4BRVA

Superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MKSFGELIYTPDRAEGEAISKAATHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRPFNPVMLGRVAFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESULFOFERRODOXIN, FERROUS IRON-BINDING REGION
publication title Structure of a Natural Sor Mutant
rcsb
source organism Ignicoccus hospitalis
molecule tags Oxidoreductase
total genus 30
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4brvA00
2JI1A 1Y07A 4BRJA 4BFFA 4BRVA 2AMUA 1DO6A 3QZBA 1DQIA 4BFJA 1VZIA 4D7PA 4BK8A 2JI3A 2JI2A 4BGLA 4BV1A 4BFKA 1DQKA 4C4BA 1DFXA 2HVBA 4C4UA 1VZGA 1VZHA
chains in the Genus database with same CATH superfamily
3CSBA 3ETBJ 3OKMA 3UMNA 3VXUD 4FFVC 1S7SA 5INCA 4BWUA 4LLDA 4YHNB 2Q87A 1SHXA 1VADB 1Q9KA 3PF2A 5IFAL 3FCTA 3HC3H 5FPIA 2XRAL 1SM3L 4XVTH 2EO9A 2W92A 1WZ1H 3AS1A 4KTEH 3CLEH 5GS0C 4WDIB 5F44A 2Y22A 3GMLB 3MNZA 4N2HA 5D1ZA 2BNUA 2JLPA 3QRBA 4AGLA 3K8LA 3V0AC 2IG2H 2Z7UA 4FF9A 5DMJB 3WFBH 3AREB 4X5LA 5IQ9B 3GSUA 3L6FA 2OLDA 3UEZA 1SEBA 2W94A 3MLVL 5BZWA 1RCYA 3BVNB 4ZODA 3F5WA 3V4VL 4KZDH 3OMIB 3GZPA 3QISA 2R23A 2UY7B 2W81C 4E5XA 1IM3B 3VW3L 3D69B 4XMPH 4NRYA 1QTPA 4A37A 3U36A 4OI8A 1TTRA 1T7WA 4OLXL 2WYIA 1TPXB 4KNTA 2MPAL 1SVBA 5K9QI 1MCCA 4H13C 3S37H 1I3VA 3IF1B 5KSVA 1MFMA 2EXWC 3IXAB 3MLYL 3ZY7A 1NCJA 2Y3NA 4BYHA 1AQMA 1FNEB 2F8VA 3AXLB 2WQVA 3VA6A 1CMOA 3ZE0B 4LNVA 5JW4Q 4AM0Q 3S3JA 1RULH 3TH3T 1BIIB 1G6RB 3E1ZA 3I85A 4RCAA 1RL1A 3E6FA 5HPMB 3DXAA 1A5FH 2PR4L 3M46A 5GS0H 3RAJH 2ZONA 1KTLB 4AI7A 2PCPA 3HKZA 4NT6B 4BELD 3SDDC 4K5OA 1YNTA 4OZIF 5T3XE 1G43A 3DK0A 4IRSD 3DGGA 4JFFB 4U0RB 5DA0B 2DOCA 5I74C 5BVPL 4P5KA 1TEFA 5D72H 3LY6A 3MV9D 3SOBH 5LBSH 3I6KA 4TV3A 3QZWA 5MEOB 1P5UA 5I24A 2MCAA 2R39A 4MXQC 4K9EL 2VXTL 1XR8B 1Y1UA 4GSRA 3QWRA 3OXSB 1JWUA 3LNGA 3KGRA 3HMXH 3TZVD 3O8XA 3WY1A 4Y7MA 3O2VH 4U05A 1JXGA 1LLAA 1SJVA 3T8XB 4U1SB 3BXNA 3L1FA 3L5JA 3TBYB 5A2FA 3ZQ9A 2G5RA 2DIJA 4I9XA 1FFRA 4NWTH 2M26A 1QI5A 5I1JL 2GUOA 4E42A 2PWHA 1F90L 2CJUL 4JW3A 4DZBA 2RH0A 1A9BA 2X38A 1FL6B 3GYRA 1BD2A 3N9GL 4Z78B 1E90A 4Q9RH 5D7JC 4M5TA 3D2UA 4GRWH 4AC4A 1RMFL 4GT7A 5GGSY 3T4AC 1KC5H 5M94B 2CLVB 3GGWA 2PP9A 4UBDC 2BSRA 5DU7A 4ABVA 1BZ9A 4ODVL 1R3IH 4UYQA 5KYNA 5DS8A 3FTXA 4XH2A 5F89A 1TJHL 4YE4H 3CCHA 3GKWL 4FCAA 2XV6B 3LRSA 4NUPA 1DQJA 4MYPA 1HH9B 5D2NC 4X4ZA 4LSVL 3G04B 1S2EA 3FU5A 1HDMB 4XGZB 5EULV 1T89C 3SD5A 1HK6A 1NSNL 3CDFA 3F6IA 1TCRA 4LZKA 4LESA 3SE8H 1QBMH 1ZSDA 3FQRB 1D5RA 5ID0B 1IC5H 5C07B 3G5YB 3CVBA 3VGHA 3BZEA 1A4JA 4AV4A 1WBYA 2XN1A 1QNZL 3FH8A 3WTXA 1G0DA 4QY8B 3MRPA 4GJTB 3VAEA 4P2RE 3MBXH 3H2WA 3X1BA 2ZCZA 4HC1L 2ZYHA 2RR3A 3EJSA 1KYOK 3WHE0 1Q9LA 2P8PA 3VXOB 2OULB 1F18A 2FJSA 4M5SA 1VGKB 1BQHB 4MCYB 1OVZA 3ARDD 5L88H 3C2AL 3ATFA 1MREL 2ITCA 3Q8EA 5EUOE 2K4WA 3UXFA 2Z64C 4LSPH 1G7PA 2A1WH 3EJRA 3SQOL 3MUHL 4FQPA 4Y5YB 5FCUL 3THMH 1RJYB 4R7LA 3CXHK 2JKXA 3SDAC 3TCLB 1KFAL 4FQXB 3CFQA 5C0BD 1OOWA 4KH2A 4Y8DC 1EDHA 1F3DJ 1VCAA 1LO4L 5IV2A 3HE7D 3ZT7A 3NIFB 5F7WC 5KVDE 4KH9A 1MHEA 4NZRH 4DP6X 3S37X 2R2CA 3W81A 4XN4A 1Y6MR 3UTQA 4U1GB 5C0GB 1HHIB 4HMCA 3VJ6B 4BBWA 2EC8A 3OMZA 1U93A 2CR0A 3OGCA 4KUCF 1RLBA 3K74B 2DH2A 2WKLA 5F7NC 1BMZA 1CN4A 5KVFH 2V2XB 2JCCE 3TX4A 2VLRB 4BDVB 1L3NA 3NJJA 4JFXB 2MIZA 3GSQA 1IC4H 4U2YA 2P5WE 4C4KO 5D5MA 2VM4A 5BVJA 4ODWA 2OP4L 3TPUA 5JNYA 1K8IB 1AHWB 1OT2A 1ZA3B 2WXRA 5IMMA 2VAJA 3HI1B 3VFRA 1AGBA 1KJ2L 4L3EB 3F7PC 4N68A 3ZTEA 1I8LC 2VDMB 2C4FU 2QZQA 1LQSR 4LHJB 4MJ5B 5DUPL 5SX4I 2NY5H 1VZGA 3FAXA 3N43B 4QR7A 4L1LA 3WELA 4PGBA 2HKFH 3P9MB 3UZVB 1FORH 3L3IB 3O3AB 4IU3A 1AY1L 2RGSA 3NESA 4MD5B 5HHNA 4B9PA 1U8NA 1BOGB 2CPCA 2VZOA 5E94B 5D2LA 5C0AE 4ESKA 5IW6B 5K9JH 1R46A 4L1HA 3WENA 3VCLA 1L9RA 4XNZC 5DJ0B 4DAGL 1QG3A 2B4CC 4ZAKB 4HJIA 2Q76A 4DP7X 4LL9A 4UM9B 1B0RB 5I1AA 1NIDA 5CKAA 1AFVH 5GJSL 2FO1A 3U30B 4NERA 1Q72H 4J4PC 3FO2A 4CILA 5DYFA 4F27A 5EWIL 2YPVH 3PCYA 4TULL 2AMGA 3ES6B 3C2SA 4YUEH 5FYLL 3S5LA 1YAZA 3T0BA 5AVVB 4NC1C 2XQYG 3H7BB 4L5FL 1L7TL 1SYSA 1X4YA 3GMNA 5PAZA 2X4UA 4HCGA 4CW1A 9CGTA 1QEWB 4MBOA 5C08B 3HB3B 3B2DC 2KZ1B 3G5VA 1KXVC 3S35H 5C6PB 2QQLH 2EEXA 5I1HH 4GMSH 4LOUD 3RWJA 4YSOA 2L8AA 2PYFB 3LDBC 3IFOB 1IM9B 2E27L 1U8HA 3PP4H 3QO1B 3LMJH 1U8OB 4G9FB 4KKRA 2Y6TE 4GW5A 4PRHE 5CFHA 2VZVA 4KK8C 3RDTD 3KGUA 2XWTA 3REVB 2J12B 1YPZF 3QPXL 3NSYA 1IAMA 3M07A 4HU2A 3IJ8A 4KJYB 1U2HA 2KI6A 1G94A 4KVNL 4LCVA 2BVOA 3HC0A 2B4CH 2C9UA 1TSHA 1ZLUH 3BE1L 5TE6H 3X12A 1HHKA 4YSTA 3ARQA 5KVEL 1JWSA 1LGVA 4XR8C 1WBXA 2EDNA 3MLUH 5CBEB 4Z0BH 4AH2A 3C8KB 3MYZA 2P28B 1QHPA 1K72A 3C60D 3QI9A 4JLRB 5CZXC 2ARJQ 4TLSA 4N28A 4LCYA 4MVBC 1U30A 2WXLA 3FULA 3BKJL 3H9ZA 4YXHH 5I1EL 1W0WB 3O6KH 5K9KA 4LARH 4JPKH 3RWEB 3KBEA 3TA3C 1Z3GL 3U7YH 1UJ3B 3ORJA 3NCXA 5D9SA 2OMWB 2WXHA 4GLRH 2H2PC 1XEUA 2VN3A 4TLKA 3BUDA 6FABH 4X7SH 2IEPA 3QVAA 1FL3A 1EJFA 5DQJA 5PCYA 1O7VA 5H94A 3DDFA 3QAZC 1KTDA 4H25B 4P5TB 1K4DA 4HIXL 4G9DB 3H53A 4LCCB 3G6JB 3RP1A 2B0SL 4XN7A 3QQ9C 3GLAA 4NCDA 3W2DL 4JDVB 5TJWK 4PJ7A 2NXYB 1TZHA 4R2GB 4H2AA 3ILQD 2UX6A 3AY4C 4RSVA 4WTQA 3FFCB 4JUTA 5F8QC 3E80A 3VMNA 1BVKB 2CO2A 4JRLA 4Z7WA 1JZ6A 2WWOA 5IVZB 3EJCA 2ICEA 5F9OL 4EO5A 4C47A 5G55A 1DLHA 3IJSA 1R5WB 2Q6WB 1X5IA 1QA9B 5DT1H 4UAHA 3VX1A 1T6WA 2NY1D 4ZSOE 2ZKHH 4P2YA 2YPVA 3MREB 4F1SA 1FH2A 1BGXH 4BKSC 2CLZB 1PLGL 2YAMA 2CIIA 3QDHA 1IMHC 2PP7A 1T2XA 3N85L 4QRQA 3Q48A 3T6VA 4DH2A 3A4AA 3POCA 2ORBL 1A2YB 3VQMA 1P7QB 2YZ8A 1M56B 1VHPA 2PXYC 4RAUB 1NUGA 3DBXA 1HSBA 2ZJSH 3O41B 1E4WH 4FOMA 3BH8A 3IE9A 1P84J 3LN5A 5DK3A 4P04A 5F0MB 2I7OA 1O6TA 1M7IA 2R0WH 2OW7A 2V7NB 3OKLA 2DI8A 1JGUH 2OX5A 3DSNB 5C0NC 4D0BA 5HY9A 3DETC 3NIGE 2X4TA 2VNCA 4NQEB 1KB3A 2D7OA 2WGNB 4NCC1 3D87B 5LN8A 3JV4A 3KR3L 1TJMA 4XPFL 3WEAA 4PH8A 4EDWH 2VW6A 3ZHDA 2YA2A 5JW3L 4HPOH 3R0NA 3FO0H 3KBHE 3QR1A 4I3RL 2NUPA 4J7RA 1CGXA 4J3OD 3BAJA 4LFHD 2VN5A 3O6FC 5FHBL 3H3BC 2FR4A 4G6ML 4M56A 4YWGH 2D8KA 3ROLB 3WIIL 4MTMA 4RNRB 1HIML 3PWVB 4AV0A 2R9HD 4JDTH 4CKVX 2XTJC 2NY0C 1Z9LA 2ADJA 4X80L 4P46B 3D4YA 3T6ZA 1JF6A 4EUPA 4JFYB 2BCMA 1J0YA 2NZ1A 1MCPL 3P0YH 1BQUA 4HSQA 4B9JA 3SY0A 5I5IA 4QXGH 4KXCA 1OSZB 1BFOA 1N4XH 3TIDA 4AQAB 3KYMA 3QNXB 3WLBA 5JHDA 4ZO8A 1GGUA 3S8FB 4XCNB 5F2FA 3WJJA 4JZOA 1RPUA 4PHZA 5E2WL 4UTAL 4PD4J 4LRIA 1OAQH 5DURB 5H37G 4IOIA 1NDGA 1KEGL 3ARFB 1IAIM 2NNRA 4FHBD 1ZK5A 4OAWA 4R5VA 3V4PL 5L8LB 3WAJA 1F4YH 2FNBA 4YFLI 2HKHH 3VFGH 5DEZA 1WAPA 3W9EA 3LEXB 1T20B 2VDOH 3SGKA 1KLUB 1P4LA 1ORQB 4ELKB 1L3WA 3JWNG 1YC7A 3OD3A 4YHPB 1N0XL 1R3HB 4F3FB 1FV1B 3Q2LA 5TPWH 1XFPA 1BX2B 1LEGB 4XX1E 2IFFL 5IWLC 5CCKH 4GRMA 3NJHA 4FERA 4HWUA 3GUTA 4C56D 3TBWA 2IANB 1H3TA 2XACC 1OTTC 2BOLA 2PYEB 3GRWH 2OAAA 1R5IA 1L7IL 4GRWE 5F1SA 1ETZB 5KVGH 4O02A 1KCUH 4ZTPL 3B9KD 3V10A 4BH7B 2EEDA 4X9BA 4HOZA 1AR1C 2OS7A 5E8EA 2P8LB 2EYSA 3B6SA 4OU3A 3W11C 5CLTA 1YEWA 3O9WA 3KPSB 4N3UA 3MRQB 1GZPB 4NI6A 2LOEA 4HS3B 2XETA 1TKWA 2ZXQA 3H3PH 4YDVA 3OKKA 5SWSE 1NAML 3H2PA 4PJGA 3EOTL 2HPOA 3RNQA 3FO1A 1WFUA 5HGHA 5FO9B 3ZR6A 5CCJA 1I1CA 3U4AA 4FJ6A 5D1ZD 4XP1H 2WO2B 5IJKA 5GRUL 4OLWH 1A1MB 1E9QA 1A25A 2QSVA 1FZJB 1KXQA 1BJ8A 1M71B 3VB8A 3NJMA 4PIRF 4JFDA 2J73A 2MQGA 4A7GA 1I85A 4AG4H 3KL3A 4BQ8A 2ZKXA 1AIFA 5J1SC 3GXDA 4HAFA 1QLEH 2WMPA 2VABB 2ZZUT 3O3EA 4MXWL 2G2NA 1GSMA 5ESVB 4NFBA 1X7QA 2DW5A 3ZBMA 4AYMC 3KDPB 3PHSA 2K9FB 5D2NE 2FLBT 2QBWA 1IKNC 4AVJA 3ARTA 1TQUA 3PWNB 3QHFH 2JH2A 3QZBA 3C08H 3GB7A 3UZEA 1QSVA 4HFUH 5LGJB 4POUB 4GS7B 3UZQA 4HX1A 1I75A 5HJBA 5CHNB 2QDWA 4GQ9L 4DEWA 4OIBA 3TO4A 5BS0A 3DXAD 1YYMH 1CXEA 3MX0B 1U8IA 3K81A 2EE2A 4U1NA 2BH0A 3S34L 5E2TL 2BNQE 1YY8A 1LILA 3K3QA 1U8KA 2DYPB 4KPHL 5I1DA 1A02N 3GRBA 5DMGD 5JO5B 2DIEA 1OP3H 2NW3B 2YQ2A 1ZT7A 1I3UA 2NXZC 3U6XS 3PDDA 3BN3B 4FQQA 2J1XA 3K1DA 1BG9A 3CUPB 4HCRA 5FGCE 2BVQA 5KVFE 3DTXB 1TO5A 3BYYA 4BFRA 1JWMB 2VDPH 4QRRB 3QWRD 1OAKH 1UD8A 3MRDB 1ETA1 4IMLA 2CKBA 5FECB 3W9DA 2WBJC 1G87A 2X53A 5DQ9B 3O8XD 4OCXL 1JF5A 4DTGL 3DPBA 4ELMA 1W72H 1N3NB 3U2JA 5TD4A 1JD7A 1VB9A 2MCMA 5HI5C 4QCIB 5E1AA 4KZCA 4O2FA 1QFWI 3WFDL 1CVRA 2CJTA 3FQNA 1AQHA 2R7EA 1CU4L 3U7WL 2GT9A 1JFQH 3QEQB 3CFKA 4TQEH 2BXZA 2R56H 4E9VA 3OJDB 4JY5L 3BCDA 4L4TB 4URTB 1BD2D 4F20A 4MB4A 4WCYH 2Y5EA 3D2UD 5F1KC 2H26B 3L9EA 4NZUL 4QRPB 5F7AA 2NR6D 1YEIH 3BVTA 3VXNB 3QFJA 5DO2D 5EN3A 2OFQA 1JV5A 4Z7WE 2ZAHA 4N86A 2BIMA 1TVHB 2FTAA 3WNNA 3BVDB 1ADQL 3SKNA 1KWKA 2MMXA 4IKIA 4OVUA 3RU8L 1UXLA 1RVFL 2DQIL 3EYVA 1O6VA 2AV1B 4PG2C 4PY8I 1OK8A 3JVGA 3V2AR 5I6KA 3BO8B 5D7SH 2BCKA 3GIZH 4EBQH 3VYOA 4RGMB 2F74B 3ESUF 2J4WL 1UJTA 2FQDA 1DQQA 3IPEA 4D7BA 1CDYA 3SY6A 4P2OD 3SPHA 4Y4FB 5EBLB 2GTZA 2PTVA 1JJUA 4F33A 4MD0A 3KCPB 3CMOH 1EEYB 2YD0A 1J88A 3QH3B 3P3SA 4Y19B 1NCGA 4FNLH 2KBGA 1TPXC 5JOPE 2X4RA 4NM8H 1I1RA 2NX5A 3PABA 1MCKA 2EXYD 5EU5B 1F5WA 1CBVL 4PLJD 1ROWA 4M5ZH 4QRBA 1K8DA 1XL6A 1VKXA 5IW1B 5BQ7A 1G7JB 1PFCA 1UQSB 4HS8H 1N6UA 1HKFA 3I3BA 4H8UA 4LXFA 2QLVB 2VLKE 2XV0A 3CFJA 3G08B 2XG5B 3UOAB 1W8EA 1VFAA 4NC1E 2Y2WA 4B9ZA 2PPEA 3EYUH 4U0RC 3O6LH 3CFIC 1RZ8B 4N2EA 5G2NA 3V0VB 1Z1WA 3BEVB 1ZHBB 3ARGC 4WK4B 3T3PF 3D39B 1TZGH 5IFJA 3VXME 3L4UA 4Z5RB 1SDAB 5DLML 1P1ZB 3GDCA 2VGLM 2WB1A 3F6LA 1WD9A 1EHLL 4Z7IA 2EYRA 1BG1A 1A6WL 1ET7A 3QG7H 1UD2A 3WIAA 1RZGB 1SMOA 5LLIC 4JKKA 3Q6FA 4XNUL 5LHDA 1W72A 2D03H 1A21A 4BSVB 3BUYA 4FNPA 2JJTC 1PLCA 2G60L 4C8XA 1EO5A 5EO9B 5T1DH 2Y2YA 1GS7A 4LEBA 4DVBA 2ZUQC 4M3HA 5FO8B 5ICUA 1BVZA 4PYHA 2R8SH 2JKIS 3PFUA 4KKLD 1S9XA 5EOCJ 3WNJA 1EO8H 3RYMA 1A8ZA 3DX3A 4FQ2H 1JV2B 2C9SA 3MAWA 4W1TA 4OD2B 4AL8L 3F7VB 2K6YA 2EECA 3PWUA 1YMMB 3RJQB 3O2WH 4JRWA 3UO1L 1R9FA 1T7ZA 2OMYB 4M7ZB 5DZNA 3N42B 1FP5A 4KTDL 4N6RB 3WS3B 4HV8A 1XH2A 2AK4E 4Z8FH 2WLNA 4I0CC 2A0LD 3VX0A 3HPJA 3F04A 3W39A 5J3HC 2Y1AA 1VZHA 3N44B 1A7BA 4UZSA 3BWUF 2PO6B 5G5DB 5ICXB 5IJVA 4H88H 1AD9A 2YPLE 5FYJD 4HKJB 1HILB 5CJXC 4HIIA 2I60L 2RCSL 2MTAA 5D7LE 3OPZL 1AJ7L 2WP3T 32C2B 3HUJE 4OM1L 4LO9A 2C1PA 4F2EA 3I84A 2APVA 4EVNB 1XQ4A 2BC4A 2BERA 5C0DA 3CHXA 3N06B 1BQLL 3MRKA 3ETTA 3V5HA 1R5VB 1U8JB 2V8MA 4ZD3L 1NCBH 4KUZH 5HHQB 2QQKH 1J8SA 4PJHA 2XJKA 4L3CA 1X44A 4JQIH 2GI7A 3EYFB 4FQHA 4Y2LA 4PJCB 3FTGA 3QEHB 3KPLB 2H2SC 4J12A 4WTXA 4XBEH 2WTRA 3QDGE 2SODB 3CDZA 2IQ9L 1KBGH 5SWQB 3QW9A 1OO2A 5FA4A 1A9EA 2Y4SA 1MFUA 1I82A 4E9LA 1OPOA 3D3VB 4GAGH 1J1XH 4OGYH 1MWAH 2QGBA 4ZYKB 1KXQE 1V7NL 3IKCB 5AFAA 5EB9A 5KSAA 4YFEA 2XWJA 2X28A 4JFDE 1QNIA 4G8GA 1NGZA 4FQXC 1WSST 3NCFB 3F7RA 3BH4A 2AJZB 5EU7E 4AYGA 2HSIA 2I27N 3X1NA 1D2PA 2NY3D 1F6AA 2CE6A 2VXSL 1JGEB 2DQFB 4P2CG 5DD5L 5AAWA 4X6DE 3CFBA 3PXHA 4G59C 1B4JL 3UJIH 4U1GC 5DEJA 1FGVL 3VD5A 1COBA 1SEQL 3QI9D 2C4XA 4FC3E 3WKMH 4DIXA 1G6RL 2C9PA 2JIXA 1W8NA 1DZ0A 1UXSA 3J8F7 4E9XA 3HN8A 5F1NB 2W9EL 3HG1E 1H3PL 1EHKB 4KHTL 1G7IA 5JHMA 1XGTB 4ZUSB 1KB9K 2J8HA 4YDJA 4CRPA 3CHPA 1MJ8H 5BS0E 1KSRA 4Q2ZB 1UCBL 2BHUA 2YOCA 4RGOL 3TYFB 2W59A 5KYXA 1MAML 1J9QA 3MR9B 1LMIA 1QLRB 3WE6B 3FF7A 1AHWC 4LU5H 4XZUB 2E4FA 5AOMA 5B1BB 3BSZA 1QFWH 5JW5A 4OF0A 2A83A 2OCJA 1WEJL 3LNEA 4LAQH 2EZ0C 3OGOE 4P59L 4OQTL 5GXBB 4K7FB 1AQKH 1I8IB 4K5MA 1OAXH 4LDOB 5DO8A 1G9HA 1Z7JA 2KL6A 3FFOA 2E9BA 3BSHA 3IU3A 1K9TA 1INEL 3K6OA 5ISZB 1S9YA 1S7WB 1LEKB 1QR1A 2UVFA 2XTJE 4Z95L 4H2CA 5IB5B 3MNVB 3QARA 4WHYG 5E1GA 1WE5A 3H8NA 5JIKA 4NNXA 2HFEA 4HAGA 1WCBB 1TETH 4DP1X 5FYKU 1AGEB 1IBDA 1NCAL 2EIBA 2W65B 3D0LA 3JTBA 4EDXA 4BZ1L 4ELME 4CVZA 1YEHH 4QO1A 3LIZL 2X3CA 2MOVA 1EQWA 1KGCE 5KVGE 4AYBA 1OLZA 3OKOB 1INQB 2KLRA 3BDBA 3U30C 3ILDA 3SDXA 3KH3A 1FQ9C 1NKOA 1XDTT 5TFSL 2P5PA 3HCVB 2ZXAA 2LLNA 4AGOA 4OM0H 1H5BA 3DUUB 2PW2A 3BFOA 5GS2H 3WJLA 2DZEA 2WZAA 4PGZA 5IBUG 2XU9A 4YMPA 4CVUA 5KW9H 1MG3C 4P2QE 2WKOF 4OZIB 2E75C 1IAIL 2VDMH 3GMRA 4M6OL 1S7RA 4XWGH 3TA4D 1A4BA 3U4BL 5DTFA 1IJ9A 3QFDA 4Z7QF 4NNPL 4HZLA 3NK3A 1FZOB 1NIAA 4UYPA 2F18A 1JGDB 2GJRA 3OLEA 1THCA 3VACA 3TEZA 5JOPD 2YMXL 4ODXB 1MWAA 1P6AB 4HT1H 2Y07L 1HE7A 4P8QA 3QB7C 5JPNC 4HU8A 3U1PA 5TF0A 3L3DB 5DD3L 1J8KA 1TEYA 3BESR 4UTBH 4OZFG 2V17H 2AJSH 1J7VR 3D30A 3OAUL 4TUJA 4QHKJ 3C5XA 4U1IA 3L1EA 4ZS6D 5E6RB 4Q52A 3REWB 5FKPA 5H35A 4KKNA 2A77L 1RURL 1F4HA 3D0VA 2GIXA 4WNSA 1U95B 3NACH 5MENA 4Z7VA 4KKAD 4X5RA 4GG6E 1OE2A 3TVMA 2OMTB 3P2TA 1CD1A 3EBHA 1N0LB 4HXBH 3ZYIA 3ULSA 5FYKH 2EDMA 4O2CB 1ZRUA 3KPRE 5CGBA 1KUMA 4UM8A 1JPGA 3GMOB 4JDZB 1FAKT 5KTEH 2NYKA 2ZWZA 4ALAC 2K0RA 4GY4A 4LLVA 5JORA 3QPQD 3AC0A 4GAAA 2LR4A 1OKEA 3CIAA 3MJ6A 4JKNA 4HS6A 4PJFA 5JHDD 2XG4B 3IDGB 1FDLH 4OGAD 3GI8H 1BZQK 2MHAB 4JFOB 1G6VK 2W60A 2ZOUA 3ESNA 2ADGA 4GXFA 4WU5B 1PNDA 3P54A 4QXTA 4AOFA 2UUDH 4P5TC 5D1QB 1NBZB 3P3UA 4JAMB 3V52L 1NICA 5DEFB 1KTRL 4HGMA 3UL4A 4LCCC 4TVPD 3IFPB 5B39A 3EG9B 4H8VA 1D5IH 2L7QA 2CBPA 1AO7A 3MRNB 3D08A 5E9DB 4HGWA 4NB7A 3EGXB 3VDAA 3QC5X 2NXYC 2HLAB 2WVSA 3H0TB 3I74A 1FNHA 3CHQA 1T80A 1CJYA 2XDHA 3I9GL 1MRCL 1T0MA 2VSCA 3TFKD 1LYQA 2X70B 5F7LB 3MOAH 2VXVL 3LSOA 3O11A 4L0ZA 4GG8A 4IBLT 2R1XA 1WZLA 2W0PA 1YG9A 2WN3A 1KZYA 2HN7A 3QIWA 3FCSB 4JFQB 1CL7H 4D3CH 4CMMB 3GBEA 2NW2A 4OFQA 4R0LB 5L2KA 1IGMH 1WS7A 4TQHA 4X7TB 4DP5X 1LEIA 3G6DL 2E46A 3MLWL 1WC7B 3PHOB 4WFFD 2D3JA 3KLHC 1OAUL 1FFNB 1D5ZB 2EH8H 5GSVB 1PQZB 4R4BB 5GPRA 5A16A 3O9WD 2ESVB 2AVGA 1HEZA 1BPLB 4XVJL 4Y4HC 5L4JA 4LT7A 4PREB 4EPSA 2GJ6B 2V5TA 3PS6A 5JIQA 2DEWX 3UFIA 1DLFL 1Q90A 1FNSH 3Q2CA 4XMKH 1KT2B 1NLBH 2YK1H 3ML8A 2EABA 4N3TA 1JTPA 1SZNA 3GJEB 5EIVA 4Z7OE 1I4FA 5BRZE 4YR6B 5HGAA 1ZIBA 4NKMB 5C9JA 4I9WD 2WQ8A 4H8PA 2ZWKA 1I1YA 5IVXA 1UB5B 1EXGA 2EVFA 3CC1A 1IEAB 4R7VA 1T1ZA 5TDOA 4D9QE 1KYOJ 3HN5A 2UZIH 4HUUB 2QELA 1NGWA 4FTDA 2DBLL 2FGZA 5FO7A 1TLMA 2EC9T 4M61A 1D6VL 2OMVA 4XN8A 3QNYB 5CU5A 3R1GH 2HG5A 4Y1AA 1AHKA 4LBAA 1CYXA 1TCMA 3CXHJ 4JG1H 4W81A 2PTTB 5DDHB 5C0CB 1HXYB 3MV11 4G8GE 3DX0A 3N41F 3V5KB 4K3EL 3HNSH 2DI9A 3LS5H 4G8EA 4ODSH 4OQ1A 2XIIA 4DGVH 2G4EA 2X6MA 5E03A 5EOTA 4WLCA 3TO4D 5BS0D 5CP7A 4X8JA 4UQ2A 4QRUA 1IIIA 1U58B 1K5WA 1GPOH 1LP9B 3WKPA 4O2EA 4RISL 5BZDA 4WHTB 1JAEA 4POZD 4L1DA 2W91A 4KROD 3NSJA 4YK4B 4ALAL 1N2RB 2ZXCA 1MRFH 3B2PA 1S3KH 3PUCA 3RTQB 4MMZB 3WTWA 3NVQA 3VSVA 2LAGB 2XQ0A 1RV6X 2Z93B 3A6BL 2C8NA 3QUKA 4FD0A 3RY5A 4PW9A 2QFRA 2VERN 3LNIA 1NGPL 5CFAA 5CR1A 1QWUA 3ZZLA 4NP9A 2ZQKA 1P2CB 4QKXB 2BNRB 5AVZB 3CC5A 1DJIA 1YPZB 5JPMA 3FTSA 1U3YA 1BEYL 4ONGL 4JFFE 5AW1B 3BRFA 3RBSA 5CMAA 1AGFB 4B60A 3I6LD 4RMWA 2H9GB 4JFTA 4JHUA 2H1PL 4F9PA 3ENEA 2VSDA 4QTIL 1NDMB 3F12B 3RWFA 1ZAGA 2GPZA 3HFMH 5AZUA 1JHKH 1EEUA 1IKOP 1PBYA 3EAKA 3QFJD 3VTMA 4D94A 5ABDE 4ZUUA 2FWSA 1ZANL 1PYWA 4FNRA 2PUQT 2B39A 3QS3A 3QG6A 4LCIL 3BWAA 4ORGA 1K4CA 4QOKA 1DVZA 3L3GB 2YAPA 1PTZA 2ZX6A 5IQOA 5IBUB 5CLXA 5L9DL 1NIEA 2OR9H 4HA1A 1A6VH 1FO0B 2AJYL 3PDOB 4G6JH 1G7QB 2E9IA 2OJEA 1MHHA 3PFQA 3TNMA 1CDBA 2BHFA 2WW8A 3JWDC 5HHXL 4I4WB 5J57B 1WG3A 3R06B 1FFTB 2E4TA 5KSUB 3FHQA 2FDBP 3VFNB 5EC2A 4XP5L 4MMYA 3QYNA 3FRPA 4JKLA 4TRPL 4Y5VA 3EXJA 1XF5A 3BWZA 2FATH 1JOIA 3ZOAA 4JPVL 2ZUUA 1ZLVK 4AM0B 4JZNB 1H3UA 4JPSA 2HTKC 4LASL 2MPAH 4KO9A 2WUBH 4OZFB 2MFNA 3N0PB 3HBZA 4K94L 1IVLA 1KNOB 4ODUA 2NX5D 3FAWA 2KDGA 3QQDA 2VJ0A 4BWTA 2YKLL 4LRNL 4NO2A 3ZKXB 3NRQA 4HIPA 1EGJL 1ZHKA 3IGAA 4GQQA 3GBML 3FN0L 1RK1B 3FTYA 5EF1A 4TNWF 2CBTA 2EIDA 5C07E 1D3CA 3VRLE 5FUZH 4OV5A 3IXTB 1UWEH 4C83A 3N91A 2Q8BL 3L2NA 4TNGA 4Z7VE 5DJZA 5JUEH 5I1KH 3JWDH 2GSMB 3Q7JA 3TWCH 1SY6L 2NYYC 3QRLA 1KCVH 4LLWB 1XTLA 3RVVD 1CGUA 3V6FA 1GR7A 1C16B 2P48B 3BD4A 3J07A 3OQRA 4FYRA 2YC1B 4HZAA 1KB5H 1YDPA 4K9EH 4XX5A 4MA7H 4E68A 3KPQB 4FXLA 2W9DH 4JY6A 4AUYA 1JYNA 4DUWA 1HINH 1V7ML 4RRPM 1UKQA 1NBVL 2ZX7A 4ZS7H 3BW9A 4FMFA 4B9CA 4RWYH 5C7XH 2DYRB 4DK3A 2BFGA 4KAQL 5DQDH 2DQUL 4UT6L 4X6FA 3VFVA 5A6IA 1I8MA 4OZHA 4U31A 1M1XB 1X7SA 2XX1A 3BGMA 2DDQL 5E5UB 3BDYH 4HK0B 4DGYL 5I0DA 4TPRL 1P7KA 2RIKA 2WIMA 2ALWA 3U9UB 3X2QB 2XX0A 5IHBA 1A3QA 3NIFE 4UQCA 3TEWA 2Y7NA 3CFUA 1CXHA 1DZBA 3H9SA 1FNLA 2PPCA 4I88A 4ZX6A 1KPRB 3OVUB 2K6ZA 5EF2A 4DN3H 4PJ9A 1LO0H 1M42A 1INDL 1KIRA 2IGFH 2EIZB 2VJ8A 5F3BA 4XO3A 5SV4A 2X2IA 4D0DB 1JUFA 3UGEA 2CO6A 2VKXA 4UDTB 4ZOCA 2VLRE 3GMPA 3MZGB 1E3ZA 3O0RL 4JL2A 1XL4A 2QGCA 3DLQR 4XCEA 3LPPA 1MIMH 4KRLB 3ZDWA 3CV5A 3HG0A 1CFTB 4S2SB 3KMDA 1FL5B 4PP1D 1UASA 3X1EA 1RZPA 3P40A 3WD5L 4M1DL 2PCFB 4O5LL 4L3EE 1UXWA 4NNYA 4R7XA 3V4VA 4YDKH 3LKSA 3AS0A 1MNUL 1URZA 4YOKA 2HJKA 3SE3C 4YZWA 1SFHA 1IBGH 2XXMB 5DC9B 4Y4FC 3AB0B 2C3GA 4RA3A 4LDEB 3C8HA 4P9ML 4UT9L 3DV4B 1EJOH 5G4NA 4HUWA 4NZJA 5AG8A 4AE0A 2G0LA 3PL6A 1NFDA 2N0MA 4MGXA 3WHXB 4IS6A 4HLEA 3QUXB 4HAKA 1UWXK 3MBEA 4XWOD 1P69B 4OCRH 3OZKA 3GHEH 4LSSL 3KL0A 3T8MA 4DEPC 4ODTH 3MACH 3GJFK 1IB5A 1YMHA 2M8XA 3S2CA 3C6LB 4I3SH 3O3DB 2YXWA 4P4KB 4ZOAA 5KSBE 4LOEA 1D5MA 5FCUH 5KSAD 2H0JA 4HUCA 5CD5C 1MHPH 5KWYC 4NKIH 1SOKA 3ZKSD 4YIQA 1V3KA 3CSFA 1Y0LA 2APXA 2JQAA 1Z9SA 3FTWA 1LE5A 1N5YL 1OV8A 1OGTA 5FYKE 3WKNA 3NOIA 2LTQC 1ZT1B 3BZFA 3MLSL 1OCCB 3MRGB 4JL1A 5E56A 1KB5A 4Y1AE 2YN3A 4QJ5B 1UOVA 2H1XA 4IGBA 4JB9L 4QRAA 2DMGA 4ZW8A 2OMUB 3IK2A 1BECA 3GNMH 1OL0A 3QDME 3ZQWA 1Y07A 3IBEA 4M6NL 1MFAH 1YNKH 4OLYH 1AZNA 4OGQC 4QXUH 2WLIB 1CLCA 3QDJD 3STBA 4CJ1A 4YLCA 1FA4A 1S7UA 2XOTA 3RI5F 5DEGB 1OGPA 4W9HC 2OP4H 1ETB1 4RMBA 2WXJA 3UTSB 1DBMH 3Q8AA 4Y16C 1L9SA 1OGAB 1F6FB 1N59A 4M93C 4YHMH 1X5MA 4XCYA 5B3JF 3Q2WA 4M4PA 4O58L 1E27B 5CNHA 5C3LD 3MJGX 4RIRA 4B27A 5HYFA 1CXLA 4OF6A 3NPSB 3AU1B 2WAQA 1E5UI 4YO0A 1NANI 4Y9FA 3MQIA 3LOWA 4M7ZC 1UD5A 3KCWA 3FSAA 3U2SA 5BPPA 2DQEL 2VE6A 1KELL 1M2OA 1HNFA 4XAWL 3VTTA 5GSRB 4LHUA 3JVFC 4R4FL 2ZCLL 3NZUA 1F97A 4WKXA 4BKLA 2GEEA 4ONOA 2PO6C 4WRLA 5DJYA 1YEKH 3DVNA 4JMXA 5T1KA 2P4AB 1M6OA 4Z7UB 3HHMA 5I6LA 2JXMA 3RUGA 2XZCH 3QRGH 2UXGA 1XCXA 2MKWA 1J0JA 4KO7A 1N18A 4HP5A 5I1CL 1L7TH 5ANME 3OAYK 3ULVL 5BUGA 3D85A 4QRSB 3DIDA 4HC1A 2XKSA 4QHMB 2IPKB 2IF7A 1Z0MA 2IPTL 4L8CA 1M9WA 3HNVL 3GMQA 2R15A 3WMQA 3F7KA 5AW6B 1UB6A 1IFRA 3T0DA 3G5ZA 4K3GA 1XGRA 4YHLH 1IGCH 2BVYA 2EE0A 2DBJA 2A73A 3FU7A 4RX4A 4G7YL 2P45B 3FCUB 5TQ2L 5FR3A 3QIUD 4G1EB 3O81A 4V1DA 4G8FA 2FL5A 2DLFH 1JPSL 1QUNA 1CICB 3WJMB 2WB7A 2R4RH 4NWUL 2ARJB 4P3CH 4LPVA 3OHMB 4AQEA 5I8OL 5FXCH 1ZPUA 4JRFA 3MGTB 1VFOA 1RFDH 5MEND 1T21B 2ZX9A 1I7RA 2J8UA 4UILL 1S78D 3W0WB 3TVMD 3GS7A 4DKFH 1JZ5A 4G42B 5ESAA 4HIJA 1EERB 1FBIL 1YEJH 5ELIA 5A2KH 3CFMA 2ICES 4LEXH 4LCUB 1A1OB 1FN4A 2P80D 5IB4A 4TUOB 3I50L 2MNJB 4HH9B 4NRZB 3NN8B 5HDOA 3Q44A 1M3IA 5KBLA 1KY6A 1XIWA 4FNUA 4PRNA 4H4NA 4Y4KB 3RWHA 1F1AA 1OZTG 1MF2H 1SUHA 2HZHA 1KJ2A 4Z0XB 2NCEA 4OKVB 1AZBA 3QUMB 5EORH 5IBTH 3RA7L 3WEXA 4LIQH 3GLEA 1MDTA 2HKAA 3GBNH 3EJYD 3HE6B 4YX2H 3SBRA 5CIPB 4NUGL 1IARB 1P5VA 2FT7A 2OL3H 1FSKC 4YJZL 1TZIB 5E95B 1AO7D 1R34A 4L9LC 1LO5B 4JDEA 4QHUA 5J6HA 1A3RL 3JV6A 5KYYA 4JHAL 4GW1A 2DJ4A 4PS8A 3LZNA 5ACZB 2K70A 1M53A 1WCQA 3GSXA 3NJXA 4MB5A 1GMEA 5T1LB 4I18B 2WQAA 1WFIA 5IJDC 4HKBB 4GMTH 4OLZL 5C8JB 2JB6A 3FMGL 1TZOA 3LKNB 3R19A 3SPVB 4EKJA 3FUEA 3QIWD 4OFPA 3C09B 5J6SA 3L17A 2XQYK 3ULUC 4PR5A 5L2KD 2O61B 1MH5A 3OR7A 1MHCB 2F54D 5CILH 2LFEA 1HXKA 1I7TB 2CRMA 2WCPA 4Y16A 4M4RB 3JXAA 1Y7VA 4FG6C 1HYRC 2X9WA 1OAYL 2ADYA 1JNLL 2ZCKH 3B2UC 3NFNB 1T5WA 1SF3A 5I1IL 2D73A 2XPYA 2CJSA 1MQKL 1Q8MA 2YBRB 4M7LH 4DGWC 1XXFC 3KW8A 3SSGA 1J18A 1EAOA 5FIEA 2B5IB 3LH2L 3HTLX 3L3OB 4CSPA 1UZ8A 1CE6A 3DVIA 43CAA 1E8WA 4JM2F 2GCYA 5JHLL 5AW9B 1XF2A 4IDJL 4OCSL 3GSVB 5FB8B 3L5WA 2PYEE 4MNHB 4OKDA 4PB0H 5GJTL 4XBGA 4H26B 1XCQA 1UM4L 1CZ8H 1CO1A 4HUMB 3L7EB 1A7OH 3V4LA 4PTUB 1E6JL 2DTML 2CLRA 1G7MA 5D1XB 4WV1C 2CZNA 4DZ8A 4XBPB 3DUSB 5DCCA 3WIIH 4F7PA 4K7PY 1XGQA 5GZOA 5JXEC 2Z31B 4FQIH 1E5AA 4XOCA 4E41A 1KLGA 4X80H 1YEFL 4APXB 4BQ9A 3X3FH 2QADC 12E8H 1HNGA 1TMCB 1B2YA 3MCG1 3VB9A 1WWBX 4HJ0D 4CBZA 3KVDD 1WF5A 1C1EH 1S5HB 3KPMA 1N5AB 3GSNH 3MA7B 3SKOA 1T1YB 5J12B 1F58L 1JPEA 2BXYA 5KBNC 5ILTH 4GUOA 2AMUA 1UACL 2WVVB 1KEML 1MN4A 2HRPH 2R0ZH 1JRHL 1A4KB 1Q94B 4FXGC 4DGIH 1BQSA 3D2TA 2YKKA 1ACYL 4ENEC 3KE0A 1ZK9A 4NQDD 3UTOA 2OBGA 1O9VA 4PJIE 3WLWD 2BJMH 5DSCB 2E76C 5D93B 4S1RH 4AGPA 4ELDA 3BP6B 4GIOA 4J3UA 4BUGA 4PG9A 1NC2B 4PJ8C 3O3BA 1SJHB 3APFA 4FI8A 2OL3A 3TS8A 3FQTB 3EOBB 1IL1B 3S96A 5IFHH 1Z5LB 1IBYA 1ID2A 1SVZA 3RPBA 1A22B 4JBSA 5BRQA 5T3ZL 4DQOL 4O51B 1NANH 4UIKL 1JHLL 1KV7A 5CEZL 1N0XH 1QASA 3Q0HA 4MWFA 1K85A 3BISA 5ETUA 3TPKA 4ETQB 4MCNA 5E4OA 3P4NA 2VMDA 2D0FA 2XZAH 2XVBA 1HN1A 4EZKA 1BVLA 1CDCA 5B8CA 4WJKB 1OLLA 1CYWA 2AGJH 2FB4H 3B43A 3HZKA 4XMLH 4U1JA 4N2KA 4WUKL 3DIFB 1SQ2N 1ZVSA 1L7IH 4R0LC 5DFTA 3T1WA 3DTDA 4GSDL 1FYTB 1YZZA 3FO9B 1KENH 2OTUA 1SGKA 3ESMA 3GC3A 1EFXB 1G1KA 1V05A 5IHHA 4A6YL 3DX7B 3NIGF 5TF1L 1LWRA 1WJ3A 5J4MA 2VTFA 2JI3A 2L7EA 2F15A 3BIKB 3NABL 4KZEH 2EEBA 3EGDA 4R26L 1G84A 4AEHH 2EIEA 2Q20A 2OMNA 1JXDA 4IEFA 4LLUA 5C9KA 4EEEA 3GS4A 4L9LA 1UM5H 1MQ8A 1KY7A 3OKEA 4P3WA 4UUJA 4X9GA 1OCWL 3ULUL 3QJUB 2VMEA 1TTFA 2ENJA 4QOKD 4G6KH 1PZ3A 4YHZH 6PCYA 3BT2L 5I71C 1A7NL 4GINA 4OGZA 2IH1B 2JCWA 5F6HI 5C6TL 1X7TA 5EU6B 3EJJX 4MLSA 3SYPA 4S1SL 3RZCC 3MNWA 5HSFA 4NYLA 5FWQA 1DEEA 4Y88A 4UU9A 3UX9B 4MMXB 1SHWA 4RZCA 4BSWB 2YQGA 4IOFD 1IFHH 1AGDB 3CDGA 3JZYA 3OHXB 3T0EA 1TYEB 2NT0A 4QRFA 4YNYB 4PRPA 2F58H 4PJXF 5LGHH 2XY2A 1J48A 2IXQB 1TNNA 3IMRA 4L1SA 3O2DH 5F7DB 3BKYH 4F8QA 1BCIA 5M7QA 1HHGA 4GBXC 5CJBA 5H2BA 5K1NA 1DDHB 1PS3A 4IBVA 4R97B 3G6AA 4X8XA 2VR9A 5ID1A 4P06A 3PNRB 4RSYA 3WNPA 2BO0A 4UQAA 4X5WA 1JK8A 3ARSA 4HWEH 1JZ8A 1VEOA 2CU9A 1KCLA 4G6FB 1PG7L 4XNMB 5ABAA 2OKMA 1JNNH 1RUQL 2ED8A 1KB9J 4YEEA 3LXCA 5DRWB 4AUUA 4U6TA 4GRWF 4NPYA 2H6PB 3HAEA 3NG5A 1QACA 4MMZC 1RUML 1QO3B 4PJDA 2A3TA 3EH4B 2E7HA 4GAFB 3A5VA 4YSSA 3GEFA 1A9VA 3PGDB 3FT4B 2TRHA 4ZUTB 4Z7QB 1PSKL 1WDAA 3RY6A 2CGRH 3BP5B 4DGUA 4FABH 5I23A 4WEEA 4MCZA 3UYRH 2W07B 4NKOB 5HYQA 2OTWB 4KVPA 4IKKA 1JCVA 1RUAH 3N0AA 4KK5C 3BN9C 43C9A 5DFVC 1T22B 4FXGA 4ZPTB 4G7QB 2ED7A 2KZWA 1VGEH 4U1HB 4WO4B 3ABZA 3BQUC 3ALWA 3NUKA 3WMPA 2DD8L 3QCUL 2UZXB 3H9SD 4HG4K 4G8IB 1X5ZA 4JPWH 4PJ8A 3VU1A 1NFKA 2F8XC 4MJJA 5DHXB 5IK3B 3GK8L 3N1FC 1VF5C 2RACA 2P8MA 5FGRA 4JY4A 2YD7A 3TT3L 4PJ9D 2AXFA 1BAFH 3DUHA 3IAPA 4JREC 3MRHA 2F53B 3M1OA 3OKYA 3RU8H 5E8DH 1YJDL 1CE1L 3DV6B 2GSGB 4LEOB 4MNQB 3LH9A 3WXWH 3FONA 1DE4A 3NCMA 3QO0B 5F72S 4ZMQA 1CLOL 3G3LA 1RZFL 4PI2A 5HI3C 1ZGLB 2VC2H 3RGHA 5CUSH 4F5CA 3UGUA 5C0EA 4F91B 3SBQA 1RUKL 1HFUA 4HUKB 3JWOL 4HDIA 2QVMA 3NP3A 5AB9A 4A2HA 1K5NB 3B8YA 4ZMYA 4JFZL 4NS0A 1A6UL 1IT9L 3L9YA 3QEUA 2A9BA 5MI0B 4G1MA 1U8MA 2GI0A 2YGPA 3RVTC 3UDWA 1YMME 3PQYA 3M45A 2XZQH 3ZTJG 2YSSA 2P43B 3V79C 4N8CH 2QKIB 3PL6D 4K8RC 3BCFA 4UQ3A 4DVRL 3LRHA 1M6UA 2Z1KA 2ZT9C 3MBED 3O2DA 1WLHA 4HJJH 2OW6A 1KGXA 1AYOA 3NCCB 3CN0A 3ZKXC 1CFVL 1MPAH 3TH4T 1QBLL 1JHTA 1I8KA 2RTTA 5I9QB 7TAAA 4UINH 3BH9B 5F3HA 3MV8B 1HKLH 1V10A 1DBKL 1IE4A 4WFHE 2CD0A 4F2FA 2CMRL 2Y36L 4LLYA 3RZCA 5C0RH 2ATPB 1TU2A 5DR5L 4KK9D 1DVYA 3H55A 5E6IC 4E41E 1NCWL 3EDEA 3ZYZA 1T83A 1U41A 4IJ3B 3HIZA 15C8L 4ADIA 4IGBD 2EINB 2VRQA 1EHLH 4ABWA 4Z18A 2VW4A 4W6XB 3LTVA 5DJ8A 1A47A 1RZIA 3P73B 2R4SH 3PPSA 4L4VA 1A3LH 4ODHL 3H85A 2I9LB 4K8RH 5C09B 3UAJA 1PZ5B 4A2MA 4LKXB 4XNQB 3MV7B 4LIQE 2VN7A 4NOBA 2HX9A 4M8UA 4HKXB 3MJ9H 4ZT1A 1OT1A 1BWWA 3K2MC 5A6LA 4GBXA 3SKJH 2ERJB 1O7DC 3GUFA 5CBAA 3FTZA 1Q9OA 4KVCH 4LVEA 2BSCA 5EOQL 3ZKND 4BFFA 3WTUA 1SOXA 5DYOA 1FHNA 1QP1A 3QIBA 3SE4A 2CK0L 1HI6A 5DHYA 4F8PA 5KYWB 4FE9A 2BZ7A 3LN9A 4XO4A 4LSTL 4GAJL 3ZKMC 3OC8A 1P9MC 3OMNB 1A3ZA 1SNRA 2B14A 2HA1A 3GLDA 4GRLB 4JO5A 4CU7A 5AB2A 1C9SA 2Q2LA 2X89A 4LHUD 2FEEI 3EO9L 4FNQA 5TGBB 1XO8A 4LPUA 2NY6B 4MD4B 2FQFA 4HJSA 4S1QH 1OQXA 4HVBA 5T1KD 3NAAH 1RQ5A 3ZHKA 3VXRA 1LD9B 3VSUA 3MRIB 3JTSB 1OAZL 4R5XA 3VNYA 2DLEA 4KGJA 3EO1A 3OV6A 3WFHB 4PBWD 3K7UA 3VI4A 1YEGH 4A1RA 2XLLA 3D5OF 4OF5A 4RWHA 3UYPA 3VWJC 4XNBA 5L7XL 5EEUA 2PP8A 2FE0A 2WWKO 5AVWB 3D85D 1AKJD 4YGVA 4P57A 3BUIA 2AV7A 4N2IA 2HRGA 5HD8C 5ISZE 3INUH 2AJ3B 3V7AE 1KN4H 2VZ1A 5I1LB 1FO0L 3C9NB 5IESL 2VZTA 2BVEA 5E8OA 1I7UB 1PEZA 2V0AA 2RBLA 4JHBA 4PJEA 1OCZB 2A6JA 3FUMA 5FFOA 4RX4D 5TH2B 3T09A 4ZMPA 3B4NA 4ZTOL 3BYTA 5JMOC 2B2XH 1GIGL 2NNCA 1T03L 4PPTA 3VG9B 1MNNA 1DFBH 2JKLA 2JKRM 1I53A 2PETA 4P4KC 4V1DD 2BS8A 4Z3GA 3MRJB 3ISWA 4IHOA 4BH8A 5E5MB 4NX0A 3P4OA 1NPUA 1TNMA 2PW1B 1M2VA 4A63A 2WJ5A 3BP7B 1ERNA 3J2PA 1PNCA 2EXWD 4IIQB 4N2FA 5HVHC 2CXGA 3TN0C 4YZFE 2PABA 3LKQA 1ET8A 2HUHA 5I8EB 1S5IL 1S7VA 2PPDA 5HYJA 2UWEE 3RFZB 3D12B 4LSQL 2OZ4L 1XGYL 4C4KT 1QSZA 3VDCA 1M7DA 5DS2A 2AW2A 5FUOL 4JFEB 4PRIA 3ZMEA 2W9EH 4IBWA 1EDQA 4MKMA 3PWPA 1MCRA 1OP4A 3LV3A 4G72B 5D7HA 5JHBA 2YUZA 4DSYA 4MDJA 3CFNA 4GKNA 2ZX8A 1MAMH 3NFPA 2OSYA 5E6ZA 1XIWD 3H9HA 1AQDA 2HVBA 3KHOA 4HIHA 4WSJA 3TBVA 2XWBA 4KJWC 3FPXA 5F88B 1AS8A 4J3BA 1I1AC 2EADA 4I48A 1ZLDA 4I85A 2QPFA 1JNHB 3HMWL 4NQCD 5J6GA 1XF4A 4K71C 4CU8A 3L7FB 3SYAA 4GUPB 3NPSC 4LFHG 5HHMD 5ICZA 4J6IA 2FZ3B 2LU5A 3HUJF 1E4XI 1II4E 4PJDE 1YNLH 4GUCA 5MEPA 3ILPA 1WT5C 4XAKD 4XXWC 5C0BB 3BLKA 5A7EA 1LK2A 1T7YA 2R0KL 1A14L 1ZTXL 7PCYA 1C5BH 1PZAA 2NLJB 4LNRB 1IGFH 5E0QA 4XMWA 3ZMRA 1ZS2A 4YHOH 3EO0A 3HE7B 3H7LA 5DRZB 5I75B 1I9JL 1UKSA 2X4SB 2J55A 4K0OA 4OIFA 3BP4A 5EPMA 3VFMB 2ZCHH 3N6YA 5CINL 4XP4H 1JVOA 2X12A 2N59A 5FYLD 1GGYA 4DKDC 3K6IA 5JQ6H 4BFEA 4CU6A 3ZLQC 5I5MA 3O6ML 4X7EC 5D6DA 2JJUA 1QQDB 5CSBA 1I9IL 1FRGL 5FHAL 2AI0L 4HMEA 1Y18A 2V2TB 4I2XB 5D4IA 4QYOB 1QSEE 4WDIA 2QVIA 1AC6A 3GMLA 4A7GF 1DBBH 2BSSB 4FFYH 2YGQA 4U3CA 3T0WA 4OFDA 2ZG2A 1RIUH 1RI8A 3AREA 1WZKA 5ITBL 4ZMWA 4P05A 3L8QA 2VWEC 2UZYB 3U4KA 4H0IA 1LE9A 4X6DF 2J6WA 2Y6SC 3P69A 5IEKA 5ALCH 1IM3A 1HQ4B 2A9ML 4XPBL 2DQGL 3C87A 3IDXL 1HJCA 3IMUA 4GXUM 2X5PA 2R2BA 3IF1A 5INDA 2NZ9D 5T5FH 4UOJA 3GZKA 5JDJA 3DIVA 4FQCL 3U9PH 3LQAL 3QS2A 1OEZW 3QYMA 1XF3B 4FLOA 2LGNA 4FXTA 1BIIA 1JDDA 1X5HA 1FAIH 4YHIA 4ZXBB 5GZOD 5HPMA 1VEPA 4LSRL 5CEYB 2LT9A 3MRCA 1KTLA 3BAXA 2V7HA 4I1PA 5AVQB 4AMKL 4UDUB 4U6XB 4BZ2L 2YWZA 4S11A 2KT6A 4XPGL 3MCKB 3NJLA 5FA3A 1DJXA 3MLXH 4FADA 2FX7L 4RETB 1RY7B 1ZHLA 1ZHNB 2W38A 2OYLA 1GZHC 4HKZB 4OQTA 4ELMF 4XI5D 1NEPA 1MW0A 2RJMA 4KY1H 3OXSA 1ILUA 3HE6C 4C58B 3MROB 2Y7SA 1FF5A 3V6ZB 1DUYB 2E9JA 3RDTB 3FXIC 3A22A 4XE0A 3CD4A 5C0JB 1GGIL 2VDKB 4WWKB 1AC0A 3T8XA 1OSPL 4U1SA 3TM6A 3TBYA 2HT2D 1BW8A 3KJ6H 4L4VE 1ZGLM 3RKPA 1DCEA 3FB7B 4BZ1A 3TOPA 5JOFB 1QYGH 5IGXL 1VPOH 1UHVA 1GOGA 4Z9KB 4P4RA 5FM4A 3VFPB 5JIPA 5MEQB 5C0CE 4I18C 1FL6A 3MTRA 1CD9B 4N0YL 1OB0A 1RZKL 2AZUA 2YAQA 3APNA 3VD2A 3A4DA 2A9NH 1WHOA 2QT6A 2UV3A 4B9KC 1JPTH 3G7TA 4MQXD 3C60B 4PYGA 3P02A 7FABH 2J2ZB 1CI5A 4XXCA 1YN7B 3Q13A 2KMWA 2LVEA 2NSMA 5L6YL 4YC2B 4YXLL 1OP5K 3J27A 4H1LH 2YEZB 3BFWA 4J3VA 4UB0L 2ZPKL 5DUJA 2BY1A 3G04A 4DETA 4MZRA 4Q56A 3IWVA 4XGZA 1AYRA 4YDLC 5DC4B 4A2LA 2MTPA 2YEVB 3VSQA 2ZAIA 3I75B 3QZWG 4N2NA 2LFGA 2XUWA 4S10A 2JJSC 2Z7ZA 2WWNA 4WW1A 3LHPH 4K23L 2XPGB 5GGRB 5FDWA 3G5YA 5SV3A 1VEMA 3UG4A 4S0HA 3WNIA 5J89A 4XCCH 1OE3A 2DQHH 3RE0A 4XXWA 3A67H 3E8VA 5I30L 1E8ZA 4MS8D 4I1NB 2D2CC 3TJPA 4GG6F 1A7RH 1E2VA 1BZ8A 3VI4E 4PV9A 1SBBA 4MDRA 4MJ6A 1G9NL 4DKAA 5L8KB 2G3ZA 3P1VA 4F8LA 4NHCL 1FLRL 4WI5A 1FIEA 5T5FA 2LAAA 2BFVH 2OK0L 5TDPA 1BP3B 3AU0A 3GSWA 3H54A 1XD0A 1VGKA 5KANG 4MCYA 3PWLB 2OSLB 5FKAB 3LZLA 4O4YL 3DURB 3ECUA 1TJIL 3TXAA 1WZMA 2YN5A 1HNYA 4YVUA 3HG2A 2Z31C 1D6VH 3O4LA 4Q58C 4R8WH 4Y5YA 5DD6A 3T0ED 4ZJ9A 5DWUL 2VDRL 4PRPD 2WY3B 5ADPL 5JQIB 1JP5A 3PNWB 5DK2A 3WN5B 5I6MA 2ZICA 3D18B 4YDIL 2VDLB 2BDNH 2L0DA 4BK5A 4MA8L 5B4MC 4P2RB 3AG1B 4PV8A 4IKLA 4IK7A 5EZIL 3CXFA 4DHLA 3IMBA 1HHIA 2OYPA 2KUTA 1N7MH 5KBPA 1N10A 4MVBD 1HOEA 4N20A 1KXTA 4A7QA 3VH8G 3BZ4A 4X6BA 3F7YA 3RY4A 4M7LT 2V2XA 4YQXL 5IB1A 3V6OC 4BDVA 4JFXA 4PRIE 1NOAA 1E4XH 2PWGA 4MAUL 2ZSWA 5D70L 2F6AA 1DVSA 2SEBB 2W0LA 2D7NA 1ZA3A 3EGSA 3CHSA 3PWPE 5EUOB 3ZJAA 4H44C 3HI1A 1PD6A 3U25A 1LK3H 1SYVB 3ZTDC 3RIFF 3QUML 4YBLC 1FGNH 3D9AL 4M5YH 4YSUA 4F93B 2WYTA 1TTBA 4ACTA 4AKOA 4OCWH 1GHFH 3DA0A 3RPIA 3RHWF 3ME0B 2OJZL 1DN2A 1P4BL 3O3AA 3UTZA 4XP9H 4K7PH 3VUAA 4AZ8A 2LLGA 4R7NB 4OJEH 4KQ4L 4M1GH 3RWIA 4TSCL 3FB5A 4F7TA 1QSFD 4JRXD 2X0VA 1OP9A 3ARBC 1EHXA 2J6EH 4S1DD 2XSKA 4UM9A 4ZAKA 2ZF8A 1IGYB 2VR3A 2X4QB 1RUPH 2B9AA 4DPAX 2VR7A 4OY9A 3EHBD 2JCCB 1XSIA 3ABGA 3WGUB 2I7SA 5JDSB 3DO7B 2ZWSA 2P5WB 4PS7A 3ZRSA 4N90D 2AAVA 3S4SG 1XR9A 4TL4A 2NY2B 5E8NA 5EEWA 1QFPA 2ADFL 5DHEA 2FX9L 3HI5L 1MEXH 4U6HA 5KN5A 3FTVA 4FN0A 4QMEA 4XX1G 4OD1H 1TQVA 4R4ND 1ZEAH 3HZVA 3AQYA 5HYSG 1F13A 4WI2A 1EFQA 5HHXH 4OZGB 1O7DE 4N25A 2ED9A 3IFOA 1IM9A 2YAEA 4QEGA 2R29L 4G9FA 2XN9A 1M57B 2YPKB 3LN4B 1REIA 5AZEH 1BM3L 5C0AB 5C0ND 4UOZA 1J1PL 1G5GA 3PQYD 3JSSA 5F7EL 2BWQA 4AEIH 1Y6NR 4X6CE 3OHXC 5GRWA 4MB3A 3ATDA 1B0GA 3UBXB 1UOWA 2COVD 2BVPB 5DRXB 5IG7B 4X7CC 2ZOKB 2HFGL 3B9KB 4F58H 4RFEA 3QZOA 4WI0B 3CFCH 1F1DA 4UIMB 5DD1H 3KYOA 4MFHA 1KIQA 2OSWA 3HS0B 4ZFGL 2DRUA 4ZW7A 5CBEA 1D5BA 3IAGC 4WY7H 5EZOH 3WDIA 5INCB 1S7SB 2OA9A 3GJFA 4LLDB 2IH3A 3CVHL 4GW4A 2Z3FA 3FCTB 4N8UA 3EOYG 3PGFH 2WUCH 1S9WA 3A6CH 3BLBA 2WLZA 1WP6A 4M6MH 1JK9B 3I02A 1W0WA 3MNZB 2XA8H 5D1ZB 5CZRA 3RRQA 2AFNA 5IM7B 1UJ3A 4RMTA 2F7OA 2OMWA 3II1A 1CFQB 5E08H 2GTWB 3SBWC 3UBFA 3N04A 5ALBH 4XO8A 2Q8AL 3RPKA 5MP6L 3Q01A 1R3KA 5IHUL 3L6FB 2WOBA 3NFSH 4PCSA 2EO7A 1G7LB 3QUZB 2D7PA 3VI3A 3UAJD 1S7XA 1KCBA 4AVKA 1XHHA 1FPTH 1I8AA 2R23B 3G6JA 3UGXA 1NWPA 3SGEH 4WFGD 3IPFA 4NRYB 4NENA 5DMYA 3U36B 4YHKL 4LP8A 4JDVA 1RERA 4JM2B 4DGYH 3LZFH 5DVNA 1OGSA 3HRZB 1AVAA 1LXMA 2H32H 2ICWJ 4OSUH 3FFCA 4KKBD 5KSVB 4WO4C 1FUNA 1EA9C 1H8SA 1USQA 3QIBD 3M86A 4M00A 2FLRT 4YE0A 2YAHA 2C7FA 3K80A 1CT8A 2Q6WA 1QA9A 4KI1A 3IJHB 3D05A 3E6FB 3DXAB 2H0FA 3M8OL 3L4TA 3V8OA 3MREA 2IDFA 5CJQL 1U8LA 1F42A 3F7QA 1CFBA 2XVKA 1JYVA 3DGGB 3OR6A 3LJ3A 2X89D 3WFCL 3CWGA 4G3YL 4K7PX 3RIAF 1AR1D 1WS8A 4MQSB 3IEAA 3KGTA 3L08A 4DP2X 5TDNA 3I6KB 2IAMB 1TYJA 1P5UB 3QZWB 2XZZA 5DHDA 3VXRD 1MCEA 3QUHA 1H3GA 1OGAE 1X5GA 1R0AH 5I8CB 4JO1L 5IBLD 1JWUB 2AXGB 3EYOA 4OJFL 4JN1L 5MI0C 1HT6A 3BUTA 5DJAB 3TGXA 2IADB 4HPHA 3BXNB 3ZIYA 2QHRL 2CBOA 1TR7A 3N5AA 3VRLF 4CADA 3GQFA 2EEFA 2O5XL 2QKIC 1L9MA 2HMID 2F5AH 2ENQA 2GUOB 3QJRB 4KKPA 1JZHA 4KQ3L 1AOZA 4XNXL 1WAAF 4Z7VF 3UEQA 4DZBB 4APQC 1EGJA 4RDQF 2UX7A 4PB9L 5FK9B 1RHHA 3GGWB 3SDYH 5IQ7L 1X5JA 2BSRB 2XYBA 5I9QC 1BZ9B 2Q10A 5DS8B 1E9PA 4ANWA 4XH2B 5F89B 3I6GA 4U7KA 4CN4A 3CCHB 5KS9E 3FPYA 3LRSB 1BM7A 4P9HC 4P46A 1SY6A 3GSRA 4OGXL 3O4LE 2AEQL 4ENED 2CO7A 2XPZA 3CZJA 5HYJD 1ZSDB 2O5ZL 4FFWD 1NCCH 1I1FA 3NIGB 3VGEA 3NJKA 3BZEB 5I73C 1A4JB 1SBSH 3M17B 1WBYB 5E5LA 1SLVA 4UT6A 2DQDL 2X7LB 3MRPB 3VH8B 3NIFF 4BA8A 3ZZQA 5CF3A 5B7MA 2D7TH 3ARFA 5D7IE 2Y25A 4DKEL 4NIYE 4F2MA 1HZHL 3NSCA 4L4JA 3QJHA 4XOAA 1T20A 4W4OA 5B3NA 3VXSE 2MCG1 1ORQA 3IJ7A 1J1OH 1CBJA 2ERJC 1Q9LB 1R3HA 2P8PB 1FV1A 4FHJA 4YHPA 3WIHL 1EV2E 1H6TA 3KYNA 2F08A 4DF9A 2NY4D 3DRQA 3PWJA 5I2IB 1B3IA 2ITCB 1IE5A 3MBWB 4P9HH 1SHSA 1G7PB 2XTSA 2Z8RA 3DSFL 5DUML 2IANA 5T1MB 3HC4L 4M7JL 5DJ2A 5EMYA 1MCOL 1SF5A 1ETZA 2DF3A 4IRSC 4UANA 2ICWA 2NMSA 4EUPG 4BH7A 5F97E 3S5YA 5IV2B 2OMZA 1UFUA 3LB6D 3OJ2C 4TQPA 5DZLA 5HGDB 2N01B 4S0SD 2K7QA 3GXNA 3IMVA 1BXXA 3D7PA 3KPSA 3UTQB 1GZPA 3RURA 4BSJA 4HS3A 3EYSH 3FL7A 3AQZA 4NQSB 5HGBB 3ZRFC 5LQBL 2HJFA 2IIJA 1U93B 4NM4H 3S4SB 2XQYA 3Q3GA 4WEBL 4TLUA 2AEPL 4ZX3A 2BK8A 4MNGA 5DF0A 5FO9A 3ZGIA 2O6FA 5GRXG 2VT0A 5C92A 5KSBF 2OPCA 1RHFA 2AEOA 4CSTA 3MCLH 5E4EC 4FYQA 4N8VG 2IPTH 5HYSB 3VWKA 5D5MB 3IJYA 2FEDD 3UO8B 3JYCA 4TUKL 1Z9NA 3VFRB 3ARED 3WY2A 1DQLH 3T0XA 1BBDL 3UPRB 3ASNB 3QUYA 5IIEA 3EFDH 5DJ6A 1C8PA 1D6EA 1WFNA 3PP3H 4HBQA 1DO5A 3VVWA 2WZ6A 3L4YA 1IM3D 4AIXA 1Q0EA 2APSA 4NZDA 1ZOXA 5HHNB 3D34A 3EXLA 5GRJL 3HJ0A 4ZMAT 4U4BA 1MFBL 5HHVL 4ZNEE 1MFDL 2JTYA 3VE0A 4IIQC 2D4DA 4GEJA 3VCLB 1CXFA 3B83A 3KNBA 4NJAH 5I1AB 4JMNA 1MOEA 4UILH 5KZCD 3RFZC 3NTCH 5CHNA 3IFLL 2OXGA 1L9QA 5GRVL 5AL8A 4OB5L 1WV7T 1CLZL 4U6VH 2YMOA 3ULAB 2FHFA 1SVCP 1SYSB 1U6AH 3GMNB 1ZLSL 3MYJA 5JO5A 2I5YL 4GOSA 2QPUA 2ZXWB 3KVQA 2NW3A 1BF5A 3G5VB 1FH5H 3CUPA 3F83A 3FUJA 3L5XL 3T4YB 3T4AB 3VXUA 3BUPA 3V0WH 4NN7C 1HCZA 2D9QB 4K5NA 1ML0A 3UC0L 4QRRA 1U8HB 3LZOA 3C5SA 3MRDA 3GINA 2EAEA 4GW5B 5FECA 1E0OB 1HL5A 5CGYD 3ARDC 3OQ3B 4WF7A 2XWTB 5D2NB 4A2FA 4UQEA 2FAUA 1N3NA 1MSPA 4Q0XL 1E5CA 4X2UA 1XT5A 4IRZH 3HC0B 3ZU8A 5F96L 1FVDA 1TQBC 3L1OH 3B7UX 3VI3E 3EJUA 1A7PH 3X14A 3CVDA 1N19A 4KGLA 4FQ1L 1HHKB 3X12B 3ZYJA 2NY3B 2ZXDA 1M1SA 3WSQL 3US0A 2JKTM 1JWSB 3HE7C 1WBXB 5I75C 4L4TA 2BNQB 3FMGH 3HBQA 3ZN6A 4G82A 2ZOTA 1DQVA 1JSYA 4XMZA 3QI9B 3VXNA 4WW2C 1XCTA 3DROB 1YEEL 3L3KA 1T3FB 3X3GH 5FGCB 1TVHA 4IU2A 1C08B 4NP4H 3AWFA 3P30L 1ZD6A 3VD3A 5K9KB 1JNJA 3V8CA 1T2JA 4TM9A 1F41A 2VXQL 3V6OE 2AV1A 5KJ4A 3AGVA 1MQKH 1PAZA 2X9XA 3DHUA 3HVDA 4KI5E 4XC3H 5C0IB 4JANB 1ZY9A 1H6UA 3VRJB 3BAEH 3WS6A 3WL9A 1AS7A 5BO1L 5DQJB 1F4XH 3UIZA 5FCSH 5H94B 3SDAB 5IY5B 1KTDB 1BA9A 4WI3A 1CK0H 1NPJA 4LSDA 3QQXA 1JZEA 5E2VL 1W0VB 1DHKA 1QOKA 4NO3B 1MFEH 2APWA 3KCPA 3BX7C 4FA8A 1SXZA 4Y19A 1TZHB 2J1ZA 5TE7H 4BD4A 1PZ2A 4CC0A 3BGFB 4K2UH 3HR5A 1S3RA 1TLKA 1W6WA 4QLRA 1ASQA 2PPFA 4Z7WB 5HDQL 4K3JH 4A66A 2ICEB 1DSFL 1IC1A 3TZVA 1G4MA 1W6LA 3JT0A 1N26A 3WY3A 4QGTA 4V2CB 1IBHA 1CG9A 1G7JA 2IGTA 1WFJA 4ZFOA 1S6NA 1DCLA 3O4LD 1PKQE 3VQ1C 4MA1C 2YWYA 3G08A 3NCJH 4LPCA 1T2QL 1IX2A 2CIIB 4QRQB 3F2LA 4WGVB 1ODAA 1KBWA 3BRGC 1KGIA 1RZ8A 1CDGA 1DBJH 2BSEA 2YQBA 3DI2B 3V0VA 1ZHBA 5EC1A 1GS8A 3D39A 2AF2A 4G7VL 5IKCA 2I32A 4HEMA 1CLYL 1HSBB 1Z9OA 3HLAA 4LOUC 2EIMB 3BH8B 1MFVA 3B37A 1EMTH 1UM6H 4FG2A 3LN5B 5B7EA 5H37A 3EYQD 3DHMA 2AJXL 2G30A 3KBPA 4MZIA 3BWSA 3RDTC 2OX5B 2Y06H 3PGCA 4D0BB 4BSVA 4BCZA 1D7CA 4WWKC 2X4TB 1KDJA 4IRZA 1OOAA 4XNZB 4GP8B 4O9HL 5AWNL 2BX5A 3JV4B 1DQDH 3HFFA 4XPAL 5FO8A 3QCTH 2GBUA 1U4EA 1GS6X 4F2ME 3UBXI 2XKUA 1HTYA 3RX8A 5F0LB 3NEEA 4PS4L 5CJOL 2NUPB 4F3FA 1UKTA 1F2XK 3F7VA 2FR4B 3VO0A 4WUKH 1NCDH 3C5JA 3N1QC 3C60C 5AZ2L 1IV8A 3VXMB 5I66B 2X42A 2QL1A 4N6RA 3B2VL 4NDMB 4ADJA 4B9YA 4YC2C 4EUPB 4IRJA 4OIAA 3AM8C 1IGTA 4BKTC 1GZQA 5ICXA 3SY0B 4HMDA 2GBTA 1BFOB 4HKJA 1E5ZA 1HILA 4PGDB 4UM9D 3KYMB 4ZAKD 5I82A 2CQVA 3GS0A 5A2AA 4KDTC 5JHDB 3TH2T 2E7DA 4NZTH 1C7TA 3EADA 4JZOB 1TMQA 5D1ZI 3T0VA 3KWWA 1AXSB 3IAQA 1NDGB 3QJVB 2AEIT 5DGRA 5E99L 3ZDXE 3QRFM 2X09A 5BOZG 1RK0A 4OAWB 1R5VA 3NZ8A 1D7BA 3VTAA 4HOMA 5C08D 2EXTA 3HB3D 4N26A 3W9EB 1CPUA 4N8VB 4RGNE 2OXHA 4ZW6A 5GGTL 1SUJA 4DO5A 3EYFA 1CF1A 4S1SH 2XXGA 1IC7L 1PZUB 3QEHA 1RIHL 1J5DA 1HVXA 3V95A 3C6EA 1IM9D 4FZEL 2X41A 1U92A 4U7SA 5SWQA 1LVEA 4G9FD 2XN9D 5D7KE 5GRVK 2DM3A 1DR9A 3D3VA 3KM2A 2NY1C 3IKCA 4AYEC 1BFTA 2WXPA 2YPLB 4PJIF 4XC1L 3WAKA 2FQGA 2OCCB 3QA3A 1R5IB 3L4VA 5D7LB 3JZ7A 1H9DA 3HUJB 4BUQA 4U7MA 3GI9H 3QPKA 2WCGA 4M43H 3LRLA 3BJ91 1UWGL 5E8EB 2EYSB 2MOQA 4PJAA 3PREA 1JGEA 3I2CL 1NKGA 3OX8A 1KN2L 4KITB 1TKWB 1EXHA 4YDVB 4XNAA 1E3XA 3MA9H 1X3DA 4M62H 1KCRH 4K5LA 4ACPA 3NCBB 1CTMA 5FC9A 1UADC 3TJEL 3MKGA 4ATTA 3RNQB 3FO1B 1NGYB 3KYAA 4X4XB 1R17A 3DGCR 3NEXA 4XPHH 3QDGB 2MKLC 4BCYA 2EDDA 5AVYB 4Q2ZA 3PV6A 4HK3J 2GFBB 3TYFA 3WU1A 2CDGB 1Q1JL 4NSKB 1E9QB 1LO3L 3QXDB 4JHWL 1MCHA 4XZUA 5GS1C 3LAFA 4YSEA 3CZEA 3CN4A 2EJ1A 4GP4B 4JFDB 5T33L 1AIFB 1JF1B 4K7FA 1EBPA 5EDSA 5I76A 4P5TD 1I8IA 4J3OC 2OYKA 4UQBA 2LVCA 3HZMA 4HF5H 4ISVB 3O3EB 1TJXA 2TSAA 3VXUE 1UD6A 4XB7A 1QKZL 4LLAA 5A6MA 5KANI 2R9HC 4GH7B 2VDKL 4DOHE 1X7QB 1ZXQA 1ECYA 1KTKE 2MQCA 4Y2NA 5IB5A 3EJZC 2VDLH 5TQ0L 1IVTA 4R2GD 4YXKH 3UPAA 1WCBA 4LKCA 1PZBA 4A6YA 5B21A 2W65A 3AG2B 1TDQA 5F9WB 3FFCD 2F5BL 5GISH 3QCUH 4JO2H 3SZKC 3GB7B 2FSEA 3MJ8B 2G5BA 1DQML 3UZQB 5I17B 3EBIA 3QR0A 1INQA 5T3XL 2Z0BA 4GEIA 5FFLA 3TO4B 3PV7A 5BS0B 4OLVH 1U8IB 3NA9H 1D9KA 4HWBH 1QWNA 2WJ7A 3DUUA 4KI5D 4RRPA 3UTTA 1U8KB 3UJTH 1JZ4A 3GLZA 4NIKB 1Z5YD 5I1DB 1A6AA 2P5EA 5HHOA 3DECA 4N22A 1QFUH 1I9RL 2ADIB 2VDOB 3FT3A 4I77H 1X5YA 3O6FB 4J3OH 2BVQB 2ATAA 1DBAL 4KXZH 2XTJB 2H8PB 2JTDA 3RIKA 5DVOA 4WEUD 3CVIL 1N6QH 1JGDA 4JKPH 1F56A 2GG1A 3BPNC 4ODXA 5ACMA 4ELMB 1BVOA 5E1AB 2A6DB 5ADOL 3E2HC 3OXRA 4NQED 1VCBC 2AKRB 3DDGA 3MUY1 4XHQA 1F0LA 4HW6A 3FQNB 4CC4C 3S88H 2OM5A 4EOWL 1YUHB 5I26A 2GT9B 3B9KC 2H3KA 3ZL1A 5EIQA 3CFKB 3ZVVA 2MWCA 1NGQL 3RX7A 1D7FA 3DMMA 3REWA 3D6GA 4UV7L 4D9RD 3E6HA 3HS0C 4Z7NE 3MV9E 1GKOA 1CGYA 2P47B 3L5IA 1OCOB 3SDCA 1YECH 3QFJB 2OMTA 1I9EA 1BJ1H 2EH7L 1W2KT 4JHZA 4AEFA 2AJVL 3BKCL 1TQCB 1YHPA 2ITEA 1VACB 4OCLC 4P46D 1ACZA 5ESQA 1ZKAA 5E0FA 2AQQA 3EYVB 5D1ZC 1UWYA 1XTMA 1N64L 3HNTL 1HS6A 4L1TA 3WXVL 4YHYB 1CF8L 4HCFA 4OT1L 2EEAA 4B9IA 5DMIL 1QLEB 2R51A 5D1QA 1NBZA 4H8QA 4RFOH 1QTSA 3ARFD 3IGFA 3GXTA 5DEFA 5DD0L 1SN2A 4JZJC 4MD0B 2J88L 3Q5OA 3ZDZB 1FNGB 2WVTA 1BBJB 4I0PA 4KFZC 4P23A 5E9DA 3SKUD 3HOGA 1GGCH 3BQVA 4WSGA 2XIBA 3H0TA 1KYFA 1EANA 3EOAA 2NX5B 1PY4A 2A6IB 6CGTA 3VNZA 3H42L 1G9ML 1NDTA 3KPRB 2J5WA 4JO3H 5J13B 1A4AA 1K8DB 3DX1A 1SLUA 1J5OL 1I31A 1OCRB 1VKXB 4NRXA 3AT9A 5BQ7B 1RZJL 2FX8H 4M8RA 3P4MA 2IAND 3TV3L 1Z3RA 3CFJB 4RDQG 2Y5TA 1VFAB 2ROYA 1GW6A 2QSCH 4TNWK 3EJTA 3X13B 5DLLA 2IMNA 2QMKA 1BVNP 2WV3A 3L81A 1LDPL 5DMGC 1FFNA 2YD4A 1D5ZA 2LQRA 3FJTA 5IFJB 1PQZA 4R4BA 4FKHA 4KV5E 1WA0X 4XP6L 4N2CA 3CQPA 1P5UC 2WBXA 4U3SA 3KPSD 5FOBA 5JR1L 3STZA 2OCFD 4UT7L 2ODHA 2VDPB 25C8L 3T2NL 3WDJA 2EYRB 4L3AA 1VJSA 4RGND 3N44F 1MCQA 1F4AA 1L5GB 1A6ZB 5AVXB 3FC8A 3O8XC 1WFTA 2FGWL 2EVHA 3Q6FB 1Q0YH 4UAOB 5AW4B 1W72B 4NBYB 4AQ1C 1FLTX 2KS0A 4UF7C 1F8TL 2YSTA 5B39G 3GJEA 1MJ7L 1ANUA 3SYCA 4N2GA 4HJGA 4BCXA 4YR6A 3VWKD 2ODIA 1E2ZA 3CFDA 1IQDB 5IF0A 5C0BE 4R90H 3MMEB 4MX7A 2WXMA 3QUYD 1A7QH 3NH7L 4HUUA 3PWUB 4QXWA 4KMTL 4PJCF 5DVKA 2FJGA 2FH8A 3H4FA 1NGXA 5DO2C 4E9SA 4YSAA 3K5RA 5AD0A 4HGKC 5A2CA 4HV8B 4PU2A 3DPDA 1Q0XH 1NMAH 2NXZB 3CMGA 4JPQA 4JFVA 3HPJB 4F8TA 1FVEA 1TTUA 3W39B 3Q6GL 1GGBH 2E59A 1A0QL 4DN4L 2Y7LA 2PTTA 4Q89A 1EJ8A 5DDHA 2DKSA 2Y7QB 1ZGLP 2XBZA 4HIIB 3V5KA 7CGTA 1SOQA 1BVNT 2CA3A 3WMSA 4NLHA 3NZHH 2Q86B 1UVQA 3K0YA 2OMXA 2C1PB 3NSDA 2UXTA 4YBHA 3VGGA 4PJAE 5C0DB 4GXVH 1FI8C 4WU7A 3MRKB 3V5HB 5F6HJ 3U0WH 1J5IA 2DJUA 3MN8A 4PJHB 2A4CA 1YSOA 4X42A 5IHZB 4WWID 4TSAH 3E9TA 2RQEA 4UWQB 4FQHB 1OARH 1AZZC 1ZWIB 1PX3A 5ABZA 3FTGB 2CM6A 5AVUB 5GGVL 2Z8VC 4N5ED 2F0CA 3QGVA 3RTQA 2WTRB 2ZUSA 4FL4C 2HFFA 1WYJA 2J3SA 5F7MC 4QRRD 1ORSA 2EXYC 1GTNA 3V0JA 4FQLH 4PLJC 2Z93A 5FA4B 1A9EB 1EBAA 2WXOA 1RU9L 5HI4D 3RJOA 1BZDA 2VR4A 4FQJL 3S3DB 5BNXD 4K55A 2W0KA 1KYUA 2XWJB 3BVUA 4F57L 3TYGH 4G8GB 5ANHA 1NGZB 2BNRA 5CLWA 3GO1L 1YPZA 2N56A 2CO3A 2NY7H 1JFHA 3QEQD 3STLA 3H6JA 9PCYA 4QJ3B 4L4TD 1J9CT 2V33A 2H9GA 3QJQB 5F3FA 1QLFB 5TTRA 3WE1A 1F3JB 1K2DA 2EYTA 3N2JA 4RMRA 3UJJL 3GHPA 1NDMA 3F12A 4ABUA 1GYCA 4NJ9H 5JW4N 4FEMA 3CH1A 3ULVD 4JZJA 1ES0A 2JIXB 3DO3A 5KJRH 1UXSB 3O45A 4MSWA 1G7IB 5I8KH 5LWYL 2X2JA 1F45A 5BO0D 1Q9WA 2QVTA 4HXAH 3LCYA 3LS4H 2HVKB 5KBMA 2BP0A 2FWLB 3ULUF 1G7QA 2X40A 3UTTE 4S0TD 2J21A 3RI5K 3U83A 5JW5B 2CHZA 1L0QA 3BGAA 3FT2A 4KKLC 3VRIA 4I4WA 4PGJA 5FYJU 1YEDA 3P0GB 4AQ8C 1F2QA 4AGQA 2C3XA 2VQUA 4YZFF 4N0UA 4A67A 1TVBA 5JXAL 2A9AA 4OF3A 1AOHA 2UWEF 5C3TA 3ZSSA 2HRHA 3ARGB 5BW7A 5IT2L 3IU3B 3AS3A 2JK5A 1S9YB 1QR1B 4FGMA 2YRLA 4JZNA 4KNSA 4PJ5A 4Y19D 2A0LC 2C1OA 1MJJA 3D0LB 5CD3A 4EDXB 5F70A 1MFCH 2HFTA 4AENB 2E5EA 3ECVA 4QO1B 2ITFA 4ZZKA 5SX5K 3PAVA 2OZ4A 4TUUA 5IHLB 1LWJA 1H8OA 4AQ1A 1SXAA 2F7IA 1RK1A 1NIBA 3MLRH 1OE1A 3HC3L 4GLRI 1H5BB 2ZUQB 3TO2A 3MOBH 4NO0B 2FUTA 3FDWA 4XVTL 3WHE1 3F58H 1WZ1L 2BSED 4JGJA 3L45A 2DH3A 4KTEL 3CLEL 3CAFA 4I13B 3D39D 1CGSH 1XSOA 3HG3A 3ZE1E 4A68A 3FQYA 4PJDF 2XQBH 4K15A 5EF3A 3GMRB 4OBSA 1S7RB 3SYQA 1HEHC 2YC1A 4JGMA 2IG2L 3QFDB 4R84A 3KPQA 3P2BA 2NR6A 3MHZA 4HZLB 3WFBL 1J8HA 1P6FA 3N40F 1BFVL 3PUUA 5IMOA 2Y1VA 1MCWM 3FRPG 1MWAB 2EDKA 3GWJA 4RMVA 4KZDL 3FZUD 4HISA 5GGSB 2ZUYA 1OW0A 1OB1A 2VH5H 3D48R 5F7FA 5FYJH 4XMPL 3AQXA 4QKTA 5GZNA 4N85A 3OWRA 5CN1A 4HK0A 4TUJB 3U9WA 2NY3C 5FKPB 1BOYA 1BJMA 4N0YH 5H35B 5FWRA 3U9UA 3D0VB 3BI9X 4AEEA 2GABA 1E30A 5MENB 2XWZA 4P2OA 4Z7VB 1OF2B 5KUMA 4N0CD 4OLUH 1CD1B 1KPRA 1RULL 3CPUA 3FH5A 3QI9C 1BMWA 2YBGA 2EE9A 4GI6A 1A5FL 5GS0L 2PKDA 1JPGB 3RAJL 1NCUA 5ICYA 3VD1A 3BAKA 1BSIA 1OD9A 3ARZA 2AJUH 3MU3A 4IRJD 2DEXX 2ZPKH 3MFGB 3F8UB 1WWAX 2X0UA 1YYCA 1CR9H 4LLVB 5JORB 4N8PA 2WSDA 3SOBL 5LBSL 2X6AA 1CFTA 4XVSH 2W95A 4S2SA 1UT9A 7PAZA 4KMQA 2W60B 4KHXH 3ZTNH 1B4RA 2N1TE 2ADGB 2PCFA 1VIWA 4B6ZA 1B4LA 2NY5C 4QXTB 2BP5M 4OTXH 1ZTMA 3HMXL 3P11H 1CI3M 2BRRH 1BLNB 3ZL4L 1AI1H 3O3UN 5C6WH 5B39B 1U33A 4PAZA 5AB1A 3DV4A 3HZYA 2ZWNA 1MRDH 1X9UA 4FHKA 4HGWB 1BZ7B 1EUTA 2WINB 1FLRH 4ZFZA 2DLHA 5IB3A 2APTA 4I3GA 2OK0H 3BGFC 3QUXA 3G9AB 3CDCA 4JFPA 2ZKYA 3TASA 4BFNA 2ICEC 2DM4A 2TAAA 3O11B 1QBBA 4GG8B 4Q9RL 2R1XB 1F3DH 3C6LA 3D3VD 3QIWB 4BK4A 2HN7B 4FDWA 4JE0A 1KC5L 2JWYA 3RG1C 5L2KB 1R3IL 5FM8A 4BZ2A 4YE4L 3BPLB 2G3NA 2PLTA 3FRUA 4NN6C 5CGMA 3TESA 1UZGA 3S9DB 2CGYA 4Z3HA 2W80C 5A16B 4B3VA 4GO6B 4LQFH 3UABA 1OTUD 1QBML 1V3LA 1HEZB 4NQVB 3SE8L 3HS9A 4OZGE 4AVHA 4JFHD 1IC5L 1EAPA 4H20L 3U7AA 5F1OB 5MERB 1KTJA 2VUKA 4BA0A 4XPTH 2AHIA 1QBAA 5T3Z