1HKLH 1SOXA 5EUKB 2C1PB 1MVUA 3SGJC 4P5KB 3UGXA 5C8JA 3QRFM 4FFYH 3FU7B 5DXWA 1KTDB 1IBZA 4PG2C 5FGBA 1KOAA 3SYCA 1IQWH 3Q6GL 2R83A 2IDCA 3T65A 5KAQF 5AKSA 4K4KA 4PIRF 2I24N 3MLTB 3TONA 4ZMXA 1KYOJ 4KJPD 4L8BB 5SX4I 1GYAA 2EYTA 2GFBA 4PJ5D 4FXKA 1P9MA 1D5MB 3CD4A 2JTYA 1OTUC 5ITBL 4ELMB 1KPRA 3W38A 1OV8A 3IJYA 4GEJA 3NCJH 4KC3B 1T7ZA 1W16A 3BZFA 4KXCA 2P24A 3V6ZB 4OCYL 2MHAB 4R96B 5DRNA 3KPLA 4YHMH 4HK3N 4OV6F 1UXWA 2ZX8A 1VDGA 3PV6B 2VERN 3U0WL 5C2UB 3ZTJH 1A8ZA 4URKA 4JG1H 4M1GH 2JKRM 4JDZB 3DC0A 3ECVA 5AW0B 2EUXA 1GYCA 5ACLA 3S7GA 2FX7L 3ARSA 3E8VA 3FUDA 1UVQB 1X5XA 3SKMB 4ZTPL 3FSZA 3F04A 2HFFA 2HP4A 3EYFB 5FXCH 3GK8L 3QO1B 1DVYA 5AW7B 1U4FA 2QT6A 2YJQA 3G5VB 5DS8B 3WE1A 4N0RA 1QSVA 4N8UA 2A6JA 1H5BA 2G5BA 5HYEA 2DWTA 2UYLA 4YLCA 2X1PA 1NPUA 4W9HC 3BLKA 4HWUA 4NFCA 1HQ4B 4I9XA 3BISA 3HLKA 1A6UH 1J8RA 5DQ9A 4N8PA 2XZQH 3IXTA 1HH9A 1Q8MA 3P9LA 4OUUB 2EDTA 5IR1A 4Y5XC 5KYXB 1R19A 1OWRM 4AGQA 1Q94B 4C54A 3IU3B 1RQ5A 2RALA 2BP0B 3ZR5A 2APTA 2MKLC 3QUYD 5IQ9A 3P69A 1NL0H 1RCYA 3GS4A 1MRFL 4TRPH 3IGAB 4WY7H 2ZAGA 1WZKA 3A21A 3QIUB 4EKJA 2ZWKA 4FABL 3BKMH 4QHMB 1XR9A 4B9GA 4XP9H 4LSDA 4DIXA 1UADC 1YLBB 1TKWB 2APSA 3MSPA 2Y2TA 1KBKA 3BPLB 4J3OC 5DJ8A 3BFWA 4N8VA 3HG5A 2IAND 3RTQC 5I8KH 4NN7C 2VR5A 1YEDA 4KMTL 2DH3A 3KL5A 4PJDB 3K6SB 1QOKA 5EO0B 1VFOA 1FFNB 4YHIB 3HE7D 3WN5A 1KFAL 1VERA 2DKSA 4UM9A 3VM5A 3L7FA 1YQVL 2A74C 4AQOA 1MXDA 2D3NA 2D2CC 3MRNB 4KDVA 3O11A 3MCG1 3MYJB 4ANUA 1DBKL 2RGSA 5D1XB 4AEFA 3HRZA 2Y07H 5DC9B 3LRGA 3RZCC 1D2PA 2J8UA 2P43B 3N41F 3SPJA 4Z1PA 3KLKA 1QSFB 3GJFH 3QDHA 4NQCA 1JVOA 3ABGA 3N1GC 1P6AB 2RQEA 3F2LA 4NZTL 2UV3A 3VRIA 2GCYB 1WICA 3WNNA 4HXAL 3SDDC 3HS9A 5EU6B 4Y2NA 1JMXA 5CWSB 5FYLH 3KR3H 1I8UA 2XRAL 5E1AB 5T3ZE 2VRKA 5KANI 4QAWA 2W9DH 2AKRA 1T20B 4PB0H 5H4YA 5D6DC 1YMMD 3D08A 4KKBC 4LRIC 1YEKL 2F8XC 1QLFA 1AD9B 3MLYH 3FUNA 5ID0B 1E4XH 2VMDA 1DLFH 4QY8B 4XO8A 4U31A 3V52L 5CD3B 5HYQA 2F58L 1C8QA 4MQXD 4CMMA 3FZUC 5FO7B 5ENWA 4K23H 3ME0A 1B2WH 3EJJX 4OD3L 3KVDD 2ZICA 5D4QA 4PVLA 3CBRA 5IEHB 2B59B 4Z8FL 3EFFA 3CFJB 4KZDL 3G08B 4P48A 3MBWB 1JL8A 3QXWA 3AY2A 4UBDD 3TWYA 3QXAB 3P4NB 2OMYA 5AVZB 2APBA 5E9DA 2F53E 1U8QB 3GJEB 1DJXA 1CICC 2C4XA 1MG3C 3HUJB 3R06B 1KIUA 1TTBA 3SQBA 3OJDB 1QQDA 3U4KA 3UMNA 2EH7L 5F7HA 1PLGL 4GW1B 1PQZB 4Y16A 1IB5A 3D0LA 1RFDL 4H26A 1IKOP 2EEBA 3KWWB 2P9RA 3WNMA 3QISA 3FW6A 1C08A 3DYOA 4QJ3B 1DJIA 3KLAB 3O6ML 5F0LB 4X7SH 4L4TA 3HBZA 5KVEH 2X3CA 4UYPA 5FYJL 2EXSA 1B0RB 4XBGA 5CXPA 4GKZA 5C0DA 4ODXA 2BNQE 4QD2E 4LVEA 2Q3AA 3RFZB 4WCYH 2C26A 1QW9A 2J73A 1ZIBA 1NCCL 2XTJB 3DSNA 4NKQB 4C56A 2XTSA 1A3RL 2J2ZB 1IFHH 5F9WB 4LSRH 3SSGA 4S11A 4MYWB 5IJKA 1LE5A 4B6ZA 3T9WA 1SEQL 4KKQA 5BUPA 1HIMH 4IKIA 1R3LA 3Q44A 5BVPH 2RCSL 3IFOB 3V5DA 1LGVA 2CRYA 4J23A 4JHAH 1ORQB 4Q6YA 3DSFH 2PPDA 1CU4L 3DI3B 1P84J 4IS6B 3RRQA 3AWEA 1MF2H 3KM2A 1TEGA 3L1OH 3IM1A 4WWOA 4XO4A 3LKRB 1U8JA 3UIYA 8FABA 5C0IA 4HT1H 3SPCA 3V5HB 1FNEB 5CJXC 4NUPA 2DQJL 2ICES 3IMSA 1ZLVH 2UXTA 1N12A 1VA9A 2WLYA 1MHPL 3OC5A 5I8CB 1WFJA 2Z8RA 5T1LA 4CC0A 3V0VB 5HP5A 1WIUA 1FN4B 2O5XH 4OZIA 2VM4A 4TYUA 5GGVY 1K8IA 2HH0L 4X0KB 3VI4A 1M7UA 3I6SA 4DCQA 2XT1B 4UQ2B 5I1KH 4JY4B 4HU8A 5CBEA 2OMZA 5EA0L 5EH1A 3QVAA 5K59E 1R5IA 1NMBH 3NSYA 1JBJA 3VUAA 4XT1C 2DQCL 1X5AA 1KN2H 4PS7A 1CMOA 1LO2H 1FVDB 4LPVA 1AACA 3PDOA 2FX8H 3OAZH 1JZHA 4U7KA 4HS3B 2BY0A 4ZS6C 3TJPA 1KYAA 3SPHA 3BPCB 3BVWA 2XETA 3MUZ1 3DURA 1AAJA 4AZUA 4N1CA 2VXTL 4ES9A 4YDVA 3QXVA 1EXUB 5E00B 1BAGA 1FDLH 5GRYA 2J20A 5C0CD 4NO0D 3DPDA 4GRLB 5E51A 3VE0A 4ZJ9A 1J5OL 1CLOL 1GSKA 3TBYB 1AHWB 2VC2L 2XXGA 4YC2B 2EO7A 3UC2A 1AXSB 4P3DA 4PJ9D 2Z9TA 4G83A 2NZ9C 4NKMB 4R7NB 1BZ9A 1CF8H 2H7WA 2GBVA 3DX8A 3DOIA 4ZDHA 3WJLA 1W80A 1OCWL 1S9VA 4GAYB 3ARFB 3I74A 3SQRA 2ROYA 4X2UA 4PRPE 4Y19D 1VKXA 2NY3D 3MRHA 1TVBB 2IXQB 4J6IA 1KTRL 1XEUA 1LP9A 2DJUA 2DQIL 3BZ4A 4MNHA 1A2YA 3MDJA 1IKFL 4AZ8B 4XMUA 2I60H 2Y7QB 2NX5A 4R3SB 4YHPA 1KN4L 1QTPA 3CFIC 2CBQA 4DN3L 2NY4C 1HX0A 1ZHKB 4PRNB 4ZG1A 5CIPB 2FIKB 5DS2A 5FHBH 2XX1A 4A7GA 2NY0B 1PNDA 3S3JA 4N2LA 1IGTA 1OAKH 2VDLH 3K74B 2WP3O 5D6CB 5E0QA 2DWEA 4JHBA 1QKZL 3VXUA 1KGYE 4WGVB 4N2HA 3QH3B 3MGAA 1G4RA 4FOMA 5D55A 3CFMA 1BGXH 4UWQB 25C8L 3AMLA 3D39A 2WVVB 3EBGA 1I3GH 3D52A 4XWOD 1RZ7H 4FULA 4M1CD 3LS4H 3QDJD 4Y4FA 4ZUVA 2P52A 2P5EB 4QRPA 1FCGA 1T89C 2GPZA 2Y5QA 4TSCL 4P4RA 1IAKA 3X1FA 3PHOB 2ZCHH 3DVGA 2EEFA 1GRWA 3UDWA 1KWKA 2EH8L 3DOSB 4P06A 4Q9RH 2EYTB 2GFBB 1I9IL 3KDMA 4FXKB 4U7MA 1FA4A 1PL3A 4RA3A 2BY1A 3FCUB 1KPRB 1UCBH 1WISA 5I74C 3BRFA 4ZUWB 4RZCA 1J8HD 2YUXA 3JYBA 1NWPA 4YBLB 3BZFB 3QDGE 4KJQD 4O4YH 2HKAA 1A7QL 2X3AA 2FWOA 2ZOWA 4R90H 1RUPL 4MSWA 4ACPA 5A16A 5K9KA 4X99A 3HE6C 1DBMH 1E5CA 1NBYA 3L2MA 4HV8B 1ZT7A 4F7MA 1GC1L 1D9KA 2E6PA 5I1GH 3VTTA 1ADQH 3PABA 2HFFB 3DV6B 4MZ3A 4WTQA 3TNMA 1CFVH 5JQ6L 4XXWA 1XH3A 4YFLF 3RTLA 3S88H 2ZP0T 1H5BB 2G5BB 1ZDQA 3D4GA 5AVWB 4JGUA 2Q7YB 2UYLB 3BEWA 4JY5L 1OIOA 3DX1A 1KJVB 5DD0L 4ALAL 1WZ1H 3OAUL 3PWUA 3PWPE 1TFPA 3C8DA 1H3PH 2FSDA 5EEWA 3CFTA 3IXTB 3SKOA 4GBXD 5EC1A 3P9LB 4NWUH 3B2XA 4O2CA 3MRLA 3N50A 5IR1B 2CK0L 2F0CA 3HOGA 3WOVA 1XSKA 2BOLA 1Q9KA 4HK0A 2X4QB 5IQ9B 4DSYA 1GMIA 3CC5B 3LY6A 4QTIH 4QT5A 4KWUA 3FOLB 4QXGL 3CCHA 3RFRA 1FBIL 5F0JB 2WN3A 4FTDA 4NQDB 3H9SE 1IAOB 4DQAA 1WDAA 5HVHB 2WIMA 3CN1A 4XP6L 4UNVA 1SDAB 2Y1YA 1GGCL 2YAPA 1Y0LB 5DJ8B 1MRCL 1XGQB 4N8VB 4DGYH 4E36A 1TZGH 3AUVA 4NKIL 2G60H 3WFBH 4AE1A 4XR8C 1YEDB 4H25A 4JFPA 1HZHH 4RETB 1TUPA 3VD2A 1RHHA 2V2WA 4UM9B 4M4RB 5DVPA 1MFCL 2CRMA 7PCYA 3FUHA 1JRHI 4MS8D 3KW7A 3IGLA 2BOCA 3O11B 4MD4A 2UXVA 3MV7A 3VWKA 1Z7JA 4F1SA 4QUOA 4YHLH 3Q06A 2Y7LA 4JR9H 4N0CD 5E03A 4HKXA 2J8UB 3QR0A 2ICEC 1K5NA 1HINH 2DI9A 4WHDA 5BW7A 3GO1L 4XPBL 5JO5A 5GJSH 3KHQA 1V3LA 2XTLA 3FDWA 4YDKH 1XZ0B 2ICWI 4ZOEA 4N0UA 3RP1A 2IGFL 2BIOA 1I8MA 4Q9QH 4XN7A 5DUJA 3TFBA 1QLFB 5G55A 2Y5EA 1YUKB 5TTRA 3PWNA 3SBWC 4FZ8H 4NHUB 2VXVL 3EKCA 1C8PA 5HYQB 4BHUI 1I8LA 3DO7A 1NLBL 1MFEL 2ZOKB 5ENWB 3ME0B 4X80H 3P9WB 4XBPA 2KZKA 4QHKI 2Z93A 1Z0NA 4EN3A 2VUYA 2WQXA 4G6AC 2E7BA 1FZMA 2AGJH 4CJ0A 4DKFL 3K46A 2Q6WB 5J6HA 3I3EA 3JVFC 2OMYB 2NTSP 3BAWA 5I16A 4FP8L 1UURA 2ZD0A 5TPWL 3WL9B 4DW2H 5AWNL 4LHUD 4EVNA 1DEEA 3HC3H 4DQOL 4GW4B 2LLGA 3ECBB 5E6UB 1JV2A 4Y16B 1CZ8H 4H26B 1GAFH 5GS1C 6PCYA 2CSPA 4Q4IA 1CQKA 1QZ1A 1V7NL 4OZHF 3B9DA 2N4IA 5A7EA 1R33A 1X5HA 5B1JA 3FN0H 5PAZA 1CD1A 1GYVA 1XCWA 3VFMB 3D18A 3HA0A 4HPHA 4LOEA 4N22A 2JFCA 3BT2L 5GJTH 4L4TB 4N5EC 4XBGB 1E9PA 3NRPA 3FRUA 5C0DB 1U3ZA 1KG0A 5FKPA 4ODXB 3A3YB 3NZUA 2BCMA 5LCVA 2YPLD 3DSNB 3F83A 4C56B 1P0SE 5EORL 2VH5H 4KROB 3S35H 1KV7A 3WELA 3FOMA 2RB8A 1U2CA 3T4YA 2YLHA 2G75B 1W8EA 4R2GC 5MENE 1LE5B 4P46D 5L8KB 2P5WB 4B9ZA 1R3LB 2VC2B 4OBSA 3V5DB 1PD1A 1U8OB 4PLJC 1IAIH 3E6HA 4WHTB 5KW9L 1KXVA 2QKSA 1HWGB 1ZXKA 4TKWA 4G6KH 1MDTA 4HSAC 1ID5I 4BGLA 1UM5L 2IVFC 4UV4L 5E2VL 1JPSL 1D7CA 1AMYA 3ULSA 4XXCA 5T3ZD 1F4WH 1UM4H 4C4KT 3T6XA 8FABB 5BPPA 5C0IB 4I1RA 4NJAL 5GSRA 3BOVA 5HHME 1AIFA 5L6YH 2K3TA 4LLAA 2VSKB 1QFUL 2E7LC 3PGDB 1GZQA 2EDXA 3AT9A 3SGKA 5CJBA 4KTDH 4U1KA 2HZHA 1ANUA 2WLKA 3P9MA 5T1LB 1R6VA 3T6QC 4DETA 4OZIB 1K8IB 5AAMC 2EIKB 1ET7A 3AWFA 3STZA 4DCQB 1AFVL 5FIEA 1K72A 2OMZB 4JPVL 2VQ4A 1R5IB 1CK0L 1YN6A 2F53D 3GRGA 1YHPA 2VYRE 1GKEA 2Z7UA 5KVGL 2OR9L 4L4VE 4GQQA 4TLUA 3PDOB 2EE9A 4IMLB 5GZNC 3FBKA 2PTVA 1AGDA 5HDBF 4KHXL 1YCSA 2WQSA 5LCVL 3QS3A 5E2TL 5FV1L 1UT1A 4PGEA 4DP5X 1MJ7L 3EG9A 1E5ZA 3S8GB 2XWEA 3CN0A 4KKLD 4UAOC 4HJSA 2WZPD 3PAZA 2OXGB 3N06B 2BNQD 2GSMB 4FXLA 3RWJA 4QNPE 1OTUD 1RK1A 3PNWA 4F7EA 2EIMB 1FFPA 2ZYIA 4MXWH 1MREL 2CBMA 2QR0B 3G6AA 5H8DA 3LOWA 3PU7A 1K85A 4IRJC 3DX8B 5DRZA 4ZDHB 4AGMA 2J55A 1XCQA 2WANA 3WCYA 1ZHNA 4HKBB 4TL4A 4NENB 1VKXB 2AQPA 5FGCB 5B8CC 3HS8A 3MRHB 2F1EA 4GXVH 1FNGA 3WJJA 3QEQB 1GS7A 4UIMA 3H8NA 3N1QC 3BZ4B 4MNHB 4RFNC 1A2YB 5SWSA 2YA2A 3ZDXE 5DU7A 4G1EA 4N9OB 2NX5B 2WJ5A 4ZSOA 3HI6H 1NSNH 3DMMC 4UTAH 5CZKA 2FATL 4JO4H 1WFNA 3WXWH 2C34A 4OZIF 1OPGH 3VI4F 2AS5M 4QCIA 3ARBA 1WHPA 2YD8A 5F3BA 3D34A 4NWTH 3ZKSD 5IB5A 1UWXH 1WS7A 4IU3B 1IGTB 4NHCH 1D7FA 3VXUB 5D7JB 3A4DA 1XIWA 3ULVF 1GZHA 5GGSB 3VW3H 5T33H 4Y88A 3RL1A 1WP6A 3KPQA 4R4FH 1JOIA 2D2OA 2BVQB 5TDOA 7FABL 5C71A 3MNVA 1JZEA 2VLRE 2VERA 3MAWA 4Y4FB 5D7SL 1SUJA 4ZUVB 4Y9EA 1H9VA 5LBSA 1OZUA 4Z3FA 3WUZA 3CX2A 1THAA 3MV9A 5DK2A 3QHZH 4QOKB 1IAKB 5EC2B 5F3FA 2XYBA 3TGXA 3A6BL 3UC0H 3DOHA 3QUXC 4QLWA 1I1AB 1TFHA 4Z23A 1VFAA 1FIGH 2JIXB 4PJFE 3RIKA 4TULH 4FNLH 3FQWB 4RZCB 4FEMA 4NRYA 1PCSA 3BPLC 2HFGL 1KZYA 2FWOB 3FHEA 1F5WA 1FZOA 2GEQA 5LXGH 4MSWB 1AGFA 1LP9F 1QEWB 4X99B 2L0DA 1RH8A 2YKLH 3LRHA 4M8UA 4ODUA 1NBYB 5JHLH 1SN0A 4LIQL 5FO2A 3RZCD 2VLME 2UZYB 1DP0A 1SEBA 2AW2A 1FO0B 3IB4A 1NGQL 3PABB 4PRPD 3TNMB 3MRGA 2DDQL 4ZK8A 1CXIA 4GG8B 1JSYA 3NRQA 1XH3B 4A7GF 4BFJA 3U1SL 4N2AA 2L7UA 1WG3A 4O2EA 3BEWB 2Z31B 5I2IB 3QFDA 4KKBD 2WUBH 4H44C 5EN2A 1EJOL 3D85D 3VD9A 1NCBL 3ATBA 3CPLA 3SKOB 1NIBA 5EC1B 4O2CB 3MBEA 1TZHA 4G8GE 2DYRB 3F12A 3FZUD 5AB0A 3QAQA 2VJXA 1ED3B 2N56A 1IUZA 4HK0B 4HUCA 3T8MA 4FCHA 4MNGE 3FB7A 4DTGL 4DHLA 3OSVA 3CCHB 4XPAH 5KSVA 5F7UA 4YWGL 2J6EH 1L9OA 2IPTL 1YPZB 1IC7H 4G8EB 4XMTA 3ZDZB 4A7SA 1PKQE 4UNIA 4Y0GA 3VG0L 3FTSA 4KZEH 2BJML 5KANG 3VFRA 4X8JA 2PW1A 5INDA 4XN2A 2AXJA 3PY9A 3F62A 4CJ1A 3H9ZA 2IOMA 4JFPB 1GH7A 2W59A 3HFFA 3JWNC 1RHHB 3FO9B 5DD3L 2V2WB 4WI9A 1SXNA 1J5DA 2FT6A 4LL4A 3MREB 2YAEA 3IBEA 2ZYHA 1DQDH 4FNTA 3EYSH 2Q9OA 2JQAA 5F7YC 3KH4A 5HGHA 4DGIH 1AZCA 5I1JH 1RL1A 1A6VH 2BOCB 5G4OA 4K9EH 4MD4B 3VWKB 4M03A 2PCXA 4PJCB 4OF7A 3QSKB 3QDGD 5AYQA 4XPHH 3ULAB 4HKXB 1TTAA 1K5NB 3CX5J 4Y1AA 1GY1A 3F5WA 3FQRA 1F8TH 3X1EA 1AGEA 2ENQA 2R4RH 1YEFH 1FAIL 4S0HA 2V3FA 3OHXA 3WEAA 5ALCH 3GLEA 4A1RA 2YBGA 2IFGA 1MCNA 4PJ6A 1MXGA 5L4IA 2R2BA 2X28A 2XTJC 1V7ML 4N0UB 3W9EA 1CDJA 1IAII 1N7MH 5HHXH 1I8MB 5F9WC 2J4WH 4TMPA 4AIZB 2NQDA 4G7YH 4P04A 4FERA 3EOTH 4H0IA 4OGYL 2H45A 1INEL 4FFZH 4E9SA 3MJ6A 4RMQA 4BV1A 4YS4A 3WTVA 2FO1A 5KBKA 2HPOA 5JDSA 1HOCB 4M7LL 4XBPB 3O0RL 4MMYB 3DUHA 3PWPD 4OW6A 2XWCA 2WQRA 4EN3B 3U6RA 7CGTA 3EIFA 5JR1L 1MCLA 2PN5A 2CXKA 2BWDA 5J6HB 3X3GH 1N2RB 2BS8A 3ZQ9A 1P7HL 1T4KB 4PP1C 3AQDA 3RKPA 4EVNB 3JZ7A 3RWCA 3HHSA 5EO9B 1VZHA 3IJSA 4KQ4L 1FIEA 4ONHA 2KUTA 3A6OA 4U0RB 5K39A 3T0BA 1KPUA 1J10A 2D7TL 3UP1A 3VMNA 3V7MA 1Q0EA 3H9SD 3NH7L 4YQXL 1E6OH 2AXGA 4K73A 5FFOA 5H37G 3NJIA 1UD3A 3IETB 1M05B 1QD0A 3DHPA 4H1LB 4PCSA 4L1HA 4ZS6D 1UJ3C 3H42L 1JPST 3NK4A 5IBLD 5TH2B 3FRUB 1BPLB 1KG0B 2ZKHH 3NCYS 4Y2LA 1HHIA 3ESUF 4GRWB 4LFHG 3PGCA 4NQSA 1CT8B 2QTEA 3BP4A 3EO9H 4G7RB 1RIHH 4RMVA 1LDPH 2J8HA 2F5BL 3IF1A 4XBMA 4JEGB 5CZVH 3ENEA 3L2NA 5EZJA 2BMKB 1KPVA 2NZ9D 4CKVX 1CGYA 2WYHA 4TN9A 1QLRA 4DAGH 3VRJA 1BF2A 2OTPA 2P45B 2WQVA 5DUML 1GCFA 5K69A 3AT0A 3U46B 3ULSB 4S1SL 4ORGA 1AHWC 4HJTA 4JNXA 1AQKH 5GSRB 2BNUB 4PJBF 5I1AB 2OCJA 3I02B 5D72L 3ZTCC 1QSEB 2Q8BH 1PPIA 3ETTA 4EOWL 4G8IA 5EF3A 3BUTA 1GZQB 3SKJL 5J6GA 5GRUL 4KUZL 3DETC 2WZ0A 3UAEA 2NY4D 4U1KB 3MLPA 2X7LB 4JUTA 1ZGLA 4YSDA 4CNIB 2A2QT 2QDVA 4HFWA 1RUKL 3RUGA 5GGUB 1QWHA 1E8XA 3STZB 2ZXGA 4WDIB 1ZE3C 3BIKB 3C6EA 1PTZA 2DWSA 1OHZA 1OE2A 2C1OA 3EF7A 4I2XA 4BWWA 2ZOOA 5MEPA 3AQZA 1J0KA 2XKUA 1FL6B 5DHDA 1IJ9A 3CG8A 2HFTA 5HYJA 4G9DA 3W0WE 1AANA 2NY0C 5ILTH 2APXA 1R1CA 2VDOH 4TLKA 5D1QE 3A6CH 2YA0A 1RUAH 4G9FA 1GIGL 3I2CL 2E7CA 4FHKA 1BVNP 1KXTA 3P2BA 1OCCB 4ODVL 3V0GA 1DZ0A 3JWNE 2QLYA 4RIRA 1JERA 2VDML 3EG9B 1SXAA 4M5ZH 5IEKA 5L8JB 4CC1A 3CV5A 4XX1G 4DWHA 2LHAA 5D1ZA 5FWQA 3RWJB 3MNMA 4EBQL 3G9VA 2QQLL 1U6AH 3TT3L 4JCLA 1NICA 3PNWB 4F7EB 5FGBC 1VZIA 1FFPB 4S1RH 3JWOH 5FYKD 3W39A 3G6AB 2GTQA 2VR3A 5MEND 1XGPA 4Y4KA 3GQFA 3EZ8A 3R8BB 1XCQB 5EN3A 3VXTA 1ZHNB 3V4PH 4M6OH 4LSVL 4LPCA 5IV2B 1AO7A 2EDYA 3I75B 4NGHH 4P5MA 3LRLA 3MXVL 5F93C 1ZHLB 3HE6D 2OMUA 3L3IB 1P9MC 1FNGB 1GOHA 2VL5A 4FXKC 4UIMB 4I3SL 4Y9CA 4XN9A 5DZAA 3KXFA 2R23B 1QHPA 5SWSB 3WMPA 3PIQA 1O9ZA 1RUQL 4YBLC 1XF1A 4UT9H 1M6UA 4G1EB 3UTSE 1NIAA 4ZSOB 4H8UA 1G7QB 1YEEL 1MHCB 3QJTB 2DM2A 1O9VA 2NNFA 4QCIB 5HHMD 4D0CB 5F3BB 5IB5B 1N0LB 1VSCA 4FJZA 5DMKA 4WI5A 1IGJB 3HW7A 2FEJA 2X0UA 5I73B 3PUUA 2W0PA 2OXHA 2F68X 1JNNH 3U36A 2N3JA 3US9A 3UTZA 3NCEB 1J9CT 4R7DB 5E4EB 3DVFA 1XF5A 1PYWB 2B5IB 3KPQB 5KSAA 1JS4A 1H5BC 5TDOB 2MTAA 1AYOA 4ZUUA 1LK2A 5DDHB 2XN0A 1I7RA 1Z9LA 4F80A 1D3CA 3WEOA 4M7JL 2VO8A 3NA9H 1K4CB 4PM1A 5T3ZH 4YHNA 5AAWA 4L4VD 5FA3A 5DO2C 1Q9LA 1YAZA 2FO8A 5DK2B 4BM7A 3R8QA 3SE9H 4NEHB 1KBGL 1WZMA 2D31B 1X7SA 5K9QI 4RMTA 1FL5A 4MXQC 4GG6B 1JE6A 1EIBA 1S5IL 1BYOA 5E5MA 2EVIA 3CC1A 3N2JA 4OFYD 2OYLA 4EI5B 2Y72A 1WBXA 2ADJB 3C5ZA 4AVHA 1FFOB 2K45A 2HJKA 2V6HA 4ZBJA 4AJWA 5HVHC 4NUGL 3BUQA 2DMHA 3Q2CA 4NRYB 4ZO7A 5E99H 5INCB 3RY6A 4AK2A 5ESQB 1W72H 3FUIA 1FZOB 1G9ML 1X5MA 3O4LA 5CR8A 1QR4A 2YN5A 1EFXD 3MLSL 2EDBA 4K3DL 5F96H 1A47A 3VGHA 1OF0A 5H37A 3WN5C 1SEBB 2R9HC 1WYJA 3DO4A 4TVSa 3VD7A 4DP8X 3ZXAC 1DSFH 3SDAA 3BWAA 1F1AA 1QVOA 5I23A 2GJ6E 5I1IL 2ZZUT 2CA3A 2YOCA 3HRZC 3VDBA 3VA6A 3QFDB 5I9QC 5L2KA 4Y5VA 2PTUA 3MI6A 3FMGH 3REWB 3CPLB 3VGGA 3CJJA 3JTSA 3MBEB 1TZHB 5IFJA 3TV3L 3ILPA 3GLDA 3GSWA 3Q43A 4FQCL 2PABA 1AOHA 4UZSA 1SMOA 1LEIA 2IGTA 3MUY1 1RIUL 4V2CB 2VZ1A 1QABA 3FB7B 3U0TA 1ERNA 3Q6FA 3TH4T 1YC8A 4QRQB 4P3WA 1MG2C 4TNVF 1F3RB 2A0LC 1RVFH 5BMFL 3BPOC 3QDMA 3IJ8A 3BVTA 2VLRD 1PIFA 2Z91A 4FFYA 3GXFA 1C5BH 3FU9A 4X8JB 3VFRB 5TDNB 5IGXL 5CLWA 3GBMH 3MLVL 1HHGA 2KI6A 1FGVL 4MBRA 3IFLH 5FGRA 1XGTA 3PFQA 4EZLA 2AVGA 4N0YH 5FOBA 5E8EA 5C86A 2OS7A 1JGDA 1DDHA 2HRHA 3Q8BA 1U0QA 4N5ED 5F71A 4PWFA 3U9UA 3VG9B 5HI3C 4R84A 1O75A 1JK9B 1FFRA 4NC0B 4Y16C 1C9SA 5I5RA 5I75B 3P02A 5FF6B 3INOA 2CMRL 3L9RA 4ODHL 4J5VA 1II4E 2A4EA 4ZS7L 4FQXA 4Y1AB 4M7LT 5CILH 2XN9B 3F5WB 3FQRB 3QC6X 2OZNA 1WH0A 2BSSB 1OGAA 1VGKB 2EYRB 3GJFK 5C08A 3OHXB 3PFUA 1JGEB 2YMTA 2VLMD 3K5RA 4PLJD 4B96A 2K4AA 3CPUA 3D06A 1R3HA 3TYFA 4F15B 5ID1A 1XF4B 2YC1A 3UBHA 3C2SA 2CBPA 3Q1SH 4OLYL 1WTGT 5IJKC 4BSWA 3LEXA 3OLDA 3RY4A 4WK4B 4JFZL 3B43A 1X3DA 4O58H 3HC0B 1AYRA 4BXVA 3W3BA 1WD9A 4K71B 4PIBA 3L08A 3U6RB 4NX0A 1T7WA 1UB5A 2DI8A 2FJFA 3BZ5A 4CL7A 3UG4A 1D5BA 1DANU 4G8GD 1CTNA 2VW7A 3UBFA 1KJMA 4OVUA 2CDGB 2Z8VC 3MLRL 1HKLL 2EDFA 3CSTA 1FP5A 4FLQA 2YQGA 4WTZA 3RWCB 2XWTA 4YVNA 4U1NA 4MJIB 1A5FH 2Y7NA 5D4IA 4RVBA 3V95A 3HZMB 1RKRA 1IQWL 2CNZA 3LEVH 1RI8A 1WA1X 3RG1C 3F7VB 1M3IA 2ZUXA 4P57A 4B9KC 2Y06H 4OUOA 3HHRB 5GZND 4UINH 4Q4EA 2V37A 3S98A 2FR4A 1NOAA 4XMWA 1AR1B 3NCJL 1ZTXH 4N2IA 4ONGH 4UNTA 2IWKA 4PWIA 3UAAA 1HHIB 1SDDA 1A25A 1L5GA 4YHML 3OD3A 2VAJA 3PGCB 3I3DA 4NQSB 4AGOA 2VDMB 1U8HA 3BP4B 4JZNB 1WAAA 2X4NB 3IDYB 2AXFB 1NCAH 2C5DC 1S7RA 4JG1L 4M1GL 2D3VA 4W70A 3LZQA 1NFDA 4FLOA 4X9YA 3H9HB 2VR8A 2LAAA 5EZJB 2LU7A 3W56A 4AENB 4HJEA 3ATEA 3ET9F 1JZ6A 3QQDA 4IRJD 3RPIA 4F33B 5JHDD 4OZHE 2XVBA 4LBAA 1URZA 3QJRB 3BZEA 4ORGB 3ZKXC 2PWEA 5FYJE 3L1GA 5E9NA 4UU9A 3M1OA 4YSEA 5I1LA 1KLUA 5E6YA 3CFCH 1A6UL 2XZQL 3QW9A 3ZHLA 4S0SD 4G8IB 5CU5A 3UPRA 1UD8A 2CCLA 1LTXA 3WJLC 4Z7NF 4NQCE 3DMMD 5J6GB 2WUCH 3CIQA 3E8UH 5EIIA 1ASQA 5DD1H 3SHSA 4WO4A 1SJHA 3VWJA 4PG9A 5DEGA 1ZLVK 5HGDA 3B56A 3WO3B 4HFWB 1NL0L 3RUGB 4JZOB 1LQBC 1GC1C 3V6FA 2IMMA 4WY7L 1F6AA 1NUFA 2CM6A 3BKML 4ZX5A 3CXHK 2CUMA 4OCRH 3FPXA 4XP9L 2OMTA 5AFAA 2AP2A 3S35X 5HYJB 1ZT1B 2YQBA 5ADOH 4G9DB 3SBRA 1G6RH 1HHKB 3O9WA 5FFGA 5I8KL 2BFGA 2W9LA 4JFYA 2WOYA 4JVUA 3QYMA 1RP8A 5CEYA 4G9FB 4ILDA 1N8ZB 3MV11 3OAZK 1KXTB 1NPNA 2QV4A 1T5XB 5E9DE 2UXFA 3AAZA 3GZPA 3VQMA 4RIRB 5IEKB 1K2DA 1AS6A 4HEMA 3QUXD 2B0SH 1VEMA 2Y07L 3IXAA 4N9GA 2YBRA 4Y4FC 5D1ZB 3GPEA 3QUGA 4O5LH 3VVVA 3GSOB 2ZUYA 4J3WA 1Y6MR 1GMEA 4NAMA 5EDXA 4ZX4A 4TUOB 4X7EC 3W39B 4MX7A 1XGPB 5FYLL 3KR3L 5J56B 2ICWA 2OP4H 3UDWC 1MI5A 5IJBC 2W9DL 4PB0L 1XGZA 4YPGA 1G6VK 2VL5B 1XHHA 1Z5HA 3MLYL 4GUPA 1E4XL 1SJXA 1W0WA 5HDBE 4OV5A 1TYEB 1DLFL 3PIQB 4BHUA 4C56E 4DP4X 4FZEH 1HCFX 2ZWYA 4IOIB 4K23L 1E9OA 1B2WL 2QKIA 1FV1A 1FZJA 2EO1A 2XFGB 3EYQC 4XNXH 2E6QA 3S4SB 4PJ7F 5E6IA 3NK3A 4AG4H 5MEQA 3NJMA 5DMKB 1B90A 3GI8H 3K2IA 4XO9A 1D9KC 1Z0MA 5IHWA 4NQUA 2OXHB 2PR4H 3KAAA 3U36B 1KCBA 5DO8A 3K6NA 4NXSA 4EMZA 4XXWC 2X2IA 2Q8AH 3NMEA 3ISWA 5DLLA 4IDLA 3S5YA 3MTXA 5E8PA 1I7RB 3KBPA 5DCCA 4HXBH 5B39G 2CGZA 4PYHA 4W9GC 3CLWA 3W0WD 3GXPA 4YHNB 5FA3B 4X7SL 2V9TA 4BWUA 5D1QD 1Z9NA 1UT2A 5KVEL 4OJDH 5LHDA 2A77H 2O5NA 3Q2LA 2W07A 4YNYA 3ZO0A 4OZIE 2WZ5A 3VI4E 3HN5A 1A7NH 2A99A 1FL5B 4X6CF 4HCRH 3JV0A 4WCYL 4AYSA 2HMIC 5E5MB 4RCAA 3N44B 1F3JB 1IFHL 4LSRL 4PJXA 2G9KA 3C5ZB 2OR7A 1IBFA 4Z3TA 4BFGA 3ULVE 1NCDH 2LU3A 4C55A 4GAAA 1HIML 3ILEA 5BVPL 3LKOA 2A38A 2O93L 1NMCB 4YVUA 4JHAL 2CM5A 3EO0A 2OA9A 3DSFL 5C0RH 2QQQA 4DJMA 2E8ZA 2C9VA 1MIEH 1MF2L 1VRSA 3VXQB 3OKOB 5D7LA 3L1OL 4XHJC 2AV1A 3FUMA 3RILA 3IDXH 4RWHA 3WY2A 3BD4A 1YY8B 4HT1L 2Y25A 3SDAB 1H8OA 5MHSE 2BERA 4ZNCD 3VWKC 1A7OH 1DSYA 1M7DA 1XD0A 1QWUA 3LQZB 3GBNH 3UTSD 4KRLB 5L2KB 3SYAA 4WNQA 4OZGB 1F3DJ 4Y5VB 2X40A 4U1IA 4FG4A 3Q13A 4N4YB 5AB1A 2I69A 2O5XL 5BW7C 5AOJA 5KS9A 2VZVA 4LEXH 4GKNA 4WWKA 4Z0BH 5IFJB 4WV1B 5I1KL 1HHJA 1L9QA 3ILPB 4Q52A 1LWRA 1PSKH 3GSWB 1C12B 4Z7WB 4WW1A 5FYKH 1LP9E 4KKCC 1NMBL 4PWHA 4Q8BA 4DGVH 1VENA 2F5AH 2GBUA 1KN2L 2JK5A 3BAJA 3U0TB 3Q6FB 2NX5E 1X4YA 1SVZA 4M6NH 1LO2L 1NC4A 4PP1D 3RNKA 2FX8L 4P9MH 1I8LC 3NPZB 1CE6A 4TVPH 3ROOA 5JW3H 1UD5A 3QZWG 4GS7B 4EN3C 3IDGA 3O3AA 4BD4A 4NLHA 1BZQK 2BP3A 4W93A 1FDLL 1YAIA 1RSYA 5CJQH 3VXOB 1XGTB 3E2HB 3EUDA 1K8DA 2FL5A 3QFJA 2OMBA 4HJUA 3SIKA 5FOBB 3D39E 2BO0A 4KY2A 1DDHB 1XF2A 4RAVB 5J89A 4OM0H 4NZUH 5F7KC 1OARH 2DF3A 3ARGB 3CGTA 3U9UB 4BQCA 2KDYA 1F13A 3D69A 5J06A 1CF8L 4RZKA 1WCBB 1UKSA 2AJVH 2Z92A 4I89A 2WVTA 4QRPE 4FQXB 4LOUC 5B1JC 1EBPA 2ADFH 1OGAB 3LH9A 2RIKA 4WHYH 2YD3A 5C08B 2E59A 3WIIH 1IZJA 1S3RA 3SE8H 1DHKA 3T0EB 4JKNA 3CHPA 2ZWSA 4BUQA 4DK3A 1ADQA 2I60L 3EOAB 2EADA 3LZLA 3TYFB 3II1A 5ID1B 3CLEH 2H2PC 3UIZA 1G7HA 1T2QH 3KJ4B 1MFDH 5FHBL 4NC2B 1J48A 4PVBA 2GJ6D 1NCJA 3DI2B 3U30C 4E0RA 1DFBH 2VDLL 1OAKL 4JRWA 1M1SA 1B9KA 4K0OA 1KXVC 3DYPA 4QLRA 4JGMA 1JZ2A 1U3NA 3NGBC 1BGXL 5AW9B 1UB5B 2FJFB 3DETD 1JDAA 1D5BB 3QXUA 3WBDA 1UQSA 1KJMB 1PFCA 1I3GL 4L2YA 4PGZA 4XXCC 1TPXB 3O4OB 1RZ7L 4JO3H 3VXSB 1DDTA 2LFGA 3L6FA 1IEBA 2WXPA 3LS4L 2XWTB 4KK9C 3FH5A 4H4NA 4PSRA 3FUKA 4U1NB 5FFLA 5H35A 9CGTA 3V9CA 5L7XL 5LLIC 2OYKA 4AGLA 3IFNH 3HNTH 3K6OA 2X4PA 4NRXB 5E7BA 3SGKC 1HWWA 2BZCA 1A6WH 4KY1H 5GRZA 3VRLF 3GMRA 2WWKO 3ARRA 4PRHA 1KIRA 2NW2A 4R5TA 4GP8B 3FT4A 5HPMA 3L17A 4Q9RL 1VJSA 2BK8A 1G7PA 3LSOA 3FT9A 3X13B 2X9YA 4FF9A 3TASA 2Y7SA 3TBSB 4XMPH 1UCBL 2FR4B 3HAEG 2WYZA 4AUUA 1PMYA 4O4YL 3CZKA 3WMQA 3A22A 4XPTH 3RYMA 2BVEA 1QRNA 1CLYH 1NEZG 2NR6A 2X4RA 4A6YH 4IHBA 3GBEA 4R90L 4ZFFB 1IQDB 1U8HB 4ZOBA 1UTDA 1KJ2A 4Z78A 1DBML 1S7RB 2OLDA 4TUUA 3MV01 3NCCB 2HLFC 2I25N 3GJFB 5I1GL 1R5WA 4Z7QB 1ADQL 3IJ7A 3B3IA 1CFVL 2KLRA 2N01B 5DRWA 3S88L 2HVBA 2Q10A 3U4EA 3WFCH 5CCGE 2VE6A 1OF2A 4UU9B 5ABZA 2WLNA 5I1LB 3ECWA 3MV7E 1KLUB 4IGBA 1WZ1L 2XUWA 1TVHA 4EUPG 1H3PL 1ZVSB 1GA2A 2F74A 4PJ5A 5ITFA 5HJ3A 4NWUL 3KLDA 5EIIB 2Q1EA 3CK0L 1SQ2N 2AANA 3VYOA 2D9QB 5DEGB 3VWJB 1QX1A 4LGSB 4AJ0A 4AKQA 5JUEH 3WJJC 4ZMLA 4LLMB 3D1MC 4QTIL 4JFDA 3V6FB 3GBDA 5AQ0A 4EXKA 4N0UE 1QAWA 3SCMB 1FORH 3IT8D 1QBMH 1MNUH 2FT8A 5IMMB 4NO5A 2O5ZH 2DYSB 3ARBC 4BGDA 2OJEA 1OSZA 4DGYL 3KPOA 4CGTA 3O9WB 1TZGL 4J8RB 2G60L 3WFBL 3GUFA 5I18H 4Q58C 5I19H 3W11D 3LNFA 2IMNA 1HZHL 3RB7A 5I73C 4B97A 4PJBE 2QPDB 2WVUA 3X11A 4HKZB 1XIWC 2YD6A 1GZHC 2CO1A 4R0LA 5DO2D 3ZHKA 4ENEC 2W8CA 4KJWC 3KGTA 4YSUA 5E24E 3ERXA 2EDMA 1WAAF 4QI3A 1DO6A 2BSRB 1K2DB 1DVFA 2CR0A 2OCFD 5CCJA 1NBZA 4OJEH 3EH4B 1NFDF 4MXQD 4YHLL 2RACA 2BH0A 4JR9L 2YBRB 4FNRA 4Z7QF 1XTLA 1E4HA 1HINL 4HH9B 3PDGA 2IDFA 4DPBX 1GOFA 1QTYT 3QUYA 4PN6A 2Z0UA 1X4XA 2GSGA 5DHYA 4LASH 5GJSL 1T6WA 4N6RA 3DV4A 4QRBA 4YDKL 2MIZA 5DJYA 2AVFA 4RQQB 5EV7A 5HDRA 1P84K 3BP7A 4PWJA 5EOCJ 2VN3A 4Q9QL 1DVXA 3BIBX 4PVNA 4OFIA 1LILA 4FFWC 5BQ7B 1W0WB 2C3VA 4PY7B 4FZ8L 5EBWA 1NKRA 3AB0B 2AJZA 2YFOA 3FL7A 4FKEA 1T66D 4A2HA 3ZZQA 5FYJD 1NUNB 3D3VA 4XTRC 1E9OB 4X80L 1Y18B 5K9QG 5ICZB 4HF5H 3K7UA 2GI7A 4PJEA 1E28A 2K6YA 4MDIA 5MEQB 2AGJL 2FQDA 3L4WA 3TBTB 2CGYA 5SV4A 3WY1A 1Q1JH 1CL7I 4NQCD 3TYGH 2Y5TA 2AJXH 1UWXK 1TU2A 2O61B 2ICCA 4M61A 5KJ7E 4DW2L 5BS0E 3HC3L 2JQZA 3CU7A 4P2RB 3OR7A 5C0AB 2EIZA 5HHPA 4JRLA 4KK5D 3TF4A 3Q8EA 3QUKA 1IBBA 1CZ8L 1TTFA 2VM3A 1GAFL 2AK1H 5E8PB 1T1YB 1XR8A 4GSRA 4OQTH 1R0AH 1RPUA 4QRUB 3P0GB 4B9JA 1IEHA 3L9YA 4ECNA 3FN0L 1JK8A 3J27A 2A0LD 5LGHH 2JCCA 1YMMA 1IM3A 3MBEC 1SMAA 1Z9PA 5GJTL 3ZQWA 4HWEH 4ZXBA 2W07B 2ZIDA 4UQAA 5BV7C 1DQVA 1HTYA 1KXHA 3GYRA 3UBXG 3S36H 1AJ7H 4LOFA 3QQ4A 4DN4H 3WKPA 4XCCH 4JGNA 2OMNA 2VH5L 5E9DD 3C6SA 3MLWH 3S35L 4PJXB 3GB7A 2XFXA 5F1SA 4AIXA 3FULA 2VLJA 4S2SA 4L8CB 2HX9A 1TJHH 4FRWA 3MRCA 5HI3D 1IAIL 1EJ6A 1BW8A 1JF1B 3RX5A 2FEEI 3EO0B 4LCWB 1X9UA 4G6KL 3HBQA 1I1RA 2FLMA 1BDYA 5D96C 5IHBA 3ZPDA 3MJ7A 4FFTA 2AV1B 4NUQA 1F4WL 1UM4L 2FNBA 3K71A 1KBWA 3KLSA 3RNQA 2XPYA 4C47A 5L6YL 1Z32X 3B5HA 3VXRB 1U8KA 5GQBA 4ZNEA 5I75C 3MRJA 4XZUA 3WNPA 5K1NA 3BW9A 4IRSA 1NEZA 2KH2B 4C56D 1C7SA 3QQNA 2Y4SA 4KTDL 2YGPA 4U1IB 4X42A 4HQQH 2PP9A 2IGLA 4D0DA 2OKMA 5F7DB 3OHXC 4GKNB 4WU7B 2VDLB 3M7FB 3TO4A 1HHJB 2N1KA 4HISA 2WJ7A 4WW1B 3N40P 4LIQE 5FA4A 5SWSE 3C9NA 3V0HA 2JK5B 5I6OA 2YXMA 5A2IH 4NKDA 3CZJA 5B21A 4KDWA 5F9OH 1GZPA 4ZSOE 5AOKA 4L2LA 5C0BB 1SLXA 3ZKNC 2H1LM 3GS7A 1CE6B 4GO9A 2GJPA 1N68A 1X7TA 4EUPA 1I8KB 4JJ5B 1D7DA 1OAYH 2PO6A 5DJ0A 2DIJA 3O3AB 2YUWA 4GNKB 4OZ4A 3S2AA 3P73A 5T1LD 1NM9A 1F0LA 1K8DB 3ESOA 2FL5B 3QFJB 4XRCA 1AQ8A 3U1QA 2A9BA 3TURA 4H0HB 2WIIB 3SBPA 4CMHB 4EKXA 5SWZA 4LAJH 5EO1A 3W82A 4MXWL 4N2EA 4YPJA 3KYMB 3P0YH 4NZDA 3ULVD 2KERA 3WY4A 3TIEA 4H7VA 3APCA 4GB9A 1A8JH 5FDWB 3MV9E 5EZOH 4GXVL 2CKBH 5JHLA 2QVIA 3R4RA 3KPMA 4KV5F 4NZRH 1WS8A 5C0EB 2FT7A 1JZJA 4DO5A 3Q5TA 3BSHA 3Q48A 4NYLA 3HI6L 1NSNL 4UTAL 4ICWA 4JO4L 3WXWL 3DIFB 5KBPA 1G7HB 1OPGL 5KS9F 3IDYC 4W9KC 5MHSD 4NWTL 2PF6A 5BRZE 3KPPA 3MCKA 4NO0A 3ASOB 3S5LG 4NHCL 2ORBH 4NNPH 2P4AB 1TEFA 2OV0A 2XHNA 4YSCA 4GOSA 4OCWH 2VIRA 1F97A 1ZD6A 3DX3A 2BZDA 2WNGA 3CBKB 4QXUH 3VW3L 4NFDA 5T33L 4XO3A 2YRLA 4JKLA 3NIFB 1SJEB 4R4FL 3WLBB 1UQSB 5EUOA 4PJ9A 3TP4A 2PKDA 3OKEA 4ESKA 2XBDA 1X5FA 2UZIH 3L6FB 5A43C 3GMQA 1JXKA 2BC4B 4HUXA 4KNSA 1ZT4A 2EIBA 2J6EA 4LP8A 2NX5D 2X4PB 1V8HA 3MRRA 3V4LA 2BHUA 4Y4HA 4UDUB 3UEQA 3QHZL 3GMRB 4PRHB 4RISH 1KIRB 2B16A 3F64A 4H8VA 3FT4B 1G87A 2RMNA 3R0MA 3UC0L 5HPMB 5I30H 5CJ5A 3IE9A 3LSOB 5CKGA 1NCUA 2R2HA 1FIGL 4PB9H 1S7WA 3ZBMA 4TULL 1EUUA 4FNLL 4UM8B 2IH9A 4BXSV 2A6IA 4QXVA 4GP4B 5PCYA 4ZMOA 1BFOB 3IMRA 1QRNB 3D39D 4FADA 2Z34A 3DJTA 5LXGL 3KCPA 4Z78B 2VJ0A 2YKLL 4PRAB 5JHLL 3GMOA 1OEZW 2MOVA 4HD9A 3ZYZA 1QFWI 2HJLB 4QRPD 3QPKA 4GINA 4LLYB 1ZSDA 3KPNA 2X2HA 3QDJA 1UASA 2XKNA 4MB4A 2VAAA 3UBXA 1CGTA 1JHTB 4FJ6A 1DUYA 2MCPH 3AREA 1CFQA 2VE6B 4J3VA 2QDWA 5D1ZC 2WUBL 1ORSB 2IALB 3FO0H 1TVHB 1PZ5A 1QZNA 1V3KA 5CJOH 4LCYA 3NIFF 4FFZA 4PJ5B 3M46A 5I8EA 5JHMA 2ZUQB 4Y1AE 4Y4KC 4QYOB 4OCSH 3EYQD 3RWFA 4JQXA 1ZAGA 4ZT1A 2VMEA 3L16A 1CD0A 4HIJA 3EHBC 2OSLA 3HMXH 4Q97A 5J8OA 5JPMA 5F0PB 1D9KD 4X7CC 1S9YA 4KTEH 4XPAL 4XE0A 2J6EL 2QQNH 3LIZH 1IC7L 2X70A 5JW4M 1U8CA 4NO5B 3KEHA 4H2AA 3NZSA 4KZEL 3EUUA 3WTUA 2UX6A 3LPWA 3KPOB 1D7BA 1LMIA 4FXGB 3QRLA 3C08H 2P1YA 3OTTA 3BXNA 1AS7A 1MAMH 4GSXA 4B50A 4R0LB 1WIPA 2FUTA 3SJVA 3H85A 1DQDL 1YNLH 4U1GB 3NFNA 3EYSL 4Z7NE 3BUBA 2V3EA 3VYNA 5KSAC 3PQYA 4DGIL 2HA1A 4WNSA 5I1JL 1A6VL 2J88H 5KG9A 4K9EL 3ARZA 5JLZA 1HNGA 1NBZB 4GBXA 2HMID 4XPHL 2XNAA 2DTSA 4F20A 4MJ5A 5AAWC 1P5VB 4K9JA 4LCCA 3BT0A 1F8TL 3QUYB 2R4RL 2C7UA 1W0VA 1YEFL 3L4TA 4UCFA 5DHYB 3RI5K 3BSZH 4TSAH 5ALCL 2PETA 2CJUH 2AJ3B 1QP1A 5BUGA 4N6RB 1CLZH 3EFDH 3MZGB 1SLVA 1INDH 1ZRUA 3BJ91 4WI3A 3DRTA 1JNLH 1CFMA 1N7ML 5HHXL 1FAKT 2P42B 2J4WL 1BJMA 2YGNA 5ETUA 2QFRA 3SPIA 1IMHC 4JM0A 1X9LA 3C5ZC 4G7YL 3EOTL 4XHJD 2R7EA 5FLVA 2IANB 5EBWB 5LNGA 4Y2DA 1EUTA 4FFZL 3UO8B 4QYAA 3RY6C 1LNUA 3HE7B 3MV7D 4HAFA 4L1DA 1NDMA 3ZZSA 4AIOA 3FQXB 1G9HA 4PJEB 1E28B 3GMPA 1MEXH 1U2YA 3V6OA 1J11A 1NAMH 3PWLA 4MNQA 4LF3A 3EH5B 3X3GL 2W94A 3FK3A 1TU2B 1I8AA 2AQSA 5T1JA 5A40E 3SDAC 1OAQH 5C9JA 2F7IA 5CSZA 1T03H 1TQCB 3STBA 2NLJA 3EDEA 2DTMH 1DJZA 3QUKB 4KKCD 4HVBA 3LCYA 1C7TA 1HAWA 1XR8B 4Y5VC 1E6OL 3QULB 5C09A 1OGSA 3ISRA 2AV7A 3A67H 2JCCB 3S5LA 1TNMA 1IM3B 1YMMB 1N6VA 4ZXBB 1WVZA 2ZYSA 3KL0A 4NOBA 4XNZB 2MNWA 3BCDA 4R6UA 4U3XA 1CLVA 5J9PA 5KYYA 1LE9A 1I53A 4EN3D 4PJ7E 4DVBA 2ZKHL 4RMSA 4PY8J 3MRIB 4UQCA 5C0JA 3MRMA 3C6SB 4I2XE 3EO9L 1BIHA 1RIHL 2FZ3B 1QPXA 2W9EH 3BUYA 1LDPL 5HYJE 2VLJB 4K94H 4W6WB 5KUMA 5EFIB 5CZVL 3MRCB 1KB5H 5SX5H 4PGBB 2VXQH 1A1OA 1BMZA 4L8DA 1BX2A 1ZMYA 3LKNA 4MCNA 4LHUA 5EOCH 4LO9A 4DAGL 3IJEA 1ZSHA 3VD1A 5EHFA 1FJ1A 3KYKH 4LOUD 5HJGA 3V4PA 3MJ7B 1B2YA 1Z66A 4A66A 5D93B 3K71B 3FO2A 4ZW3A 1RULH 3EOYG 1HL9A 1AQKL 1LO0H 1U42A 3H54A 3RNQB 4XNUH 1U3JA 1OHQA 1G0DA 2Q8BL 3T3PF 4XZUB 3BW9B 3H7BA 4X6CE 3V2AR 4PLKD 3BPNB 5KTEH 2F08A 4FQXC 4JW3A 2QZ5A 1ZTMA 4HDIA 1H0DB 4D0DB 2VZOA 2YPLA 2WM0A 3E9UA 1T4WA 3Q1EA 4P5RA 1JGLH 3DRQA 4UB0H 1AO7E 4GJTB 1AZUA 3HS0A 3WXVH 3OKLB 3HIZA 1UATA 2OX5A 3OZ9H 4KKAC 3KXFE 2GBTA 3C9NB 5BS0D 3APMA 2QPUA 3GIVA 1T7XA 5ILTL 1GZPB 1MCCA 2VDOL 2Y7MA 4GI9A 3GEWB 3HB3D 2YSTA 4JG0H 4N6QA 5FYKU 2JJTA 3A6CL 2UY6A 4KK9D 1RUAL 1MCHA 2NZ1A 3WO4B 5IVNA 2FO4A 2BP8B 2R15A 3BKYH 2CR6A 5IQ7H 1J0ZA 3VX1A 4LCUB 3P73B 3QJXA 4CBPA 2LAGB 1E2ZA 4M5ZL 5IJVA 4Q56A 1JPTH 2WOBA 5IW6B 4NUJB 4HIIB 4XRCB 3K81A 4IIZA 5FKAB 2XQBH 3MGTB 3COOA 1CXLA 4U49A 3BAXA 1U6AL 3HPLB 4NS0A 5EO1B 1BLNA 5F1OB 4A7TA 2NY6D 3QZPA 4S1RL 3JWOL 4R83A 3SDXA 1TQWA 2J1WA 2CNYA 3BD3A 3WS3B 3T6ZA 5FAAA 4YL9A 5BO0D 1XCXA 3Q01A 5D7IA 1T0OA 3X14A 3RWEA 2IV9A 4M6OL 3V4PL 1RD6A 2EP6A 5KBLA 2UWEA 4NGHL 3IFPA 5T1DH 5IOKA 2B4CH 3KPMB 2HLFD 2FECL 1TDQA 1P1VA 4KXZI 3D7PA 3DLQR 4XGZA 4UT9L 4L37A 3ZRCC 5L4FA 1TXKA 4NYLB 4AX3A 3WIAA 4BK8A 1F86A 4OZFG 3OWRA 3OM3B 1MCWM 2AHIA 3VFGH 2C7FA 3N1FC 5C0CB 3MCKB 4NO0B 2OL3B 3O4LE 3EAKA 5KYUB 2VQTA 4PJGB 1TO5A 1JNNL 2IFFH 3HJEA 2BNQA 1OP3H 3RIAK 1MQ8A 2HKFH 1EO8H 2VLLA 4PJ8A 4PJ9B 3OKEB 4I3GA 4EIUA 1DR9A 3P4LA 4RMBA 3BH8A 3RU8H 4ZFGH 4TLTA 2J21A 4HUXB 4YHOH 3FQUA 5SWSD 3NA9L 2NUTA 1ZLDA 1ZT4B 1S6NA 5T3ZL 4Y19B 2NY3B 5L2KE 4AMKH 2FYYA 2UUDH 5LO7A 4Y4HB 4Y9FA 4Y2OA 5EZLA 3QHFH 4WO4C 3ARBD 3SE9L 4DZBA 3VWJC 4DP7X 1RZGB 1ZV5A 4ANXA 1EXGA 5HHNA 3CVIH 4JPQA 4WK0B 2A6IB 3I84A 1XIWD 1LK3H 2XXCB 3MFGB 1NIEA 4IOFC 5E99L 3LZRA 4KJWD 4NSKA 3KYNA 1W72L 3O9WC 2KBGA 4G42A 3QDME 4OGAC 2BOBA 4D7PA 2F8VA 2FJUB 2JELH 4HCIA 2ATKA 3CX5K 5F96L 1SYSB 3GMOB 4WVRA 3B9KA 3MN8A 2OTWA 3OKKA 3CSPA 3NESA 2CPUA 1ZSDB 1J1OH 3STLA 1OALA 3GGWB 3MV9D 1P4LA 1WWWX 5ISZE 3QDJB 3TX4A 1DSFL 3VRLE 2XKNB 3UBXB 2VAAB 4NKOA 5FCSH 4K55A 4ERSH 4Z7OF 3DGGA 3AREB 5KOMC 1CFQB 2ISDA 1DEDA 4N2GA 4ZMWA 4HLZH 4DEPC 5LDSA 4FFWD 1PZ5B 3FMGL 2FBJH 2Y2WA 1HSBA 1UXSA 2VKWA 4OU3A 3IVKA 2WLIB 4LHQB 3NEXA 4W4OA 1WTLA 4OT1H 5EUOF 5I8EB 4JHZA 9PCYA 1TVDA 4XTRD 5BRZD 5DEJA 1DYZA 1GPOH 5IKCA 5IESH 1J8HB 5BJTA 3FU8A 1S9XA 5HGGS 4R4ND 4HIJB 5JXEA 2OSLB 3ULVH 3PAYA 5JPMB 1DQIA 2ITFA 1S9YB 3AB0C 3II2A 1JUFA 1RVFL 1UEYA 3BN3B 5EU5B 4R9HA 1U8CB 2DQFA 1JVLA 3HI1A 2QKIC 3ELAT 4XX1E 1ADWA 1XGRB 1XWVA 1C5BL 3MRFA 4JFSA 4XBEH 5E6IC 3VXPB 4JCMA 2BDNH 1C5DA 3GBML 3Q0HA 1JFQH 1MDAA 4ZYKA 1OY3B 2F9BT 3CFKA 3BXNB 3IFLL 1MUJB 3TEYA 2MH4A 1XX9C 1VEPA 1YDPA 4N0YL 2YAHA 3LNGA 4B0MB 2FLRT 3AM8A 4LNVA 4HUNB 3QIWD 4Q89A 1F1GA 3PJSA 1CGSH 4QRRA 5I66B 4GBXB 4J28A 1GVIA 1TZAA 2XNAB 4AC4A 4OD1H 5CFAA 4L05A 4NQVB 5CILL 4MJ5B 1QI5A 2C7UB 4X6FA 4MFHA 2WYTA 3ZU8A 4N68A 4P99A 5SV3A 1H3TA 4OKDA 4Z7UB 3FUFA 4PHZA 1N0XH 1P5UA 4EZKA 3CFBB 4U1JA 5AW6B 1DJGA 2OJZH 3DRTB 1CI3M 1MCOH 3F7YA 4HALA 4JPWH 5ETUB 3Q1SL 3HG1E 3B2PA 4JFWA 3S97C 4EAEA 4Y2DB 3VACA 1I1CA 4FTVA 4ZW6A 1X9QA 4O58L 1WC7B 3GD1C 1WAAE 2GY5A 2DQHH 1E30A 3MO1A 1R5VA 3QJOA 4N1EA 4KO5A 1NFDE 5C3LD 5C97A 1S5HA 1PY4A 2H3NA 5E2WH 3PWLB 4Z7QE 1SLWA 4Y1AD 3EJPA 1PX8A 3BP6B 4RMUA 3PG2A 2R1YB 3QDGA 3CWGA 3L3OA