2HRLA

Siglec-7 in complex with gt1b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
116
Chain Sequence
DYSLTMQSSVTVQEGMCVHVRCSFSYPVDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siglec-7 Undergoes a Major Conformational Change When Complexed with the {alpha}(2,8)-Disialylganglioside GT1b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Sialic acid-binding Ig-like lectin 7
total genus 27
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrlA00
3I75B 4EOWL 3A67L 4FABL 4EN3C 1OGTA 3EZJB 3L9RA 3BSZH 3HNSL 2OBGA 3OF6D 4LSTL 3MMEA 4QXUL 3AUVA 1EUTA 4UAOB 2EE3A 5GS0C 2MSPA 5EOCL 1UXWA 4GMSL 3U6RA 3FB6B 3MOAL 1DSFH 1INDH 3U4EA 3FTGA 2HT3C 5KSBA 2NYYC 5CBAA 4Y7MA 2FJHB 2QQLH 4FG6C 3MRFA 4OLYH 1KULA 2J88L 1G1YA 1MAJA 3BQUD 5CP7A 1SJVA 4PJCB 4BZ1H 5TGBB 2XZCL 2D03L 3U30B 2IAND 3LEXA 2EXYD 1OTTC 1CFSA 1K4DA 3LKPB 3MNZA 4PLNC 5TQ2L 4PJDA 1K85A 2X5PA 3ARFD 1YEHL 5E00B 3VGFA 4B41A 3KJ4B 3WLWD 4NT6A 1A7OL 2PW1A 3MRKB 3G04A 2EKSA 5EO0A 3ZTJG 4N8VA 3RWDB 3QFJB 4KK9D 5IR1A 5TDPA 1G7PB 2AK4E 2VO5A 1TVDA 1W72B 1KPUB 5HGBA 1JWMA 3D1MC 3F6LA 5L2KB 1HI6B 4A2LA 1S7XB 3BMWA 3F7YB 2P5EA 4XMPL 4Y16C 3UTQA 4IOFD 4ALAH 4PBXA 3WDHA 5JQ6L 3RWCA 4U1JA 5C6WH 1BPVA 3Q1SH 2R2HB 4NC0B 4WEBL 5C07B 1G9NH 4OFYA 4U6XA 4E41B 3EOTL 1AXTL 2CIIB 1AO7E 4OZFA 1D5BB 2KQNA 4G7VH 1A1OB 3RVWD 3S37L 1Q0XL 4GT7A 5E6ID 5T1MA 1CD1A 4JHAH 4Q2ZB 5C70A 3EJYD 1QRNB 1OM3L 4ELKB 4ZS6C 4EBQL 4R7NB 1I9IH 2LQRA 3DXAD 1GYAA 5DJCB 1MCPH 4XWGH 2QADC 2H9GA 2A9MH 4KJWC 4NUGH 2HP4A 5FYJD 4BH8B 1I1AB 2DM4A 4O51B 3ELAT 2MQ0A 3DBXB 1S7UA 5B8CB 2Z9TA 3BH8B 4UU9A 5GGRB 3L3KB 5C0GA 5T1KB 3VG0H 4GKSA 3MRGA 1KLFA 1N0LA 3HMXA 2BY1A 4XBPA 1AQKH 3LKSB 1IM9D 1XMWA 4L3CB 3BT2L 4R4ND 4KMQA 3QIUD 5IB2B 1YYLH 5CLWA 1IQDB 1IVLA 3W0WD 5C07D 2Z8RA 1AE6H 1XGRA 2XICA 4GAJL 1FDLL 4KK6C 5A2LH 3Q6FB 1JPST 3TEUA 3VXMB 3T0BA 5IM7A 4GRWF 4ZS7L 4KK9C 4OCRH 3UBXB 4XNUH 1Q0YH 5IT2H 3WS3B 1KIRB 1IGMH 4FTVA 4X8XA 3HNVH 5EU4A 2YPLD 5INCB 4O2FB 1QKZL 4UDUB 5F21B 2F54B 4GH7B 2W60A 4LLWA 1A4JB 3VFPB 4KHTH 1R3LB 2XG5A 3G6DH 1EHLL 2I27N 1BQLH 5E1HB 2OSLA 1MHEA 3PQYD 2DTMH 4LF3B 5HGAB 3RNKB 4OCSL 5IFJA 3E0GA 2CKBH 3PWJA 4YE4L 5SX5H 3EO1A 5E8DL 3O4LA 1DN2A 3BH9B 4JM2A 1R3HA 3B3IB 4MNGB 3ECBA 2AQ2A 2DDQL 2FL5A 3BP4A 2AV7A 3VFSA 4TVSa 3SDDD 4LCYA 5DQJB 2MKLC 2YPVH 3GSNL 2VXUH 3B5GA 5DGQA 3EYUH 3V8OA 5A40E 3V9FA 2DQDL 2VDRH 4M3KB 4RMSA 3NH7L 3MBEC 2J8UB 2DAVA 1HSAB 4E5XA 2XN9B 1T4KB 1ZXQA 5F7EH 4Q0XH 5J8OA 2AKRB 1BIIA 3CFDA 4QHNA 1YEGH 3OPZH 3RGVD 1G6RB 3PGDA 4MGXA 1V3JA 1ZS8B 2VLLA 4S1RL 3EO9H 1LDSA 5J1SC 5EPMB 5B39B 3MO1B 3NN8B 1FGVL 3SDXF 3P9LB 1ZS8A 3HPJA 2GUOA 3BKYH 3VI4E 4H0GA 2NY3D 2X05A 4RDQG 5MEQB 1HINL 3JWOC 2BJMH 3AB0C 3EYVA 1TZGH 4UDTA 4KZEL 2GSGA 2YD2A 2EYRB 3TWCL 1P84K 3ESVF 1U58A 4J4PD 1T21B 4UQ3A 5CJ8A 3OAYK 4XAKD 3ARBD 3TV3H 1KLUB 4I18A 3WFCH 2PYFB 1HSBB 3BD4A 1CE1H 4JPWL 2P5WE 3SE3C 1HXMA 3QIWA 2AXFA 4ONFH 4WFEE 4UIMB 3T1WA 4B0MM 1A3RL 4WUUE 2IPKA 3U48A 4Z7VF 4RDQF 1W8NA 2P8LB 3W9EA 4Y4HC 1J0JA 2FX7H 4NQVB 3ZT6A 4YE4H 1Q94B 3ARBA 1SVZA 3ARGD 2XIDA 1D5MB 1IBGH 4P5TA 2IADA 5AUMB 4C56D 3S96B 2VDML 1MCCA 1NBVL 5J12B 5TDOA 1WT5A 3MRNB 2A38A 4PG2C 3KPQA 1CICD 2VDPL 6FABH 1OP5H 4L4JA 3PDOB 3RDTC 5TDOB 5JW3H 1QSEE 3CSBA 5HI5C 2GI7A 1UH2A 3GHBH 1JRHH 4OCLC 4P9HC 1QFHA 4PGCB 2UWEF 3NAAL 1C5CL 3QNZA 3VXMA 4NYLA 1JF5A 3KPRD 2FR4B 4U6TA 2W0FA 4YUEL 5HYSG 5INDB 5J0BA 4JB9L 2HJFB 4FHBD 4P5MA 4HD9A 2JB6A 1MFAL 4U6VH 1NBZA 5IGXL 1QBML 4TUKL 1FFPB 1U2CA 3LCYA 4OF5A 5IB2A 2UYLA 5JXEA 1FL3B 2HYMA 2JB6B 3JWDH 2DQIL 1A3LH 3VWKA 3JWOH 5DEGA 2DM7A 1RZFL 3CK0L 5HHVL 3SDYH 4RGMB 5F7LB 4OM1H 2ZSWB 1A22B 5KTEL 2ADJB 4R4NC 4L4VD 3AU1A 1XF1A 2V17H 3MLYH 2IQ9L 1GGBH 4A6YL 2E6PA 4YXHL 3WUWB 2FB4L 3NA9H 4TNWK 1I3RA 1PX3A 3A6BL 4U1GB 4DKDC 1ORQB 3FRPA 1HH6A 3CFEA 4HJJH 3HB3D 3NZHH 4QHNB 5F88A 5A43C 3H9ZA 3QHZL 3L3IB 3U36B 5DEFA 3KS0J 4HUKB 4QXGH 3MV7A 1P2CA 2P8PA 5L7XH 1KLGB 4WO4A 3AC0A 5D7KD 4NBXB 4XXDA 2BHZA 1FO0H 2R1XA 3MRHB 1TJHL 5J11C 2DI8A 1NC4A 3ZDYE 1T03H 1A1OA 1G6RH 1N4XL 2IGFH 4Z7NE 3KPPA 4D2NA 2WWKT 3MRIB 4NQUA 3SKNA 4RIRA 5HYJE 2O5XH 2A74A 4I1NB 3EDKA 5C8JB 3MLRL 3TJEL 4KKBD 3LSOA 1G9MC 4NYLB 2PYFA 2BOBB 3VA2C 4ZUSA 1G9EA 4P2RB 5D7KE 2IANE 25C8H 1T5XA 1GSMA 1HE7A 2YZ1A 4HKZB 4X5XB 5TQ2H 4L4TA 4JY5L 4HWZB 2IG2L 4OGAD 2FEDD 1AH1A 1A9EB 4YHPA 5MERA 5BV7H 3AMKA 1XF4A 3DUSA 3ULUC 4O2FA 2GSIA 3HI6L 3OKKA 1WZMA 1I3RB 2R1YA 4BZ1L 4P57A 2G60L 2BVQB 3AU1B 4PRHE 2J88H 3H0TA 3DVNB 4RAVA 4PJCE 4HFUL 4OCMC 5E08L 4UTBL 3KAAA 3QI9D 4WCYL 3K2UH 3V5HB 1CE1L 1HOCA 4JR9H 3VFWA 5HVGB 4QWWC 5CILH 1NCBH 3SGDH 1MLBB 1KB5B 1KCSH 3N9GH 4RAUB 5ELIA 3UXFA 4XMKL 5K33A 4F2MA 1T2QH 4MNQE 1XGYH 1SYVA 1V7NL 3EAKA 4FRWA 1A6AB 5IBLC 1UM6L 2BVYA 2DM2A 1NQBA 3BJLA 3PDOA 5BO1H 1TMCB 5KBNC 3BEWB 1KCUL 5B3JF 3JTTA 3VXUA 1J87A 2CIKB 5EPMA 5B39A 2JELL 5GRWA 4OLUH 1DQDH 1MRDH 1Y0LB 3RZCA 5I17B 1KPVA 5EIIB 2Y4SA 1T0MA 4HXBH 1JK8A 1TTGA 4MD5A 5I8OL 4GRWE 1XGQB 2FH8A 1AO7B 4F9PA 2VLRE 3VJ6B 5IFAL 5KVMC 3HMXH 3UTTD 5DRZA 2A77H 3U30C 1N64L 3FN0L 3JBG7 2DJUA 5GGVL 2PYED 4PYGA 5H2BB 3RUGF 3SJVD 3HI6H 1INEH 5I1IH 4R3SB 1XIWD 2JIXB 2NY4C 1R3HB 2WUBL 3O2DH 1I7UB 5B4MD 3KPOA 1NCCL 4YXKL 5FO7B 4Q6YA 4DN4H 3QUML 4XPFL 4G9FE 1YPZB 3EYOA 2NY2D 2BOBA 4N8CH 2YC1A 5HGAA 3RNKA 3REWB 2CK2A 4M61A 3MA7B 2HFGH 5GS1B 4H1LG 5JMOC 5DWUH 4GQPH 5IB1A 2DI7A 1FV1B 3SE9H 4L8CB 2VDLL 1KSRA 1IC4L 5EZJA 3NFSH 4P2OD 3OF6A 5I73C 1K5NA 4UOW0 3MOQA 3GI9L 4Y1AA 4YO0B 5E8EA 1KB9J 5DLML 1JHKH 4F3FA 2AEIT 1AHWA 5C0JB 5I19L 2VZSA 3V8CA 4MJ5A 4NJAH 4Y4KA 4JFDA 12E8H 1RZKL 5E00A 1W72L 4U1KA 5F97E 3HPLA 4NQDB 3X13A 1BD2A 3H8NA 5DEFB 4U31A 1MJUL 5CIPB 4RGNC 2O5ZH 1K8IA 4BSVB 4M1GH 4AT6A 3WNNA 4PJ9D 1LO4H 4QXTB 3L7FA 1OAYL 4JO3H 2P8MA 4MCYA 3LKNA 1ZLWK 2MQ3A 1FZMA 3GRWA 4NBZB 4NZTL 1LO2L 2VLJE 3LAFA 1E6JH 5GS0H 4KPHL 4P4KD 3X3FL 3B83A 1GOHA 4XCNB 4DWHA 4IOIB 4XPGH 4XBGB 1M4KA 5IKCB 4IRJD 4KKAD 1X5IA 4R3SA 4XPHL 3X11A 5FUOL 3CXHJ 3SKMB 3QO1A 1YMHB 4CNIB 2H1PH 2IALA 3MSPA 4LGSB 1KJVB 2BNRE 1EERB 2Z8WC 4CAGA 4JZJC 4QF1A 4HJ0C 2XTJD 4WY7H 5I1KH 2Z91B 2V2XB 4J4PA 4MQ7B 5EWIL 1KPVB 2ZOLB 2FD6L 4M3JA 5L6YH 1JPTH 4FNLH 2BX5A 4QTIH 2W9DL 5LBSL 3WNLA 5B39G 3UPAA 2CRYA 1PSKH 2CSPA 3STLB 3VFMA 1YQ2A 4O4YL 1SEBA 4O9HH 1LK2B 3I3EA 2ZPKL 1R3KB 3U0PA 2CLRB 2IADB 1V7NH 1YEKL 1NPUA 4WI2A 2PNDA 4WUKL 4MAUH 1KIUA 4KJYB 4TPRL 5CD3A 3H3PH 3QPQD 1LE5A 1OB1B 1SJHA 2M8XA 5K59F 1FZMB 3QI9C 3TESA 4YHLH 4NWUH 1T1WB 2L7UA 1MQ8A 2ZG1A 3B2VH 1MH5A 3NTCL 5KSBE 3STZB 5DMJB 1X5GA 1MI5E 4O51A 1HHJA 5HHMB 4UB0L 4X6BB 3OB0K 3MV9B 1FGNL 4KQ4L 4G80B 1WZKA 4NZTH 2H1PL 3GUTB 4JGMA 5IGXH 2OJEB 1A2YB 4EZMA 1YECL 2EDEA 1U8JA 4ODUB 2QQLL 3UYOD 2F5AL 3EDEA 1S5HB 2KZ1B 1YNTA 2BSSA 3NAAH 4WY7L 1BM3L 3HRZB 5I1KL 1FL5A 4ORGA 1X6NA 1A7NH 4YZFE 4RGMC 1ETZA 1MI5D 5MEPA 3S4SB 2CPCA 1OCWL 3S96A 4M61B 2PTTB 5LWYH 5EBWB 1DUZB 4K9EL 5F9AC 3HE7D 3H9SA 3VFRB 1T66C 3MRDB 4PIRF 1IEAA 4M7ZB 3QDME 5EZLA 2NXZD 5FYKE 2HLFC 1QSZA 5F1IA 4ZUSB 3DO3A 4G43A 2DL9A 4NKMA 4PRAB 2H45A 3D9AH 1PKQE 3G04B 1X3DA 1IGFH 4G3YL 1SY6A 4PRIB 3EOBA 4HIXH 4X7EC 1DQLH 4JM2B 5C09E 2ICEA 4M4PA 5JDSB 1FG9C 1M1SA 4LLYA 4D0BB 2I9TA 1YN7B 5E7FA 1XAUA 1I1RA 4QRPB 1QR1B 2VIRA 3U36A 1MRFH 3PWJB 4QRRD 5D7SL 2N7BA 5C0JA 4GQ9H 1T7XA 2X44D 2Q86B 1SJXA 2VXQH 1WBXB 4F7TB 2IQ9H 3JUYA 3MPCA 2YD3A 5E6ZA 3G6JB 3G6DL 1EHLH 4YHKH 1NMAL 4DZBA 4OQTH 2IEPA 4ORGB 3W0WB 1OAKH 3G6AB 2ZSWA 3VWKC 1MQKL 4NZRL 1JE6A 2Z0BA 5D70L 1E0OB 3CFJB 4PLJD 5IVXA 3RWGB 4PJFF 2OJZL 1LD9B 4P3DB 1B0RA 4LPCA 25C8L 3QDHA 4PV9B 1IT9L 2B1AL 4JFQB 3KS0H 3IDYC 1NCCH 3DX9B 1ED3A 3K80A 1YDPB 5FYKH 4M6AA 1BQUA 1UT9A 4HLZG 5SX4I 4NOBA 3O9WC 3GHEH 4G43B 4U1MA 5F72S 5IJVB 4K94L 4YDVA 4HIIB 5HVFB 2X4PB 1QRND 3QXDA 5DWUL 1NANI 5IF0B 5JHDE 2FR4A 1ITBB 1V3LA 1OAQH 3AREB 1T0MB 1H3VA 5ICZB 4Q6IC 3X3GL 5E94A 4J2XA 2PF6A 4MSWA 4AG4H 3K2UL 3KYMA 2FWOA 2LU3A 3P4MB 2Z31C 1E27B 3AREA 4GRMB 3S35X 4UNTA 3GSUA 3OKEB 5FECA 1YNTB 1GHFH 3INUH 4X6CA 4YHZL 3KYMB 3EYSH 2LVEA 4NM8L 5F93C 3ARFA 3QDAA 4J8RA 5I0DA 3OAYH 1EAJA 1WICA 4KI5E 4QKXB 4EN3B 4RGNB 1R0AL 3LRSB 4N0FA 3I6LD 4LDLB 4X6BA 3MV11 1FRGL 5I8OH 1C7SA 2P5EE 5EB9A 3VXMD 3E3QC 1GGTA 1C7TA 3C60A 3LIZL 3Q6GH 3CLFL 4JFEB 2D31B 1NC4B 2Y5TB 1K4CA 3K7UA 1S7XA 2HWZL 3WKMH 1GAFH 1S9YB 3MRLA 4BQ9A 1UYWH 4NWTL 2GY5A 4Z9KB 1UM6H 4GKSB 3K4ZA 1Z5LA 5DS8A 4L8BA 5F8QC 3FCTA 3BZDA 3HE7A 2V5TA 4OLWL 6FABL 5HDOA 4Y4FB 5I1HH 4NP4H 4DZBB 5D6DA 1OWRM 3G6JA 2R0LL 5EC2A 3DHMA 4L4TB 5D9SB 1WAAE 5KSAB 1KXQE 5DD1H 5DHVH 1VFOA 4FXLA 1TJHH 5FCUH 1RIUL 4PRIA 3NCMA 4NO2A 5I74C 2XN9A 4M6ML 4HDIA 2P5WB 1IILE 1VEOA 3GMPA 3LVEA 1YNLH 5E1AB 1ZHLA 4K9EC 5CAYB 1YN6A 5HDQH 4LARL 1JNLL 4EXKA 4OCWL 1H5BC 3O3AA 4HWNA 4EVNA 3INUL 1FLRH 4GRWH 3DV4B 5F7YC 3IXTB 3QXAA 1UQSA 2Y72A 1AXTH 3ZKMD 1INQA 2COQA 4FQJH 4LPYA 4AEEA 5MP6L 2CXKA 4UV4H 4DTGH 3KLHC 4JQIL 1PG7W 2OMNA 4XMPH 5FFLA 4N90E 1KB5H 4OKVB 4M7LT 2OK0H 4O00A 4I13B 1HHKA 2BSSB 2W59A 3KXFB 5DJ6A 3Q5YA 1I8LC 1NANH 2X4SA 4X6FA 3QNYB 4GG6A 1MJ8H 4LAJH 4W70A 4PR5A 1KELH 5C08D 3PL6D 4JFHD 5DJ2B 4XX1G 5C7XH 1MWAB 3TA3A 3OAUH 5HPMB 2DS4A 5JPNB 3UZEA 1I9RL 4PP2A 1AGEA 3MZTA 1J8HA 5F6IB 5FGCB 4F7MB 3RKDD 3IB4A 5AD0B 3HS0B 1K6QL 4JFFD 2J8HA 2XQBL 3NCFB 1CLYH 3DI2B 1IAIH 1RUAH 3DX7B 4YXLH 3NIFE 1A6AA 4YC2C 1E6JL 1DVFA 3MLYL 4L4VA 3JSSA 4HKXB 2P8MB 4D9RE 1FZOB 1YMMB 3I6KA 5HD8D 3ZKNC 5DMIH 5MEOB 1I3UA 3HC3L 1BFSA 4JRYE 4TNVK 4GXVH 2WZPD 3VWKD 1UWGL 4MWFA 3BO8B 3M1BA 4X9HA 4LOUC 4IS6B 4JANB 1XZ0A 1MVFA 1N5AB 2FEEI 1RUPH 4RFNB 5DJYB 1JYWA 4DOHB 1A0QL 3B2UC 4PY7A 5FK9A 3TT3H 1AGBB 3VFMB 3ZTJH 1I1AA 3RA7H 5IESL 1CF8L 2NQCA 3BHBB 4DGVH 4ZG1A 5DGRA 1QBLL 4KY1L 1G1CA 3GB7A 3F7RA 4P46C 3DVIA 5I75C 3QDGD 4M6OH 5EIIA 4K2UL 5E6YA 1JF1B 4PJBA 3JTTB 3KHOA 4XAWH 2W0KA 5KW9H 5DD3H 1A9EA 4YHPB 4XP1L 5D93B 3X12B 3QDJD 2B1AH 3A6CH 4ZPTA 4NPYB 2OR9H 4CVZB 1T1YA 3CX2A 1S7SB 3VRLE 5FO9B 1Z3GH 4F8TA 4TVPH 2VDPH 3CVHH 4LNRB 1RZ8B 5AZEL 5M94B 4OIIL 3RX8A 1OTSD 1HWGB 5AAMA 4N8VG 3P0YH 3BYYA 5F7MC 1DEDA 5MHSE 2PXYD 3L3OA 3E8UL 1YYML 4PJXE 3SKNB 1MCKA 5DC9B 3V6OC 3FHAA 5C2BL 3V0AC 3HRZA 4OZGA 3V7AG 2NR6C 4NKIL 2LU4A 2BK8A 2AJVL 1DQJA 4NQEA 5TE6L 1QFOA 5E6IA 3KGRA 1FZKB 4RISL 3LEVL 2ARJA 1D6VH 1FH5H 2JJUA 3BKCL 4PTUA 4QHKJ 5HGGS 3TJHC 2J12B 1OPGL 5SV3A 5IB4B 4Y4HD 4PJCA 2E7BA 1J1PH 4OLYL 3MV9A 5TJWK 1L7IL 4F3FB 2VXTH 2Z31D 2FJHA 4I0KA 3VXSD 4DVBA 1AKJB 1UFUA 5ECJE 4UBDD 5I73B 2HFTA 4MNQB 1YEIH 5T5FL 1BHGA 1VEPA 3HZYA 1T2JA 2VZ1A 4OCRL 2AV1B 1KEML 4MNGE 1F58L 3U4EB 3LN4A 3A67H 3O0RH 3HUJB 3L5WA 1LDPH 2W9LA 4ZUTA 4M7JL 4XTRC 4JZJB 1P1ZB 5FM5M 4NN7C 2P4AB 5I8EB 1WSST 4P5MB 4HFWA 2KQMA 1MIML 5KOVC 3KR3L 3MROB 4MD0A 2VDQH 2A77L 4N1CA 2D9CA 1UVQB 5KS9F 1N2RA 3FHQA 1ZLUK 4HUXA 1EHNA 1KIQB 1CU4L 1ZOXA 2QV2A 1ONQB 4MLSA 4OLZH 4M1DL 2PXYA 4HPOH 2CUIA 3DOSA 4DOHE 2B5IB 2IQAA 5IVNA 2Y06H 3BGAA 2OL3B 2UZXB 3PABA 3CFCH 4PLKD 1DBAL 1KENL 3MCKB 4JE4B 1C5CH 1X6LA 4U1JB 4KV5E 4WVRA 4PRPE 2C3XA 2ICES 3MTRA 5D7JD 1YEKH 1IQDA 2GJZB 2GJ6A 3BPOB 3PV6B 1YYLL 2ILLA 3FFCE 5J12C 4OF3A 1NCDH 3F7YA 4XVUD 4M5ZL 2FX9H 1G7JA 3SO3C 4XAWL 5I76B 1T89C 5KSAD 3IU4H 5MHSD 5J9PB 4K7PX 1MCNA 4NQDD 2VQ1A 3VW3H 1EFXA 2XWTA 5IIEA 2VXTL 2N1KA 4YWGL 5EFIB 4UZGA 4H1LB 3BQUB 1RJCA 5JLZB 4ZTOL 4BH8A 4BSVA 4F37F 2BCKB 5GS3A 5IESH 4OAWB 5F9JA 1F3DJ 5I1CH 1SMAA 2R56L 5FF6A 4ALAL 3TVMB 5IB3B 5D2LF 4ELKA 3HPLB 4NQDA 1JUFB 5D7IE 1T20A 1JGVH 1Q9LB 1KEGL 3KPNB 1X5HA 1QYGH 5ERWA 2ARWA 4JVWA 4PPTA 1ACYL 4ETQB 5JPMA 1ITCA 1XGPA 2D7MA 3WFCL 4N1EA 1GGBL 4DN4L 5TH2A 2ZUXA 1BGXL 2XT1B 1OAUL 4LHUG 5IEKB 3PV7A 3KXFD 4OGXH 2PO6D 5IG7B 3IJYB 4OTXL 3Q6GL 1T4KA 3LN5A 1MCPL 3B4NA 3V0VA 3G08B 3CVHL 5BW7A 1I8KB 1FL6B 5JXAL 5C0BD 1PAMA 1I1FA 2NY7L 4Z7UF 2ZZUT 4BFIB 3ETBF 1NAMB 2APXA 2BMKA 2IAMC 3PJSB 2HJKA 4JN2B 1HXYB 2QSQA 4NJAL 1H8OA 5C1MB 1X5JA 1XCQB 1NAMA 1SMOA 2JCCE 1MAKA 4HUUA 3VMOA 3O4LB 5FIEA 2CK0H 1P4LA 4LPUA 1UG9A 1EAPA 4WFHD 1F6FB 4JRYA 1UADC 3RTQC 3EOTH 3HKFA 4LVOB 4YBLB 3IETB 4M6NL 4WU5A 5DI8B 5K9OB 3LDBB 3ULVE 3ZHKA 3HMWH 4XVUC 2VYRE 1DN0A 1WIPA 4FQJL 5MP6H 5DS8B 3U4BL 3T1FB 4EUPA 3FOLB 1DR9A 2PO6B 4FQCH 5IK3B 5MEOA 5JPMB 4LASL 1W0VA 4I2XA 3V6FA 2BVOB 2OJEA 1UJ3B 3HR6A 1T7YA 4I3RH 4OZFH 4HG4J 3MQIA 1J0IA 5KTEH 3L5HA 1IAKB 4M48L 4UTBH 3AY4A 5T1LA 2OL3L 4JFOB 4LCYB 5HYEA 5FGRA 5C6TL 2FLBT 2NLJB 5B3NA 4LIQL 2A0LD 3FRUB 3FZUC 1JL8A 1HOCB 1YEDB 5I30L 1UWEL 1AGEB 3BQUA 5D6CA 5EFIA 4YK4C 1QLFB 1CGXA 2YEZB 3PGCB 4I3GA 1NGXA 1QA9B 3H3PL 1S7WB 4JKMA 3MA9H 1BZ7A 2VLMD 4FQIL 1IC7L 1R5IA 2YPLB 4F7EA 3FOMB 1BQHG 3P4MA 3DRTB 2DMCA 1SYSA 3PV6A 4MAYD 2XZAL 3BISA 1A6WL 1EEZA 3VCLA 2V5SA 3KJ4C 3MOBL 4KK6D 5GGSA 3LS5L 3LQZA 1CFNB 3PABB 3OAZK 4G6AD 4Q0XL 4ODTH 1B4JH 2LTQC 3BVNA 5LCVL 4MD4A 3G5YB 4R26L 1QSVA 1XF5B 4XPTH 5DMGD 2VTFA 3LZFL 2H32B 4HLZH 1Z9SA 3DTXB 5I16A 4G6KH 3UBXI 2V2XA 3QJHB 3L3JB 1FAIH 1KB9K 3GIVB 2A9NH 5E9DB 1CF8H 4IOSD 1UB5B 4FFVD 4X4XB 4PY8I 3CDCA 2C5DC 1HQRB 3ULUE 3QHTC 3ZHDA 3LKRA 4LCWE 5DJDA 1HN1A 4MDJA 4LLQA 4K9EH 4K8RH 2NX5D 4MB5A 3CMOL 3QIWC 4QY8A 4XCNA 4XT1C 2IH1B 2MPAH 1ZK9A 1B2WH 2EYRA 3RUGB 4UUJB 3W39A 4Z7WB 3BFOA 2PW2A 3VGAB 4F80A 1F8TL 2Y5EA 3HG1B 5EO1A 5BW7C 4KVCL 4GRWB 4HC1L 1FN4A 5EC1B 3T4YB 3MV8E 3M17A 1MIEH 5EIVA 2QEJA 4KRPD 3TNNB 3T3ME 3GJEB 4XWOC 2DKUA 3BW9A 4NRYB 3ARZA 1S7TA 1X5KA 2XZAH 3MGTB 2A73B 3HUJF 2YZ8A 2D4DA 3WXWL 4ZOAA 4KRPC 1H0DA 3BZEB 2ARJB 1WIUA 4EI5C 4P2QD 4KKAC 1EK3A 1JYXA 4IHOB 1T6VN 5D7LA 1LP9E 4U1IA 5J9PA 4XPTL 4QRTA 3MXVH 4Y2DA 4QRRB 4ZQKA 3BPCB 4ZD3L 2APBA 3HR5B 4KROB 2MWCA 4R6UA 3TO4C 2VAAB 1H3PL 4MA1C 1JI2A 2FO4A 5DZOA 4J8RB 4AK1A 2AGJH 5JHDA 2HLFD 1S7VA 1U8KB 1YEEL 2DN7A 4NPYA 2HFFB 3TBWA 3ISWA 4KK8D 5JMRA 3RAJH 4GRMA 1NCBL 4PRBA 1JZ6A 1RZFH 3X14B 4HMCA 4NQDE 4Z7OF 3PHOA 3VXRB 3ZE2E 1A5FH 5AYUL 1BMGA 4WI9A 5E70A 4TVPE 5K9JL 4P5KB 1C8PA 2XN9D 1IAII 2P46B 4AEHL 2Y07L 1QP1A 4Z78B 2YR3A 4LCCA 2XV6B 3ROLB 2AEWA 4PJ9B 2EEDA 5CD5D 5DD5L 3Q48A 3FT2A 4LVNB 4CADA 2JJSA 4KROD 4JO4L 1HQ4B 4XNYL 1BREA 3TLRA 1UM5H 1EO5A 3NCBB 2ED8A 2EECA 2EEBA 5T5FH 2VISA 1ZA3A 3BDBA 5C0IA 1YEGL 3OPZL 1C16A 5EU6A 1QO3A 3DI3B 5FYLH 2O5ZL 4ISVA 1QBBA 4XI5C 3FO0L 1FNFA 3MR9A 2MPAL 3MLTA 4ZSOA 4G6FD 5B8CA 1LWRA 4NUJB 3MLWH 3EJZD 3VE0A 3Q3GA 5IQ9A 3TZVD 4D3CH 4X7SL 4ZFZB 1M71B 3UTSD 1CXKA 4HH8A 3L7EA 1XGUB 4XHQA 2CMRL 5BVJA 4PB9L 3DVFA 4GMTL 3QDGE 3LKOA 1WWBX 4RFEB 1WBYA 5IB1B 5FKAA 3BZFA 5IMMA 3CH1A 3HA0A 4HS8H 3OKKB 4I3RL 1E4WL 2QSVA 2FL5B 2R4SL 3F6IA 1FJ1B 1S9VB 1K3IA 5F1IB 4C57C 4NHCH 5KZCD 5C0NC 5CCKH 2H6PA 5MENE 3O6KH 1JZ7A 1OARH 4P2RD 3QZWB 3SCMC 2QJDA 1ZANL 5E8NB 5KN5A 3IU4L 3OG4B 2VWEE 2WBJD 5L8LB 4QHLB 2X1QA 1UKSA 1R3LA 4YHOL 1ZEAH 5FYLE 1TTUA 4V1DD 3SDCC 1PGRB 5EOQL 5DVOA 3RWDA 3VD4A 1OP9A 1YJDL 5B38B 2P49B 4TSAH 5D93C 4TVPD 2HVJA 4NDMA 2QQQA 3V4UH 1XGQA 1V3KA 1U8QB 4MAUL 5F71A 1MUJB 3M8OL 3RZCC 3K46A 1QFUL 1TJIL 2NTFB 3QUMB 1NBYA 1YEHH 5JW3L 5MI0C 3GI8L 2OJZH 3OB8A 3GO1L 1P7QD 2MHAB 5SWSA 3L6FB 4KJPD 5I1EH 5GS1A 5AG9A 4IBLT 3NBNA 4QNPF 4X6EA 3HI1B 1YEIL 2ESVE 3QDMB 2EIEA 1KUMA 1GC1C 1DVFB 4GRLB 2ZKHH 1BOYA 4LFHD 4L5FH 4HH9A 4Z8FL 4CADB 2L0DA 3O11A 1UKQA 4IJ3B 4LEOA 3TNMB 1E4WH 5JW4R 4K8RL 4QY8B 5D2NB 3P3YA 5TF1H 4M62L 4P4RA 5L2JA 4CN6A 3PP3K 4FMKA 3OKLB 1JHLH 2VZUA 3AS2A 3K8KA 4I77H 2PCPB 1M7DA 5GJSL 3KWWA 4KPHH 3DVNA 4RAVB 4GW5B 1J1XH 4Z0BL 5ANME 3GIZL 4RGOL 3UROR 4BSWB 2UUDK 2VRAA 4XCCH 4G6MH 2YKLH 4TRPL 2OS7A 4PJEE 3IJHA 4FXGB 2YD8A 5HHQB 5CHNA 4Y5XB 5CKAA 3HZVB 3O45A 1KJ2A 2RQ8A 5ETUB 1RHHB 3OXSB 4K23L 3MV01 4K3DL 5DJ8A 5D1XB 5DD0L 4LFHG 2AABL 5DRWA 1YEFH 5ETUA 3D69A 3QDMD 1MHPL 3LKQB 5FV1L 5LJYH 3O3UN 1CQYA 1UZ8B 4E0RB 4G42B 1AFVL 5JHLL 5IKCA 4R4FL 3CUPA 5DVNA 1BVKA 4L29B 1U8NA 5C86A 2NPLX 4CMHC 3BPCA 2GCYB 3LS4H 2B0SL 1TQBC 4Z6AT 3VW3L 3DWTA 5IF0A 2BNRD 3EO0A 4XNMA 1RIVL 4DW2L 1BVLA 5HXMA 1A6ZA 1WVZA 5MENB 4PJHA 4TSCH 4UV7H 1H15A 2GQHA 2XTJE 4HKJB 3PIQB 1B6UA 5IJVA 4P23B 1TETH 5JR1L 3AXLB 1VFAB 1OTTD 1UC6A 3J7HA 4Y16D 1QVOA 1Q0XH 3OHXA 1FBIL 1RZGA 3BI9X 1OF2B 5T1LB 4CMMB 3I85A 4JQXA 1CN4A 1HHHA 1FHGA 4Y4KB 1HYSC 3U83A 3RWGA 1PZUB 1IC4H 5EO9B 3KVQA 3D18A 3LZFH 2H8PB 3BP7A 2MCPH 2E5EA 3T0XA 3GSWB 2YUVA 4FG6D 1N4XH 5DURB 1K5NB 5D71L 3WFBL 2BZDA 5IJKC 2ICWB 4ZUUB 3FCTB 4YDKH 3TF7C 4ODSH 3GSNA 4Y5VB 4JRXD 3BQUC 1D6EB 4PJFA 1QNZL 1J8HD 2VLRD 4YHNB 4LAQL 1I1CA 4OUUA 3NCYP 3OL2A 4XP5L 1IZKA 2E7CA 3MZGB 3TYGL 4PRHA 5L2KE 2AS5M 1HSAA 4K23H 1NMBH 4DKFH 1FGVH 2A83B 2BNQA 3PL6A 1U8LB 4PJGA 4GBXD 1RZ7H 5DRXB 1MCWM 5I6XB 3D3VE 2GITA 1T89A 3RVTC 1YN7A 4FFWC 4TQEL 5MEND 4M9PA 4PGDB 3WS6A 4LNVA 1NFDA 3RWIA 1D6VL 4E41E 5I1DA 3L3JA 4S10A 4TSAL 1KJ3H 3V79C 4PP1D 4S1SH 3UAJD 3OJ2C 3QIUC 5T3XL 4EQ2A 2W9EH 3O2WH 3PWVB 3QIUA 1BFVL 4C4KT 3VFUA 2X4NB 2I5YL 5BS0A 3BKJL 4KVNL 5GXBB 4Q9RH 2JELH 1F11A 2P7TA 4HUNB 1GJIA 1SBSL 2W65B 4LLDB 4X7CC 4RBPH 1F8TH 5CEXB 4LLVA 3O6MH 4LLWB 3MUGB 4XHJD 4E42A 1WTGT 2ENYA 5J89A 4XP9L 1RUKL 4Z77A 2VR5A 4KRLB 2BOCA 1T1XA 4QHUA 3HZKA 3MBEB 3WIIH 4PJBE 1F13A 1NGZB 1TNNA 3NFPA 4X6DF 1LEGB 2DMBA 1RVFH 5DZLA 3TZVB 3UC0H 1DQMH 2EE9A 4PYHA 4YDVB 1DJSA 1OAXH 3VGBA 5DJAA 1ZT4A 2G9HB 3UTPE 5E4EC 4NQSA 4NO3A 1MCJA 3V2AR 2UZIH 5F7KC 1O5DT 3MJ8B 1IM3A 1RFDL 1MH5B 5J13C 4NHUA 5HHMD 4HG4K 1G0XA 1IAKA 2I9LB 1L0YA 4PB0L 2QSCH 4FQIH 3D5OF 1I9JH 2R9HC 4NQED 2ERJB 2J6EH 2Q6WB 32C2A 2CDEA 4GW1A 2I5YH 4MQXC 4KZEH 1LK2A 2CUMA 2WBJB 1KCRH 4GOSA 4ZXBC 4KKCC 1G7IB 1CE6A 3EOYG 3L6FA 4LHUB 3TBYA 4HX1A 1G7HA 3KLAB 4M1GL 5BV7C 1LE9B 2VR4A 1Q9KA 5HI5D 3OXRB 4JHAL 4LKCA 1JWUA 1OAYH 3ILQC 3NZHL 5DUBB 1MLCB 3AMLA 2XY2A 4RWYL 2BVPB 3QDJA 2A9NL 4E41D 2JCCB 3GBMH 4QGYA 3ABZA 1CLZH 2X70B 3O4LE 1OHQA 4Y19A 3V95A 4F7PA 1G9MH 3P30L 4MXWL 3EYSL 1QPPA 5D2LB 5FGBA 3OKLA 3TYFB 3W2DL 3VXUD 2ZCKH 1P7KB 4JFFB 5L2JB 4OZHB 1G6RL 3VG9C 2IMMA 4L9DA 5GGTL 3NIDE 1DTUA 2O61B 3U1SH 1NL0H 5C0AB 4U0RC 3H9HA 4XVTL 1JWSA 3L3IA 3BJ91 4BK5A 3DO7B 3IAQA 2H2SD 3NZ8B 2XFXA 3GMQB 3QQNA 2HRLA 1S9WA 3L7FB 4PUBH 3ARGA 5HY9B 3WUWA 1KIRA 3U7YH 1ZGLM 4MHHI 3PWNB 3GHBL 1NLBH 1AR2A 4WFGD 4HBCH 2DMKA 3QI9A 2D7TH 3NPSB 3QXTA 1U92A 3CVHB 3WXWH 1AD0A 3T04D 1TENA 1EGJH 5BQ7A 1ZGLP 3BZ4A 4IM8A 3RGVC 5FYJE 1DQQB 1MY5A 2DQIH 3F8UB 3V4VH 3EFDL 3VXPB 1BOGB 2VDNL 4APQD 1Y6MR 1ZVHA 5EUOE 3GSXB 3T77A 4UINL 2W9EL 2XG4A 1HCVA 3RWJB 5EN2B 1QR4A 5GS2H 4HT1L 3LKSA 4LQFL 2IFFH 2GFBA 5CD5C 2IJ0C 1OGAE 3QISA 4LQ1A 5IW1A 3RP1A 1G7JB 3VD5A 3T2PA 1R24A 1RU9H 4QCIA 1XFPA 3I6GA 3TYFA 3K1KC 1P5UA 1KCLA 3KNBA 3HCVA 1ORSA 5I2IB 2DYPB 5CGYD 4ODHH 4WI8A 2VKXA 5I66A 3AAZB 1TJGL 4GKNB 5FXCH 3QG7H 2ZCKL 1KPRB 5GRJL 5C09D 5F7DA 1YUHB 4LLMA 3AM8A 1S3KL 4HIHA 3FO1B 2B4CL 3QCVL 3OG6B 2AQ1A 1NEZA 1KC5L 3C5SB 4IMLA 3DX6B 1OQOA 4O2CB 4HWEH 1A6WH 1UCTA 1RZIB 2XWJA 1ZLSH 4DEPB 4S1RH 1UH3A 2YK1L 4OZIF 2AXHA 2X4UA 3O9WD 4NO0A 5FK9B 2VXVL 4RCAA 3H7BA 5ICXB 3SDAC 1MFDL 4DKAA 3SDAA 2R69L 2HG5B 2VLJA 4ODWB 4ZPVA 4Y0GA 1BIHA 4CU7A 1QLRB 4JFED 4UIKH 4ZTPL 5I74B 5TE6H 4PV8A 2FSEB 2JJSC 2GFBB 3QUYD 3MFFB 5GGVH 1U8HA 4PJ7F 4X9BA 3L1OL 2GK2A 3D6GA 4JREC 1WBZB 2ESVB 4NBYB 3EDJA 3T3PF 4P46A 4OLVH 1F6LL 1IGIH 4KJWD 4XRCB 1MHPH 3ES6B 3QDMA 4F7CA 1PEWA 4HT1H 1JZ2A 1DLHB 2P44B 1EEYA 4P3CH 1P9MC 5JHLH 3TBSA 1MRFL 1IGML 4OZHE 1ZGLA 5DD3L 1BBDL 3R06B 3KYNA 4N90D 2F15A 1OCWH 1CR9L 3SGEH 5L9DH 3T0DA 3ULVD 3V5HA 1X4YA 2AAVA 5C09A 1ZA6B 3FFDB 2K9UA 4X6DA 3BRFA 3RJQB 1ODAA 1QLEH 5CBEA 3KPRA 5CEYA 4G6ML 4K7FA 5I15H 2DBLH 1F4YL 5JORB 4H26B 5F7EL 5BJTB 4I0CC 3OX8B 3FFDA 1D9KC 1Y18B 3KHQA 2YSSA 2CLVB 1BJ1H 3ZKND 4PJEB 5T3XD 2X7LB 4NRZA 1FCGA 1CZ8H 5IV2A 5HHOD 5FAAA 3GMNB 1JGLH 2YMXL 2FJGA 2Y23A 3FQUA 1TLKA 4E9LA 2JJVA 5CCKL 4HIEA 3FB6A 5CMAB 4P2RE 4Y5VC 1DBJL 3OKDB 5CZVL 3C8KB 5D7JA 1PY9A 3GSRB 3VFTB 3BSZL 2OXHA 3U82B 3RVWC 1E28B 1ZHNA 4XNQA 2XKUA 3WE6B 1OAQL 3I3BA 1AE6L 3EDFA 2P24B 4L3EE 4A6YB 4MYWB 1PW3A 4UV7L 3C6LB 1OGAB 3HFML 4XXCC 3V5DA 2X9WA 4LSVL 4U1IB 2CR3A 3EYFA 3GEWB 3BD5A 2IWGA 1UB5A 5I8CA 2ICCA 5CGTA 1MFCL 1MCHA 3O3EA 4GKZA 1Z9MA 4HX1B 1DEEA 3KPRB 1TDQA 1YEJL 3FQNB 3IFLL 1RUQH 2VDOH 4PY8J 4OV5A 3LD8B 1U8MB 1LE9A 3MRQA 5I9QB 3M1BB 3V6ZA 2WWMC 3IDNB 2QLVB 3O2DA 3GMMA 2UWEA 5TPWL 1BFOB 5SWSD 4WI3A 1KT2A 4LKXB 1ND0A 4LSUL 1I1YB 1SQ2N 3TPUA 3QJFA 4HMEA 4K3EH 2PR4L 1MFBL 2GKIA 3FZUD 2R56H 4K71B 1HYSD 2ZCLH 4L4VB 3RU8H 1ES0B 3QULB 1MAMH 4JFYA 4X8JA 5DDHA 5CEZD 4JFPB 4DFIA 4MQSB 4OJFL 1IGJA 3D87B 1NGXB 1K8DB 5L8KB 3F5WA 1AC6A 1D9KA 4JAMB 1JHLL 5ENWA 5CIPH 5F89A 4KRMB 5GS0D 5DA0B 1BGXH 2KUTA 1MVUB 2NLJA 3C6SB 3OAZH 1K2DA 3DX6A 2GY7B 4I5BA 1UGNA 2ZOKB 4KZDH 3WIIL 5D1ZC 5KZCB 4LSPL 3RTQD 2B4CH 3WO4B 4RNRA 1NLDL 3WL9A 1V3MA 3HFMH 1MNUH 2R1YB 3TZVA 1XF5A 3U4AA 4D9LL 3EJZC 1U3HC 3MRCA 4PRBB 1RJLA 5HDBE 5C3LD 3P11H 5EU6D 4X5XA 5H94B 3WHE1 1U8KA 4JY5H 4JM4L 5JW4M 3QUKB 3LS5H 5LAXA 4HWUA 3KPSB 1ONQA 1G9NC 1NGYB 3EFDH 1LO5B 2BJML 4KWUA 2R1WB 2WLYA 5DXWA 5A3ID 4KJQC 1IKNC 5D5MB 3MREA 2E9JA 4S0TD 2CDFA 4XCYA 3OGOE 3W81A 5FEBA 1UYWL 2R4RH 1T3FA 4I3SL 4NWTH 5KW9L 1QYGL 3BKMH 2A74B 4MJ6B 4WUUB 1QA9A 3FQTB 4S11A 1MFEL 2EE6A 2QQKL 4YGAB 1EO8L 2HKFH 3O41B 2XZQL 3MXWH 3WIFA 5B38G 3JV6B 4HCRL 3MJ8A 1N7ML 4M7JH 4WI7A 3QIBA 3DARA 1MJ7H 3O6FA 1X4ZA 2EDBA 3MODL 2FGWL 3SY0A 4NHCL 1C5BL 2X4TB 4M7KL 3QQ3A 3D39D 1MFCH 3C5ZA 3VD7A 4N9OB 4O2EB 5C07E 4AMKL 1ZVYA 5HDQL 1F45A 1D5XA 1D5IL 3QHFL 4GG6E 4FQLL 3UPCA 1XF2B 1K4CB 5CJ5A 5ESVB 3FB8A 4LCWB 1LNUA 2NZIA 1U8QA 4AM0A 5TDNA 1E6OH 3AGVA 5CJXA 3BE1L 4D0DA 2ORBL 4JGJA 4S1DD 4F8QA 5EU3B 2FCBA 4MQXD 3VWJA 2CK0L 1XCTA 3ARQA 4OZIA 5JW4Q 5DFWH 3SHSA 3WN5B 3B3IA 4L4VE 4NKMB 3ECBB 4PGDA 1U8PA 5J56B 2Q8AL 4MJ2A 4KHXL 2WBJC 3RBGA 5DD0H 3ZDZE 3S9DB 5HI4D 3KPQB 1WCBB 1J7VR 2NY4D 3F7QA 1AD9A 3PWPD 2NMSA 3SDAB 4HEPG 2BXYA 2ESVD 2J8UF 4LCUB 3MJ9H 2F19H 3KYKH 2KZWA 3QUMH 3RX7A 2WIMA 1FORH 1UZ6E 4LRNL 4PFEA 1KIPB 4P2QA 5E8PB 4M6OL 4XP6L 2EO9A 4X9FA 4LLDA 4OCXL 3RY5A 1NUDA 1BLNA 1GL4B 3ET9F 3VXOA 4YEEA 4HV8A 2NY2B 2BERA 3D0VA 4IIQB 3C9NA 1BQHA 1HHIB 4WHYG 3RL2B 3ARRA 3ZE0F 1TJGH 4TVPL 3QNXA 1GZPB 4EXPX 1VGEH 2APTA 4YDIL 4QOKD 3X17A 2EDJA 3QIBC 1A3RH 1MJUH 4DGVL 4X4YA 2BNUB 1NGWB 2CDGB 1FBIH 1VFBB 1JYVA 3GKWL 5IEHB 5D1ZD 4JFPA 1YDPA 3U9PH 1CXFA 1NGWA 3QHFH 1KJ2H 1CXHA 3BDYH 1G9NL 1Q72L 2A83A 3SKUD 4F9LC 3IFNH 3GBNH 1SJHB 3O3DB 1KJMB 5FGCE 4HUVB 1Q1JH 3A6OA 4CL7A 4OB5H 3OJMB 1BVKB 4L29A 5D1XD 3HE6C 2HG5A 1PG7L 4Y1AD 2BDNH 3L3KA 1UEYA 5T1KA 5C0GB 4ZFGH 1DBKH 2X6MA 4YIQA 4XP9H 5E5RB 1LVEA 4OV5B 4OI7A 3TFKD 3L5XH 4U3HA 2ZWLT 3C5ZB 3HNVL 3HNSH 2M1KA 2X4TA 4Q9QH 3NFNB 2H9GB 4CVUA 2D7OA 1FZJB 1JZ8A 1J5OH 5GRVK 4K55A 5A1AA 2V5MA 3PG2A 1SBBA 4JRYB 1AGCA 4LVHC 4QTHB 3K81A 4LBEA 4PRDA 5CINL 3QUMA 3N85H 1BQSA 4U1SB 3VFUB 1T0PB 2X10A 3H9SE 4PJDE 4OBRA 1IAOB 5FYJU 1MCOL 3JV6A 4X9IA 5IB5B 1CICA 2EEAA 3HLAB 4Z7VA 5I1DB 2EXWD 1PKQB 3JWOL 4LAQH 2HFFA 5E8NA 3O2VH 4HFWB 2FX8H 3VWJB 1S9XB 4PGBB 3QUXB 2J4WL 4L8SA 4OFPA 1DANU 1RZJH 1JZ5A 2PXYC 4J3TA 2HMIC 4XPGL 5T3ZH 5C71A 2EYTB 3S4SA 1JNLH 1J0ZA 3C6LC 4HKBA 3R0NA 5FDWA 1I8MA 3LMJL 1F4XL 4PJAF 2VXSH 5CMAA 1NCNA 4AMKH 2E8YA 5INCA 5T1DH 3TCLA 3LKOB 3MRCB 4UMGA 1CDCA 3U2SA 1H0DB 1U8JB 2NY0B 5E2UL 2VDKH 3B2UD 2XKSA 5CEZL 3L7EB 2V5RA 2C1OB 4KTDH 4IMKA 1T22A 2ADFL 4LEXH 2FD6H 5I1JH 5L6YL 1SM3L 4O5LH 4GAGH 1FSKC 3KYNB 3LQAL 3M8OH 4BFEA 1OF2A 3LH2L 1RURH 2FHFA 3G5VB 4Y4FC 1GGUA 3J8F7 1TCRB 3LPWA 4G8IA 4XWOD 3QQ4A 4GXUM 4R26H 5EO1B 1I75A 1OW0A 5FUZL 1W0WB 3IKCB 5J1TC 3ULVC 2VITB 4JY6A 4DVRH 2W91A 3WO3B 2NY3B 3E1F1 1GPOH 2RB8A 1LE5B 4U6HA 4DGYL 1DBAH 1KENH 4NN7B 3REWA 4LU5L 3FB7A 1S7UB 4U7SA 4PGBA 2V7HB 4RGOH 3RY6A 2VDOL 3QUKA 5LAXB 2HT2D 5GS2D 4F7PB 3MCKA 4FXKB 5TF0A 1IM3B 1RZJL 1TQCC 1G7LA 2VLKA 5DHVA 1RV6X 2X89D 2WBWB 4DKEL 5HSFA 1EXUA 3ZSTA 5E24E 1QACA 1WZ1H 2AEQH 4XP4L 1UWGH 1MUJA 1FQ9C 4X6CE 4M6MH 4BSWA 5CWSA 4KTEH 5GHWH 5BCAA 3LQZB 5F7DB 3NACH 4NNYB 4PB0H 4QRUA 4YNYB 3RA7L 1NFDF 4DN3H 4JLRB 3ZKMC 2A0LC 5DJYA 2F8XC 3FMGL 4QXUH 2HN7B 1D9KB 2E27L 4WFFE 2YBRA 1R5VB 3BP6B 4XBGA 3ALWA 2VXUL 3H9SD 5C0ND 3X11B 4GMSH 3QO0B 2DQEL 1S7WA 4DAGL 1B90A 3CFKB 1Q1JL 2FZ3B 5JQHC 5C0AE 2AV1A 3P4LA 5IR1B 4Z76B 1C5DA 1NJ9B 4NCC1 1G0YR 5HYSB 1JGDA 4UQ2A 4RMVA 3NCJL 4U6HB 5LKNA 1AKJA 2VE6B 1WZLA 4QRTB 3GDBA 4JDZA 1MLBA 4NO3B 2IPTH 4J4PC 5DJZB 4CBPA 3IJSA 3DROB 5CIPA 5DT1L 4GXUN 4S1QH 3BGMA 3LB6C 5FYKL 3DGGB 3P4OB 5JNYA 4H26A 4JFDB 4TNWF 3V6FB 3D0VB 4HC1H 4IIQA 3U2SB 3VXOB 4YK4B 3BGMB 1OOAA 4OKDA 2Z93B 2AEPL 5IQ9B 1E4XI 2C1OA 4HXBL 1BEYH 1JN6B 3WLBB 4XZUA 1IL1B 1JWSB 2OXGA 3QEQB 5FV2A 3TM6A 4D0CA 2F74B 3STBA 4WGVB 5D7IB 2EYTA 2XFXB 3GMQA 4TULH 3WXVL 2X1OA 1RZ8A 4MB3A 3NMEA 4QOKE 4NCDA 4F15C 1H3TA 4AG4L 1J05A 3L5JA 2Q8BH 5DJ0B 4X4MA 3RUGA 1S9XA 1T1YB 3QIUB 2ICEB 5CFHA 1AGFB 4HXAH 1BZQK 5H2BA 4PRAA 1FPTL 1VSCA 4GAFB 1FIEA 4NSKB 4WHCA 4MA7H 3ULUF 5I6XC 2HFEA 2NY5H 4XBEL 3I2CL 1VKXB 4Y16B 4IRJC 1BZ9B 4YPJA 3G5YA 4ODTL 3IT8D 1F4YH 3BXNA 3G08A 3QQ9D 2V7NB 5JOPE 4P5KA 4E0RA 1NEZG 4ZDHB 5E8PA 3ZE0E 4P59H 3TT1L 5L7XL 2XRAH 2Q7YA 4ZUVA 5D1QB 3OKOB 1RIVH 4DW2H 4F15B 3WKML 2DQJH 2ZCHH 1IC7H 3ULSA 5FUCE 3D25B 1XGPB 1I3GH 1D5ZA 3F12B 2D0FA 4HUVA 4WEUD 1MREL 1T0NB 3BN9C 4PJIF 5EOCJ 3SY0B 1OTSC 4OLVL 1DDHB 1OT1A 5DO2C 3IJHB 4FXGA 4YFLF 1QLFA 2QQNH 4FQQB 3E8UH 1IEHA 2NY5C 4LU5H 1R5IB 3UPRA 4H8WH 4F2MB 3CK0H 1J0KA 4IJ3C 4RAUA 3AY4C 1CD0A 3S5LB 2WWKO 3HNTL 3ZE1F 5DEGB 4V1DE 3UZVB 3QXDB 4L9LC 2EIZA 1JTTA 5HHOA 5IP4A 2C1PA 2VXVH 2D7TL 5D6DC 4FZEL 3BE1H 3MJ9A 3NA4A 4MDIA 4D0DB 1II4E 2R0KL 4IDLA 4BH7A 1DQQA 1KC5H 4OIBA 4ENEC 1YNKL 1VFBA 1AKJD 2BVOA 1VPOH 4R7DA 4CJ0A 4JFHE 4ACPA 1T1XB 2VL5B 3WO4C 3RGVB 2DWDA 1B3JA 3WEXA 2FJFB 3GMLB 4U0RB 3DJ9A 3KDMB 5GGVY 4KJQD 1LO3H 4LOUD 5ISZD 4YR6B 3TO4A 3OKEA 5FECB 2IQAB 4HWZA 1Q0YL 2E7LC 1ORSB 3RVVD 5HGDA 5FA3B 1TJIH 1T1ZA 4A6YH 2BSRB 2DQEH 2ZUWA 3BX7C 4UUJA 5E94B 2DBLL 4HUWA 4MVBD 4D8PA 2DQCL 2VZTA 3WN5C 4QWWD 4GW5A 3QCUH 3EIFA 2XQYG 5IVZA 1Q94A 2VLJD 5L9DL 4ZD3H 3EFFA 2V17L 4L3EB 4UBDC 4YAQA 3GSXA 3T77B 2JCCF 2WLZA 3ARUA 4CW1B 1LP9A 1ULVA 1VADA 1NDGB 4I18B 1DP0A 1DBBH 3VH8B 5I16B 5L88H 3ZTNL 5KG9B 1FC1A 2XA8H 4OUUB 1FZJA 1H3UA 1RZ7L 1G7HB 3S35H 4UIKL 3K1DA 4GG8B 4YUEH 2FATH 1C12B 3UJJL 1P7QB 4OLXH 5DUMH 4AEIH 3MOAH 3TYGH 4WW2B 2X09A 3MLUL 1A6TA 5EU5A 1KN2L 5EA0L 3DO7A 4P59L 1PYWB 1DQLL 2Z93A 3TVMC 3ZDXF 4X80H 5KVGL 1BZ7B 2X42A 4PS4H 1J12A 1G6RA 3PGDB 4PJ7A 1S8DA 4MA3A 1EHXA 4ONOA 3O3EB 1TNMA 2MCPL 5GGTA 1AI1L 3NGBC 3VWKB 4OD1L 3O6FB 2X1WL 4KAQL 5C08A 1HILA 1Z6JT 3P77B 4YWGH 1TZHB 5DMYA 4XVJL 1LO2H 2VABA 1U8IA 3QPQC 4NKDB 3MR9B 5HHXL 4LSQL 3S5LA 4OZFG 1ZLVK 1OT2A 3WNOA 2QHLA 1MHCA 3P9WB 1J88A 1JPGB 3SPVA 1MFBH 1GZPA 5AYUH 3RVVC 4XGZA 1KCKA 2RJMA 1U8HB 3KPSA 5F70A 5BVPL 3S98A 4GMTH 2L7JA 5K9KA 3O6FC 1M05A 4Q7DA 2WUCL 3A0OA 1INDL 4EUPB 1PZ5A 4LPTA 1QEWB 4WENB 3UDWC 4LCCB 5TQ0L 2GJZA 4MVBC 3H42H 4WWID 3FQWB 3WEXB 1OL0A 3QEHA 5DRWB 4APQA 3QIBD 2FBJH 5SWQB 4ZYKA 3LRGA 4L8SC 4KH2A 2CGRL 3SQOH 3GB7B 4P9ML 4XNYH 3ZYOA 1X4XA 5I8CB 1HYRC 4K7FB 1WC7A 1TFHA 4X7TB 2X4NA 1B88A 2YUZA 5ADPL 3O8XA 4GLRH 4JB9H 4K94H 3RWFA 3V7AE 4DCQB 2DRUA 3MNWA 3C60D 1HSBA 4FZEH 4ZSOB 3FAXA 2EDWA 4I48A 3QWQB 4PJ5D 3LH2H 4GAJH 4RZCB 4OLUL 1F42A 3I50H 3NFSL 1TZHA 1CTOA 3B2VL 2G75B 5ACZA 5TDNB 1P4IL 4P3DA 1QBAA 1ND0B 4U05A 3IDYB 5DDHB 1TTFA 4GFTB 3BOVA 1IFHL 4LCWD 1V5JA 3B6SA 3V52L 3MJ7A 2BDNL 1N26A 2DQGL 1HHGA 4JR9L 2Z8VC 3ROLA 2FYYA 4P2OC 2JE8A 1B0GA 3HZMA 5DO2D 3N9GL 1ZSDA 4PTUB 1A6VL 2BHUA 1DLFL 2B7DT 5KSUA 3SJVA 2DTML 2H8PA 4GKZB 3TV3L 5DZNA 1BD2E 5C09B 2YMXH 4YDIH 5FCSH 3SE4C 5L0QB 4DKEH 1QRNA 2R2EB 1MCWW 4RAHA 4RWHA 3ULUH 1NDGA 4QHLA 3EGSA 1QSED 4NKQB 1S9WB 4PGEB 1A7QH 4R9HA 1JGDB 4UQ2B 2DIBA 4IRSB 3SCMD 3S4SG 1NUNB 2DYPA 4XNQB 4N0CD 4RMQA 1MRDL 3E6HA 4YHIB 2CJUL 3OTTA 4XPBL 5DVLA 3EO9L 4MB4A 4UILH 2GJJA 4DQOH 2CDFB 4KQ3L 1F4WH 2AXGA 4ZFFA 2YBRB 1FNLA 1F2QA 4K71C 1AQKL 5IMKB 4NM4H 2QADD 4TULL 4H5SB 5HI3D 1UXSA 3RJDA 4AZ8A 1AXSB 2YKLL 1GAFL 4PJFB 1FJ1A 2CR6A 1Y18A 5EU4B 3F7VB 3JWNC 3GIVA 3CLFH 1FE8L 3VXNA 2K3TA 3V4PL 1XIWC 5D1ZB 5I9QC 2ATKA 4ZTPH 3O8XD 3VI3F 3PQYE 4ZFZA 2DM3A 5FHAL 3H42L 4ONGL 5BJTA 5GJSH 5IROC 4EIZC 2UZYB 4OAWA 1JFQH 1M7DB 2Y25A 3K2MC 4QXWA 1CXIA 43C9B 1A6ZB 2BRRL 4JKPL 4ZO9A 5MENA 4JQXC 4WFFD 5HVWA 1ZGLB 1K8DA 2XPGA 5JW5B 3WXVH 3HUJA 1DLFH 3L5WB 2IAMB 4MA7L 2NXZC 4X9GA 1EJOH 1RZJC 4JY4B 3D9AL 4ZODA 3JWDC 4D94A 1KJMA 4MS8D 2ZUSA 4XBPB 3BIKA 1SJEA 2Q3AA 5JW5A 1D5IH 1YMMA 3I6KB 2ZCLL 2UUDH 3WSQH 1NFIA 2HT4C 5ACZB 1R3KA 3U0PB 5CP3H 2AJZA 4H20H 4JO4H 2EDKA 3BZ4B 4AQ1B 3GJFK 5BZDB 2VLJB 4ODWA 3UJIH 5EU7E 4P9HH 4LCCC 3O8XB 4XC1L 4U4BA 4XPBH 3DMMC 1L7TL 2XWJB 4K07A 4ZS7H 4GBXA 5ESQB 4XP4H 3P0GB 1BWWA 3DURB 5E5UB 3LHPH 2NY6B 2PO6C 1FGNH 1I4FB 1NKRA 4KQ4H 2P5WD 2R8SL 1KB5L 4Y16A 4MD0B 1KELL 3K4AA 3BUTA 1ZT1A 2GYSA 3C09C 4JPIA 1KPRA 2DTSA 5I17A 3HCVB 1IRAY 3UMTA 3BAEH 1B4RA 5FKPB 3QNYA 1DUYB 4LVOC 1EBAA 1G0DA 1MREH 1RUMH 3FOMA 3V6OE 2XKNB 3QPXH 3WNPA 3HI5L 4OCSH 4PJGE 3NA9L 3LN4B 4PRNA 1F3JB 1W72A 3R8BB 3NGBB 5EIQA 5I8KH 4Z8FH 5L2KA 2YHGA 3I6GB 2VZ3A 1G9ML 3CPLA 1AXIB 2EE2A 4HS6B 4WWKB 4WTZA 2WP3T 5TE7H 1HKLH 1CICB 1NBQA 3HI1A 5GZOC 4PRPD 3TO4D 2C9AA 2CRMA 3FAWA 3EJYC 2C7UB 5EBLA 5C8JA 1KLUA 1LHZA 5HHNB 1BAFH 3GRWL 4GAGL 3LQAH 3CVIH 5C08B 3C2AL 1MFAH 3KLAA 4U6VL 12E8L 1RZKH 3AB0B 3BZEA 2AJXL 5FYLD 4X98B 3CFJA 2EDQA 1MAML 1J9CT 3QXVA 1SHMA 4C56E 3D3VD 3RPIB 4OD3L 3WD5H 1A7BA 2NZ9C 5D9SA 2ADIA 1H8SA 1DN0B 4AH2B 4HF5H 2Y1VA 5FO8A 3HAEH 1P6FA 5H37H 2NY7H 4P57B 4XCEB 3CC5A 1NC2A 5D96C 2F53E 1C12A 1C16B 5EU6B 5GRXG 1YZZA 5KVFL 2FATL 5AEAA 2BY0A 2P7TB 2G5BB 1HHHB 4JRXE 3EYOB 5I1LB 2NW2A 4KVNH 5J1AB 4BKLA 1PQZA 1F02I 4UT9H 3L9RB 2OI9B 1LEKB 2VXQL 4JO3L 3VFOB 3QA3A 2Y5TA 1UQSB 3MYZA 2EICA 1JV5A 4PG9A 2Y7QB 4X4YB 1JPFB 2GK0B 2F58L 5GRUL 4HWBA 5GS0L 2W0LA 2WNGA 3UYRL 1FFPA 2RCSH 4QRUB 1KNOB 4O58H 3BZFB 1DQTA 4YHZH 3MYJA 3F62A 4NJ9L 2RAMA 5DQDH 4X6CB 1CCZA 1LILA 3HE7C 1JWUB 5GRVL 3EJJX 3OKMA 5I1GL 4NGHL 4OFYD 5D96B 1ZE3C 4OM1L 1KTLB 1NDMA 5I71B 2GT9A 3ARSA 3KPLB 3T0EC 4NNPL 3NCCB 2OL3A 4UDUA 2Z92B 1EZVX 1CT8A 5CJOL 4L9LB 1JNHA 1KG0B 2V2TA 1NMCC 4OBSA 3HE7B 3QEGL 4JHWL 4QCIB 1OTUD 2OTWB 1KN2H 4GKOA 3TBTA 3D3VA 3PXHA 5FYKU 3HG1D 3IYLW 3QXAB 3VG9B 3T2NL 1U8OB 5DVKA 5GHWL 4Y19E 3T0WA 1S9YA 3DX7A 3VI3E 2BCKA 3HI5H 2V9TA 1WQVT 1V7MH 5D6CB 1WZ1L 2AEQL 3QQ4B 4N9GB 1A4KA 4GLRI 1IGYA 4FQXD 5ITFB 4G5ZH 5DJXA 5D70H 3S37X 5J6HB 3CUPB 1IKFL 4Y5YA 3NIDF 3WMSA 3LEYL 1BBDH 5K93A 2K7PA 5GISL 3S7GA 3U9UB 1X5FA 1KV3A 4EUPG 4OB5L 1NLBL 3RIAF 3PHOB 2D7QA 1XIWA 4M93B 4U49A 4QYOB 1BFOA 4LVHB 3V4VL 1FN4B 2QADB 3TCLB 5SWZA 1JF6A 8FABB 3PQYA 1CT8B 4N0RA 4PJAE 5IROA 3QWOA 4NC2B 1U95A 4PJ8D 2J1KA 4LSPH 4MSWB 1QPXA 2A9ML 4NUGL 1Z9OA 1RQ5A 2O61A 3NABL 5BMFL 4Z7UE 4U7MA 4AY0A 3KWWB 2ATPA 5KJRH 5HI4C 1N3NA 4P5TC 3PJSA 4XBEH 2FX7L 2NXYD 1XCQA 1YC7A 4HC1A 1N3NB 3TH2T 1VPOL 3QG6B 4RGNE 3ARDD 4YBQD 1QFWI 3MUJA 4NO2B 2I25N 1ED3B 3BPLC 4TUOA 5CLTA 2O93L 3K3QA 1J05B 4P4KC 5IOPB 1NSNH 4ZFOL 4RQQA 1RI8A 2YRPA 4PTTA 4FQPA 3DV6B 3BGFB 5DD5H 2VL4A 3N50A 1FL5B 4RISH 5E8OB 3GMNA 1XIWB 3QR2A 1MQKH 2OTPA 2VWEC 1WTLA 2GTZB 1UWXK 2HT2C 4G5ZL 3SOBH 5GISH 4N5ED 2ADIB 4PJ9C 4PJDB 1F00I 3FQXB 4QHMB 5GSRA 1WBXA 2ITDB 2Q76A 2AKRA 4C54A 3P4OA 1QVOB 3H6JA 5AG8A 3KPNA 1Q38A 4M03A 5C6PB 1CGSL 2AK1H 1FL3A 4OZGB 4CMMA 4MQTB 5C7XL 2C1PB 5C0RL 1EVUA 1BVLB 5CP7B 4G6JH 3U0WH 1PD6A 1EEYB 4PJ5E 5JUEH 3UTSB 1L9NA 3IS1X 2XZCH 4WNQA 5LVEA 4OFDA 1CXEA 3QP3A 5KSBF 5KN5B 1QSFB 5F9OL 4DVRL 4C55A 3TH3T 4XCFL 4AEFA 3LDBC 3QFDB 5EUOB 4ZPTB 5AYQA 3K4DA 4KJYA 5AD0A 5F8RC 4I9WD 3HZKB 3MBEA 3T1FA 1KOAA 2D3VA 3CIQA 4HGMA 2MFNA 5IMOA 1J1PL 3ARPA 3BP5A 3RX5A 1MNUL 4RNRB 2R0WH 2Z31A 1ZT1B 3ALPA 4YXLL 3SDYL 2Z91A 3ZDZF 4Y88A 4PB9H 1CR9H 4RMUA 1UM4H 5C0BB 3KXFE 4PJ8A 4XC3L 1U3YA 4WUUD 3FONB 2QHRH 1N64H 1A9BB 2E9WA 5CSZB 5I30H 1BFVH 5J3HD 4JAMA 1IGTB 4FP8L 4U1MB 4M5YL 2XTJB 3VFOA 2Y7QA 2ZJSL 3MRRB 4UT9L 5I8EA 5FYLL 3VDAA 3SE3A 4AM0B 1FFRA 4NQCE 5GJTH 3WLWC 3IDXH 4O02L 4M9OA 1KXVC 3AS3A 4WHTB 1OSZA 2X41A 4KDVA 1CFTB 1TCRA 2Z35B 3I02B 3U1SL 3ZLQC 1S7RA 4YHYB 3EYUL 5E2VH 5DLMH 3BWAA 3CDGB 2C4FU 1S7TB 4OF7A 4E5XB 3DROA 5IWLC 1WT5C 3SN6N 3MRBB 3ZYIA 4AEHH 4PJ7E 1CDBA 3RWEA 5KAQG 1FH5L 3GBML 2BNQE 1A47A 5D1ZA 4NQEB 3NCEB 1VA9A 1I1AD 1QHOA 3IDGA 4JDTL 5TGBA 1OSPL 2CIIA 4FN0A 4JG0L 4OZFB 5IW6B 1RUML 2VDKL 1I8MB 2Y6SC 3HRPA 4HQQL 4K3JH 3WFDH 1VEMA 4R2GC 5E4EB 3BAEL 3MRLB 3S88H 3IF1A 2HRPL 3D85B 3X12A 1KCRL 3GK8L 4LLQB 2XKNA 1ZTXL 1EVTC 4S2SA 4WW2F 2BVTA 4WTWA 3PHSA 1N6VA 4POYA 5KVGH 4YX2L 4PJEA 1IKFH 3H7LA 1G7PA 1A4JA 1QSFE 3JXAA 3ARYA 2AI0H 1A14L 1PG7X 1OGTB 4KKBC 3GGWA 1JF1A 1GPOL 4PJBB 3O81A 1ZHKB 1GGYA 1RY7B 2ZUVA 3QRGL 1WBYB 5HHQA 3T0EA 5CUSL 1CDUA 4MD4B 3ARXA 1EPFA 2VDQL 4GAYA 3TNNA 1CVSC 4MA8H 1KCUH 5DMKA 4FXKA 1DBBL 3TA3D 5IHUL 4Q9QL 3IXAA 4PRPA 3MRMA 4O9HL 2WINA 5ICZA 1QNZH 4R90L 3S6CA 3CFBA 1B6DA 1EFXB 2XWTB 5BO1L 1UKTA 5L2KD 5D71H 2HFGL 3IGAB 1TVHB 4FA8A 3S34L 3O11B 4LEOB 1OWWA 4HMDA 3FFCA 1QFWL 2EH8H 1FNHA 2IAMA 3U6RB 3HAEB 4MXVF 1MFDH 3H9YA 2VQTA 4JRXB 1KJ2L 1IC1A 4RGND 3GJFA 5EOCH 4AENA 1YQVL 1NSNL 3UJTH 1H3PH 1AD0B 3B9KD 3C5ZD 3RQ3A 5JR1H 4Y5YC 5B8CC 4O58L 1WFTA 1U8OA 2OZ4A 5LGHH 4W4NA 5HHXH 4AJ0A 2NTFA 1MPAL 2APWA 1I1AC 1PJ9A 2V6HA 4LK4A 4EN3A 3QNXB 3OGCA 2V5YA 3ARDB 3RL2A 5JPNA 3WBDA 2ITDA 2PO6A 1DQJB 3FQXA 1AP2B 1B4JL 2BOCB 2R9HD 3PWPB 4LSSH 3SDAD 4XX1E 1AXSA 4MAYB 2XNAB 3HN3A 3T3MF 3OR7B 2R2HA 3CH8A 3QH3B 5C07A 5KS9B 1FFNB 1KTLA 1NDMB 4JZJA 1UACH 5DSCA 1YMHA 4CNIA 1HEZA 4LLUB 2X4OA 4QRSA 3K8MA 5SX4H 3PWLA 1E4KC 1AR1C 1PLGH 5E5MA 4PJIB 4M7ZC 5C0DB 3LKRB 5HGBB 4HUUB 3IFOA 1IGIL 5IVXF 2VAAA 2XWBA 1A7RH 2UY6A 4XP1H 2CKNA 4IIQC 1Q9WA 3KPSE 3PNWB 2ARJQ 5HGHA 5HYQA 2LE9A 1ZLUH 5C0FB 1B2WL 4OZIE 1I3GL 3ZSSA 1Z0NA 1CL7H 4JFQA 1BAFL 3CVIL 4BKLB 1FL6A 4DAGH 1J1XL 5D1QC 4Z0BH 4MXVE 5KSAA 1OARL 3EYVB 4DEPC 3ZDYF 3CDGA 2B1HH 1QFWH 2V9QA 3UJTL 5C0EA 4XXDB 1MF2H 5GQBA 5FCUL 1M71A 3S37H 5F96H 5IEKA 2I60L 4NRYA 3VGGA 3BW9B 4WUKH 3X3GH 3MCLL 3SGJC 2EDTA 3JUZA 5BRZA 4P3WA 2I07B 3WKNA 1N6UA 2DKSA 1J1OL 1LMKA 4OLWH 4MCZA 4LSQH 3HG1A 5GGUB 4OFVA 4WI5A 2ED7A 1FVCB 4X6CF 5T3XH 1OQXA 5DJDB 4YDJB 1FYTE 2AW2A 3DIFA 4JZNA 1PSKL 3VH8A 5ILTL 2OI9C 3AXLA 4BFBD 4J1UA 3O2DL 4P2OB 4TSBH 2JIXA 4N0UA 3VXSA 3OAUL 4PJBF 5T33H 1OTUC 1KGCE 3IDJB 1JPTL 4HUMB 4PP2B 1YECH 2HJLB 5GSVA 3LIZH 4Y8AA 3T0ED 3O0RL 5J4MA 1PLGL 3UBXG 1A7QL 4ZXBD 4R8WH 1X5YA 4R4BB 1ZANH 4ZNEA 2VSCA 3KPTA 3IFPA 4D8PB 4H88H 5AZ2H 4TTDD 5BVPH 1TVBA 4GW4A 5DT1H 4WWKD 4D9RD 3S36H 1XZ0B 2VLME 4UB0H 2X1XR 1QSEA 4J3OC 1F11B 1AP2A 3ILQD 1FNSH 1HCFX 1M7XA 1RULL 1U8PB 1SYSB 2YRLA 3NACL 5GPRA 3GM8A 1GC1L 2NNAB 4HKXA 4HZLA 4MXQC 5ESQA 3V6OA 1OSPH 4JG0H 2XRAL 5HDBF 3HR5A 1MF2L 3VGDA 1IGFL 4G3YH 4NHUB 4ZQKB 3G5ZB 4M6NH 4QRRA 1NFDB 3RWIB 4MX7A 1I3VA 1XGYL 3C8DA 4R7DB 2PCPA 3B9KC 5C9JB 1TZIB 2VKWA 4ONGH 1NH6A 1YNLL 4UNVA 4Z7VE 3F5WB 1TZGL 2JF1A 1F90H 3IDJA 5I1CL 1CFQB 4LCWA 4BSJA 2IFGA 2NY6D 5I76A 3CXDL 4WTXA 1AFVH 2NY0C 4YEFA 3QNZB 1PQZB 3LY6A 3G9VA 3OSKA 5TE7L 2FECI 5DK3A 3LN9A 2GTWA 5LQBH 3O6ML 2UWEB 1IZJA 5DJ6B 3CC5B 3TA3C 4OFIA 5FGBC 4HCRA 1A6UH 4V2CB 3I6LE 4OLEA 2XY1A 1MFNA 4XCCL 4Z7WA 2YPLE 4GW4B 4ZS6D 3W39B 7CGTA 5K9OA 4KI5D 3FO2A 2J6EA 3CFDB 3FQRA 1UCBL 3MV7E 3OKMB 1N2RB 1D5MA 3MJ6A 5D8JL 5E6IB 3BPLB 4NQXB 4OF6A 1VHPA 2IBZX 4JFEA 1H15B 1KACB 1P7KA 4JFFA 3DMMA 3NOIA 5ICYA 2BSTA 5BZWA 1ZVSB 2D7PA 3LHPL 4WUUA 1MY7A 3VRJA 5FYJL 5T5NF 1N8ZB 5E1AA 1IQWH 1DQDL 3SBWC 1IARB 3DMMB 3UTTA 5C0FA 2VNCA 1CFVH 3VXSB 4DJMA 3H9SB 4NC1E 3QZWG 3C87A 1UZ8A 5JA9A 1Q72H 2R1XB 3MRHA 3VFTA 1GC1H 1AGFA 3KPSD 2GJ6B 2BSRA 3BD3A 4MNQD 5E9DE 4G6KL 1TQBB 2EDFA 4CVZA 1SM3H 4O5LL 5IUSA 4NNXA 3HZYB 1J10A 3VFPA 4P2YA 2V2WA 4PRNB 1D6EA 2JJTA 1S9VA 3N1QC 4LRIC 4Z95H 3JWDL 3CSYB 1KTDB 4JREB 1T66D 1EMTH 3PWPA 4Q9CA 1F58H 5E7BA 2FWOB 2KKQA 3QQ9C 2H2PD 4Y89A 4TYUA 1AIFA 4CMHB 2UVFA 1QKZH 1UH4A 4F7EB 4Y1AE 2A6KB 2DD8L 1C1EH 3QB7C 3VFNA 3MCG1 1TITA 1BM3H 1FNAA 4JDVB 3ZE1E 5F3BA 3WFEH 2H26A 4R0LA 2IMNA 4N8CL 5GGRY 3MLSH 1SBSH 1S7RB 3W82A 2D31A 4LIQE 1CICC 3ARBC 4YXKH 3TJHD 3RFZC 2EC8A 2EIZB 1CWVA 3WHXB 5J6GA 1DANT 1RU9L 1FV1A 2QQNL 5I15L 1CU4H 2GEEA 4K7PL 1WWAX 4N0UB 3C09B 4GSDH 2FNBA 5C9JA 3B9VA 2F54D 2Z4QA 3UPRB 3BP4B 4FZ8L 4U7KA 4PGZA 5DR5H 2A6DB 1YA5A 5JOEA 5J7CC 2OCFD 4MNQA 1JTPA 2OTWA 3L1OH 4P46B 3T65B 2RR3A 4KMTH 3BIKB 3O4OC 2DB8A 4X6DE 4TNVF 5BXFA 3ULUL 5AZEH 4P4KA 4I48B 3KG5A 3VFWB 4MMXC 4Z5RA 3MRNA 1CI5A 5IB4A 1KJ2B 1OAZL 2H2SC 3HZVA 2F54E 3IETA 2DF3A 2A6JB 2OYPA 2C4FT 3UTOA 5E4IA 1PG7H 5F44A 2WQ8A 2WQRA 3N0PB 4R7NA 1EAPB 4UAOC 1WCQA 2NY1D 2I9TB 1BD2D 4F9LA 4LVEA 4FQ2L 1KIQA 3DETD 3R0MA 2X4PA 1HINH 2DL2A 4RRPG 2IPKB 2CIKA 3VXRE 1I8IB 3LQAC 4R4FH 1RVFL 5D2NA 3UC0L 1I85A 2YD1A 4PS4L 2QSTA 1FO0L 4PBWD 4P2OA 4R90H 4M8QB 4EJ1C 2AJZB 1P1ZA 4U33A 5EORL 1L0XA 4CN1A 4PV9A 4MHHG 2DLIA 5JOPD 1CLOL 3QAZB 5ALCH 5E08H 5I8KL 4Y2DB 5ACMA 2IBBA 1ZMYA 5DYOA 5DSCB 4YXHH 5M95B 5D7IA 4R2GB 1N6QH 1CD8A 3EYQC 5L88L 2VITA 4JY6B 4K7PH 3DGCR 4ZMAT 3GSVA 5JXAH 5E2WH 5F7FA 5AZ2L 5JORA 4NQXA 4OD2B 4YLQT 3EGSB 3DYPA 1I9RH 3HC0A 3P40A 5BV7L 4ODUA 1FZKA 2OL3H 2Q76B 1RAMA 2DQJL 1MPAH 4G7YL 2EDXA 3VE0B 3V4UL 2K7QA 5J06A 3T4AA 4FQHA 2AJUL 3OV6A 1F6AB 3SJVB 1URLA 1NMBL 4D9LH 2NY2C 3FO9B 3PDDA 1S9KC 4Y1AB 3WFEL 1MWAH 5EZIH 4ODBD 5IIEB 1X44A 2A2QT 4L8BB 3IDMB 1CGWA 1UXSB 3HMWL 4XVTH 5C0AA 1I7TA 2WW8A 3EO1B 5CBAB 5IQ7H 1JGEA 3P11L 3QEQE 2FX9L 1KCSL 3T3PE 4F58L 1HEZB 3BH8A 3P0VH 4NJ9H 5FHBL 3I50L 3PWUA 4PJIE 4ZSOE 4M7LH 1V8HA 1HDMA 1QFPA 5GGTH 4DZ8A 3MRRA 1WWCA 3P4NA 4JPIB 4P5TD 3S3PA 3FO1A 4HDIB 4XMLL 3R1GL 3HLAA 1BECA 1KBGH 4KZDL 1YUHA 4WV1C 4HUWB 1A1NB 4JFZH 1RPQA 3BEVB 3MUZ1 1UB6B 4PJAA 4APQC 5C0BA 4U1SA 1P6AB 4B7IA 4KXZI 2YA2A 2R2BA 3VMNA 3FB5B 3HNTH 2DQTL 3MBXH 1M7IA 2W0PA 5E0QA 2EYSB 2Z35A 1ZSDB 2CO7B 3I02A 4ZOBA 4HWBL 2PN5A 4JRWA 4LPVA 3PHQB 4P4KB 1SYVB 1AY1H 5KSVB 5E6IC 4NQCB 1I7TB 4ZUWA 3LV3A 3W9DA 4JJ5B 3O6FD 3PHQA 1U3HA 1CFQA 2H41A 4MA1B 2XACC 4DFHA 4HHAA 5EORH 1NGQH 4YFLI 3QCUL 2E6QA 3ZTNH 5T33L 4G7VL 3HS0A 3L3HB 3LQMA 1FLTX 4R97B 4ZTOH 4MX7B 5E2UH 1K9TA 5KVEL 3CJJA 1ZHBB 2H2PC 3P0VL 5D2LE 1B0RB 4FQQA 3SE9L 4EBQH 4Q2ZA 3NPZB 3PUCA 5DF0A 3U0TA 1NAKH 3D0LA 1B0WA 1HKLL 1N59B 3NABH 4J7RA 4NQEE 1ZWIB 4LMQI 3QPXL 1DQML 4OF0A 4IRSD 3SCMB 3B8YA 4HKZA 1WFOA 3K74B 5F1NA 3CCHB 5SX5K 3AS0A 2WUBH 1FNSL 2EIDA 2CKBL 2HTKD 3FFCD 4KKNA 3UTZB 4OTXH 1K3ZA 1QR1A 4QRRE 2YD5A 4H0IA 4HS3A 4R97C 3PWVA 1EH9A 3IDMA 2ADGA 4TUOB 4U1LA 4IHOA 2DDQH 3MLXL 5BOPA 2P47B 4QXTA 1HXYA 2EKSB 2HVKA 1RD6A 4KI5C 2BMKB 4XPAH 1NFDE 3H2WA 3BRDA 2XWBB 7FABL 1UWXH 4TQEH 3QCTH 1U8LA 4J12A 5HYJD 3ARFB 5J1AA 4NZUH 2GITB 3U79A 3VFRA 3MACL 4LHUA 3TBYB 5E95B 3S36X 2CD0A 5BS0E 4OZ4A 3PXJA 3T2NH 1MRCL 1SEQL 3T0EE 4POZD 4QHMA 5GSRB 4P9MH 2XTJC 4PY7B 4IMKC 3P9LA 3RKPA 1WAAF 2I07A 2SEBB 1UENA 3GBNL 3O9WB 4NOFA 1JN6A 1XF3B 4NC1C 3RIAK 4FQ1H 4XVSL 2NY6C 3GSWA 3U0TB 2WSKA 4QTIL 1IM9A 1VFMA 3MXVL 3B9KB 4WRLA 4IRJA 2GTWB 4P49A 3RAJL 2JK5A 3JV4A 3GUTA 1FVEA 4ZAKA 2BRRH 4JKPH 3BUYB 4NGHH 3NIGE 4NQTA 4BZ2L 2ID5A 5I18L 2BNRB 1AO7D 5F7WC 3OJDB 5EU7C 3QFJE 1X9QA 2C7UA 5EBLB 3UTTE 2VE6A 1HKFA 2AV7B 4HFUH 3WDIA 4H1LA 4PRID 5GGSY 3VXTB 1XH3B 4LCIH 2WIIB 2NXYB 2VH5H 3QJHA 1PDKA 2G5RA 5CJBA 3QEQD 2FX8L 5LGJB 1LD9A 2MNUA 3IVKB 2DQGH 5IVXB 4WO4C 1EUUA 2W0FB 5HJ3A 2P45B 1FORL 3DXAB 4LRNH 3PGFH 4PD4J 1J0HA 2RGSA 3IGAA 3VJ6A 1MWAA 3TA3B 4ERSL 2Y6SD 3D2UB 5C2BH 2EDLA 2Z31B 1HNGA 2A6JA 4GBXC 2LAGB 1T2XA 1MELA 1NGYA 4PJXF 2CH8A 2EDHA 4GG6B 1J0YA 1MHHB 1M7IB 4FFZL 3EDDA 1N59A 1DVFC 3BT2H 3TBWB 43CAA 2V2WB 1WCBA 3KLHD 3PP4H 1H8NA 1QRNE 3I84A 1ZLSL 4Y5XA 3BDXA 4NCC2 4FMFA 4NZUL 5IBTL 3B43A 1INQB 5L8JB 2DJSA 1FFOA 3QDJE 3RGVA 1QRKA 1EX0A 2AXFB 3WIHL 1WISA 2YPVL 1T83A 4LSRH 4OZIB 1RURL 4D9QE 4U1NA 4U6XB 4BFGA 4E41A 4RMWA 3C5JB 1LQSR 3DNKA 4OQTA 3STZA 4JFXB 4KKLD 2M26A 2W92A 2OQJA 1XH3A 4JM4H 4Z0XB 2UY7A 1N0XH 4RBPK 1QSFD 4ELMB 1QOKA 2DOCA 5IMLA 1RIHH 4K94C 3D2UD 4YDJA 1TVHA 1RUPL 4BZ2H 1BQLL 1U95B 2F9BT 4R96B 4WV1A 3MO1A 3NN8A 4LLAA 3T8XA 3GSOB 3Q5OA 4OZHF 2YXMA 3P0YL 1ORQA 1J11A 1CS6A 1HZHH 1JNHB 2VAJA 4IDJL 3T0VA 5ADOL 3F12A 3MBED 4OCXH 3GSOA 4PG2A 3LPFA 3DSFH 3O9WA 1DBML 5BRZE 4QRPA 5FF6B 4ZNCD 1GGCL 5TE4H 1YJDC 4RQQB 1JNNL 1N7MH 1R3IH 3T0EB 3O2VL 4CDHA 1TQCB 5KG9A 3V0WH 5IFAH 3RL1A 3BWAB 3O8XC 2HKFL 1CGTA 1VESA 4PRIE 5EZJB 4KXZH 4OM0L 4N0YH 1A4KB 4HHAB 1O7SA 3VGHA 2XTLA 4JKLA 4I2XE 1I9EA 5IBTH 1U3HB 3SGKA 1ZEAL 4J3XA 4OQ1A 1U3ZA 1UWEH 3BKML 2HVKB 3FTGB 2QL1A 2ATPB 2P24A 3LN5B 4U1HA 4XH2B 4YGVB 1A14H 2OMBA 3P9MA 3TBTB 2X4OB 1A64A 4KDWA 4CN4A 3N06B 1FC2D 4H8WC 3KYOA 1YMMD 1JIBA 2W60B 4NQCD 1ZTXH 2E9IA 1N6QL 4HJJL 2NW3A 4UT6L 2C3GA 1HH6B 4M5YH 2B20A 4JPVH 4FTVB 4PREB 3TN0D 5I1GH 3QT2A 4XB8A 3CH1B 4PRDB 1UVQA 4U1KB 3ARBB 5CWSB 1W72H 3P73B 4AYFA 1XGUA 1DSFL 4Z18A 3WS3A 2VB5A 3ARDA 3P4NB 3L3HA 4NRXB 5ALBH 2EDRA 1JHKL 4YO0A 5E8EB 4V1DB