2HRLA

Siglec-7 in complex with gt1b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
116
Chain Sequence
DYSLTMQSSVTVQEGMCVHVRCSFSYPVDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Sialic acid-binding Ig-like lectin 7
publication title Siglec-7 Undergoes a Major Conformational Change When Complexed with the {alpha}(2,8)-Disialylganglioside GT1b
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrlA00
1FGNL 1WISA 2WINA 4MDJA 1T21A 3RY6A 3QO0A 5C9JA 1I9EA 1RUPL 4WUUA 1A0QH 4QHMB 4Y4FC 1F6FB 5E94A 2XZQL 5J1AB 4FZEH 5CZXC 3QR2A 5D1ZA 1BEYH 1MRCL 1P7QB 3EBAA 3R06B 1I9IL 2PXYA 4APQD 4ZFFA 1G0DA 4HZLA 1R3HB 4P57A 4ZS6D 1ZA6A 4Q2ZB 1INDL 5SWSB 4DEPB 4JM2A 3HPJA 1F97A 4O5LL 2HTLD 4X99B 3CU7A 1HN1A 2DS4A 5DGRA 3DVNB 1N0LA 3L5HA 1ZA3A 3BKYL 3SKJL 4KQ4H 4X7EC 4NRYA 5KSUB 1KN2L 3BGFB 4CVUA 3NCJH 4RFNB 3VXMA 4U1KA 3S3PA 2FIRT 3HC0A 4JRXE 3DGCR 5D1QB 3ARGB 1LE5B 1QLRA 5HYSG 4JFXA 2IPUG 4KJQC 5IHZA 4WI6A 5HGHA 1SMAA 3TZVA 6FABL 4DGYL 1GIGH 3IAPA 1XGQA 4QXTA 4LSQL 2NX5D 1JRHL 1LO5A 4TULL 2VDNL 1DL7H 2NXYB 1PAMA 1OGTA 1JPFB 5CUSL 3HG1E 5T1LA 5C0CE 1VADB 3QULB 2VLKE 2XN9E 2K7QA 1WWWX 1XEDA 2R0KH 3ULUL 3MA9H 1FG2B 5IEKB 1G6VK 4QHMA 2OLDA 4XCFH 3BIAX 1R3IH 5J1AA 4JRYB 4Y16C 5IUSA 1TPXC 2QHRL 1P7QA 5C2BH 3WIIL 3L1OL 1UFUA 2XRAH 3R06A 4FQLH 2V9TA 1R3HA 3EYUL 3RGVD 5SWSA 4Q2ZA 3LQZB 4OTXL 1D7FA 5DFVC 5IT2L 3ROLB 4X99A 3W2DH 3MV9B 2YA1A 2D4FA 4UB0H 3DVNA 1CXFA 1KTRL 2O26U 1OAUH 5KVMC 4YEFA 1R0AL 4NBXB 3P4OB 5AAWA 4MDIB 5KSUA 3I84A 1RY7B 4XT1C 4RNRB 5TDPB 4WHYG 2EDEA 3W0WD 3SKOB 3CUPB 5D1QA 3ARGA 3STZB 1SY6H 4F7CB 5C7XH 1LE5A 4MAUL 4UOW0 4PFEA 1TCMA 1IGIL 4HXBL 1AXTL 3VI4E 3W82A 2UWEF 4MYWB 5MEOA 1B4RA 3U7YL 3FT4B 1I9JL 4U7MA 1A4JB 4EI5C 1TJHH 3PWPE 1JPFA 5TE6H 4P5KB 4CU8A 4XPTL 4OUUB 1VADA 3K81A 3QULA 4LQ1A 1MCPH 3CDCA 3Q6FB 2ZUVA 2BNRD 2AW2A 3DROB 3P4MA 1FG2A 5IEKA 4PRPD 3H9SE 2C3GA 4HBCH 4NSKB 1Z6JT 4Z9KB 4JRYA 1WEJL 4MB5A 4G8EB 4AMKH 3MRDB 5CZKA 2MQCA 1B90A 1HYSD 2ZPKL 3S5LB 3ZLQC 2VN7A 3KJ6H 5F9WC 3LQZA 1SJXA 4PV8B 3ROLA 3ZDZF 4I0PC 1RIVL 2QADD 3MV9A 1G0YR 1QBBA 5I1GH 5D93B 2WAHA 3WMSA 2YN3A 3ZL4L 4AENB 1RVFL 1UWGH 4GAJL 3P4OA 3DRTB 4MDIA 1BGXL 1KACB 4RNRA 5TDPA 1NC4B 3IF1B 5GRZA 3GJFH 3SKOA 3CUPA 4KJPD 3STZA 4F7CA 5I1IH 2XXCB 5HD8C 3D2UD 4ZXBC 1IC5H 4Y19D 4IRZL 1UA6H 3MCLL 2A0LD 1H3UA 1CF8H 3FT4A 4JO4L 1A4JA 4HH9B 4P5KA 5L88H 4H1LG 3CVIH 4LEOB 3AUVA 4OUUA 5FM4A 2J5LB 3BHBB 4Y4KD 3Q6FA 5C0ND 1GC1C 1AFVH 1NCCL 4ZPTB 3DROA 3GSNH 4LU5L 5DRZB 5SV3A 3TPUB 3ARUA 4P4KB 5T3ZD 1WVZA 3RVTD 4YHKH 4J4PD 3WDIA 4NSKA 4LGPB 4LPYA 4KAQL 1ES0B 4G8EA 1CS6A 5C08D 3MRDA 43C9B 4P0DA 1EVUA 1YEKL 4O9HL 3S5LA 2ICWJ 3ZSSA 4ODTL 1PY4A 3LD8B 4PV8A 1FYTD 4X9HA 1A6WL 4FQXB 4AENA 3QPXL 3LIZH 2WWKT 4YHMH 1XGPB 3MLSL 5HGGS 5I30L 3DRTA 4OF7A 1ORQB 4IJ3C 1IZJA 4XVJL 1L0QA 1NC4A 3IF1A 5CJOH 1PD6A 5E9DD 3SKMB 4ZPVB 1O5DT 4YFLI 5ESQB 3PQYB 5DMYA 4IRSB 4FOMA 1U8PB 2APTA 2CXGA 3S36H 1TJIL 1RZ7L 3TBTB 5BS0E 3WFEH 1R5WB 3FAWA 5BRZB 5F7WC 1OW0A 3G5XB 4HH9A 5IHUH 4L3CB 2C5DC 4RGMC 4JM2F 1T7WA 4K3HA 5ILTL 3MODL 3KLDA 4LEOA 1KCUH 4K2UL 3BHBA 3HMXA 4JFED 4ZPTA 4X4ME 5ID0B 3WFDL 3TPUA 4P4KA 4U1GB 1AGCB 4M5YL 2B1HL 3QDMB 4IM8A 2FL5B 5F1SA 1XCTB 1I4FB 5C92A 4XHJD 1MFBH 3C6SB 1JIBA 4JJ5B 3LMJH 4JQXA 5DVLA 4M6NH 4GT7A 5GRVK 1AGFB 1ES0A 3GK8L 5EO9B 43C9A 4LIQH 1OAQL 4WY7L 5FV1L 1TJGL 4PB0L 1NFDE 4XNQB 4YK4B 4XAKE 1YYLL 1DQMH 5H8DA 1B3JA 4OZIE 1RULH 2IWGA 3CFCH 4KROB 4RMUA 3UJJH 4JCLA 3K0WA 2R8SL 4FQXA 2VZ3A 2XY1A 2BOCB 4TTDC 1XGPA 5L7XL 3FQXB 2XWJB 1JNLH 1ORQA 4H20H 3L3HB 4OM1H 1T66C 4A2MA 3NA9L 3ETBF 3SKMA 3MGAA 4ZPVA 3RY4A 3PQYA 4JCMA 1G7HB 4IRSA 3C5ZC 3TN0C 1U8PA 3HMXL 4XNZC 4JZJC 3FN0H 1OD7A 3TBTA 4C57C 1OTTC 5BRZA 5DWUL 3GGWB 1TETH 2CGRH 3G5XA 4S1RL 2EDYA 4L3CA 4NWTL 1TFHA 3MNVA 1AKJB 5FM8A 3DVIA 5J1TC 5IK3B 4MS8C 5ID0A 2QSCL 3HA0A 5L2JB 1AGCA 5IR1B 3QDMA 1NEUA 4O02H 2FL5A 4RISH 1AQDB 3RA7L 1XCTA 5GRUH 1I4FA 1YDPB 3C6SA 3A0OA 4JJ5A 4JGUA 2XPGB 5F70A 1F3DJ 1AGFA 4EZMA 1CI5A 5F6IB 5EO9A 5KSBB 1EGJL 2DQGH 1MCCA 3HHRB 1CD8A 5AYUH 4XNQA 3ZKMD 1QZ1A 4JHWH 5GJTH 5E7FA 3K2UH 1O7SA 1HHJB 4DZBB 2BOCA 1X5AA 1T04B 2V7NA 4M1CD 2XQBL 3FQXA 2XWJA 2P1YA 5I0ZA 5DQ9B 3GIZL 1K2DB 4M3KB 2GCYB 5GIRB 5A3IC 2BJMH 1QSEE 1Z0MA 2R39A 2DQFB 5HHME 5M94B 1G7HA 3UTZB 2FGWH 1YMME 1T5XB 4ZAKC 4UUJB 4BQ6A 1YQVL 3K1DA 1BAFL 3GGWA 4MJ5B 1UXWB 3PHSA 5EZIL 1A47A 1AKJA 4WGWB 5CLWA 2X44D 4LPCA 4LDOB 4P49A 4Z6AT 1JVKA 2L7JA 4LBEB 2Q20A 5IK3A 2ICCA 4DN3H 4TSAH 1M1SA 5L2JA 1F5WA 2D4DA 3SOBL 5IR1A 4Q74A 1UYWL 1T03H 4RWYL 12E8L 1AQDA 1FVEB 4N8CH 1YDPA 4JO1L 2XPGA 1OAZH 4LRNL 5KSBA 3MLWL 2VN4A 2WNGA 3OKLB 4B53A 4FS0A 2IG2L 4CADB 3DSFL 5KZCB 1ZT7B 2H41A 1MI5E 3BPOB 4G6AC 3QJFB 3QDJE 3ZDYE 1CICC 3FTGB 1HHJA 2HLFD 3RWJB 2GJ6B 5BCAA 1KELH 4F15B 3MRNB 1HYRC 4HJ0C 1T04A 4HQQL 1MFAL 2DQHL 4WI5A 1HWGB 3FFDB 4UBDC 4X80H 1EZVY 1SYSB 3GHBH 5DQ9A 1K2DA 1NEZG 3EO9L 5E99H 1J1PH 4D3CH 2GCYA 1INEH 5GIRA 5BV7B 5HYSB 3HE7D 5JOPD 2DQFA 4FTVB 4OSUL 3UTZA 1EERB 3KPSB 1T5XA 3T8XB 1U36A 4UUJA 3BX7C 3NFNB 1OP3H 3EYVB 2AI0L 3MJ7B 3P9WB 1ZVHA 2X1XR 4MJ5A 1UXWA 3RGVB 4JVPA 3U0WH 5JDJA 5FCSH 4KRPC 3EJYC 3LOWA 4LBEA 5DT1H 1CWVA 5I1JL 1ZXQA 1OL0A 3GIVB 5IOPB 4UQ2B 5EOCJ 1FVEA 2HH0H 1QLEH 1ZTXH 4X6DF 3LQAL 3RJDA 1U3ZA 3EDEA 2ADFH 3LKPB 1A3RH 3OKLA 3AAZB 4FFVD 3C8KA 4J23A 3R0NA 3NOIA 3RBSA 5IJKC 3X17A 1JPTH 4CADA 4LPXA 1NBZB 1ZT7A 4ALAH 2DICA 4NC1E 3QJFA 1UJ3C 4IMKC 3PL6C 4H0GA 3FTGA 2YUVA 3RWJA 2GJ6A 3MRNA 2VL5B 5DMGC 2VDKL 2VXUH 3FFDA 1RJLB 3F58H 3RY5A 1SYSA 2BNRB 4OJFL 3N1FC 2FATH 4PRPB 5HYSA 3ARDC 2EZ0D 4TQEH 3GMOB 3O3DB 4FTVA 5M7QA 4LVOC 4Z5RB 3RX5A 3QIBD 2ESVE 1FCGA 2AK1L 3KPSA 3T8XA 2YK1L 4NQSB 3NFNA 5HBBA 1V8HA 3EYVA 3MJ7A 1BBJB 2B4CL 1CQKA 1CR9L 1K3ZA 7CGTA 5T5FL 5D1XC 3RGVA 4F33B 4HV8B 1I3RB 4QTIH 5TQ0H 3KGRA 5IBTL 1MJ8H 1WTLA 2FX9H 3QUKB 5ALCL 5FO8B 4ZO6A 2DQTH 3I9GH 3GIVA 5IOPA 4UQ2A 5EORL 5I71C 3EUUA 2VSDA 2JJWA 3KJ4B 2GFBB 2UZXB 3HNSH 4MNGE 3GKZA 4PG2A 3NCYS 2P5WB 2CK2A 3VXTB 3MV7E 3LKPA 1VEOA 3AMLA 3AAZA 3SDDD 4NWUL 3GBLA 4X9FA 5DF0A 5EU6D 5F7HA 4Z7UB 2HFFB 1NBZA 5EBGA 5BV7L 4JANA 5DZLA 4KWUA 3Q48A 1GGTA 5IROC 2VL5A 3MR9B 3CU1A 1W0YT 3VGBA 1RJLA 5JIHA 4XVTH 3WFCL 4DGVL 2BNRA 3BYYA 1CYGA 4QXWA 4PRPA 1MWAB 1ZV5A 5JHDD 2OYPA 2BFVL 3GMOA 3O3DA 3HC3L 5CEZH 2NY5H 4Z5RA 1L9NA 3VXOB 4TUKL 2OX5A 1MIEL 4NQSA 4HC1A 1BBJA 1TVHB 1ZS8B 2ZZUT 4TRPL 4GJTB 1QRNE 3I3EA 1WWBX 3O6LH 4F33A 4QXUL 4HV8A 1I3RA 3QI9D 3TESA 4H1LB 3SDCC 1FYTB 1A7BA 5E5RB 3EHBC 5FO8A 1YYML 4N9GB 4H5SB 1RZJL 2VYRE 3MLVH 4UTAL 3JWDL 3C5SB 5E6YA 4FQ2H 3NABL 4G43B 1CGVA 1RAMA 3OAYK 1IGYB 2GFBA 4BZYA 5JA9A 1DCLA 1I1YB 1RV6X 2OL3B 1FNGB 2P5WA 3VXTA 1CE1L 2W9EL 3T0XA 3NZ8B 5AZ2H 1AJ7H 1PW3A 3F7VB 4OF0A 2WBJB 1S7TB 1RIUH 3NIFE 3VWJC 4Z7UA 2HFFA 5L2KD 4PBWD 2OTWB 3A6BH 4FA8A 1R3JB 3IKCB 3MR9A 1ZE3C 5CKAA 5K9QI 4HC1L 5DR5H 5ADPL 1H3TA 1RZKH 1MCLA 2IFFL 3EIFA 2IADB 1MCKA 4JY6B 5H37G 4G9FD 1NH6A 2ZCLH 1MWAA 1FVDB 3IU4L 3S36X 1SEQL 2XFXB 3UZVB 1A6ZB 3VXOA 5JLZB 4XVUC 3IJHB 4OGAC 2P47B 5SWZE 3BIKB 1TVHA 2VDLH 5KVGH 3WHE0 1ZS8A 3O6FC 3WNMA 5C0GB 1BFTA 2I9TB 4FNLH 1OPGL 4H1LA 1XFPA 1IEAB 5HHVH 1FYTA 1BD2B 3QH3B 4X6CE 4JB9L 5KSAC 3VMOA 4H5SA 4HUUB 5AG8A 1QBMH 1T2XA 1VEMA 3H3KA 3TA3C 3PWVB 5KVEH 3C5SA 1HHKB 4G43A 3PP4H 3ZTJH 1ZEAL 5DTFB 5EN2B 1IGYA 4NQED 4OFKA 1I1YA 4S11A 2OL3A 1FNGA 1NC2B 2NZ9D 3VFGL 3WHXB 3HCVB 5DK0B 1NMAL 3NZ8A 5JQ6L 5FA4B 3X3GH 3F7VA 5I6XC 4RFEB 3FL7A 2WBJA 1S7TA 5JXAL 5HVHB 2WIIB 3ULVH 2OTWA 4I9WE 2AQ1A 1MWAL 3AC0A 1R3JA 5HHPB 1YEFL 3IKCA 3NAAL 2HRPH 1CXKA 2DJ4A 3MRIB 1IM9D 1MJ7H 3U7WH 2IADA 4LLAA 4JY6A 4YPGB 2ZCKH 2BVOB 4LSVL 4NHCL 4MXVF 1FVDA 2O5YL 4V2CB 4D8PB 3WL9B 1U8LB 2YC1B 2XFXA 4IRJC 1A6ZA 1I8LA 5BMFL 4MLSA 1FBIH 5JLZA 3KYKH 2Y7QB 3IJHA 3HNTH 3OB8A 4K8RH 3BIKA 4OF3A 4KGJA 5C0GA 4QRRE 2DBLL 4GLRI 4GBXD 1OM3L 3O3UN 1IEAA 4U4BA 2OL3L 1BD2A 3QH3A 4OLEA 3UTSE 3MRGB 4DFIA 4HUUA 5JOEA 4HZAA 5J13B 1B4JL 2NY6C 5I1KL 3DSNA 3NCEB 4GO6B 2DQIH 4XMPH 3PWVA 4YX2L 2EDHA 1WBXB 3OPZL 1A02N 4OGYH 3WJJA 1HHKA 3TNNB 4JRXD 3BEWB 3PGFL 5DTFA 5EN2A 2MCPL 3QIUD 5D7IE 2FNBA 3WIFB 3BRGC 1NC2A 1OP5K 3WHXA 2VERN 3HCVA 3OJDB 5DK0A 4KUCF 5FA4A 2JF1A 4RFEA 1TVBB 2WIIA 2EDDA 5I75C 4C55A 5EH1A 4NZUH 3T3PF 2Z8WC 1NBQA 3UJIH 3ZE1F 3B5GA 2BY1A 1QYGH 4Y88A 5HHPA 2P24B 5KJRL 4BKLB 3HG1D 3GI8L 5SV4A 5E1AA 5C0CD 5B8CC 2BNQE 2VLKD 3MRIA 2B5IC 2XN9D 4YXLH 4KI5F 4HAGA 2DLGA 3QCVH 3QPQD 1RIHH 4DGIH 1YEDB 2Y36L 4YPGA 4WFFD 2BVOA 1XF2A 3K74B 4GXUM 1N64L 3R1GL 4HULB 4D8PA 2FX8L 1U8LA 2YC1A 1I75A 2NTSP 4WWID 5CWSB 3CSBA 1OGAE 2Y7QA 3DHJA 4FN0A 4OLWL 5AZEH 4MGXA 1R6VA 5JW3H 4KDWA 1K6QL 5LCVH 5DD6B 4OZGB 1ZSDB 2A1WL 3CFKB 1K85A 1BJMA 4JFFE 4Y8DC 2G60H 4QRUB 3MRGA 3CSGA 4HWBA 1LNUB 4P23B 2HT2C 3PHQB 3BKJL 4Y0GA 4JFQB 5FYKH 4N5EC 1GCFA 2PO6C 5DD3L 3DTXB 4HUWB 5FO7B 4OLYH 5FYLE 3MTRA 5I1EH 4FFWC 3CLFH 3WIFA 4ELKB 1X4YA 4MNQE 4WNQB 3OJDA 2LTQB 5IMLB 1UEMA 1TVBA 3OZ9L 4NIKB 2H45A 4D0BB 1HKLH 5FKPB 3T04D 4AG4L 2OSLB 4P9HC 4Z95L 1E4KA 5GHWL 5T1DH 2P24A 4WEUD 4BKLA 3NVQA 1JP5A 1JPSH 1WT5C 2K7PA 2W0FB 3QCTL 3BRFA 3SKNB 3MYZA 3DUHA 3D6GA 5DJ0B 4YXKL 1YEDA 1CK0H 1NEZB 1S78D 4MZ2A 2WQ8A 2NY0D 4U1HB 3H9SD 2JB5H 1UH4A 1MAKA 4XMLL 4O2EB 1U91B 4NDMB 2YXFA 5GRVL 4HWBL 2DL9A 3GM0A 5JTWA 4Y2DD 3C08L 5LGHH 2BVTA 4YIQB 4U1SB 5DD6A 1DSFH 1PG7W 4OZGA 4Z7UF 5I15L 1ZSDA 3EYFB 3SGKC 1AD0B 1DBMH 3CFKA 5C0IB 3KYAA 3SDAD 5D7LE 2MMXA 4Z7QF 2IBZY 4QRUA 3L3KB 1V7ML 2HKHH 1MQKH 1A7RL 5KANI 1LNUA 4P23A 3UC0L 3PHQA 3AM8A 4OKVB 3SO3B 4K3EH 4JFQA 5HYJE 4MAYB 3TFKD 5JDSA 3DTXA 1TQBB 4AYFA 5FO7A 4Q9BA 3VG0H 4U3XA 4L5FL 3WV0A 1IILE 1H9VA 3MRBA 5CZVL 4PLJD 4ELKA 1ZHNB 3CH8A 4WNQA 4DOHE 3RNQB 5IMLA 4ZQKB 2PYED 3OR7B 4NUJB 4ZS7H 4D0BA 5FKPA 1BBDH 3ZSTA 5D9SB 2EC9U 4CJ1A 2OSLA 5DUBB 1AXIB 3C6LD 3MJGX 4HCRA 3IDUA 1LO0L 1F2XK 2NW2A 3L7FB 1IAOB 2W0FA 1XIWB 3SKNA 2JIXD 1FFRA 4X8XA 4ZD3H 1FNSL 1TZGH 1MEXH 2BMKB 5DJ0A 1NFKA 1NEZA 4U1HA 3GSXB 4MD4B 1YN6A 3HB3D 4O2EA 1U91A 1F11B 4NDMA 2Z9TA 5J11B 3T2NL 2LAGB 3MLUL 5DHVH 4R6UA 1S5HB 3QUYD 4YIQA 4R0LC 4U1SA 4PRBB 3EYFA 1AD0A 4ODBD 3ARVA 5C0IA 5MENE 3QHZH 3TO4D 2NXZC 1LVEA 4KPHL 3L3KA 4TVPD 3K8MA 4QGTA 2EXYC 4FXKB 2Q87A 3ZKQD 1NBVL 4OKVA 4U6YB 4FABL 5DLMH 4MAYA 4P48A 1EMTH 4HKBB 2V17L 4NP4L 3QQ9D 4HCRL 2D7PA 2WWMC 4I1NB 1ZHNA 1P53A 1A6PA 4XPAL 4ZQKA 3RNQA 3OR7A 3M8OH 4KK5C 4NUJA 5BS0D 3QIWC 3CPLB 4P4RB 1LEIB 3LB6D 3VG9C 5D9SA 4EDWL 1JNHB 4B5EA 4JKWA 3P0VH 1A14H 3L7FA 1IAOA 1XIWA 3IJSB 5DMJB 3PDGA 2WV3A 2BMKA 2RB8A 4AH2B 5F1OB 2ZCHH 3WLWD 5F7DB 3GSXA 4MD4A 4Q0XH 3RAJL 3B9AA 1JV5B 1H8NA 1F11A 1MF2L 2Z35B 2YEZB 1HHHB 3S34L 4P3WA 5IFHL 2AS5M 4PJGB 1PSKH 1IGFL 1S5HA 1UM4H 1WAAE 4PRBA 1VFBB 4F58H 4PJFE 4XAKD 3GKWL 5L2KB 1U6AL 4N8VB 5C3TA 1B6DA 3WFBH 4ONGL 4PJAB 1MSPA 1AR1D 4FXKA 3UPRB 4PY8J 4U6YA 4PJDA 1UKSA 2EC9T 3WSQL 3QUZC 4FZ8H 5EWIL 4LCWB 3BQUB 5E2UH 2PUQT 3U79A 3ABZA 3RZCC 3PV6B 2I5YH 4HKBA 4OIBA 1MY5A 4G9FB 4UILH 3H7BB 5HDOA 1PYWB 3GBMH 4ZYKB 1U3HD 4UI2A 2QQLH 2YD4A 1DQDL 5CCKH 3EYSH 4NJAL 2B39A 3WD5H 2BERA 2CUMA 4U3HA 5C70A 4UINL 3QP3A 4P4RA 3CPLA 3TYGL 1G9MH 1LEIA 3VD7A 4WI9A 1BVZA 5CFHA 4WRLA 2I26N 1JNHA 1T6VN 1V3JA 1N6QH 3DECA 3IJSA 3WS6A 3I6GB 4XCYB 3FMGH 4AH2A 1BQHG 1NLBH 3BVNB 4DAGL 3TIEB 4OF6A 5F7DA 2EO1A 4NC2B 1P9MA 4Z76B 1H3WM 1JV5A 4JG0H 2AJYH 2VZVA 2Z35A 4XP4H 3WNLA 2YEZA 1HHHA 4LLUB 3VRJB 3SE9L 5DK3A 2AEQL 35C8L 3PV7A 2AJUH 2JJTA 4PJGA 5C09E 5KVDH 4K23L 5A1AA 1VFBA 3ARED 2R4SL 1F4XH 5L2KA 4N8VA 1ITCA 4BM7A 3VW3L 4PJAA 5L6YH 5CGTA 5D7JC 4Z7NF 3T0AA 3B9KB 3UPRA 3QAZC 1DBAL 3N9GL 1KIRB 4OIIH 4NQDE 4LCWA 3BQUA 3GRWL 4HUMB 3PV6A 4YHLL 2NMSA 2DQCL 1MJUL 2EKSB 5A16B 2AEPH 3S37L 4YQXL 4G9FA 3H7BA 4LL9A 1PYWA 4ZYKA 2VXTH 4K7PL 3IRZA 5HHMD 3TT3H 5L8LB 1FGNH 1DQTA 1YMMD 3BD3A 3FZUC 3GMLB 1RUPH 5DEFB 1BPVA 1ZGLB 2XZQH 5I1AA 2EIEA 1UGNA 4V1DE 1IKFL 1NMCB 4PIRF 1I9IH 2X41A 3DV6B 5E7BA 5JA8B 4GRWE 4BA8A 1INDH 1O0VA 1I7TB 3I6GA 4XCYA 5DQDH 4C58B 2EXWD 4PG9B 4O5LH 5HI3C 3BVNA 3TIEA 2I60L 2NY2B 4M02A 5F6HJ 3BKYH 3SKJH 4JQIH 5JW5B 4NNYB 5J56B 4JRXB 2ZWLT 1JFQH 3MXWL 3QIUB 1KN2H 3FOMA 3VRJA 5E56A 5CKGA 4Y4HC 3RKDD 4QYOB 5I8OL 4FQQB 1C8PA 2R0ZL 3ARRA 1I1AC 6FABH 4DGYH 4Z8FL 4LSQH 3RX8A 1N0XH 3B9KA 1JRHH 2WP3O 3IRPX 1ZLWK 3HG1B 5C0CB 4LLWB 4TULH 1RZFL 1KCRL 2VDNH 4G42B 2ADIB 3OSKA 3ILQD 3KXFE 5E0QA 5CUSH 3UAJD 2EKSA 5A16A 2AABH 4XNMB 4LSRH 1PG7H 3VJ6B 3QFJE 1JYVA 3ZT6A 3FB5B 3U48A 3SJVE 3WKML 3ULUH 3GMLA 3EYQC 1LMKA 5DEFA 4NKOB 1ZGLA 3TC9A 1U8NA 3CSPA 2QHRH 1F4HA 4I2XE 3WIIH 3L1OH 1F2QA 4P2OD 4GBXA 3DV6A 5FA3B 2P5EB 4J1UB 1WICA 2JE8A 3EYUH 4OTXH 1I7TA 5IT2H 4PG9A 3QYCA 4AQ1B 4F7TB 2R0WL 4K8RC 4FFYL 4YHYC 2CQVA 5JHLL 2FJGB 3RIFF 5JW5A 2X1WL 4NNYA 1TVDA 4JRXA 4KKBC 2IBZX 1R0AH 3QIUA 3VMNA 3MLTA 1KPVB 3QG7L 4Y2OA 2X10A 4MAUH 4QYOA 2ARJQ 3N1GC 4FQQA 2GJZB 4NQVB 4GW1B 2R9HC 3KNBB 1IGIH 4HXBH 2NY3D 2P8LB 4N1HB 2H6PB 3PWPB 4FHBD 3I2CH 1CG9B 1SM3H 3HG1A 3U7YH 1I9JH 5C0CA 4LLWA 1RPQA 4PJCF 4GXVL 1KCSL 4YXHH 4G42A 4PJ5E 2ADIA 5IM7A 1FAKT 3J7HA 4XNMA 4XPTH 2WW8A 2NY0B 4YJZL 3H9SB 3VJ6A 5I1DB 1A5FL 2GSIB 3MLRL 4OI7A 3FB5A 2ESVD 3ZDXE 3B9VA 2DLHA 4NKOA 5AYQA 2BRRL 2RCSL 4Y2DB 5ACZB 2ZNXA 2FR4B 2AQ2A 1FFQA 2P46B 2ZPKH 2DLFL 4J1UA 5FA3A 3B5HA 5K59E 3QCUL 5IB4B 4EBQL 5E6ZA 4F7TA 1WIPA 1AI1L 2B0SL 4YZFF 1J87A 5EO0B 3ZL4H 1MCQA 1RVFH 4GAJH 1SJVA 2CR6A 3FQTB 1BGXH 3MV7D 5DJDB 4RGNC 4R4FL 1YECL 1XGTB 1KPVA 4M03A 4N0UE 1D3CA 1JF1B 2BY3A 1ZKAA 4CMHB 4KVNL 4U3CA 3DO7B 2GJZA 1F6LL 4NQVA 2VDPL 4GW1A 3KNBA 5JUEL 4IRZH 2P8LA 1CDIA 3KLAB 2H6PA 3PWPA 3MCLH 3C6LB 1MCIA 2IBBA 1CG9A 2BVQB 2EE2A 2A6JB 5D7SH 4JO4H 4F9PC 2DL2A 2HWZL 1LK3H 4PJ7E 3D5OF 3RBGA 3HZMB 4IS6B 3KAAA 1G9EA 3IXAB 5H35B 2EE6A 3P30L 3H9SA 5I1DA 3NN8B 2GSIA 3I85A 1NCCH 1UWXK 4LU5H 4PJIE 5FGRA 2UV3A 1U92B 4HSQA 1N5AB 4Y2DA 5ACZA 4PJGF 4XXDB 1MPAH 4YBLB 5EUOB 2FR4A 3QUYB 4KAQH 1QRND 1NL0H 4OCWL 2VLJE 3S6CA 5TPWL 3TO4B 4PJAF 1FSKB 1YEKH 4O9HH 2XACC 1OHQA 1KTKE 25C8H 4R90L 4ODTH 4WW2C 5IB4A 3TYFB 3U4EB 4MD0A 1XH3B 4XB7A 4C59B 5E8DL 5EO0A 1A6WH 2DB8A 5I19L 3GO1L 1QOKA 1EHXA 3QPXH 4Q6IC 3MLSH 3RVUC 5I30H 3L3DB 3FQTA 1KPRB 3TH2T 5DJDA 4XVJH 2CD0A 1I3VA 3GMRB 1XGTA 1JF1A 5BS0B 5GS1C 3DO7A 2QR0B 4O58L 5A43C 2W38A 3KLAA 1OSPL 1TJIH 1RZ7H 4H26B 4LSTL 3C6LA 2J88L 2BVQA 2A6JA 5DC9B 3U36B 4YPJA 3HZMA 4IS6A 2JIXA 2PN5A 5FUCC 4Y4FD 1U8OB 1D9KC 3IXAA 3OB0K 5H35A 1C5CH 5ILTH 3MODH 4QWWC 4YDLB 1F6AB 5CZXD 4K2UH 5IFJB 1GPOL 3X12B 3NN8A 3BH9B 3S7GA 3WFDH 4ORGA 4M5YH 2B1HH 5SWZD 1BJ1J 2HT4C 1N5AA 3HZYB 5J6HA 4XXDA 3IFNL 3EDKA 3RUGE 1GGUA 4MA7L 5EUOA 2D7NA 3QUYA 1NFDB 2Y1VA 3MX0A 3GK8H 3H9YA 1E6OL 4WY7H 1OAQH 3GBNL 4TSBL 4OZIB 1ED3B 1TJGH 3TO4A 2Z31B 3K2MC 4P3CL 4PB0H 4JZNB 1QPPA 1YYLH 3U4EA 3TYFA 1KV3A 5DHYA 1I8KB 3VGFA 2X05A 3CDFA 2R8SH 4C4KO 3MGTB 3FB8B 4KJQD 4XAWL 2APFA 5I1HL 5L7XH 2O5XH 1HHGB 1DL7L 4AIZB 1KPRA 2YRZA 1WTGT 3IFLL 4DKEL 4JFHE 2XQYG 4KRMB 3GMRA 3ZE0E 3NA9H 1L9MA 1JN6B 4XMKL 5BS0A 3HI5L 4I9WD 4HIXL 2AXHA 2QR0A 3HMXH 4YFDB 1ORSB 4H26A 4PLOB 2HMIC 5DJAB 4ZNEE 3B2UC 1R3IL 3U36A 5DURD 5DWUH 4X0KB 2IPKB 2LE9A 4MQ7B 1U8OA 5B3NA 4NWTH 5C2BL 4X4MA 4PR5B 2XRAL 1KB9K 1F6AA 4Y16D 5IFJA 1QHPA 3O8XC 3X12A 5CSBA 1YJDC 2GYSA 1S9KC 3BH9A 3O3BB 3U6RB 2YD8A 2C3HA 2XTJE 2QSCH 4IOSD 4OZFH 3W5MA 1JZ7A 4YDKL 1EJOL 3RDTC 4W6XB 5DFVD 4LGSB 3HZYA 3HKFA 1X5GA 1NFDA 4GKNB 4MJ2A 2YZ8A 1EGJH 4ZOCA 4OZIA 1ED3A 4N9OB 3MFFB 3UTSD 1RURH 2XZAL 4IDJL 1H5BB 4JZNA 1DEEB 4CKVX 2IALA 5CINL 3TT1L 4CL7A 2YD9A 1BQHB 2P49B 1NKOA 1I8KA 4KK9C 5I0DA 2NY7H 1QFWM 3MGTA 3FB8A 5BVJB 2XQBH 1T89A 1BLNB 5DC4B 3TCXA 1HHGA 1QSEB 4AIZA 3VGHA 5GGVL 5HHMB 1II4E 3GIZH 1YMMB 3SQOL 5EA0H 4EI5D 3M1BB 3VCLB 3INUL 5BOPA 4LK4A 1JN6A 1GAFL 2Y5EA 1JHTB 2ZNWA 2BX5A 5JNYB 4AEIL 5T3XD 5A2IH 1H8SA 1ORSA 2Y9RT 5DJAA 2MPAL 1BAFH 5FFLA 4UT7L 2BNQD 3QQ4A 1SHMA 4PYGA 4X0KA 5JZ7C 1FORL 4UV7L 5EZIH 1FNEB 1VCAA 1NCNA 1WFOA 2IPKA 4MQ7A 3KR3L 3X14B 4E5XB 4PR5A 3CFBB 3QDGB 1G9MC 4OKDA 1X6NA 4HK0B 3O3BA 3U6RA 4OLVH 1VA9A 1OGAD 3HC4L 1DJSA 3SOBH 1UYWH 1WIOA 4RWYH 12E8H 3ZTJG 3QEHB 4KKCC 1AY1L 4I0PD 2VMFA 4KUZH 4JO1H 1E4WL 3F12B 4LRNH 3SGDI 4CAGA 4PJXF 4GKNA 1YEHL 5C1MB 5C6WH 3DXAB 3MLWH 1KC5H 1MI5B 3MFFA 3QDJB 1ROWA 3RI5F 1H5BA 1LWRA 2IG2H 3DSFH 1DEEA 1IT9L 3T09A 1BQHA 4XP5L 5HYEA 5HD8D 1B2WL 4HQQH 1MFAH 5FYLD 2D31B 3UCRA 4OFVA 2DQHH 2ZSWB 4BQCA 3X13B 1BLNA 3WUWG 4D2NA 4LEXL 1DVFB 1QSEA 2YZ1A 2XA3A 3EW3B 3VXRE 3MXVL 1MFEL 5HY9B 3EO9H 1YMMA 5L88L 5DO2C 2MQ0A 3F6IA 1J1OL 3M1BA 3VCLA 3UBXG 3LPFA 3B2VL 4HH8A 3MA7B 3RWGB 1JHTA 1BOYA 5JNYA 4OSUH 3LY6A 3H8NA 2DJSA 3ZHKA 3BMVA 2DMBA 2AI0H 4L4VE 4GAGH 4JJHA 4NN7C 1FNEA 4Z7VF 1QBAA 3X14A 3CFBA 3QDGA 1X5XA 4HK0A 3LKSB 4QY8B 2NR6C 4FG6C 2D7OA 3QEHA 3GUTB 1A7PL 3QXUA 4RAUB 3F12A 5MI0C 5MEQB 1IEBB 3DXAA 1MI5A 3QDJA 4QRSB 3WN5B 3FQNB 2YPLE 4LVHB 4NKMB 5HYJD 4HUXA 1B0GB 1MVUB 3WFEL 1FNFA 2VDKH 3B8YA 2D31A 2E6PA 1KLFA 1Z5LB 1S9YB 2ZSWA 3X13A 1DVFA 3T3ME 4K7FB 4CDGC 2ESVB 2VLRE 3RY6C 4WTZA 3MA7A 5EUOF 1YEJL 3V79C 2YK1H 3V5DB 3GMMB 2H1PL 2B4CH 4K94C 2PXYC 2F53B 4XNXL 3LKNA 1Z9OA 4JM2C 4KV5F 5IBTH 2DDQL 4PYHA 5CSZB 5ALCH 4GRLD 1QQDA 2EDKA 4IOFC 4M62H 2CLVB 3EFDL 3LKSA 1VEPA 3MJ6A 4QY8A 4NNPL 1GGIH 3EJJX 5GGTA 4E41E 4MNGB 4P2CG 4WWKB 4DWHA 3GUTA 2V2TB 4RAUA 3VFNB 4JLRB 3L3JB 3S9DB 5MEQA 5MEND 1GXEA 4MMZC 5KAQF 3VFVB 4TTDD 3TZVC 4U2ZA 4NWUH 1AD9B 4PLKC 4QRSA 4QHUB 3WN5A 1OLLA 2IAMB 1YUHB 2EO9A 3FQNA 1T66D 5K9JL 1IVLA 2EEBA 1KUMA 4NKMA 4X5WB 3C2AL 4UV4L 2VQ1B 2PKDA 1B0GA 1MVUA 3QXAB 5I74C 3MYJB 3WBDA 1Z5LA 1S9YA 3C5ZD 4OM0H 3TN0D 4G7YL 3WFCH 1X4ZA 4DGVH 3ZT7A 4XWGL 3O2VL 1OTTD 2HT3C 4K7FA 5HI5D 2ESVA 5HHOE 3J8F7 3BKML 4JQVA 2BFVH 1HHIB 1P69B 4GH7B 2EDOA 4TUKH 1WBZB 3DX9B 4GW4B 1QRNB 1MIEH 3V5DA 2OTUB 3GMMA 4YGVB 1XZ0B 4MS8D 5GRUL 4XH2B 5GGTL 5BQ7B 2BCKB 1EEUA 2F53A 4TRPH 5IEHB 1UZ6F 1JNNL 4JGMA 2CIKB 2YKLH 4PJ9B 4QXUH 2UVEA 4DEPC 5ID1B 3P9MB 4NKIL 5D4QA 5CSZA 1OSZB 5I18L 5IV2B 1YYMH 2CLVA 2GIYA 2IAND 5J89A 4QKXB 1NAMH 2HKFL 3KDMB 3RVWC 4UTAH 1A1OB 3JWDH 1FL5B 4MNGA 3BGFC 1HEZB 4WWKA 3NABH 1EFQA 4RFNC 2V2TA 3GJEB 3L3JA 1U41A 4U31A 3RI5K 2UY6A 1FC2D 5D1QC 5JXEA 3JTSB 5IG7B 5I8KL 5IHBA 1CE1H 1MY7A 2W9EH 3VFVA 1MIML 1AD9A 1EUUA 4WHYH 4QHUA 2X9YA 4NRZB 3VFRB 2IAMA 2BJML 1YUHA 2D3VA 1F4YH 4X5WA 5A3ID 4TNVF 2NXYC 4I13B 3JWOH 3ZT5A 4L4TD 5FGBC 3QXAA 1J7VR 3MYJA 2J6EL 5B39G 4ZAKD 4HC1H 5ADPH 1YN7B 2IFFH 1N8ZB 1IGML 5SWZB 2BVYA 3IU4H 1HHIA 4YUEL 1DEDA 1ZLSL 1WBZA 2BVUA 1HNGA 4GW4A 4OGXH 1QRNA 3LN5B 4YGVA 1XZ0A 3G6DL 3BDXA 3IDXH 4XH2A 4DKFL 3QEGL 5BQ7A 2BCKA 5IEHA 3VD5A 3KLHC 1RQ5A 4WFED 2NNAB 2CIKA 4XPHL 1OPGH 3EAKA 5HHQB 5ID1A 3P9MA 1T3FB 2C3VB 3WIHL 1OSZA 3VXPB 5IV2A 4JVUA 3JWNC 4M6ML 3SE8H 3KDMA 4Y1AE 5ENWB 1A1OA 2CLRB 3SKUD 1FL5A 2DI9A 3LPWA 4LMQE 1HEZA 1GZQB 3GJEA 1OB1B 1ZEAH 3H6JA 2CK0L 4G6AD 1RU9L 1UM6H 4CMMB 1CICD 3JTSA 5IG7A 3VFGH 2OBGA 4HJ0D 3GHBL 1NMAH 3ZTNH 5JQ6H 5CJQL 4Z7WE 3RTQB 5E99L 3VFRA 5JXAH 4NRZA 4UBDD 4RIRA 3L5IA 3TVMB 1GGYA 1LP9F 1MWAH 3U1SL 1HQRB 1OD9A 4NQDD 5B4MC 5GS2D 2C3XA 1EO8H 2ED8A 4Y4FA 1YEFH 3NAAH 1JZ3A 4Y16B 3BI9X 3VD4A 4M9OA 4LNVA 1FG9C 5KVFL 4QNPF 1YN7A 3L3GB 1M7IB 4W68A 1I85A 2FLRT 5CILH 1N8ZA 3HUJB 5SWZA 4H1LH 4KRPD 4BZ1L 2O5YH 3EJYD 5I1CL 1X5LA 1KB5B 2JK5B 4V1DD 1JZ8A 3LN5A 2WWKO 4QRRB 2YRLA 1X9QA 4KHTL 1AIFB 2F5BH 4WFGE 1G9NL 1OP9A 2HH0L 4OIAA 5F8QC 3B4NA 4NCDA 3CCHB 4RDQG 2NNAA 4MSWB 2DBLH 2UZIH 3WJLC 5HHQA 5FEBA 1OM3H 2C3VA 4M6AA 5INCB 2ADFL 2OL3H 3VXPA 1DQLL 3GSRB 5EULV 5D5MB 1B4JH 5D93C 2KQMA 5I1KH 4OF8A 4ALAL 5ENWA 4MA1C 2CLRA 4QXGH 5D7IB 4YX2H 3OPZH 2IFGA 1U9KA 4JAMB 1GZQA 3MV8E 1RHFA 2OJEB 1JGVL 2FD6H 3PGFH 1OB1A 4OT1L 2MCPH 3V4VL 1DTUA 2RIKA 4I3SL 1LQSR 3PL6D 4J3OC 3ISWA 4CMMA 1TZHB 3VRLE 3CIQA 1R3KB 4RCAA 5DMGD 2R2CA 3RTQA 5CLTA 3IDIB 4XC3L 1EJ6A 3TVMA 3BKCL 1HQRA 2BNQB 4X5XB 5EOTB 1OW0C 3ARDD 3EOTH 1CGYA 1AXSB 5KJRH 3KXFD 5L0QB 3QRGL 3GI8H 3CAFA 4OCYL 4Y16A 2F8VA 4PJEE 3V95A 4XC1H 2EDJA 2J5LC 3QFJD 4MB4A 3L3GA 1ZLUH 3SJVD 1M7IA 3RWHA 5JORB 2Y36H 4NN6C 2A83B 3CDGB 5ANME 5TQ0L 1OGAB 4NQXB 4P4KC 3HUJA 5D1XD 5F9WB 1N64H 3R1GH 2FX8H 1C1EL 1EUTA 3W39B 3I9GL 4I0PB 1KB5A 4JPWL 4JQXC 3MRRB 4U49A 2JK5A 1DQQB 1PX3A 4FXLA 32C2B 4OLWH 5EG6C 4QRRA 4TUOB 2YPVL 4JFFB 1AIFA 2V5MA 3IT8D 1K6QH 4H8WC 3CCHA 1I3UA 2A1WH 3TV3L 4MSWA 5HPOA 3JV4A 4JN1L 1A21A 3PGCB 5INCA 2BSED 3GJFK 4N0CD 3GSRA 5IBUG 4FQXC 3HAEG 5D5MA 3WXWL 5DD0L 4Q9RL 4XNUL 4RGNE 3BKJH 5DUML 1URLA 3FT2B 5CS7A 5D7IA 2E7CA 1CLZL 5ALBL 3HRPA 4JAMA 4B7LA 4MNQB 5DD3H 2OJEA 1KULA 4HWUA 1L7TH 1ZHBB 1G1YA 1MHCB 1G7QB 1TZHA 4XVTL 1R3KA 2AK4D 2IPTH 3NPZB 4KH2A 4IIQC 3GSWB 4IRSC 3Q6GL 3OZ9H 3IDIA 4KDTA 3HE6B 4TNVK 2VUYA 4V2BA 3KVQA 2LV4A 4AG4H 2VO5A 2BNQA 4RMWA 4X5XA 5EOTA 4Z95H 5T3ZE 5GHWH 3I6KB 4PJ5D 1CDCA 1AXSA 4U1NB 1KB5L 2DM4A 4HK3N 3JUZA 4YHZL 1UH3A 3QCTH 2AJXL 4LAQL 3WUWB 2YD2A 5JMRA 5C08E 1CQYA 3O6LL 5JORA 1P7KB 5TE4L 2A83A 2V7HB 2Y06L 3CDGA 1OGAA 4NQXA 4U1GC 3UBXB 2FZ3B 5LAXB 1BJ8A 4XMLH 3W39A 3IFOB 4H25B 1JJUA 3SDCD 4I0PA 3MRRA 2YA2A 4HDIB 1DQQA 2EIDA 4BSVB 3EHBD 2PETA 32C2A 1HH6B 4TUOA 4JFFA 3G9AB 5D7LB 3C08H 1BIHA 3WNKA 4GG6B 3GSVB 1KB9J 5I15H 4YK4C 2VB5A 4NQTA 4NBYB 3PGCA 1G6RB 4KROC 1V7MH 5E9DE 2CUHA 5F7LB 2CRYA 4YEEA 1A7QL 4LF3B 3BSZL 3P40A 2Z8VC 3FT2A 2BOBB 4LLDA 3VWJD 4AY0A 3GM8A 4OCMC 4MNQA 4P46B 4DOHB 2ZG2A 4M7ZC 3BUTA 1ZHBA 1MHCA 5CZVH 1MCSA 4P9ML 3GSWA 5B22A 3STLB 1GYAA 1TNMA 3HE6A 5H2BB 3LEVL 2D0HA 5FUCE 2FCBA 3HPLB 4JFEE 5IESL 4HWNA 3UZQA 3I6KA 4A6YL 5A2FA 1LO0H 2VDLL 5ISZE 4XVUD 3WUWA 4GRLB 4OGAD 1FNSH 4OD3L 2X2YA 4KKAC 1P7KA 4KQ3L 3X11A 2V7HA 1DFBL 3O6FD 5HHVL 3UBXA 5DEZA 5IB3B 2FZ3A 2OR7A 5LAXA 4F37F 3DMMB 2OTPA 3IFOA 4H25A 2DLIA 3NIFF 3P2TA 3OKDB 4BSVA 1QRKA 1BFVL 5TJWK 3T2NH 5KSAD 1L7IL 1HH6A 3MLUH 5MENB 5FYLL 2F9BT 3TA3D 5D7LA 4NC0B 3O11B 4GG6A 2VRAA 3GSVA 5IIEB 1G6RA 4U1MB 3VU2A 4KPHH 1B6UA 4MA3B 5KW9L 1F00I 4ZUTA 4MXWH 3FO0H 4LVNB 3LQAC 3MZGB 4LPTA 4ZUUB 1HSAB 1NBVH 2EECA 4FABH 5CIPB 3TN0B 2BOBA 1GJIA 3TGXA 1EBPA 1M7DB 4P46A 4PRID 1FGVH 4XP1L 2V17H 3IDYB 4JM4L 5AAMA 2K9UA 4HCRH 5DVMA 4Z0XB 3STLA 1E0OB 1TDQA 5H2BA 3MROB 5I76B 5LXGL 4G8GD 1REIA 3AU1B 4EDWH 5I8EB 4GKZB 4EQ2A 3KYKL 4C56E 2Y6SC 1OAYL 1RJYB 4GRLA 5F7KC 1Z9SA 2YN5A 1ACZA 1BIIB 2EH7L 2Y4SA 5D71L 5IB3A 3RAJH 1G6RL 1IC7L 3DMMA 5D6CB 1MF2H 4FQPA 3OKDA 4ZSOE 4PJFB 3OTTA 2GTWB 5MENA 3S34H 3AROA 4CVWA 3S8WA 5IFHH 2NY6D 5TH2B 1JYWA 5HYIA 1IGFH 3O11A 1UXSB 1CLOL 2HTKC 3GKWH 1U6AH 4L29B 5FGSA 1QG3A 3V7AE 5IIEA 4L9LB 4ONGH 4U1MA 4M93C 2N4IA 1QBLL 3WNPA 4MA3A 2Q8BH 3OJVC 3GMNA 1HSAA 4ZUUA 1X44A 3V4PL 3BPLC 5EWIH 5CIPA 3TN0A 1KN4L 4JZJA 3EYOB 1M7DA 3O2DA 2J8UF 4NQCE 2XWBB 3HUJF 2Z4QB 5BV7C 5ACLA 1I7ZB 1WCBB 1DQDH 5C0BE 4NJAH 4HFUL 5DD1L 1TXKA 5C6PB 3MLYL 2UWEE 3H42L 4Z0XA 1CDUA 3TYGH 3MROA 5I76A 1T5WB 5EU7C 4N8PA 3AU1A 1AC0A 5I8EA 1B0RB 4F9LA 4GKZA 1XCQB 3C09B 3DI2B 2FYYB 1RJYA 5LCVL 5D5MF 2DJUA 1J8HB 1ADQA 4KI5C 1BIIA 2X1OA 4DAGH 4PB9L 3CVHB 1XT5A 4JFDE 4P5TB 3DURB 2D9QB 3MO1B 3E0GA 3DIFB 5D6CA 4PUBL 5C09B 4J2XA 1WAAA 1C5BL 1MCJA 2CXKA 4PJFA 2VXVL 2RJMA 3DVGB 1CICB 3ILPB 2GTWA 2LU3A 4PG2C 3SE9H 2AEQH 2HT2D 4XPFH 5TH2A 35C8H 1RZJC 4UOJA 2YUWA 4JVWA 4K23H 4UIMB 3ZDZE 1UXSA 3FCTB 3O2DL 2R4SH 4N5ED 4L29A 2PO6D 4L9LA 2F19L 3VW3H 1CGWA 2GQHA 3QISA 5EZOL 4NQDB 1MCNA 4FFWD 4QRPD 1DBAH 1HKLL 5I17B 3N9GH 5D6DA 3OF6D 5JOFB 1VFMA 1ZLVK 3JTTB 3EYOA 1MNUL 3GRWH 3IYLW 5T1DL 4YHLH 2DQCH 2XWBA 4YQXH 3E3QC 1JPSL 2Z4QA 5JPMB 1I7ZA 1WCBA 4K7PH 3CZFA 4MX7B 3LRSB 1IAMA 1QSZA 1ADQL 4V1DB 1G7LB 1Y18B 1EFXD 2JB5L 1T5WA 2DKSA 3QT2A 1W8OA 4GRWB 1IKFH 1XCQA 2NY1B 1Z9LA 2OZ4A 1RJCA 4QRTB 5E1HB 1H3XA 3QA3B 3T4YB 1DSFL 2RHEA 2Z93B 2MOVA 4F37K 1J8HA 1PEZA 4RA3A 2F8XC 2PTUA 4JFOB 3DUUB 5I73C 1QLFA 4BQ8A 1RK0B 2A77L 4XBPB 3RP1A 2I60H 3DO3A 3CVHA 4QGYA 4P5TA 2CRMA 3DURA 3MO1A 3DIFA 5LKNA 5C09A 1NKRA 3KJ4C 3MXWH 3DVGA 1LK2A 3PL6B 4ODXB 1CICA 3ILPA 4AZ8A 3IJYB 3QBTB 3ULVF 4HJGB 4UIMA 3FCTA 1H0DB 5I8OH 2A0LC 1NCBL 4XB8A 2R0ZH 3FQWB 4K3GA 3H9ZA 5AD0B 4XWOC 4NQDA 4Z8FH 3VFWB 1RUAL 3ARDB 3KXFB 5I17A 4ZFZB 1BBDL 4LVOB 1TITA 1RZFH 1KCRH 2VKXA 5JOFA 1A9BB 4ODVL 2ZUYA 3QFJB 1R24B 4WUUE 3VXRD 4ORZC 3SJVB 2OZ4L 4D94A 5D1XB 5JPMA 2CSPA 2M1KA 4G5ZL 4MX7A 4WI8A 3ZE2E 3WKMH 1K4CA 4N1CA 4WW1B 4V1DA 5F89B 1G7LA 1NUFA 1PJ9A 1Y18A 4I2XB 5H37H 2DIAA 2XNAB 4L4VD 1R3LB 2R2BB 4GG6F 3CVHL 1Q9KB 4K7PY 3VA6A 1WFTA 4R9HA 5CJ8A 4ELMF 2ZUWA 1S7QB 3QA3A 5GQBA 3T4YA 1MCFA 2Z93A 1Y6KR 3KS0H 3P77B 4JFOA 3QHZL 1BHGA 3DUUA 2R0WH 1RK0A 5EU4B 2N56A 5JHLH 3S3JA 2W0KA 4UDTB 3CXHK 3D39E 2NXZD 2L7UA 1S9VB 2MWCA 5MP6H 2YUZA 3PL6A 4ODXA 1QSFE 2EXYD 3IJYA 3TJHC 4QHKJ 4XP6L 3OKYA 2W9LA 4HJGA 3QG7H 2VDQL 2WBJC 4K55A 4B50A 1H0DA 2LU7A 2W59A 2YPLD 5ITFB 1IAKB 3FQWA 1JHKH 1LO4L 1L4IA 2FDBP 3VFWA 3ARDA 3HAEB 1UACL 4ODHL 2WWMD 4PJ5B 4EJ1C 5LQBL 3KXFA 1UH2A 3PXHA 4ZFZA 2HP4A 3CXDL 4TUJB 4X4YA 1A9BA 4KK5D 3QFJA 1KCSH 1R24A 5T1KD 3KYNB 3QIWD 4TOYL 3UTQB 2EE3A 3SJVA 1OOAA 1ACYH 2PF6A 1A5FH 3OJ2C 3OL2A 5D1XA 4MCZB 1NUDA 3MLRH 3OQ3B 1I8LC 2ZCHL 4WW1A 5F89A 2V9QA 4I2XA 5FHBL 4LFHG 1ZT4B 4G8IB 2BRRH 2RCSH 2XNAA 2L0DA 1R3LA 2D7QA 2R2BA 5JIPA 3DX7B 1Q9KA 5F1NB 4N5UA 4I18C 3ULSB 3MJ9L 4OI8A 5EB9A 1QFWL 4UQ3B 4ZMAT 3MOQA 1S7QA 2DLFH 1NGXB 3GMPB 4ODWB 3QCUH 2IEPA 3CLEL 1FZKB 4HF5L 2LVEA 3WKNA 4EBQH 1W72B 3P77A 3WFBL 5EU4A 3ECBB 4E41D 5ERWB 5B3JF 1AI1H 2X4SB 3JSSA 1IQWL 4M00A 3EFFB 4UDTA 4JKMA 1S9VA 4N0UB 4LFHD 4LHUG 3D25B 5E2UL 4E42A 5MHSE 1OAKL 1UM5H 2I5YL 4R4FH 1W0VB 2QKIB 1I9RL 3QUZD 4B41A 1T22B 2C1PB 4KVNH 5ITFA 2QQLL 3RZCD 1IAKA 2VDPH 3WD5L 4JDVA 4MDJB 4PJ7B 1P7HL 5JUEH 5C9JB 4TNWK 3HAEA 4PJ5A 1ZWIB 3NGBB 1L0YA 3MCKB 5I16A 2XWTB 2EDRA 2HWZH 3B9EA 5EC2B 4TUJA 5I9QB 2LFGA 4G6KL 1QFOA 2DD8H 4JHBA 3KYNA 3UTQA 3ET9F 4U05A 5HHOD 4D9QE 1N6QL 3P30H 1NLDL 2C1OB 4LHUD 4MCZA 3KPTA 3O9WD 3FMGL 1A3QA 4NGHL 1EHLL 1QPXA 1ZT4A 4G8IA 2VLJB 3VH8G 3DX7A 5F1NA 2O61B 3FQUB 2AJYL 3Q2CA 1FNHA 1KIQB 3LRHA 3ULSA 1DBJH 4OCWH 2IF7A 4UQ3A 5EBWB 5TPWH 3VD9A 5DC0A 3ARSA 4WEMB 2BK8A 1J5OL 1NGXA 3EOAB 3GMPA 4R90H 4ODWA 3V0VB 2H3NB 4RAVB 4X8JB 1FZKA 2XA8L 3HR5B 3MC0A 1W72A 5IHZB 2I24N 5J13C 2XI9A 5E8DH 1S7RB 3ECBA 3TPKA 5ERWA 2X4SA 1IEHA 4IDLA 1KJ3L 3EFFA 3GO1H 2PYFB 4N0UA 5TDOB 1CIDA 5D7JD 3D25A 4I3RL 3OKOB 1JF5A 1W0VA 1YY9C 5F96L 2QKIA 4JO3H 1T22A 1KTDB 1AO7B 2C1PA 2Y25A 2X4UB 5E2JA 3LAFA 4NN5B 4O58H 4PJ7A 4MLIA 5KBNC 5GSVB 1OSPH 1E4KC 2YUXA 4LSTH 2J88H 5DD5L 1ZWIA 3MCKA 4S1SL 5C86A 2XWTA 4YHPB 5EC2A 3FZUD 2UVFA 1F8TL 3T0DA 1NMBL 2E7BA 4PJIA 1EEQA 4CVZB 3O6FA 1GPOH 1FL6B 2C1OA 4KZEL 4X6EB 3HZVB 5KOMC 5DQDL 4WFHE 4LLMB 3RUGB 1NQBA 1KJVB 1MJJB 2G5BB 1W72L 5DK2B 5C9KA 2VLJA 3FHQA 2KUTA 3DBXB 3WNOA 3IFNH 4JQIL 4MA7H 4M1GH 5HI3D 2O61A 1JFQL 3FQUA 1KIQA 3WLBB 2QQNH 1E6OH 4TSBH 3GBNH 5EBWA 1KSRA 1GOFA 4U1JB 3EOAA 4P3CH 3V0VA 2H3NA 4RAVA 4X8JA 5DEGB 3HR5A 1A7NL 4P23C 4Y1AD 3AM8C 4OZHB 1S7RA 2XIDA 4Y4HD 3MNZB 4Q97A 4X6DE 2WMPA 3WO3B 5MEOB 4XAWH 2R2EB 1N0XL 2PYFA 4UT9L 5I1HH 1I1AD 4HPOL 1YPZB 5TDOA 5FGCE 3IFLH 4KMTL 3D3VE 2CR3A 3OAZH 4DKEH 3OKOA 2EDWA 2LTQC 2AABL 4WI2A 4LSRL 2AXGB 1KTDA 2B5IB 1PG7L 1AO7A 4XMKH 1CGSL 3HI5H 2AEIT 2X4UA 4HIXH 3MUZ1 5GSVA 5SX5H 3P4MB 4WFFE 1JTOA 5GZNC 4B0MM 1F45A 3MBEB 3N1PC 4YHPA 3V5KB 1V3KA 3EYQD 3E6FB 3KPLB 1I1CA 4D9RE 2XTJB 4CVZA 4YE4L 1FL6A 3LZFH 5LBSL 4X6EA 3HZVA 2YWZA 1FYHB 3AS3A 4LLMA 4TVPH 3RUGA 1KJVA 1MJJA 4YDKH 1EJOH 2G5BA 3VGAC 3OAUH 5DK2A 3W81A 3DBXA 2ZUTA 3N50A 3P9LB 4WFGD 1ONQB 3ARQA 4RDQF 4K8RD 5FIEA 3WLBA 2B8OT 2QV2A 4U1JA 5D2NE 2ERJB 2XZAH 1YY8B 1BF2A 4IDJH 2VDMH 4LARH 3UBXI 1TENA 5ADOL 5DEGA 4CN1A 1U8HB 5CINH 3TT1H 3RKPA 4UTBH 4OZHA 3SO3C 3O0RH 4AEHL 1X6LA 3NIDE 3MNZA 3BP4B 2YD6A 4MAYC 3QZWG 5HGAB 1MCHA 2YBRB 3MV8D 2R2EA 2RQ8A 3I2CL 2R9HD 1TQBC 1SM3L 1CVRA 1DBBL 1YPZA 3PJSB 1JGEB 3BP6B 5GGVH 4OV6F 4YXHL 2FJFB 1KCVL 1YEEL 3O4LE 3SQOH 4NHUB 5BRZE 2AXGA 3INUH 4ZNEA 1GAFH 4JKLA 2FHCA 4UZGA 1CD0A 4DQOL 4AEIH 4BYHA 1T83C 2MPAH 4C83B 3MBEA 5CBEA 4O51B 4UT7H 2Z8RA 3V5KA 1FORH 1XIWC 2ICWB 4UV7H 3S37X 2EDLA 2ZKHL 4MXQC 4G3YL 2VTFA 3TH4T 3E6FA 3KPLA 3ESUF 1JTTA 3KR3H 5F8RC 4NZRL 5C0RH 4K7PX 1HKFA 5HSFA 2RBLA 1BFSA 4UU9B 5J3HC 2QL1A 3HMWL 3A6CL 5HDLA 1HE7A 3HC4H 1Q9LB 1V5JA 1AY1H 3P9LA 4FQ1L 1ONQA 1E4WH 4K3JL 3HRZB 1HCFX 2R0LL 2ZUXA 2MQ3A 1YEHH 3AS1A 1L6XA 3VWKB 2DQDL 5KS9E 2XV6B 1YY8A 1VFOA 2VIRB 1U8HA 4RGND 1IT9H 4OD1L 4RRPA 2QSTA 4XP5H 3OF6A 4X7TB 4CRPA 3BP4A 3C60B 2PYEE 1NGQL 5HGAA 2YBRA 2PTVA 5FYKD 4DVRL 3VXRB 1B2WH 4OI9A 3ZDXF 2X89A 1S7VB 5D7SL 1LK3L 3PJSA 4LEXH 1JGEA 3BP6A 2FJFA 3VI3F 3MXVH 3WYRA 1MFEH 4G6ML 3HTLX 1WT5A 4NHUA 1J1OH 3EZJB 1QTYT 1HXYB 2AQ3A 3B2VH 1ZOXA 5F7FA 4E9LA 1RUKL 4PTTA 5K59F 3I3BA 5GGVY 1D5BB 2DQUL 2CRZA 2X9XA 5D7KE 2GY7B 1NPUA 4R2GC 4C83A 4D0CB 1MPAL 4ZOEA 4O51A 3L5JA 2ICWA 1JYNA 4W70A 3ARWA 4M7LT 1NL0L 3WS6C 2VJXA 5HJ3B 4RMRA 25C8L 2F54E 4UU9A 1CD1B 1P9MC 1WZKA 4OZFB 3MLXL 4EUPH 2WANA 2V5SA 1Q9LA 4TVPE 1EAPB 4RMTA 3ZZ1A 1A7PH 3GNML 4MWFB 3OXRB 3HRZA 2JJTC 4MQXC 5LGKA 3IXTB 2AGJH 1OTUC 1FP5A 3VWKA 4P9HL 4HG4K 3RVUD 3RFZC 4KY1L 4MJ4A 5JIKA 2VIRA 4EKXA 1G7JB 1F58L 2VR5A 4X7TA 3C60A 3BQUC 3S96B 3VXRA 3VG9B 5LG1A 1S7VA 2VLRB 3NZHH 2QEJA 2HFGH 3ULUF 1MCOL 2GTZB 4IEFB 5JPNB 3MNVB 2HJFB 1C5CL 4YH6A 4LNRB 3PUCA 1HXYA 4GS7B 1D9KD 1YEJH 1I7UB 2B2XL 4QWWD 5FB8B 1D5BA 4UNTA 2H1PH 1N3NB 5ISZD 4D0CA 4XNXH 2YSSB 2P8PB 4BFEA 3LRGA 5I2IB 2HT4D 1LE9B 4U1IB 5HJ3A 3DWTA 3EDJA 4MXVE 5E2WL 2DDQH 2JLLA 1IAIM 5CEYB 3EFDH 1CD1A 1S7WB 4OZFA 4NNPH 5BZWB 4G6FB 5DRXB 2J8HA 3KYOB 2F15A 4LCCB 1EAPA 3KPNB 5DS8B 4MWFA 3OXRA 5TQ2L 4HAFA 1EGJA 2V7NB 3QUZB 3IXTA 2NZIA 2IQAB 2O5XL 4PGEB 3SCMB 1Y6MR 2GJ6E 4JKPL 5FYJE 4Z78B 1KXQE 1MFNA 3B9KC 1G7JA 1MLBB 5K9JH 5T33L 5DFWH 3Q0HA 2VLLB 3C2AH 3KPRE 4UV4H 4NOBA 1SEBB 1LDSA 5EZLB 3S96A 2VLRA 5HHOB 3KHQA 3OGCB 2EDBA 3O6ML 4G7YH 3QWOB 2GTZA 2HMID 4HGMA 3D85D 3B2UD 4XWGH 3RIAF 3O2VH 3RUGF 5JPNA 4NJ9L 5EU7E 2HJFA 3O9WB 4PJHB 3BKMH 3BAEL 4LNRA 3T3PE 1SJEB 3TBYB 4NFDA 1FHGA 3ZE1E 1I7UA 5FB8A 4HS8L 5H94B 2YD1A 3O8XD 1NMCC 4C56D 3V7AG 1N3NA 1PFCA 5GGTH 1EDQA 4KI5E 1JNNH 3RDTD 2YSSA 2P8PA 2AJ3B 2ZUSA 5I2IA 1CDBA 1LE9A 1VKXB 4U1IA 4NKIH 4OZHF 1WJ3A 5I18H 5CEYA 1RURL 4E41A 1IRAY 2NY2C 1S7WA 3BRDA 5BZWA 1RZ8B 3ZE0F 5DRXA 2HKFH 1YPZF 4I0CC 8CGTA 5GS0C 4I77H 4EIZC 3KYOA 4BJLA 2KPNA 4LCCA 3KPNA 2NY7L 3VH8B 4QOKB 3QAZB 5DS8A 4UNVA 4KK9D 1PX4A 3QUZA 2HJLB 2DWDB 2IQAA 1HDMB 3KHOA 4LCYA 5IBLC 3SCMA 3V6OE 4PGEA 5I8KH 3M17B 4ZUVB 3K1KC 1MIMH 1J1XL 5EA0L 2L4OA 5IB2B 2VWEC 4PP2B 5DQJB 4Z78A 3DX6B 1ZLWH 1MLBA 1QFWI 2VLLA 3E3QE 3CXHJ 3CJJA 4U2YA 1SEBA 5EZLA 2W60A 4NQCD 1CBVH 4OB5L 5DZNA 4J3WA 5HHOA 3FQRB 2CUIA 2J6EH 3U0PB 1IJ9A 3OGCA 3F5WB 4APQB 5IGXL 1NCDL 3QWOA 4P59L 5C0BD 1I7RB 3VMPA 4YGAB 4G8FB 5IKCB 3O9WA 4PJHA 1IGMH 1SJEA 5JZ7D 3TBYA 3D48R 3MZTA 4YUEH 3P0GB 1ZLSH 4NZJA 1KXVC 4OLVL 5IP4A 1KPUB 5H94A 3DOSA 1LO3H 4WJ5B 2WIMA 3G6DH 4DKFH 1A6AB 3QEGH 2VR4A 4KUZL 1NGYA 5C71A 5DJYB 2AJ3A 4XPHH 5FYJU 4NPYB 4MJIE 3GEWB 1VKXA 4KKCD 1U8MB 4TSCL 4Y1AB 3WIHH 2P8MB 1KC5L 2KKQA 4JY4B 2E9BA 1UZ8B 3C8KB 1I8MB 4JFDD 1U8KB 1RZ8A 4M6MH 5EBLA 3DRQB 2NX5B 1I1AB 3V6FA 3D0LB 3C9NB 5JW4N 2COQA 3VH8A 4Z7UE 4QOKA 4QHNB 2CK0H 4HEME 1RU9H 5TE7L 2HJLA 2DWDA 1HDMA 3JZ7A 3M17A 4ZUVA 5E5MB 5CJQH 1UVQB 2X09A 5CHNB 4YDIL 5IB2A 5ELIA 4PP2A 5DQJA 2FH6A 3DX6A 4F3FB 1FNLA 3U1SH 2R29H 4EOWH 5DO2D 4OFDA 4RX4D 1DLFL 1OCWL 4NQUA 5K33A 2MTPA 5AEAA 2JJUA 1AQKH 2HG5B 2AJZB 3W11D 2F58H 3FQRA 4GAGL 4APQA 1QFHA 1JZ2A 3U0PA 3F5WA 1A6VL 5KVFH 2ATPB 1I7RA 4G8FA 5IKCA 4LQFL 3H9HB 3EOBB 4BZ1H 3WFHB 3L5WB 5I1CH 5KTEL 4LPWA 4KMLB 5IVXE 5EU5B 2WUCL 1KPUA 4YHYB 4WJ5A 4KHTH 3D0VB 3MUJA 4IHOB 1J88A 1JBJA 2CH8A 1A6AA 1WZLA 1G9NH 5EUKB 2NR6D 3W0WB 5DJYA 4FG6D 1FFOB 4NPYA 3ZKXC 5I66B 2MJWA 3WDJA 1U8MA 3ZHDA 3EO0B 4Y1AA 2P8MA 2ITDA 4JY4A 1DQLH 1UZ8A 1I8MA 1NAMB 1IMHC 1U8KA 3TF7C 3MV8B 4K9EL 3TBWB 3DRQA 2NX5A 3U82B 4UAOB 1I1AA 4JANB 3ARXA 3D0LA 5ESVB 2GAZB 3C9NA 2BSSB 1JGVH 4QHNA 4OT1H 3V4VH 4I3SH 4Q58C 1Q0XL 2XICA 1T7ZA 5ICZB 4GQPH 5GGUA 4KK8C 4CMHC 1HWHB 2JJSC 5E5MA 2E9WA 2XKNB 1UVQA 2YA0A 5CHNA 4ISVB 1CDYA 2VITB 1RSFA 4XC3H 3LN4B 4F3FA 4JPKL 3BKCH 3HLAB 3QHTC 1UKTA 5EOCL 3T0WA 1MFDH 1FNAA 3QZWB 4WUUD 4WVRA 4M5ZH 3RIAK 4X9IA 2HG5A 2AJZA 3QRGH 4OCYH 1JCKA 3U4BL 2MNUA 1RK1B 2ATPA 2EE9A 2WLYA 4W4OC 1UWXH 5SX4H 3QSKB 2PXYD 1MQ8A 2QADB 1JRHI 3EOBA 3MFGB 3H9HA 5E08H 4M62L 4HD9A 3WFHA 1BFOB 1C1EH 3L5WA 3OG6B 4JM2D 4YBLC 4ACPA 4JPWH 1GGIL 5EU5A 1MCEA 4IOFD 2YPVH 3D0VA 3RWCB 4IHOA 1XGYL 3SBWC 5EUKA 3W0WA 3TV3H 4FRWA 1FFOA 5I66A 4RGNB 4JN1H 4HIIB 2APXA 3EO0A 3D2UB 5HDBF 4Y19B 1NAMA 3T3MF 4LRIA 3WXWH 3D39D 5DD0H 3MV8A 1KJ2B 1M7XA 4XNUH 2APWA 3TBWA 4Q9RH 5DUMH 1GL4B 4PLKD 1QSFD 5ESVA 2GAZA 4NO0D 1CLZH 5ALBH 2BSSA 1G7PB 4X6FB 3LCYA 1HK6A 4OM0L 5ICZA 4Y4KB 3SO5A 2WZPD 4N0RA 4LP5A 2XKNA 3Q6GH 4WO4C 5E4IA 4BSJA 4ISVA 2VITA 3GMQB 3LN4A 2HT3D 3HLAA 4UIKL 5F97E 3B5TA 3QZWA 5C08B 2VXQL 1KB5H 2FX7H 9CGTA 3BPNB 2PNDA 4YDLC 4YHZH 4LAQH 2AJXH 3CC5B 5K9QG 1RK1A 5AUMB 1EK3A 5DRWB 2YKLL 5TE4H 1SBBA 2Y06H 4GQ9L 5C07E 4L3AA 3LH2L 1BFOA 4I48B 1NAML 3QDAA 2AJVL 3HNVH 3RWCA 2Z31C 1T80A 2CKNA 3RVWD 5HGBB 5E9DB 3QRFM 4R97B 4XXCC 3GDBA 4HIIA 3L3IB 3D2UA 4L8SC 4Y5VB 1NCTA 4Y19A 5D1QD 2OS7A 1A7QH 3WO4B 5CD3B 3BSZH 5T3XH 1KJ2A 4DZ8B 4N0YL 1F4YL 5E2VL 1JE6A 3ALPA 5CGYC 2VNCA 5MHSD 1G7PA 4PJHF 3JWOL 4X6FA 5LWYL 3Q1SL 3BZDA 2A6DB 2NXYD 3KLSA 4Y4KA 1GRWA 4MVBD 4OLXL 2GKIA 4JFEB 4P9MH 3OJMB 4Z7NE 1FFNB 1NCUA 2VDOL 1D5ZB 5DA0B 3UTOA 3LEVH 3GMQA 1YNKL 1VERA 1TNNA 1ZT1B 4J4PA 4KJYB 1YC8A 5IESH 3CH1B 3PG2A 4OGXL 5KSBF 5C08A 4A6YH 1HCVA 4D9QD 3IDXL 4JRYD 5CD5C 1FCCA 2XG4A 3CC5A 5AUMA 2VZSA 4U7KA 4OD3H 5DRWA 4KQ3H 2EIZB 2GY5A 2A9NH 1DFBH 1JGLL 3KLHD 3CZJA 3HI6L 5IVZB 3ARZA 2NY4C 4I48A 3SE8L 4FQHB 1BFVH 1KJ2L 2E5EA 1L7IH 3L7EB 5FYLH 4XX1E 4JPIB 3UMTA 5HGBA 5E9DA 3WFZA 4GMSH 2R23B 1YNLL 1UM6L 1T0NB 2JELH 3V7MA 3P11L 1PVHA 4J3XA 3L3IA 3ZTNL 2DLTA 4Y5VA 1M6OB 5KW9H 4AL8H 2BNUB 2VZTA 3ZKNC 3MLZL 5CD3A 1U3YA 1KEGL 5GS1A 5T3ZL 4G7VL 4DZ8A 4NZTH 1S8DB 1EO8L 3D85B 4KC3B 4XP1H 4NCC1 3V8OA 4PBVC 1U58B 5E1AB 4JM4H 5B4MD 2A2QT 3S5LG 2A6DA 3IS0X 1EV2E 1IFHH 5E4EB 4JFEA 1FFNA 2R56H 3PXJA 1XF2B 5CILL 1D5ZA 4C56B 5LXGH 1ZT1A 2R4RL 1PKQE 4KJYA 3VXQB 2EKJA 5ECJE 3MRCB 4NFCA 3CH1A 3RU8L 3DUSA 3RJQB 1D6VL 5HHNB 3PGDB 5J12B 1OAYH 2F5BL 4HJJL 1R5IA 2EH8L 3FRUB 5CP3H 2UZIL 4WFHD 1MHPL 2EIZA 4YR6B 2EH7H 5D71H 1RI8A 2JCCB 1G6RH 5IVZA 4KRLB 1IC7H 3E2HB 1ULVA 5LVEA 5IW6B 4FQHA 1XR8B 2ICWI 4POYA 4QXGL 3L7EA 1U8IA 4GSDL 2H32H 4JPIA 4PRHE 5F93C 1HOCB 2FD6L 4LSSH 1A1MB 1YA5A 1K8DB 4YHOL 4GUPB 2DQJL 2R23A 1CTOA 1CLOH 1IGCL 3VRIB 1T0NA 3DPBA 3RWFB 2YMXL 1VFUA 1CFVL 1NC4D 1QBLH 1WF5A 3MBXL 1M6OA 4HWZB 2BNUA 1EZVX 4JDZB 4NCC2 1KEML 2J1KA 2BC4B 1T1WB 3MOAH 3V4PH 1S8DA 2XZCL 1KN4H 5T3XE 3L5XL 3I50L 1DVFC 3D3VD 5C0BB 3EOTL 3D85A 1A64A 5L8JB 1OTSC 4P5MB 1U58A 4HLZG 2ORBL 1IGTB 2ZG1A 4XC1L 4HG4J 4PTUB 4QT5B 4HFUH 5DD1H 3H42H 3MLYH 4OZ4B 2IBGA 1CFQA 4X4ZA 1JWMB 5E8EB 4KKLC 4C56A 4PJCE 5DDHA 3VXQA 3GZKA 2R1WB 3MRCA 1P6FA 4P4KD 2Q7YB 3AY4C 3RDTA 3NPSB 1J0KA 5HHNA 1FO0B 4D9RD 3PGDA 3DX8B 3FO9B 3FRUA 2AXJA 5DJXB 2H2SC 4JDTL 1J0ZA 4ZSOA 4YR6A 4PB9H 3VRLF 3SDYH 4JHZA 2JCCA 1WITA 1MAML 4PUBH 1C5BH 5IW6A 1XR8A 4Y7MA 2VXVH 2Y23A 1GZPB 2DTML 2VABB 4FQXD 4HUKB 5FXCH 5CIPH 5JDSB 4C54A 5FHAL 3KYMB 1HOCA 1A6UL 1A1MA 5IMMB 1L7TL 1K8DA 3SE4A 3VFUB 3O2DH 4GUPA 3VRIA 3WN5C 4MJ6B 1S7SB 1FAIH 3RWFA 3MRBB 3T4AB 3HE7B 2F19H 3H2WA 4LVHC 2IPTL 5EZOH 4HWZA 1NCAL 1J12A 4JDZA 3H3PH 4POUB 1RMFL 2BC4A 1T1WA 5BO1H 4IRSD 1YJDL 4HUNB 4BK5A 4X9GA 3VGEA 3MMEB 1MNUH 4M1DL 5C0BA 1D5XB 3O4LD 4P5MA 5BRZD 2NW2B 1N5YL 1PLGL 3NMEA 1IGTA 4JQVC 4NN7B 4OFPA 3QEUB 4PTUA 4QT5A 2GSGB 5FDYA 4OZ4A 4Z77B 5E5UB 1ADQH 2Y07L 1FDLL 1JWMA 5E8EA 5B38G 4KVCL 4OCNC 1YN6B 4KTDL 4XNYL 1JHLL 2R1WA 2Q7YA 2C26A 1MCWM 1FO0A 4Z7OE 1S3KL 4ONHB 5MI0B 2W65B 3DX8A 4JFDA 3FO9A 5DJXA 3NTCL 5CJXA 3CDYA 2A77H 4MZ3A 2DMCA 4WWKC 3OGOE 2X9WA 3EDDA 4KROD 2ILLA 4OQTA 1X5HA 4PJAE 5JXEC 1GZPA 2VABA 1BQUA 4O00A 1EHNA 1TZIB 3KYMA 4LVEA 3QUMB 3JVGC 5IMMA 3RVXD 4ONFL 3AS0A 3VFUA 4MJ6A 2IAMC 2VC2L 2A73B 1S7SA 3T4AA 1NCBH 2VQUA 3HE7A 1LDPH 4U33A 2IGFL 1IC1A 3QIBB 1RUAH 5IB5B 5ITBL 1PEWA 5IWLC 3G04B 3NFSH 2W07A 2VISB 4ODVH 3MMEA 2X4OB 1D5XA 3L95B 3IDJB 1GH7A 1P5VA 2OZ4H 1FO0L 2CJUL 4QF1B 1WZMA 3QEUA 4G5ZH 3MNWB 1A7OL 5E03A 3S35L 2GSGA 1AKJD 2GK0B 4Z77A 1N7ML 1BREA 1F90L 1RHHB 5D7KD 3DYOA 1ZVYA 4FFZL 4KKAD 2W1NA 1DN2A 3U9PL 3CVHH 5C0EB 4GG8B 2KZWA 4ZTOH 4CNIA 1HQ4B 4PJ9C 4OQTL 4ONHA 4KTEL 5F71A 2F54D 2HVJB 3SDDB 3LDBC 2W65A 5EU6B 1JI2A 4DUWA 3D39B 2IJ0C 3AGVA 1QSFB 1G9NC 2DIJA 2GK2A 3FO0L 4MXWL 4NO0B 4TYUA 1Q9OB 5GS2H 4PJDB 1OQOA 4UDUB 3MLPA 2BHUA 2EDQA 3OKEB 4XP6H 4HMEA 1TZIA 3L6FB 3MV01 2VKWA 1J05B 1FGVL 3DYPA 3QUMA 2VDQH 2O5ZL 2A73A 5JHDB 1OVZA 2KDGA 4XBEL 2FB4L 2YPKB 5JO5A 1LO4H 3QIBA 3K4AA 5IB5A 1UACH 4ODHH 5LQBH 3G04A 2HJKB 4KFZC 2VISA 3CXDH 4M6OL 1FRGL 4XI5C 2X4OA 4TOYH 3L95A 3IDJA 4GRWH 3QI9B 1I85C 2ARJB 2OMBA 1AE6L 4QF1A 2DM7A 3MNWA 3G08B 2GK0A 2WM0A 2Y6SD 1ERNA 4WHDA 1RHHA 5FHBH 4DVBB 1F13A 3AVEA 3BESR 1JZ6A 2X1QA 3ZYIA 2IANE 5C0EA 4YO0B 3V0WL 4JFPB 3V4UL 3MJ9H 4GG8A 4PP1C 1QFWH 1HQ4A 4LAJH 2PW2B 2NW3A 2HVJA 3D18B 4O4YL 3GFUA 3SDDA 1JMXA 3CLEH 3OKMB 4HF5H 3CFEB 5EU6A 2F5AL 3D39A 3QUML 2DI8A 5GRJL 1UCBL 4ZUWB 5DSCB 1IQWH 1QSFA 1AHWB 2AP2A 2HTKD 4NO0A 1Q8MA 1Q9OA 2Q8BL 2Y5TB 5KZCD 1D5MB 2D0FA 3LS5H 2B1AL 4UDUA 2CDGB 4YBHA 2VWEE 3OKEA 2GJ6D 1OAKH 1F4AA 3L6FA 1J05A 1CIUA 4L4TE 3VXNB 3RTQC 1I9RH 1KG0B 5FYJD 3TBSB 2R69L 1J11A 4LMQI 5JHDA 4K94L 2QQQA 3TVMC 2YPKA 3BE1L 3IDNB 3KPRD 1KYOK 2HJKA 4FTVD 1Y0LB 3GRWA 5I1AB 3KPSD 4KUCD 4G6KH 1A22B 2XG5A 2X4TB 3QI9A 2ARJA 4L8DB 1U8JB 1NLDH 2JCCF 2NY5C 4WFEE 4EUPG 5C0JB 3G08A 4AQOA 5L9DL 1J10A 1NFIB 1XF1A 4NGHH 4WEBL 2P5EE 1EHLH 2Q3AA 4DVBA 4JG1H 2UY7A 4OCRL 4OCXL 1E4XL 4KI5D 4R4NC 4YO0A 5DJ8B 4JFPA 1RJZB 4NQEB 4LPVA 3MUY1 4BELD 3FOMB 1H3VA 2PW2A 3UO1L 1J5OH 4XPFL 3D18A 1J0IA 2Z92B 3OKMA 2NYYD 2XA8H 3CFEA 4DK3A 2YOCA 1EX0A 4ZUWA 5D72L 5DSCA 4W6WB 1AHWA 1BZ9B 3FT3B 1KJ3H 3RWIB 4PJXE 2Y5TA 4WV1C 3RVVC 1D5MA 5JR1L 3N06B 3HAEH 4JHAH 5DI8B 2NCMA 3FB6B 2CDGA 4I3RH 1IM9B 2DM2A 4J3VA 5FGBA 5F96H 4KJWC 3VXNA 1KG0A 3LEYL 1NAKL 3TBSA 4KDTC 1DUYB 4DTGH 3RGHA 3G6JE 2FO4B 3IDNA 2DBJA 4NKDB 1FVCB 5EBMB 4D0DB 5DD5H 5L0QC 4S1SH 3ELAT 1Y0LA 15C8H 4OZGF 1RZKC 1F8TH 1U8NB 5HVFB 1CGXA 1NMBH 1U95B 2WUBL 2Q8AL 2RR3A 2X4TA 4GBXB 4L8DA 3B43A 1U8JA 2AKRB 3PP3H 4KZEH 1KENL 5C0JA 3ARFC 5FV2A 1NFIA 3UPCA 3IS1X 1W72H 5IMKB 2YS4A 3C8HA 2EDXA 3SGEH 3NIGF 1MLCB 4Z7VE 1PZ5B 3O4OB 5DJ8A 4MA1B 1RJZA 4NQEA 4F8QA 4MJID 5FOBB 5GZOC 3TH3T 4PRNB 3MLTB 2Z92A 4X6DB 4GMTL 1CVSC 1A7NH 2P5WD 1M71B 3MUHL 4JY5L 4LKCB 5FGCB 3GI9L 3EGSB 1BZ9A 3FT3A 3D3VB 3RWIA 1SBSL 4UT9H 1NANI 3PE9A 4HPOH 4XWOD 5DI8A 2VLKB 3FB6A 2XN9B 1G7MB 2WQRA 1IM9A 4KMTH 5IM7B 4BFIB 1P4IL 4YHNB 1QA9B 4BQBA 3V52L 3ULVC 1DUYA 3HE6C 1CGSH 1K8IB 3EJZC 1CGTA 4J3UA 1ZLUK 2FO4A 1WQVT 4NN6B 3ROOB 4NKDA 4LDLB 3OMZA 5D2LE 1FVCA 1IAIL 5EBMA 3NH7H 4D0DA 4JKKA 1T4KB 5DUPL 3QXVA 1KGCE 1IM3B 2FBJL 4Q9CA 3I02B 1U95A 3VDBA 1RUML 3JV0A 4Y5YB 2FEEL 1Z3GH 3ZMRA 4YE4H 3K46A 2AKRA 5EUOE 5LBSH 4LKXB 3FN9A 5DVNA 3WJLA 2VLMD 3JBG7 3T1WA 5E6IC 5IMKA 2YRPA 1X5IA 3BDYL 1MLCA 1PZ5A 5D2NB 5DGQA 3UYPA 1A8JH 3L3OB 4CN6A 4KV5E 5MP6L 3D9AL 2ZUQC 4XCEB 5FOBA 2AV1B 4M7LL 2GEEA 2DMKA 4PRNA 1CCZA 4NM8L 5FDWB 4X6DA 5ADOH 1G84A 3DHMA 3TJHD 4AEHH 5HDQL 2AK4E 1M71A 2DAVA 4IIQB 4LKCA 5GRXG 1JHKL 2WBJD 5KN5B 3EGSA 3D3VA 3ZE2F 4P46C 3O4LB 3V5HB 1DBBH 4BUHA 2BDNL 3U4AA 5FCUL 2VLKA 3DVFA 2XN9A 1G7MA 1KCVH 1YEEH 4H88H 4BFIA 4YHNA 1QA9A 3VDCA 2WK2A 1ACYL 5GRWA 1K8IA 4F57L 4DQOH 5DRZA 3ROOA 4J7RA 2V5TA 1P4BL 3T0EC 5C2UB 1T4KA 4PY7B 1IM3A 4XCNB 3QQ3B 4XHQA 4RA0C 2ZOKB 2ZKHH 4GRLC 4G3YH 4YAQB 3I02A 4NZRH 4Y5YA 4RBPH 5DMIL 3SDAB 5BZDB 4OAWB 4HBQA 3IETB 2EYRB 4LKXA 4XPGL 4HMDA 4MD0B 3DMMC 3HMWH 3A6CH 1FIEA 4PJDF 4ZTPL 2R15A 4U6VL 3MRFB 1J0JA 5SWQB 1BD2D 5B38B 3TBVB 1UZ6E 3NA4A 1UB5B 4LASL 3TJEL 5KS9B 4FQ1H 4MCYB 4K3JH 5D2NA 2R0LH 3L3OA 3SQBA 4Y5XC 1E27B 4XCEA 2DQDH 2AV1A 4NOFA 1H3GA 1MAJA 4JREB 1UM5L 4M7ZB 4MQSB 2PYEB 2A9ML 5FDWA 5HI4C 1H15B 4PJ8C 4LVNC 4R8WL 5F9DC 3VE0B 3M07A 5ESQA 1NC2D 4OD1H 4OLUL 4DW2L 5C0FB 1FLRL 2M8XA 2D03L 4IIQA 1NGQH 5KN5A 2CKBB 4DVRH 1AP2B 3O4LA 3V5HA 5HI5C 1R5WA 3IDYC 4AIXA 3BO8B 2JIXB 3FAXA 3TWCL 1S9WB 2DD8L 2E9IA 1TLKA 4MA8L 4G6MH 3OKNB 3U2SB 3B6SB 1WSST 1GGCL 1IBGL 1RUKH 4H8WL 1RD6A 5A2JH 2DQUH 2VH5L 4F9LC 2OQJB 4ORGB 1CZ8L 4PBXA 3R8BB 1ZGLM 2AERT 4ZO8A 4PY7A 1CFTB 5J6HB 4XCNA 2GUOB 3QQ3A 2F54B 2ZOKA 1BP3B 2MSPA 4WU7B 4YAQA 1KCLA 1DBJL 3SDAA 5BZDA 4OAWA 3C87A 3HN3A 5C07D 3IETA 2EYRA 4R26H 4BZ2H 5F1KC 1XAUA 3MLXH 3QB7C 5DHYB 2BXYA 4NUGL 3MRFA 3UDWA 3OV6A 4LLYB 1EH9A 5SWQA 5B38A 3TBVA 1UB5A 3GNMH 5KS9A 3HI1B 4MCYA 3SE3C 1E27A 5J06A 4P9HH