4OZGA

D2 protein complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozgA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ozgA01
2KBGA 3G5YB 4LNRA 1MFNA 2A83A 4PJAA 3MV01 4PJEF 4NKQB 2XZCL 3W0WE 5D7JB 3A6CL 1U8IB 1JYWA 2VQUA 1INEH 1JF1B 3C5ZC 1XGUA 3CXDL 3DUUB 4TUJA 5E8PB 3QNZB 3FB6A 3GMPA 4XNUL 1G6RB 3STZA 4YEEA 5HY9B 1W0VB 5FKAA 1VEMA 2NPLX 1R3IH 2EDTA 3PHOB 4MXWH 4AY0A 5D93C 4OCNC 4Q9RL 5ETUB 4AG4L 4AYFA 3WXVL 1KT2A 1U41A 3PHQB 1WTLA 1KGCD 1MH5B 4QNPE 2HRPH 3OXRB 4PY7A 4WTWA 4HMEA 5EZLA 4KGJA 2Q7YB 3MZTA 2GI7A 1KCVH 4LQ1A 2A9NH 2P7TB 4X6EB 3MV9E 3O9WD 3MJ9H 2A6IA 1PG7W 3ZL4L 3DBXA 2R1WB 1JPSH 2CDFA 5HYQA 1DQLL 4ENEC 5DQJA 3OJMB 4O9HL 4D9RD 5C6WH 4ODVH 3BKYL 4XHJD 4AM0A 4WI3A 3RY5A 1NCCL 3MLSL 4O58L 4L8SC 4LAQL 4DGVL 5L2KE 1P5UA 1UB5B 4NZTL 3DMMD 1N2RA 4OKDA 5F9OL 1E4XL 1HQ4A 5AYUH 4P2OA 4DKFH 1FORH 2VUOA 2EH8L 4EI5A 2VN7A 3QT2A 3IDYC 4ODTL 1SJVA 1MFCL 2VDML 5F1NB 5GS0L 5TE4H 2XNAB 3PV6B 5D7IE 1SY6A 1WF5A 1RZGB 3HUJB 1CXEA 4DCQA 3BPLC 3WIHH 3T1WA 2XYCA 1N6UA 4LHUA 3GJFK 4LIQL 1XCQB 3V7MA 1P7HL 4JDTH 2JB5H 4DAGL 5I1CL 2F19H 4H0GA 4UILL 2ED9A 4W6YB 4N0CC 1SJEB 3EJZD 5CMAB 3QNYA 5ALCL 4KDWA 1AGFA 4EN3C 1HSBA 3L1OL 4XX1E 3QXDA 3V4UL 4L3CA 1P4BH 1RZJH 2HT4D 4JFPA 4MS8C 1QG3A 4F7PA 3LKQA 4P46D 5I19L 3RIFF 5AAWA 3QDGA 1K3ZA 3W0WB 4PV9B 1RUPH 2OR7A 4KROD 2BFVH 4L9DA 4Y1AA 1KJVA 3RX7A 3P4NA 4P0DA 3MJ7B 5D1XC 3QH3A 5K9QG 4M3KB 1R5IB 3HFMH 1VGEH 1GJIA 5E94B 1INEL 2VL5A 3V6OC 4AQ1B 5JPMA 1OTUD 2CMRH 5LAXB 5DMJB 4JFFB 2Z92A 4JE4B 3M17A 5C0NC 1OY3B 4I2XA 4I9WE 1I3VA 3GGWB 1PYWA 1FNFA 1R3IL 4NSKB 4MXWL 1A7QH 5HHOE 1QPXA 4MCYA 5C1MB 4QHUB 3MV9B 1MVFA 4YX2H 4EDXB 5T1LB 2HJKB 1EH9A 2ZOKB 3DETD 4U0QB 2HRPL 4PLKC 5KVFL 1JZ8A 3VWJC 1KCVL 2A9NL 4AJ0A 3MJ9L 1KLGA 2EDBA 4JRXD 1JPSL 4OLUH 5L2KB 3FQTB 4HKXA 3NCFB 3GIVA 4YFDB 4Y8AA 3TGXA 4NHCH 4PJDE 5L8KB 4Z7VF 3DVGA 2B5IB 4ODVL 1EEYB 4L8BB 3DPBA 1EFXA 1TITA 1PLGH 3L5JA 2JKXA 3AFLA 1UKQA 3UCRA 4ONGH 4ZO8A 2G75B 4P2QD 1HI6A 3UTSA 2LFGA 4DKFL 5AYUL 1WIPA 1FORL 1OARH 2IF7A 2D9QB 4U0RB 3H9SE 1C7TA 1KC5H 4ONHB 5TE4L 1N6QH 4MNQE 1QSFA 5E4EB 3FT2A 4GRLA 3SDDC 2WWKO 1S7TB 4GKZB 5I73B 4B50A 3WIHL 4N0YH 2XWBB 3HE7A 5K33A 1WT5C 5GGTA 1BQHB 4G43A 5ITFA 5B8CC 4JDTL 2JB5L 4X7TB 2XA8H 2F19L 3A6BH 3ULVF 1RZ7H 3NIFE 5MEND 1MLCA 2VLLA 3G5XB 4PR5B 2XFXB 2C9AA 1I8IB 3NCCB 3B9KC 4OZIA 4UZGA 1MJJB 4L4VD 3HPJB 3X13B 1A6VH 1AR2A 3DGGA 5BZDA 5FOBB 1P4BL 4MNGE 1RZJL 2YZ1A 3OMZA 4XAKE 4N0FA 4X99A 3SGJC 3L3IA 2OL3H 4QGTA 5D96C 1G7PB 1RUPL 3FJTA 2BFVL 2EDQA 5JW5A 3P0YH 4JJ5A 4WFHE 5HDBF 1INQA 3WD5H 4M9OA 2XZZA 1JNNH 5EIIA 2D7QA 3ARGC 3QEUA 5JHDA 4PG2C 2JE8A 2NX5A 3QISA 3ZKMC 3HFML 1PZUB 1OTTD 3OR6A 3QUMA 5IVZB 3U1SH 1VGEL 1IGFH 5HHQA 3TYFA 1TQCB 3TJHC 1JHLH 1O7SA 3PXHA 5HHOB 1QFOA 3QQ3B 5FV1L 5EZJB 2CMRL 2BNQA 2VWEE 3KJ4C 3K46A 3UYRH 5T5NF 3TN0A 4FQHA 3PL6C 3U0WH 4XZUB 1PY4A 1Z9SA 3CSYA 1A7QL 1HNFA 4FFZL 5I9QB 3HG1A 1QD0A 4ODUA 4UT7H 4YX2L 2OMBA 3UBXA 3KPRD 5L88L 3SOBH 4QYOA 1U8PB 3VXRE 4JZNA 4C57C 1KB9K 1KB5A 4GAYA 4PJDB 1JVKA 4L1DA 3GB7A 4XXCC 4OLUL 3OKEA 3KPMA 2NMSA 2YRPA 4NHCL 3Q1SH 3H9SB 1PLGL 3NPSB 4F33A 4G80B 5C0JA 4QGYA 4ONGL 1BREA 4MNQB 3U0TA 1V05A 5F1IA 4I1NB 5EO0A 4R2GB 2EDDA 1OARL 1UQSB 4HHAA 1KC5L 4R4FH 1RZIB 2AP2A 1JGEB 1N6QL 3ARVA 5JIPA 3WE6A 1P5VA 2NY1C 3UTTA 2W92A 4N0YL 3CFKA 4UTBH 3L3OB 4Y7MA 5KTEH 1CK0H 4RGMB 4CJ0A 4MQSB 4DVBA 3LKRA 2XA8L 3A6BL 5D1ZD 2NY7H 3OJDB 4U2ZA 4P9HC 2IWGA 3FL7A 4NRXB 2ZSVA 1A6VL 4TVSa 1YPZE 3D18A 1WZKA 3EDDA 2X40A 1CN4A 2Y1VA 4JY6A 1W72L 2FRGP 2OL3L 3UAJD 4TTDD 1MOEA 4P23B 1ORQA 1L6ZA 3P0YL 3WD5L 1JNNL 2VN4A 4KKLC 1GOHA 5E7FA 3BO8B 4WEUD 5D7JD 1UJ3A 1PQZA 5D5MF 3IDUA 4RFEA 1KLUB 1IGFL 1UG9A 5C0IA 4KI5F 1JHLL 2GUOA 1JUFA 2WWMC 3WNLA 1FN4A 3TWCH 4J6RH 4POYA 5B22A 3UYRL 3WDJA 1CDHA 2P8LB 3HE6B 1G7IB 4JG1H 2BSRA 3VXOA 25C8H 1CL7H 2IADB 3VXRB 4ZTOH 4Q9CA 5GRZA 1NJ9A 5JOPE 4UT7L 3TT3H 5IVNA 1XCTB 1TZHB 3T1FB 2CSPA 2X7LA 4WGVB 4LLWA 3IGAA 3SOBL 1JMZA 5F97E 3NAAH 3T0BA 5CBEA 2IPUK 3WS3A 4HPOH 4MJIA 1S3KH 3D0LA 3KPNA 2FL5A 2CKNA 2NY0C 2OQJB 2WW8A 4PBVC 1EEUA 4I18C 3RWIA 2V6HA 4F3FA 1G6RH 4Y2DC 3Q1SL 4WWKC 4NFCA 1DQJB 4WTXA 5CAYB 2ITCA 1NSNH 4D0CA 4KKBD 2NW3A 3NH7H 1PGRB 2KKQA 3MBXL 1DVFB 5J0BA 2AJVH 3TIEA 4GRWF 4R4FL 4LMQE 3VXME 2G9HB 4M1CC 3AUVA 4PJFF 3QEGH 3QZWB 3DX9A 2X4OB 3BEVB 5I17B 2OTUA 1RJLA 4HX1B 5E8NB 4KZEH 5IJKA 4UTBL 4NOBA 5KTEL 5HVHC 2DQDL 1CK0L 5IEHB 2BY3A 3QPQC 4K3EH 2QKIA 3CSGA 1YPZB 2NY7L 2LAGB 4RISH 1BGXH 3D69A 2OMNA 5D9SB 1S7SB 3ISWA 4E9LA 2OCFD 4LDEB 4HFWB 3VXQA 5FYJL 1Y0LA 2DKSA 5I1KH 3GHEH 2FJGB 4HS8H 1AY1H 4JQIH 3GM8A 1LEKA 1UCTA 3MTRA 4ZAKD 4QTHA 3W0WD 3DV4A 3TFKD 3ORJA 4XC1H 4MNHA 1MHHA 1ZLWK 3RUGE 4YBLC 1S7RB 3U6RA 3FB8A 4PJ9D 5HGDB 1K8DB 1K2DB 3GSXB 1OWRM 3TWCL 5F7UA 4NJ9H 3HNSH 1F2XK 3H2WA 4X7FC 3C09B 4JG1L 2EDXA 3VFOA 25C8L 4WV1C 1CL7L 4JY4A 1FNEB 2DBLH 4ZTOL 4R7DA 1HWHB 2A0LD 3DNKA 3MV9D 5ICYB 3TT3L 5CGMA 5IB5B 1KPRA 1FVEB 3QUYC 3B8SA 4M61A 4C56A 2APBA 3VGDA 1NFDE 1X5FA 2GEEA 2CLVA 5ISZA 3NAAL 1PW3A 4UU9A 4HPOL 4Y0GA 1TCRB 1S3KL 4JVWA 5K59E 3BYYA 5L2KD 4ZQKA 4KRPC 5CSBA 2FB4H 3MRCB 5J13C 4Y4HD 3I6GA 4OT1H 2WBJC 1G6RL 1CT8A 1T5WA 4WW2A 3F7VA 3GMOB 1KNOA 5F6IC 1NSNL 4WHCA 4UV7H 2Z31B 1MUJB 3VXMB 3NH7L 2AXJA 2ZUTA 3HHRB 3OB8A 1MCPH 3RNKA 5FHAH 2AJVL 2MKLC 3DX7B 4ZMAT 4Z77B 4YZFE 5D2LA 4X6FA 2W65A 3QEGL 1LDSA 1ROWA 3JVGA 3UPAA 2P45B 5F9WC 4KUCD 3SQBA 4KZEL 4HZLB 1Z5LB 1RZKH 4PJEA 2A1WH 4XNYH 4K3EL 1ITCA 2F5BH 5CJQH 1S9WA 1VHPA 3L3HA 4I48B 3P30H 1EV2E 2DLIA 2J6EA 3WNOA 4MVBD 4RISL 1BGXL 4EI5C 4C55A 5I1KL 3GHEL 3GSVB 4HS8L 1AY1L 4JQIL 3RUGB 1WZLA 3EYVA 5F7DA 3ARFC 2O61A 4XC1L 1REIA 3OR7A 3LV3B 4YPJA 4UMGA 1CZ8H 5I66A 3AB0C 3HLAA 1XR9A 2H26A 1XF2A 1TPXC 4I9WD 4KU1A 4LLQA 4Y4KC 3QO0B 3DARA 2I07A 4JZJA 3UPCA 2PR4H 5HHNA 5HHOD 3SDAD 1NCUA 1CLZH 3RTQA 1NFIB 3RJDA 4R6UA 5T1KA 3HNSL 3ILPB 4G8IA 5BMFH 5DXWA 4X98A 4UNVA 1JYVA 2DBLL 1NFDB 3GMNA 1EAPA 1X5XA 1VEOA 1T66C 5DJAA 5J9PA 4JGUA 4YXKH 4ZYKA 5FDWB 5EBWB 1KB9J 1I75A 3WS6C 1U8QB 2DQJH 3L3JA 1UZ6F 3IETA 4N0RA 4U1NB 4QRRD 2FB4L 3QXUA 4WI2A 1CTNA 3ARYA 4OT1L 4PGBB 5GGUA 3C9NB 5IG7A 3H9SD 4ZXBB 2V2TA 3S4SB 1DANT 1CDJA 4JM2A 4UV7L 1VKXA 4R2GD 2HLFC 5DJCA 4Z78B 4J4PC 1MCPL 1D5BB 3BPCB 1X5LA 5FHAL 1OOAA 4IMKC 4RZCB 5KVGH 4NQCD 3AREA 2ENYA 3WNPA 4TVPD 5C70A 5T1MB 4HH8A 4KWUA 1VACA 2C3GA 5IOPA 1FPTL 3G6JE 3QUZD 1GL4B 5ACMA 4H20H 3NCJH 4KK6D 1G6VK 4BFIB 2GSIA 1RUQH 1RZKL 1S9KC 1SVZA 4IRSB 4HEME 2JJSC 3L3GA 2Y07H 5DRZB 2A1WL 3LD8B 4M00A 4XNYL 1AXSB 2F5BL 3UTZB 5CJQL 2ARWA 4N90E 1HEZA 3P30L 2DB8A 1F00I 4XAKD 4XWGH 4LLYA 3W39B 4WO4A 5EU3A 2Z8RA 1QFWH 2X41A 2YSSB 1U95A 3E1F1 2MHAB 1QLRB 5FCUH 4WFHD 3R0MA 4OB5H 2P48B 1ZWIA 3P2TA 5J6GB 1HNGA 5ENWA 3WDIA 4QRTA 3LY6A 4R8WH 3MQIA 5F70A 2HWZH 5DUBA 1CZ8L 3STLA 1MAMH 1MCRA 4XP1H 4PJHF 3QZWG 4K7FA 4YUEH 2Z4QB 3D25A 2PR4L 3MRLA 1CLZL 4XVUD 4U1HB 4F7EB 5C0EA 4LPYA 3N0PB 2HVKB 5C07A 2VH5H 4A6YA 1ZKAA 1J1XH 4EQ2A 5BMFL 3VXRD 3OSKA 2YC1B 5HSFA 3KYOB 4NWTH 4NGHH 3IU3B 4OFVA 2DM2A 4YHLH 4YXKL 1PZ5B 5M94B 3MRNA 2JLLA 3TBVA 1A6TA 2DQJL 2AK4A 1NGWA 1G7QB 4M7LH 1XIWA 3ZE0F 1TJGH 1N59A 4KQ4H 5E9DD 1T7VA 4HUNB 4M5ZH 5I1IH 2P24A 1FFRA 3BIAX 5GS1A 2R8SH 1M7IA 2EXYC 5TH2B 4X5WB 4Z7UF 4WUUE 1XF4A 2HKFH 2SEBA 5GJSH 3QUXD 3PWPD 3V7AE 4FFVC 1B9ZA 5HYSA 5KVGL 2EIBA 2EIEA 3P4MA 4B5EA 1ERNA 3SDYH 3DTXA 2F9BT 4H20L 2ZUSA 2KPNA 3NCJL 3TO2B 1FZJB 1RUQL 2AJZB 3PQYA 4MLIA 5IK3A 3LKNA 2Y07L 4P2RD 3MR9A 2BVPB 1EHAA 1MCCA 2H8PB 3BP6B 4P5TD 3DSNA 1GGYA 4XWGL 1VA9A 5D7LD 4YAQA 1GGIH 5JXEC 3P40A 1JWUA 1QFWL 2QHRH 3VFVA 5D2NA 1CYGA 3OJVC 1A1NA 5ACLA 2F74A 3G5ZB 4OZFB 3V2AR 1KCSH 3QIBA 4KVNH 2EH7L 4R8WL 3LEXB 2HWZL 2ZWLT 2RFXA 5IM7B 5AEAA 1MAML 4XP1L 3BN3B 4YK4B 5BRZA 3MMEA 1KJMA 3TPUB 4YUEL 1WIUA 2QHLA 3IU4H 3BH9A 3IJYB 2R69H 3RGVC 3VU2A 1NBZA 5JOPD 1KIPA 2G5BA 4XVJH 2VH5L 2UY6A 1U8OB 1J1XL 2ILLA 3LB6D 4MQ7B 1EZVY 4QXTB 2VIRB 1MI5E 1SEBB 1A6PA 1IM3A 4OFIA 4NWTL 5IFAH 1C5CL 3O45A 4M7LT 4PJ8A 1LK2A 4YHLL 1UYWH 1MJUH 2PTTB 3T04D 2WINB 3DRQA 4P48A 1UJ3C 1ADQH 2P43B 2Z35A 2ZUQC 3H7BB 5CBAA 1QSEE 4M7LL 3VCLA 3J8F7 3GI9H 2CLRA 3TZVB 1TJGL 4KQ4L 4AIXA 3REWA 2FLRT 3NGBB 4WUUB 1FFPA 2R56L 2NY3D 4K7PY 1FVCB 1NGYB 4M5ZL 3WL9A 5I1IL 2VSDA 4GQPH 3P0GB 4Y19B 2R8SL 3N1FC 1URLA 4Q6IC 3LN5B 4HULB 4WU5B 5GJSL 1RHFA 1N4XH 4BQ6A 2HMID 1H5BA 2NLJA 5FGBA 5IF0A 3WIIH 1VFMA 3SCMA 3SDYL 1ZSDB 5DS8A 1LWRA 3SE9H 1EBPA 5GGSY 3BZEB 3HZKB 4TN9A 5HVGB 4NRZB 2YK1H 4ZS6D 2J8UB 2RB8A 3QIWC 5D5MA 3RPKA 1IQDA 4PJIB 1EHLH 2VAAA 4LASH 1IEAB 1T0NB 1YEIH 4KJPD 1GGIL 1YNTA 2H1PH 1D5XA 1FHGA 3C5SB 3HRPA 4GXUN 1WWCA 2QHRL 3C2SA 4HJGB 4KV5E 1E28B 2QLVB 3S4SG 2H6PB 4N8VB 2HN7A 1KCSL 3DX6A 4KVNL 3U9UA 5FO8A 3JTSA 1FNLA 4NNXA 4HGMA 2QR0A 2H41A 4GMSH 1AKJD 1HILB 2LABA 3J7HA 1U6AH 3OKKB 5DJ6A 1QBLH 4N68A 4FQJH 3TBTA 5FECA 3IU4L 4PJGB 2R69L 2X4SA 4ZUSA 3K2MC 5GSVA 1NUGA 1XFPA 1NEZA 2Z8VC 3QQ4A 4HDIA 4XXDA 4EUPB 4RDQF 4XVJL 5E00B 2JK5B 3N1PC 4DZ8B 1CS6A 1I9IH 3BEWB 3PWVB 8FABA 3CXHK 1DUZA 3SDDB 2IAMB 5IFAL 3MREB 5BZWA 1UYWL 1MJUL 4M48H 3O6MH 3FFCE 1ADQL 4CNIA 4GOSA 2DQHH 4PJFA 1HSAA 1NMAH 1A8JH 3GI9L 1IKNA 4HCRL 1LO3H 3RL1A 4XRCB 4DZBA 4DN3H 3WJJA 1F42A 3MLPA 3I84A 4XGZA 4NKOB 2AXGB 1IC5H 4EOWL 4PV8B 5DURB 4MJ6B 3V95A 2B39A 2FECI 3GBLA 5GZOD 2VOTA 2XKSA 5JIHA 4IMLB 1N4XL 1UXWB 5K9JH 2CK0H 1R3JA 4Z7OF 1W0WA 5ERWA 2NY5C 3GBMH 2N7AA 3OKDB 4X4XB 3QG6B 1A4JB 5CIPH 3WIIL 3PGDB 2YR3A 3MUHL 1FIGH 1B6DA 4GW5B 3MJ8A 1P7KB 3SE9L 4ZFZA 5LGHH 3U82B 7FABH 4N9GB 5LGJA 3ZE2F 5MHSE 4NN7B 1YY8A 2YK1L 1O5DT 2OI9C 4JDZB 4E5XA 1IGTB 2C4XA 1M05A 2DTMH 1EHLL 3BRGC 2UYLB 1W2KT 2H45A 4LASL 1YEIL 2W0KA 2H1PL 1D9KD 3E0GA 3SKMA 2GITA 1U3HC 4G42A 4NBZB 4M93B 3SJVA 2AXHA 4UDUB 1XGRB 1F3DJ 3OXSA 1NGZB 2BVTA 5HD8C 3VDBA 3MNZB 3GKZA 4F2MA 3VFNB 5H35B 5DDHA 4LOUD 2X5PA 4GMSL 1CDUA 1YEKH 1U6AL 2EE2A 4L4JA 4RWHA 2EDEA 3PUCA 1QBLL 1I9RH 1MCJA 1LD9A 4UBDD 2DLHA 1CL7I 4FQJL 3D85A 1I1YA 4ZFFA 2FIRT 1TLKA 3T2NH 4OZHE 1XGYH 2J4WL 5DI8B 3FT3B 4G9FE 5FKPB 1VGKB 5EO1A 4WU7A 5J8OA 5GGVH 1I9IL 2HTKD 1R3KB 2AJ3B 4D94A 3FMGL 4OZGB 4RMTA 1FYTA 4QRPA 1JIBA 4HV8B 4UDTB 3IDNA 3QQNA 4M48L 3SDXB 1T20B 3O6ML 1BOYA 4OZFG 3AVEA 4OFDA 3ARDB 4HFUH 1FZMB 2XWTA 2C3VB 3T0AA 4PRHD 1DDHB 5DSCA 1NMAL 4PRAB 2IH3B 4NC2B 1Q9LA 2XY2A 1LO3L 2PYFA 4DN3L 4PTTA 3B3IA 3ZT5A 4FMFA 1IC5L 4OTXH 3N1QC 4RRPA 3OKYA 4ZOAA 4FFYH 4IRJB 4IRZH 3W5MA 2PTVA 3CFDA 3UZEA 5F3HA 3T65B 1J9CT 2E7LA 1N0XH 3OAZH 2CK0L 3UX9B 3CFCL 5K9JL 4IM8A 1X9QA 3MV7E 4XPBH 1BQLH 3GBML 3NFSH 4P99A 4YDJA 4Q6YA 2VZUA 5IEKA 5DVOA 4MZ2A 1FIGL 1XGTA 4R96A 4N90D 4OF0A 3C5ZD 5M95B 5HGBA 4G8GA 5LGHL 4JLRA 5KSUA 4RBPH 7FABL 1RD6A 2DI7A 4GMTH 3RNQB 1BBJB 1F6FB 2DTML 3IJSB 5EFIA 5EUOF 3AS0A 1QKZH 3BGMB 5I6XC 4ZUTB 2BNRE 2Q8BH 2X4QA 1FGVH 1FAKT 3FO9A 4ODBD 4QHNA 3OF6A 2R0WH 4NUJB 1NUDA 3IDMA 5D7IF 4P4KA 4CKVX 3BKMH 4Z76B 4HUWB 4X7DC 1KG0B 4NRYA 2HTLC 4NC1C 3HCVA 1FV1A 4X6BB 5CJBA 4PJAE 2F8XC 4ENED 1YEKL 2I24N 4KUCF 4OZHB 1I9RL 1TIUA 4LHJB 4G9FB 2PCPA 5F9JB 1CXIA 2ICWA 5KVDH 1EFQA 3OWEA 1FH5L 1JWSA 5KANI 5MEOA 3T2NL 3MJ9A 1XGYL 3LQZB 5SX5H 1Q0XH 2CKBA 3HZVB 5L2JA 4GG6B 5GGVL 4H5SA 3TNNB 1ZGLA 3MYJA 3ETBF 3KPTA 3FONA 2BSED 4X9FA 1JNHB 4N8VG 4NKDB 1YEHL 4HFUL 2O5ZH 3K4DA 2DWDA 1KCUH 4RIRA 3IKCB 3MFFB 4N0CD 3O3EB 4QCIA 5ESQA 4WUUD 1AGDA 3GSWB 5FO9B 3IVKB 1A6WL 4ELKB 1S9YA 2CGRH 4OTXL 3L7EA 3Q3GA 3O9WA 4JN2B 3MV7B 4MS8D 4FFYL 4IRZL 5JHLH 2V7HA 4FTVD 3AU1A 1F4XL 2ZUWA 1N0XL 1KN2H 4XPBL 3BPNC 5D1XD 4NP4H 1BQLL 2AV7A 3NFSL 4L9LC 4PREA 3MUY1 4GH7B 4PGDB 3DMMA 4N0UE 3DV6B 2GT9B 1XIWC 2G5RA 1AO7A 4RGNE 4CVWA 2R2HA 4RQQA 4KMTH 1A9EB 4PJHA 1CCZA 5C0ND 5GS1C 5SX4H 4GMTL 2HJLB 3U0PB 5EUKB 4X5XB 5C7XH 1GHFH 2PW2B 3MRJB 5BS0D 3LDBC 4JRYE 5C08B 5DD6B 5EN2A 4TNVF 1QKZL 3VFTB 4BQCA 2Q8BL 1FGVL 1G7HB 4LCUB 3FCTA 2HRLA 2R0WL 2XZQH 4LNRB 2A83B 4PLKD 4PJAB 2C1PA 3VWJD 3PJSA 5HI5C 3QDGE 5DJXA 4ZUVA 3BKML 4Y1AE 5C0FA 5CEXA 4JY5H 4TUJB 1F4HA 1XGUB 3BIBX 3ME0A 3FB6B 3GMPB 5J13B 3FRPA 5F71A 4P46A 3STZB 5F7EL 5FKAB 2CDGA 4LCYA 3DO7A 1MI5D 3BP4A 5C2UB 1B0RA 3VRJA 1YA5A 4HXAH 5KVDL 2DIAA 1OAZL 3BDYH 1KT2B 1RUKH 4I2XE 1CFNA 4R97C 3V9FA 3QHTC 2YOCA 4PY7B 1Q0XL 5GGRY 3WV0A 4U1JA 5EZLB 3OG4B 1MVUA 3K81A 4Z7UA 4Z7QE 3CPLA 1QSED 3SDDD 1J7VR 3WJLC 2A6IB 4APQA 3DBXB 3P73A 2GHWB 3LKSA 2CDFB 1EUTA 5HYQB 5E24E 5DQJB 3BN9C 1AJ7H 2ATPA 5CWSA 4OQTA 4AM0B 1XGPA 2O5ZL 5D72H 1KCUL 4YHKH 3WBDA 1N2RB 5AG9A 1HQ4B 4P2OB 3AC0A 4EI5B 4LRNH 4EUPH 5DJ0A 5TFSH 2CGRL 3X12A 4J1UA 3DOSA 4HGWA 4JRXA 3OZ9H 4YIQA 4R0LC 5SWSD 1PKQE 4LVOC 1LGVA 4DCQB 5JHLL 4TOYH 4PJ8C 1CI5A 4LHUB 1KN2L 4WCYH 4RGNB 1UWXK 3ARGD 4NP4L 4OZ4B 5MEQA 3I02A 4XNZB 4P2QA 3ZKMD 1L6XA 3VE0A 3TJEH 3TJHD 4TSBH 3QNYB 1AGFB 3CDYA 4MCZA 2YPKA 4KMTL 1HSBB 3QXDB 4L3CB 2GJJA 3EBAA 3PGFH 3PL6D 4CVZA 5C7XL 4JFPB 3BDBA 1GHFL 1U92A 5INDA 4XNMA 4F7PB 3LKQB 3OAYH 3VFWA 3QDGB 5FO7A 1RVFH 2IQAA 4DKAA 2UY7A 5MENA 2Y72A 1KJVB 3P4NB 5FGBC 1B6UA 5KSBF 2XZQL 3QH3B 2ZUXA 3AMLA 4NDMA 1JHTA 5ANME 4U6VL 1RJYA 4XMLH 2CXGA 3X14A 4OD3L 4M9PA 4JY5L 2VL5B 5JPMB 4NO0A 4DFHA 2Z92B 3B5HA 2NX5E 3MA7A 4U6HA 3M17B 4CL7A 3L3DA 4I2XB 5ALBH 1JWMA 1KENH 2ADGA 4U6XA 1PYWB 1RV6X 1EHXA 5DK3A 4MCYB 2A6JA 4UAOB 1J87A 4HXAL 1YMHA 1IAIH 1KXVC 4OIAA 3BDYL 1RUKL 1M71A 5EORH 4W81A 3EO0A 3U46A 1A7BA 3HG1E 3FFCD 1A7RH 2J8HA 1N5AB 3ARWA 1ZK9A 3K74B 1KLGB 2NY1D 1LP9E 5D71H 1P84K 1I7TA 4HKXB 4CJ1A 3GIVB 3WKMH 3DVGB 1AJ7L 3RVXD 3MLZH 4P3WA 1DQDH 1EFXB 3LMJH 4XP9H 5D72L 4YHKL 1XGQA 1HI6B 3UTSB 4K9EC 3VFMA 1YNKH 2VQ1A 3U7YH 4LRNL 5DJ2A 5JDJA 5F1SA 3MC0A 2XPGA 2AEPH 4M1GH 1X5AA 1QSFB 3FT2B 1GC1C 3OZ9L 3SGDH 4GRLB 4TYUA 4WNQA 3KPPA 4TOYL 3BD5A 3HE7B 4WCYL 1U8MA 2MCG1 1ZVHA 4G43B 5ITFB 1CD8A 4Y5VA 3F12A 5MHSD 1AHWC 1MLCB 5E99H 2VLLB 3TJEL 4FNLH 4TSBL 2EDFA 2WWMD 3BP7A 4ESKA 4OZIB 3BP5A 1G7MA 3VGHA 1G0DA 3DGGB 5BZDB 3PGFL 1X5JA 1ZEAH 1J1OH 1A2YA 4N0FB 3L3IB 1QVOA 5J7CC 5EPMA 3VXNA 3IYLW 1CICC 3BSZH 2QADB 1T7ZA 5JW5B 5IVXE 5D1ZA 4JJ5B 1B3JA 1CG9A 1INQB 5EIIB 2APWA 3QEUB 4ODSH 5JHDB 4QY8A 1DBAL 1FL5A 2NX5B 3OR6B 3QUMB 2XN9E 2PYEA 5HHQB 3BPOC 5EIVA 3TYFB 2NY0D 1Z6JT 3BE1H 5IMOA 2EEAA 1OSZA 2EECA 2BNQB 1J8KA 1QFPA 4Y2DD 2F53A 1CXFA 4FQHB 3TN0B 4MQXD 3VFRA 5ALBL 3ZDYE 1KENL 2WP3T 2EDNA 3CSYB 1BIIA 4KJYA 3HG1B 1JJUA 2BXZA 2YKLH 1BEYH 1CF8L 2Y23A 4ODUB 1IAIL 4JKLA 5EORL 3UBXB 5L9DH 4OV5A 4QYOB 4JZNB 1A7RL 3W2DH 2K1MA 1KB5B 4M1CD 4GAYB 2P49B 4YDLC 1A3LH 3GB7B 1S78C 1JF6A 5D71L 2HAZA 3DURA 3OKEB 3KPMB 4PFEA 3WKML 4JRWA 5GGSA 2YUXA 4OSUH 3QPQD 3MLZL 4MJIE 4XAWH 5SV3A 4KDTA 4XP9L 4ZOCA 5KSAA 4F33B 5GGVY 4YXLH 5C0JB 3U0TB 5F1IB 1LILA 1KOAA 1MY7A 5EO0B 2D9CA 1YNKL 3U7YL 4HHAB 3BYTA 1F2QA 5DMIH 3RY6C 3T77A 4PRDA 3UDWA 5A2KH 5EBMA 3MV7D 2AEPL 4M1GL 3IB4A 1AR1C 3TA3C 3GBNH 3E6HA 5IMLA 1K85A 4N5EC 1EVUA 5I1EH 1EJ6A 3V52H 2UVFA 3HPLA 3UTTB 1QSVA 4OBSA 3CFKB 1EXUA 4XNQA 1AD9A 1FDLH 5JA8B 3DSFH 2X89D 3MFGB 4LSSH 3CGTA 3VMPA 4EJ1C 4DVBB 3LKRB 5CZVH 3T0EC 5E99L 4BZ2L 2ZNWA 3H3PH 4X4ZA 4FNLL 5JQHC 2YWZA 5BW7C 1QLEH 4LMQI 3VXUA 2ERJC 3B83A 2MCPH 2ZSVB 2BNRD 1IM9A 3D18B 4OLZH 4DW2H 1J1OL 5GJTH 4CDGC 2EDKA 5E8DH 2FHBA 4JY6B 5HYFA 2X70A 1RU9H 1PEWA 3PGCA 3BSZL 3EDKA 1ORQB 43C9A 5EC2A 3QUYD 4ODSL 4YZFF 1UJ3B 1PQZB 2VYRE 2FEEL 1R3LA 1IBGH 4G5ZH 1MIEH 4H25A 4RFEB 5C0IB 4LHUG 2GUOB 1JUFB 4KRPD 5DR5H 4HBQA 3BE1L 4YC2B 1X5HA 1FN4B 4K23H 4LCCA 3CSPA 4ZAKA 2WBJD 3LHPH 4Z8FH 3T0XA 4GAFB 3P9LA 2BSRB 3VXOB 4PIRF 1MY5A 3VD7A 4K3DH 2AJUH 2YKLL 1NJ9B 1BEYL 1JCKA 3T3PE 1TDQA 2X7LB 5L9DL 4NT6A 4OBRA 3S36H 4LLWB 1GH7A 3IGAB 4PJ9A 4MD4A 3JWNC 4P4KC 3W2DL 5CBEB 3WS3B 4MJIB 4M6NH 1A3LL 4M43H 1J0ZA 3D0LB 3KPNB 3V5HA 2FL5B 3Q6FA 4C56E 1Q1JH 4OFYD 4Z7WF 3L6FA 1JK8A 3BQUC 1F3JA 3RWIB 3MUJA 5MEPA 4F3FB 1CXHA 1HHIA 4OSUL 2H32H 3GSUB 3S34L 3WHXA 4XAWL 3KPSE 4Y5YC 1JV5A 5A40E 2ITCB 4D0CB 2Y7QA 4YXLL 2IPTH 2NW3B 1FCGA 4EI5D 1ZT4A 3SE3A 5T3ZE 1V7NH 5DMIL 3TIEB 3RIAK 1MFBH 2Y25A 3UPRA 2ICEA 3GBNL 2CD0A 4FZ8H 4MLSA 3ARFD 1CIDA 3DX9B 4Y4HA 3QRGL 4LGRB 5I1EL 3V52L 4WI7A 5EUOA 2OTUB 1RJLB 4RFNB 1FDLL 5ECJE 4HAGA 1VPOL 3DSFL 5D2LE 3O8XC 4LSSL 5D7IA 2QKIB 5CZVL 1J11A 4Y4KD 3H3PL 2CO7B 3G5VA 3NN8A 4JRYD 5FDYA 3D69B 1QLEL 5J3HD 1A47A 5BVPH 1RIVH 3VXQB 1Y0LB 4OLZL 5HYEA 4DW2L 3OG6B 5GJTL 3VDAA 1LEKB 1QBMH 3FTGA 3PWNA 5E8DL 1T7WA 4QTHB 3C6SA 3DV4B 1RU9L 4LLVA 3NIDF 1T66D 2DQFA 3DVIA 4MNHB 2BVEA 1MHHB 4Y1AD 2EC9T 1S5HA 4KKCC 5DRXA 1PBYA 2A74A 3BT2H 1FAIH 3U6RB 2ITDA 4LRIC 3G6JF 3FB8B 1MIEL 1V8HA 1YYMH 1DE4A 3VGAB 2EDYA 5HXMA 4MHHI 5GS3A 5DR5L 4K23L 1CGYA 3MNWB 5C09D 3LHPL 4Z8FL 5IMKA 1CXKA 3VFOB 1TMCB 4GSDH 4JY4B 2AQ3A 4K3DL 3R8QA 2QSVA 4R7DB 2AJUL 2HLFD 5FM5O 3NBNA 4J4PD 4U49A 3MLYH 5H37H 2R0LH 1M6OA 1KUMA 32C2A 3ZT6A 4OF6A 1WZMA 1KPRB 4FS0A 5C0BE 4TULH 4M61B 4C56B 4JFQA 3SDAA 3D3VE 4YHOH 2YD6A 5ISZB 2BRQA 4BZYA 5LCVH 4UU9B 4M6NL 3QDAA 2YWYA 1P84J 4ZQKB 1X7QA 3BWUC 1Q1JL 5C0GA 5EOCH 1N5YH 3WFDH 2BK8A 4M8QA 3I6GB 3VD3A 3JWDC 3H0TA 4HLJA 4QO1A 1CT8B 1T5WB 1IVLA 2E7MA 4WW2B 3F7VB 1KNOB 2VDOH 5IKCA 2IPTL 1CE6A 1RK0A 2D0GA 5F9DC 4N9OB 2YS4A 3RNKB 3C08H 1A1OA 4J3TA 1UA6H 1V7NL 5FFLA 1MFBL 3BGFC 4ERSH 2NXYB 5D2LB 4X6FB 4QRRA 2W65B 4FZ8L 2IGFH 1N6VA 1CU4L 4NO3A 3TT1L 3UBXG 1II4E 3QUKA 1DSFH 4PJEB 3GEWB 1U93A 1E4KA 3V4VL 5DWUH 1CXLA 1S9WB 2YA0A 3L3HB 4NC1E 3RKPA 4BZ1L 2BZDA 1ND0A 4NQCA 5BVPL 1RIVL 4J2XA 4OGAC 2CUHA 3QUZA 1B2WH 3GMLA 2FATH 3EYVB 4F7CA 1QBML 4FQXC 2P8PA 4L3EA 5F7DB 2MQCA 2O61B 1J0HA 2QADD 4F7MA 3OR7B 5FF6A 5I66B 4MNGA 5GGTH 2CPCA 3BT2L 3HLAB 4KHXH 1XR9B 1FAIL 2H26B 5CKAA 1XF2B 1HHKA 3HTLX 5DYOA 2B2XH 4LLQB 3ZHKA 1D5IH 1OCWL 1YYML 2I07B 4JZJB 5HHNB 4ONFH 3RTQB 5ID1A 3ZLQC 2GJ6E 5T1KB 5I71B 3HZYA 3ZKNC 3HI1A 4G8IB 2YPLE 3HG1D 4GSDL 4X98B 2EXYD 1CGXA 3GMNB 1EAPB 4Z7VE 1NAKH 5DJAB 5J9PB 3MLYL 2R0LL 2RHEA 3Q6GH 4PJXE 4ZYKB 4C59B 4FFVD 3VFPA 5E8EA 4QKXB 1Q94A 4NUGH 4YHOL 4IJ3C 5FCSH 1ZLVK 3L3JB 3IETB 3QUMH 5LCVL 5GRVL 3TCXA 4JQVA 3QWQB 5KS9E 3RVTC 4M6OH 5J06A 5HHMB 1N5YL 3WFDL 3PNWA 4JO1H 2AK4E 2DQTH 1UGNA 5GGUB 1MF2H 5IG7B 1F4WH 2V2TB 4FQLH 2FH8A 1NAMA 4JM2B 1VKXB 3U7WH 5DJCB 2NXZB 4OGZA 5EBGA 3REVA 5JXED 1IE5A 1BZQK 3C08L 1UA6L 1T83A 1ZV5A 4ERSL 3AREB 4NKIH 1VACB 1QLFA 5IOPB 5E9DA 1ACYH 3GZKA 4PRPE 2IGFL 1IKFH 3MLRH 2Z8WC 2GSIB 1O0VA 4U1LA 1QUNA 4LNVA 1C5BL 5CGTA 5KSBA 1DSFL 3L3GB 2GY5A 1N7MH 2J88H 2QSQA 1ZVYA 5D1QC 5DWUL 3QUXA 5FM4A 5SX4I 3PWPA 2PTUA 1HEZB 3RGVD 2FYYA 2CLZA 4LLYB 4WO4B 2IBZX 5EU3B 1GVIA 2R0KH 2VSCA 4V1DE 3MJ6A 1U95B 3A6OA 1RJZA 3K2UH 1B2WL 5K93A 2FATL 4P3CH 1ZWIB 3KGRA 4JR9H 5ENWB 1KYOK 2XIDA 5GGRA 4QRTB 1J18A 2FJFA 1HKFA 2XN9D 3KNBA 5E6IC 5DUBB 4NCC1 4P2RA 1FC1A 1K4CA 3STLB 5GGTL 4KHXL 1JNJA 4YBQC 4P5TA 3C6LC 5D7LA 4AEFA 5DLMH 2B2XL 4K7FB 1D5IL 4JFEA 3D25B 3MRLB 2F8VA 4ONFL 3U4EA 4M7JH 5C0EB 4GG8A 4RBPK 1BP3B 5BRZE 1XT5A 5C07B 4A6YB 2DQGH 3WO4B 1JGVH 4P5MA 1L0XA 2W9EH 1J12A 1ADQA 2Z93A 4JZOA 1YMME 3Q6GL 5JUEH 4KV5F 3MRNB 4NUGL 1A6TB 3TBVB 2AK4B 4MJID 1NGWB 3QUML 3DHMA 1W8OA 1XIWB 4PJ7B 3UTPE 1CGVA 1N59B 3KJ6H 4I77H 4N1CA 1KPUA 4NHUA 5KZCB 4M6OL 5E0QA 1WJ3A 1B90A 4JO1L 1FGNH 2DQTL 2P24B 1MF2L 5J4MA 3QIWD 5GS1B 1F4WL 3F8UB 4FQLL 2V2WA 1M7IB 3GHBH 2X2YA 1XF4B 2SEBB 3U7WL 4HT1H 1LE9A 2PETA 5F6HJ 1X4ZA 1L0QA 3UJIH 4PUBH 4JFHE 5SX5K 4BQBA 5HYSB 4ZPVA 3GO1H 3LVEA 4NKIL 5D6DC 3P4MB 1QQDA 4QWWC 1QBBA 1ACYL 3DTXB 3CFIC 1IKFL 3MLRL 2YBRA 2UV3A 3PQYB 5IK3B 4RMVA 2NY6C 3LKNB 3DHJA 1N7ML 1TVBA 2J88L 3MR9B 4OV6F 5I75C 3DI3B 4HUMB 4U6TA 4MB3A 1J05A 4YAQB 4NQXA 5F7FA 1JWUB 3UDWC 1P69B 5D5ME 1OP5H 1HHGA 5D2NB 3VFVB 3K2UL 1A1NB 1DR9A 2JJTA 4P3CL 4KI5E 2F74B 2C5DC 3QIBB 4JR9L 2YN5A 2XG4A 3BWAA 3H3BC 5JLZA 1CQYA 2RFXB 3FQRA 5DJ8A 4RNRA 5BRZB 3MMEB 5DLML 1KJMB 4M62H 2GIYA 3RWEA 4NN6B 5T5FL 1YNLH 2D7PA 3MPCA 1UB6A 3S3PA 1MCWW 4M7JL 3BH9B 1YEGH 2Y5EA 1NBZB 4H1LH 4LSRH 1KIPB 2G5BB 1IAII 4U7KA 2DQGL 3MGTA 3VRLE 5C0DA 2JB6A 1JGVL 4PB9H 1QA9A 2W9EL 1IM3B 1AKJA 4UT9H 3O3DA 3O45B 4PJ8B 1LK2B 3ILQC 5JUEL 4C56D 3DRQB 4D0DA 2A9ML 2Z35B 3P4OA 5J11B 5CBAB 3H8NA 4JVUA 3KPSD 3VCLB 1JL8A 2CLRB 3KJ6L 4I77L 4C4KT 4GRWE 3REWB 5FUCE 1FFPB 1IMHC 1FGNL 4PJFE 3WL9B 5T3ZD 3IAGC 4RMUA 4LSVH 5DVMA 2CRMA 5HDOA 3GHBL 3OQ3B 1CD0A 2YD3A 4LGSB 3NVQA 4UNTA 4HT1L 5CIPA 4PP2A 1A3RH 4I4WA 1U3HD 4PUBL 1H5BB 2NLJB 3GM0A 5IF0B 4MB4A 3GO1L 2I25N 4DOHE 1CFQA 4XVSH 3RJQB 3SCMB 3MRGA 5HD8D 5DS8B 3NTCH 4IDJH 3U30C 4JREB 4G6MH 2QL1A 2DBJA 5AYQA 4HC1H 4G6AC 5T3ZH 5D5MB 4LVHC 4CRPA 1IQDB 1P6FA 2VAAB 1YNTB 1D5XB 3D39D 5CEZH 3CUPA 3VXPA 1A4KA 5TQ2H 2HN7B 3AROA 3DX6B 4K3JH 3U9UB 5FO8B 4HLZH 3JTSB 4IHOA 3VWKA 5IUSA 4NNXB 1Q9KA 1CGUA 2QR0B 4FFWC 1MJ8H 1H3XA 2A6DA 4AEEA 5CHNA 1G0YR 5FIEA 4DEPC 2EC9U 4M62L 1D9KA 4OD2A 5DJ6B 4BKLA 3MLWH 1Q72H 4B53A 2EC8A 2J6EH 5DRWA 5FA4A 3TBTB 5FECB 1YEGL 4ZUSB 4Z7WA 4LSRL 5GSVB 4X4YA 1NEZB 1W0YT 3QQ4B 4HDIB 4XXDB 4X9GA 4L8DA 5IW1A 1GGCH 5C0BD 3I6LE 3D3VD 1WAAE 3K7UA 8FABB 2FO4A 2DTSA 1DUZB 3KLAA 4Y16C 43CAA 2WANA 3QEQE 4UT9L 5BZWB 4Z0BH 2IFFH 3BJLA 3L5IA 4JGMA 2CIKA 1NL0H 4GRWB 4BM7A 1MIMH 4FMKA 4CNIB 3RAJH 3CD4A 4N8CH 4PJFB 5F8RC 1FYTE 1INDH 1HSAB 5E1AA 1L9MA 4NNYA 5IBLC 3LPGA 4YQXH 3RL1B 3ARSA 4DZBB 4G6JH 5IJVA 4WUKH 4XGZB 5HHVH 3ZMRA 2LE9A 4LSVL 2NNAA 1Q8MA 2HFFA 3WUWA 1J86A 1A3RL 1R3JB 2OTWA 1W0WB 5ERWB 4PRHA 4NQDD 4HGKC 5CJXA 1IL1A 1A7NH 2MNUA 4XVSL 2ADFH 4X7SH 1LNUA 4LCWE 3BGAA 3LRSA 2HTLD 3LKPA 3NTCL 4KTYA 4LFHG 4AMKH 3MJ8B 4ZFZB 3DI2B 4IDJL 4G6ML 5LGJB 2JTDA 1YY8B 3LN4B 4HC1L 3G6JA 5T3ZL 3QI9C 4E5XB 4S1DC 5H94A 1MSPA 4G8GE 1M05B 3DYOA 3BW9A 3DX8A 5MP6L 4JAMA 5DD3H 2J5LB 5CEZL 3SKMB 2GITB 1IT9H 5ADPH 3SHSA 2ORBH 4LCIH 1S7QA 4G42B 4NCDA 3SJVB 1KYOJ 4F37F 3C5ZA 4EIGB 4K3JL 3OXSB 4FQ1L 1P53A 1Q9OA 3C2AH 1CD9B 1IZKA 3ARBC 5JR1H 4F2MB 1EO8H 1MJ8L 3G04A 5DDHB 2B4CC 4NOFA 5EU7C 2GJ6D 3WN5C 4MWFA 1KN4H 2VITA 3MLWL 1Q72L 5KOMC 1LD9B 2YPLD 1RZFH 2J6EL 4D0BA 3D85B 3W9DA 1I1YB 1WFOA 4ZFFB 2BSTA 1UZ6E 2EYTA 3ZT7A 5EO1B 4WU7B 1UC6A 3HZMA 2Q8AH 1C12A 2E9BA 1ODAA 3HI6H 4X9HA 1FYTB 4QRPB 5T5NG 4Z0BL 3IDNB 2IFFL 5BXFA 3ARTA 3I50H 4X6DF 1NL0L 4L8SA 1MIML 3RAJL 3K80A 2AK4D 1G7JA 2XWTB 4N8CL 1XIWD 1INDL 5DSCB 4P59H 4H88H 2IG2H 4WJ5A 1Q9LB 4YQXL 2PYFB 1EK3A 4G6JL 4PTTB 2ERJB 4WUKL 5HHVL 3B3IB 4A6YH 4ZSOA 3F62A 2M1KA 1KXQE 3P11H 3O6FC 4YGAB 3BKCH 5IFHH 4PRPD 4HUUA 3CFDB 5F3HB 1UACH 1JGLH 4YDJB 5HI5D 2IMNA 4Z7QF 1A7NL 5GRJH 5IEKB 2ADFL 2DMCA 4X7SL 1KIQA 4EN3A 1XGTB 4R96B 2EEBA 3CDFA 4J12A 4AMKL 3EO1A 5HGBB 4G8GB 3TP4A 4JLRB 5KSUB 4URTB 3LQMA 1R24A 1GRWA 4RSVA 4V1DD 2VDKL 2R4SH 3CK0H 5JOFA 3U36A 1AO7E 1U8NA 2BXYA 4CN4A 4FTVA 4NZUH 4Q97A 5EFIB 3VFUA 5D1XA 4PJHE 2LU4A 5DD3L 1QTYT 2WNGA 2X4QB 1LO2H 1IT9L 4QHNB 3FO9B 5ADPL 1EGJA 1CFTA 1NKOA 2ORBL 4LCIL 2R39A 4KY1L 3IDMB 3BDXA 4XPGH 1OP3K 4P4KB 3V6OA 4M8VA 3C2AL 1P4IH 4NRYB 1NMCB 2X09A 4MA8H 3HCVB 1FV1B 2DL2A 5JR1L 1EO8L 3ALXA 5BS0A 3BN9D 5EC1A 4LSUH 3KPOA 1PKOA 2DKUA 3O2DH 4O51A 5L7XH 1KN4L 4X5LA 5FK9A 1RZFL 2PCPB 2ICWB 4S10A 5I76A 1XR8A 4DKDC 3VWJA 1CR9H 3FN3A 1JWSB 5MEOB 1YMMD 3MUGA 2VO5A 5DEZA 4AL8H 4CGTA 2CKBB 3ZE0E 3BHBA 5L2JB 2Q8AL 3GMQA 4H5SB 5F96H 1ZGLB 3RHWF 3HI6L 3MYJB 4MB5A 1I1AC 5GXBB 3E3QC 5DHXB 4PJ8D 4QRQA 3UTPD 1BFTA 3QIUC 3FONB 1AGEA 4YO0A 3I50L 3JWOH 4Z7UE 4YHYB 3GK8H 4JHBA 5FB8A 4GO6B 1MI5A 5KVMC 4U1GC 5JORA 3ZDZF 2DWDB 2YMXH 4RIRB 4K71B 1NGXA 4P59L 4H88L 2IG2L 2OX5A 4BFEA 4GJTB 4QCIB 4QRSA 5ESQB 4P5KA 4BUGA 1AGDB 1QO3A 2W59A 2PO6C 5B3NA 4HIHA 4PBWD 1S9YB 3BMWA 5DMGC 4A6YL 5L8LB 1QSEA 3ZYOA 3L7EB 3Q3GB 1C16A 2OJEA 3O9WB 1MRDH 4JFHD 3TPKA 3P11L 1NDMA 2NZ9C 1WT5A 3BKCL 5IFHL 2Y4SA 3V0WH 2V7HB 1NEZG 5B8CA 3AU1B 1UACL 4XB8A 1JGLL 4JRXE 1PY9A 5ELIA 2AV7B 4PREB 2E9JA 3HC3H 3B9KA 2ZG1A 3DMMB 3NOIA 5GRJL 1ZLUH 1BJ8A 4M5YH 2J7LA 1MWAH 1LP9F 2R2HB 4RQQB 4BH7A 5I0ZA 3JXAA 3SGJA 4PJHB 5SWSA 4N1EA 1A21A 4U6YA 1IJ9A 1CTOA 2R4SL 2LTQB 4Y4FC 1I4FA 2P5EE 2OJZH 1H3PH 3ARGA 5EN2B 4PG2A 4Z7NE 3FCTB 1LO2L 5IB1A 2GCYA 2C1PB 1H3WM 2BMKA 4XPGL 3PJSB 5F93C 4B41A 5IGXH 5DJXB 4ZUVB 4C83A 6FABH 4KXZH 2H9GA 1P4IL 5C0FB 5CEXB 1NCDH 5MENE 4MA8L 1T6VN 2DM4A 2BOCA 3PL6A 1MRFH 4LSUL 5JNYA 1C5DA 4P46B 2BHYA 3O2DL 5L7XL 3BRDA 2CDGB 4UIMA 4H8WH 1WLHA 2Q3ZA 3C60A 3MBEC 3H3KA 1MHPH 4LCYB 3DO7B 1IAOA 3BP4B 1B0RB 3VRJB 4D9QE 3RDTC 1CR9L 4NQED 1CFNB 2BY1A 2QSCH 4AL8L 2Q87A 4U1JB 1MVUB 4XXCA 4Z7UB 3QO1A 2OZ4A 5F96L 3QQ9C 2G2RA 4APQB 4I0PC 3P73B 1TQBB 3LKSB 5IVXF 3VGFA 3CAFA 3BD3A 3JWOL 1ZA3A 5FYLD 4BFGA 3GK8L 3KPQA 1V3KA 4P9MH 2ATPB 5E2JA 4L29A 5CWSB 3ULSA 4EIZC 2X1QA 1XGPB 4YHPB 3GIZL 3T0DA 4L8CA 3AM8C 2BSSA 5DJ0B 1XMWA 3X12B 3MRHA 4J1UB 1MRDL 4XCYA 4HGWB 1ZVSA 4JRXB 4YIQB 1T1ZA 4LSDA 5TQ0H 1TJIH 3V0WL 3D48R 2AQ2A 1CICD 2JF1A 1NLBH 3OPZH 2PW1A 4HS3A 4GRWH 3LSOA 1FSKB 5DT1H 4TUOA 3V79C 3HC3L 5MEQB 3I02B 4P2QB 3TLRA 4YR6A 4M5YL 3VE0B 5GRVK 3ROLA 1MWAL 4NM8H 4HWBA 3MNVA 3IDIA 2ID5A 4MCZB 2YPKB 4CADA 1AC6A 5I74B 1EVTC 4CVZB 2QBWA 3PF2A 5INDB 1U92B 3NCYS 4XNMB 2OJZL 3CFBA 1I7ZA 1AD0A 2N56A 1H3PL 4L4TE 4M7ZC 3VFWB 1N3NA 3EJYC 5FO7B 3RZCC 2IQAB 3TBWA 5F1OB 2VNCA 4HS6A 4JFDD 5MENB 4JO2H 1QHOA 4LAJH 2BNUB 4NDMB 2AEIT 1QEWA 1JHTB 1TXKA 2VR4A 4RGOH 3PHQA 5IGXL 1RJYB 3X14B 6FABL 1A7PH 1S78D 3B9DA 1FNSH 1NCDL 4EZMA 2A73A 4NO0B 3U4AA 3QAZB 1MRFL 3MA7B 4U6HB 4PRBA 3L3DB 2PYEE 1JWMB 2ADGB 3OV6A 4XBGA 2ED8A 4H8WL 1S9XA 4LPVA 4KK5C 3I6LD 1MHPL 4R4BA 2A6JB 5KVEH 2YUZA 1YMHB 3HN3A 2F53E 1JTTA 4MAYC 1M71B 1E4WH 3QEQD 4NYLA 1I8LC 3EO0B 2QSCL 5C0RH 3U46B 1EEZA 3TA3D 3VWKC 4N5ED 4I18A 2X4NA 1UKTA 4LSPH 2XNAA 4Y2DA 3GRWH 5DQ9A 4WWKA 1MCIA 1I7TB 3N85H 1MEXL 4P9ML 1CGWA 4LEOA 4TNWF 3T0ED 3GNMH 4Z7OE 2Q86A 1XGQB 1K3IA 2VZTA 2IAND 1EJOH 2W07A 3VFMB 2VQ1B 1MJ7L 5DJ2B 3FQWA 3B9EA 2XPGB 1XF1A 2P4AB 3ARPA 1ITBB 5TQ0L 3ZE2E 4WNQB 4LCWD 3KPPB 4LVNC 1NLBL 1ZA6A 3OPZL 4LPWA 1U8MB 2NY4C 1AQKH 4Y5VB 5DT1L 5EOQH 3F12B 4NZDA 5CD5C 1M7DA 5HGAA 4TPRH 3VXTA 1XAUA 4C58B 4G8GD 4NM8L 5E5MA 3BP7B 1T04A 3BP5B 1G7MB 3F6LA 3QCUH 5E94A 1A2YB 3LH2L 2WP3O 4F9LC 4WGWB 3V5KA 1FFNA 3VXUE 1QVOB 2X89A 5EPMB 3VXNB 1I1RA 3PIQA 5D1ZB 1NBQA 1CG9B 4JO2L 4FXLA 3ULUC 3WCYA 3F58L 5B21A 3SDCC 3QHZH 4P4KD 2O93L 3L5WA 4QY8B 4RGOL 1FL5B 3KYMA 3NZHH 2PYEB 1A7PL 1E4JA 2BNRA 1FNSL 4LEXH 1QRNE 5IMOB 1OSZB 3BQUD 4TRPH 4WV1A 2XTLA 3MOAH 3WO3B 2F53B 4YGVA 3VFRB 4KJYB 1BIIB 2VLRE 4M1DH 4PS4H 3LIZH 5KVEL 4R7NA 3QUYA 4L8BA 3FQUA 1QHPA 4QOKE 3TBSA 1E4WL 1I1FA 3MRIA 5C0RL 3EYQC 4OV5B 1RJCA 3CJJA 3R1GH 3CMGA 2APVA 2H32A 1ZHLA 2WBJA 1ZHBA 4LSPL 3DURB 3GRWL 4Z18A 4Y88A 1DBBL 5I18H 4KKNA 2FLBT 3O8XD 1MCKA 3CIQA 5GGSB 2EO1A 5FYKE 3N85L 1IGIH 1KCRH 1JYXA 4KFZC 5KSAB 2HFGH 2LV4A 1NC4A 1EJOL 2ADIA 2RGSA 5E6YA 1UJTA 3FRPG 2F15A 3T77B 4PRDB 1I8IA 5EBMB 2CKBH 3EOAA 4PBXA 5HJ3A 2C1OA 1T21A 3E6HB 5IMLB 4OFYA 1RZJC 2N1KA 3WMSA 2HFEA 4AIOA 3HPLB 4U1MA 1EXUB 4I5BA 4XNQB 1AD9B 4KKCD 3BISA 2UWEE 4ELME 1AQKL 5JW3H 5EOQL 1YEFH 4YHIA 5EUOE 1AO7D 1LMKA 4TPRL 3EZ8A 1F6AA 3QCUL 3WFBH 4AENA 1IM9B 1TETH 3O3BA 3ARFA 3SEPA 4N0UA 1WC7A 3FAXA 4I3GA 2X70B 5E2TH 1NUFA 5DK0A 1YEEH 1QRKA 3PGCB 1NGPH 2KH2B 4Y4KA 3U9PH 43C9B 5EC2B 3L9RA 1VENA 2VZOA 3QHZL 4AEHL 4JRYA 3HI5L 1H3TA 4OLEA 5GPRA 1R3LB 4H25B 3NZHL 1T3FA 4LEXL 4U7SA 4J23A 4BSVA 2BCKA 3U4BH 3MV11 4X6DA 4XCNA 4TRPL 3T0WA 4E41E 1X44A 4LCCB 4ZAKB 3MOAL 1BQUA 5KG9A 2YUVA 4YFLF 3P9LB 5IIEA 1OGAD 4M1DL 3OAUH 3BI9X 3LIZL 4PS4L 3MOQA 5KSVA 4ZNCD 1L0YA 4HWUA 3WS6A 4NT6B 4QEGA 3QULA 4PJ9B 4MD4B 4CW1A 4OIIH 2I9LA 2W9DH 3CDGA 2YD5A 3R1GL 2VQTA 3OTTA 4APQD 2Y36H 2B1AH 3O6LH 1PSKH 5C09A 3Q6FB 3V5HB 4LKCA 2ZUUA 5I18L 3L6FB 1JK8B 1F3JB 5MEPB 1HHIB 3JWDH 1IGIL 3ZKXB 1BHGA 1KCRL 3WHXB 1JV5B 4J4PA 1VADA 3MO1A 1BVLA 1VFBA 3NFPA 1UH2A 3QJHA 2Y7QB 4TQEH 1JPST 4IMKA 2V2XA 1ZT4B 4OGAD 4D2NA 1FL6A 4D8PA 2CKBL 5F7YC 2YD4A 3UPRB 4FQXD 3VXSD 2ICEB 1EUUA 1HYSC 2R2BA 4Y4HB 5F7NC 4ZUUA 5EUOB 2JJSA 4PJXF 1F13A 4QRRE 5D7IB 5JW3L 2IMMA 5J1SC 2KL6A 1YEFL 1PKQA 4X0KA 4CAGA 4ISVA 4OQTH 2FX8H 2XTJC 2P5ED 5KS9F 1KEMH 3G5VB 3NN8B 3NIGF 5HPOA 5EU7E 3CVIH 5DTFA 3BIKA 3WFBL 1TETL 3QCVH 1WVZA 1GGTA 3ZKND 4IIQC 3FTGB 3PWNB 1MCHA 3MRQA 2FZ3A 4JFYA 4U05A 3S3JA 4NQCE 3C6SB 4TVPE 4LLVB 2P8LA 5E2TL 5TDPA 2FO1A 2DQFB 3S8WA 1YEEL 4YFLI 1S5HB 5JMRA 1NGPL 5DRXB 1T7YA 4NCC2 2A74B 2C7UA 3AXLA 3WDHA 4L3EE 1U9KA 2ITDB 1BD2A 5MERA 5J12C 1DE4B 3TESA 1GSMA 4NO0D 4KI1A 3RVTD 1OTTC 3U4BL 4D9QD 3TC9A 4FQQB 5ANMA 1MRCH 3VGEA 5IMKB 3VD4A 4I3SH 3SGKC 1Y6MR 2ZSWA 3OAUL 4POUB 3QDJE 2E6QA 5SWZE 3BUYA 2BVOA 2NW2A 1M6OB 3LPWA 32C2B 2IPKA 4NN5B 5IBTH 5E6ZA 4JFQB 4OIIL 3SDAB 3BZ4A 2W9DL 3O3UN 2VZ1A 1UEMA 1A9BA 3E8UH 4W70A 2Y36L 5GS2D 2B1AL 4UNUA 3O6LL 1PSKL 3E2HC 4RDQG 3S88H 1X7QB 5C0GB 4M8QB 3H0TB 2IQ9H 3JWDL 3MXWH 5D1QD 3C60C 2ARJQ 2GY7B 1LP9A 4TQEL 5IKCB 1FLRH 1CE6B 1RK0B 1SHMA 3O4OC 4QXUH 4XBEH 1DP0A 1A1OB 2AS5M 4JO4H 5IB2A 4HFWA 4R3SA 2MMXA 4WDIA 4QRRB 4NO3B 5GS2H 1J8HA 3QUKB 3CFEA 5CGYC 3VFGH 4YBQD 5E9DE 3C6LD 1U93B 4YFEA 2EIDA 2ICES 5JXEA 4OQTL 3ZTJH 2FX8L 4HEPG 2ZP0T 1KEML 2IALA 5KSBE 1ND0B 1PDKA 4L4TD 2LU7A 4NQCB 4NKMA 3CVIL 3V0VA 4GBXC 4GKOA 3PWPE 3QUZB 2ZOLA 3GMLB 1MCWM 4JHWH 4F7CB 5KN5A 2P8PB 4L3EB 5IVOA 4F8TA 5D70H 2D31A 4K55A 3TO4C 4F7MB 5FF6B 3N06B 1RZ7L 4K8RC 4MNGB 4JKKA 2GAZA 3O4LD 4WTZA 5M7QA 1HHKB 1A1MA 3QWOA 5DYOB 5F44A 3RGVA 2PYED 1JMXA 5DJZA 3E3QE 4G6FD 4P2RE 3KXFE 3WUZA 5D7JC 4DVRH 1G9NC 5IVXA 3GJEA 3MCG1 5JPNA 3GI8H 3FN0H 5ID1B 5D7LE 4TSAH 2F53D 3A0OA 3SY0B 1YDPA 1MRCL 4JFEE 3HC4H 2W0FA 3HZYB 2XN9A 3HI1B 2XOTA 4I3SL 1J0JA 4K2UH 4O2EA 3UO1H 3L95A 1VERA 1AI1H 3QDHA 2HVJA 4OIBA 5IBTL 3P9WB 3U1SL 3VFPB 4YNYA 5DD1H 2W60A 5E8EB 1Q94B 5A43C 4QWWD 4R4NC 3E8UL 3FOLA 3RIFK 3HRZA 4FXGA 4LK4A 5ACZA 3PG2A 3S88L 3U0WL 2X9YA 3PNWB 2NY6D 4Q6IA 4QF1A 3LN9A 1HDMA 2IQ9L 3MXWL 5CP7A 4GXVH 5KSAD 1EA9C 4K7PH 1VFOA 3EOTH 5ILTH 1NAMB 1FLRL 3VI4F 3REVB 4P2CG 4QXUL 4OI9A 2XI9A 4XBEL 3EDJA 3VRLF 5KANG 4JO4L 3K4ZA 4LBEA 1LO5A 3SBWC 3W11C 4NWUH 1QLFB 5E9DB 1MCEA 2EYRA 5BV7B 4U1LB 5IV2A 3QIWA 4Q2ZA 4L5FH 4XPTH 2D0HA 3VFGL 5KSBB 1ZHKA 3QDME 4LP5A 1Q9WA 4A2MA 1MHCA 2P1YA 3QUXB 2E27H 4L1HA 3PWPB 3JV0A 3IFOA 3K4AA 3CCHA 3VG9C 2OS7A 2FECL 4MJ5A 3VXUD 2FYYB 2CLZB 2E9IA 3K8LA 1IM9D 4HZAA 2DF3A 1E6JH 1RJZB 2XA3A 5GGRB 1RURH 5D70L 2FJFB 1R5VA 3LEYH 4KXZI 3KNBB 4P2RB 1K4CB 1JPTH 1QRND 3ILQD 4NJAH 1CDYA 2PF6A 4P5TB 5D7LB 1I9JH 2ARJA 4H1LA 2VLJE 4PP1C 4JFEB 2VLRD 4G9DA 3U4EB 5HYJE 3GI8L 3FN0L 4GG8B 4QOKD 4TSAL 2YEZA 1S7XA 4F15B 5F7LB 3HC4L 4K2UL 3UO1L 1U8LA 4P5MB 3ZSTA 4GFTB 1AI1L 1JRHI 4MXVF 2Z93B 2ADJA 4JZOB 5L0QB 2P5WE 3S4SA 3V6FA 3IFPA 2CUIA 5F21B 1ZHNA 3ECBA 5DD1L 4YHNA 4U1SA 1KTLA 5FYKD 1BQHG 1MCDA 2VXVH 4J6RL 3NCMA 5HVFB 3MROA 2OBGA 3EIFA 4XX1G 4NHUB 3CSBA 4BSJA 3BUTA 4G6AD 4GXVL 4K7PL 3EOTL 5ILTL 2V2WB 2B5IC 2WV3A 3AY4A 4LDOB 1SYVA 5JW4Q 1LE9B 1YN6A 4QHLA 3SO5A 3FO2A 1PFCA 2CRIA 3KPSA 2DQEH 4ZPVB 3HR5A 4U0RC 5FGSA 2XQYG 3DROA 4NWUL 1QQDB 1WAAF 2D7OA 5FYKH 4PJCE 2YBRB 2EDJA 2NY3B 1RPQA 4HC1A 5E4EC 4FFWD 3SN6N 5J6GA 1K5NA 2L4OA 5CD3A 4XCFH 5I73C 4L5FL 4XPTL 1W8NA 1U3ZA 5DUPH 4HKBA 5BOPA 2CO6B 1TVBB 4JCMA 2E27L 1J05B 4UOJA 1U3HA 4XC3H 4NQXB 1U58A 4LSQH 1HHGB 5EU4A 1E6JL 4HWZB 1QFUH 1ZT7A 2CH8A 3HNVH 3BWAB 1RURL 5JLZB 1WBXA 3LEYL 1FNAA 4ODWA 5I15H 4BFBD 1JPTL 1UEYA 3FQRB 4JHZA 4LPTA 5DJ8B 4NJAL 2CK2A 4E41D 3HB3C 4RNRB 3IU3A 1I9JL 2WMPA 3D0VA 5IW6A 1YUHA 3RWEB 4EXPX 2HJFA 2C3WA 1UB6B 3D39A 5IBLD 4C4KO 3AS3A 3WYRA 4MXQC 4JFZH 1TQCC 5JO5A 1A0QH 3MGTB 2XACC 1DQQA 5C0DB 2JB6B 5MI0B 4QRUA 1QA9B 3B6SA 4HD9A 4Z7WE 1OAXH 3VD5A 1AKJB 5I9QC 3O3DB 1JF5A 4NZRH 4D0DB 1NANI 3ALWA 1WWBX 2JJUA 3O11A 3P4OB 3IF1A 3SQOH 2P47B 2VXVL 4NJ9L 3O41A 4HSQA 4AQOA 1FFOA 5E8OA 1F3RB 1Z9MA 3FO1A 4OF5A 4S11A 3CVHA 5C0BA 3D3VA 5IHLB 4W4OC 1IC7H 3DVNA 4NQTA 4QHMA 5DHYA 3QI9D 4S1DD 1TJHH 1ACZA 2YA2A 1I8MA 2NTFA 3HMXA 5CIPB 1H3VA 3NPSC 1DEEA 1TVHA 4JANA 4PP2B 4I4WB 1JPFA 5B3JE 2DQEL 1LEGA 5HDQH 3MA9H 1CFQB 3ESVF 1H3UA 1EBAA 3MRGB 2VRAA 1CDBA 3ARBD 4PG9A 4PRHE 3ULUE 2C3HA 4Z0XA 4LKXA 2WZPD 4S0TD 5DHVH 4RA3A 5DUPL 3NIDE 1NBVH 3VA2C 3TH2T 4OUOA 4RGMC 5I2IA 4XBPA 3RKDC 3LKOA 4XC3L 3RY4A 4JG0H 2X1WL 3QFDA 4K3HA 4NQDA 2E6JA 5DEFA 3EFFA 4LSQL 3CUPB 3VXPB 5TDNA 1BJ1H 2JELH 3STBA 3JZ7A 1QFUL 4L3ED 1A4KB 4QLRA 1BWWA 3HNVL 4IHOB 3VWKB 2J12B 1Q9KB 5I15L 2CXKA 2IFGA 1PJ9A 3QXVA 5HHPA 3M1BA 3IJHA 4QT5A 2A6DB 2VKXA 4GRMA 3OHXA 4P23C 4WWID 5L6YH 5CHNB 2ESVE 4KKAD 1D9KB 4OD2B 4BKLB 5DRWB 2L0DA 2VWEC 5FA4B 3QDJD 4X4YB 4Z7WB 4JFZL 4TVPH 5SWZD 1A0QL 4L8DB 1MCFA 2DMKA 5IW1B 5IFJA 3ZDXF 4KVCH 3O6FD 3D2UD 3V0AC 3HE6C 3NA9H 2FO4B 1OAXL 3KLAB 4WFGE 43CAB 2GJ6A 2NZIA 3IDGA 4LVNB 4R26H 1JHKH 2CIKB 4NZRL 2YPLA 5C8JA 1OD9A 3SQOL 1EPFA 1DTUA 4Z7VA 5E1AB 1SEQH 1A6ZA 4NNYB 3EGSA 3DO3A 4PJXA 3I75A 4PJ5E 2ICWI 5IJVB 1BMGA 3BJ91 4GKNA 1RK1A 2FHFA 4RAVA 1IC7L 2NNAB 3HZKA 1TJHL 3SKOA 4PJBE 5KS9A 5DFWH 2X4RA 1I85C 1ORSA 4XP6H 4L9LA 2E7BA 4JQXC 4ZSOE 2HFFB 3WUWB 2OTWB 2V9RA 4PRHB 2X42A 1DVFC 1F4AA 5EDXA 5HDQL 1R5WA 3I85A 1IL1B 3MA9L 3MLTA 1LNUB 5E2UH 4ZOBA 3AAZA 3LRSB 4ZG1A 3LKPB 5E2VH 5DRNA 3VD9A 3T3ME 3GFUA 4WFEE 2V9TA 4HUVA 3FFDA 3O2WH 1NBVL 3G6JB 4PRPA 4RMRA 3HA0A 5H94B 4YXHH 1NAMH 4FABH 2VABA 1NC2D 2UVEA 3BW9B 4JG0L 3DX8B 3RI5F 4JAMB 2B0SH 2VZVA 1UCBH 1DZBA 3QFJA 4FTVE 1S7QB 2JELL 1OAQH 3ES6A 3IDJA 3JTTA 3C5ZB 4MGXA 1HCVA 3RP1A 3LEVH 1Q9OB 1GYAA 1PVHA 3O2DA 4V1DA 4BQ9A 3KXFD 2KZ1B 5BV7H 3G04B 3V6OE 5I8CA 5D93B 1CLCA 5L6YL 2OXHA 4MWFB 2VITB 4M3JA 4JFED 5FCUL 2A2QT 4KMLB 4D0BB 4OB5L 1RI8A 3CLFH 3WFHA 3W9DB 4I0KA 2PO6D 5BS0E 2GK0A 2BSTB 2AJXH 4TVPL 5DMGD 5K9KA 1KPVA 2EYTB 5FV2A 3WJLA 3HZMB 4GW1A 4KVCL 4MA1C 1C12B 2ZCLH 3C09C 3NA9L 1GZQA 4Z7NF 5DK2A 4I13B 2IH1A 4R26L 5BXFB 2EDRA 4IBLT 4L8SB 2WK2A 1G7JB 2B8OT 1G9MC 2Y6SC 2QEJA 3IDYB 5HI3C 1YMMA 4WJ5B 1VESA 3QHFH 1UM5H 4FXKA 4R0LA 3IRPX 1CLOH 4ZSOB 1CQKA 4NGHL 4Y4FD 3BPLB 4IEFB 2O5XH 2ICCA 3ZZ1A 4HUUB 4XP6L 5KW9H 2GJZA 1U2HA 2Z31C 4X9BA 1U8HA 2Z0BA 3P9MA 5I8KH 1MWAA 2APXA 3QDMD 2Q1EA 1KIQB 2BRRH 5E2UL 4BQ8A 4EN3B 4ZDHA 5E2VL 4Q9BA 3EO1B 1CFBA 1OAUH 2V5YA 1IAMA 1R24B 4ETYA 3O2WL 2HKFL 1QR1A 1FNGA 5JOFB 1FFQA 3U36B 4DJMA 1U8NB 5I1AA 4FTVB 4YXHL 1NAML 4FABL 3MBED 3VFUB 1HE7A 2XT1B 5F88A 4HQQH 1H0DA 5D1XB 2PKDA 1E6OH 5SWSE 3M45A 5C0AA 3U83A 2B0SL 3RDTD 1UCBL 5HDLA 3UMTA 1CFTB 5DUMH 1OAQL 2WUBH 3JV6A 2XG5A 3LEVL 2HA1A 3QQ9D 2VLJD 4PY8I 4I0PD 1Z3GH 4LPXA 5BV7L 5HYJD 4ETQA 5D7SH 3T8XA 5BQ7A 4M4RA 5BS0B 5EC1B 1OTSC 3KPOB 4MQTB 4O51B 4CMHC 4YLQT 2R1YA 2V7NA 4YDVA 2DWEA 5FK9B 3MGOA 1ZANH 3CLFL 4NIKB 4YE4H 3QEHA 1XR8B 5I76B 3VWJB 2AJXL 5AZEH 2P5WD 2MFNA 3MUGB 5ICZB 4G8EA 5GRWA 1WSST 3BHBB 1YN7A 3GMQB 4AIZA 4K94C 2BJMH 2QSTA 2ZCLL 3HAEH 4QRQB 2DN7A 4HWNA 1SJXA 1AGEB 4YO0B 5FYJE 3IXTA 5F7MC 5FB8B 1MI5B 3GMMA 3MRBA 3L5XH 5JORB 1NGXB 1TZIA 4NQEA 4ONOA 4QRSB 1WBZA 3ARUA 4P5KB 1QO3B 4HIHB 3QHFL 4MHHG 1UM5L 1KJ3H 1CLOL 1QSEB 3MV8E 1C16B 2OJEB 2O5YH 5FEBA 1NDMB 3F65A 4ZXBC 1DEDA 2R23A 5KW9L 3EJYD 3RZCD 4CMMA 5B8CB 1YJDC 2DJ4A 1AHWA 1OW0C 3NCBB 3MLUH 5I8KL 2N4IA 1BX2A 4LQFH 4LVEA 5EU6A 2C3XA 3B9KB 2W9LA 2BRRL 2Z9TA 1AXTH 2UZIH 4BH7B 2AKRA 3FT4A 1A64A 1OAUL 4DN4H 4X8XA 2FCBA 5SWSB 1MELA 4U6YB 4Y89A 5D96B 5DFTA 3VI3F 4IRSC 1I4FB 3FZUC 3AY4C 1CICA 2AXFA 5CINH 1C1EH 1CDCA 4KK5D 2VB5A 5ICXA 4HQQL 3ARGB 1E6OL 3V6ZA 4MAYD 3EYOA 2CRZA 2R0ZH 5IB1B 1MCLA 2GCYB 4JPWH 2LU3A 4WI8A 5DUML 3KLHC 2WUBL 2BMKB 5IQ7H 4OGYH 3VWKD 1WIOA 4C83B 2H9GB 3LQZA 1BOGA 1KSRA 3KJ4B 1WUNT 3BVNA 3WUWG 3FHQA 1Z3GL 2BOCB 3GSRA 2JIXD 3LPFA 3P0VH 3S5LA 4F9PA 3PL6B 2I5YH 2ZJSH 5D7SL 5I8OH 3TNMA 2DYPD 5JNYB 1C5DB 4FQCH 3BMVA 4UIMB 3C60B 2FSEA 1D6VH 4OCWH 1IAOB 1ZANL 4HKJA 1OVZA 4JFDA 2W91A 3FAWA 5D8JH 4MDJA 2YD2A 4YE4L 2FHCA 4UBDC 4NZTH 3GRWA 4ALAH 5IB4A 3QO1B 2BJML 2G2RB 4JN2A 1DCLA 2NY4D 1ZA3B 5HBBA 1XZ0A 1BFVH 1Z9OA 5FA3A 1ZMYA 2E5EA 3KPQB 4HK0A 1WAAA 4L29B 3ULSB 5CD5D 3L5XL 5HPMA 3OKNA 5CP3A 3QEQA 4WW1A 3RY6A 1N0LA 3K8MA 3PE9A 1UZ8A 1HZHH 4E0RA 4P4RA 3FFCB 3TA3A 4L8CB 2BSSB 3MLVH 4OGXH 1KJ3L 1LEIA 1VFAA 3MRHB 1PAMA 1T0PB 1T89A 2NY1B 4XCYB 4KZDH 3QXAA 1ZVSB 1S9VA 2O5YL 1T1ZB 5JW4N 1D5ZA 2DQHL 3T08A 2PW1B 3JV4A 3T0EA 1EIBA 3MLUL 4F58H 3MCKA 4HS3B 3ULUD 4LQFL 3LSOB 5I1JH 4TUOB 1P7QD 1LVEA 5BW7A 2ZUYA 5FYKU 4BUHA 3DVFA 2IANA 4YR6B 3UYPA 3ROLB 4ZFGH 1AXTL 4KHTH 2UZIL 4GQ9H 5K9OA 2KDGA 3MNVB 3IDIB 1FCCA 3RWJB 4OKVA 4CADB 4DN4L 3PXJA 2C4FU 4LCWA 5CINL 4IOIA 1IGJA 1C1EL 1RMFH 1I7ZB 1WZ1H 3CFBB 1AD0B 1N3NB 2BERA 2EKJA 2ZKHH 3TBWB 4HS6B 4HIJA 2R0ZL 4JFFE 3EYQD 3H9HA 4JPWL 3ULUH 1QEWB 5IQ7L 4OGYL 2ESVD 1D6EA 4CDHA 5KVFH 3WNKA 2A73B 3P0VL 2UWEF 2I5YL 2ZJSL 1MPAH 2R1XA 4ELMF 1OF2A 4KPHH 5I8OL 5IHZA 4PRBB 2HP4A 5D6CA 2D7TH 4FQCL 3LQAC 3SGEH 3IRZA 4XBGB 1S9XB 5JOEA 4YK4C 2FH6A 1D6VL 4OCWL 4R4BB 3V7AG 1JI2A 2XV6B 1DBKH 4JFOA 1WICA 5D8JL 3Q48A 3KPLA 3WXWH 4WFGD 1LO4H 2W0LA 4NYLB 2IBBA 2UZYB 1EEZB 3TVMA 4ALAL 4K3GA 5TPWH 2NY0B 1M1SA 2JJWA 3BQUA 3F7QA 4I18B 2X4NB 1ZGLP 3DECA 4Y2DB 1NCAH 5DQ9B 4WWKB 2GTZA 1CFSA 4Y5YA 3VMNA 5EU5A 3WSQH 2H2PC 4PJ5D 1BFVL 4U1IA 4JB9H 4LEOB 4DUXA 4Q58C 4ZO6A 3PABA 3EOBA 3QXWA 4HW6A 5IR1A 1ETZA 3TM6A 4OZ4A 3G08A 1BAFH 2Q86B 3VG9B 2I26N 1XF5A 1HZHL 5DFVC 1B88A 3TZVC 3FQWB 3MLVL 4JM2F 4OGXL 3NGBC 1MREH 5DF0A 2VLKA 1YY9C 4KZDL 3RBGA 4J7RA 1KIRA 1WITA 5HVHB 3O8XA 3MYZA 4X7EC 1ZA6B 5T3XE 4AT6A 1NPUA 4X4MA 4F58L 1UENA 1Z9LA 3OX8A 5KOVC 1EDQA 4WFED 5GIRA 5A2LH 5I1JL 2X10A 5CJ5A 1KACB 3MRRA 4EN3D 1M7DB 3EUUA 5HGAB 4ZFGL 2MWCA 4KHTL 3VXTB 3CDCA 4GQ9L 5E5MB 3SE4C 3NCYP 1A02N 1NFKA 1T04B 3CU7A 1P9MC 4KK8C 1OT2A 4EUPG 1RMFL 2Q76A 3V5KB 1FFNB 1WZ1L 2ICWJ 4O2FA 3ROOA 1TTUA 2BY2A 2MQ3A 2ZKHL 4YBLB 3PIQB 3RVWC 2CDEA 4WHYG 4LRIA 4FFZH 4G7VH 5CEYA 5EZOH 5BVJA 3ULUL 3L5WB 4JM4H 3ZYJA 2OK0H 1J0YA 3KYMB 4QHKI 5L88H 2P42B 4S2SA 2BNRB 3RFZC 1N5AA 1CGTA 1PG7H 1MPAL 4HIIA 4WV1B 2M26A 3WLWC 4KPHL 1U8KA 4YGVB 2D7TL 3QJFA 1XEDA 2OYPA 5C71A 1AIFA 3CZFA 4R7NB 4X6DE 2LVEA 1DBKL 3QUYB 3WXWL 3FQUB 3QP3A 3TBSB 1LO4L 4PRIA 1I1FB 3WKNA 3MRIB 1EGJH 4EBQH 4KRLB 1WFNA 5TPWL 4KRPB 1HYSD 4U7MA 3ZO0A 5F7HA 2H32B 1ZHLB 2WBJB 1ZHBB 2R29H 1CVSC 1NCAL 4HJ0C 2YRZA 4WEBH 2JCCF 2IAMC 3WSQL 1GGBH 2H2SC 1OGAA 5F6IB 4JB9L 4PJ7F 1QP1A 5C09E 1NDGA 2XTJD 1GOFA 3WIFA 1BAFL 1BBDH 1NC4B 2M8XA 4DWHA 2ADIB 4B7LA 4MJ2A 4J3UA 1MREL 5F9WB 3EOAB 1BZ7A 5HJ3B 3H7LA 2C1OB 1T21B 1F97A 4U2YA 2HFEB 5FM5M 1T4KA 4U1MB 2YD8A 4I5BB 5E4IA 1FJ1A 4FP8H 2HYMA 1W72H 3R4DA 3B9KD 4TUKH 3IT8D 4YHIB 3S7GA 2FR4A 5ID0A 1F6AB 3H9ZA 3WFCH 4OLYH 1KCLA 3TH3T 4FQXA 3VXSA 4AENB 3OGCA 3O3BB 4WHYH 3ARFB 4N0UB 2CR3A 4WI9A 5FOJA 3WEXA 4HIEA 1WC7B 4CVXA 4NN7C 5T1DH 2RCSH 4J3WA 3AB0B 1CDIA 5DK0B 5AUMA 3KWWA 1TPXB 3RWFA 4Y4KB 1JZ4A 4G7VL 4X6CF 2B1HH 3L9RB 3MRFA 5EZOL 2P5EA 4POZC 3VFSA 4PLJC 4JRYB 4JM4L 3VH8A 5IWLC 2OK0L 2ZCKH 4M93C 2X4PA 2X1OA 1T3FB 3BOVA 4BSVB 3GSQA 1PG7L 2BCKB 2VDLH 5DGRA 2MSPA 4X6DB 4XCNB 3PWLA 1BD2E 5KG9B 1F11A 2IBGA 5IIEB 4XB7A 3C60D 4Y1AB 1S7UA 5KSVB 2EZ0C 3DGCR 4NZJA 3TEUA 3ZDZE 1MFDH 1I7RA 3W9EA 3QULB 1EGJL 4CW1B 5FYJD 4U31A 2I9LB 4EBQL 3MBXH 4HUXA 3CDGB 5TF1H 2EDWA 1H8OA 5C09B 2R29L 4LKCB 3MUZ1 2FWOA 4XVTH 4JPVH 3VRIA 3QA3A 1OHQA 3OKOA 4WEBL 5CGYD 2OSLA 1GGBL 4CN1A 2MJWA 4PY8J 2RAMA 3MV8D 1MCOH 2VDNH 1VADB 3MO1B 1BVLB 2DQDH 1VFBB 3NFPB 3AGVA 3ARDC 3QJHB 3RVXC 1BBDL 4BSWA 2YUWA 2V2XB 5C9JA 1FQ9C 4GBXD 1SMOA 1FL6B 4D8PB 3IS1X 1E0OB 1OB1A 5FYJH 4F7TA 2OZ4H 2R2BB 4XCEA 5CLTA 3TO4D 4ZUUB 3KLDA 2RR3A 4IRJC 2PXYA 4K8RD 4FP8L 5D1QA 1G7LA 2OM5A 1B0WA 3UP1A 4TUKL 5IBUB 4GAGH 3GSOA 1PKQB 4X0KB 4ISVB 1J8HE 1ZT1A 5I1GH 1NMBH 2A6KA 5TFSL 1DN0A 3DYMA 3WFCL 4OLYL 2XWJA 5DTFB 3BIKB 1ED3A 1IGMH 4X8JA 3GSNH 5E6IA 4JFYB 3MRQB 2FZ3B 2XQYK 5GZNC 2CR6A 2RCSL 3B2UC 4KKLD 4OAWA 5T1DL 5TDPB 3C6LA 3GJFA 5EZIH 3F5WA 1I8KA 4OCLC 3T4YA 3AXLB 2C7UB 4K8RH 2B1HL 4H0IA 1BZ9A 3WFEH 4G8FA 1BD2B 4R4ND 4P9HH 4L4TA 5MERB 2ZCKL 4HWBH 2VR5A 1G9NH 2VDLL 3CU1A 4X99B 1T03H 4N8PA 1HXYA 5ANMB 2DD8H 3RGHA 4GUPA 4PTUA 3ESUF 1RVFL 1G9EA 3RZWA 4P3DA 3CZJA 1WWAX 1UM6H 2ZSWB 4S1SH 3GSUA 2YD7A 4MQXC 3O4LA 4OD1H 4PGEA 4NFDA 3BUYB 2BVOB 4XMLL 5J1AA 2NW2B 1MFAH 3RPIA 2EKSA 2IPKB 1MFDL 3TCLA 2ZG3A 2EEDA 3OGOE 2YA1A 3BZ4B 3W11D 4EI6A 1A9BB 3IFLH 1HKLH 1QYGH 4CU8A 4TNVK 5TF1L 4LARH 4F9PC 3U48A 4WWKD 1NBYA 2OR8A 1YC7A 1NLDH 4XVTL 4JPVL 2J3SA 9CGTA 1OAKH 1AP2A 1MCOL 2VDNL 5DZNA 1LP9B 1S8DA 1SBSH 2DS4A 4YJZL 5D6DA 1YZZA 5BCAA 3K1DA 1RQ5A 5IB2B 4R3SB 4WDIB 2OZ4L 4PGCA 2E7CA 2VE6A 1J8HB 1DQDL 3LMJL 3CFEB 2Z91A 2DOCA 2H3NA 3HR6A 2VKWA 4KK9C 4GAGL 1ES0A 1J0IA 4RA0C 5I30H 1DLFH 3C8KA 1AH1A 4PP1D 4O5LH 5I1GL 4ZFOA 1MLBA 1NMBL 5BO1H 2IALB 3LOWA 4O02H 4IDLA 4NKMB 4KRNA