4OZGA

D2 protein complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozgA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ozgA01
1SJHA 2C9AA 2WUBL 1DE4A 4X5LA 1U8MB 1V7NL 5FF6B 3CH1A 1VDGA 2FBJL 2VO5A 1KTLA 2ICES 3IFLH 4Q74A 4Z7UE 3TBTA 1CDCA 3HE6D 1KELL 1IAIH 5JIPA 4R26L 4P46B 4HWEH 5KZCD 5IG7A 3QUKA 4TUKL 1UB6A 4R96A 4RAHA 5E2UL 4GG6F 1AXTH 1TJHH 1FZOA 1KG0A 3GSNL 4LARL 3DHJA 2DS4A 4QYOA 1N5YH 1DN2A 5D7LA 2MSPA 5TQ2L 4LHUB 1CD9B 1UA6H 4F7PA 4R9HA 4GRMB 1ZLSH 4GKOA 3V5HB 5EWIL 3SE8H 1MRCL 3PV6B 4UMGA 3RWGA 4WDIB 4L4TA 4X83A 4HJGA 1P7QB 2IJ0C 4JLRB 3AREB 1KACB 4QXTB 2XZAH 4N8PA 5HHVH 3UYOD 1HIML 3TH3T 1Q9KB 4FFYH 1KPRA 4I4WB 1JWSB 1KT2B 4B50A 1FO0A 2F54B 4V2CB 3QRFM 4ZUVA 3QIBB 1EERB 1MAML 4W6XB 2FZ3B 3EJZC 4FQ2H 2G5BA 5CJQL 5IMKB 4I3RH 1VSCA 1F42A 3OAZH 1PG7X 4HF5L 3TJHC 2AJUL 3IVKA 2NY3B 2BHYA 2BVOB 4OLZL 3EOTL 3BZEB 3IETA 2HVJA 4YAQA 2ORBH 4U05A 1XGPA 5FFLA 3P11H 4GXVH 1UJ3A 4TQEH 3PHQA 4MYWB 4OGAC 1FNSH 2X42A 4HLZG 5FYLD 3IF1B 3NZHL 4XP5H 3O11A 3L3HA 3DRTB 1NCDL 5D1XC 1EXUA 3IU4L 5DLMH 5DUML 3LIZH 1G7JB 4NJAL 2D4DA 3I2CH 6FABH 3QUXB 4K8RD 4NJ9H 2J88H 2IH1A 3PNWA 4ODBD 4X4XA 5CWSA 4XI5C 5H94B 2ZPKL 1CZ8H 4NZUL 4QEGA 3VFPA 1WBZB 5LXGL 3PJSA 5GRUH 1IC1A 1R3HB 1FNAA 3ARPA 5BS0A 5K9JL 2V2XB 3OAUL 1XH3B 3ZKNC 1EO8H 4LCCB 4PLNC 4DW2L 2QEJA 1BQHA 1RIVL 3D25B 4KMTL 4ZFGH 5J4MA 2F53B 3ZE1E 1K2DA 1K3IA 4NCDA 5IKCB 3HMXA 1G0DA 1I8MB 3QI9B 3GMMA 1HHIB 4O51B 3CVHB 1J5OH 3S36H 3TYFB 1N64L 3KG5A 4QXUL 2GCYA 2YMXH 3SN6N 5LJYH 4U33A 4XPHH 5D7SH 3RWIB 2NZ9C 1KCVL 4BFBD 3TNMB 4L8CA 4FXKA 2VN7A 4U6TA 4BZ2L 4GH7B 2VDRH 1MEXL 1HQ4A 3O4OC 1TCRB 3UTSB 2YUXA 4Z76B 3OG4B 4FOMA 5B3JF 3VD5A 5E2VL 1TQCC 3ETBF 4LU5L 2UYLA 5I74B 1IILE 3FT2A 5GGVL 2F5AL 2IAMC 5IEKB 1HILB 4PREB 1ZV5A 1CXLA 4RMSA 5DRZB 1X5GA 2EC8A 3MR9B 4XZUB 1HHJB 2PN5A 5C9JB 3BESR 2DQEL 2P43B 1P7KB 2B5IB 2XWTA 4PS4H 4OIBA 3DX8B 1GGBH 3VD4A 5HGDB 5C0CA 4HK3J 4YDIH 5KVFL 3QEUA 2VMFA 2BY3A 1I4FA 4GMTH 2VZ3A 4Z7WA 3GBML 3RWEB 4OGXH 1CU4L 4IRZL 1V3LA 1VB9A 5HI4C 3TBSB 4OGYL 3ES6A 5FYLL 4GG8A 4EXKA 5JOFB 2A6JB 2JELL 1M6OA 4D9QD 4X6EA 2OZ4H 1JL8A 1R0AL 5J1AA 1SBSL 1JWUA 5IQ7H 4JJ5A 2F58L 1MIML 1JHKL 2GHWB 5C2BL 3WJJC 4PJGA 3HNTH 4KTDL 2MHAB 2HVKB 4QRQB 4TSBH 4NUJA 3DX6B 3BO8B 4Y2DA 4HS8L 1DSFH 2C4XA 4NT6A 1AR1C 1PYWA 1JI1A 1MI5A 3EIFA 3TBYA 1IM9A 2R0KL 5ICXA 4Z7QF 5IMLB 4OCXL 1BVKA 1D9KC 4Y5VC 4B7IA 4WFGE 5CP3H 3DI2B 4J4PD 4ZFOL 3KR3H 1P1ZA 2IAND 1XF5B 1JZ6A 2XZQH 2BRRH 4DJMA 5EUKB 5GRYA 2AI0H 1QBLH 2VC2H 5HD8C 5JUEH 2AK4A 1NKRA 2A38A 1RZ8B 5FA4B 2AXJA 4HH9A 5ANME 1AI1L 3H9SD 3QDGD 1XCTB 5KS9B 1A47A 3HAEB 5JHDA 4LQFH 4YE4H 3LSOA 4RFOH 2DKUA 2RQ8A 3CPLB 3RAJH 1DQQB 3R06B 4ZSOA 2A9NL 3FT3A 5HGHB 2CMRH 3VXNA 3KYNB 2B4CH 2XIDA 3MJ8B 4I0KA 1YJDL 1UM4L 2JJVA 4NBZB 4H1LG 4OSUL 3ARTA 3K8LA 3M17B 4JFOA 1U3HB 2B7DT 2GAZA 4HV8B 3X3GH 4Z0BL 4HBQA 4N90D 2XA8H 2ESVA 2I9LB 3SHSA 4MB5A 3INUH 3UJIL 3REVA 4GRLB 5E6ZA 1JPST 1HSBA 1QSEE 1WQVT 3WL9A 3O2DL 4C57C 1GGCH 3O4LE 4C56D 2B0SH 4AEEA 4NYLA 4XPFH 1KCUH 4D0BB 4EI5A 1NCUA 5AYQA 5HVWA 4KAQH 4HK0A 4RQQB 1MFCL 1ES0B 4JKMA 4ZAKA 5IVZA 5IFHH 3LKRA 3G6JF 3V4VL 1TCMA 2J1KA 5AZ2H 1VACA 3BT2L 2E9IA 1I9IL 4TNVK 3EYUL 1AE6L 4ZODA 5ELIA 3UTQB 2P45B 1Q72H 2GJZB 2EIDA 4ONFH 1JZ2A 2R8SL 5FCUH 3GJFB 1K6QH 3CFBA 3SCMC 1AO7E 1JZ7A 1J86A 4K7PX 2BRQA 5D96C 3R8QA 3DMMC 1R24A 1FVDB 4EUPB 1NGYB 3OJDA 4G8GD 1FFNA 3H3PL 5HYQA 3G6JE 5E94A 3ECBB 4QTIL 3RKDC 1E4KC 5JIKA 4POUB 1G0XA 2FJHA 1FGVL 1N0XL 3C08H 4XAKE 1N0LA 2RFXA 3ULVE 3SBWA 1BOGA 4OLYH 1H3PL 5DFVD 4NZRL 5AWNL 5DJ0B 1ZGLA 2X1PA 3QR2A 4KKCD 4N8CH 4YHYB 2QQLL 3PIQA 2Y07L 4P5MA 1A1NA 3C5SB 4FXGB 1HNFA 5I1IL 1SMOA 4L5FL 2L7UA 5J13C 1VA9A 1Q8MA 3HC4H 4FRWA 3PP4H 3IFNH 4J8RA 3ARFB 4P46D 4DUVA 4Y4HB 4HGKC 1OAKH 3ARSA 4LASH 1EZVX 1PDKA 3WJLC 2X9YA 5HYIA 4LHUD 3IDJA 4HUVA 4MSWB 2FO4A 2X70A 1DL7L 2WM0A 5BVJB 5TDOB 3F65A 3BWAA 1OM3H 4JFDA 4U0QB 4NO5A 5F7WC 4LCUA 5IBUG 3CFCH 5L8LB 3HG1A 4JAMA 1YC8A 3D6GA 1P7QD 1OPGH 2BSSB 3MCLL 2DJUA 3PG2A 4Y19E 3ARED 4MJ6A 2NNAB 5EORH 3WFHB 3MMEB 2FL5B 5CEZE 5J1TC 1RK1B 4WCYH 2FRGP 2NY5H 3WFZA 1FJ1A 4M5YH 2PYEB 3GI9L 1C7SA 3V5DB 1D6VH 2F54D 3FO1A 5H35B 1RZKH 3QIBD 3BKMH 4K9EL 1DN0A 4FQCL 5JQ6H 4YDVB 4J7RA 3GBNL 4JFHD 2YPLA 4NRXB 1R3IL 5T1MA 3KDMA 2BNRA 3UYPA 3KPNA 3U0WH 2ATKB 1IQWL 3QDMA 2G75B 2NY3D 4GJTB 4PJ8C 4HWBH 4RFEB 3O6KL 4P3CL 3RWFB 4NC1E 2ZSWA 2J8UB 4V1DE 2VXSH 1GGUA 5HI5D 4LL9A 1YEHH 1P5UA 2PKDA 5KJRH 1JN6A 5DMKA 3HZVA 3GSQA 4Z7UA 4JDTL 3VDCA 1RULL 2DYPB 2DQHH 4XP9H 3QUXD 4RMTA 4U1JB 5CZVL 4IOIA 4LCWE 3VGAC 1FYTB 1RURL 4OCWH 2NY7H 4NQCE 3R4DA 4D0DA 2ICWB 2W9EH 4L3CA 3V0WL 1UVQA 3VXOA 1QLFB 1WIUA 4RWHA 2XT1B 3U9UB 4YHZL 3T0EE 3U7WL 1O5DT 2ENSA 3UXFA 1QA9A 5GXBB 3KPTA 4X6BA 3SQOH 2GT9A 2F53D 2W0PA 4AQOA 3FQNA 1V05A 1T7XA 2APTA 2R56L 3FB8B 3SE3A 3QI9D 1TVHB 1P4BL 2AVGA 5I1GH 4BJLA 1NQBA 1GAFL 4P2QE 4XPGL 4M43L 5F7DB 4XBGB 3K1KC 3UTZB 4OZHF 4PJXE 3GMLA 3PDOB 1FNEB 3K46A 3BP6A 4GKZB 1IC7H 4HIIA 3P4LA 4JM2B 1ZEAH 2NY4C 2VAAB 1S7VB 5K9OB 1FC2D 2J6EA 1MFNA 4JFYB 4I48A 1MJUH 3IXAA 3BP5B 4NQUA 1P84K 3UTSD 1KB5H 1AGCB 4KUCD 4BQBA 1S78C 2CO7B 5I8KL 3CSYA 1F90H 2H6PA 4D3CL 2YRZA 2NY6B 2JLLA 4OI9A 4L4VB 4ZXBA 5DHYB 4CMMA 3V5KB 4HQQH 4OZHE 3S37H 4O5LL 2QSTA 2X40A 1FLRL 5GISH 2DKSA 1S7SA 4FFVD 1JTOA 4HUMB 1IQDB 2OP4L 3VFNA 1G7IB 3QIWA 1MFAL 1A6VL 3HPLB 3G6DH 2B2XL 1FGNL 4MCZB 5I1AA 2B1HL 1MCQA 1AD0B 3L9RA 3C6LA 4BH8A 4KI5E 1P4IL 1C12A 3C2SA 4JZJA 2YUVA 3TBWA 3V0AC 3SJVD 4UT7L 4LLUA 3QUMA 4OCSL 1TTUA 5KSAA 4UUJA 5FCSH 4I0CC 3BPNC 4HGWA 5ALBH 1A7BA 2DD8H 3EKCA 1WVZA 1T03H 2Y5TB 2EDEA 1SY6H 4JQXC 4NP4H 4PGDA 1OTUD 4OI7A 4Q9BA 1F4AA 4JFXA 1QACA 4ODXB 3HZMA 5DQ9A 1UC6A 2E7LA 2CJUL 1YNLL 4DVBA 3GSOB 5F7EH 3T09A 4LDOB 4G8EB 3UTPE 4MCYB 4QHUA 4U1MB 1MCIA 4X7SL 1MF2L 4LEOB 3CXDH 3VH8A 2WINA 4UT6L 2CKBA 3FONB 3KPMB 4NHCL 1CE6B 4AL8H 1BREA 1WEJH 5CGYC 4NN5B 5L8KB 1SYVB 1OAZL 1CQYA 2VKXA 3MUGA 4ELMB 4MDIB 1NBZB 3QISA 3GFUA 4OZFH 1U41A 3M1BA 4PV8B 25C8L 4LSQH 5D1ZC 4MQ7B 4F7EA 1NCAH 3IJSB 1IGCL 5HXMA 3JXAA 3TYGL 2EEDA 3UPAA 4NO2A 4EDWH 1NGWA 2C4FU 3NGBB 2Q7YB 4DCQB 4E42A 5I1DB 4UIMB 5F7NC 5C0GB 2OBGA 1J1PH 2YN5A 4YHML 5KANI 3QUZA 2VZOA 1F5WA 3N9GH 1CFSB 3BPLB 3G9AB 2BSTA 3OHXB 1HCVA 1U8IB 4KZDL 3CMGA 4XAWL 3NIGE 5F70A 4BK4A 2FD6H 3PL6B 4XNMA 4ESKA 4R4ND 5D70H 1X5YA 1A9EB 1FZJA 3BOVA 2AXFA 1OARL 4S1QH 1KPVB 3A67L 2K7QA 3BIKA 4LRNL 1MCDA 2XG4A 3T0VA 3RDTA 4LLAA 4DN3H 4N0YL 1VADB 3W2DL 2WBWB 1JF6A 3U30C 1U3HD 3MTRA 4LLDB 5D71L 5E95B 3ZTNH 4CN4A 1ZMYA 2M26A 1NFKA 4YHNB 3RGVC 1GGYA 3Q6FB 4UBDD 1YQVL 1GXEA 3MODL 4YPGA 4EVNB 2NTFA 5T3XH 5HDQL 2XV6B 5CUSH 4LAJH 1J8HB 2GJ6B 5GJSH 1FC1A 1FL5B 4Q7DA 5HY9A 2ZUTA 1DUYB 4NWTH 2IFFH 5C0EA 1T21A 1D5BA 5CJOH 1EIBA 3C60B 3FCTA 1FVCA 1RZKC 1WJ3A 1DR9A 3NPZB 4OIIH 1MOEA 3C9NB 3FRUA 3QEGL 2OTUB 1EJOH 2VXTH 1U93A 2BZDA 3TJEH 5IB2A 3T04D 3SE4A 4KRMB 1CFNA 5DRXA 5DVKA 2C26A 4PP2A 1NGZB 1J0KA 2FATL 2QQKL 5DD1L 4Y5XA 5ANMA 4A2LA 1FFPA 5DYOA 3WN5A 2Q7NA 5HYFA 2GSIB 2LFGA 4JZOB 3VWKA 4S1RL 5F72S 4LFHD 3I85A 3ARBA 4HHAA 4LQ1A 5IK3B 3U46A 3KLAB 5AEAA 3DSFH 2OMBA 3RU8H 4Z7VB 4FQJH 5CCKH 4NOFA 4JN2A 3VI3F 3Q1SL 4XMKH 4A2MA 2H2SC 5FHBH 3I6LE 3EO9H 4X80H 3O9WB 4PY7B 3HAEG 1V3JA 3Q0HA 4J3WA 3UROR 2P5EE 2V2WB 4CJ0A 3SQBA 1J0YA 4S11A 3MBXH 3ZT7A 4X8XA 3TVMB 43C9B 1C1EL 4XNUH 3T4YB 3ARFD 4RA0C 4Y4HD 1MSPA 3B5HA 5F6IB 1NANH 3IDYC 1RZGB 4KK6C 4L1HA 4ZNEE 3X12A 3AB0C 4IHOB 4U0RC 5JW3L 3CLFL 1BVZA 1NAMA 5IFJB 5GGTL 1MWAB 3MLPA 4G8IB 1QSEA 4JRXE 2DMCA 5KSUB 3O4LA 3ZKXB 4P2OA 4PG9B 2LU3A 5B8CB 3K74B 3C09C 4YDKH 1VFBB 4R0LA 2X1XR 3E1F1 4N1EA 3O4OB 2K9UA 5JXEC 1IT9L 1IEBB 2PYED 1Z9OA 1MQKL 2X4TA 2MPAH 1MUJA 3K4ZA 4WW2F 1JNNH 3F58H 5TGBB 4MJIE 3OV6A 2G60L 2IG2H 1AO7A 5LWYH 3KJ4C 4WI2A 1QG3A 4YXHH 4XPAH 2YA1A 3VFOB 2VL4A 3MX0A 1F4WL 1WCBA 4XBEH 4XHJD 3MGOB 2UVEA 3G6JA 5JPMA 3DNKA 4YFLI 2HH0H 1Y6NR 3VRIA 4I5BB 4JVPA 3IDIB 5TH2A 3BRDA 3BE1H 1CGTA 2OJEA 4G8FB 1FRGL 1LO4L 3QQ9C 2EDLA 4YGVA 4P4KA 3UBXB 1FPTL 4JKWA 4JHAL 4LFHG 4EUPG 4QTHB 1R3LA 4MXQD 5F9JA 5LVEA 4ZO9A 3UEZA 2DQTL 2VLME 2XYCA 4I18C 1W0WB 2DYPD 3LY6A 1JF5A 2ZOLB 1JZ4A 1MRFH 3S88L 3D85A 2ERJC 3DETC 1FYTD 2LE9A 3HFML 5EBMA 5L7XL 1OY3B 1RPQA 4F3FA 2CK0L 1JYVA 1DLHA 4M62H 1YDPB 2A74B 1AHWB 2PW1B 4NOBA 4PLJC 3UPRA 3GHBL 5DJAA 1GC1C 4HC1H 4PJIF 2O5YH 3MV8E 1YYLL 3BN3B 3GM8A 5EZOL 5JHLH 1J1OL 2NXYC 1BQLL 3GM0A 4Y19A 1T83A 2B1AL 3QWRD 4M9PA 2R4SH 3FN0H 3ZZ1A 3AMLA 3EYSH 2DN7A 3L3IB 1HH9A 1JNLH 1W72H 1ZHLA 5C2UB 1P2CA 2BVQA 3C6SA 3O0RH 3MLSH 4QCIA 3U2SB 1FE8L 3TP4A 4WGVB 3LKSA 3CDGA 4Y5VB 4J1UA 2ZOKA 3MXWH 1REIA 3V6OC 1T1ZA 3SDCB 4XWOC 5F9AC 5C3TA 4IM8A 4OFDA 2UUDK 4RDQF 4I1NB 5I1JL 1IJ9A 4JM2D 1LO5B 2FB4H 4UILH 5DK3A 2IGFH 2FEEL 3CC5A 3MYZA 3F6IA 2OL3B 5HPMA 3QDJE 3RI5F 4PTTB 3WIHH 5EA0H 3E8UL 3MRPB 5EIIB 3F12B 4FZEL 2NY6D 3TA3A 4JN1L 3W5MA 2VLJE 3QNYB 1T0MB 4L4VD 4Y16A 4JRYE 4CVXB 4RNRA 4MXVE 2XN9E 4BZ1L 1ZVSA 2EDKA 2IFGA 2HYMA 3WKNA 4JJHA 4LCYA 5DRNB 5CMAA 1L4IA 4LCWA 3MRRB 4IBLT 2MQ0A 3P9LA 4NQCA 2NY1C 4L9LC 5GZOC 1BFVH 1N3NA 5IW3A 2Z91A 1XCQA 2OI9C 4KKLD 3LPWA 4MAYC 5D6DA 2XKSA 4C54A 1BM3H 4PLKD 5E4EC 1SJVA 3L95A 3LS4H 3T0EA 1RJCA 3ZDYE 1K8DB 2Q86B 2FO1A 2EYSB 3V6FA 4OKDA 4Y4FC 1MCWM 3V4PH 3FB7A 4G7YH 5HHMB 5IHUL 3F7RA 2IPTH 2BY0A 2VDNL 5CLTA 1I3RB 3GMNA 4LPCA 1FBIL 5FYKU 1MFBH 3VXTB 1HZHH 1RZJL 4P2QA 1XF3A 3CFKB 3EFFB 4JO3H 2IQAB 2FH8A 3F7YB 3BH9A 4M8QA 5IHLB 3EOBB 1MRDL 2GTWB 1JHTB 4PJXA 1L7IL 5DS8A 4TSCL 5E08L 2WBJA 4WNQB 3LRHA 1GIGL 4MZ3A 3VRLF 3GBLA 2NW2A 1PVHA 2VKWA 4LLQA 4ISVB 4CW1A 1KGCE 2EE6A 1QBML 1HI6B 4ZYKA 5D96B 3AVEA 1LNUA 5KOMC 1G9NC 2DLIA 1ZLWK 1PSKL 3LKQB 5F71A 4OZHA 5BXFA 4M6OL 5J6GA 1IAOB 1IC4H 5E56A 2DQJH 2BSRB 3G9VA 5L9DH 4P59L 3N1PC 5CD3B 1NCTA 2DIJA 4OF5A 2ED9A 1MPAH 2BVEA 4O58L 3BMWA 4X8JB 1UKQA 3IAGC 3ZE2F 3S34L 1B0RB 3O6LL 3ZE0E 3K81A 2ZUUA 2ZKHL 1J0ZA 5EU6B 2LU7A 1L0QA 1W0VA 1CICC 4IRSA 2A83B 3OBAA 4KK5D 1G6RA 2AJZB 5JDSA 1GYAA 3KPPA 3PL6D 5LBSH 1U3ZA 5B4MC 3FMGH 4R90L 1H15A 2JTDA 1KB9K 4ZTPL 1Z0MA 3PF2A 3ZE2E 1JFQL 1GGTA 2Y23A 3QG7L 2PYFB 3VFTB 3S35L 4PJ5B 1CGSL 1XZ0A 2I07B 4YZFE 3VJ6A 1NLDH 1XIWC 2HN7A 2PXYA 4NBYB 2VIRB 1U8LB 3JWDL 3ULUL 5F1NB 3RWHB 3F7QA 4RAVB 1RJLA 5I1KH 4D9LL 4OZ4B 4PJFE 5IB5B 1KJ2A 4M93C 1IL1A 3H6JA 1EO5A 5C92A 5DA4A 4QHLB 7CGTA 4OB5L 4I0PA 1J8HD 2GJ6D 3GRWA 1BFTA 2F74A 1A4JB 4RWYL 3HNSH 1QRNB 5MEOB 3J7HA 5KN5A 5H37H 5I75B 3OKDB 3UTTE 3C60D 5J8OA 4OT1H 5ACLA 3EJZD 3WFCL 4MQXC 1RFDL 2VZUA 1MLBB 5C6TL 3BUTA 4XXDB 2HT3D 5BV7H 4R4FL 1K5NA 2XFXA 4OCNC 3Q2CA 2HFEA 4ODWA 1UG9A 1H5BC 4QXWA 3TJHD 1H0DB 4E0RB 3ESUF 3ILPB 5I30L 4KV5E 4OFYD 3UJJH 5INDB 3WXWL 1QFWI 4N9OB 5DDHA 2ITDA 5ICYA 4K2UL 3ARGC 2M2DA 1IC5H 3THML 2HWZL 4Y4KC 4JG1H 4CN6A 1KULA 3F7PC 4GAYB 1KIRA 1YN6A 1ZVHA 4I8DA 4R2GB 4PGEA 3ZYJA 4YXLL 2CLVA 4H5SA 4KJWC 4LIQH 1EVUA 1F2XK 2YD6A 2MMXA 3UZQA 1A7PL 5LKNA 2YUWA 3S3JA 4XWGL 5E6IA 5KW9H 1EFXB 3NABL 3AROA 4UIKL 4J6RH 2V17L 3VGAB 1A22B 3EOAA 4XI5D 4X7TA 4MD4B 2DQDH 1E4XL 1KXVC 1C08B 3O9WD 3OJ2C 1D5XA 3NPSB 4I77H 4OCRL 3ZKND 1T4KB 3MLYL 2C3GA 4P2CG 4WEBL 3H9YA 4F7CA 4H26A 5F93C 3TVMD 5FYKH 2X4RB 5D6CB 1BBDL 1ED3B 3L3JB 4R4BA 5CJ8A 4LNRB 2ATPB 2ADIB 4ZQKB 4FQ1H 1E0OB 4ZD3H 3TV3H 1SYSB 1MCPH 4FMKA 5C9KA 4RA3A 1F45A 1SEQH 4NIKB 1K8IB 2R2BA 4MMXC 3BSZH 2J7LA 2NZ9D 3P77A 3E2HB 5F7LB 2VL5A 1Q9LA 4NQDB 4DUXA 5FA3B 4OQTA 2NW3A 1A4KA 1YEEH 2NY4B 1AD9A 1H3VA 4ZUWB 4X6CF 3P9MA 3KAAA 3MLWL 1EDQA 3BAEL 3VD9A 4TRPL 2AJYL 3HRZA 5J7CC 3NCYS 3NFSL 4LVHC 4CAGA 1LEKB 1NSNH 4NKMA 2GY7B 4JPWH 3CZFB 2OR8A 3K7UA 2UZIL 5JTWA 4ENEC 3BZ4A 5J3HC 1FFQA 3BUYA 3LKOB 1QFWM 2H26A 3EUUA 3MPCA 3MCG1 2HLAB 1Q1JH 5CD5C 1D6EA 5C0JB 4PRHB 1QO3B 3CFDA 3T8XB 5T5NF 3QQ4B 1PW3A 4JKPL 4YHPA 2R0WH 4WENB 3HZYB 5I19L 3L3DB 1JPTL 4K07A 3ZL4H 4GG6B 3BPNB 2P5EA 5K9QG 1KN4L 4BFEA 3MRKA 3G5ZA 5HI4D 3BRGC 3D5OF 5FM8A 1G7PA 1R3JA 3RPKA 4FP8H 3OWEA 4UINH 3MLUH 4ZNEA 1HE7A 4BZYA 3NCYP 1U8QB 4XP1H 1QSFB 5DC9B 3ALXA 4QGYA 3DARA 1V7NH 3UYRL 1LVEA 1ZANL 2FHCA 3I84A 4JRXA 4Z0XB 5MERB 5FKPA 5HJ3B 3L5HA 2QADC 1JGVL 2LVCA 3RVUC 2VISA 1A7NH 4R26H 3BYYA 1TPXB 4DUWA 2VDKH 2P7TB 2B20A 5E2UH 5MHSD 4U6XB 5C0BB 3U6RA 2JCCB 1IVLA 5DJ6B 4UB0L 1AR1D 3O41A 4KKNA 4MJIA 3MNWB 3QXUA 4ZUUB 3SDCD 2YSSA 1HH6B 1MRCH 3BHBA 2BCKA 4UOW1 3IYLW 5ADPL 5F88B 5EO9A 2OM5A 1QQDB 5D7KE 5HD8D 1LWRA 4I3GA 2X4OB 1WZKA 4M4PA 4QRTB 4WEUD 4WW2A 2DL2A 5DRWA 1KIPA 1J1XL 3RIFF 3HZKB 2AV7A 5IB1B 1JJUA 3QJFB 5CZKA 3RVTC 1T2QH 3T2NH 3LQZB 4NQEB 1KFAL 3HNVH 4X6DF 1J05B 4MLIA 3WV0A 4ACPA 4Z7OF 1UZ6F 2FLRT 2ZWLT 3QCUL 2KDGA 2W38A 3IDNA 5GRVK 1DP0A 1MJ7L 4KPHH 1I3GH 3IFPB 3WSQH 3UBXG 2NXZB 2WP3T 3O6FA 1WGOA 4R7NB 4JGMA 5I17B 3QO1A 1BZ7B 1QUNA 1NCDH 4NKOA 2R9HC 5CHNA 3IU4H 3MA7B 3PWVB 5DUMH 4PUBL 1KEML 1RHFA 3MV8A 3SDAA 4Z7OE 1UZ6E 1ORSB 4HIXL 4NQTA 5HHMD 1GZQB 3KXFB 4U1LB 1QHPA 1I8KA 5GS1A 5F89A 3ROOA 5IIEA 1QR4A 4LBEB 3GIVA 4HWNA 4XB8A 4APQC 5CKAA 1Q9WB 5ACZB 5LXGH 2VQUA 2H3NA 1B90A 1DQLH 5K9JH 2E9JA 2DWEB 1KBGL 1YPZE 1OQOA 3B2VL 5DSCA 3FQWB 5C0DA 5TE7L 4HT1H 2IANE 5I8CB 3SKOA 3BQUB 1RIVH 1EMTL 1NUFA 5CIPH 1C5DB 4RGMB 4ZTOH 2ZG2A 3C8HA 3V7AG 2OQJB 3P3YA 3OR6A 1EAPB 3QDGE 1TQBB 3T1FB 1IE5A 1N64H 4IIQA 4PJBF 5E8PA 2AQ3A 4AEHL 4F7TB 3RUGF 3CFJB 1JPFB 1CLOH 4JRYA 3QXDA 4I9WD 1JHLH 3BP4B 4U4BA 3RKDD 4CVUA 2XN9A 4PJEF 1PZ5A 1TZIB 4GO6B 2VDLL 3IXTB 3LCYA 4H20L 3S3PA 1T22B 4LAQL 2HKFL 1MEXH 3MNVA 3WUWA 1ZLUK 3WDJA 2DMKA 5EU6D 5C7XL 3FN3A 3DV4B 5FV2A 3BYTA 1BVLA 4UU9A 4HIEB 3BEVA 2X4SA 5FDWB 1TDQA 3VW3L 3U4EB 4M8VA 2EDXA 2ARWA 2FWOA 1M7IB 2M1KA 4ODUA 4PJEE 2W0FB 2YS4A 1FFOB 2F5AH 5CKGA 2OL3L 4POZC 3IDYB 4PJCE 2E6QA 3BW9B 5EUOB 5DD3L 3O8XA 1MCRA 2DQEH 3DRQB 1ETZB 2WLZA 2YN3A 4U0RB 3IFLL 3N1QC 3WDIA 5T1LA 4QNPE 1C5CH 2Y4SA 3D48R 4GUPA 4PJ5D 3QAZB 1IAIL 5CJXC 4C56E 3O3DB 3VGGA 4XTRC 2CGRH 5KVFH 3SGEI 1OWRM 1TJHL 4WO4A 1NDMA 1N5YL 5L0QB 3WEXB 4IRZH 2K1MA 1F4HA 1UA6L 5AG9A 4X0KB 1UWXK 4C83A 4OGYH 1T5XB 4NZTH 1ZLSL 2HRLA 4GRWE 5FYLH 1BIHA 3SE8L 3QWQB 1KB5B 1KIUA 2R2EA 3L3OB 4KKBC 5C8JB 3LH2L 4OD3H 3VXMB 1QRND 1HHGA 4KQ3L 4Q0XL 3VFRB 3R0MA 1CL7I 3GSNA 4HUUA 5SWQA 5MEPA 1SBSH 2XZAL 2IQ9L 1GPOH 1MIMH 2VLLA 4KK8D 5F6HJ 1LQSR 1JHKH 4FFYL 5C09E 4HZLB 1UXSB 1MJJB 5C2BH 5E7BA 3AS1A 5JLZB 3VXUA 1IGFL 3TIDA 3CXHJ 5D1QA 5ENWA 4FQ2L 4KVNL 3LV3B 2HTLD 3DSNA 2W9DL 4HS8H 5C0IB 4I3RL 4R2GD 4S1DC 3D0LB 2JE8A 4HG4J 3KYOB 2OLDA 2QL1A 5FO7B 2HMIC 4IEFB 1AGBB 2CIIA 4OF3A 1ZOXA 1FVEB 3B2UC 4HUXA 1EFXD 1NPUA 4KGJA 1A6ZA 4XCNA 4GXVL 3GSUA 4TQEL 1YEJH 4KK9D 1FNSL 4XP5L 2CK2A 3PWPB 5EN2B 1VKXB 4PRIE 3QO0A 1MREL 3B9KC 3I2CL 3BKJH 1P5VA 2BDNH 2HJLB 6FABL 3OKEA 1A3LL 2J88L 1CFQB 5DJYB 1HSAA 4HAFA 4RRPG 1XF2B 1RJYB 1CDBA 2EICA 4PB9H 3FQXB 1FNFA 3T4AA 1VFUA 1Z5LA 2Z8VC 4NDMA 1RJZA 5KSVA 3QEQD 1EO8L 2A9NH 1I1YB 5A16B 2F54E 1S8DB 2NLJB 4OZFB 5BW7C 1YJDH 1UM4H 4ZFGL 4HIHA 3UTTA 1CD8A 5EH1A 2MCPL 1I8LA 3PWNB 4PRDA 2X10A 4JFHE 4NQDD 3NBNA 2VE6B 3S96A 3BPCA 2BOBB 3JTSB 4X99B 2NY4D 4Z0BH 2DWDA 1J5OL 2YA0A 3EHBC 1FAIH 1T0PB 2YMXL 5FYJL 32C2B 1NCWL 4XPHL 5D7SL 2EIEA 2BMKB 1S78D 5EBWA 4AENB 2A6IB 3TIEA 1KSRA 1DBML 3S97C 3MACL 3O2DH 1EX0A 4HEPG 4P48A 4HZAA 1DEEA 3HE6A 4L8SA 4P49A 1MFCH 3O45A 3OKLB 4YBQD 2EDBA 4UDUB 1X5KA 2Z31B 4YDLB 3DROB 3W0WB 3D87B 5FO8B 5DK0A 4F8TA 3IKCB 3VDBA 1D5IH 4PRHD 3EYUH 4L9LB 2QTEA 3WHXA 1KYOK 2VYRE 3L7EB 4JFPA 5I1LB 3GNML 2R8SH 3I6KB 5D93B 4D2NA 3T2OA 3MRLB 1P7HL 5DK2A 1Q0YH 4RZCB 1JZ5A 4LPTA 3MYJA 4XNYH 1UYWH 2SEBB 2MKWA 3NIDF 1S3KL 2CKNA 4Y4FB 3WLWC 1GGBL 1S7TA 4BA8A 5IW1B 2C3XA 1OHQA 4YDIL 1FGVH 3IGAB 1MHEB 2EYRA 4GMTL 1H3PH 4GKSA 1ZT4A 4OGXL 1QSFD 4NQXB 4HDIA 2HLFC 2QQLH 4R7DB 2GK0B 2QV2A 5I1IH 3LN5B 4K3JL 4L5FH 4EXPX 5HHPA 5DVNA 1CXKA 5JW4R 2CDGB 2GTZA 5DJXB 1LMKA 5ESVB 3K2UH 2X4QA 4CU8A 2FECI 2OZ4L 3UTSE 5C0BD 1F11A 3IDGA 3AY4C 5A3IC 1Z9SA 4NHUB 2R0ZH 1WUNT 3P0YL 1FL6A 2GUOB 4H8WH 1KEGH 1MH5B 3MRGB 2VQTA 2N1KA 4JPKH 1RZ7L 4R97C 2QQNL 4WTWA 1DSFL 4EIGB 3VXPA 1QFOA 5GGUA 4NKQB 4HPOL 4N8VA 4Q2ZB 3WO3B 1F3RB 2L0DA 3QIWC 1CLYL 2D0HA 2BRRL 1R5IB 3IFOA 3SPVB 3X17A 2AI0L 2VC2L 4YFEA 4MLSA 3AU1B 5JUEL 3D18B 4NM8H 4QRSA 3C6LC 3GBNH 4G6KH 4MB4A 2Y25A 2YD5A 4G43B 1R3IH 4NQED 4JDVA 4XH2A 1AGEB 4DFIA 4CVZB 5IJVB 5FO9B 1HK6A 1MVUA 3I50H 3FRPG 4J3SA 5J9PA 1N7MH 4RFNC 2OSLA 5IB4B 3MRJB 12E8H 3GSRA 1PJ9A 4L3AA 1HHHB 2AEWA 3RAJL 4NKDB 3KJ6H 2H2PC 2NXZD 1L7TH 3QHZL 2UUDH 2N56A 3KYKH 3MRBA 4LGSB 5ISZB 4P5TB 1N8ZA 2ADJB 3VE0B 4WY7L 5FDYA 4DAGL 4BSVA 4MD5B 4X6FB 2PNDA 4WJ5A 3OGCB 1RULH 5LAXB 3BN9D 1WBYB 3KXFD 1KXTB 2MJWA 5I8OH 2E7LC 2PCPA 3RHWF 3K80A 3JWOC 1RURH 1A3QA 1BLNB 4ELKA 3EDKA 1J18A 4LPYA 5J0BA 3X3GL 2GFBB 3KPSB 8FABA 5FKAB 2XA8L 1BHGA 1FN4A 3PABA 1DQTA 3V0WH 1ZAGA 1VFOA 3INUL 3FHAA 1VESA 4YHZH 3U7WH 4UTBL 2OK0H 4ZO6A 3BQUD 2HT4C 4CU6A 1GGCL 3CX5K 2B0SL 2GI7A 2ITCB 4HSQA 1KCUL 2XQBL 4FQLL 4IJ3B 5LG1A 1X5LA 2ADGB 3IAPA 1F6AB 1KNOA 2XXCB 5KS9E 5IFHL 1GAFH 5IWLA 4XPGH 5DMGC 1A6AB 1CT8B 2B39A 3AMKA 4JFQB 1T1XB 2Z92B 4M43H 5AZ2L 4BSJA 3S4SG 4H1LA 5KSBE 1OW0A 1SJHB 3MRMB 1Q72L 1WC7B 4U3HA 3WE6A 1N2RB 2EXWC 4YFDB 1G7QA 2DM2A 1OSZA 3QUZC 4ONFL 1K6QL 3G5VB 1QRKA 4P3DA 3WYRA 4U6YA 4WW1B 4PRPB 4UOJA 4AIOA 2P24B 1NUNB 3OKNB 1FG9C 5ETUA 4AZ8A 4LSTH 3P4MA 4G7VH 2C3VA 3C08L 4QY8A 5FK9A 1Z6JT 4KXZH 3QZWB 1Q9OA 4O5LH 3S7GA 5ITBL 2CSPA 1U8PA 4OLYL 3RPIA 4L9DA 2ZCHH 1LEIB 2OP4H 1A9BA 3I75B 4J3UA 3UAJC 1A6VH 3G5XA 2H9GA 1EA9C 5A2JH 4CL7A 5CSGA 3EYQC 1W72B 3Q48A 1UT9A 4L29B 2WAHA 3HC4L 1ZLWH 4GXUM 1HXMB 1P4IH 3QPQC 3S5LB 5BRZB 2P8PB 5EC2A 2WSKA 1UENA 1EK3A 4O9HL 4OCSH 4EQ3A 1HKLH 1ZHKA 2ZCKH 5GSRB 1YPZA 2BY2A 3SGJC 4J4PA 4MNHA 2IANA 2G9HA 4OZGF 1CE1H 5GGSY 2R1YB 3X3FH 5DJZA 4OD1H 3DYMA 3VXMD 1TZHA 4GAFB 3CDCA 3H9SA 3QDGA 4PP1C 3SE4C 1RMFL 3LDBC 4ZUSA 5EORL 1DUZB 1KTDB 1YNLH 2CRMA 3VXRB 3ZT5A 1UM6L 4KU1A 4WTZG 1ROWA 4WCYL 3LRSA 2NY5L 3VGHA 2W0LA 5E5MA 5I9QC 4M5YL 2OR7A 2ICEB 5IW6A 1D6VL 3WN5C 1Y0LB 1RZKL 4KMLB 1RUQH 3BKML 4MXWH 4R3SB 5JQ6L 4NHCH 5EOQL 1CGVA 5F3BB 2Q8BH 1CGXA 3MCKA 4WU7B 3QQ9D 4HKJA 3WNPA 5C08B 1HYSC 1RZIB 1I7UA 3RWJA 2JF1A 2D7MA 3HR5A 3OKKA 1KCRL 4PJBA 4POYA 1V3KA 4U6HB 5GJTL 4HULB 1M05A 4HJJH 1G7HB 3TWCL 4HWBL 3MREA 2BJML 4PJEA 5L2JA 1A6UH 1OQXA 5IGXL 3DETD 3LD8C 2YD8A 5A43C 3TYGH 3LPGA 1T2XA 2VXSL 3P73B 1V3MA 4HS3A 4PYHA 5GGQL 3V0VB 4LLWB 1TJGL 4OKVB 2EDYA 5D7IB 5GS0H 1I7ZA 2DAVA 1NL0L 2H32A 4PLJD 4C56A 3RL1B 2DQHL 4XP9L 3BPOC 4YNYA 5IHBA 4KHXH 4OCWL 2NY7L 2QADB 4XAWH 4QWWC 5DJ8B 2V2TB 1T0NB 1S9XB 4MWFB 3VXQB 1BX2B 4X9IA 4NM4L 5IOPB 3QULB 2VDOL 3HPJA 1ZA3A 2BK8A 1OARH 2GEEA 2PYEE 3LAFA 4P2OC 2X4UB 4P4RB 4LRIA 4QHNB 4XXCA 4HWZA 4R0LC 3SQOL 4N0YH 4XWOD 4F2MB 5GS3A 4ETYA 4G8GA 4PLOB 3LEVL 1XGYH 2Z35B 2F8OA 4KJQC 5HDQH 2W07A 4CADA 5IB3B 4NKIH 5B38B 3TESA 3RWCB 3NIFF 5D72L 2EH8H 1P4LB 2J8UE 4M3JA 4JPVH 1U8MA 5FF6A 1KC5L 5CBEB 1ZEAL 3PUCA 2I25N 4N5EC 1WCQA 5I6XC 1N26A 4M5ZH 1MJUL 1CGYA 3MJ7B 1KB5L 4LSSH 2EO9A 3B43A 2Z31D 4P46A 1F90L 3DVNB 4P4KC 4JDZB 1BD2B 1H9VA 2AEQH 1ZT1B 3S37L 2RAMA 5GZOD 3WFCH 2FATH 4XPBL 5GISL 2QQKH 1U8HB 2X6MA 4LHUA 2IF7A 4HEME 3HTLX 4MAYD 2Q20A 2G2RB 4GG8B 4Z18A 3G6DL 3SGKA 2C1OB 3V5HA 2Z8RA 1EEUA 1NFDB 3PV6A 3U0TB 1TNNA 3HI6H 4WDIA 3IU3B 3MQIA 4K7FB 4Y4FD 1P7QA 5T3XD 3MC0A 4JLRA 3AREA 4JM2F 5GGSB 3NN8B 4LSVL 4APQB 4QXTA 3P0GB 1Q9KA 4GXUN 4TVPH 2AQ2A 4I4WA 1JWSA 1KT2A 2F54A 2V7HB 2E8ZA 1HINH 3IDMB 3QIBA 1S9YB 1SY6L 4NP4L 5BV7B 2VLRB 2FZ3A 1CVSC 5DT1H 5L88H 5IMKA 2Z4QB 4FN0A 1C1EH 4YEFA 2ZJSH 3EJJX 3ULUF 3ALWA 3T1WA 1J7VR 5IJKA 3CU1A 1NMBH 5F7EL 1GC1L 5HHQB 2BVOA 3BZEA 4PG2A 4OZFG 5D5MF 5DMIH 5JW3H 2KL6A 2O5XH 1EHLH 3CXDL 3VFSB 4L4VE 1IBGH 1JPSH 1DANT 3IF1A 2AEPH 3DRTA 4AL8L 1WEJL 1URLA 3MJ9H 3D9AH 2JJTA 2BVPA 1G7JA 3TA3C 2EDJA 1A7OL 4NC1C 3QUXA 4NC0B 1OTSC 4Y16C 3ARRA 4KZEH 4KJYB 3HCVB 4YO0B 3SY0B 2EC9U 5H94A 1J8KA 5EZIH 1WBZA 4JY6B 4W4OA 1UB5B 5EFIB 4KRLB 3RVVC 2V2XA 4EDWL 4LGRB 4NWUH 1DTUA 1WZ1L 1XH3A 2E7MA 4LCCA 4MNQB 1FSKB 1I7RB 4E41B 2DDQH 1F4WH 5B4MD 5FOJA 3D25A 1VEMA 2F53A 3N9GL 5AUMB 1ADQL 4EOWH 5IKCA 1IMHC 1I8MA 2DTMH 2WQRA 3QI9A 4OF7A 5HDBF 1HHIA 3T0EC 4PJIB 5EB9A 1GHFH 4HCRH 4O51A 3CVHA 4J2XA 3TYFA 4GKNB 4LVOB 4OUUB 5ISZD 4P5TD 4C59B 3RWIA 4JHAH 1VGKB 4HH8A 4PY8I 3MXVH 3TNMA 4S1QL 3E0GA 2H45A 4JCLA 1B0GB 3TN0C 4WHDA 3C5ZC 5H2BB 2DQTH 4HX1B 3LRGA 3S88H 4DN3L 5JDJA 1OGAB 4JO1H 3E6FA 3F7VB 1OF2B 1RVFL 2BC4B 3HFMH 3KS0H 3ZTNL 5L7XH 4ELME 1TCRA 3UTSA 4MVBD 4Z76A 2X41A 3KPSD 1FCGA 3P40A 1VACB 2WBJC 5EPMB 3TGXA 4MQXD 4M7ZC 4K7PH 5T3XL 3OX8B 4LSRL 4FQHB 5EO0B 4LVNC 2YRPA 1OL0A 4UV4H 5AYUH 1DQJB 3D3VB 4F58H 5TPWL 5IEKA 1HILA 3ME0A 4PREA 3DX7A 1YYLH 5DRZA 1TVDA 5EZOH 5SWSB 3SDYH 2IFFL 3MR9A 4O2EB 4XZUA 1HHJA 5C9JA 1DLFH 4K3DL 1J1OH 5CJOL 3ARGD 1K9TA 3FZUD 2HJKB 4OIIL 4Y4KD 1P7KA 3T3PE 5CSZB 1YN7B 5FM5M 1BPVA 4JCMA 4ORZC 2DOCA 4PR5B 1EJOL 4H25B 3QYCA 5HGDA 3TJEL 1D5MB 2E9BA 2FJGB 3SOBL 1RY7B 3RWEA 4TPRL 1P9MA 5A2KH 4P23C 1IGJB 4KI5C 1ORQB 3U7YH 5I1JH 4GMSH 3Q5YA 3TBSA 1G9NL 4PRPD 3VD7A 5JOFA 2A6JA 3BEWB 4NNXB 4J8RB 2YA2A 5E03A 5GS0C 3EO0B 1QEWA 4UQ3B 3B8YA 3B9KB 3RU8L 4H0IA 4FZEH 1HHKB 4FQJL 5CCKL 3O6MH 4HIJB 5EBGA 3TH4T 4DVRL 1YC7A 3O2VL 4XMKL 5GS2H 2E6PA 2KPNA 4LCIL 4X7DC 4BZ1H 2A9MH 5ILTH 2GJ6E 2MHAA 2HVKA 5DD6B 4QRQA 3STBA 1OP5K 4OZIF 2HAZA 3CJJA 3DX6A 3BO8A 5FECB 1N6UA 4KDVA 3MBXL 5D4QA 2HG5B 4XNUL 1NC4B 5BRZD 1MCKA 1LHZA 5MENB 4R8WH 3P4NB 4I0PC 5KVGH 5IMLA 2Y6SC 3KPOB 4NQVB 4QRUB 2ICWJ 3RX5A 2X4PB 4Z7VF 1ZLUH 1A6WH 1XF5A 3OKYA 4QRRB 5IHUH 1DDHB 5CILH 5EUKA 2VDNH 4TTDD 4HUKB 4G6AC 1RZ8A 5FA4A 3V8OA 1IGTB 1XCTA 5KS9A 4ODVH 3PHSA 3HAEA 3GK8H 4Y1AB 4BYHA 2BOCB 1PEZA 3FTGB 4NSKA 4YDJB 4ENED 1IZJA 3VXRD 1G84A 2DIBA 2QJDA 5D7LE 2C1PB 3CPLA 4WFED 5GGTA 4PRBB 4Z7VE 1MRDH 1DQQA 3R06A 1JNNL 1L7IH 5E08H 3OZ9H 1UZ8B 3I9GH 5LWYL 3GEWB 5J11C 4YXHL 1OP3H 1PX4A 4L4TE 5HGHA 1L6XA 5E6IC 3KYNA 4U31A 4XBEL 1QBMH 3MJ8A 5C08D 4X5WB 2NY2B 3IRPX 3UO1H 1TTFA 3M17A 1U3HA 5GRWA 3WFBL 1UWXH 3VFVB 1K4CB 2J2ZA 4L3CB 3VGFA 3BD4A 3BE1L 4HV8A 4L4JA 4PY8J 3RA7L 3FFDB 2LAGB 3ARUA 2I9LA 4FQXB 4UDTB 4EQ2A 2NCMA 1ZWIA 4XP6H 1MNUH 3DLQR 3S34H 1QLEL 4GRLA 3O6LH 2XWJB 5K33A 3R8BB 5AAMA 1FIEA 2EEAA 5JZ7C 3IRZA 3LVEA 4LMQE 4M02A 4D0BA 2J8HA 1MHHB 1XGUA 2QADD 4RQQA 2XY2A 1FORH 3CGTA 4M62L 4NN6C 4DN4H 4R90H 5CIPB 1ZXQA 1PKOA 5BMFH 3QIUB 3OB0K 1ZLVK 1JFQH 4EN3C 3QG7H 2XRAL 1XR9B 3UTQA 5K9QI 3S35H 1CGSH 2GJZA 2O5YL 2PO6C 4M7LL 3GJFA 3ULUH 3JVGC 3SKUD 3FN0L 4R97B 1FVDA 1UADC 4EUPA 1NGYA 5MEQB 4M1CC 4D9LH 1JNLL 1W72L 3ECBA 1A5FH 3MROB 5BS0E 3O0RL 3MLSL 2YPVL 1V7MH 3HC0B 3C5JB 3MXWL 1BFSA 1X6NA 5I16B 5DJ0A 3MJGX 4FTVB 4WUKH 3EOYG 3QCTL 1LILA 5TQ0H 3QNZB 3VI4E 4X5XB 3GMQB 3MLTB 2DBLH 1BGXL 3C5SA 4FXGA 5M7QA 3EZJB 2FB4L 1RUKL 4UILL 5C0AB 1RFDH 2CXKA 2IGFL 2Y1VA 3C6LB 3RVTD 1AQKL 4AEFA 5CEXB 1NC2B 4WI9A 1JYNA 3WIHL 1E6OL 3ARFA 5EA0L 4Z5RB 4Y4HA 4QGTA 1J88A 5I30H 3D39E 4LMQI 4UTAH 3WXWH 1BD2D 3D1MC 3V95A 4JEGB 4UZGA 2GQHA 2A0LD 5ADOH 4YQXH 2HWZH 5FGCB 3DHMA 5KVEL 4C55A 4MSWA 3IS1X 2Q76B 5BVJA 5TDOA 1VCAA 4YXLH 1U9KA 5C07B 3HN3A 1I7TB 2R9HD 4PFEA 1CI5A 3SDXB 1JRHI 1A7PH 2CD0A 4ZS6D 1EGJH 4PJHE 2F15A 4KHTL 2BSSA 4Z95H 4BSWB 1JGEA 4DVBB 1BZQK 2NNAA 4P2YA 3WFHA 3MMEA 2FL5A 4APQD 3V7AE 1BM3L 4KRPB 5I73C 1E4XH 1I9JH 3LS4L 1HEZB 3MLVL 2PYEA 3V5DA 5H35A 3V4PL 4G7YL 4OCRH 4X6CB 5IQ9B 2VLRD 2E7BA 4YDVA 1JV5B 3B9VA 4NRXA 4JY5L 5HVGB 2WP3O 1S5HB 2HT2C 4YK4C 1MFBL 5C0CE 1EH9A 1HZHL 4M7JL 2ATKA 1A6PA 4XT1C 3AS2A 2O61B 4JO3L 4RFEA 2OTWB 3RWFA 3DUSB 3ZKMD 2J8UA 2DLFL 4RCAA 1EBAA 2ZSVB 2VDPL 2IPKB 2VDQH 3BIAX 2ZUWA 4N0FB 3MZTA 3O2WL 4ZFOB 5TDPB 1JI2A 2DYPA 3LKPB 4U1JA 5B38G 2F8VA 1FYTA 3VDAA 5JORB 3L5JA 2O93L 2GY5A 2ICWA 1IC4L 4TRPH 4JPIB 3L1OL 2IBZY 1R5VB 5L9DL 1FZJB 3NFSH 1FFRA 4Z8FL 1QLFA 2AK1H 2XKUA 1MPAL 5CEYB 3U9UA 4MNQD 4MA3B 5E00B 4OFIA 5FYKD 5I1EH 1A1OB 2UWEF 2WIIB 5HHME 1MI5E 3O6FC 4LDLB 3HR6A 5J57B 4RMUA 3QWRA 2V9RA 3S8WA 3FB8A 1U58B 5B21A 1TVHA 1F6FB 4LLMB 3UJTL 4YPGB 4XTRD 5I2IB 3C8KB 4TUJB 1S7WB 2XZZA 3SDAC 2DM3A 4J3VA 4JKPH 4F8QA 5F7DA 4XBGA 5GS1C 4N0UE 3KPQB 5DJDB 4WI3A 3UTZA 1H3XA 4Z7NF 5C0EB 3EYFB 1CLZL 3PDOA 1RIHL 1FNEA 4YHOH 1BEYH 1NLDL 4GKZA 1OGAD 2VAAA 5FIEA 1S7VA 5K9OA 2P5WB 4DKEL 4BKLB 3BDYL 4JFYA 1FV1B 1KOAA 5H37G 3BP5A 2VXVH 1VENA 1XGRB 5I1KL 1AGCA 5DEGB 3LB6C 4WV1C 1KTKE 4X9HA 5ESQB 4L4VA 1HNGA 5DHYA 3V5KA 4I9WE 2VLKB 4HUWB 1S7UB 1DBAH 1JGVH 3HUJF 5SWSD 3TNNB 1EHAA 1IQDA 2VQ1B 4ONHB 4GQ9L 5IVXB 1G7IA 4IIQC 3HPLA 3DO7A 4OT1L 1PQZB 3U46B 1WFOA 4MCZA 4UAOC 5T1KB 4XHQA 1AD0A 3GSWB 4YIQB 3EGSB 5DQDL 5BV7L 4UB0H 2YD7A 5ERWB 4X6DB 1QBBA 3CIQA 4EBQL 1QSVA 4O02H 5EO1B 4ERSH 4HFUL 4S0SD 5EOCH 3KLHD 5EC1B 5DFWH 1IC5L 3OKMB 2AERT 4JG1L 4YUEH 1U6AL 7FABL 5ADPH 1MAKA 1I9RH 5D2NB 15C8L 5JW4Q 2E27H 4DTGL 4QRPB 4ALAL 5C0FB 3T0XA 2Y5TA 4LIQL 2LTQC 5CJ5A 5I71C 2WIMA 1FL3B 4LVEA 1DVFC 3B9KD 3PWUB 4ODXA 2FDBP 4TN9A 5KW9L 1J1XH 2F5BH 3O8XC 3LKNB 5DJ2B 5F1SA 2W9LA 5F7UA 3GSOA 2PF6A 4Z6AT 2Z93B 1A21A 2DQDL 1ZA6B 4XCEB 2J4WH 2ZP0T 4G8EA 2APWA 1XF1A 4MCYA 4U1MA 1BF2A 4PJ7F 5DHVH 4LEOA 1KFAH 1U8NB 2COQA 3ROLB 2D0GA 5LQBH 3FONA 4I77L 3KPMA 2I24N 1CE6A 4BQ9A 4WO4C 5DEFB 3GKZA 4OCYL 2DJSA 1QRNE 3TEUA 1SYVA 5FYKL 4ELMA 4MDIA 1NBZA 4G3YH 1NC4D 4DZBB 4HUNB 2HFGH 1GOFA 4LSDA 5MEND 3U1SH 4PV8A 4N0CD 4U1GB 1F3JB 4OQ1A 3LEYL 5IMMB 4FQ1L 4ZD3L 3TV3L 1MCPL 2DBJA 3IJSA 2BVYA 3EHBD 5GPRA 4JB9H 1SEQL 4PUBH 5FGBA 5HVHB 1AIFB 4HIXH 4QRRD 2ZUVA 2W60B 4G80B 3BGAA 3CU7A 2Q7YA 4DCQA 5I1DA 2EE3A 4GQPH 1EO7A 1RZFL 2WMPA 2ARJB 1X44A 5C0GA 4RDQG 1U36A 1YEEL 3CFIC 3HI5L 3U36B 3ULSB 5K59E 1CFSA 5I6XB 4OI8A 4Y1AD 2NZIA 3OHXA 2D9CA 3FOMA 3WUWG 1KBGH 1NMAL 4I3SH 3B2VH 3W11D 1MQ8A 1RUML 3PL6A 4DGIH 1QFPA 3VFUB 5IP4A 1Z3GL 1A9EA 4JFDE 4JPWL 1KPVA 5EU7E 2BNUB 4OGZA 5GSVB 4MA7H 1BJ1H 2NY2D 1VADA 3CSBA 4YX2H 3RNKB 5DMJB 1Q1JL 1E28B 4LLDA 5FYJU 4OLXH 4YHNA 3PGDB 1UACL 3Q6FA 1SEBB 1T2JA 5D8JH 3R0NA 2FSEB 4EVNA 4FQXD 1CVRA 2A6KB 1J8HA 2GJ6A 2FIKB 4LAQH 2HKFH 1FL5A 2HRPL 3ZHDA 1DUYA 2P8LB 1TZGH 2ZUXA 3C60A 2D7QA 1WITA 3MOBL 3PE9A 4IMLB 4NQDE 3VW3H 1WICA 4UINL 3C9NA 3MBEB 4PD4K 4XP1L 1ZK9A 3OL2A 2XKNB 4J1UB 1T1ZB 3OPZH 4OFYA 5DD3H 1DCLA 3JV6B 3O3AB 3QIUD 4KI1A 3EFDH 1NGZA 3BZDA 4JO4L 2RB8A 1A7NL 2IALB 1A14H 2YC1B 4X98B 2GSIA 4JZOA 3Q5OA 2VDKL 3SGEH 3ELAT 5IK3A 1MCBA 3KLAA 4V1DB 4Z7VA 3IKKA 4NBXB 2FR4B 1UEYA 3MLXH 4KUZL 4PJDF 4KKAC 3W82A 4L8SC 1LO0L 1O0VA 3CSGA 3LH2H 2XACC 3O9WA 4FMFA 4FTVD 4KQ3H 4PY7A 5I15H 3R1GH 3OXSB 4Q0XH 1UWEH 2P48B 2DI8A 3DIFB 1CL7H 3BDXA 4GG6E 4LEXL 5C0AD 3P9LB 3C6LD 2V2WA 2IQ9H 1YZZA 1ZVYA 3TVMA 43C9A 1X5HA 1NC2D 4F37K 3T4YA 4HFWB 2UY6A 2WW8A 1RZGA 5IFAL 1IGFH 4U1KB 5D7JB 4D8PB 2P49B 4ZS7H 3ALPA 5DR5H 2JCCF 4IHOA 3I02B 4KVNH 1QSFE 3T2NL 1T2QL 3V6ZB 1RU9L 2W9DH 4YHKL 5IFJA 4GBXB 1MWAA 3UCRA 4G8IA 3HNVL 5KSUA 2QR0B 5C07D 4DK6A 4NZJA 3QPXH 3B3IB 3TN0B 2YPKB 3C5ZB 4PG9A 4UQ2B 3RVWD 4KPHL 1XF3B 5B8CA 1I3GL 3LPFA 3WSQL 1VFBA 5I1CH 4NGHH 2LVEA 5C0BE 2JCCE 1ZGLM 5JO5B 4PBVC 4KRPD 2D7PA 5I66B 1IEBA 4CRPA 5TGBA 4QXGH 4M7ZB 1MREH 4WGWB 2XY1A 5DGRA 4L1DA 1MELA 5I8EB 1A3LH 2Q3AA 4K23H 3VFOA 1R5WB 3VXSB 3MGOA 3PWLB 1DQLL 2VRAA 4Y5YB 4Y8DC 3I6GB 4I5BA 3IDIA 5DMGD 4G8FA 2VH5H 4HT1L 5HI3D 2AKRB 3MRCB 3RY6C 3VA2C 4K8RC 2OX5A 3UBXA 4H0GA 2MCPH 4QTHA 4ZTOL 4P23B 1JBJA 3QUZD 4NQEE 1G7MB 3FFCB 1W0WA 2ZOLA 2J6EL 2PTTB 2JK5B 3WS6A 3D39A 5FYJH 3VG9C 1NCWH 2A6DB 1CLOL 1JHLL 5J12C 4BUHA 1DBMH 1YDPA 2A74A 2VWEC 3OTTA 1YEGH 3MACH 1AHWA 2GIYA 3CK0H 4P9MH 2EZ0C 4LKXB 1W0YT 5C6PB 3BD3A 3NFNB 3WJJA 4P99A 4W6YB 1KJMB 4NFDA 1A3RH 2CUIA 1GZPB 4PJHA 3HB3D 3KXFE 2DF3A 3SO5A 3MV01 3L3IA 3QPQD 1JZ3A 3DGCR 5JOEA 3U2SA 3GNMH 5DUBB 3U48A 4Y5VA 4F9PC 4LSPL 1FIGH 3SDCA 5CS7A 5D2LF 1C5CL 2DLGA 1AY1L 5DVMA 5B3JE 1S3KH 1CXHA 3SJVB 1LO5A 2P5WD 5D9SB 2CGRL 3OR7B 4WFGD 5F1IB 3FB5B 2OL3A 3REWB 4PTTA 3O81A 3MRPA 5EIIA 3F12A 3VG0H 2ITDB 1VGEH 3QNYA 1T0MA 4K7PY 1UM5H 3CZJA 4FQQB 4NZTL 2XTJB 4CVXA 3LHPH 2VLKD 4N8VG 4K3JH 1YEDB 4XRCB 2BHUA 1YEKH 1I85C 1ZE3C 4OD3L 5IWLC 5IM7B 4WWKC 5EUOF 5DRNA 3HLAB 4U1NB 5J11B 3HS0B 4P3WA 5T1KD 3MRRA 1GPOL 4XNXH 3GMPB 3JSSA 2E6JA 1AP2B 3CUPB 3P0YH 2DTSA 1JUFB 4HAGA 1H8SA 5BJTB 2R69L 2ENYA 1K4DB 3FO0L 3N06B 5HGAB 1RZ7H 5T5NG 1K8DA 2Q86A 2QQNH 2EYSA 3G5YB 4QRPD 4TULL 4ZMAT 4ZPVB 1MJ8L 4HPOH 1EZVY 2CLZB 4FXLA 3VXTA 3ZKSD 2EECA 3DV6B 1CLYH 1YEJL 4AQ1B 5SX4I 3CFKA 3FO2B 5ICZB 3EFFA 2IQAA 2ZUQB 3F7YA 1OT2A 4N0UA 4DGVL 3EOBA 1JF1B 2GTWA 1JHTA 5DEZA 4WNQA 4Z7QE 3DUUB 4EN3B 1WAAF 3BKJL 2BDNL 4ZNCD 3TO4C 1M1SA 3CVIH 4ISVA 3VXME 2PO6B 3MUHL 4J4PC 4PB9L 3G6AB 3NCBB 1HI6A 3CD4A 3IJYB 3QHZH 1ZT7B 3OXRB 3LKQA 1VPOL 4WY7H 3WHE0 1QHOA 5KG9B 2QSVA 4DAGH 1E4KA 2P1YA 1I1CA 4M6MH 5CD3A 1KENL 4ZOAA 4X8JA 2FGWH 1B0RA 5ALCH 2UY7A 3GMRB 5CZXC 5EU6A 1CGWA 1RUAL 3P0VH 4U1IB 1CDGA 2AEIT 1MCSA 3T0WA 1FAIL 2A83A 4OD2B 3EDDA 2AJZA 3OAZK 3DWTA 4HK3N 5HDOA 4JQIL 1L6ZA 1FDLH 5CGTA 4M1DL 4RRPA 4UTBH 1KLGA 1OP5H 4LLYB 1PEWA 2PTUA 3G08B 5DO2D 3PWPE 3WJLA 1K3ZA 2XQBH 4FQLH 5IV2B 2PYFA 1UKTA 2R0LH 3VFTA 4B0MM 3AM8C 4PJ5A 2I07A 1UFUA 3QQ3B 4K9EC 2VIRA 1U8LA 2X9WA 3L5WB 3HE7C 1KJVB 5F1NA 3RWHA 3U0PB 1D5IL 5T1DL 4RAVA 4PTUB 2IADB 4OZ4A 3RTQC 1NMCC 5IB5A 4WI7A 4QHLA 3QA3B 2QKIB 1KPUB 3WXVH 1Q0YL 3DVFA 4KC3B 4GS7B 1A4JA 1NGXA 2IBBA 2VABB 1HXYB 4XNYL 1UYWL 1QRNA 3OKDA 3D2UB 1TXKA 1ERNA 4JY4B 2Q1EA 4OZGB 4FHBD 1MLBA 2Q6WA 2CH8A 5GGRY 4XXDA 3MBED 5ITBH 4I2XB 4PB0L 1CIUA 4LRIC 4NC2B 1OB1B 4E0RA 1H0DA 5LCVL 5EOTB 1WTLA 3ILPA 5INDA 2C7UB 1VHPA 1WK0A 4KY1H 1G6VK 1NAML 4GAYA 3K2UL 1FP5A 1EV2E 3T65A 4MJ4A 2H8PB 4O9HH 4AYFA 3AAZB 4X4ME 2PTVA 1EFXA 3W0WE 2EIZB 4V1DD 1OTSD 2R0ZL 3K2MC 1YY9D 4H8WL 1KEGL 4EEEA 4DQOL 4JPKL 3CLEL 1T3FB 1C08A 3WLBB 3U4AA 1ACYL 3MFFB 4P46C 2OZ4A 3RVVD 5HVFB 3DOSA 1AQDB 1RMFH 2R39A 5E5UB 1T4KA 1QVOB 2ZNXA 4O2CB 5LGJB 1UM6H 3OB0H 1ZS8B 1ZLVH 2X4RA 1KCKA 5T3XE 5DUPL 2W1NA 4R6UA 1JYWA 3GJEB 3L3JA 1ED3A 3WIIL 1INEL 5D7JD 4LNRA 5EULV 2ATPA 2ADIA 4ZQKA 5EOQH 1SYSA 4NM8L 4AK1A 4G6KL 4GBXD 1K8IA 4FG6C 3AREC 3I50L 2BNQB 1N7ML 1KCRH 1II4E 5GJTH 5CP3A 1PKQB 3TN0D 4TOYH 12E8L 4NQDA 3C5ZD 2VSCA 3TWCH 1DQDL 2BJMH 5FA3A 3NFPB 1S7QB 3QBTB 5IGXH 3KJ6L 3DURB 4WHTB 5IEHB 2FGZA 1L7TL 2DQCH 3QIBC 5MI0B 4ZUWA 3KYKL 1RHHB 5GGQH 1TJGH 2D0FA 3RBGA 4X7CC 4WV1B 2WBJD 1NCCH 1NL0H 3DVGB 3B6SB 4PJ9B 5EDXA 4RIRB 1LEKA 1YMMB 5I8OL 5IJKC 3CZFA 2JB6B 3EYVB 4PG2C 3AUVA 3VXSD 2PW2B 2DQUH 3QDJB 4FFWD 1O7VA 3LKOA 2APBA 5JA9A 2VLJB 4L3EB 1KIQB 5HI5C 3FRPA 2HLAA 4NM4H 4MQSB 43CAB 5C0JA 2VDOH 4PRHA 5CEZL 1QO3A 2CXGA 2ZG3A 4A6YH 1BF8A 2JJTC 3T8XA 2XG5A 2OK0L 3QQ4A 1JTPA 5DQJB 5ESAB 1AKJB 3QUXC 2OS7A 1WFTA 3NZ8B 1U92B 3QXAB 3HZYA 3L3DA 4QHKJ 4GG6A 5HYSB 4P23D 4PGCB 5IHZB 4KI5D 2P42B 3Q3GB 4LHUG 3FFCD 1AGFB 3LEVH 1QBAA 2VR4A 2F19H 4JQXA 2AGJL 2LTQB 3H9ZA 3K8KA 1GJIA 4UV7H 3QUYB 5DZNA 4G6ML 1NGPL 4NO0B 4TVSa 1X4XA 4NO3B 5GS0D 1DVFB 1EFQA 3TPUB 5D72H 1YEFH 2P8MB 4XNQB 1U8QA 1QSFA 4GOSA 5ISZE 4YLQT 1QOKA 5T5FH 1KC5H 1EHNA 5T1LB 1Q94B 1ZSDB 1D7FA 3VCLA 4Z0XA 5GGRB 5MERA 2CQVA 4DZ8B 5EBLB 5HJ3A 4MA8L 4XC1H 2X1OA 1HQRB 3SDDA 5HHOB 1OCWL 4LSTL 4G7VL 1I75A 4WRLA 3L3GB 2P7TA 3LN4B 4U6XA 5C0BA 3L6FB 2JCCA 5BOZG 3TZVC 4F57L 3KPSE 4S1SL 4XPBH 3UTPD 5DJ6A 2I5YH 2VUOA 2ZCHL 4LPUA 1T66C 2D3VA 2JJWA 3KPRB 2DQFB 3MNWA 4ZUUA 4U7KA 1EAJA 3QXWA 4RMVA 4UNTA 1HH6A 5E1AB 5F8QC 4YEEA 3S4SA 3TC9A 4ZFZB 5F88A 2R29L 5D5MB 3CFEB 4L8DB 1ONQB 4JZNB 1QQDA 3RX7A 1I1RA 4LSVH 2X4OA 1MHCB 3X14B 4WI5A 4NQSB 2NX5B 4Z77B 1OOAA 3F62A 1HKLL 2ZCKL 3F5WB 4QRTA 2GSGB 3HZKA 5GIRB 5IB1A 1PG7L 3QJFA 3QSKB 2XTJD 1CE1L 3QDHA 4WI4A 3X3FL 4OD1L 3LQZA 4ONGL 1A2YB 3E3QC 4NQEA 3IJHB 2D7TL 1J05A 4HJ0D 4QOKB 4URTB 5DFTA 1F8TH 3V52H 1GC1H 1A6ZB 1P9MC 4ZUTB 2VZ1A 3IFPA 1ZHBB 5E4IA 1BMGA 4R7NA 5I17A 2AW2A 4XCFL 1RUQL 1BZ7A 1OTUC 4MXWL 3RY4A 2Q8BL 3KWWB 1T04B 3MA7A 3PWVA 2XPGB 2KZ1B 5F97E 1I8IB 1ORSA 1A7OH 1GZQA 1OAQL 3KXFA 4U1LA 1JK8B 4LBEA 4YHIB 3JV4B 4HJJL 1Q9WA 4TVPD 2R2HB 4Y0GA 5ACZA 2R1XB 4PJFB 5BRZE 1A6UL 1G1YA 3TT3H 2DWEA 4ORGB 2AJXH 1WZ1H 3FQWA 4QT5B 5GS0L 4WTZA 5I8CA 1OWWA 3BQUA 5E2JA 1YY8B 4EN3D 1C5DA 1ADQH 4HWBA 2OQJA 4KHXL 2PO6D 4G42B 4BUGA 4HMDA 3MFGB 3T1FA 4U49A 3OF6D 2Y06H 3TCLB 1QZ1A 4ODSH 3VXRE 3FOLB 3S9DB 1R3KB 5JIHA 2DM7A 3CFJA 4F7TA 1JPFA 4WFEE 3IS0X 3BP4A 1RAMA 1T1WB 4K94C 1KJ2L 1F3DH 1TZIA 1UCBH 2A73B 3U7AA 3SKMB 3B8SA 3IXTA 4HS6B 3RWDB 3ZKQD 2YRLA 3GRWL 1T22A 1RVFH 2XQYK 5D7IF 1P69B 3FQTB 5C08E 4BK5A 2EDQA 3NCJH 3DV4A 5IT2H 1YQ2A 4HIEA 4R4NC 2P46B 1XGYL 2QHLA 4CNIB 3GSXB 1CK0H 5FDWA 4PBXA 4U2ZA 4LSRH 3U4EA 3I6LD 4NKIL 1FNLA 5FB8B 1M7IA 2W0FA 3MLZL 1FFOA 1GRWA 4JFPB 1EUUA 5TPWH 2EH8L 1T89A 2C3HA 4U1SB 4JFFB 4JPVL 1RQ5A 3BW9A 5EUOA 3WUZA 4K3DH 3DRQA 1ETZA 4M5ZL 1NJ9B 3BX7C 2E5EA 4LSSL 3O3DA 5DD0H 2EXYC 4PRAA 5T3ZH 1B6UA 2D9QB 1W8OA 2RHEA 2JJSC 4X9FA 3SOBH 2AEQL 4OZIB 4GRLC 3MRFB 4HDIB 4TPRH 1CBVH 2X89A 3WEXA 1YUHB 3SEPA 3LEXB 3BGMB 3T2QA 5DD5H 4X0KA 1T5XA 4JHBA 1G9NH 4W70A 2I9TB 5D1XB 1KB5A 3O3EB 3L3OA 4LHQB 1XF4B 5C8JA 3HI6L 3VXMA 5AD0B 3D2UD 1VFAB 3RY5A 1SMAA 3VFRA 4ETQB 5KVDL 4M03A 4DVRH 1UJTA 3O2VH 1EEZB 2JB5H 4LCIH 3BFOA 1FL6B 1U3JA 4TVPL 4WFFD 4HZLA 1UXSA 1MJJA 4FNLL 5JLZA 3ISWA 3TT1H 3UDWA 1HINL 5TDNB 2ZZUT 5KAQF 4Z7WF 1CR9L 3QRGH 5DT1L 5L88L 3LV3A 1W8NA 2EDTA 1I1AC 3NA9H 5C0IA 4P57B 3L5XH 1BWMA 2ZJSL 3VI3E 3D0LA 1LK2B 4L8BB 3FN9A 5FO7A 1NMBL 4YBHA 1AGBA 4UT9H 1BQSA 1FVEA 1NFDF 5CINL 5DMIL 2O5XL 4YHYC 1EHLL 1BD2E 1IBGL 1SY6A 4AM0B 1JPSL 3LQAH 2AEPL 3GKWL 5I76B 2I60L 3PWPA 2LU4A 5EN2A 1AH1A 4JDVB 5HPOA 3MJ9L 3D9AL 3ZYIA 4PJGF 1VKXA 3ARFC 3V8CA 4XCYB 4NRZB 5F9WC 2HJLA 5GS2D 4KZEL 1WFUA 5DJYA 1NFDE 4RGNC 1MCCA 2YHGA 1XF2A 1RJYA 4JO2H 1S9WB 5DHVB 5EZIL 3CCHB 4GLRH 4MJ5B 3FQXA 3O3BB 3RZCC 4EDXB 2AJ3B 1TQCB 1TETL 2GITB 5HYEA 1UKSA 2EEBA 4NWUL 2IAMB 2IBGA 2VXUH 3H7BB 1I1YA 5A16A 4X9GA 2DDQL 4GAGH 1S8DA 1MHPL 5IVNA 2NLJA 3PQYB 4XNZC 4OZFA 2PCPB 5TF1H 4MD0B 2BNQD 3BH8B 2VLRE 3W9EB 1JGDB 1G7LB 1N59B 1TJIL 3BZFB 1CFTB 3PWNA 4ZDHB 3LS5H 4EOWL 3WFBH 2A77L 2DTML 2QHRH 2VE6A 2HFFB 1F13A 5F7KC 2BOBA 2KQMA 3JTSA 5FUCE 1GHFL 2FX8H 4HCRL 4X99A 5ITFB 3GIZH 3RA7H 4PJAB 2D7NA 32C2A 4OCMC 1S7XB 2BMKA 3MXVL 4HKXB 4AENA 3LB6D 1QLEH 2A6IA 4XHJC 4AJ0A 1E27B 1AXSB 1F4YL 2X7LB 4LIQE 5F9DC 4PJ9D 4JO1L 3DGGB 1YMMD 4P9HH 4GW1B 2H1PH 3QDJD 2O26U 3OKLA 4TNVF 4WWKB 4X4MA 4UDUA 4GFTB 2Z31A 5F44A 3DROA 3W0WA 2VLJD 4L3ED 5FO8A 1VFMA 4K7PL 3IKCA 4MAUH 2XRAH 4QHMB 4QKXB 2A1WH 4UV4L 5EU4B 5AYUL 4F58L 1RZJC 3BJLA 1WWBX 3L7EA 5I1LA 4M7LH 3SDYL 4CN1A 3I6KA 5GRVL 1AKJD 3MRLA 1DLFL 2Y7QB 4RZCA 4MNQE 1OD7A 2V9TA 4E41E 5FYKE 1E4WH 4JANB 2SEBA 3P4MB 1WIPA 4Y4FA 3KVQA 5IBLC 5IW1A 2D7OA 4NUGL 2YPVH 3IGAA 3QUYD 1D9KB 1MHEA 4NO0D 1IRAY 4PJIE 2GK2A 1KXQE 1DVFD 4HPYL 1LO3L 4HBCH 4BFIA 5JR1L 3STZB 1FO0H 1NCBL 4XC3H 2KH2B 4NQXA 1IKNC 3QCTH 4PRNB 3U7YL 2H9GB 4GMSL 5IMOB 4R7DA 2GK0A 4ZFFB 5T1LD 1BGXH 3MRNB 3G04B 3LN5A 1RUKH 4EI6B 1AQKH 2CDGA 2BHZA 5DJXA 5ESVA 5GZNC 4JFEB 5HHOD 1OGAE 2F9BT 1E6OH 4XVUC 1FNGB 3ZSTA 3TO4B 3O6ML 4AIZB 1YPZB 5EU5B 3KYAA 3BXNB 4GW5B 3T3MF 5KVEH 4NHUA 2A9ML 5ILTL 2GUOA 1GL4B 1B2WL 3KPRD 3ULUD 1MH5A 4XPTL 4YR6B 4IRJC 4J3XA 3D3VE 2EYTB 1G9MH 1JRHH 3FKUS 1FZMB 3DXAB 5SWSE 4HXAL 3MA9L 1T20B 4KHTH 4YWGL 3GSVB 5DI8B 4R8WL 4AT6B 5KVGL 5KVMC 2X05A 3T3ME 2NX5D 1XGTB 3WDHA 4U3XA 4Q2ZA 3MLVH 5B3NA 3BKYL 1MCOL 2F8XC 1A6WL 1NFIB 3MRIB 1R5IA 5CILL 2QSCL 3SPVA 4MS8D 3AU1A 3D18A 4G5ZL 3MLRL 1FZKA 4JY5H 1I7UB 1TVBB 4G43A 1AGEA 4FZ8L 1YNTB 4CVZA 5IJVA 5FO9A 3PGCB 4QOKD 4ODVL 2R1WB 4KKLC 4M7JH 3GK8L 5EIQA 4TSAH 5IB4A 3MRJA 2VSDA 3HMXH 3OSKA 4PLKC 2YUZA 2DICA 5IR1B 5L2JB 4BQ6A 5IBUB 4J12A 1HHHA 1VEPA 2UWEB 4NKDA 4PJCB 2CRZA 3UZVB 3HE7B 2DLFH 1BFOB 3OZ9L 5ISZA 1H3WM 3I9GL 4KDTA 3KNBB 4P5TA 5DJCB 4DKFH 2ADJA 4GAJL 3VE0A 2VDPH 4N9GB 3RTQB 3UC0H 3FAWA 4X7EC 5JIIA 3QWOB 3O2WH 4MD5A 4X6FA 4YNYB 3SCMB 1ND0B 3OGCA 3T0DA 1JWMB 3E6HB 3B9EA 4U6VL 1WBYA 1CDJA 3UO1L 3DMMB 4TYUA 1T7VA 1FH5H 5K9KB 1BLNA 5JQHC 3H9HB 3KPLA 3WD5H 4M61B 1QPXA 1WLHA 2GFBA 2EKSB 3AFLA 3KPSA 5FKAA 3L1OH 3NCCB 3VXUE 5MENE 3VRLE 1G0YR 4X4YB 4Z8FH 1Q0XH 1D5ZB 4XP6L 4OM1H 1MNUL 4NN5C 1X5JA 1JP5A 3SKNB 1B4JH 1Z9LA 4QRRE 2ITCA 3QCVH 1BIIB 1KCLA 1LEGB 2ADGA 4Z7UF 5A40E 5J13B 1N6QH 1VEOA 3UJTH 1FORL 5C09B 3PGFH 1CFVH 1NDGB 5B39B 5FGBC 3HUJB 1A6AA 5MP6H 4Y1AE 1UQSB 1CT8A 2XA3A 2VN4A 2CLRB 2YXFA 4XCCH 4JFQA 4DN4L 1S9KC 1A1MB 1T1XA 1ACZA 2Z92A 5BMFL 4MDJB 3MRMA 2VR9A 3D69B 2X2YA 1WC7A 4RGOL 3GGWB 5BZWB 1N2RA 1CLZH 1RIHH 1JNHB 1SM3L 4PGBB 3BPLC 3G5VA 4KK5C 4KKAD 2Q3ZA 4WW1A 2XWBB 3NACL 4PRPA 4HW6A 4DKEH 3BDYH 3VGDA 3LQAC 1DBJH 2P24A 5JW5B 3PL6C 4Y8AA 3OKNA 3ARDA 3MRHB 1A5FL 4PV9B 1SJEB 3D0VB 4M7KH 4JKKA 4WFHD 1V7ML 5E8DH 3OJMB 1HN1A 3QZWA 2EDFA 4HC1A 5HYJB 3TPKA 4NPYB 1S5IH 1F2QA 4PRIB 1SVCP 4WUKL 4JFFD 1LEIA 3WKML 5TQ0L 4GQ9H 3I75A 2DBLL 4KTEL 2NQCA 1Y6KR 1W72A 4L29A 3QQNA 5DQDH 1HXMA 3S5LA 4PJ7B 5BRZA 2P8PA 4EBQH 4LSUH 4UTAL 1QFWL 4PJ8B 4HFUH 5C3LD 2BSED 3MV7E 4Q6IC 2FX9H 5E8NB 5GSRA 4YQXL 5ADOL 2VAJA 3A6OA 1U6AH 7FABH 4RMWA 4DKDC 15C8H 4OGAD 3C60C 4F33A 3DPBA 1EUTA 4DTGH 4ALAH 1QYGL 3OKOB 1MCLA 5D1XD 2R1YA 2HT3C 3IAQA 3OQ3B 5HHXH 3WIHA 5AAWA 1EGJL 3HHRB 3GI8H 2VERN 4Z95L 1T1YB 2GJJA 4Z78B 1M71B 1DUZA 1X7QB 4U3CA 1KTDA 4P9HC 3VXRA 1JZ8A 4F7MB 1I9JL 1INQB 1CD1B 2ICEA 4MNGB 2DIAA 2EIBA 1WBXB 1Y0LA 4AMKH 2CDEB 1CXFA 4OLEA 4PGZA 1AC0A 4R3SA 1X9QA 5BOPA 5F3BA 4AEIH 3VWJA 4UNUA 3T77B 4OCYH 4WU7A 2BVPB 1X4YA 4FTVE 2DQIH 3FO9B 4XVJH 5C08A 1MLCB 1RZIA 3WIFB 3ZE1F 1CCZA 5C0AE 2W65B 2WWKT 4U6HA 3H3KA 3ET9F 3PHOB 2N7AA 4K3EH 5E7FA 3LEYH 1G7HA 3SDXF 2J12B 1MFEL 3QEQB 3DBXB 3RNQB 3O9WC 3P73A 4V2BA 5E9DB 5INCB 3V0VA 5FGCE 4LLWA 4OKVA 5D7IA 3TVMC 1RZFH 2VDQL 2GYSA 1YMHB 1ZHNB 3VFWB 5F3HB 5F6IC 2EZ0D 3RL1A 3HI5H 4WVRA 5C07E 3NCMA 5J56B 3SDXE 1XEDA 5K93A 2P44B 1NMAH 4WU5B 1RUMH 5DJ8A 2V2TA 1T0NA 1S9XA 4MWFA 1Z3GH 3VXQA 3BKCH 5FYLE 2CDFB 1BX2A 2AK1L 3TLRA 3QULA 3TZVB 3ZKXC 5IOPA 4K55A 2IAMD 5EZLB 4D0CB 2X4UA 1U91B 4P4RA 5I1EL 5B8CC 1LDPH 3PQYD 3E6FB 4QHNA 3FQUB 1UJ3C 2R4RH 1U2HA 4X6CE 3BISA 5HGBB 4IDJH 2ED8A 1RUPH 4F2MA 1AGDB 3RBSA 4HLJA 1G9MC 3MV9B 1N5AB 3SGDI 3EO1B 1UACH 3TBVB 3FAXA 3Q6GH 2Z35A 2HKHH 5IB3A 5B38A 3QFJB 4NFBA 3RWCA 4QF1B 3DX7B 5J89A 4XP4H 2HRPH 1P4LA 2MTPA 3BP7A 3N1MC 5CP7B 4P2RB 4YHOL 4DK3A 1BEYL 5D7KD 5CBEA 4Q9RH 3MOBH 4PJDB 2BERA 1BBJB 2BP3A 3AS3A 1GOHA 3MJ7A 2VXVL 3WMSA 4WWKD 3PWJA 5IF0B 3KGRA 3DVNA 3ZHLA 4JDZA 1BD2A 3UTOA 4WHCA 1ZT1A 2E8YA 4JO4H 4O2FA 1DZBA 1U8HA 1DBAL 3DX9B 3PDDA 4YHLH 4ZO7A 5DTFB 2G2RA 5IBTH 1CYGA 3MNZB 1LDSA 3WS6C 2C1OA 1HWHB 3RP1A 1QEWB 1NFDA 3FT4B 3U0TA 4MA1C 3IU3A 4K7FA 2MKLC 4OV6F 1NEZB 3ARVA 2ZG1A 3QEHB 4OFVA 1AHWC 4K8RL 5GGSA 3NN8A 4O02L 5BO1H 4KRNA 2EDHA 1D9KD 4APQA 4KUZH 5D1ZB 4ERSL 5EOCL 3OAYK 1U42A 3KYMB 1S9VB 1LO0H 1YYML 4YUEL 5CFHA 5DXWA 1I9RL 1LD9B 2AXGB 2V7HA 1S7RB 2E27L 1UXWB 3IDMA 4AH2B 1S9YA 3C2AH 4LEXH 3O3UN 2VLRA 1UGNA 4KJPC 2Z4QA 1LE5B 4JFED 4HKZB 2F5BL 2P5WE 4TNWK 5IVXF 1OGTB 1RSFA 5IFAH 3TO4D 4JGUA 3X13B 3SDCC 4BM7A 5HHQA 5F6HI 2YZ1A 2APFA 2J4WL 1IAKB 4H0HB 2WLYA 1RU9H 4YHKH 2IWGA 2IH3B 3VFSA 4OJFL 1P84J 5LQBL 3VMPA 2VLKE 4JHZA 2AJVH 4DOHB 4O4YH 1B4RA 3DXAD 1LK3H 3QNXB 4S2SB 5IVXE 4D9QE 4G3YL 2AQ1A 3MRQB 2HFGL 4JR9L 4NSKB 5JA8B 3U30B 4MGXA 4KJYA 3HCVA 4YO0A 3U1SL 3SY0A 5KSBB 5CZXD 1OSPL 3RGVB 3N50A 3LZFL 3NAAL 4JY6A 4X6DE 1UB5A 5EFIA 1CG9B 2OJZH 4JB9L 4OCLC 4U1HB 1C16B 2ZUSA 1P6FA 4MNQA 1I7RA 3KHOA 4E41A 5D2NE 4ZPTB 4QRPE 4HD9A 3ZHKA 1GGIH 1U8KB 5AUMA 1QLRA 3W81A 4I3SL 5CJXA 3QFDB 4PJIA 1U8JB 1YEIH 4G9DB 4Y2DC 4DGIL 3VMNA 5E24E 3HE7D 1CWVA 4GKNA 1ZWIB 2NYYC 4OUUA 2AV1B 3IB4A 3NA4A 1VGKA 2A2QT 1XMWA 3RTQD 3SO3C 4DGYH 4TUOB 1B0GA 1RK0B 5H2BA 1DBKH 3GMOB 3H9SE 4MA7L 3SCMD 4HX1A 1OGAA 4YX2L 3F7VA 1XGUB 2J6EH 3DMMD 1OF2A 2BC4A 4XVSL 2DLHA 4OLXL 5D2LB 4WUUB 2D4FA 4M00A 2E3VA 1MCFA 5D8JL 5EPMA 2FJFB 2YBRB 5SV4A 3OX8A 3UP1A 4FQHA 5EO0A 1IEAB 4M6NH 3ULVF 1DQJA 1IARB 1KCSL 3D3VA 3VA6A 4E5XB 2FIRT 4OLVL 5SWSA 4O2EA 3X11B 3ZSSA 5L2KB 4PJBE 1TZGL 3CMOL 2R23B 3RUGE 2HJKA 1IGIH 3P4OB 4RBPK 5CSZA 4E9LA 5E6YA 1YN7A 1I1AB 4C4KO 4A6YB 5CBAA 5C09D 4RX4D 2W0KA 4N90E 4PR5A 4H25A 1BQUA 3OPZL 1D5MA 3QUMH 2FJGA 4LSPH 3AB0B 3EFDL 3ESVF 3V4UH 4OUOA 4K71C 1AY1H 1IGJA 1ORQA 1A14L 3CDYA 4LKCB 1U2CA 5FYJD 4KROC 1OD9A 3BEWA 4NNXA 2CR6A 5KOVC 2FCBA 1N4XL 3H0TB 2O5ZH 3EO0A 4UQ3A 3B9KA 5J6HB 1CD0A 3C09B 1IM3B 5F9WB 5TE4H 5E8OB 1HHKA 5C1MB 1HYRC 4HIJA 3IDXL 4EI5C 3MLXL 4RGNB 5DGQA 5TE6H 3RI5K 3LMJH 3JWOH 1PAMA 5HYJD 3HI1