2HRLA

Siglec-7 in complex with gt1b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
116
Chain Sequence
DYSLTMQSSVTVQEGMCVHVRCSFSYPVDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sialic acid-binding Ig-like lectin 7
publication title Siglec-7 Undergoes a Major Conformational Change When Complexed with the {alpha}(2,8)-Disialylganglioside GT1b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 27
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrlA00
3UJTH 1IGIL 4BA8A 2AAVA 2ZOLA 1KC5H 5CSBA 5KSUB 3DUSB 4O4YL 2X42A 1S7XB 3TT1L 1DSFL 4QGYA 4F7PA 2F9BT 4MD0B 2P44B 2Z93A 3IS1X 5EU6E 4E0RA 3P4MA 1U2HA 1HEZA 5DUBB 3W0WD 4ELME 3OPZH 1HIMH 4YE4H 3L5JA 1M71B 2F15A 2FO1A 1N4XH 4Z7VF 4R7NA 3QFJB 4PJXA 5GS1B 2ZUTA 1NGZA 4U7SA 1SMAA 4RGNC 1ED3B 2I07A 4K23L 4Q9RH 3F8UB 5JHDD 3GB7A 4OGZA 3ULUH 3DPBA 3PL6A 2BFVL 3X3FL 4NKQB 5D7IA 2CUIA 1XF3B 2QHRL 4P4RA 2X4TB 2C1PB 4NRYA 1F4WH 1QSVA 4JM2B 4PRHE 3TZVA 3JV5A 4DEPB 3WIFA 5I1GH 2YR3A 3KG5A 4LLVA 2ZUSA 5IFHL 2BNUA 1S7TA 5FYKD 4M48L 5C0CB 4KVCL 3KLSA 2WBJC 1AHWB 1DQDL 1QHOA 3VXSD 3AMLA 3IU3B 5FAAA 1RJYB 5LGJB 5JO5B 3AY4A 5GGVL 3CDGA 3MRJB 5DURD 3ZT5A 1VCAA 1WBYB 2VLKD 3SDDC 3LRSB 2VISA 4WI2A 3KXFE 2EE3A 4P5TC 3NGBB 4QRRB 5EUKB 3KPNA 3OXRB 3VXPB 2ZKHH 3WIIL 3ROLA 1XFPA 1GH7A 3QDGB 2P4AB 1DUZA 3I3BA 3GHBH 1K8IA 2IAMC 3TT3H 4M1DH 4FZ8H 4RFEB 2EYRB 2A6DA 2QHLA 4FG6D 3W0WE 2XQYG 1AGEB 3QDMD 3U2SA 2P8MA 5JIKA 3HCVB 1WBZB 4GRMB 3VXNB 3MRKB 2CH8A 2EC9T 4UNUA 1QTYT 3WD5H 3SOBH 1Z9SA 2J6EA 2VLJA 3L5XH 4FQXC 1EERB 4JFDA 1LDSA 4GQ9H 1JUFB 5JHDE 4OB5H 1OSZA 2M26A 1HHIB 2EKSA 4CVZA 5DRXA 2DJSA 3LQAC 4KK9C 2HVJA 2NY4B 5E00B 1FNSL 2Z8RA 5DA4A 4GG6B 4CL7A 5FECB 3WFHB 5DC0A 1R3KB 1PZUB 3IVKB 1PEWA 2V2WA 2JJVA 3LQAL 5ADOL 4FQQB 5JA8B 5JHLL 4J12A 5DJ6A 1UZ8B 4AG4H 2R0ZL 4WW2C 4ZSOA 2WSKA 4WHYH 3ZE0E 1QBLL 1P7HL 3RGVA 4JRXA 2V5SA 3OKEA 1S3KL 4S1DC 3WNNA 5D72H 2OR9L 1JGDB 5CBEB 4RQQA 1F3RB 5AUMA 3MJ6A 3D2UD 5E70A 4Q9BA 1A2YB 4IRJD 4MNQB 3V7AG 2VL5A 3I02B 3STZB 2V9TA 1J88A 3BP5B 1KCRH 1RZGB 3DRQA 1EAPB 4ORGA 2WIIB 3HMWL 1A6VH 1J10A 4QOKA 5C8JA 4RMRA 1IZKA 1P9MA 1NGWB 4JQVC 1CFQA 1NFDA 1LGVA 4LF3B 5J3HD 4NC1C 4P3DB 4H5SA 5ID1A 5IT2H 1DZBA 3CLFH 3QCUL 4M6MH 3QNXB 5IB4A 2YXMA 5D1ZB 1DANT 3PV6A 4JN1H 1LO4H 3P9LA 1HILA 4NZJA 5EH1A 4PTUB 1EHLL 1JRHL 1S7RB 5F7DB 4ZTPH 4DAGH 4QF1A 4AQ1B 5HI3C 5IHZB 4MJID 4XPHL 4Y4KA 3QUZD 4HIIA 1PJ9A 1JYXA 3WUWB 1JF6A 1J1XL 2NY0D 1KN4H 4M7KH 4G42A 5B39G 5ALCL 4NNYB 3IU4H 4MDJB 2FSEB 3UTSB 2I5YH 1QO3B 4NQEA 4PJHA 3F5WB 3QI9B 1A02N 3RWGB 1BD2D 1E4WH 5BO1L 2EECA 4X7FC 4G43A 4QTHA 3CFDB 3G6AB 5C0NC 4HFWA 3EOAB 2BVQB 3GKWL 1YQVH 1FZKB 1WFUA 1I3RA 4KHTH 4MAYA 3BGMB 4NBZB 4KJPD 4YDJB 1BZQK 3QEQE 3QPXH 4X9IA 5LG1A 2C4FT 3FRUB 5I30H 5I9QB 4DTGH 4JRYA 1XGUB 3VW3L 1MUJB 1ADQL 4KDTA 2D7TH 4RIRA 1P1ZA 4N0FA 3U30B 5B3NA 4JHAH 4M6OL 3I75A 4EI5D 1JNNL 3GSNB 4JPVL 1DBMH 1HH9A 1JPFA 1SJHA 4A6YH 1HSBB 4NUJB 2WUCH 4K3DH 4HAGA 1Z6JT 2DQDH 1EEUA 3IKKA 5FO9A 5I74B 4AEHL 3VMPA 2VSCA 1S5HA 5TDOA 3K7UA 2NYYC 4S1QL 1WJ3A 1KTDB 3CMGA 2Q7NA 2R56H 2WBWB 1PX4A 5D2LB 2EZ0C 5D1QB 4RX4A 1MCHA 1MRDH 3TIDB 1OW0A 3WSQH 1QEWA 3NAAH 4KJQD 1CE6A 4PP2B 3K0WA 5C07A 4FQJL 4RNRA 1C1EL 4MJIE 3FQXB 2NW3A 5LCVL 4G6FD 5MHSD 3ARZA 2WANA 2KPNA 2GFBA 2EDEA 4HT1H 2HKFH 4YNYB 5JXEC 2MQCA 4WDIB 2YWZA 5F1NA 3KYMA 4Q0XH 2OP4L 2GAZB 3MV7D 3PQYB 4P3WA 3KPSE 4Y4FC 4XNQA 4LCCC 1D5MA 1NMBH 3JWOL 2IG2L 4JFZH 4BYHA 1W2KT 3MGTB 3GI9H 5JOEA 4JZJC 5MEQB 2DQHH 4ZUTA 1QRNA 1PEZA 4XP6H 4OF6A 4OCSL 2IBBA 4NYLA 1OM3L 3ARFB 4PRAB 3G04A 3L6FB 1LO5A 4U6XA 4DFIA 5D71L 1JGVH 3VG0H 3D85B 4E5XA 4O2CB 4I0PB 5KS9A 5A2JH 5D7JC 4GG6F 1MJJB 1UADC 1WWCA 5KG9A 2ED9A 4GRLB 5F3HA 2CLRB 3ARDD 4XXDB 4OLZH 4JCLA 1KTLA 4M3JA 3QXDB 2FEEL 4PB0H 5DLML 3VH8G 5FHAH 1KOAA 1ZS8A 4YBLB 3SDDA 5EU6B 5DS8A 5DQDH 4MYWB 3HAEB 4P5TA 1OAKH 2X09A 2YD6A 3E0GA 5E2WL 4ELMB 3PP3K 1ZT1A 5DK2A 4ZNCD 1NGPL 1OQOA 1KT2A 2FD6L 4YK4B 3T1FB 1UH2A 4OQTH 1WLHA 5MHSE 4G8IB 3MO1B 2HMIC 4M62L 2IPTL 2IAMA 4AIZA 2ADGB 1PQZB 5EO0A 1Y18B 3B83A 3CMOH 2B4CH 4EN3B 1U8JA 3MV7E 3C8DA 1HZHH 4PRHB 4GRWH 2BJMH 4FA8A 4R2GB 1LMKA 1N59A 2LAGB 3FJTA 4PUBH 2EDJA 1K6QL 2FJFA 3BQUC 5JIIA 2BP3A 3L9RB 1WAAA 4M7ZB 1CLOH 1W72H 2VXUH 1VFBB 2VDKL 2WUBL 1MSPA 2HJFA 1VKXB 2HLAB 2HRPH 2PXYB 4NM8L 4G8EA 3KXFB 4NPYA 5EOCH 5TF0A 4ZYKA 3CVHA 4GMTL 3O4LA 1MFBH 1UM5H 1FZMA 1Q72L 3CDYA 2GTWB 4WW2A 3IAGC 2GJ6D 5IK3A 4CVUA 1OSPL 5T1MA 3PV7A 5J9PA 1BM3L 5AZEH 2XWJB 5ALBH 3RDTB 5I8CA 1H15B 2CO6B 3RUGA 5CILL 2A73A 2BVYA 2APBA 4B5EA 2R15A 2E6PA 5JOPD 1ZANL 3C8KB 2ZUQC 3RWEB 5IUSA 5E6ZA 3NACH 4JO3H 5DJ0A 5ITBH 3UMTA 1KG0A 1T1YA 4HIHB 5JHDB 4HPOH 4TULL 4PBVC 5C86A 3OKDB 4O58H 3MZGB 5DK0A 3VGAB 2EC9U 4RMWA 4L8BA 5EU5B 4QTIH 5T5NF 1MJUH 1L0XA 2P24A 3T0BA 4NOBA 3N1MC 4HK3N 2CIKA 3QQ3B 1B3JA 5FYJU 1YN6B 4Z7UF 1ETZA 4R3SB 2I25N 4XAWL 5DJCB 1MH5A 5EB9A 3WFEH 1TLKA 2AJXH 5MP6L 4LSPL 4JVWA 1RSFA 1XCQB 2FO4A 5F9OL 1ACZA 2R2HA 1SJXA 5I1HL 1E0OB 1TJHH 1C8PA 2V17L 3HZKB 4LCIH 4FFZH 5B8CB 4KRPB 3QJHA 3T77B 4KJYA 1TZIA 1DBAH 1TVBA 4X7SL 4HUVB 2NXYD 4PJ9D 2RIKA 3HB3C 4N1EA 2GJ6E 4GKZA 1U92A 3IXAA 3OR7A 1GL4B 3PWUB 5T1LA 5CEZH 5AAMA 5ETUB 3U0WL 1ADQA 2V7HB 1GGTA 1F11A 1U42A 2NNAB 1OAZL 3QULA 3MUJA 4HSQA 4WI5A 5HDOA 2VR4A 4TVPD 5A16A 4ETQA 4U1JB 1FCGA 4TTDD 4LOUC 3UTZB 3IJSB 1T6VN 2PN5A 5I1KL 4HULB 4FZEH 3HE6B 2C3HA 3QQ4B 1RIVL 4XCCL 1IKFH 4RISL 5EULV 2VKWA 4QXTB 5J6HB 4K7FA 1MFDH 1A6AA 2Y1VA 1HK6A 1DANU 3TGXA 1TNMA 2IH1A 3FO9A 3PABA 5ACZB 5SX5H 3FN0L 1DQQA 1RUAL 3G6DL 2B0SH 1G7PB 3UAJD 1ITCA 3OKYA 3VFMB 3SE9H 4OIAA 2BY2A 2MMXA 1BJ1H 4NCC1 1IC5H 1B9ZA 3BN9D 1GC1H 3F12B 3EJJX 4HWUA 1JZ3A 2APXA 5EO1A 4UAOB 5D1XC 2HJLA 4DKFH 1KCUL 4UDTA 2JE8A 3A6BL 3S7GA 3QEQB 3BZDA 3PDDA 4OFYA 3M45A 2NY1D 2IMMA 4LPVA 1EUUA 3OAUL 4HMDA 4FQ1H 3Q0HA 5ISZE 4LCCA 2HLFD 4KI5E 2Y25A 3J7HA 1WFNA 4YIQA 3MLPA 3HI6L 5K59F 2ZCKL 4BH7B 5TH2A 1NAMH 5FUOL 4TVPE 1TJGH 1PG7X 2F19L 2PETA 1ZA3B 1SY6H 4WTXA 4U1SA 4W70A 5IKCB 4NWUH 4FNLH 3FQWA 3MRIA 43C9A 1KNOB 5HXMA 1UB5B 3BYYA 1GAFL 4LLUA 3OKLB 4F7CB 3QR2A 1KJ2L 3MXWL 3PXJA 3CH1B 1JGLH 1MWAL 4Y4HD 2VZOA 2PW1B 4KAQL 4HBCH 3RVUD 3BVNB 1FZOA 2FX7H 4NKIH 5BVPH 1CD1A 1ZGLP 5I73B 2V5YA 1S9WA 4MDIA 2OL3B 3MLYL 1UACH 3KPSB 1RIHL 3DV4A 1CGUA 4V1DA 4M02A 4P2RD 4JKKA 3T0ED 4J4PD 5LQBL 1I1CA 5C0RL 4QGTA 2MNUA 5GQBA 5F7LB 1I3VA 4Y19A 4LSTH 3QIWA 5C0BA 5GS1C 3OJDB 4YHIA 2QTEA 1UEYA 5I76A 1YY8B 3QEUA 1T5WB 2BSTB 3QH3B 5GRJH 4NP4H 3W9DA 3H0TB 2AK4A 4P9MH 2WMPA 4P2OD 2ARJA 4Y0GA 2BCKA 2VAJA 1YEJL 3I6GA 2DQJL 1QBAA 3BQUA 3H6JA 4V2CB 3N50A 5T3ZE 1JHKH 3C2AH 1UYWH 1KIQB 5KSAD 3QCTH 2FCBA 1M05A 1XGRB 3GSRB 3EDDA 4OIIL 3A0OA 1LP9E 4LVOC 1AHWC 5IB2B 2R0KL 2VDRH 4F58H 3O9WC 5F7FA 1ZTXL 3X3GH 4ONGH 3X13A 1CDGA 1U58A 5IJVA 3FT2B 1P69B 3UROR 2IJ0C 5CZXC 1S9VA 3UPRB 4KDWA 1F4HA 4L4TB 2AVGA 4JPKH 1J12A 3TBWA 4EDWH 2O5ZL 3NGBC 5TE7H 3MLUL 5FF6B 4NHUA 4NRXB 4AIOA 4JAMA 4ZS6C 5DMYA 2FYYA 5T5FH 4BQ9A 5IG7A 1OLZA 1W8NA 4OCXL 1BQSA 1AQKL 3CZFB 1Z2KA 4WVRA 4Y8AA 5E9DB 3BDXA 4NDMA 4KQ4L 4Y5XB 4Z7VA 4LAQL 1LVEA 3LMJL 2DF3A 4P59H 3O6FD 4EVNB 1OB1B 3FFDA 2QADC 5ICYA 3GMPB 1LQSR 4LCUB 4PG9A 4GSDH 5IBTH 1A6WL 4K3EH 3HPJA 2C1OB 2BSSA 1CGSL 3O45B 5HYSA 2NY4C 4EOWH 1I7ZA 4PS4L 3RI5F 3PJSB 1S7QA 3INUL 2YD8A 3RY6A 4NBYB 5DTFB 4WY7H 3W82A 1W0VB 3MLRL 2AJ3B 2KDGA 4P5MB 4ZFOB 2DKMA 3D0LB 2HTKC 2L4OA 3VXRD 3MNWA 4BQ6A 4FFVC 4F57L 1DR9A 3STBA 3T2NH 2OZ4L 5C6WH 1PGRB 1JYVA 5EBLA 2V2XB 1KF9B 1QKZL 4L9LB 4HIXL 3Q6GH 1FH5H 4MJ4A 3KS0H 3ULUD 4GW1B 2AV1A 2DQTL 4MB3A 1JGUH 2ZSVA 1BZ9A 3BZEB 1ZLUH 1JRHI 3RWJA 2EYSA 1SBBA 4NRZA 5DJ2A 3BKCH 3EO1B 4PRPD 3LEVH 2F54D 1Q9OB 2G5BB 3PGCB 2P5EA 3MBEB 1HDMA 4MS8C 1J0YA 5DYOA 5I8EA 4O5LL 1OARH 4N68A 2HT2C 3VXUE 3T3PF 5E8NB 4HWZA 4UOJA 2X9WA 3QUXB 2X05A 3SJVD 3QG7L 1XGPA 1IGYA 3BDYL 1NBZB 4LPTA 1HXMB 1YN7A 1WGOA 5D1ZC 4OQ1A 5GS0C 5GGSA 4RGOL 5HYFA 2A9NH 4ODWB 2FR4B 3RJQB 3QRGL 2EIZA 1MIEH 2DLFL 3VFVA 4XHJD 2ZPKH 2BXYA 2A77H 4MVBD 1MF2H 2DMCA 5LBSL 2GCYA 5C0JB 1HQ4A 3P30H 4BSVB 2QQLH 5IMOA 4X6DE 2CLZA 2J6EH 5IV2B 4K94H 4GUPB 3HLAA 2J5LB 4YEFA 4OF0A 3QI9C 1I1FA 2Y06H 2JK5A 3C5ZD 2XNAB 3KYAA 4WWKB 5D1XA 1RZJH 4HJGA 5GZND 2EYTB 4OGAC 3RAJH 4ODHH 3FOLA 1ZEAL 1ZT4A 5AEAA 2YKLH 4QHMB 5EA0L 2DBLH 4P2QA 1S7VA 4OT1H 2NXZD 4PGDB 5I9QC 3GO1H 2OYPA 2R23A 4PRPE 2F54E 1E27A 4TPRL 3U30C 3V6BR 4ELKB 4PGEB 4Z7NE 5TE6L 1O0VA 3N9GL 3EDJA 1TVHB 3E2HB 2PTTA 3G6JE 1MWAA 1UA6H 2Z8WC 3FHQA 5FYJL 2VLLB 4TNVF 2GK0A 3TPUA 1GGIL 2C3VB 4PV8B 3GSNL 1UXWB 1F58L 5EORH 5D1QC 1YJDC 2A83B 2B5IB 2X4OB 4FFYH 3LKRA 2A9MH 3TVMA 1AXSA 1NKRA 1RUML 4KVNH 5KSUA 3L7EB 3DUSA 3VD3A 3MRHB 4PLKC 4KK6C 4KRLB 1S7XA 4YQXH 5DDHB 4XBEH 5HYIA 4M1GL 1N7ML 4NO0D 3HKFA 1X5ZA 5ISZB 2BK8A 3JTTB 5DUBA 4XH2B 3K2MC 2A1WL 3RY4A 1BEYH 2DI7A 3BPNB 1M71A 3PG2A 2FEEI 4WEMB 3QFJA 4JY5H 5AAWA 5GS1A 5IVZB 4M7LT 3ESVF 1FYTB 4X5LA 1ED3A 2AXJA 3ZDYF 2HFGL 5GHWL 1ZGLM 1F45A 5KBNC 4OGXL 2VMFA 1CICB 1UWXH 3LRHA 1XF3A 1XF4B 4D2NA 3ARFC 4R97B 4U05A 4G3YH 4JM2A 4AMKL 5DR5H 5D2NE 3VWJD 1BVZA 4LMQE 4PYHA 4I0PC 4UBDC 4FFWD 1A64A 5CJ8A 5C0CA 2UUDH 1AHWA 2W0KA 4GRLC 4ZNEA 3IU3A 1RJYA 1NEUA 3DHJA 5LGJA 3D69B 5DD5L 2KZWA 3MRJA 3TH3T 1A6UH 3A67H 4YBLC 3LRSA 1AGCB 2ATKB 4LCYB 4ZUVB 4H1LG 2ED8A 4Z7OE 4O02H 5IJKC 3OKNB 5E99L 1RFDH 1U6AH 2W92A 5EUKA 4QRRA 2RCSL 2APTA 3OXRA 3VXPA 2MKWA 3QDGA 3S37X 2FX8H 4YK4C 3VRIB 4AL8H 1YEKL 3DI3B 3EYVB 5EOQL 2W0PA 1K3IA 2EYRA 3L95B 1RJZB 1A0QL 3M8OL 4EN3C 3ARED 1IGCL 2ZWLT 2VIRB 3LZFH 1IGIH 1AGEA 3CUPA 3HCVA 5EN2B 1WBZA 4GRMA 4XXCC 3VXNA 3MRKA 1CN4A 4O4YH 3TT1H 1DSFH 4TSAL 4J3XA 1UCBL 4LVEA 1FRGL 1D9KA 3MRGB 4PJFE 3TJEL 4JPWL 1JUFA 1LP9B 2DD8H 4J3SA 4QNPE 2W59A 3ULSA 1LEIB 1OF2B 3R4DA 2PO6D 4M7ZC 1V7NL 1EFXB 5ESQA 4DN4L 5KSBF 3ZE1F 3T4YB 4NFDA 4HUXB 2BHYA 1A1NB 1I9RL 5HVFB 3FB6B 5E00A 4KTDL 2OZ4A 2QR0B 4Z0XB 1T89A 1X5IA 4GG6A 4R4ND 5FECA 2ZUXA 3WFHA 3QWOB 1R3KA 1JE6A 5DA0B 3IVKA 2PXYC 3X3FH 3ZDXE 4YUEL 4YPJA 3LB6C 5IW6B 2QHRH 4D9LL 4MD5B 1KCSL 4ZPTB 2EE9A 3EDFA 1DVFB 1IEBB 1UH4A 2BVPB 2JJSC 2MFNA 5D93B 3UP1A 3DNKA 5IFHH 3IJYA 3FT3B 2HH0L 3IXTB 3DVIA 4DGIL 4M48H 4X9GA 4KVCH 2XYCA 5C6TL 1DQDH 3BKML 5F7EL 4S0SD 5HHMD 1RZFH 1A2YA 4MNQA 1LDPH 1BGXL 3STZA 5GGVH 3R1GL 2O26U 3BP5A 4FOMA 1RZGA 3UYOD 1EAPA 3VGEA 2WIIA 3ZSTA 2HVKB 3NMEA 3BW9B 4ZOEA 3P73B 1BHGA 1UJTA 3OG6B 4WCYL 4D0DB 4X8JB 1P5VA 2VL4A 4P2OB 2IFGA 4HKBB 4C57C 2X89A 1CS6A 3VGAC 1NGWA 5IBLC 4LF3A 2VR5A 3H7LA 3WDIA 4P2YA 1EEZB 3MTRA 5CZVL 2KH2B 3CCHB 5E56A 5L8KB 1WEJL 3B9AA 1ZWIB 4AEEA 1YYLL 3U4EA 3VFOB 1OWRM 4JO2L 4IIQB 2YOCA 1AP2B 3QNXA 5D1ZA 5HYSG 2NY5C 3QO1B 3K3QA 3RNKB 2XZZA 2ZCLL 4D94A 1X7QB 1XIWB 4PTUA 1S7RA 5F7DA 4X7EC 5A43C 1WIPA 3LD8B 4X6CE 3K80A 3MYJA 3LSOB 4GXVL 5C9JB 5IHZA 1AR1D 5JQ6L 1J05A 2YPVL 5B8CC 4KRPC 5L2KE 5JNYA 3WUWA 2EDLA 3OJVC 4NNYA 1FNSH 4MDJA 2FSEA 3UTSA 1QO3A 3BO8B 1S7WB 3F5WA 3PDGA 3QI9A 4WU5B 2PF6A 3LH2L 2JJTC 3RWGA 1Q9WB 1XAUA 3SKOB 4J3VA 3LQAH 4L1HA 3EOAA 5JHLH 4FG6C 5ANME 5T33H 2BVQA 1FZKA 1KIPA 2R0ZH 3VXUB 1QBLH 3B3IB 4ZXBB 5F7KC 2VLMD 4EZMA 4YDJA 5IVXB 1S3KH 1VFMA 3FRUA 4HGWB 4JN2B 1XGUA 2OR9H 3CVHH 1MUJA 1MFCH 5ABDE 3HE6C 3GSNA 4MXQD 5CJQH 4QHNB 1OP5H 3OMZA 1HSBA 4NUJA 5F89B 4Z7UA 5GRXG 4H25A 5GXBB 4J1UB 5DZOA 1KELL 3LRGA 1KTDA 1G7IB 2EH8L 4NQCA 5ESVB 1WCQA 5D2LA 5BZWB 5D1QA 4X6DB 4XGZB 2Z4QB 3TIDA 4W68A 4KRMB 1YMMD 3QCUH 2PYED 4PP2A 2EDNA 3RWDB 3FQXA 3AROA 4H8WC 4UAOC 4P48A 4OJFL 4IRJC 1QLFB 1EHLH 1JRHH 4MA1B 5D96B 3DUUB 4YNYA 4WDIA 1MHCB 3DX9A 2GAZA 3PQYA 4RMUA 4XPHH 3GSQB 3ET9F 2F54B 4YHYB 3FQRB 1J1XH 3MGTA 1QSFE 2DKSA 5ALCH 2BVOB 5MEQA 1HI6B 4RAVB 4JREC 1TPXB 4PJGB 2VLME 3GEWB 3G6JB 1T21B 5BQ7B 3GSWB 5BO1H 4PRAA 1BFTA 3L6FA 5IW1B 4Q2ZB 3C6LB 5DK3A 1JMXA 4I0PA 3U9UB 4HS8H 3C2SA 4CDHA 4XPBH 4GRLA 3VW3H 4MJ6B 5JPNB 5DC4B 3RX8A 2CLRA 5CEZD 3SDXE 1ADQH 4WV1B 5E2VL 1FDLH 1J86A 4M6OH 1JNNH 4NQDD 4OFIA 1BFOB 4UUJB 4JPVH 1JI2A 5DVNA 5EU6A 5I73C 5EWIL 3UTQB 3FMGL 3HAEA 4HK3J 3MX0A 3NFPA 5GSRB 4XP4L 3BGFB 2VDNL 4AEHH 3DARA 4N8PA 3WE6B 2PW2B 4Q6YA 4S1QH 4NNXA 3T1FA 2RHEA 4G8IA 3MO1A 2VDOL 3ARBB 1EVUA 1PQZA 2OL3L 1Y18A 1Q9KB 1SEQL 3GSVA 3GMRB 2XZAL 1YEHH 2VH5H 5ILTL 3RWIB 2YD5A 2DTSA 2B20A 4FQJH 1C1EH 4PRHA 4XXCA 5LCVH 1DFBL 3IFLL 5D2NB 3L5IA 1BECA 3KAAA 2XFXA 4FTVB 2X4QB 4H0HB 1IAIM 3GIZL 1G0YR 1PLGL 2BXZA 1JN6B 3CFKA 5F96L 1JWMB 2XRAL 2VLRD 4PJCF 2B1AH 2OTUB 4XVSL 3V6ZB 3WJJA 2IG2H 3MV9D 4YFLI 5IWLC 5I8OH 1VFBA 1RZ7H 1G1CA 1I9EA 3FL7A 2HLAA 2PXYA 3KXFA 4RFNB 4OCSH 3BKJL 3EFFB 1OM3H 4NO2B 2N7BA 1EAJA 4J7RA 4PLOB 2GTWA 5EC1B 3KPLB 3RWCB 3QT2A 5MERB 5D71H 1INQB 4IHOB 1I9IL 4PJDF 1D5BB 3T65B 2DIJA 4PJ5A 4AZ8A 3RDTA 4NO0B 1XF5B 3VCLA 2CK0L 2XN9D 5AYQA 2CIIB 4WO4D 5I75B 1D5IL 4GKOA 1NSNL 3KYNA 4OZFG 5DLMH 3RTQA 3RWEA 4JFFD 4PRID 4Y5XC 3L3DB 4D8PB 4OZIE 1T7VA 4P23D 4LDLB 4PJFB 3RHWF 3B9KB 2FHBA 4HIHA 5E2WH 4PTTB 3ZE2F 3V6OE 3I3DA 4Z7WF 2OBGA 3V7AE 1H0DB 3OKDA 3DSFL 3BMVA 1BF8A 1Q94A 2GUOA 5I1DB 3ZTJH 4OI9A 3ZYJA 5EU5A 3U4AA 2P42B 4MA7L 1N0LA 3OKOB 4M62H 2IPTH 4ZOAA 1OAQL 4J8RB 1YN6A 5MI0B 3L3OA 3ARXA 4R3SA 2MSPA 3ARDC 5DJCA 1RZ8B 3MMEB 3UEZA 1A6ZB 4NFBA 4U1LB 4P2CG 4W4NA 3BRFA 3MV9E 1XCQA 1K6QH 4OCRL 3RU8L 5F97E 3SDCD 4UDUB 3D5OF 4IOFD 3VA2C 4QHUA 4LLDB 5GRVL 3T77A 4M1CC 2HP4A 4L9LC 1QBBA 3R8QA 4DVBB 4XCNA 3U79A 4HUVA 2H9GB 2VDKH 12E8H 5DGRA 1F4YL 1AY1L 5JIHA 3DV6B 4NM8H 3DI2B 4XWGL 2JJTA 2IPKA 4G9FD 1R3LB 4GMTH 4AH2B 5ETUA 2XOTA 1XGQB 3U1SL 3WMSA 1ZLSL 2V7HA 1Q72H 2NR6D 3LY6A 4PY8J 1A7QH 1A4KB 4QYOB 2NNAA 3KYKL 4GW4B 1U3YA 1OSPH 1MLBB 3MBEC 2HN7B 3DX8B 3DLQR 1BM3H 4PRIE 4IRSB 1U3HA 3UTZA 3IJSA 3N85L 3LHPL 5CILH 3VI3E 1S7SA 3QUXC 3HE6A 1ZANH 1K8DA 3QQ4A 1HKLH 1A6PA 4LU5L 3WLBB 4D9RE 4GXUM 4QXTA 3TLRA 5J6HA 1JVKA 1HCVA 2WZPD 2WAHA 4TULH 5CJ5A 4ONHB 2JTDA 1F4XL 5TE4L 1PBYA 4DGYH 3D3VE 3AUVA 5L2KB 5ACZA 3QUMB 5FO7B 3CJJA 4W6WB 3KDMB 4TNWF 5F88B 4LGRB 3O8XD 3VFMA 3GHEL 2VJXA 3O2VL 5DJDB 1JNJA 3WUWG 3MRCB 2J5LC 4PJBE 5ANMB 2GT9B 4XAWH 1I1RA 4WWKC 2WNGA 5FM4A 5MP6H 4LSPH 5CMAA 2QKIB 4PLJD 3GZKA 2B2XL 3QEQA 1J8HB 5CCKL 4BZ2L 5F9OH 5I1HH 5EIIB 3EHBC 5L7XL 3MR9B 2DL9A 4X7SH 1HCFX 4BH7A 1J5OL 2FJHB 4HXBL 3WO4C 3QUKB 2YC1B 1ZA3A 2VAAB 2OS7A 3E2HC 3U0WH 3U7WL 3IFOA 4Y88A 3PL6D 4Y5YB 5IKCA 3MRFB 2OLDA 1OAZH 1UB5A 5DJAB 1A7OL 5L0QB 4F7CA 1L0QA 4IDJL 1UZ6E 2ZUWA 3TZVD 3BE1L 5I16B 2DB8A 3CH1A 5E03A 5I1KH 1QUNA 3IJHB 4M43L 4P46D 4E41E 2AJSH 2AEPL 2E9JA 2CKBL 5DZLA 2B5IC 4BK4A 4LQFL 1MCRA 2PW1A 3BVNA 4L9DA 5IR1B 2XQYK 3VFNB 1RIVH 4J3WA 4XCCH 4JHBA 1UM4L 1XCTB 4F9LA 3MBXL 2D7OA 4K9EL 5LAXA 2NXYC 3W81A 3G5ZA 2OL3A 5HJ3B 3KPSA 1MEXL 4HGMA 5KVGL 4KI5C 1FPTH 3FN0H 5HI4C 1RUAH 3G6DH 5IMLA 3QDHA 1QSFB 1T22B 2GIYA 1CXLA 3MUZ1 2IGFH 3IKCB 2R9HD 1T5WA 15C8L 2BSTA 3QH3A 5DEFA 1WWAX 1WTLA 3S37H 4O2EA 4EQ3A 3H42H 4W4OC 1FVEB 4LRNL 3QPQD 1CICC 2G9HB 2NPLX 4QRPE 5IMMB 3DSNA 4YHOL 1NC2D 2C3GA 2VQUA 4R97C 5CEYB 3D25B 3A6BH 3MPCA 4PJXE 3A6CL 4OZGF 1KIQA 3OAUH 1ZVSB 1XGRA 4YXLL 2VLJD 3GSRA 5F93C 5DJ8B 4ENED 5JDJA 3HI6H 2IMNA 5IB2A 4I4WB 1RUPL 5BCAA 5FUOH 3TWCL 5HI5D 1VADB 2ARWA 3FT2A 5SX5K 3UPRA 3EGSB 5IEHB 4L4TA 1RZKC 3PE9A 3UC0L 5A3ID 4P57B 1X44A 5JW5A 1MCSA 5FF6A 3HAEG 2GSGB 2X10A 4NRXA 3MRPB 1RZIB 1TTGA 3MXWH 2F53B 4R7DB 3RGVD 4JRXD 2AXGB 1UGNA 1MWAH 5E9DA 4KAQH 2HLFC 2BX5A 2FATH 2X1WL 4EVNA 1EHNA 1OB1A 3Q48A 4KKCC 4YHML 1A5FH 3MJ8B 1CL7H 1FFOA 5A2LH 3Q6FB 1TETL 2AKRB 3NABH 3RA7L 5E24E 3GMPA 5ADPL 4U1GB 4QOKD 3ZKQD 5LQBH 4LCUA 4LGPB 2ICEB 4UMGA 2C1OA 1GGBH 1DBBH 5J11B 4HWBL 4WUKH 3O45A 1NBQA 3K8KA 5T3ZL 3ARGB 4HUWB 4UOW1 3VFRB 5CD3B 3SE8L 2FBJL 3PJSA 1BF2A 4UNVA 1K2DB 1I9JL 2XXCB 1X4YA 5DTFA 1W0VA 1YPZE 2AJ3A 4JFDE 3D0LA 3EKCA 1Q0YL 3P0YL 1YEJH 2DQJH 1TJIL 3IDNB 1DVFC 3LEYH 4JVPA 3MFFB 2V2XA 4YBQD 3S36X 2GTZB 2R2CA 4L9LA 4KI1A 4OIBA 5C0DB 2AV7B 4GW1A 1T20B 4ZS7L 3EYFB 3NTCL 1QZ1A 4Y4KD 1I7TB 2R0KH 3RIAF 4E9LA 1ZTXH 5J1AB 1TQCC 5J57B 5FM5M 4LKXB 1CXHA 1T1WB 1OLLA 3BZEA 4DN3L 4XP5L 3JSSA 1EV2E 4NQED 4JDVB 5FGSA 1NCAL 3OAYK 2O5ZH 1WK0A 3EO1A 3T0WA 5BRZB 3OKMB 1Q9OA 1ZHKB 2G5BA 3DO3A 3PGCA 4NT6A 3MBEA 3MLUH 4B53A 4P2OC 2VDPL 4LIQL 1HQRB 2JIXB 4M7LL 4KMQA 4IEFB 5E8NA 4MAYD 2VXSH 4LK4A 2IALB 4OCXH 1LWRA 5J89A 1AQKH 3QUXA 5D6CB 5GGRB 4JRYD 1ROWA 4IIQC 4KQ4H 4LAQH 2WBKA 5I1LA 3MV9B 3BSZL 1IZJA 1U8MB 3B8YA 4BUHA 2C9AA 4XVJL 1I8IB 1XIWC 4ODWA 2FR4A 2CR6A 3QFDA 4JFXB 5JLZB 3FQNB 3LV3B 4XMKL 3LD8C 4JPIA 4P4KB 1OVZA 2CKNA 3IB4A 4OCWH 3UPCA 2WP3T 3M1BB 5C0JA 4S1RL 1CZ8L 1CGSH 1CD9B 4KC3B 1NLDH 3BIKB 3P4OB 2VXQL 4NQVB 4RWHA 4PS4H 4RX4D 4GUPA 1F13A 3ORJA 1M7IB 4XNMB 4PP1D 2XNAA 4WWKA 3MLRH 3U0TB 4PJIE 2EYTA 5C07D 4F57H 1B4JH 5GRYA 4PRIB 2W9EL 5B38A 2AGJH 5TFSL 2OZ4H 3O6FC 4ZXBC 1OQXA 2BVTA 4R96B 4QHMA 4C83B 1QKZH 1GYAA 1CFSB 4HIXH 3SE3C 2VYRE 5IMKB 3WJLC 4BFGA 4OUUB 3VFPB 2DQTH 1XH3B 1FO0B 1AR2A 1KPVB 2LU7A 2VXTL 3V4VL 3ZKMD 4ELKA 4PGEA 1LE9B 1MLCA 4RGND 1R6VA 4DUXA 3HG1E 1J0JA 2F5BL 3ZE0F 4TUOB 1TVHA 5F7MC 1X4ZA 4JLRB 1LK2B 1QR1B 1QRND 2CKBA 2Q3ZA 3D3VB 3WN5A 3LN4B 4N8CH 1QLRB 1CIUA 2VLLA 5KTEL 3ARPA 4O5LH 4PV8A 5C0AE 3MXVL 1UXWA 3HUJB 1CGYA 1QNZL 2X4OA 4KHXL 2WBJD 4HX1B 3QG7H 5J56B 1CLYL 1MAML 3L7EA 1L6ZA 2EC8A 3MRHA 2XQBL 4RGOH 5DDHA 5GGUB 1IJ9A 3SDDD 4MA1C 5D96C 2DLFH 5C6PB 5ISZA 3JTTA 1FL6A 4XH2A 3OZ9H 4P5TD 4X9HA 5IROA 3MRLB 4N5EC 1TFHA 4JO4L 4LSRL 4YHYC 3BPOB 5IVZA 4IMKC 4EIZC 1FYTA 1TPXC 2IAMD 2YS4A 5JPMB 1CICA 1XF4A 3WNKA 3BESR 5FEBA 4XC3L 3OKKA 3RKDD 2J3SA 3DO7B 1IC4L 1UM6L 4B50A 2N7AA 4E41B 3NFNB 5CP7B 1DUYA 2RFXB 3D0VB 5EA0H 3BRDA 2EDTA 2OXHA 1LE5B 4U2YA 1KBGH 2EEAA 4MVBC 5MENA 1SEBB 4KK9D 5FO8B 2LE9A 2R0WL 3LQZB 4ZFFB 1MQKL 1QYGL 1LK3H 5TE6H 4YEEA 1IQWL 2E27L 1AGCA 2ATKA 4LCYA 4U6YB 4ZUVA 3VH8B 1K9TA 3OKNA 1F02I 5KZCD 5MEOA 5FYJH 3O4LD 3C5ZC 3UJIL 3P4NB 1OAXL 1XR9B 5GZNC 4G6JL 2ZJSL 1FVCB 3GSNH 4Y2DB 1F58H 3UBXB 1T03L 3VRIA 3U0PB 1FC1A 3VFGL 3EYVA 3ARBC 4UIKL 2Z93B 1F97A 3L95A 4QRPB 1AJ7L 1RJZA 2YZ1A 2VIRA 4OLUL 1RUMH 3VFUB 2XKNB 3H9SB 4HWBA 1YQ2A 5EN2A 1TZGL 4R7NB 5D2NC 4PJXB 4M1GH 1GJIA 3CDFA 3MRGA 1A4JA 2J8UE 5IHUL 1LP9A 1LEIA 3PL6B 1OF2A 1EFXA 4KDVA 2Z9TA 3T4YA 4HUXA 1Z3GL 1A1NA 3HTLX 3FB6A 3MLSL 2QR0A 3H9HB 2I9TB 5GHWH 3QWOA 4OGXH 3I3EA 4PJAE 4NC2B 4XPGH 1S7TB 2M2DA 5IW6A 1RUQL 5B21A 4X80L 5CJXC 1WAAE 5D5ME 4ZPTA 5IESL 2OI9C 4AMKH 1DVFA 2BVPA 2VE6B 5ERWA 5HHXL 3KGRA 4WTZA 2FDBP 4OD2B 2X41A 2B1HL 3KLDA 4JFHE 4K7PY 3IXTA 3FCTB 4TYUA 5HI3D 2DMKA 2QSTA 4X6EB 5F9AC 4ZQKB 5I75C 2YSSB 3L5WA 4LLYA 4NJAL 3MLXL 5DD5H 1PVHA 5DRWA 3ROLB 1YZZA 1V05A 5E1AB 1I7UA 2HVKA 1EVTC 1DUZB 4U1MA 3BW9A 3IS0X 1K8IB 5J4MA 3B9KC 2JB6B 5E99H 5T1LD 4D0DA 3P77B 2RCSH 4HKBA 1FGVL 1F3DJ 5J0BA 4HIEB 4YWGL 1YYML 5FDWB 4JFOB 2DM2A 1YEKH 3VWJC 2D03L 2UZXB 3HAEH 5EOQH 2IANE 4HLJA 3VFOA 1Q8MA 1ZVYA 1CK0L 1IKNC 3B6SB 1YPZB 3M8OH 3BPLB 4FFWC 4IIQA 4JFDB 4JFEA 1AP2A 5GS3A 1IGCH 5MI0C 1J9CT 3N1QC 4PJCA 1DL7L 3QO1A 3RNKA 1N0XL 2ITDB 1G7HB 2OK0L 4FXLA 1X7QA 1CR9L 1XIWA 4FABL 2HVJB 4TSAH 1D6EA 2BMKB 4GAFB 2OJEB 4X7DC 3TJEH 3LSOA 2X4RB 4JPWH 5C9JA 4OF5A 3DECA 1T83C 5HHVL 1T66D 5BOZG 4F8TA 1CLZH 1V7NH 4DN4H 2NYYD 3EOBB 1WVZA 1I9RH 4ZPVB 5DMGC 3BO8A 1JZ7A 3RGVB 1A3LL 3C87A 3TESA 3O3EB 4WU5A 5H37H 3OF6A 1Q9WA 4YUEH 4D9LH 2OMNA 3KPOB 1KCSH 3X14B 5TGBB 2N1KA 3VXUA 3MQIA 2J4WL 4ZXBA 3HR6A 5IVXA 5JXED 1QACA 2XT1B 4MMZC 2HH0H 1CYGA 2V5TA 4OFYD 3B5HA 4JN2A 3SE3A 5E08L 1VFUA 3BKMH 5F7EH 3WJLA 4NKOB 2NY6D 4KROD 1BGXH 5D7KD 1DEDA 2X1PA 4JDZB 5LWYL 5JW3L 3R1GH 4N0UE 4QHNA 5DRZB 2WLZA 1YDPB 3AMKA 1B4RA 5F89A 2P45B 3PUCA 5TQ0L 4WCYH 2B39A 2WK2A 3CU7A 4HBQA 1G7IA 4L3CA 4NO3B 5SWSB 3NN8B 5ESVA 1X5XA 4UTBL 2P49B 5BZWA 3I84A 1O7SA 2Z35B 4X6DA 4XGZA 2Z4QA 4GH7B 4TQEL 1K4DA 5CZVH 5FA3B 2QQNL 4JO2H 4S2SB 2V5MA 4PJIB 3NIDE 5HDLA 3CK0L 3RWDA 5TJWK 5IB5B 1QLFA 2EDQA 2R69L 4MA3B 1FFPB 4PY7B 3PP3H 4WHDA 3X11B 4X6BB 4G42B 3BPCA 4DKEL 2JJWA 1MHCA 4NJ9H 1X6NA 4GXVH 5HYJE 1G9MC 5JQ6H 3UYRL 4YXHH 2ZOKB 3GSQA 5B38G 4V1DD 4X4XB 3FQRA 4QTHB 4K7PL 2XTJD 4IMKA 2HYMA 2BVOA 3HG1B 4Y19D 2HA1A 1HI6A 2IQAB 4XP9L 5K9QI 3QIWD 4PJGA 2HMID 5C0BD 1RMFL 1SYVB 5HD8C 2EDKA 3G6JA 4XVUC 1G9ML 3C60B 5BQ7A 4NBXB 2L7JA 3GSWA 2D7PA 4H88H 4KK8C 1NAKH 1SBSL 1SM3L 4F80A 3O2DL 3BXNB 2AK4D 4Y5YC 5C0AB 1P1ZB 1L9NA 3R06A 5IW1A 4POUB 3D48R 4JKPH 4Q2ZA 3C6LA 1NLBL 2F74B 2YA2A 5L0QC 3U9UA 6FABH 3NIGF 3BQUD 4OFKA 5SWZB 4DGVH 1F42A 4MJ6A 5JPNA 1T7XA 1MCKA 3JBG7 1WF5A 4WV1A 5K9QG 1NDGB 4I3SL 4JVUA 5DF0A 4LSSL 5FO9B 5HHOE 1S5HB 5TDOB 3MLZL 1NBYA 2W91A 3ZZ1A 2V9RA 4U1IB 1BFOA 3GNML 3UTQA 1DQJB 5CINL 2VUYA 3QDJE 3MV01 4ZAKB 5GSRA 2BY0A 4G8FB 1K4CB 3K1KC 3WE6A 3MGAA 2PW2A 4HS3B 1KELH 3EO0A 4I9WD 1K3ZA 2EH8H 1HYSD 4YC2B 5JW4N 1BOGB 1J1OL 4AQOA 3VD7A 5E4EB 4ZO8A 3ARBA 5HHPA 1X5JA 5AWNL 1KJMB 1RQ5A 3JWDL 1OT1A 3DVNB 3GMRA 3RWIA 4TUJB 4FQCL 3FO1A 4R8WL 4CU6A 3T1WA 2NY2B 4XNQB 4V1DE 5D2NA 4OJFH 4QRTB 2E8ZA 5AZ2L 2XTJE 4FTVA 3RVWC 2X4QA 2X4UB 4MXQC 4FMKA 2BDNL 3TEUA 1JN6A 1NGQL 4PB9L 4FS0A 1JWMA 4H8WH 4UTAL 1I1AB 2OTUA 3TYFA 3SQOH 2AK4E 1U3ZA 2E7HA 5DHXB 5JW4R 3BJLA 3UZEA 3QRFM 1EO8L 1DDHB 4WFFE 4E5XB 3DOSA 2DLTA 4F7MA 4MLIA 3VGGA 2I9LB 3I2CL 5HYQB 4EI6B 3CLEH 1GOHA 4MHHI 4NO2A 5BMFL 5CJXA 5EC1A 3KPLA 1MFNA 4XAKE 4IHOA 2X1XR 3RX5A 1E4XL 2E9WA 4WUUB 1D5BA 3T65A 1NCWL 2AI0L 1MIML 1ZS8B 3D39B 3BZ4A 1XF5A 4PY8I 1WITA 5E2VH 4LRIC 1I8MB 3FAWA 1ZT1B 5DK2B 4WGVB 4P3CL 3T3ME 3D6GA 3S36H 3HB3D 4I9WE 5D70L 3L3DA 3GRWL 4MHHG 5EWIH 4D8PA 3FMGH 4PJFA 2Z31A 2J8UB 3B9KA 1UWGL 4HCRA 4PTTA 1DEEB 5EO0B 4XP4H 4XMPL 1H0DA 1UWEH 5IF0B 2AEQL 1U8JB 4U1GC 5I1DA 2P46B 5JDSB 2P5ED 3BEWB 1F6FB 1Z9LA 1N59B 3OKOA 5GISL 4Z7VE 2VDOH 1JPTL 2OL3H 3ARGC 3D9AH 4J8RA 4LOUD 4PJAB 1IKNA 1IQDB 2YPLE 4DFHA 4HUNB 3NH7L 2XZAH 5A2KH 5CHNB 4I18A 5ILTH 5D5MB 2W0FB 4OTXL 1DFBH 3T8XB 1RZ8A 3IFLH 3MMEA 4MNGE 4CNIB 4U1LA 3RNQB 4HEPG 3MODH 1XF2A 2GJZB 2BVEA 3GIZH 4ERSL 1PLGH 4RDQF 1T83A 4GFTB 3K4DA 4LLDA 4Z8FL 1WTGT 2XRAH 3U4BL 1KXVC 4DVBA 3FFCE 2YHGA 3GI8L 1HH6B 1RPQA 4HWEL 5CUSL 3SKNB 3M17B 1KGCE 2XA3A 1R3LA 1P4IL 3BKJH 4Q6IB 3V6OC 4AH2A 1GVIA 3SCMA 1QRKA 1N2RB 4ODUA 1A4KA 4QYOA 4FMFA 5D1XD 5FYLE 4GW4A 1MLBA 4WEUD 2HN7A 3VXOB 3DX8A 1EHAA 4IRZL 3NCFB 4IRSA 1TDQA 2IANB 1H3VA 3NCJL 1KG0B 3RIFF 1SYSB 4P2QD 1D5IH 4HS6A 1NSNH 25C8L 2R2EB 5IFJB 1GC1C 2MWCA 4K71C 5DT1L 5JZ7D 3WLBA 5DJXB 1T04B 4LNRA 1ORQB 2A6KA 3VRJA 4ONHA 1WZ1H 2E6QA 3V5HB 1ZE3C 4K3GA 5L2KA 3WFDL 1ETZB 3QUMA 5FO7A 4P4KC 5LJYH 3KDMA 3P40A 2BVUA 1AIFA 4LGSB 4YXKL 3K81A 5CIPB 1OAQH 4RFOL 1FV1B 1R3HB 5KANI 2ID5A 1HHGB 2AJUH 1CG9B 5GJTL 3UTTE 4WO4C 5ANMA 2GT9A 4M8QB 4CAGA 3TVMD 2W07A 1MCEA 3O3UN 2QKIA 4OCRH 5H35A 3RU8H 1MCQA 1J8HA 4GKZB 1A9EA 3L3JA 4MJ2A 4P23C 3ULVL 2BSRA 5EIIA 4UNTA 1WZMA 3O2DA 3MR9A 5KANG 2BNQE 2B7DT 1NUDA 2FJHA 4N0UB 5DQJA 2DM4A 3GK8L 3QFJD 1F4YH 1AY1H 3QUKA 5A16B 2YC1A 4XWGH 2VAAA 1U8OB 1MNUH 1P5UA 3HFML 1DBKL 3QWRA 1GHFL 3U1SH 1ZLSH 5EU4B 3MRFA 3KYKH 5DJAA 2GSIB 1FO0L 4JM2D 3IYLW 5I16A 1T80A 3WEXB 3GSUB 3IJHA 4KKLC 3SDCC 3LHPH 3C5JB 5I0ZA 4IOFC 5C0CD 5IR1A 3VFNA 4JFQB 3QG6B 5F21B 1FNLA 1XCTA 1DQQB 1WSST 1C7SA 3REWB 1MFAL 5DFVD 3MREB 1KTKE 5HYJB 1CF8H 1GZPB 5CZXD 3B2UD 1NH6A 5I8KL 4QRRD 2NR6C 1QSFA 1T22A 1T5XB 4YH6A 5GSVB 3PWLB 4MCZA 3WO3B 4ZS6D 3GHEH 3QDGD 3BIAX 1FGNH 3BPOC 3O2VH 3VA6A 2XTLA 3CDCA 4LSDA 4DW2L 3ZL4H 1A3RH 2DJ4A 3RZCB 5ACLA 5E8DH 1FVEA 5L2JA 3W5NA 3MACH 2G9HA 4G6MH 3MJ9L 4Z5RB 5IMMA 3UTOA 2YD9A 1FJ1B 1KYOK 1XR8B 3EZ8A 5JR1L 5CEYA 4YIQB 3D25A 4U31A 2B2XH 1AGDB 3QFJE 5CCKH 4BZ2H 2YK1L 4FQ2H 1ZVSA 3O2WL 1D9KD 5L7XH 4G6KL 4U1SB 2IFFL 5HHOB 5E95B 1J5OH 4I4WA 3ULUF 1RY7B 3B2VL 4JGMA 3RVVD 4HXBH 4L8DB 4GKSB 2NY4D 1VADA 2HG5B 3QDJB 4WFED 3EGSA 2E5EA 3ARUA 3U7WH 3O0RL 4M4PA 2O5XL 4U0RC 3WS6C 1LD9B 4OI7A 4P57A 3W9EA 3TF7C 2GSGA 1A7OH 2WW8A 4FFVD 1RZIA 3MRPA 4H1LB 3GRWA 4OF8A 5FHBL 3I6KB 2F53A 3BE1H 4OCNC 4I77H 1CD1B 4Y2DC 1T0PB 1X5HA 2CMRH 4M00A 4F37F 3OX8B 2H1PL 2R1YB 1B2WL 1E4JA 2AEPH 4LRIA 1SJVA 2CKBH 4JY4A 3DV4B 4LQFH 1N6UA 2LVCA 2DYPB 1V3JA 1CXEA 3T0VA 1UM4H 5D7SL 4MNQD 3QIWB 3MJ8A 3Q6FA 1MEXH 3AFLA 3RWHB 5KVGH 3PL6C 4OKVB 5CLWA 1SVZA 1AXIB 2X89D 1Q38A 1DBJL 3ARGA 4HUWA 3I6GB 3VFRA 5CD3A 3TZVC 15C8H 1JV5B 2OTPA 3NZHL 3MJ7B 1JL8A 3PGFL 1I3GL 1NC4B 4YHOH 3F6IA 5D1ZD 2RR3A 2QQQA 1AE6L 3D2UA 4Z18A 3IDNA 1EZVX 2Y9RT 2E7CA 3A6CH 3MFFA 5TDNB 4DZ8B 4YDVB 4GBXB 2GTZA 4YXLH 2BOBB 3RWFB 4WFEE 5IJVB 4QXGL 2N56A 4X4ME 5DMKB 1S9VB 4GG6E 3EYSL 5AD0B 3EYFA 3TA3B 1ZHBB 3TN0A 1I7TA 2ZUVA 3BEVB 5EZOL 1RUPH 4WFHD 5LXGL 1N5YL 5J1AA 4LKXA 2JF1A 3TWCH 4JAMB 5EZIL 3BJ91 3V6OA 2R9HC 3UTSD 1NCBL 4JDVA 1BJMA 1R5WB 3QI9D 2YRPA 5IVOA 5BRZA 3OKMA 1ZHKA 3UC0H 3QAZB 5F7NC 3KPPB 4XT1C 4EDXB 4Z7VB 4WI7A 1SMOA 2JIXA 4MNQE 4WJ5B 5KSVB 2YPLB 3QUYB 2IALA 2AABH 1RZKH 4JE4B 5D6CA 3BISA 4HF5L 3WFZA 4G8GE 5GGRA 4K94C 4MNGB 1F2XK 3BPLC 2VQ1B 5FYJD 5CWSA 4XMLL 4ENEC 5DD3L 1DTUA 3S97C 2BSSB 3LS5L 4OM0L 3AS1A 4BZ1L 1CWVA 1YNKL 4JFXA 1TETH 1P6FA 5JLZA 3FQNA 3RA7H 3LV3A 1KEGL 4I2XB 1UKSA 2ICWB 3V0WH 5BS0E 5ADPH 4P4KA 3FFCB 1DQLL 3M1BA 1Y0LB 3GM8A 2O5YL 2I26N 5T3ZH 3BIKA 3SGEI 3P4OA 1RU9L 1JTOA 4NQVA 5D1QD 3SE8H 2FBJH 4XNMA 1M7IA 3RGVC 5C0GB 4O9HL 3N1PC 1GGCH 4MB4A 5LGKA 4UT7L 3U0TA 5J7CC 5KW9H 5E2TH 1A9BA 1Q0YH 3P0YH 2H32B 4PLKD 5EUOF 4KK6D 1TJIH 5C09B 1E28B 1MELA 4EI5A 4C83A 5FM8A 4DZBB 1CFSA 1IEHA 3UXFA 1IAKB 3PQYD 5IMKA 2Q87A 3ZDZF 3ARQA 4ZS7H 4ZUUB 4OUUA 3JUZA 1XH3A 3OR6B 3B8SA 1FO0A 3VJ6B 2Y6SD 5DYOB 1DQTA 1P9MC 4HLZG 1BVLB 1NDMB 4GMSL 4XP5H 5C71A 2FECL 2DQEH 3PWPE 4JLRA 1LK2A 1QR1A 1NCAH 3LN4A 3FN3A 4MB5A 4G5ZL 3DXAB 1XGPB 2VDPH 4LIQH 5JW4Q 4ZUSB 1I7RB 4M7LH 2VKXA 2HT4C 1GZQB 3HUJA 3P3YA 1VFAB 3D85D 3WFCL 4E42B 4I0PD 3UTTB 4UBDD 4DKAA 2EIZB 4EXPX 5C0EB 4HX1A 4RGMB 4GRLD 4Z7UE 3BSZH 3CNKA 3O4OB 4Y4KC 2OJZH 5JUEL 1WICA 2EDXA 2XZCL 1KJ3L 1NQBA 4NQCE 5EU6D 4GG8B 4OV5B 4D0BB 3CX2A 4XMKH 2YEZB 2MQ0A 1VESA 3W5MA 4NQXA 3MJ9A 3MRLA 5JORB 3BZFB 2BNQB 4LPUA 5FGCB 4S1RH 1CZ8H 2YBRB 4KK5D 5C08E 4LPCA 1UJ3B 2GQHA 1JFQL 2VXQH 3ALXA 3FOLB 5C92A 4G7VH 1ZT4B 2PTVA 4MAYC 5EZJB 5JPMA 5C2UB 4NZUH 4EN3D 7CGTA 4YX2L 2Q86B 4MZ3A 4C55A 3LVEA 4DVRL 1FLTX 4PRHD 4KDTC 2W9EH 3DO7A 4R2GD 1CU4L 5TFSH 3KPRB 1KJ2B 4E41A 3NFNA 5CP7A 5EU3B 3WDJA 3BKYL 3D0VA 1BX2B 1CGVA 3WUZA 1AC0A 1LE5A 4UT9H 2PTTB 1OGAB 1MRFL 2K9UA 5INDB 1SEBA 3UYPA 2VXTH 4YFEA 2R4SL 3V4VH 3LQZA 4ZFFA 3GBLA 4R90L 4P49A 4LASL 2F5BH 1FNHA 3EYOA 2ZUUA 4RCAA 4U6YA 3VH8A 1IL1B 5BV7B 2PXYD 4J6RL 3KXFD 1IM9B 3ARYA 4U1HB 1OW0C 4ZAKC 3LB6D 2VABB 4OLVL 3LKRB 1VGEL 3TVMB 3FB7B 3P4NA 5KTEH 3OGCB 1P53A 1JZ8A 1FVCA 4Y2DA 3DTXB 3UBXA 4YC2C 2ORBL 3EDEA 3U0PA 2X4PB 3QNZB 4W6XB 4PJ5D 5E4EC 3RDTD 3T04D 1CVSC 4KHXH 4QRPA 5FK9B 1Y6KR 3VFUA 2XKNA 1MAMH 3H9SA 3VI4F 2XQBH 3RTQD 4FQHB 2IF7A 1E4XI 3ZKMC 3WLWD 3ZHKA 3EZJB 1MCFA 3JZ7A 3GMMB 4Y89A 4EBQH 3CFCL 2CPCA 2DQGL 4LSRH 4JO4H 4QLRA 4OCMC 3O6ML 4P0DA 5IBLD 5C0IA 2H2PC 1H8SA 4JM4H 5K59E 1U8IA 4ZUWB 3H9HA 3DX6B 2I9TA 4GRWF 4CMMB 3HNTL 4K2UL 4PJEF 1CDUA 4NCC2 3DX7A 4XC3H 1JWSB 2OXGA 2VE6A 2UV3A 4OD2A 4AM0A 2DTMH 3FCTA 1MFEL 3FO0L 5CJOH 1VGKB 4X6EA 4ZQKA 4D9QE 2YSSA 2BY3A 2K7QA 1MCNA 4KRPD 4PGBB 2R0WH 1KFAL 1MQKH 1QYGH 5C70A 1LO0L 1BQUA 4POYA 5E1AA 1IQWH 2E27H 2LABA 1VERA 3KPQB 4OZFB 5T1KB 1NUGA 5ID0A 2JB6A 4PJ5E 2W9DL 4KPHL 1PFCA 3P77A 4X5XB 3W2DL 3UJIH 3SDXF 4UZGA 1OAXH 4R9HA 4JY6B 2Q7YB 4HIEA 2QQKL 4G6JH 3CUPB 2XXMB 2ZJSH 4OFVA 5FDWA 3RKDC 1T03H 4HH9B 4JFOA 3SBWC 1VHPA 2DN7A 3UJTL 3VFGH 1RURL 2ADFL 1AJ7H 3B6SA 1YPZA 1D9KB 1UCTA 5F3BA 2C7UB 4OLUH 3ULSB 1XGYL 3HE6D 1J18A 1EO5A 5ESQB 2ITDA 1G7HA 1ZV5A 4U6HA 3H8NA 1G7LA 2BMKA 5E4IA 2OJEA 1L9MA 3HE7B 2J7LA 2X4RA 5IHUH 5E8EB 5CJBA 3EOBA 1Z3GH 3ULUL 3EYQC 2H26B 3U48A 3MLSH 3QDAA 4ZPVA 4X4YB 1LNUB 5DD1H 1F4WL 3IJYB 3O3EA 5D9SB 4F3FB 4Q6IC 2W60B 2CGRL 1RUQH 1H5BB 3KPOA 3NZ8B 4X80H 2XG4A 5TGBA 3X14A 1QSZA 5IESH 1RIUH 4YO0A 1A14L 3VMNA 4NGHH 5HHXH 3QZWB 3ZT7A 2IQ9H 3HNVL 2AS5M 5I0DA 1G9NL 4PJ7F 3QEQD 2HFTA 4G8GB 3ISWA 4NUGL 2BSED 2BC4B 4JKMA 1IILE 5JXAH 4NKOA 1N3NB 3ZLQC 2HFFA 4JDZA 3C08H 5DRZA 1YDPA 5BS0B 2HKHH 3DIFB 2AP2A 3TH4T 3U4EB 1FGVH 2ERJB 1KYOJ 1U8NB 4GAYA 4NO3A 2UWEF 5SWSA 4YWGH 3TT3L 3NN8A 1GCFA 1UH3A 1E6OL 1KLGB 2Z35A 3PHQB 5EC2A 4LLQA 5FA3A 1W0WB 1G1YA 2D03H 4ZFGL 2KL6A 4OZIF 4HCRH 4JG1L 4S2SA 4BJLA 4PJIA 3MYJB 2FX9H 2H8PB 3G9VA 1B90A 2V2TA 2YA1A 3MSPA 1DL7H 5IB5A 1J05B 4Z78B 1N0XH 5JNYB 1RJLA 4MA3A 5BW7C 4HKZB 1FFPA 4PY7A 1CR9H 3HPLA 3X11A 4X6BA 1T2QL 1ZLVK 4LCWE 1IBGL 1OP9A 3KPSD 3NA4A 1AO7E 2ZOKA 3UJJL 4X4XA 1MVUB 1BFVH 3GGWB 3RJDA 5J1SC 4AEFA 1NBVL 3HG1A 1E6JH 1KIPB 2IQAA 4HDIB 4YDLB 3PWPB 1SYVA 1A3LH 3C60A 4U3XA 4AG4L 2ICCA 4JB9L 3BXNA 2Z92B 2A6IB 2ICWJ 3NIFF 4PRNB 5C0AA 2L0DA 5D72L 2F74A 43CAB 2YZ8A 2NY3B 3R8BB 5SWZA 4Y5VB 4U6TA 3ARSA 5E08H 3CSBA 1SVCP 3T3PE 1JPSH 4Z7UB 1NDGA 2XICA 1MCOH 3WXVL 4IMLB 4H25B 1T66C 3WKML 1HXYA 1ERNA 1A3QA 5JW3H 3SGEH 4U1IA 1LHZA 4NQCB 2BRRL 1ACYL 1DQJA 2H3NB 4ZAKA 1T7YA 5TQ0H 1KENH 4G8FA 5BJTB 1K4CA 4L4TD 1KCLA 4YHZL 4HS3A 5C08B 1NFKA 1RHHB 2NW2A 2XI9A 5IT2L 1BOGA 4UTBH 3JWOC 1NMAL 2UZIL 4TQEH 5H94B 3BH8B 2QQNH 1KJMA 3E1F1 3DVNA 1EZVY 1NKOA 1X9QA 4TUJA 3CK0H 3DX9B 3QXAB 3FQUB 3QUMH 3OL2A 5E9DD 4ZTPL 4DAGL 3SGKA 2NY6C 4KROC 4QRTA 3MOBH 4R0LB 3O11B 3DRTB 1EJ6A 2X4UA 4DKEH 2VZ3A 5IEKB 4J3OC 5JIPA 3ZSSA 3M07A 3BP7A 3SHSA 1I1AA 4LHJB 3OAZH 3I50L 2QSVA 4IS6B 4EIGB 3FONA 4XP9H 3S9DB 1DDHA 3UBXI 4WI3A 3LCYA 1G9MH 3ARWA 4OF3A 3WFBL 2I9LA 2WP3O 5HYQA 4EI6A 1AGFB 3QXWA 3QHFH 4QY8B 4ODTL 3O2DH 1J0HA 4Y8DC 5FGRA 5HYEA 4CKVX 1QFHA 4WUUA 1NLBH 4LSVL 5I18L 1BJ8A 1H3UA 5TDPB 3D39A 2AQ3A 4PREB 4JHAL 5AG8A 2CD0A 2HT3D 5E5MB 5DVOA 3NFPB 4LPXA 4M1CD 1I8MA 3UBXG 3VXQB 4L4TE 1AKJB 1WIOA 3LKQB 4LSSH 4KZEL 4K3DL 1FG2B 3MLZH 4NNXB 4BFBD 1I85C 2XTJC 1KLFA 3E6HB 1YUHB 1UZ6F 2J8UA 2E9IA 5CINH 5GGQL 3QIWC 4APQA 2MKLC 4MD4A 1DEEA 2I27N 5IF0A 1IEAA 2CRYA 3GSVB 1JWUB 3IDIB 5JDSA 1I1YA 5HGAB 3MBED 5I17A 5E9DE 1BAFL 3SBWA 3BEWA 1J1OH 3NAAL 4NM4H 3FT4B 2XFXB 1PD6A 4PJAA 5AWNH 1IQDA 1N26A 4G9DB 1P4LB 4YPGB 5CHNA 1Z5LB 3ZDYE 3QUXD 2YPKB 3U83A 3CFKB 4R8WH 5D5MA 2HKFL 2W0FA 3T8XA 4CNIA 3RNQA 2CUMA 4YHKL 3PF2A 5AZ2H 4KKBC 5HGDA 3KLAB 3VU2A 3Q5OA 2GJZA 2LTQB 4K3HA 4GBXC 5DO2C 2DQHL 4UTAH 5I71B 2WM0A 4R26L 3H2WA 1HH6A 1KB9K 4N5UA 4L5FH 1HYSC 1FNEA 1EO8H 1HINL 3SKNA 3M17A 4Y16B 4PJ5B 4Q6IA 4CN4A 3I2CH 1F3DH 1JGVL 1IE5A 3VCLB 2E7MA 1N2RA 3F7VB 5BMFH 3ELAT 1A1OA 4KJWC 3VXMA 4WWKD 3CXHK 3D18B 4NQTA 3QAZC 4FQPA 1HOCB 3RI5K 3VXOA 3KYNB 1E4XH 3RTQB 5D7IF 1NCWH 2AI0H 1MIMH 2IANA 4OUOA 4PB0L 3BP4A 3QUYC 1KIRB 5HPOA 4OLWH 1SYSA 1RULH 3EHBD 3F65A 1H3XA 1VACB 2R2EA 5DQDL 5IFJA 4P3CH 1Q94B 2GUOB 1OAKL 4X5WB 5D70H 5SV4A 3GRWH 5DJXA 1T04A 2ZP0T 1CGWA 1WV7T 3OB8A 1ORQA 1UWGH 1U8HB 4XMPH 1F4AA 4GLRI 3V5HA 4YHNB 2AEQH 3L3OB 3RY6C 1OHQA 4Q58C 2HFEB 2X2YA 2Q6WB 5FA4B 5ENWB 1FLRL 5GISH 5KSBE 1U95B 5HDBF 3ZE1E 4B41A 5CIPA 1CDJA 1JPTH 4HXAL 1MRCL 1FV1A 1R3HA 2FECI 1LO3H 2K7PA 4NC0B 3ZYOA 1HHGA 3NH7H 1CG9A 5FV2A 2H2SC 2NMSA 4XP1L 4QHUB 3HR5B 4M8QA 4OTXH 5BW7A 5E6IB 4XCNB 3SGDI 2M1KA 1PKQB 1QR4A 3S4SB 4NN7B 2IPKB 2VXUL 4NO5B 5ISZD 4Z8FH 3U4BH 4M9OA 5FYLL 4KI5D 5EZLB 4XC1L 5HI4D 1MCDA 3GI8H 5EOCL 4N0UA 4JEGB 4HWEH 3ZT6A 5CUSH 1FYTD 1U8OA 1KEML 2IPUG 2PYFB 4P9HC 3EDKA 3ZYZA 1SJEB 1U3HB 3F58L 2EDHA 5ESAB 5EU4A 4P99A 1CICD 1S7SB 5ALBL 4JDTL 1P7KB 3B5GA 2GSIA 4EEEA 3MUY1 1K8DB 2X70B 2NTFB 5DHVB 4IRZH 4P9HL 4LKCB 5F9DC 3WEXA 1FG9C 3GSUA 3X12B 3C5JA 3S5LG 5DQ9B 3NPSB 3NACL 25C8H 4RGMC 4JFQA 3QG6A 2F8XC 5MEND 4HPOL 1M7DA 4M61B 1CE1L 1HWHB 4I3GA 4O58L 3REWA 1JJUA 3MREA 4LCWB 1KIUA 5HYJA 1EBPA 1GZPA 3ABZA 3L1OL 1AO7B 2P5WE 5C0FB 5CGYD 4FXKA 3WFDH 1VENA 1J0KA 2J8HA 1T5XA 1U8QB 5GSVA 4U7MA 3PWLA 4YXKH 3RPIA 4UT6L 5CMAB 2IH3B 2FH6A 4RFOH 1UJ3C 1JNLL 4TNVK 4HC1L 4JCMA 5K9JL 3WFEL 5KVEL 1MCPL 2Q76B 3RZCA 3MCLH 4JO1L 1NFDF 4FQXB 4Z5RA 1FJ1A 1XR8A 3G5YB 1U0QA 1TJHL 3QIUB 4WEBL 3V6FA 5KJRH 4PRDB 4XPAL 1AGDA 5JZ7C 4Y1AB 4KKCD 3SY0A 5T3ZD 4TSBL 1DBAL 2C4FU 1MY7A 3MOAH 3ULVH 2ZZUT 3KHOA 1FYTE 5L8JB 3BRGC 1PYWB 4UILH 5HHOA 3IFOB 2MHAA 5CEZL 1EFXD 4TVSa 1EUTA 3GK8H 1M4KA 5I15L 4PRBB 4L8DA 4GKSA 3UTPD 2HG5A 3QDJA 3Q2CA 3HFMH 1DBKH 1GHFH 3FTGB 4KV5E 1TVDA 5BV7C 1FFRA 1LD9A 5DMIH 4PJHF 5CS7A 4BK5A 1N64H 3RQ3A 1FO0H 3TVMC 4H1LA 3HN3A 4FZEL 3I6KA 1QQDB 5MENE 1DVFD 5LAXB 3HNSL 3MRBB 3OX8A 3L3GB 2R1YA 3G5ZB 5GIRB 4ORZC 5F44A 5BV7L 1FL5B 1NEZB 4HPYL 2DYPA 1AFVL 3U7YL 1AD0B 1I85A 2FRGP 5IMLB 1YMHA 2YD1A 5EBMB 5GRVK 5L6YL 1MFAH 3OAYH 1M1SA 3O3AB 2E3VA 4YAQB 5DEFB 4GW5B 3RWHA 4BKLB 4O2EB 4OKVA 1DN0B 5I6XB 3V8OA 1L4IA 4Z95L 4FQLL 1T1ZB 4JM2C 3S35H 1JV5A 3VD5A 4DEPC 2FIKB 4DW2H 1BBJA 4MXVE 4DKFL 3MJ7A 3AS3A 3UPAA 3WHE0 4OBRA 1KCVL 4Z0BL 3MJ9H 1QFWL 1NC4A 4JFED 4Z9KB 5JR1H 5F1SA 1CD8A 2YD3A 5TDNA 4DZ8A 1XIWD 3UTPE 4YDVA 1T0NB 4GBXA 3O2WH 5DFVC 2BOBA 3RWFA 5DMKA 1NAML 3B2UC 1T0MA 4G6KH 5AD0A 2CDGA 3TA3A 1ZHBA 4OCLC 3BEVA 5I1JL 2EIEA 3AVEA 5DEZA 3CPLB 5JW5B 5F9WB 2CQVA 2NX5E 4NWUL 1C12B 2BY1A 5CBAB 5HPMA 1R5WA 3ILPB 3OF6D 2O5XH 2Q20A 3EAKA 3TBVB 1CT8B 3KPPA 3B43A 4OSUH 4EDXA 1JGLL 3IDMB 4MGXA 5FHBH 4WJ5A 2PR4L 4LIQE 3VXUD 4HQQH 5KSVA 2YPLA 4ZXBD 2AK1L 3QUYA 4Q9CA 3AXLB 2FX7L 2H1PH 4CBPA 1B2WH 4QKXB 1FFOB 4V2BA 4YFDB 4C4KT 5KS9F 4I5BB 4MNGA 4FN0A 4CU8A 1BVKA 1D9KC 2VQ1A 5D7SH 3DETC 4ETYA 1D6VL 3ETBF 3RP1A 5CSZB 3RVVC 3QQNA 5D7LB 4LP5A 5CZKA 4I2XA 2AXFB 2ICWA 1T89C 3HE7C 4YR6B 3SKMB 3TV3H 3FFCA 5LVEA 1S9KC 1B88A 3I6LE 4X7TB 1Y0LA 5GRJL 3OXSB 4JFEE 4PJCE 1DBJH 2G2RB 2FGWL 4P9ML 4ZODA 3NZHH 3PGFH 5C0GA 1I3GH 3DHMA 4NZDA 2AEWA 1FN4B 2X6MA 3C2AL 1UYWL 2NLJB 1H5BC 4Y4FB 3ME0A 1L7TL 2H32A 2EH7H 5C09A 3P0VL 1E28A 1EGJL 2HTLD 1B6UA 4PJDE 4OZHF 1UENA 5T3XL 4LQ1A 4Z7QF 4DZBA 4QXGH 4XVTL 1IAKA 3QSKB 4ZUUA 4N5ED 3G5VB 3OR6A 5LXGH 1TXKA 4NT6B 3VJ6A 2HJKA 2NY7L 4MX7B 1J0ZA 1FHGA 1BVLA 1NDMA 3GFUA 1IGJA 1FL3B 2EE6A 1KXQE 1NCBH 4UQ2B 5IVXE 2APVA 3QEHA 1ES0B 3ZE2E 3EJZD 4Z7WE 3DXAA 3U7AA 5KSBB 4ZUSA 1I7RA 2EDBA 1V3MA 5I1LB 1GZQA 4JHZA 1VFAA 3C6LD 3ILQD 4YHLH 4E42A 3UTTA 3OQ3B 4WW2F 1A8JH 3JTSA 4HF5H 3QFDB 2Z8SA 5C0EA 5DVMA 4F7TB 4JPIB 4XMLH 3LS5H 3RUGF 1MCWW 4OM0H 4ODBD 5FB8B 4BZ1H 4DCQB 3DWTA 5IBTL 4OV5A 4HC1A 5CEXB 4GG8A 4K3EL 4C56E 4D0BA 1WFOA 2VO5A 4YZFF 1KEGH 2YEZA 5FV1L 1J1PL 3KWWA 1DQLH 5E2JA 5JORA 3BZFA 2BNQA 1PZ5B 4X9FA 4EOWL 3FQTB 2O5YH 4HZLA 2YBRA 5F9JB 2I60L 1P7QB 3RL1B 3IDJB 1UJ3A 1RU9H 3BHBB 5B38B 3VG9B 4OGYL 3ARBD 3LS4L 5JTWA 5EZJA 4BZYA 3EJYD 3ROOB 1QPPA 3WS3A 4IBLT 4L4VB 4UT7H 2Q86A 3S98A 3BUYA 2WV3A 4JGJA 1EBAA 1GPOL 3KPRA 4DKDC 1KJ2A 5EU3A 1MLCB 1R5IB 4FTVD 2CXGA 4NQDA 1BX2A 2NY3C 2BNRE 4PJGE 1JGUL 4Y5VC 3DMMB 2M8XA 1OGAA 2CKBB 2ESVE 3WN5B 5INDA 3IAQA 5I74C 3OG4B 2J2ZA 4GMSH 2P5WB 1IGML 1IL1A 1KXTB 1OARL 4BSJA 1IM9A 4U1HA 2VABA 3RFZC 3NCBB 3SEPA 1CQKA 3KVQA 4WENB 4WU7B 4G5ZH 3UX9B 3FB7A 3MLVL 3O6KL 3ZYIA 3OGCA 5DD0L 4Y7MA 1C7TA 4YJZL 3DTXA 4JJHA 3WFCH 2MQ3A 1UEMA 2X4PA 2CDFB 3QNZA 5A2IH 3T09A 1FL6B 3UDWC 5FK9A 2BERA 3TNMA 1KB9J 4CVWA 1CBVL 3QYCA 2VITB 4BFIB 1JPGB 1KV3A 4FQHA 4R0LC 1UB6B 2Y6SC 2VOTA 1JTTA 1MF2L 1KJ3H 2XZCH 3W11C 5IB3B 2Z31D 3GMMA 3B9KD 3QIBB 2WWMD 3P30L 5IM7B 3CXHJ 3NIDF 3ES6B 3SGJC 2ICES 3OKKB 4ZUWA 1JFQH 4NIKB 3DX6A 2XWTB 1RJCA 4CMMA 4ODHL 3VMOA 4FTVE 3ESUF 1DUYB 1NAMA 3S34H 4YX2H 5F7YC 5B3JF 3LIZL 4JQIH 1YNTB 4GKNB 4DVRH 1JYWA 1NCDH 2QEJA 4PYGA 3AAZB 1JWSA 1RHFA 5MENB 4OT1L 1CU4H 3MV11 3RL2A 4S0TD 4B7IA 5IGXH 2D9QB 1VDGA 4U33A 1U93A 3BKYH 1AGBB 3V5DB 1VGKA 2FEDC 1U8LB 1RV6X 4HK0B 4WTWA 1RUKH 2VTFA 1MRFH 5MEOB 4PGBA 5F71A 2R4SH 3ECBB 4LASH 4KK5C 3QXTA 5DMGD 3WYRA 2FLRT 5EPMB 3KPQA 4OZFA 2EO1A 4J6RH 5T1KA 4U1NA 3STLB 4OBSA 4OLVH 1H3TA 4QRQA 1A7RL 4X5XA 3SCMD 1VGEH 1D5XB 5CGMA 3DUHA 1I75A 4LEOB 5GGVY 4JY6A 3NBNA 2Q7YA 5DJYB 5HGBB 3IFPB 2ORBH 4HH9A 2BHUA 5E8PB 4R2GC 8CGTA 3BT2L 1LEGB 5F6HJ 4IRSD 4KVNL 3U6RA 4N1CA 1MI5E 1A4JB 2C7UA 2H41A 3NA9L 3VWKB 3VRLF 4XBGB 2XIDA 2E7LC 3WJJC 1QD0A 1QSEA 2W65B 5FGBA 4K23H 4X4MA 3HE7A 5DD6B 3MOQA 4OZGE 1V8HA 2BFVH 5EDXA 2LTQC 2DQGH 4PBXA 5E8EA 1KB5L 2FB4L 5L2KD 3RHWK 3O6MH 3PHSA 5FKPB 2YUVA 2ZSWA 2H26A 4X4YA 1EGJA 1LNUA 2NX5B 1OD9A 5ERWB 4G3YL 3VGHA 1PAMA 5D9SA 1D3CA 2RBLA 5DR5L 4F3FA 3RDTC 2W60A 3QJFA 3L3KB 1H5BA 4FQIL 3NZ8A 5KVFL 3RY5A 3L5WB 1T2JA 2CRZA 2FWOA 4NSKB 3T2PA 3S3PA 1MY5A 4LLYB 1XZ0A 3QZWA 3WL9B 3RTQC 5ICZB 1B0RB 5DRWB 1D7FA 3E3QE 3X17A 3WLWC 1IFHL 2R1WB 1J8HD 3JV4B 1I7UB 2NQCA 3FO0H 4G8GA 4QXUL 4U1MB 2DBJA 1TCRB 2BC4A 1TCMA 2ICWI 1FYHB 2EICA 1N3NA 7FABL 5ITFB 2D7MA 3DURB 3WIIH 1U6AL 1LO0H 2ZNWA 3UO1L 2P43B 4WW1B 5HD8D 1IT9L 3ALPA 4XVUD 5BS0A 3DIFA 5T1DL 2W9DH 3DYOA 4KK8D 4KPHH 2FX8L 4NKMA 3MCKB 1EHXA 3QWRD 3W2DH 1U8NA 4JFEB 5FDYA 4PJCB 3HI1B 1HE7A 1KLGA 3PHQA 2D7NA 1W0WA 1RURH 3LZFL 1D6EB 2ADFH 3TCXA 2H8PA 4ZFZB 3L3HB 4RMSA 1XGYH 3TBYB 4Z78A 2X1QA 4HKZA 2DD8L 3B9VA 5E6IC 4PJDB 1QFUL 3RBSA 2X4SB 3REVB 2MPAL 2NCMA 4HUUB 4MAUL 4JFYA 4NN7C 5ACMA 1N6VA 1EEYB 5EFIB 1MVUA 4QEGA 3GGWA 1DLFL 2GEEA 2R8SL 3V4PL 5ADOH 2D0FA 3QHTC 3DGGB 1QSFD 3RKPA 4RA0C 4HDIA 3PWPA 1R3JB 4KUZL 3QA3A 4L3EE 4NNPL 2JCCF 4TNWK 1J8HE 4NQSB 2RAMA 1U3HC 5F1IB 2CGRH 2GJJA 4Z7WB 2Z92A 1IC1A 4ISVB 1IGTB 1INDL 2A6IA 2LV4A 4JKLA 4P46A 3LOWA 4UQ3B 5IQ7L 4PRNA 5H2BB 5IHBA 1A14H 3K46A 4LVOB 3RVWD 43CAA 3HNVH 1RZFL 1G9NH 3O9WB 1LDPL 4WI8A 4Y5VA 3HMWH 1G7QA 4NUGH 4AT6A 1OAUL 3PNWB 4U4BA 5DVKA 4WIQA 4IMLA 3NPSC 4ZDHB 5DI8A 3KJ4B 4L3CB 2F5AL 3GMNB 3LKPB 3CD4A 4C56B 1KPRB 1YNLL 2F8VA 1K4DB 2H3NA 4YHPB 3B5TA 4UIMB 5BJTA 3GMOA 5HGHB 5C08A 1RHHA 4F7EB 2O61B 1E6OH 1RI8A 2W9LA 3O6LL 4KXZI 3HC3L 2FL5B 1NC2A 1YEDB 3GBML 4XNXL 2F53D 5H94A 3BH8A 4ZFGH 1FSKB 4JG1H 3BPCB 3UDWA 4JZNB 3PGDB 3QXAA 4PJ8B 1CDYA 2QADB 1YY9C 3FOMB 3FQUA 5D6DC 1YEGL 2D31B 2R4RL 4XHQA 4WNQB 5BVJB 4R0LA 1WWBX 4KUCD 5AG9A 3O11A 3DRTA 2DICA 3QIUC 1HHKA 1T2QH 5CIPH 4U49A 4PV9A 2BNRB 3D1MC 4FRWA 1MJ8L 5IEKA 1CLCA 1IBGH 2ESVB 4RRPA 3UJJH 3SGJA 1HNFA 1KCKA 4IS6A 1NBVH 3GKWH 5FYKE 3VDBA 3R06B 3VXSE 3ARGD 2ILLA 2IBZX 5T33L 2X9YA 5F8RC 2ZCHL 4RAUB 1OTSD 1AGFA 1PDKA 4QY8A 4JB9H 3SDAB 2ENYA 2VLKE 4JFPB 2DLIA 1AQDB 3CVHL 5DUPL 1MFCL 1NBYB 2HRLA 5TDPA 3MJGX 2P1YA 4H26A 4F9LC 2FHFA 4PREA 4LDOB 4QCIB 5E5MA 1OWWA 5CJQL 2A6JB 3VXQA 3WXVH 5F72S 1AKJA 1QFWI 3LKQA 3WKMH 3TN0D 1FG2A 4LHUA 1QA9B 1CI5A 3EO0B 5I1IL 2BRRH 2YRLA 1PG7L 1Q1JL 1ACYH 1YUHA 3E6HA 4WI6A 1F90L 5E7FA 3WXWL 5HHPB 2F53E 3QDME 3DBXB 2CUHA 1T1XB 3CH8A 5TPWL 4YHZH 1JWUA 3IDIA 3FO1B 5BRZD 3FHAA 5HGAA 5I6XC 2YMXL 1NMAH 2UZIH 3FT4A 2JIXD 5IB1B 1HYRC 4ALAL 2VDQL 3E6FB 5J6GB 4N1HB 4LVHB 4G9DA 1P4LA 2X7LB 4YPGA 2OP4H 2XKSA 1Z5LA 2YPKA 1KB5A 1VFOA 2R1XB 4PGJA 3TYFB 2E7LA 3JWOH 3IT8D 1G7JB 3KLAA 2CK2A 2OSLB 3OV6A 4XNYL 4CU7A 1Y6MR 3Q5YA 4UU9B 3BWAB 4HAFA 4F7MB 5HTSA 4B7LA 4P4KD 4N0CC 4G80B 3I50H 3LPWA 4M93B 4MMXC 2Y5TB 2AERT 4Y16A 5F9WC 2D4FA 5I1CL 3WFBH 4PIRF 2PNDA 3BZ4B 3ULVD 1M6OA 4ODTH 3F7VA 2EEDA 3TM6A 4HS8L 4Y2OA 1ZOXA 1OCWL 3D18A 1HOCA 4XPBL 4JJ5B 4LSVH 5I1AB 5I18H 1FVDB 3CZJA 4X83A 1WFTA 1FDLL 3MV8B 1MI5B 4JM2F 1KIRA 2Z31B 1YECL 2FLBT 2YUZA 4HMEA 4ZO6A 1DP0A 1VACA 1VPOL 2ITCB 4CJ0A 4WHTB 4KZEH 3GMLB 1NGPH 2FD6H 4X5WA 4H1LH 5BRZE 1X5AA 3C8HA 5DHYB 4D9RD 3QXUA 4ODVL 5GGQH 3OAZK 1U8HA 4OZGB 3RIAK 4YHNA 1T2XA 2Y72A 3D3VD 5J13B 4I18B 1JF1A 1FCCA 2HFEA 1BAFH 2Q6WA 5FA4A 5ENWA 1YEHL 2VH5L 1U95A 3WNPA 1VEPA 1FBIL 2LU3A 4YFLF 1XF2B 5HDQL 2Q8BL 4KKLD 1RAMA 5HVGB 2HT3C 3MUHL 3HR5A 1JZ6A 2HAZA 5DFTA 5GZOC 4YHKH 5E6IA 4U3HA 1JNHB 1PKQA 1BD2E 2WUBH 3BD5A 3BH9B 3CC5A 2B1AL 1JI1A 3S4SA 3KLHD 1U8KA 4NO5A 5I8OL 1P2CB 4HHAB 1RZ7L 3ULVE 3QZWG 3SCMB 5EZLA 4R26H 1N6QL 4ODUB 4X0KB 4ZD3L 3WNOA 1HINH 3WV0A 2CSPA 3HRPA 2PYFA 5GJSL 1SJEA 5ESAA 4PR5B 2CR3A 2P7TA 4RWYL 1P7KA 2SEBB 4HS6B 5DUML 2VN7A 2WBJA 2FJGA 2NZ9C 2X70A 2NTFA 5DHVA 4LHQB 4XCFL 4LKCA 1BPVA 1V5JA 2EXWC 4E41D 3X12A 4LNRB 1EA9C 5DQ9A 2A6KB 3VRJB 5FXCH 2X44D 1MREL 3MRNB 1F6AB 4M61A 3T0AA 1AIFB 35C8L 4ONOA 4OZ4B 2WINA 4LCWA 5L8LB 3HUJE 1AO7A 3SKUD 5C0FA 3ZO0A 3IDXL 1U36A 3C09B 4R4BB 1U8QA 4XPFL 1A1MB 3MROB 1FLRH 3PWVB 2X9XA 4HXAH 2IH3A 4Y2DD 1MRCH 4L3EB 2EXYD 5H35B 4OZHA 5IP4A 3VG9C 2Q76A 1A9EB 3CSPA 3P4LA 3L3JB 5D6DA 4XP1H 2BSRB 2V17H 4FQXA 3PWJB 4QRPD 1U91B 3G5YA 4XX1G 1CDCA 3QIUA 3H9SD 2Q8AL 4PRDA 5GGSY 1DQML 3IF1B 1DCLA 4MXWL 5DQJB 4Y1AA 1WUNT 3ZKND 3TO4B 12E8L 2UYLB 4TOYL 1PYWA 3IRPX 5FYLH 2FZ3B 3DJ9A 1EXUB 3DMMC 5T5NG 4XC1H 2R0LL 3WN5C 5H8DA 1D5ZB 2H32H 1HSAB 4PRBA 5IOPA 3TC9A 1A7QL 3QCVL 1KEMH 4K9EC 2W38A 1FC2D 3F58H 3FTGA 4AK1A 1AXTL 3LDBB 4M6NL 4JDTH 2AEIT 1KSRA 2DL2A 3TIEB 1KLUA 1PG7W 1QQDA 3TPKA 3W0WB 4P9HH 4RISH 3MRBA 4RMTA 3SPVB 5SWQB 3L3GA 5GIRA 1HKLL 1FL5A 1NEZA 3LQMA 1AD0A 4WI9A 1X3DA 2ATPA 2R29L 4YDKL 3BPNC 5EBMA 1CE1H 5IROC 3VE0B 1QFPA 5L9DL 4C54A 4DGYL 4MCZB 1WQVT 1KULA 4JQVA 1IAOB 3GJEA 3KHQA 3L1OH 3O3AA 2RGSA 4YAQA 4GW5A 1GRWA 3QIBC 4BKLA 1FFNB 4RBPK 1ZLWH 2G75B 1DN0A 5L2JB 2A74B 3BP6B 4W6YB 2Y36L 1KCUH 4UT6H 4RRPG 3VXSB 1T1ZA 3H9SE 1CFTB 1JNLH 4HC1H 2FIKA 5K9JH 5KVEH 1MCPH 2VZTA 4JO1H