2HRLA

Siglec-7 in complex with gt1b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
116
Chain Sequence
DYSLTMQSSVTVQEGMCVHVRCSFSYPVDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sialic acid-binding Ig-like lectin 7
publication title Siglec-7 Undergoes a Major Conformational Change When Complexed with the {alpha}(2,8)-Disialylganglioside GT1b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 27
structure length 116
sequence length 120
ec nomenclature
pdb deposition date 2006-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hrlA00
1U8OA 4HIJA 1BEYL 1Q94B 3VRIA 4GQ9L 4XPFL 2E7HA 4EUPG 3MC0A 4X9IA 5C9KA 5I6XC 4KZEH 3QQ9D 5F7EL 5HBBA 5DMIL 1F13A 3KJ6L 1GSMA 5GRYA 4JY6B 3CFJA 4YHZH 2YD8A 3CZFA 3U83A 1K4DB 3EYOA 4YHMH 1PFCA 1VFAA 4YHKH 5F89A 2VC2H 5HHOB 5IMMA 3V6ZB 1MRDH 2B1HH 4K71C 1S7WB 4UT6H 1CDYA 4U6HB 4MXVE 5C0IB 2YD4A 1HIML 2A1WL 4LEOA 3NCJH 1WZMA 4I3RL 5D2LF 4ZUSB 2OM5A 3MXWH 1I3RB 3U9PL 5FYLE 5D1ZD 1W72L 1VEMA 1JMZA 5GSVA 4JG1H 4WHDA 4U1GC 4PJHF 1K6QH 4KVNH 2QLVB 3MRBA 3UPCA 1T6WA 4XHJD 5FYJH 2DQHL 1E27B 3LRGA 1YNTA 4OSUL 2ED8A 4HMCA 1DUYB 2VYRE 4TSAH 3L7EB 4N1CA 5C0AE 4YHPA 2YPKA 3B83A 5DJZA 4C58B 4HEPG 3CVIH 1MHHB 1MUJA 1I7UA 1E4XI 3WL9A 5FB8A 2UZYB 1MPAH 3IDYB 1FH5L 1CG9A 5IBUG 3UPAA 1MCEA 4Y1AE 1TZGH 3GUTB 1L7IH 4XCCL 4WO4B 3UTTB 2UZIL 5FO8A 3I3DA 4WHYG 5DO2C 3K7UA 3O3AB 4FQPA 5GGVY 1GGBL 1DEDA 2LFGA 1LO0H 3CH1B 2M26A 1U8MB 2ARWA 4HWUA 1M71B 5FOBB 2EDYA 5BV7B 5DTFB 5I1EH 4ALAL 3ARFC 3CMGA 3MROA 1A1NA 5LJYH 5IWLA 3FQNA 1YDPA 3MLXL 4P9ML 2AV7A 4HFUL 4PGJA 3N0PB 1GL4B 5ELIA 5FYLH 1AO7E 1DN0B 3O6LL 2E6JA 2VUYA 1D6VL 3WIFA 3IVKB 5L9DH 2QADD 4GRMB 4U1MA 2KBGA 4NO5B 1KCVL 2VDLL 2Z35A 1CBVH 3RNQB 3REVB 4DOHE 5BQ7B 1UYWH 2FX8L 1G9EA 1AIFA 1MJJB 3WIHA 1K8IB 4RWYL 2EE3A 4WNQA 2BFVL 3TIDB 4KGLA 5MP6L 4GXVH 4XVJL 2EEBA 4TULH 5F93C 5DHVH 3ULVE 4IIQB 1H0DB 3P11L 4K9EC 3L3JB 5AEAA 2YSSA 4NRZA 2DWEA 4XNZB 4R4BB 5A3ID 1AGCB 3MBEB 1WIUA 3IDGA 5D7LB 1FZKB 1L7TH 3QJHB 3G9VA 4HC1L 3OKMA 1CFTB 3WXWL 2XA8L 1J0HA 4I0PA 4ZXBA 1V7MH 3MA9L 3DRQA 3KPNB 3KS0H 1IBGL 1EAPA 2R4SL 2VTFA 1ETZB 5B3NA 4X7FC 2D9QB 3HC4L 1WTLA 4JY4A 4NQDA 3RDTA 3SE4A 2AJYL 3A6BH 5C0CE 1UXWA 1DQTA 3H3BC 1EXUB 4WFGD 2AEWA 5BMFL 1AC0A 5KJRH 1CQYA 4QY8B 2B5IB 3EYFA 2IBZY 4U7KA 2PO6A 5M94B 5EPMB 1OP9A 3BPLB 3IXAB 3MRGA 1F58L 2GT9A 3CDFA 4ZUWA 4R3SA 2YD7A 1B4RA 4QXGL 1EGJL 4IRSA 1FNSL 3TIEA 5CIPB 1XZ0A 4GW4B 5DJDA 3KPQB 4Q97A 2ZG1A 1F3RB 4Z7OE 5D7IE 4I2XB 4QRSB 3GSWA 4JO1L 2UWEE 4R97B 1ORSA 1RY7B 3ULVH 3VFUB 1P7QA 4NYLB 4TNVF 5CZXD 3FL7A 4PTUA 4NWUH 2P5EA 1FQ9C 5ADOH 4M7JL 3VRJA 4R90L 2VDRL 4P2QE 4FQ2H 1R5WB 3FB5B 5IGXH 4ZPTB 4U1SB 2Q7YA 2P5WA 3O45B 3PWLA 3HZVA 4RGNC 4WGVB 5JXEC 4OAWB 5C0EB 4YXLL 1A1MB 2GK2A 3FQWA 4PJ7E 3QRGH 3FJTA 3PABA 3V0VB 3PWJB 2DM7A 3NZ8B 1CFNA 3X14A 5EU5B 2DM4A 3P9MA 3GEWB 3MUY1 4LKXA 4UDTB 1BLNA 4LRNL 2Q3AA 5DK2A 4Y88A 4RAUB 4I5BA 3SOBH 1K8DB 1T4KB 4KKAC 2EEDA 1ZVSA 3LEXB 1GPOH 5DD0L 3D39B 5J9PB 1MCOH 2IMMA 3PDOA 4PUBL 1A6VL 1DVFA 3VWJC 1KN2H 2R29L 2FEDD 3BP6B 2VXUL 3PDGA 3KPRD 5C3TA 2GCYB 1KXVC 1WK0A 1NDGA 4PJGE 5DC0A 3ULUH 4DZBB 1YJDC 3KR3H 3RU8L 1KTLB 1FBIL 3QULA 4XVSH 1HCVA 3FAXA 1LNUB 4CUCA 5C0FB 3HZMA 1G6VK 2DIAA 4ZOEA 1X3DA 5D6DC 3BQUD 3P3YA 1GXEA 4NQSA 1DCLA 5CFHA 4Z8FL 3HHRB 5T5FH 2QSCL 4HUWB 3N06B 2VLMD 3V7AG 3HN3A 3BE1L 4K2UH 2DQUL 3TT3L 5GS0L 3RVVD 3LV3A 2A83B 4OIIH 4Y4KB 3ETBF 1SEBA 2ADFH 4X99B 5FO7B 2ZOKB 2BSSB 2XN9E 4E0RB 3BIKB 3DO3A 1Y6MR 4AL8L 2X4PA 4X6CB 5DHVA 1EVUA 5E2VL 1JZ2A 5C0AA 2I9TB 2IANB 2VABB 5HHVH 4LFHG 4H5SB 1KB5L 3SGDH 2GQHA 1JGLH 1P5UA 4HW6A 5BOZG 4F58L 1XIWA 5AWNL 1GZPB 1RPQA 4OFVA 4WUUE 1WIOA 4Y1AA 3VD5A 3TWCH 2MQCA 3L3DA 5HGHA 1G7QB 4LL9A 3KPOA 4OF5A 1J8HA 3LS4L 3BD4A 3THML 1S7QB 4UI2A 4MQ7A 3S5LG 1W72B 3PGDB 5DJAB 4PJFF 3S36H 4G5ZL 5B4MD 4GUPB 1HXYB 4LDOB 3WS3B 4BM7A 1EVTC 3QQNA 3H7BA 3OKKA 3UYRL 2ZJSH 2XFXB 4LSTH 5KANI 4IOIB 1EEYA 4NQVA 2X4SA 4J4PD 4PTTB 1P6FA 4JVUA 5INDA 2AS5M 2FGWH 2DQJL 1T22A 4OGXH 2IBGA 3IJHB 3G5XA 3VG9B 3IDUA 4GKSB 3MJ7A 3O3EB 2NX5D 2NLJA 4HZLA 1NJ9A 1MVFA 2XKUA 4PRPB 2BY2A 1AO7A 5TGBB 4TUOA 2VQ1A 4JM2A 4KU1A 4HBCL 5GS1C 4JFPA 4P4KC 4JFFB 4JFDE 1AR2A 4JFHE 3RY6A 1IGFH 3K3QA 4XPGH 1U91B 2D7MA 4X6EB 1HDMA 3AVEA 4YHIB 3CFKA 1CL7H 2R9HD 1UH2A 3G5ZB 3UPRA 1ACZA 4JPIA 1CT8B 5B8CB 4YHLH 3O11B 3P40A 2AABL 2DQDL 5TE6L 3WD5L 3QRFM 2R8SH 1NLBH 5CZKA 1RIVH 4GXUN 4BQCA 3AMLA 3FO1B 4NQCB 1CGVA 2EDNA 1FGNH 1IQWL 4NBYB 3M8OH 3PXHA 4QHUB 4UDUA 3WHE0 5J12B 3TVMA 2R2EB 5IJKA 3SDCA 2G75B 2FRGP 1AXSA 2UYLB 1X5HA 5L2KD 2ESVB 1CGXA 5C6PB 5FM8A 4MWFB 1X5XA 2HFFA 2YPVL 5B38B 2CDEB 3WFDH 1EHLH 4NO2A 3QUYD 4JO3H 5EC2A 1AHWA 4KROB 5JOFB 3VXQB 5J13C 3FFCD 5CINH 2EYSB 5I15H 1IGIH 1IAII 4Y5XB 4YDVB 1QO3A 5C0CA 1I3GL 4NSKB 1MCWW 5E08L 2XWTB 1NANI 4GAYA 3EYSL 3VWKD 5TH2B 1UWGL 5IT2H 1IGML 4HGWA 4U6VL 1RIHH 1C08B 1UC6A 5E2UL 1ZE3C 4KK6D 1U93A 4OM0L 2FYYB 3PE9A 2P45B 2B2XH 4I0PC 2V7HB 4JHWL 4ZXBC 3QI9B 2PW1A 2FDBP 3ZSSA 2VLLA 4EN3A 4ELMF 1DANU 5I16B 2GK0A 1T2JA 3RPIA 1KPUA 5I1DA 1QFHA 2EDFA 4U6XA 1FDLL 5EBGA 5FUOH 1VERA 4YAQA 1N5AB 1U8KA 4XBEL 3L3KA 5D7IA 3C6SA 4KGJA 3RDTC 1RZGB 3SE4C 3KYKH 3QG6B 2UWEA 2CRIA 3QQ3A 4XTRD 3NVQA 3RI5K 4NNYA 1CDBA 3W2DL 5IHZB 4CN4A 1LO2H 4WW2B 1IC1A 3CLFH 2P7TA 2PO6C 5DVNA 3I50L 3RZWA 4U3HA 1AI1L 4U1LB 3MLZH 4B7IA 5HVWA 4P2QA 1YQVL 1DLHA 1JTTA 3WFHA 1A6WH 3TH2T 2M8XA 2Y06L 1OAKH 5EU7E 1JPTL 3SDDA 3IAQA 4K94H 4L9DA 1AGDA 3FAWA 4OLWL 4WJ5B 4IRSC 3BKMH 2ZCHL 4JFXB 3O9WC 1JRHL 4PJ7A 4WHTA 1UVQB 3QH3A 1JNLL 1RZJH 4FQCH 4EEEA 4EDWH 4F9PA 3ZT5A 4KKNA 3DX7B 2WNGA 4OD3H 5SV4A 4ZS7H 4D94A 4JM4L 2Q8AH 1A7BA 3SGEI 2YXFA 4UOW0 1BM3L 4OKVB 2BY3A 1LK3L 1MNUH 5F6IB 1SEQL 4UQ2B 3GJEA 4N0UB 4XNMB 2W07A 1A64A 2H26B 3M1BB 4AIZB 4P5TD 4U0RB 3JUYA 3HZKA 4BZYA 4JDTL 3GIVB 2FJGA 4HK0B 3T3PE 4OJFL 1RJLA 2CIIA 4OZIF 4LSQH 1IT9L 4RWHA 1P7HL 1HWGB 1XR9A 4PJGA 4OD1H 5GGVH 3WIIH 3RAJH 5T1MA 3OAYH 4PRBA 4WI3A 3W0WB 3PWNA 4PLKD 3VXUD 5E7BA 2YUZA 4UTBL 4OT1H 4WEUD 2P48B 3O4LE 1UA6H 3HPLA 2R0ZH 2NY4B 4DAGH 2JIXA 3F7RA 2XQYK 3LSOB 1DVFC 4XAWL 4HPYH 3MXVH 2WLZA 3O2VH 1NMBH 1H9VA 3LB6C 2LE9A 5I18H 5D1XB 1YC8A 1RVFH 5GGSY 4IRZH 5H35B 4N8VB 1JPSH 4OZGE 1TTGA 3V5DB 1TIUA 3MUHL 1A4JB 5IHBA 3WFCL 2HFEA 3VD3A 4I77H 4XPTL 3AS1A 4OB5L 2QQKL 5K9QI 1RK1A 4MMXC 2XN9A 4FZEL 5DVLA 1E4KC 3I85A 3LQZB 1T0MA 2DQIH 4X6BA 5F1NB 2QEJA 3S88L 1P4BH 1LMKA 3JZ7A 3ZDXF 2AGJH 4RX4A 3U1SL 2EH8L 4XWGH 4FMFA 5I76A 5J56B 3V9FA 5GGRB 1UKQA 4WUUA 4FFYH 4XMKH 1AGEA 1MHEB 4L9LC 2BSED 1FVEB 2DLFL 3O0RH 3MV9D 1JN6A 5IQ9A 3OAZH 1XGRB 3VXNB 1MFEL 3IJYB 2AXJA 3QUXC 5CSGA 3FRUA 4ZPVA 3N1QC 4JRYD 4OCSL 5EIQA 1MCDA 3DUSA 5E5RB 5HD8C 4Y4FA 3AC0A 1IAMA 3OGCA 1ND0A 3QDJD 1C5BL 4G8FA 3EJZD 4TVPE 3HA0A 3L3OA 2CLVA 5ESQB 4ZQKA 3ARED 4HWEH 3K1DA 3QO1A 4M61B 2ZUVA 1QVOA 1RHHB 1IAOB 1KB5B 1N59A 3S37X 4PREA 1R5VB 2HT4C 5F3HA 5ID1B 4KHTL 1JI1A 4U3XA 2YN5A 1BFTA 4I48B 1T04A 4M6NH 2ZNWA 2ZSVB 2R56H 3CZJA 4JFDA 2DQFA 4MJ5B 3REWB 5FM5M 3MMEB 5IBLD 3VH8G 4LSVL 3AROA 1HH9B 3X11B 4OLZL 1H8NA 5KVFH 5IJVA 2V2WB 4QRRE 3MBXH 1IC4H 1MHPL 4CADA 2VE6B 4JGMA 3RIAK 3PQYB 2O5XL 3R0NA 1NUFA 2G2RB 2H2PC 4GKZB 4YHYC 3VCLA 3BX7C 1DUZB 3QFJE 3D0LB 1WBZB 1RZKL 4PJFB 2OZ4A 3NFNB 3ZE2F 4M48H 1VACA 4L3CB 4QTIH 4JM2C 1T1WB 4L3ED 1SJHB 3RY6C 3ES6A 4MHHI 3SKMA 3U6RA 3BXNA 3LD8B 4OQTL 1ES0B 3T04D 3BP4B 3IDMB 1QHOA 3ULVC 1FG9C 2EXWD 1D9KC 4LLUA 3C8KA 1KNOB 1Q9OA 2KH2B 4PS4L 5BXFB 5K9OB 1ZVHA 1KEGH 8FABA 4Z0XB 1QRNE 4LU5H 3TO4C 2HP4A 3MRLA 2FLRT 4JR9H 4NCDA 2BRRL 2Y07H 3G5VB 3TVMC 1HXMA 2ZOLB 4P46B 4KAQH 2X4NA 3SDCC 4UV4H 1C5DA 2X4RA 4P3CH 1G7PA 3V0WL 1T5WA 3OPZH 3LN4A 2HLFD 4HV8B 3DIFA 4JFQA 4JREC 1AHWC 5TDOB 2N7BA 4HJJH 1KENH 4MCZA 2RFXA 3RZCA 1IZJA 5I1CH 4W6YB 1CF8L 5FV1L 4MZ3A 2YD1A 1JZ4A 2D03L 5F88B 1U3HB 2MPAL 4QCIA 4LPXA 2V7NA 5BZWA 1EHAA 2NW3B 3BAEH 2AQ1A 1FFPB 5DRNA 3EHBD 5EZLA 3M17B 4EN3C 2XKNA 5C9JB 3RWEB 2BC4A 1GJIA 2NYYC 4JQVA 4Q9RL 2HVJA 5FCUH 4KI1A 3B9KB 5CJQL 1F4YH 1I9IL 4P5MA 5JW4N 1V3JA 2MQ0A 3AY4A 1IQDA 1V7NH 4HMDA 2NY6B 1HHIA 2MHAB 2IWGA 3PGCA 4OLXL 1D5MB 1W2KT 3ZLQC 3OJDA 5DEZA 5HVHB 1FYHB 4ELMB 3QUZB 3QB7C 4P5KB 4BQ9A 3SDDC 3QP3A 4K8RC 4AM0A 5FHAL 4HS3B 3FQRA 5J1AB 5HHOD 2ED7A 1RUQL 2P8PB 5DGQA 5H2BB 4R8WL 3NH7H 5AZEL 4HDIB 3RUGE 4F9PC 5GJSH 2F53B 5KSUA 3TBTA 4M1CD 4H8WH 2F74B 3PP3H 1FZMB 4G7VH 4JB9H 4PJIE 4JLRB 2AJXL 5HGDA 2WBJA 4GG6B 2DQTL 1H5BB 5BS0B 4LLVA 3L7FA 3V6BR 1EPFA 4CBPA 4HKJA 3PHOB 3O4LA 3ZKQD 4KKCD 1WFOA 5CLTA 5D1QB 3T0EE 2GYSA 1GGIH 3WDJA 5JA8B 4QRTA 3T2PA 5GZOD 2JKXA 3FQTB 4AMKL 2BMKB 5JNYB 3HR5B 1KIRA 2M2DA 1B90A 4TUKH 2EIZB 5DZNA 4HWZB 4YHNA 4Y19E 4PJAE 3UTQB 2C4FT 4OZGA 4Q6IC 4RMRA 4NKIL 3JWOC 4WENB 3O2WH 1QBMH 4M5YL 1CXLA 1EEUA 3K74B 5I30L 4WI9A 4OZIB 2IG2L 1LO4L 3EYQD 1MCLA 3PGFL 1UM6H 2GY5A 2HAZA 3ARVA 4LNRB 3BPNB 3GJFK 1N5YL 4QHKI 5TQ2L 3MRIA 4FFWD 3P4NA 4JFEB 3ARRA 5I8EB 4ONHA 4UIMA 4XX1E 4UIKH 4XCFH 4NJAH 1TNNA 3NN8A 4Q0XH 3WS6C 2Z0BA 1OAZL 3LEYL 4CN1A 1R24B 2VLKD 2VDOH 3PWPB 1MELA 4P9HH 1U2CA 1RSFA 3QDMD 1EFQA 1NGZB 1XR8A 4L4TB 2G5BB 2H32H 1ZLSH 1QD0A 2XZZA 4KRMB 1OP3K 5DRZB 1MCPH 2DBLL 2Z93B 1A9BB 5DQJB 2XWJB 5MEOB 5F7HA 4YPGB 1MLCB 5HPOA 2VOTA 3UYPA 5EO9B 3FO0H 3OKNA 2P8LA 2E7LC 3DVIA 3LN9A 4UQ3B 1CXFA 4MNGE 1A1OB 5CILL 3S35L 5TFSL 3DX9B 2FL5A 1FNHA 2QJDA 1NMAL 3ARDB 4K9EL 1CK0L 3QEQB 2B7DT 1DBKH 5EU4B 3RVWD 4I8DA 3MSPA 5HVFB 1CE6B 3DXAB 2GJZA 2QHRL 2I9LB 5CZVH 5D7KD 4Y4FC 3PIQB 1LE9B 5F7UA 3MBED 3BPCB 5D7LD 1EIBA 4H26B 4PJEF 2BVTA 4LPCA 1BD2B 1J0ZA 4LLYA 5KSBE 3IFPB 3U4EB 4PB0L 3QZWB 2JELH 4MS8D 1NDMA 1KCKA 2FH6A 5I75B 4QF1A 3QFJA 1KIPB 4J8RA 4QNPE 4A6YL 3NABH 5I73C 1HSAA 1R3JB 2W9DH 3QAZC 1PGRB 1BFVH 3OR6A 4QTHA 3GBNL 1A6AA 3HFMH 3A6CH 4S1QL 3L3HB 1ROWA 3RKDC 5DURB 3MJ9L 3EOTL 3P4OA 1FIGH 1GAFH 1A5FH 1BJ1H 3W11C 4FRWA 3MRKB 3O6MH 1S7TB 3LIZH 3KWWA 1PSKL 4F57H 2VQUA 1NH6A 4ONFL 4HS8H 3N85H 35C8L 1FN4B 3IETB 1KXQE 3T3MF 4KJWC 3U2SA 5KVGL 1QSVA 3HMWH 1U95A 1TQCC 2C3GA 1RD6A 1BF8A 5C6WH 2N7AA 1CVSC 4CW1A 1HH6B 1RZJC 2CKBL 2X1WL 3FQXA 1YY8A 5I8CB 1TVBB 2X41A 2DYPB 5DQDL 2A73A 5IMOB 1GIGH 4OZFB 4F7CB 3CSYA 1SJVA 1UJ3B 1A9EB 1RIUH 4KXZI 1N0XL 4Z7WE 1C16A 3ZDYF 4MLIA 1TETL 3F5WB 4U2ZA 3IT8D 1VB9A 1QPPA 4JKKA 3IAGC 5GIRB 1I1FB 4P2CG 4YZFE 4JHAH 4IM8A 5JO5B 5HGAA 1EJ6A 5E8PB 4XP1H 3GM8A 4AENA 3MJ8B 4UILL 5F1SA 1TVDA 5F44A 5C8JA 3RZCC 3L1OH 4HK3J 3F7YA 1DBAH 2X89A 5IM7A 3GZKA 4I4WA 1KPRB 3GHEL 2HWZH 4YFDB 3CXHK 4KC3B 5HHNB 3V4PL 3F12A 5GGUB 1T1XB 5EULV 4DW2H 2NXZB 2V5TA 1TZIA 4S1RH 5F9AC 1XCTB 5EU7C 1P9MA 2XV6B 3BEWB 3SO3C 3OX8B 4GLRH 1BGXL 5EDXA 2ITDA 4R7DA 1JWMB 3QPXH 4ZDHA 3TN0B 3I84A 4NO3A 4MD5A 3RUGA 4LKCB 3OF6A 3MNZA 3AY4C 3AAZB 5TDNA 4DKAA 1INDH 3KXFE 5ITFA 2FIKA 2C7UA 4LCCA 1JGVL 2VXSH 3QIWC 4R26L 1NL0H 4PJIA 1RJYA 1UXSA 1BBJA 4JKMA 1AQDB 1DQQA 4O9HL 3M45A 4OF7A 2KQNA 3CPLA 3BH9A 5FGCB 3T0EA 1FNFA 2C3WA 3E8UL 4LAJH 2FX7H 5I6XB 1AGBB 4KK5D 4TOYL 3U46B 1VADA 4Y4KD 1RU9L 3P73B 1UENA 4L8SC 2EDDA 3Q5TA 1IEHA 2EXYD 3F58H 4Y19A 4PJAA 4PD4J 3ROOA 5CEZE 5DD1L 3P30L 1IKNA 2ID5A 2C1OB 5EN2A 4K71B 2IAND 4YGVA 2BOCB 1FGVH 3MCLL 5GS2D 4RISL 3EYVA 2EO1A 3BVNB 1XF4B 5HGGS 3FZUC 1A6ZB 2AXFA 2HVKA 5GRXG 1HHKB 1P4LB 3BP7A 2D31B 3D69B 4XPAL 5GQBA 1BVKB 2XXCB 5EBMA 1MREL 4JKWA 3QUKB 3WN5A 2VL4A 4LOUD 4U1GB 3VXSE 1IE5A 2VLJB 2JJTC 4QRPB 3BESR 5IG7A 5EO1B 4U1NB 5JHLH 4LHQB 4Z7NE 5EBLA 2XTJE 4QXUH 1T0NB 1XGPA 4BH7A 4NQXB 5TF0A 1U3ZA 3WJJA 4I9WD 4PGDB 2FO1A 1ZS8B 1A02N 1JNNL 1A14L 1KCUL 1AR1D 1TITA 3L6FB 1II4E 1Q72L 5E56A 2W1NA 5BZDA 5HHME 1HNFA 1G0DA 2FZ3A 4WFEE 1XCQB 3C5SA 2APVA 2R0WL 1JFQH 1RUAH 4PRPD 4XCYB 1H15B 4N9GA 1C5CH 2MCPH 5HJ3B 4O2FB 5F6HI 3MACL 4JFFD 5I0DA 3MLRH 1P1ZB 1W0VB 4NOBA 4QRQB 5KN5A 5CUSL 1JHTA 4MNGA 2A77L 5JW4M 4G7YH 4RGMB 3UZEA 5CEZH 4YDKH 4BFIA 1CXEA 3KLHD 3MLYH 5EZIH 5D72L 4ZS6D 1FZOA 1W0WB 1FC2D 1Y0LA 4FQJH 3ARFB 2DQGH 3BEVB 3MNVB 3VFPB 3WUZA 1TQBC 1YMME 4NQCD 5JW4R 5IF0B 4G42B 2AV1A 1E28B 1DQJA 1X5KA 3C6LA 5I1HH 3SDAA 3LRSB 1B6UA 4M7ZC 3VMOA 5E00B 3WIHL 2ESVD 2Y6SD 5JXAH 5I2IB 4ONGH 3Q5OA 1E4JA 1XMWA 4GAGH 1S9YB 2ZUXA 1H8OA 4KDVA 3HG1B 4MB3A 3C8HA 4CVXA 3JWDC 5HDLA 2HT3C 1QKZL 2A6KA 4I3SH 1YECH 1XGQA 2AEQH 2DF3A 2CMRH 1FFQA 4DKFH 2NZ9C 4IMKA 2YRPA 1IILE 2W65A 4GMTH 4PJBE 4UINH 4U1HA 5GZND 1L6XA 4XHQA 1CGSH 1C12B 2GITA 5HI5D 1I8IB 3GMNA 4FTVB 3MRQB 4X0KB 5JORA 2BSRA 3ZMRA 4RGOL 4LRIC 3QI9D 3WCYA 2DJ4A 1KLGA 3E6FB 5BVJA 3PG2A 4FZ8H 4ODWB 4LLWA 4JPVH 1D5IL 3VD7A 3DO7B 2R2CA 5I1AB 4IOFC 3UO1H 2XICA 4N1EA 2IPKB 4L5FL 3S4SA 1MFCH 3CMOL 4KPHH 3VFWB 5KG9B 4ZTPL 3V4VH 2X4UA 3UJIL 1KC5L 4MSWA 2VN7A 3U48A 2GIYA 1N2RA 4G9FE 4OZHE 1BZ9A 1FO0A 4XI5C 3SJVA 2FX9L 1ZHBA 2EYRA 5A16A 5JTWA 2YHGA 2YPLB 5GGRY 5FUZL 5ISZB 4LCUA 4Z7WA 2CO7B 3DYPA 1TJIH 7FABL 3LQAH 1XF5B 2W9LA 5E8DH 3SQOL 4HIIB 3Q6FB 1LP9E 3KPSD 2OCFD 4YHKL 2IQAA 3HAEB 5DQ9B 3L5JA 4PY8J 4TSBL 1IGTB 5B22A 5J1TC 5F1IB 3D39E 4CRPA 4TSCH 3VGFA 4GS7C 1J1PH 4H8WC 4MD0B 2OLDA 5EUOE 5CP7B 5DT1H 5DVOA 5AYQA 3MXWL 1I7RA 4YX2H 4NJ9H 1DJSA 4D9LL 5F7MC 2VZUA 4XP9H 4D9RE 4HJ0C 3VXRB 1OAXL 4JG1L 4GKOA 4O2EA 4RGNB 3DGGB 1K6QL 1Q8MA 3X12B 4LARL 5T1LB 5HYSB 5FYJL 3CGTA 4UV7L 4XNYH 2CIKA 4OF8A 1BZ7A 1LK2B 5T1KA 3MNWA 1RFDL 1I3VA 3W0WD 4ZYKB 1NUDA 5IB1B 4IRJA 4HQQH 3SGKA 3HNTH 1CD1A 3KXFA 4BZ2H 3CDYA 3EOBA 2DD8L 1R3LB 3DOSA 1IL1B 3MRFB 3MREB 4E5XB 5I71C 1CIDA 1PKQE 3VWJB 5D1XD 1F8TH 1FFNB 1YEKL 4MXVF 1BVLB 2OR9L 2NTFA 3C2AH 1AP2B 4LHUA 1R0AH 1P9MC 1UEMA 4GJTB 3NTCH 4NN7C 3P4MA 3DTXA 5IEKB 4X6CE 5DJ0B 1ED3A 1OSZA 4DVRL 1NSNL 3D6GA 3AXLB 3FT4B 4K3JL 5IB5B 1L9NA 4KVCH 3GKWH 4YUEH 3TCLB 3WUWG 4FQQB 3LMJH 4LCCC 2FR4B 3UBXA 4NQEE 1U8OB 4HIJB 4NFBA 1JF1B 4E9LA 1ZEAL 5FYLL 3WFEH 3VRIB 2EC9T 3MGOA 5D96C 2O5YL 3T0EC 4JRXE 1NMCC 4OGAD 5L9DL 1MCBA 5AAMA 5IVNA 1UB6A 2RCSL 3CFJB 3VXSA 3CZFB 3ZKMD 4NN5C 5GS0D 3EYOB 5KW9H 1VFAB 4DKDC 1YNKH 5F89B 1U3JA 3U0WH 3L95A 5IMMB 4RFOH 4W4OA 1IKNC 3S9DB 2HTKC 4TUJA 3F62A 4FQ1H 1JHLH 2AXGA 1Z9OA 5ERWA 3DHMA 4LEOB 1JGDA 4GQ9H 3Q2CA 3D85A 1ZGLM 2QR0A 1V7ML 5F7EH 2Z31A 3KJ6H 1WJ3A 1BQUA 1GH7A 5GSVB 3WN5C 1IRAY 3MRBB 4PR5A 5E9DE 1X7QA 4NC2B 1PW3A 1YNTB 1S7VA 3A6BL 5GS2H 3ALPA 4URTB 1PG7W 5DJCA 3F7PC 1HIMH 5CKGA 4JM2F 3WJJC 4XNXH 1MSPA 4G6FB 4YHPB 3SEPA 2YPKB 3VA6A 4I3RH 5DJZB 1CIUA 3CLEL 3PQYD 5D70H 1CXKA 1MUJB 1I7UB 4ONOA 4FG6D 3WL9B 5FB8B 3O41A 3U9PH 1CG9B 1YMMA 1W72H 1OAYH 1A7OH 1DBJL 3ULVF 2BNQE 3RWIA 3V5KA 5FO8B 1SBBA 2BNRE 3V95A 2BVYA 1MVUA 2DQHH 1OP5H 4G8EA 2CXKA 4ZO8A 3VGGA 4MQXD 3ZE0E 4WW1A 4NWUL 4O02L 5ADOL 1U8IA 1KFAL 4LGRB 1JZ6A 3EW3B 4DJMA 3MROB 1FH5H 1A1NB 4F8QA 3FQNB 4KH2A 4PJBA 1YDPB 4XCCH 2AV7B 5EZJA 3FOMA 1HI6A 2X1PA 3VRLF 4P46D 2UZIH 1KYOJ 3ZL4L 2GSIA 3SDAC 1XH3A 3C9NA 3WIFB 1K5NA 4JFYA 3GMMA 4U1MB 3AM8A 1GGBH 1IGYA 2X4OA 1FHGA 2Z35B 4HUVA 4A2LA 4APQD 2OI9C 1OARL 2VDNL 4RAHA 4RSVA 5KSAA 1G0XA 1AIFB 4WNQB 4PJ9A 3CX5K 1IGJA 2EXWC 5IMKA 4G9FA 3INUL 2QSVA 3ULUF 4NOFA 1MCOL 2VLRE 2YSSB 4NRZB 1BVZA 2DWEB 3EJJX 4HFUH 2QHLA 3IDGB 4Z7OF 1U3HD 2VAJA 3B9AA 4FFVC 3B9DA 2UWEF 3O6LH 3OKMB 5CEXA 2XRAL 1D6VH 1UM4H 4I0PB 1UQSA 2CK0H 4ZXBB 2CRZA 2BX5A 2VDLH 3DRQB 1LP9A 2FX8H 4BFBD 4RWYH 4MJ6A 3B9KD 1A3LL 2N56A 1G7MA 5MP6H 2NY6D 5ENWA 4E41E 4JY4B 4NQDB 3RDTB 5MENE 1FNAA 4PJ7F 1UXWB 2XPGB 3VFGL 5GISH 1VFOA 4R2GC 1T6VN 3DI3B 3QCUL 5EUOA 5T5FL 3TJEL 4EKXA 2YD2A 3EYFB 4W6XB 4K8RL 3RVUD 2PO6B 3QUZD 4HC1H 3MRGB 5HYQA 4K2UL 3WXWH 2GT9B 3D1MC 2XA8H 4WI8A 1G7HA 4ZUWB 4R3SB 2XG4A 4D0CA 2JB6A 5ICZA 4CVZA 1JE6A 1MQ8A 2ADGA 4IRSB 4JCLA 1IBGH 2R23A 3O9WB 2D7PA 3TIEB 2R4SH 2F53D 1XZ0B 5DJDB 1NC2A 2NY5H 3MV01 1YEFH 3HC4H 1L6ZA 4KV5E 2AJYH 3GSWB 4OV6F 3I9GL 1ZGLA 2X10A 1ORSB 4N68A 1LVEA 5MHSE 5D7SH 2QQNL 5BS0D 1P7QB 4PJGF 3KNBA 5L88L 4PTUB 4P23A 2P5EB 2CJUL 3GI8L 4NNXA 3S3SA 5D1QD 3VRJB 4BSVA 4D8PA 1YY9D 1F58H 1U8JA 3TWCL 3DVGA 1QNZL 2P5WB 3G6AA 4TQEL 1CLYL 2Q7YB 43CAA 1EGJH 3PWLB 3PHQA 3HZVB 2VDKL 1PKQA 5HI4D 1T89A 1FNSH 1OAQH 3FQWB 5D1ZA 3O81A 1FSKC 5KZCB 3JWOL 3GBML 4DGIL 1NBQA 3PABB 4LSTL 1CFNB 5F7DA 3X14B 3GMQA 4IEFB 3P9MB 1OT2A 4LKXB 4IRJC 1DP0A 1BLNB 3SGKC 5A2LH 4M7JH 5DK2B 3QIUA 5E2WH 4I5BB 2VDRH 4LQFH 1ZVSB 3MRPA 1NEZA 2LV4A 2K7QA 4XBPA 4NQEA 3HI6L 3PDOB 3RVXC 4JFED 1DVFB 5KS9E 5FOJA 1QFPA 2EE6A 2Q20A 4JRXA 1RAMA 1NDGB 3B5GA 3BJ91 4XPGL 3R0MA 4EOWL 1A7NL 4ODHL 3WNPA 1NEUA 2HTLD 3QULB 4YK4C 3FB6A 3PWPD 5AAWA 4PBVC 2F19H 2XIDA 4YHLL 4LRNH 3NIDE 4L4TD 1T2QH 1OTTD 3HZMB 4LQ1A 3IDYC 2R8SL 1NLBL 1OOAA 1RIVL 4NQSB 5TF1L 5B39G 3GI9L 4PUBH 4WO4C 4J7RA 3LRHA 1J0KA 1FGNL 2R29H 3M8OL 3BHBA 2VXUH 4Y89A 3CXDL 3ARBA 1D3CA 5C1MB 3MFFA 5KOMC 4HWNA 1FBIH 4F9LA 1EHLL 3LV3B 4M4PA 5FGRA 3QUXB 1SEBB 5E9DA 3ZKND 4AQ1B 4TYUA 3DXAD 4W4OC 5A2KH 4XWOD 2XTJC 3CFEA 5L6YL 1OTUD 2X4PB 3O8XA 1RZIA 1JZ7A 5DHVB 1OT1A 4WU7A 2XZCL 4GO6B 5C0AB 4Z8FH 1MWAA 1BD2D 3WHXA 1O0VA 4M62L 2GEEA 1RIHL 2Y36L 2QSCH 3BI9X 2B2XL 3BE1H 1XIWB 2Z31C 2OXHA 3QWRA 4Y1AB 2VDPL 1GGCL 5GS0H 3NCYS 5EOTA 2BNQA 5FYKU 3L3DB 2KQMA 5HGHB 5DHYA 3KPOB 3O6FA 5JOPD 2BNRA 4MQ7B 4JGUA 5DURD 4AL8H 1J5OL 2OR7A 1X5LA 3H7BB 3OKKB 5E2VH 4BA8A 4RRPG 3QUMA 1LO2L 3B9VA 3CIQA 3KYOA 4LBEA 4Z76A 1EEYB 3P9LA 1KB5H 2NTSP 2X4SB 3CLFL 3MLZL 5INDB 1T22B 1A6WL 4F58H 4LIQL 2OZ4L 5AWNH 1OAKL 3MUJA 3G5XB 4YHYB 3MJ7B 1GOFA 5C0JA 1MJ7L 3RIFK 2NLJB 2X1XR 4HZLB 3LS4H 5CEYA 1AO7B 1OWWA 4TUOB 1JVKA 2VQ1B 4JM2B 4KQ4L 2P1YA 4OD3L 1EH9A 1M05A 4HG4J 3U9UA 4JFPB 1UH4A 2FJHA 4TTGA 2FBOJ 1WFUA 4G5ZH 1TXKA 3SKUD 1HDMB 1GGTA 2DYPD 2X40A 3CFKB 4OUUA 4DOHB 3UPRB 2ADJA 1NGXA 4JPIB 5DA4A 5E5MA 5EC1A 4GG8A 2BVEA 2DQJH 1ZA6A 4MA8L 1MCJA 3P77A 1Q9KA 5HI3D 2VLRA 3S3PA 3IF1A 3E0GA 1CDUA 4PLJC 5BO1L 2IPTH 3RVTD 4HBCH 3TVMB 4FA8A 4K7PX 4OD1L 1UM5L 1S5HA 4LCWD 3VD4A 2C26A 3RAJL 4O4YH 3SDCB 1AXSB 1QA9A 2GAZA 2UVFA 3T1FA 3UXFA 3AU1A 1J1OL 2FH8A 2HFFB 4H1LA 2B1AL 4NO2B 4PJ9C 1J86A 4OT1L 1DLFH 5EC2B 1AHWB 3GHBL 2DKMA 2J4WH 1I1YA 1UA6L 3NCEB 2R0ZL 5FA4A 4E41A 3ESUF 2DQDH 3WD5H 4AZ8A 5MENA 1GOHA 1QO3B 4N1HB 5C0CB 4DAGL 2ZG3A 5EU3A 1HKLL 1Q0XL 4HPYL 5FYKL 3MXVL 1TJHL 4GAYB 3BD5A 3O2VL 3WDIA 1NCBL 3WUWB 4KRLB 2WK2A 1IQWH 1DSFL 5HPMA 4ZD3H 5I18L 4HGWB 3UTZA 1U93B 3VG0H 4JY5L 1JPSL 4HKZA 4BSJA 2PW1B 4JVPA 2VLLB 4EN3B 2VR9A 2BDNL 1XF2A 1X5AA 4HLZH 3TN0D 2GK0B 3RPIB 5I0ZA 3CVHH 1KPUB 5I1DB 4U6XB 4ENEC 1T7VA 25C8L 4LSSL 4YAQB 3ET9F 1U8KB 3L3KB 5D7IB 3C6SB 1U41A 2UWEB 3CSPA 5DJ6A 1DE4A 1MFDL 4NNYB 4EI5A 3FT2A 4OTXH 2AGJL 1UWGH 4JJHA 2P7TB 1IGMH 4S0TD 3WNOA 4U6VH 5E2UH 1XAUA 4LCYA 4P2QB 4RBPH 1DLHB 3WFHB 2J6EA 2D0HA 1F4WL 4JHWH 1DR9A 4RFEA 3SDDB 2XKSA 1AGDB 1NFDF 1KTRL 2ITCA 4WHTB 4PJ7B 1FJ1A 2IALA 2DDQL 1FDLH 4PRNA 2F8OA 3V0AC 1KBGL 2V9QA 1FCGA 4FXKA 1EFXA 3P9WB 1ZLWH 1T2XA 1MCCA 2EIBA 2E7BA 4WWID 2VRAA 4UOJA 4P23C 3GJEB 4OZGF 1U0QA 5DUPL 1AI1H 3FN0L 1YQVH 4D9QE 1ZHNA 2LU4A 5J6GA 3HZKB 3BUTA 2FJGB 4GAJL 2BHYA 5GRJL 4YXHL 5KS9A 1QFWL 2VLJD 2CIIB 1JRHH 1CXIA 3GKZA 4QRPD 3VXME 5MI0C 1JNLH 2XWBA 1UCTA 3TF7C 1XR9B 4PJGB 2Z92A 3EDEA 2OK0L 4JM4H 4TNWK 5T1MB 1BM3H 2XY1A 5KVFL 4PRBB 2X05A 5J3HC 3MBXL 5SX5K 1SEQH 4DWHA 3PWNB 4CJ1A 3GFUA 5ACMA 3QIUC 2XZAH 4U33A 5C0BE 1ZT7A 3HPLB 1J11A 5T3ZD 4M7KL 2JIXB 4JDTH 4XC3L 3B2VH 5C2UB 4Z7QE 4QTIL 3G9AB 5DO2D 1JP5A 2KPNA 3UTSE 2NX5A 3EAKA 4O51A 3QEQE 1IT9H 4TPRL 3UC0H 4D3CH 5CD3A 1MCFA 2OL3L 3S36X 2HFEB 4LF3A 4UTBH 1RK1B 3HE7A 3KPMA 3BW9A 1YN7A 3ARFD 3F8UB 3VG9C 1IAIH 2XN9B 4TVPL 1T0MB 4N0CC 4X6BB 3TNMB 2IFFL 3IFLL 4LU5L 4XAWH 4U1IA 5HDBE 2Y07L 3H0TA 3ARBC 4KAQL 3NA9L 3CJJA 3RL2A 5I76B 4OCXH 4UV4L 1S9XA 1QRKA 4WUUB 1AGEB 3JWDL 5EA0H 1JZ8A 3SDYH 3HG1D 4F9LC 1JN6B 5IQ9B 1KENL 2LU7A 4OKDA 4OB5H 2QQKH 4PGEA 3FRUB 4ZPVB 3H9SE 1G7LA 5D4QA 4FZEH 2BJML 5E6IA 1INQA 4AY0A 3ARPA 3DUSB 3O8XC 4OCRH 3S88H 1DBBL 4Y4FB 2C4XA 4ETQA 3OGCB 4PV9A 1ND0B 4OV5A 3KLDA 4G8FB 4FTVD 5SX4I 3L3OB 2CLVB 4ZQKB 4OFYA 3QO1B 4K3DL 1H3PH 3LEVL 2A6IA 1QVOB 2R2HA 3DUUA 4JJ5A 1N59B 1HOCB 3C09C 2DLFH 4PREB 5F3HB 5I73B 1F5WA 1I85A 2DLTA 4KROC 4KRPB 3O6FC 1MFEH 3QAZB 3HRZA 3N1MC 2H2SC 4BQ6A 5IQ7L 1T04B 4LEXL 4JFDB 1TTFA 3CVHA 4CDGC 2YPLD 5CBEA 4F2MA 4POZC 5ISZD 2EH7L 4CMMA 5IJVB 1HILA 4XZUA 4CADB 1FC1A 5D6CA 4HF5H 5FIEA 3EOAA 3OG4B 3E6HA 2GW5A 3U7WH 1XGUA 4HUUA 4KMTL 2BP3A 2HJKA 4GRWE 1VACB 4HAFA 3GO1L 5ESAA 1CDIA 3RP1A 1TQCB 3ILQC 2CQVA 4H8WL 4O5LL 2XTLA 3ES6B 2OX5A 4G7VL 4LSVH 2NY5C 1CLOL 3U6RB 3SKMB 3ECBA 3BXNB 1RJCA 4OLZH 4WW2C 3RHWF 5IVXF 4KKLC 3QWQB 3BRGC 1MHPH 4LLUB 4HK3N 3C8KB 3OB8A 1Q9OB 5A2IH 3U4AA 5DS8A 3VXRD 1UACL 8FABB 4RGND 3HR6A 1JTPA 5JXED 1MAJA 5DVKA 2ZNXA 2VZSA 5JIKA 4ORZC 5T1LD 1HHGA 3MRLB 4ZFGL 3Q6GL 4P59L 3TFKC 1GYAA 1HXMB 5F9WC 2X4NB 5E2JA 1HYSC 4MMZC 3SGJA 4WFHE 4AT6A 4OZFH 1C5DB 2X4RB 5DJ8A 1G7PB 1MQKL 5F6IC 1T5WB 3LN4B 1QBML 2ICCA 5C0DA 3TZVA 3DIFB 4YHOH 4K23L 4JFQB 3SQBA 4WTXA 4Z77A 4MCZB 2RFXB 3RZCB 4KKAD 1S9VA 1ZAGA 3V6OE 1FYTE 3WV0A 1UM6L 3RUGF 3BGFC 3VWJD 2A6DA 4L8CA 2V5MA 3X13A 4B5EA 2FLBT 2BRRH 4XCFL 5F7FA 4NJAL 3OKDA 4Q0XL 4QCIB 2GY7B 4GRWH 2V7NB 3HI1A 5BZWB 1ZLVH 3T4AA 5DRNB 3BP5A 3D48R 5EZLB 3SO3B 3V0WH 4BQBA 4EZMA 3NGBC 2DB8A 5HXMA 4N0RA 3W9DA 2BC4B 3DMMA 2AJVL 2HVJB 1PG7X 4NPYA 2A2QT 4P5MB 1IQDB 2NY4C 3RIAF 3T0BA 5GGQL 1HHIB 5DFTA 2J88L 3PGCB 4EI5C 3R06A 1CF8H 3U0TA 4PJAF 1DL7H 3OJDB 2MCG1 2V2XA 2D03H 4X9BA 1WAAE 1JWSA 32C2A 2OMNA 2YOCA 4PP1C 2MPAH 5DLML 5K9QG 4XH2A 5HHQA 4AM0B 3LZFL 3FQRB 3VXMA 1MF2L 1YQ2A 4L8SB 1KIQA 1ZLUH 3ME0A 5CJQH 1DBKL 1I9IH 4DQOH 5KSUB 2YKLH 3TBTB 2F9BT 3R1GH 4QHLA 2BRQA 3QDME 2OTPA 4OLXH 5HGDB 2WBJB 1C7SA 4H88L 4HKBA 4LLVB 3L7FB 3MFGB 4HKJB 3MRHA 1M7IA 3O4LB 5C0BA 4KI5E 4WTZG 4QRTB 1BX2A 2QV2A 5JDJA 2UV3A 4B50A 3NABL 5FHAH 5CGMA 4IBLT 4HXBH 5J06A 4ZFFA 1KIRB 1BFVL 3UTSA 1RUQH 3BN9C 4R8WH 1X4YA 3HFML 3A6CL 4YHNB 1EEQA 5LGJA 4OZGB 1MH5A 4XP4L 2AI0H 5T33L 1DZBA 1OM3L 2A38A 1EO7A 4U1JA 4ETYA 5F71A 3LIZL 2DQTH 4XVTL 2JJSA 5F21B 4XP5H 3S6CA 2ZZUT 5D93C 5TE7L 4F8TA 4O2CA 2AJUL 4AMKH 4PPTA 4Q6YA 4YXKH 3E2HC 3MRIB 4S2SA 4HIXH 3P4NB 4ONHB 4P4KD 4UIMB 1LD9A 3CH8A 3NN8B 3QNYA 1QUNA 4LPYA 5KSBF 1FIEA 1R5IA 4X8JA 5C2BL 4L3EA 4P2RE 1WV7T 3DARA 4PGCA 1YEDA 4LLDA 5IMLA 3NAAL 2NPLX 1T7WA 3HE7C 1RIUL 1UWXH 3H9SA 4QNPF 4HH9A 5I30H 2IG2H 3UCRA 1XR8B 3NIGE 2ZG2A 3PGFH 1TQBB 3NCBB 3NOIA 1N5YH 1NCTA 1X6NA 4MHHG 4JHAL 2CO6B 7CGTA 4JCMA 2PF6A 4M7ZB 4XAKE 1AD0A 3OKNB 2P8LB 3WNLA 1OAZH 2Y4SA 1YPZE 2FL5B 1OB1B 1VGKA 3ARQA 4PJDF 1BOYA 4V2BA 2FATH 5E6IC 4E42A 3LPGA 3FOLA 5JHDD 3DV6A 4M9PA 2GJZB 5LWYH 2GTWA 5KVDH 1U58A 2ICES 4PD4K 3RX5A 2AEPL 2DBLH 1LE5A 1PJ9A 3LPFA 4YWGL 1G6RH 4LLYB 3QEHA 2IADA 3RWJA 4I0PD 1NDMB 1S5IH 4ZXBD 3ZYIA 4QF1B 4LAQH 3QFJB 5KBNC 4J8RB 4RCAA 5CILH 5TFSH 1YZZA 1I85C 4Z7WF 1HSAB 3HC3L 5F8RC 1NMAH 1FO0L 4K9EH 3BIBX 3OR6B 4QTHB 3ZYOA 1RULL 1A6AB 1INDL 3LHPL 4NQDD 3RDTD 4NT6A 2FSEA 4N9OB 1FP5A 1MCNA 3P4OB 4IJ3C 3PL6A 1N3NA 4RIRA 4DGVH 4F33A 2ENYA 1P6AB 2PO6D 1PD6A 3KWWB 1CTOA 2W0KA 2P8MA 3OWEA 2GJ6E 3IU4L 5DMKA 3UAJC 4IRSD 4A6YH 2HFGL 3U2SB 3O9WD 4UU9A 2YUWA 3F58L 4M4RA 1U95B 5LQBL 3GBNH 1QLEH 3N9GH 5C09E 4S1QH 1FFRA 3VI3E 1MLBA 4CW1B 1Y18A 3HLAA 3MJ9H 4ZODA 3FQXB 1P7QD 1D5ZA 1IARB 2RQ8A 4GS7B 4NM8L 4LGSB 3D25A 5GS3A 1PSKH 2A73B 5MEPA 3QJFA 1BWWA 3CSYB 3V6OA 1FYTA 3ILPA 4ONFH 2WBKA 1C16B 4Z7VE 35C8H 2FHFA 3BKYH 4G8IA 5AUMA 5KZCD 3EO0B 4LLMA 4WFFE 3MO1A 1T66C 5JHLL 2FECL 3NIFE 2AKRA 5E4IA 1SM3H 3SGJC 4RAVA 1QPXA 1S9WA 3FQUA 2CKBH 5FYJD 3U7AA 5HGAB 1U42A 2R1WA 1LDSA 4FFZL 4AENB 3RX8A 1Y6NR 3TZVC 4XGZA 4JZJA 5C8JB 1PY9A 5HDQL 4AEIL 1JMXA 1N0XH 1ZV5A 3F7YB 2GTZA 3AMKA 5IM7B 4ZAKA 4I4WB 1KT2A 1TETH 4LSUH 4YO0A 4DK3A 4DN3L 1DVFD 1JFQL 3F12B 4IOSD 5HI4C 3O6KL 3LB6D 5I71B 1GGYA 1TZIB 1X5ZA 2PTTA 1WAAA 1QSEE 1OL0A 3MLRL 3I3EA 4ODBD 5EB9A 4J3TA 4NN7B 4G7YL 5IFAL 1PVHA 5JLZA 5D2LE 2ITDB 4UILH 4R7DB 3DMMC 1S8DA 5EZIL 5GHWH 4ZDHB 5DR5H 4NO3B 4MD5B 3RUGB 3MNZB 5TDNB 4FQJL 1CS6A 2CLRA 2VLKA 2DQGL 5ITFB 5IHUL 2C7UB 4LCCB 1LEKA 3QDMA 4EI6A 4PJIB 1RJYB 1UXSB 2ZUQC 1A0QL 2ICWI 4PJHE 1M7XA 1BBJB 5GGTH 1DQQB 2I25N 3QEUA 4Z7NF 3H7LA 5E4EC 5D96B 3CPLB 3BH9B 3T0EB 5FYLD 1NMCB 3RJQB 4U05A 3SKOA 4MDIA 1BGXH 3K81A 1VADB 5TE4L 4MDJA 3GSQA 4RMSA 2NR6C 3QUXD 3DX8A 3U30C 4NN5B 4YGAB 3GRWA 1FG2A 4Y19B 4PJAB 3ROOB 3MOBH 4UTAL 2UUDH 4F7EA 3C5ZA 5HD8D 2AEQL 5CP3A 2NY2C 1NAKL 2CMRL 5EN2B 4DKFL 5C0AD 3BDYH 4GMTL 4UINL 4YGVB 4K3EH 1ZSDA 4O9HH 1CGSL 5IR1A 5EZOL 3EYVB 4Z95H 3W81A 1LILA 1XIWD 4KWUA 3RNKA 4C56E 2AXFB 4HGMA 1G6RA 2HVKB 4Y1AD 1B6DA 3FO9A 2YUVA 2UZXB 2HT4D 3BP7B 1ERNA 3EYUL 1RU9H 5EBMB 3ARDC 4KPHL 3WN5B 1FAIL 1X9QA 2R15A 3V4VL 4NZUL 1ZTXL 5F96L 5IG7B 5DD1H 4R7NA 4EXPX 2XI9A 5EBLB 1Z9MA 1XGPB 4J3VA 4BH7B 4P2RA 2Q87A 2PYFA 3MRCA 4RISH 3TBYA 5TQ0L 1ZT1A 3BDBA 3SGDI 2H2PD 1BQHA 1TJIL 5BZDB 4XPAH 1EAJA 2FZ3B 3C5SB 3LKQA 1MREH 4FQXA 5E94A 1AO7D 4JM2D 3RGHA 2EZ0C 4PJBF 2MMXA 1JHTB 5JMOC 4TSCL 2YA2A 2K9UA 2P49B 3DVFA 4MNGB 4M03A 1J1PL 1YPZA 3LAFA 4BFIB 1BFOA 4ODXA 3PV6A 3ULVD 4NUGH 5DMYA 1FZOB 3GK8L 5KVMC 4NJ9L 2EO9A 2H1PL 2AK4E 1OPGH 1Y0LB 4XP9L 4M9OA 1UZ6E 3MV7E 2X09A 4OZHF 4WI6A 3TVMD 4YDIL 2AV1B 3C6LB 1DQJB 1HYRC 2PR4H 2YD5A 5DUBA 3SDAB 3EGSA 3SDCD 3ARUA 2FEEL 4J3UA 4UNTA 5GGSB 2OI9B 2CKBA 3HNTL 5D72H 1CL7I 4ODVL 4CVXB 3SE9H 4LLQA 5T3XL 4BZ2L 3PDDA 4W68A 1B4JL 3B5HA 5C0CD 2A6KB 1LP9F 2IJ0C 2X44D 1XGQB 1T4KA 1NFKA 5CWSA 2W65B 5JW3L 4U1HB 5ALCH 5GSRA 1D5XA 2GITB 3GMNB 5JORB 4X98A 2BSRB 3Q3GA 3ARWA 2GJ6A 1KLGB 2BVPA 3QYCA 5BVJB 4EN3D 4LLWB 5I74C 1FV1A 1ZA3A 2NYYD 3S4SB 4F7PB 1Y6KR 4KVCL 2P5EE 4F80A 2ATKA 5ILTH 3RKPA 4DFHA 2X4UB 5F7YC 1QKZH 5C09A 3T77A 4DEPC 4MSWB 3LMJL 4HEME 1N2RB 3MX0A 4YIQA 1BZ9B 1FO0B 4AYFA 2P5WE 1ZHBB 3PL6C 4NO0A 2EYRB 2NXZC 5A16B 3TH4T 2O5ZL 3FT3A 4HUXA 4R2GB 2G5RA 5B38G 4LCUB 4P2QD 3TYGH 2FBJH 5GGTA 4Z7WB 3SDDD 1KOAA 4K8RD 4ZUUA 4Z7VA 5HHPA 2DJUA 4G43A 1VKXA 3C60A 4L5FH 5KW9L 4EIGB 3CMOH 1YNKL 2HJLA 2IQAB 2DLEA 4RFOL 1V8HA 1KC5H 4FQHB 4UBDC 3TCXA 3BPOC 4JDVA 4WGWB 1FLTX 2FX9H 4OF3A 2N1KA 4E0RA 4FQ1L 1JHLL 1INEL 3ARTA 3BT2L 5DC9B 2R4RL 3SKJL 5FUZH 4OZ4A 4EVNA 1PBYA 3TESA 4X6CF 5JUEH 3AS2A 3NFPA 2I60H 3V6OC 1I7RB 3DWTA 4WU5A 7FABH 3S96A 3O3DA 3VFRA 4XBGA 3SQOH 3VGHA 1QSEA 1VENA 3JV6A 1DTUA 2EDLA 4TSBH 1FSKB 2CIKB 3QPQC 4KK8C 1KYOK 1BZ7B 5T1KB 3MNWB 3L5WA 3NCFB 3WYRA 4XNXL 5D2LA 4JZNA 4X9FA 4JZJC 4IRJB 5D70L 1CD1B 2X5PA 1A6PA 3KXFB 4NRYA 4ZAKC 3EOBB 4FABL 1UZ8A 2D7OA 4D9LH 1NBYA 5C0NC 1OAYL 1A7OL 4PJHA 1K2DA 1OAXH 3L5HA 3VDCA 4LARH 4UV7H 3I2CL 3WXVL 4QHNA 2NTFB 4LHUB 4G80A 1RFDH 3P4MB 2MOVA 4LPWA 1ED3B 1OSZB 1QYGH 4YK4B 4R9HA 2AP2A 1ZK9A 2XN9D 4WV1A 4Y8DC 3WBDA 2DD8H 1VPOH 3VFOA 5H94A 3UBXB 1JHKL 1XGYL 4W6WB 4PB9L 1J8HE 3MGOB 2F54E 1XFPA 1YEKH 1OHQA 4KI5C 4KJQC 1T80A 2OR9H 4C56A 2EEAA 4WUUD 5JIHA 4KUZH 2R69H 4RGMC 4DVRH 1NSNH 2ZCLH 4YFEA 1UB6B 1M6OA 5BJTA 4K3JH 3RQ3A 1A7QL 3VXSB 5FCSH 1J1XL 3L95B 1MWAL 4MA1B 3C5ZC 3STLB 2XTJB 4Y4FD 2EYSA 4I13B 3QDGE 4TUJB 4N8VG 2AXGB 3GNMH 1ZEAH 5ERWB 1JGDB 4WUKL 2O5YH 3ULSA 4J12A 3ZE0F 3D85B 4MCYA 1GRWA 1UM4L 2CK0L 2QR0B 5CMAA 5HHMB 2Z31B 5DI8A 1G9NC 2RCSH 1Z9SA 1H3TA 3QI9A 4IDJH 2I5YH 5I1LA 4EUPA 4JFDD 4ZSOE 2X9WA 4JFHD 4PR5B 4XMPL 3QUML 1X7QB 3RKDD 3WO3B 1CFVH 3IRPX 4ORGA 2BVQB 4DVBA 1CE1H 1FL3A 2X9XA 5DJCB 5GISL 3W11D 2WBWB 1UWEL 1VCAA 3WNKA 4NDMA 4RMUA 5D2NE 2WWMD 5DC4B 2AK4A 5L8KB 4NM4L 4WW2F 5E8EB 3O41B 5DYOA 2H3NA 2ZUUA 4KJWD 5F9OH 1YMMB 4X80H 3MV7A 1SJXA 4R0LA 4FQXC 3RWIB 4HGKC 4NZDA 3V5KB 5IOPA 1DEEA 2NY5L 1OVZA 3V7AE 1MVUB 5J57B 1YEFL 3KPSA 4G8EB 3IS0X 2XYCA 5D7SL 2E7MA 4JZOA 4WW1B 4DZ8A 1U8IB 1RI8A 4JAMB 1I1CA 3CLEH 2NZIA 1E4XL 3RA7L 3OB0H 3GSNH 5DSCA 2A74A 5C92A 5GRZA 4PJBB 2WWKO 4Z6AT 1DBJH 4JHBA 3EBAA 5EZJB 3FOMB 1OAQL 1HI6B 5H8DA 5I1JH 2YWYA 2GSIB 3OMZA 1XH3B 3H42H 3MRJA 1BQLL 3C9NB 1K5NB 3OV6A 3GMMB 5LVEA 1IGYB 5EIIA 2X4OB 4HUVB 3MLUH 4WI5A 5KSAB 3VGDA 1YEJL 1S78C 4O02H 3RZCD 4PJ9B 1KFAH 3MZTA 5E2WL 1K4CA 1IGJB 4LQFL 4OZHB 5IMKB 4G9FB 4YNYA 3ROLA 2VDMH 4OBSA 1MFBH 3B2UC 2V2TA 1JK8A 3GM0A 4OIBA 2W0LA 4KV5F 5C08E 3ZL4H 2CR6A 5CEXB 2E6QA 3DJ9A 1CFQA 2DM3A 1IC7H 1B0RA 4Y4HA 1OARH 1LP9B 2F19L 2VDNH 4J1UA 4MJ6B 4WIQA 1G7MB 3WLWC 1T2QL 3TNNA 5IEHA 1AJ7L 2W0FA 5ENWB 3INUH 3A0OA 3K0WA 2DLIA 3QIWD 1X6LA 4NGHL 1MJ8L 3LKPA 5JIPA 2WP3O 1PLGH 2DI8A 4X7DC 3I75A 4HAGA 2HKFH 3CC5A 3GGWA 2J6EL 5EUOB 3U0PA 1CR9H 3FHAA 1T83A 4NC0B 4P57A 2XRAH 1ZHKA 5HYQB 1UB5A 4ZOCA 1G7HB 4D0CB 2JB6B 3C60C 5ICZB 5ALBL 4CVZB 2ADGB 2D2OA 1MHEA 2R23B 1A3LH 4Y16A 2CLZA 3VDAA 2APFA 3LKNA 4WEMB 1NC2B 5K9JH 1PZ5A 3EOYG 3J8F7 5KS9F 5ID0A 4HG4K 1ZGLB 4K3HA 5GRVK 3VFGH 4PRAA 3QCUH 1G1CA 3TJEH 3KNBB 4PGBA 4P23B 3O4LD 2EDJA 2HG5A 4GRLA 3FZUD 3IXTA 4K8RH 4KY1H 2E8YA 4BSVB 4KJYA 3MCKA 5ANME 4D8PB 5J1SC 2VITA 3H6JA 3GMLA 1IEAA 4HH8A 1U8JB 3H9ZA 4ODSH 3DVGB 3G6AB 3NIDF 4HUMB 43CAB 3PHQB 3TA3A 4M7LH 1MHCA 4ODTH 1PKQB 5MI0B 4MJ2A 1QSFE 4WCYL 4CN6A 2D0FA 3BDXA 3I9GH 3ZDXE 3PP4L 5EH1A 5F7DB 3GMQB 3PHSA 2QQNH 3STBA 2W9EL 3RWGA 4PJCE 3T0VA 4C4KT 1ZHLA 1LO5A 5L88H 2CJUH 3GI8H 1AD9A 3LN5A 1TVHA 3QIUB 2Z8VC 2ADIA 2CSPA 2EE2A 3MRPB 1NEZB 1QNZH 4XBPB 4TQEH 1CLYH 4NQEB 5C71A 2VDKH 4NFDA 3RWHB 2F54A 1J9CT 1UKSA 3JWOH 4JRXB 3GBMH 4DGIH 1T0PB 4L1DA 1T1WA 4PRIE 3BKJL 2ORBL 3FB6B 4YDJA 1RQ5A 1NC4A 2I07A 5JDSA 1OTSC 4AQOA 4WV1C 1P4IH 4FN0A 2P42B 3ZTNL 3QDGA 2J5LB 5TDPA 3HI6H 3GSNA 4TVPD 1SY6H 4EJ1C 3T0AA 2IPTL 1WWCA 3BHBB 4D2NA 4QLRA 1ZWIA 3ARBB 3BZDA 1TZHA 5DFWH 4O4YL 4EOWH 3MFFB 1A7NH 2HRPL 4ODHH 2VH5H 3TP4A 3FONA 4G9DA 3QXWA 1DLFL 5IKCA 3DECA 4ZSOA 1RZ8A 2HT3D 4XXCA 2J4WL 1L4IA 1EUTA 3DRTA 5E9DB 2BOBA 1F11A 4APQA 4NBZB 4L29A 5IWLC 3QXUA 2NZ9D 2P47B 3KDMA 3O8XB 1RZIB 1RK0A 5TF1H 3GI9H 4QRRD 3PWUA 1TLKA 4WU7B 5GXBB 4LIQE 1MWAB 3WHXB 3QXVA 5FKPA 4ZD3L 4LP5A 3CXDH 5D2NA 3V6FA 3H3PL 1BJMA 3QHZH 4X6DE 3VG0L 1AY1L 3QFJD 5LXGL 2J12B 3ZHKA 2RHEA 3ARGA 3C09B 4IOFD 1MIMH 2NW3A 5EOTB 5IB4A 2BNQB 3I6GA 1F2QA 4KQ3L 4YBLC 4OLVL 2WIIA 5DHYB 1MOEA 3CVHL 1MAKA 4MB5A 3O6FB 3RJDA 2BNRB 4NKMA 2WUCH 3SE8L 3NFSL 3ARYA 5L6YH 4XI5D 1I8MA 3EFDL 2XZCH 3JTSA 4OTXL 3QUMB 4Z76B 3KYOB 3MUZ1 4LBEB 3P9LB 3LOWA 2MHAA 2H6PA 3WNNA 2B4CH 4M62H 2Y36H 5I17A 1QRND 2APXA 3CDCA 4YLQT 2VDPH 1GGCH 5C0JB 5IESL 4R0LC 4MZ2A 2GSGA 5CEYB 5MEQA 3CFBA 3P0VH 4QOKE 3DGCR 4G8GE 1M05B 1YA5A 3U9UB 3QZWG 2ZKHH 3NPSC 1J5OH 4FQLL 2IH1A 1IMHC 4OUUB 2CK2A 2ENSA 2ADJB 1NGXB 3JBG7 3D3VE 1KJ2H 5E5MB 3S5LA 2MWCA 5EC1B 4WWKA 4GG8B 2G60H 5BCAA 4GG6F 5FYKE 1KLUA 1ZA6B 2OZ4H 4LIQH 1HHHA 3P77B 1I1AA 4HJ0D 1Q9KB 2VLRB 1MJ7H 4YQXL 4XPBL 3KPLA 2AEIT 3IF1B 5C08A 1EMTL 4U6YA 2LTQC 3V4UH 2HFTA 4KQ4H 5E99H 2EDOA 1S5HB 5F9WB 1QA9B 5ABDE 2EC9U 2GAZB 3T1FB 3AU1B 4D0BA 1MCHA 4H1LB 2Q8BL 1AGFB 1ZMYA 3TH3T 3KYMA 2XZAL 1F02I 1I1YB 5FA4B 2Z4QA 4E41B 4MA8H 3I6LE 1MY7A 1KTKE 4KK9C 5MENB 1U8QA 2VIRA 4NHUA 5EU3B 1QFUL 3B2VL 1BQSA 3QIBA 3BGFB 2I26N 5BO1H 3IDNA 5HPMB 4LMQI 2EDRA 3UC0L 3UTZB 3WO4C 4D3CL 1UM5H 4UAOB 4OZFG 1B0GA 5IB3A 3TBWA 4HKZB 3OXSA 3BUYA 2BVOA 1R3IL 4BUHA 2XT1B 2DQCL 3MRRA 1J1OH 3NGBB 4J6RL 4Y4HC 2OJEA 2B1AH 3OF6D 3VGAC 2OR8A 5FKAA 3GHBH 1RJZA 1WC7A 3CCHA 3QCTL 3N1FC 1IAIL 5FM5O 2VSDA 3A67L 3QWOA 2J7LA 3T65A 4Z78A 5DJ6B 5LKNA 1HKLH 1Q0XH 1DE4B 5FYKH 3RIFF 1TJHH 3FT2B 4EI5B 1NCBH 2BCKA 1DSFH 3DROA 3T0ED 1T83C 1T1ZA 5ANMA 5DVMA 1SY6A 4OCXL 4LCYB 5CJXA 4JY5H 5DD3L 1IKFH 3GSVA 3JVGA 3RRQA 1BJ1J 1MI5E 4RFEB 5EA0L 3SDYL 4EIZC 1B0WA 3VXPA 2BDNH 1T7ZA 4GLRI 1S7UA 2ITCB 4Y16C 4Y19D 2IALB 3IJSA 3MLPA 1T1YA 4PRNB 3TYFA 4FNLL 25C8H 4LSSH 4JKLA 1QSFA 4OCRL 2HTKD 4N8PA 4Z7QF 4FXKB 1EFXB 2J3SA 2PYEE 1MFDH 4HFWA 3IDXL 5IROA 3LS5L 4PJCA 4YC2C 4GRLC 4ZUVA 1LEGA 1H3PL 2LAAA 5AG9A 1F4WH 5A2JH 1ZHNB 5J6GB 1G9MH 2ZUSA 3HS0A 2H41A 4LPVA 5KS9B 2FJFA 2DDQH 5F72S 2NY1C 1WVZA 4P3WA 2XWBB 2IEPA 2E3VA 1P2CA 5DD6A 1MCWM 5F9JA 1KBGH 2VAAA 2Z92B 4PRIA 2OP4L 4CDHA 4L8DA 1ZOXA 1A4KA 3D2UA 5E1HB 4HF5L 5DUPH 1F6LL 1NBZA 1XIWC 3FN0H 1ZT7B 2VUOA 2MNUA 4I3GA 5D93B 1FVDA 3U7WL 4JANA 1EERB 1MAML 3VJ6A 5I66A 5GRJH 4GAJH 4YXHH 1QFWH 2XACC 3E2HB 2Z8RA 2NX5B 4O51B 4AH2A 3F65A 5DEFA 3OKOA 4OLYL 1NGYA 2OK0H 3K2UL 4KRNA 5CD3B 4Y2OA 2FECI 5EG6C 4PJEE 5JW5A 4OCWL 1JZ3A 1JGUL 3QCVH 1RUPL 5C0RL 5IB2A 4LF3B 5IIEA 4AEHL 4ZOAA 3HE7B 3KPMB 5CBAA 1BAFL 3BW9B 1YN7B 4GBXA 1KJ2A 1KELL 4NRXA 4OBRA 1KJ3L 1KCLA 1R6VA 4M7KH 4XC3H 1FRGL 5E5UB 1S7RA 5JZ7C 4U1IB 3SDAD 1WGOA 3H0TB 3ZDZE 4X6DA 4TPRH 3RL2B 1H8SA 1S9XB 2OL3H 5JOEA 4JN2A 2IQ9H 4LCWA 4YH6A 5DD5L 4YHOL 5JR1L 4XXCC 4CVWA 4PGEB 1G7LB 5E6IB 1INQB 4TVPH 4GRWF 4M02A 4Y5VA 1KTDA 2IFFH 4NWTL 2LQRA 3IFLH 2VL5A 4ETQB 3MZGB 1MFAH 5LCVL 4PV9B 1JYXA 5DGRA 4OV5B 4FFVD 5D2NC 5IJKC 3N1GC 4QYOA 4GMSL 3NA9H 3BZ4A 1CD9B 4LSDA 2A6IB 2R2HB 3DUUB 4JJ5B 2FHBA 1JPFA 3ARGC 1FPTL 3JWDH 2CKNA 4MXQC 4GSDL 3PNWA 3P2TA 1HN1A 1TNMA 2W0PA 4UB0L 3HRZB 3LKSA 4QOKA 3H9HA 4G8GA 1BREA 4HIEA 4JQIH 2BJMH 4N90E 4X4XA 3CVHB 3LQMA 1DBBH 2JB5L 4JN1H 4W4NA 5IV2A 5CBEB 3GIZL 4R2GD 4F2MB 1DL7L 4IJ3B 2WQ8A 3D3VA 1Z3GH 4CMMB 1HILB 4PG2A 4XZUB 5D6CB 1VDGA 1A7PL 1S7XA 2XQBL 4K3DH 3TLRA 3LEVH 5HSFA 1CDCA 1N26A 3PJSA 2M1KA 1EZVY 3TBVA 5BW7A 4HUUB 1HQRA 2HN7A 5J4MA 2HJKB 5A1AA 4UZGA 5IQ7H 5ESAB 4CAGA 2X70A 4DQOL 3SDXE 3T4YA 2YKLL 4LEXH 1I7ZA 3R1GL 1KG0A 1DQMH 3QXDA 3OXRA 2IBBA 1GCFA 4EBQH 3ECBB 2EH7H 1T3FA 5KAQF 1OCWL 4WWKC 3QA3A 3KYAA 1G1YA 3RTQA 1QR1A 5CSZA 1XF4A 3VH8A 3QO0A 5DS8B 2FD6L 4HXBL 4KMTH 2CGRL 5KTEL 3CX2A 1HHGB 5C07E 5F3BA 3GO1H 3BMVA 1PQZA 2VNCA 1FORH 5T1KD 2HYMA 4M93C 4O5LH 2AI0L 5CSBA 4AT6B 2H8PA 1CLOH 5DJ8B 1WAAF 4IRJD 3DX6A 5C0DB 3TZVB 2PXYA 5DJ2B 3BRDA 4QXTA 3KXFD 4XP5L 4Z77B 4AG4H 4M43H 1FZJA 1JNHA 3HAEG 1S9VB 2OSLA 5K93A 5AZ2L 1LEIA 3MQIA 3T2NL 5EWIL 3VFMA 4JO4L 1UACH 3STZA 3RVXD 1S3KH 1T20A 1V3LA 1X44A 4YXKL 2A0LC 3QIBC 2K3TA 4L8CB 2A6DB 3X13B 4HIXL 1XCQA 4ZFGH 3Q6GH 4P59H 1YC7A 2WV3A 4LHUD 2DM2A 2SEBA 3MV8E 1KLFA 1AXTL 3HI1B 1MI5A 3T4AB 3BP5B 2IPUK 5IUSA 1MQKH 2DLGA 4P2YA 4KI5F 3W9DB 3DMMB 4K23H 3JTTA 2DN7A 5CEZD 4NPYB 4P3DA 4D0DA 5HYSG 4PV8A 2PYEA 1EO8H 1SBSL 4WO4D 2ZUTA 3K8LA 3UTTD 4F7TA 2KDGA 2ZUQB 5E24E 3R06B 3U0TB 1TDQA 3NCYP 2V2XB 3CDGA 1BOGA 4NNPL 5E4EB 1JWSB 32C2B 1OF2A 3GSUA 5CJXC 3SKNA 4V1DE 5D7JA 5SWZE 3JVGC 4G3YL 4XH2B 1N6UA 5HHQB 4XB7A 1FAKT 3NMEA 3GRWL 3VXSD 5DXWA 1RMFL 2AJVH 2EDXA 4KTEL 4Y2DA 2OL3A 3VXMB 1KIQB 2Q76A 3U30B 2FATL 3SN6N 3FRPG 2XTJD 5LWYL 5KVDL 4QHLB 3KLAA 2NY2B 1N8ZA 1SQ2N 5GGQH 2J88H 3QISA 4MNQE 1PDKA 3G04A 1U8LA 4MJIE 1G6RL 2OTWA 2YD3A 2BY1A 3MUGA 1RURL 1KB9K 4HKBB 1BZQK 3D85D 1G9NL 3MRHB 1M7IB 5C0BB 1S5IL 2CUMA 3WKML 4LAQL 2Z31D 4IS6A 4WFED 5DLMH 1BX2B 4R6UA 1CICA 1U3YA 2F58H 3LZFH 4ZFFB 1MF2H 3TM6A 4BYHA 3ARSA 3UTSB 5D71H 4KMQA 5LGJB 1MH5B 1GZQA 4PJEA 4P99A 4DGVL 1KGCE 1MJUL 5JPMA 4U1JB 5EBWA 1WFTA 3HE6A 4H88H 1CGUA 2OMBA 3WLBA 3UTPE 4PJ5E 4K55A 3JV4A 2B4CC 5LGKA 1YMMD 2NMSA 3OBAA 4O2CB 3KPPA 4MGXA 2JJWA 4ELKA 3ZE1E 4KRPC 5EU6E 1Q9LA 4P2OA 5DJYA 4S2SB 1QLEL 3N9GL 4P0DA 3T0WA 2YK1L 5EOQH 1LD9B 4Q2ZA 2CPCA 3QNYB 4XP4H 5T33H 1OM3H 1R5IB 4X8JB 3CK0L 5D8JL 4L3EB 4PGCB 3G6JE 3W39A 4N8CL 1YEDB 3FN9A 4LLDB 5IMLB 4XVTH 4RDQG 5FDYA 3ZKXC 3H9SB 2WWMC 4HH9B 4GBXC 1JJUA 5TE7H 5BRZE 5T1DL 2BK8A 2AJUH 3C08L 3BKYL 4BH8A 2V5YA 1BWMA 3DYOA 1BIIA 4PLJD 1F90L 1DQDL 4L4VE 1JPST 1SYVA 3CFDA 2D9CA 3C2SA 4GW5A 4JDZA 3RGVA 1SM3L 1AD0B 3SJVE 1HZHH 5C2BH 5KSAD 5INCA 4PJ9D 5CD5C 1DFBL 3KHQA 3NAAH 5ADPL 2OTUA 1VGKB 4G9FD 5F7WC 4E42B 1QQDA 3ESVF 5SWSE 1FFOA 3FOLB 4Y5VC 3DV6B 4LSUL 2GTWB 1U58B 1MIEL 4KKBC 5EUKA 4J3OC 1LE5B 5DZOA 1FNGA 1IM9A 3VI3F 4HKXA 1HEZA 3QEHB 3EFFA 4N0FA 4XNUL 2IADB 3RWJB 3WEXA 3OKEA 4HIHA 5AD0A 5I74B 3DBXA 1O5DT 4GRWB 5GHWL 1C7TA 2X4TA 5DR5L 4HHAA 2Y7QA 4ENED 1W8NA 3GMPA 4Z7VF 3SDXA 3T09A 3D39D 2VR4A 4DEPB 5FECA 4NT6B 2FSEB 4PJXE 2Y5TB 3OAUH 2ICEA 5EORH 2AEPH 5GGTL 3PL6B 4RIRB 5E8OA 4YWGH 3NIFF 1OGAE 4K07A 4PG2C 4F33B 1WZKA 1NUNB 4RQQA 3U4BH 1JF1A 2P4AB 3ARZA 1I8KA 2P8MB 3ZTJH 4D9RD 2AJSH 3C8DA 3AS3A 4RA0C 5BW7C 5DMKB 1FE8H 4JQVC 2WIMA 3HC3H 4UU9B 5C07A 1FO0H 1X4ZA 2BXYA 2J8HA 1NC2D 3QHFL 1RULH 3MOBL 5GRUH 3LHPH 5ACZA 5C6TL 4RZCA 3BPOB 1MLBB 3BDYL 1Y18B 3HLAB 15C8H 4K3EL 1D5ZB 1B88A 4P23D 3K1KC 3D25B 4Z95L 4L3AA 1CD0A 5MEPB 3BZFB 3QJFB 3RTQC 1Z5LA 1HKFA 5M7QA 1FYTB 3ILPB 3WSQL 5J7CC 3IU4H 4BSWA 5I8KL 4PRHE 2HFGH 4JPKH 3GJFH 4DGYL 4G8IB 5AUMB 1G9MC 1AFVL 5GPRA 4YEEA 1I9RL 1TJGL 2VO5A 4LLMB 5LQBH 3MO1B 1TFHA 3HMXA 3QR2A 3MV8A 2AKRB 4RDQF 4RAVB 3FQUB 1S9WB 3SBWA 4C59B 2WBJC 2DIBA 2R1WB 2BNUA 1N7ML 5J3HD 4NM8H 1M4KA 4J3WA 5CJ8A 2PXYC 4XGZB 4JZJB 3K8KA 3UMTA 4C83A 3QIUD 3IDIA 2WINA 1EJOL 3UJJL 4ZUTA 2GTZB 3JSSA 5DMGC 4ZAKB 3O2DH 3HPJA 4AK1A 1KT2B 4NQED 1OP3H 4YO0B 3FMGL 5EFIA 2DKSA 1FNEA 1VFBA 3OSKA 1EX0A 4GW1A 4JRXD 2PTTB 1OD7A 2IPUG 3SPVA 4V1DA 5SWZA 4AEFA 3MODL 5DEGA 2ED9A 2QKIA 4P4KA 5GS1A 3HNVH 5C0GA 1T03L 1E6JL 4NC1E 4FFZH 5JLZB 4TRPL 1S8DB 1N6VA 2NY3C 4NUGL 3J7HA 5HDQH 4AEIH 5JPNB 1L0QA 1OPGL 4N0CD 2VLKB 2CLRB 2LU3A 4LSPL 1LEKB 4MNQA 3QDMB 4EI6B 4DN3H 1LDPL 4MJIA 4YE4H 1Q9WA 4G6AC 3QEUB 3O6KH 4LDLB 4LNVA 3ARBD 2PR4L 3HI5H 2H45A 5CCKL 3MR9A 1JI2A 5D7JC 1AKJB 4I0CC 3SKOB 1NBVH 5A2FA 4U3CA 3RWDA 4MDIB 5IFAH 3IKKA 1PYWA 3N1PC 2WM0A 5L2JA 2B0SH 4MXWL 4MDJB 1I9EA 3GSQB 4Z0BH 4Y2DC 5E9DD 3DX8B 4B53A 3SE9L 4K7FA 1FG2B 2ERJC 1PEWA 4F7EB 5IHUH 3O8XD 3C5ZB 3W5NA 2YD9A 1WCQA 4LHJB 4PY8I 2PW2A 2JLLA 1A0QH 5JHDA 5ALCL 5HYJE 1ZSDB 4S1DC 5MERA 5IR1B 4PJ5A 2DMBA 4PG9A 1QBLH 3H8NA 3RNKB 1G6RB 3QWRD 3FO9B 1M7DA 1CICC 2BNQD 5EU6A 5TE4H 4QWWC 4KROD 3RWCA 4X7TA 3O6FD 1JYWA 2BNRD 2H2SD 5ILTL 2I27N 4HPOL 2NY7L 3BSZL 1U8NA 4UTAH 1UZ6F 1YEIH 4U49A 4R7NB 5FK9A 1IEBA 1NAKH 1LWRA 1HINL 2YRZA 4HUKB 4POZD 4P2RB 3G6JA 3VRLE 4Q7DA 3HE6C 1XT5A 2PYFB 1N6QL 2Z9TA 3MRCB 5EZOH 2XPGA 3TBYB 1N4XL 3TYGL 2FBJL 1ZT1B 2WANA 4OQ1A 5A43C 5BRZA 1BQHB 5TPWL 3EYUH 5FDWA 3X3FL 4MAYA 3LKQB 1AQKL 4P2OC 2CRMA 4FQXB 4QT5A 5E94B 3OR7A 4L4VA 3S35X 1FAIH 1DBMH 5I19H 2NXYC 4NZUH 1ZTXH 4A6YB 4KZDL 3ULUE 3ILQD 4K7PH 5F96H 3O9WA 1NGWA 3DLQR 1IAKA 5K59F 2DL2A 3UTOA 2C1PA 1J05B 5T3XE 1YPZB 4KTYA 5F7LB 1CXHA 1WQVT 4KKLD 4N0YL 5E95B 3TO2A 5FV2A 1BFOB 4ODXB 4X7CC 3PV6B 4PJ8A 4R4NC 3FO2A 5JUEL 2DIJA 5TQ0H 2I60L 5SWSA 3RWFA 4HCRL 1ACYH 4BK5A 2VLRD 1UGNA 2V6HA 3G5YA 3CFCL 5HTSA 1TCRA 4F37F 3TFKD 1U2HA 4G6KL 5FGSA 3V52H 4U6TA 3RGVC 5DUBB 3GJFA 3EGSB 1HYSD 3OG6B 1NQBA 3X17A 3HRPA 3LKOA 3TPUA 2FHCA 2C3XA 2CKBB 2C3HA 3OKLA 3FB8A 3WNMA 4AIXA 3OZ9H 5CHNA 3RX7A 4LLQB 3GK8H 3T8XA 3JXAA 4E41D 5MEND 2H1PH 4PJXA 3S34H 4EQ3A 2AVGA 2Z8WC 3W82A 5HYIA 2FO4A 5HY9A 5F7KC 5CWSB 1OGAA 3O2DA 4ZNCD 1L9MA 5GSRB 1D5XB 4YBQC 5DRXA 3IKCA 4YDIH 1A6TA 4X98B 3Q3GB 2GJ6B 2X9YA 5FHBL 1WLHA 2BVPB 1QYGL 1SHMA 4U31A 4OCMC 3D18A 1FV1B 4BUGA 1ZA3B 1WZ1L 2EC8A 1ZANL 3PWVA 4ODVH 2ATKB 2AJZA 5T3XH 5C09B 2NY4D 3QFDA 3MRMA 1VPOL 1B4JH 2OQJA 3NCCB 2A9NH 3T77B 5K9KA 1FL6A 1RZFL 4YIQB 4OFKA 5MHSD 1HQ4A 1JYNA 5DFVC 1E4KA 2EKJA 2VKXA 3V8CA 4EI5D 4NO0B 3SCMA 5JW3H 2OBGA 2ZPKL 3FT3B 4HUXB 3TBSA 1BFSA 4PP1D 3ZHLA 4ZTOH 4KUZL 2R69L 3S37L 4ZUUB 4Z7VB 3HC0A 5HHPB 2ZCLL 4G43B 4PRHA 4PP2A 1VKXB 3C60B 3OAYK 2EDWA 4L9LA 1V3KA 2O93L 2HJLB 5DF0A 3CX5J 2COQA 3QUXA 1EFXD 4JDVB 3E3QE 4FS0A 4UT9L 3GNML 2O5ZH 4ZO7A 2RB8A 4OZ4B 5C3LD 1F3JA 4EVNB 5JQ6L 3NFPB 3DETC 3G6DL 4WU5B 4PYHA 3S96B 1HE7A 3O3DB 1A3RH 1WCBA 3VFRB 4IDJL 4H20H 4XBGB 2I5YL 5TJWK 1A47A 1TCMA 2J2ZA 3BN9D 3GSXA 4XVUC 1QSEB 4ESKA 4XMLL 3JV6B 5E2TL 1A7RL 4JG0H 1CFVL 1CE1L 2IH3A 3SBWC 3L5WB 1UCBL 3RFZC 4C57C 4ZOBA 5HDOA 4XPHL 1IVLA 5D2LB 1INEH 3BT2H 4JZNB 2R4RH 3SKJH 2YEZA 2ATPA 2A9ML 1JPGA 4NRYB 3EJYC 1OGTA 4AIOA 3HNSH 3FCTA 1UZ8B 5F9OL 2GUOA 4R96A 1NBYB 1KIUA 4X80L 3GDBA 4PJHB 1K2DB 1WIPA 5FAAA 2CD0A 3OAZK 2IAMA 3QXAA 1KV3A 1JRHI 2W60A 4QHNB 3BFOA 4G80B 2HT2C 4NQUA 4MX7A 2HH0L 4FXLA 5CJBA 3BWUC 2HJFA 2RGSA 4M8VA 2AJ3A 3HE7D 1OY3B 4WV1B 2Q6WA 3GSNL 2DICA 2DTSA 1WITA 4FABH 3VFOB 5H94B 1CDHA 1D9KA 3IDJA 4MAUH 5HYJA 4RMQA 5I1KH 1N0LA 3O3BA 2C9AA 2PCPA 1WTGT 3B3IA 5FA3A 5I1JL 3G08A 3VMNA 1QZ1A 3TO4A 1KPVA 1CZ8H 3H42L 5I1IH 5L8JB 4BFGA 3I2CH 5EO0A 5IW3A 3WXVH 4C56B 2QQLH 4EDXA 4XC1L 1LGVA 1EEZA 4X4ME 1MY5A 5IK3A 3MLUL 4XRCA 4HT1H 4M6MH 1JUFA 1M6OB 5BJTB 3R8BB 2YBRA 4JO2L 4WFGE 5E6ID 5EIVA 4GT7A 5DA0B 4YPJA 2UY6A 4TTDC 2PTVA 3WMSA 1YMHA 2VDML 1MFBL 1PZUB 2B39A 1JHKH 2KKQA 4CMHC 1XGYH 4MA7L 3C6LC 3VGEA 4PB9H 1URLA 2ICWA 4OFYD 3ZO0A 3WUWA 3ULSB 3B8SA 1P69B 5DZLA 4MCYB 1KN4L 4IDLA 4DUVA 4MJ4A 1IC7L 5CMAB 2VMFA 1YEHH 3P0YL 5DI8B 4YFLF 4P4RA 1FL5A 1A7QH 4YBLB 5I1LB 3D87B 1ONQA 3TJHC 4EUPB 1J1XH 1MWAH 3VW3L 3GSOA 4OCYH 3EO1A 4ORGB 4DVBB 5C7XL 4IMKC 1PLGL 1D5BA 1FL3B 2HKFL 4Y8AA 3EIFA 3IGAA 5D5ME 1I9JL 3IFOA 4X9HA 1CR9L 5D7IF 5ITBH 3VU2A 4KHXH 4NKDA 5LBSL 4NDMB 4TN9A 4WUKH 3QEGH 2HMIC 1U36A 3NBNA 2X1OA 4LCIH 2AK4B 4HJGA 4ERSH 2G9HA 3W9EA 3DURA 5DYOB 3UAJD 2H3NB 2Y9RT 3VFNA 2VB5A 1UKTA 4MAYC 5EOCL 3MV7B 4R0LB 1EAPB 5CGYC 5IOPB 3PXJA 1DEEB 4R4FH 4MNHA 5K9JL 4XMPH 3QUMH 3DNKA 4PGZA 3KPSB 3NPSB 1DDHA 2ARJA 4MVBD 4LVHC 4JZOB 1UWEH 4DZ8B 3BJLA 4KY1L 4PJ8C 5DK0A 4Z7UE 1XF3A 4WEBL 4NM4H 5DSCB 4ODSL 43C9A 4S1SL 1I4FA 3KPRE 4CNIA 3F6LA 2A74B 4LASL 3MOAL 1CTNA 4M7LL 5ICYA 3OHXA 4ODTL 4WI2A 1BP3B