4APQD

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
240
structure length
240
Chain Sequence
GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSGKGLRLIYYSYGAGSTEKGDLSEGYDASREKKSSFSLTVTSAQKNEMAVFLCASGSLLDVREVFFGKGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN-PRESENTING GLYCOPROTEIN CD1D1
publication title Type-II Natural Killer T Cell Antigen Receptor Mediated Recognition of Cd1D-Sulfatide
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2012-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqD02
1LO2L 1YY9D 3H9HA 4GS7C 5ESAB 4RGNB 5E8DL 3LPFA 1YEHL 4KVNL 4PY8J 4BSWA 1U92B 4K7PX 2GIYA 5FB8B 2QQLH 1UH2A 5HYJA 3H7BB 3UROR 5DRWA 1YNTB 3BISA 3TF7C 5GIRA 4MAYB 4KMQA 4QXGH 2Z93A 5F6IC 5KSBF 1GL4B 2GTZB 4WVRA 1BZQK 5DTFB 5JHDA 1YMME 4LSTL 1RUAL 3F7PC 5AAWA 3BHBA 3G5XB 3FCTA 3SKMB 1F8TH 3FT4A 4LK4A 5JDSA 2XXMB 1RUPL 5JUEH 4I4WB 4B0MM 4NGHH 1TVDA 3B9EA 3WNPA 2X4QB 1A1OB 3AAZA 4C83B 4W68A 3KPTA 3AY4A 2V5TA 3CVIH 3MBXL 4D0BA 4X7SL 3V0WL 3HR5A 1XCTB 3EJYC 3QIBB 3CXDL 2LU4A 1W0WB 4DKAA 4F37F 2R0KH 3QCUL 3CXHK 4RGNC 1DANT 3FRPA 4XP4L 3ARXA 4IRSD 4LF3B 1G7JB 3W2DL 5EU4B 1KEML 3SCMA 1ERNA 2Q6WB 3MQIA 5JXAL 4JRYB 1AO7D 4QOKA 3OSKA 3QULA 5D7KD 3KPSD 2ZJSL 2VL5B 3EOAA 1NBYA 2Q3ZA 3CMGA 5EZOL 3CK0H 3SJVD 1YEJH 1UB5A 1KCRL 3HMXA 4JN2B 4OD3L 1MIMH 5DJXA 3S3JA 5EO0B 3KDMB 5GS1A 2R1XB 1T1XB 5DJ2A 3TZVC 2QADD 4NQEE 5E4IA 1TJIL 4WU5A 5HI4D 3LKOA 3DMMA 4HMCA 1ACZA 1GIGH 1KENL 4JFXB 4HG4J 2ZZUT 3E2HB 1ACYL 4JQXC 3NCFB 4X83A 5IVZA 1X7QA 3OAUH 2XFXB 5AZ2H 1RD6A 3PNWA 5I73B 4MLIA 4Y1AA 5DC4B 1ZHLB 4PJAA 4RFEA 4FG6C 5HHOE 5K9QI 1KC5L 3QT2A 1UEMA 5BS0E 3T2QA 3SKUD 5ISZB 1F97A 4K94H 3CX5J 4PJBF 4XHJD 3ZE1E 4O2CA 4AIZB 1ORQA 1R5VB 5CJBA 1ZHKA 4QTIL 3V0AC 4E5XB 1MAJA 3GMOB 3ARDA 5T33H 3QXWA 5D4QA 3PWVA 2YD9A 3CPLA 5D8JH 5CP3H 2GYSA 3KXFE 1XF5B 4LSQL 3P73B 3T0EA 3BKMH 5ID0B 3IVKA 5I8KL 4G80A 5KZCD 4PJDE 5FGSA 4OTXH 2VB5A 2V2WA 4IEFB 4HV8B 4ELMA 2IH1A 1QFWH 1I8LA 2ENYA 3ULVH 3VFPB 4L1HA 2CDFA 2R0WL 4JFZL 1H9VA 5JOPD 3SGJA 1JNHA 3GSQA 4I0PB 1XIWD 3O4OB 4OCYL 2C26A 1JTOA 4LSSH 4OM0H 5C2BL 1UZ6E 4Q9QL 3PWPB 5B39G 3L3IB 5DQ9B 2Q8BH 2J1KA 1HIML 3I3BA 4L8DB 4O51A 3KLHD 2H32H 3VWJD 4FQLL 2GJ6E 5F7KC 5FA3B 4C54A 2Q20A 1T1WB 4HUUA 2NXYC 1IQWL 2VJXA 4ZUWA 5ITFB 5J6GB 4KJQD 5I73C 2YOCA 4XPGL 4LLMB 5FKAB 3PDOB 2JB6A 3EFFA 3HC3L 4K2UL 2ICWJ 1OGAD 4OUUB 2Z92B 2O5YL 4R7DB 4GMTL 4PJ8A 1FZKB 2BNQA 3PP3K 5EIIB 4DZ8B 5MP6L 1MWAL 3IJSA 1QHPA 1KV3A 2AJVH 2O5ZL 4BUGA 1WIOA 3CFJA 4X5WA 4M7JH 2X4RB 5J6HB 4LBEB 3V8OA 4ZOEA 4K9EL 5DUBA 5JXEC 5SWZB 4TRPH 2YRPA 3BGFC 3JWOC 3MROB 4DAGL 4L4VB 3O3EB 2VISA 3D0LA 3FRUA 3MGTA 4B50A 3S36L 2SEBB 2APXA 1YMHB 3F5WB 2VXVL 3PWNA 1PEWA 4I0PC 1LE9A 5SV3A 5CEYA 1YEKL 3ARFD 3ZKQD 2DN7A 3MSPA 4J2XA 4Q6IB 2DJSA 3DXAE 4HT1H 4N0FB 2YK1L 3IJYA 5EN2A 5KVDL 4YDJA 2DIJA 4XPFL 5GQBA 5DUPL 2A74A 3E8UL 1OAYL 2DQIL 3BDBA 4WI4A 2AXFA 3MLSL 4FQJL 1H3PL 4PJHB 4YBHA 3TN0D 4PRNB 5GRVK 1GYAA 1NQBA 4OM1L 3VD4A 4PJIE 1ZKAA 3HPJB 1NMBL 2DQUL 1FFPB 3NCYS 4J23A 5DI8B 2EC9U 4HPOH 3BUYB 3CFBA 5EA0L 1B6DA 4HIXL 4ZNCD 1MHEB 2EDFA 1FFRA 5KBNC 3HC4H 1LP9A 1T89A 1ZS8B 1G7PA 4L4TA 3TBTA 1IGTA 3P0YL 3SO3B 3VH8B 4LOUD 5HGHB 3REWA 5D2NB 5B3JF 2K3TA 4PRPD 3U9PL 1FFNA 1GGBH 5FOBB 3LS5H 1F11B 5DQDL 4ZOAA 5E8OB 2IBZY 2HKFL 1P4BL 2HMID 3VRJB 3EYVB 5E8EA 3OKDB 3ELAT 2R8SH 2X70A 2ESVA 3KWWB 4DW2H 5HGBB 1V3JA 1KJ2B 4F7MB 3PWLB 2ADFH 4PB9H 2V9RA 2WBJA 2QJDA 1DQLL 2ZUQB 4GQ9L 4WY7L 3P4NB 2CR6A 4ODWA 5GGRY 4OQTH 4NT6B 4WTWA 4GBXD 4I5BA 3G08A 2PW1A 1NFDA 1QRNB 5CZVH 3E6HA 4JFDA 4HG4K 3KPMA 3AB0C 4HWNA 5B8CC 2OR8A 1AJ7H 2XKUA 3DYPA 4DZBB 5HHXH 1MVUA 4LIQH 1SMAA 1XR8A 1AQKH 5F3HA 1MI5B 4OF8A 3RJQB 3D39B 5FB8A 1G9NL 3DPBA 4PG2A 4HK0A 3MLXH 5GS2D 1KOAA 3V79C 2VLRB 4X6CE 3H7BA 3MJGX 3EYUL 3SKJH 1FH5H 2NCMA 1SJXA 4MAYA 4WWKD 4XTRC 4RFNC 3U7YH 2QQKL 2GTZA 4MMZC 4PREA 1IAOA 4TUKH 4HQQL 4YR6A 3NH7L 5A2KH 3IDXL 3V8CA 2R1WB 3HG1B 2Q8AL 3IXAB 1IL1A 2E7LC 1LWRA 4U6XB 3HZMA 5GGSY 5J12B 4FABL 3D3VB 5AWNL 5I1GL 4K3DL 1W72H 2X4QA 1A1OA 1NGQH 1C16B 3SQOH 1QA9A 4HUXB 5I30L 1BD2E 1U2CA 1EJ6A 2D0HA 3K4ZA 4QTHB 1Y18A 3FB8B 2JIXA 2X09A 4UDTB 4PTTB 3LKSA 4KVCH 4KGLA 3RTQA 2AS5M 2WV3A 4C56B 1W0WA 2MQ3A 1EHLL 3TBSB 4O02H 5E8PB 2OZ4A 5DDHB 1B3JA 5T3ZE 1G7JA 1EV2E 2PR4H 1YEFH 3OJMB 1T0PB 1A4JB 4WEBL 5EU4A 5AZEL 3CZFA 1EH9A 2FLRT 4JRYA 1N5AB 1VA9A 4I3RL 1PW3A 1RUKL 2VL5A 1OL0A 1IGCL 1A2YB 5TPWH 4BQ6A 4D2NA 3LHPL 4M1CD 3X3GL 3DIFB 2Y23A 3BT2H 2EDWA 2R2HB 5EO0A 1FL5A 3BD5A 4B53A 3C6LD 2R1XA 1T1XA 1X4ZA 1IZKA 1ZANH 2X4NB 5DWUH 1P6FA 1JPSL 1HH6B 1S7TB 5HY9B 1UM5L 4P23A 2XQBL 2IAMA 2CO7B 2FEDD 4N8VB 4NKQB 5ERWB 2EDHA 3EYSH 5EU3A 4XRCA 1QBML 4QRRE 1R3IL 4Z7OE 4BK5A 1L7TH 3MFGB 5E2UH 1OP3K 1J11A 2ICWA 3TH4T 5JA8B 2ZCLH 4P2OB 2XTJC 3VA6A 1MCPH 3F7RA 4N0YL 1QD0A 3MV7A 43CAB 1LO4L 3KHOA 4AIZA 1EEQA 1PQZA 4JHWL 1TDQA 1R5VA 4XBEL 1OP5H 2DJ4A 4G5ZH 4PJEF 5KOMC 2IH3B 1Q9WB 4E5XA 4KXZI 4JDTH 4JG0L 3JWNC 4PJEB 5IR1B 3NIFE 4CMHC 4YIQB 3U0PA 1XF5A 3L5WB 5F7DB 2BSSA 3P73A 4KV5E 4NQDD 3L5XL 5ID0A 3DV6B 3K8LA 3V5DA 1FNGA 3CD4A 1OP9A 4NRZA 2DMCA 3VFPA 1NANI 4YDIH 4ACPA 3DX6B 1HNGA 1U8OB 3MRQA 1SJEB 3BZFB 1VFAA 1JIBA 1CVSC 1T6VN 1A7BA 4LCCB 1UWXH 1IBGH 3MRJA 4GSDH 3NAAL 4L8DA 3WFHA 3WIIH 4NQSB 3QQ3B 2P5WB 4JPKL 1I75A 5C0CB 1H3WM 4NN5C 1T1WA 4JY6B 5GRYA 4U2YA 1HHJB 3UC0L 5ITFA 3FFCA 4ZS6C 2GFBB 1T5XA 1KB5H 4LLMA 5FGBC 2WQ8A 4PJ9D 1LO3H 1SJHA 5TDPA 3QJHA 2Y72A 1SEQL 4LMQE 1Q9OA 2OXGA 4OUUA 5J3HC 1GHFH 5TDNA 4R7DA 5FCUH 3E3QC 1Q72H 5DD5H 4AJ0A 2ZOKA 5C0FB 4JR9H 4LPXA 4KI1A 3C9NB 4DZ8A 4U4BA 1RU9H 2APBA 3O6FC 4G9FD 3OJDB 1FZJB 1OPGH 5DSCA 4PY8I 4DN3H 5A2JH 1H5BA 3RGVD 2N1KA 3ARBC 1J10A 2X4RA 3QUZD 5J6HA 4LBEA 1DBKH 3TCLB 1T66C 1Q0XH 3OG4B 1NAKH 4L4VA 3O3EA 5JW4R 1K85A 4YK4B 4OD2B 4J4PC 2IPUK 5J06A 1EO8H 2SEBA 1YMHA 5DD6B 4JPVH 3NZHH 3UBXB 2W38A 2F54E 5F9WB 3BRFA 4Q6IA 3FQUA 5DMIH 4JY4B 3BN9D 3M45A 3QIWC 5BXFB 4K3JH 4MS8C 3S35X 3UTPD 1W72B 3PQYA 5IM7B 4FXGB 2XKSA 4XVJH 1R3KB 1CE6A 4WUUD 3RVVC 4FFWD 2YMXL 3NIGE 4IRSB 2BHUA 1NCWL 1RUMH 4C58B 3HPJA 2EDBA 3PP4H 1I1YB 1FFPA 4YHMH 1AO7B 1PX3A 5ABDE 5F9OH 1MHEA 3KPSB 1P1ZA 5D71L 1ZS8A 3FN9A 5HGHA 3VH8A 3SJVB 5D2NA 3TEUA 5E2WL 5FOBA 2X5PA 2P43B 3EW3B 1F11A 5E8OA 3X14A 2WLZA 4M7ZC 3AUVA 4XPBH 3WL9A 2QADB 3EYVA 3LN9A 3VRJA 3OKDA 4K71C 3V6ZB 4POYA 2NLJA 4GKNB 2NY4C 5D7LD 3U4AA 5HGBA 3MLZH 3FQNA 4X6DE 1KJ2A 1XGRB 3UYRH 4F7MA 4HC1A 4IDJL 4XBPB 2VZTA 2OR9H 1TTFA 2ZNXA 4KFZC 3RVUD 4RAHA 4X7TB 4YHKH 1QRNA 5INCA 2X1WL 2AJYH 4AL8L 1UCBH 2Y06H 4IOSD 2P45B 3I02B 2YPLE 4UOW1 4PLNC 2XPGA 4L3EE 2W59A 4UT7L 5GS2H 3NCYP 4PR5B 1RK1B 2BZDA 4FZEH 5IEHB 1WITA 4D9LL 5HYSG 1MI5A 4K8RL 2IPUG 3QZWB 3LD8C 1AC0A 4M48L 2RCSL 3KPLB 3DNKA 1BLNA 3QISA 3L5HA 1A6WH 3RFZC 5KZCB 4P48A 2CIIB 3WFEH 4BFIB 43C9B 2YN5A 5CJOH 1MCCA 3IFOB 4WHYG 4OZGF 1XIWB 5DFVD 4UIKH 2R1WA 3HG1A 4EUPA 3IXAA 2DQDH 2DRUA 2EXWD 2P47B 3UTOA 4HLZG 4O00A 3WS6A 4U6XA 2QEJA 1MSPA 4Y5XC 1GGTA 1AGBA 5FV1L 5J1AB 1N0XH 4NSKB 4PJ7F 3ARWA 3GFUA 3VWJB 2EDKA 5GSVB 4XP6H 2AJXH 1WSST 1C16A 1CXLA 4PJ7B 1Z3GH 2ZOLB 4YDKL 4QTHA 2FBJL 3FB8A 3BDYL 4PTTA 1CDIA 2DYPB 4C56A 4I1NB 1NBQA 4WGWB 4DGIL 5C09A 4YHIA 3TBSA 1EHAA 1OGAB 3IDNA 5DUMH 4XHJC 5E8PA 4LDEB 2M26A 4HW6A 1V3MA 1E4KA 4P46A 1IM9A 1IQDB 1K9TA 1KB5B 1A4JA 1FLTX 3DVNA 4Y4HD 2LFGA 3KYNB 2NR6D 4I8DA 1Q0YL 1QR4A 3S37H 3CFKB 4DJMA 3INUH 5F1IA 2V5RA 1IGJA 4NC1C 25C8H 1AP2A 4S2SA 3GBMH 3RU8H 3S4SG 3VD9A 5D2LB 4YEEA 2GTWA 3UTTE 3EOTL 5KVFH 3DIFA 2GAZA 5T3XD 1OAUL 5C0IA 5FYKD 3VRIB 4HKBB 5T5FL 3T0XA 5KANG 5D7IE 3NFNB 1XIWC 1G9EA 2X4NA 4KI5E 5J9PA 4XWOC 4HS6B 3NMEA 5DGRA 4B7LA 1MHCA 1D5IH 1S7TA 5HY9A 2KBGA 3ARFB 3V4VH 5IF0B 3UJIL 4LCUA 2KZ1B 2HT4C 2XG5A 5FOJA 1JNJA 2J12B 3QUXD 4N8VA 3VXNB 1MCWW 2HT2C 2ID5A 1XGPB 1NGYB 1S3KH 1ZOXA 4L8SA 1D3CA 1RMFH 2FIKB 5J8OA 4EVNB 1KNOA 4P2OA 1JFQH 1XCQA 3TN0B 4LKCB 3LEXB 4L9LC 5CHNB 1EZVX 1ZHBB 3HZYB 1EGJH 4OJFL 4PV8B 4KHXL 1DQTA 3PGDA 3NA9L 4PJFF 2IH3A 1Q9WA 5E2VL 1QHOA 4X6EB 5TQ0H 4GKSA 3T2PA 4XXCC 5IR1A 1T22A 1P2CB 5KS9A 3L5WA 4LFHG 3ARED 4F58L 5F7DA 1S7UA 3ULUE 4PRPB 2DQCL 3DV6A 1A0QL 3O6ML 3O6LL 4OFKA 2CGRH 3NIDE 4MNGB 5F1SA 4NM8H 2XICA 4ZDHB 4JE4B 3QJFB 4LLAA 3MRRB 2NY1D 3DX6A 5MEQA 1U8OA 4DKFL 3U4BH 4ONOA 3BZFA 4LKXB 4NQED 4FQHA 1INDL 4ZG1A 5DHVH 2J5LC 4X6BA 3ARFC 2HLFC 4LCCA 1CVRA 1NEZG 3ALPA 1EHNA 2VYRE 4KRLB 1XAUA 2Y36L 4M61B 5FUOL 5LWYL 1IJ9A 3N9GL 3QQ3A 5HD8D 5JIHA 4GBXB 1IE5A 3O2WH 4XNQB 1HYRC 1J0YA 3SE8L 4ODTL 1HHJA 3MV9B 3MLVH 1J0IA 2GFBA 2W60B 4LGPB 8FABB 1UWEL 5BS0D 5CP7B 4M1GH 4J6RH 3SY0B 4GXUN 1CICB 3D2UA 5KVMC 3U7AA 2RGSA 4ELKB 2DBLH 4TTGA 1FGNH 2VDNH 4YHNB 1NJ9B 4M43H 1OD7A 4LOUC 5DEGA 2VR5A 5JR1H 4GLRI 1KTLB 4G6KL 3O8XA 2GK0B 4NBZB 4WWKB 4APQC 5F9DC 3TCLA 1CXKA 2MHAB 3JWDH 1ZLSH 1I1FB 4MNQA 4V1DD 1F4WL 5DRNB 2OJZL 2DM7A 3D69A 3A6CL 4NRYA 5DD3H 1CI5A 3C5ZC 3DX7B 4YO0B 2FEEI 3BMWA 3UBXA 4D8PB 1V3LA 1NGXB 2AK4E 2BDNH 4HIJB 4Y16C 5CJ5A 1UKSA 4OIIL 3JWOL 4U1IB 4JY4A 1KLGB 1CGSL 1T21B 2Z31D 4GKOA 5BXFA 5E8NB 3IAGC 1IC7H 2FO4B 2GJ6D 1BHGA 1RIVH 2JELH 3KJ4C 3BPNB 1NCAL 4M03A 2Y7QB 4ZUTB 1HOCB 1T20B 3MTRA 3VXOA 1R3KA 1TJHL 1XGYH 4IRSA 1RURH 1INEL 3LQAL 5F7EL 2KL6A 5DMYA 1DBBH 2PYFB 1I1YA 2NX5A 3QHZH 5GRJH 4NCDA 5IBUB 2VAJA 1B4JL 2N56A 3KPSA 1M71B 2D3VA 4Y4KD 4JHBA 3HUJE 3SJVA 1J1XL 3LN5B 3O3UN 5J11C 5KTEH 1IAIH 5JOEA 2I5YL 1EXUA 4L8BB 3C6LB 4MMXC 3V6ZA 1XR9B 4GKNA 1I7UA 3L5IA 4RBPK 3FO9B 4WFFD 5CBAB 1XGRA 2NY6C 2EIEA 4U7SA 2LQRA 3WIFA 4XBPA 1TVBB 4WW2F 1YPZA 5IHZB 3DXAD 2VWEC 4WTXA 2QQLL 5MEOB 4NKIH 3MLWH 3P0VH 1QFWI 4X7TA 1DP0A 4QXGL 3HZKB 2EYSA 1N26A 3ZYJA 3AM8C 5IW6B 2D9QB 2AQ2A 1T5WA 4PJ5A 2BY1A 3HE7D 2EICA 1DL7H 2CJUH 5IEHA 4FXLA 3JUZA 1F8TL 3JUYA 5IVXA 5D7JC 4JO1H 5EOCJ 1QFOA 5JUEL 1X3DA 4NQDB 4ODSH 1KIRB 3QZWA 4NGHL 4QXWA 5ITBH 5CSZB 4HCRA 3PXJA 4MSWB 3QO1B 2CIIA 4XNUH 4NQCE 4M1CC 3ETBF 3KLAB 4BFIA 43C9A 5GGRB 5JZ7D 1BJMA 2R0KL 3O2DH 2BNRE 2RIKA 1A6VH 3ZZ1A 2LE9A 1GGCH 1KACB 1L6ZA 1MCRA 4AEHH 3BUTA 1U3HD 5CSBA 5J89A 3T1FB 1A1NB 1MQKH 3DRQB 2FH8A 4D94A 2ZSVB 4PJCB 1MFEH 3RGHA 2FEEL 1AGFA 2DTSA 3PL6D 1DEEB 2X4OB 3LKNB 5DHVB 4X5XA 4WW2C 4U1GB 5DMJB 2ZUVA 3CK0L 1YEJL 1S7QB 2DYPA 4IRJA 4PJ9B 4OCWH 5C07A 1BBDH 1MIML 4ZXBC 1OGAA 4PD4J 5BJTB 3CCHA 3IF1A 4CAGA 3L7FA 2A77H 3TBYA 4HSQA 2YD6A 2UZXB 3DLQR 1NGPH 2HRPH 4G9FB 1GIGL 3GSOA 1EUTA 3KYNA 1Y6KR 1WFUA 3RGVB 5T3XH 3CFKA 3FHQA 5FYKH 3FAWA 4R97B 1X5FA 1MEXL 1UKQA 3OAUL 5I19H 3BQUA 1UCTA 5IT2H 1EEYB 2DWEB 5D2LA 5AZ2L 4OLYL 3QH3B 1S9VA 3HAEH 4OAWA 5E94B 1DQJB 4LP4A 1WF5A 4HKBA 1SYVA 3MA9L 5BQ7A 3NFNA 1J0KA 4OGXH 4HS6A 1P4IH 2QKIB 5T33L 5IF0A 5K93A 5D8JL 1H8OA 3VXNA 1P6AB 3GHEH 3BKML 1XGPA 4M7LH 1NGYA 3LS4H 2EZ0D 4JFPB 4N5ED 3UTQB 3GJFH 4OZHF 3JV5A 4QRTA 3MBEC 4OTXL 3O9WA 3BKJH 3KS0H 4R2GD 1QFWL 4CVXB 4LKCA 4R3SB 3ULVL 1AGEB 3X12B 3U1SH 5HDBE 4PV8A 3GSNH 3SKOB 4JPIB 2FO1A 1CCZA 4LSSL 5T3ZD 4OM0L 3C8KB 3OG6B 5D1QC 2MJWA 2WW8A 3V6OA 4C4KT 2NY7H 1JF6A 4ZFOB 4LVNB 3QUZC 3ZTJH 4JO4H 2NNAB 3ARPA 1P7KB 3NPSC 5FV2A 1KEGH 1UC6A 3MRRA 5D7LB 5F7HA 4HIHA 1CXHA 4F7EA 4LKXA 5CSGA 3ZDYF 3A67H 4D3CH 1ZLWK 4D9RE 2AJVL 4M61A 1H0DA 3WLBA 1F42A 4UINH 4GBXA 1D7FA 1AXSB 4HLJA 5DR5H 4QRRD 4AT6A 3MLYH 2WZPD 1FPTH 4HS3A 4TRPL 1RZGB 5L7XH 5KSAC 3MV9A 1U0QA 4BH8B 5IGXH 4FFWC 3R06B 3VFTB 8FABA 1Z9OA 4MDJA 1JGDB 4JZJB 5D1XD 1CICA 5TGBB 1CE1H 5JHLL 4MGXA 4W4OC 3VXRD 4ELKA 3VGEA 4HT1L 4YHNA 3TC9A 3CUPB 1NJ9A 5DJCB 3SDDA 4LVNC 1NPUA 4OF6A 4Y8DC 5AG9A 4XCFH 1O7SA 5C7XH 4WWID 2GSGB 1IT9H 3D9AH 2C1OA 2MHAA 1BF8A 2HTKC 1MCWM 4M4RA 2QL1A 4PGJA 3TBVB 2EYRB 5JHDE 1LE5B 5HI5C 4XWGH 3K2MC 4YO0A 3OGOE 4D8PA 5GISH 1NGXA 2R0LH 4HIJA 1GAFH 4HPOL 2NY0C 4X8JA 3PHSA 4HX1B 2HFFA 5I71B 1KLGA 3QIUA 5JW4N 4KQ4H 3RVUC 1YEGH 5GGVH 1LEKA 1P7HL 4MZ3A 4WENB 4J3VA 1I9IH 4WGVB 3L3HA 5ADPH 2Y7QA 4ZUTA 4PRIB 1GGBL 3VE0A 1HOCA 3QI9A 3AS3A 4TULH 1RZJH 3LS5L 1XF2B 3L3JA 3QPXL 1ZGLB 1NL0H 3RY6A 3GMPA 4NNXA 4YQXH 3DSFH 4ZQKA 2R8SL 4F15C 4FTVD 2A83B 1B6UA 1A9EB 2HJFB 4HWZA 1IKNA 4XP5H 4DW2L 2PYFA 1OAKH 2R4RH 1W0VB 4Y4HB 1UM6H 1KXTB 3T4AA 4OCNC 2ADFL 1EIBA 5INDA 2DLHA 4PB9L 7CGTA 2NY3D 4MXQC 4PD4K 4HJGB 3MR9B 2HTLD 2NQCA 3UPAA 4OZFH 4QT5B 5EBGA 2W1NA 2C4XA 3ZTNL 3K1DA 3H3PL 1CS6A 2W92A 1KCUH 4OQTL 3LN5A 5MI0C 2VN7A 1VGEH 5CZVL 4G8FB 1CZ8H 2JE8A 4IIQC 3FHAA 1FNSH 2BFVH 4JFEB 1AJ7L 5HHXL 1XR9A 2EXWC 1L0XA 2OS7A 3TESA 5I1DB 3HAEB 4GQPH 4LIQL 2O5XH 1AQKL 3VCLA 3QXAB 1MJ7H 3VFOB 5IKCB 3BH8B 3QUXB 2YUZA 1CD0A 2Q76A 2UYLB 5I71C 3MLXL 4QGYA 3QDJD 4S1DD 3RWHA 4HDIA 1P7QA 3ZKXC 1Z5LA 3SKJL 1KJVA 4O2FB 1FH5L 1QPXA 2A6KB 3HZKA 2JF1A 3U7YL 1YN7B 3SDXE 1D6EB 4TUKL 2BNUA 4Z0XB 2M1KA 4Y1AE 1OHQA 1FLRH 5LGHH 3TT3H 1B2WH 5F3BA 4MAUH 5C0GA 2J8HA 3T2NH 1PZ5A 3GSUB 3ZO0A 2NR6C 3MRIB 1I9JH 5HHPB 3WIHL 3OL2A 1W72L 2AGJH 2Y4SA 5L0QC 2ADJB 4E42A 5CSZA 1NGQL 2P8MA 1A8JH 3SQOL 2J88H 2H2PC 5IWLA 1FFOB 3T0EE 4MSWA 5EO9A 3T08A 4URTB 1HHHB 4KVCL 4BQCA 2W0KA 5GGRA 2E27H 4RQQB 4O02L 1MJUH 2VRAA 1U3YA 3QAZB 4NQEB 1P5UA 4C59B 1ITBB 4PBVC 1JHTB 3T1FA 1A1NA 1F3JA 3DRQA 2PR4L 1TNNA 1YEFL 3S98A 4PJCA 1NUNB 4TTDD 3QUXC 4HF5H 3WJLA 1WT5A 3NZ8B 2X4OA 4OIAA 3LKNA 2HFGH 1FYHB 1OLLA 2ADGB 5TPWL 3SDCB 4K7FB 3IU3B 4QY8B 3WSQH 3RIAF 1FJ1B 4PJ9A 3ZE1F 4GUPB 3HNTH 1I85C 4MB5A 3BT2L 3NCEB 2YPLD 1TZGL 4MJ2A 5AEAA 4RRPA 5BJTA 1WZ1H 4L3ED 1DLHB 1S9XA 3RNQA 5IW1B 1ZANL 5DWUL 4LSUH 3IFNH 1T7VA 3HE6C 4GRLD 1JE6A 2WAHA 1CGTA 4O2EB 5I8CB 2BNQE 3PIQB 3AREC 1WZMA 4KK5D 2AV1A 3RGVA 1CFVH 1G1CA 3I3EA 4O9HH 5CZXD 5GGSA 2BVPB 3GZKA 3EYSL 2DWDB 4Y5VB 1EEYA 3QH3A 5E2UL 1RI8A 1J5OH 1MHHB 3NCMA 4J7RA 2ZCLL 4V1DB 1DQJA 1MCPL 2V7HA 2QSTA 5D5ME 3N1QC 4CU6A 2NY1C 2DLGA 2YSSB 3N06B 5LKNA 1RK0B 1UZ6F 3V4UH 3UTSD 3IDYB 5HYEA 5M7QA 4G5ZL 4PRHE 4X4MA 1KPVA 2QKIA 1IVLA 3VGAC 5E5UB 4JDTL 2NW2A 3CC5A 3CH1B 3LPGA 3C09B 5HD8C 1HQRB 3GSRA 1XF4B 1AXIB 2OR7A 5HYQB 1KF9B 4N0RA 5IFJB 2X41A 4TNWK 4YBLC 5GGQH 5T3ZH 2Y5TB 4ZUSB 5DA4A 4F37K 1TZHB 4J8RA 1R5IB 3GRWH 1AGEA 4YDIL 1T3FA 3NN8B 5IG7B 3VFRA 5TDOA 3SKOA 1HI6B 3TZVA 3SEPA 1F2QA 1JYXA 1FP5A 3C8KA 2ED9A 3DOSA 4QF1B 4HWBH 1IBGL 5FK9B 3ZKMC 4GSDL 4Y4KB 1U8PA 4GAYB 5GGTA 5TE4H 2R9HD 1OGTA 4UQ3B 4JJ5B 1HHGA 4JZOA 1LP9E 4XVUD 2NNAA 1MFAL 4NZTH 1TIUA 2FLBT 4OZFB 2IALB 4F57H 1KB5L 4J3OC 1C5DB 1ZXQA 4PTUA 1LO3L 5DK2B 4P5KA 1GZQB 1MCBA 4M00A 5JPNB 4JVPA 1GHFL 5FCUL 5E2TL 1Q72L 1VEMA 5DD5L 3T3ME 4JR9L 4P5TB 1G6RH 3WDIA 4H25B 2FRGP 1RU9L 1EEZA 3W81A 5GJTH 2Z31C 3MA7B 3IDIB 4DKDC 1OPGL 4DN3L 4YDLB 1LILA 1AXSA 3PUCA 4X0KB 1NCDH 2D9CA 2X4UA 5AD0B 1RZGA 4MD0B 1DBKL 1NFDE 3G5VB 4WJ5A 2VTFA 1NAKL 4JFDE 3HE7B 3GMLB 1B9ZA 1BX2B 1EO8L 3O4LD 3CVHH 4FFYH 4JZJA 4JPVL 3NZHL 4M5ZH 1RZJC 2JJUA 3U48A 1S7XB 1C7TA 4NJ9H 1EUUA 3THMH 3K0WA 1HNFA 2EH7H 4X98B 5DMIL 4PYGA 3SE9H 3CUPA 4K3JL 2YA0A 2WP3T 1U8KB 4Z95H 3ULUD 1CT8B 1YNLH 1J1PH 1JI1A 4XVJL 1WC7A 5SX5K 2EYRA 4ZSOB 4WO4D 2LV4A 1U3HB 3UDWC 1LE5A 1RUML 5CBEA 3CFDB 3PP4L 1CDBA 1MIEH 1RZKH 3NCJH 4U1MB 2R2EB 5DZOA 1X5ZA 4YHML 3OAYH 3PL6B 4HX1A 5F9OL 2VLMD 3BWAA 2FB4H 3BEVB 3EBAA 3EGSB 4KRPD 5FXCH 5C8JB 3GUTA 3NFSL 2FX9H 2KKQA 4PRIA 4EXKA 1I1CA 2BSTB 5L2KD 2V5YA 2F15A 5EFIA 1AE6H 5I6XB 1E0OB 1LMKA 2FSEB 3HNSH 4OCXH 3HE7C 2B4CH 4XPBL 3W0WD 5C0NC 1ZGLA 4MJ5B 4OV6F 3G04B 2HVJA 3ARQA 1A9EA 2HJFA 1VESA 3MLZL 3EO0A 4Y4HA 5E99L 2CXKA 3UYRL 5KVEH 2W0LA 4X6CF 1VKXB 4HJGA 3MR9A 4QT5A 2UUDH 2EE2A 2OR9L 1S8DB 4X6CB 1XZ0A 2D7QA 4JRYE 1HCFX 4QHUA 4YHKL 1I8IA 3FONB 1OARH 3B8YA 1I8MB 3G6AB 3HB3C 4G8FA 2A9MH 1NUGA 4KZDL 2AJYL 4BFGA 4TSBL 1KIPB 1UCBL 2Y06L 3GMNB 4I0CC 3KPRA 4QRSB 5E1HB 4JFEA 3R4DA 4GAJH 2CKNA 5FM5M 5I1DA 2FATH 4E41A 5BVPH 2AJUL 4FRWA 4FZEL 1QBLH 1MCIA 3QXAA 4YUEH 3EDKA 5SWSA 3VFOA 1QLFB 2P42B 4QHLB 3BH8A 3ISWA 1DN0A 3TYFA 3PABA 1D5BB 5H37H 1A6WL 1CGWA 1PFCA 2NTFB 4KKBC 4NQVA 4O2FA 3H7LA 4Z7WB 3B2UD 4FOMA 1W8NA 3EYFA 1FNLA 4UB0H 3WFEL 4R2GB 4JFHE 4P5MB 6CGTA 4OLUH 5CJOL 3VI4E 3GIZL 4UIKL 5ISZE 4KTYA 2DQDL 3S6CA 3T8XB 3GSUA 3MRIA 5IHUL 1L6XA 2D7OA 1N0XL 4LL9A 4XP6L 4PS4H 3WDJA 5C6TH 2EIZB 2AJXL 2W9DH 4QRPA 1Z3GL 1CXEA 4K7PL 1FCCA 1FFOA 1M05B 4R0LC 4UTAL 5J13B 4F33B 1JHKH 5E6YA 3OHXB 4F7CA 2UWEB 3QQ9D 4LCYA 1DLFH 1BAFH 4RQQA 1AKJD 2OSLB 5B8CA 4GJTB 4O4YL 4KUCF 3ZMRA 1NMAH 3F65A 3GHBH 3CMOH 4M5YH 3QWOB 2E9IA 1LK3H 4ZUUA 1FG2B 3PWPE 4Z7OF 4L9DA 3S37L 3QRGH 4NP4H 2CDGB 3NZ8A 1NC2D 3INUL 3MNVA 1A3RL 1S9YB 2EZ0C 3M1BB 1HK6A 1G6RB 3FT3A 2ADGA 2MWCA 4YZFE 3SDCA 5BO1H 3ILQD 4K7FA 4MA3A 4QY8A 2R2CA 3QEQB 3RU8L 5I1HH 1CGUA 4GKZB 5KVFL 4R2GC 1FJ1A 4NYLA 2VZVA 4WW1B 3MNWA 2DJUA 1DLHA 3U0TA 3OB0H 5D1XB 1JZ8A 2R0ZH 3TCXA 4JRXB 4LQFH 1D5IL 2ADIB 2BVEA 3V4VL 4O2EA 3VXRB 5I8CA 2CUIA 4KV5F 3WNNA 3PIQA 2DKSA 3ARGB 4LHUD 1U8QA 3CVHB 1GC1H 3SGDI 2BVPA 5C0EB 3RWGB 3TO2B 1QSFD 3BPLC 3MGOB 5J13C 1S3KL 4Y5VA 4YHLH 1RMFL 4NQCD 3BW9A 5SWZE 1QFWM 1JFQL 5IBTH 1N2RB 3O11A 5DHYA 3ULSB 2A38A 4L4VE 4BYHA 2YSSA 4ZPTB 1ZVSB 3BESR 5TE6H 1EGJL 2HJLB 1DQQB 2B39A 3RBGA 4FQ2H 3MRKB 4JJHA 2E7CA 5TQ0L 4KJWC 1BECA 1AIFA 1XF4A 5IMKB 4OQ1A 1IAII 2GJZB 3WBDA 2CKBH 5FO8A 5IFJA 4KRNA 5CJXC 2CGRL 5BCAA 1K8DB 2Y5TA 4ZUSA 3OKKB 2DOCA 1WK0A 1DBAH 4NM8L 1U93B 4FTVB 5IG7A 5D6DC 4PJHE 3MRDB 3U4BL 2P49B 1KCLA 2YD8A 1QFHA 3FQTB 1YDPA 4EJ1C 2DI8A 3RNKB 4JZNA 2NY3B 4QF1A 3IGAB 4I77L 3BKCH 1J05B 1I1RA 1F4XH 3A6BH 4Y4KA 3GEWB 2HN7B 1KPUA 3AROA 2PW2B 4UQ3A 2NMSA 4JJ5A 2HFEB 3B43A 3KVQA 3O2WL 4O5LH 3V7AE 4RX4D 3B9VA 5D2NE 1H15B 5E1AB 2IALA 3TIEA 2EH8H 3D85D 2VAAA 3C60C 3RHWF 3KJ6H 5DK2A 5KOVC 5I9QC 3IDGB 1GZQA 1BWMA 5JPNA 4Z18A 4M1GL 1A6UH 1DVFD 4J6RL 1MQ8A 4P5TA 3W9DB 4FQXA 2BOCB 3TA3C 2LTQC 3DBXB 1AXTL 4OLWH 2JJSC 1ES0B 2DBLL 3IDIA 3QDJB 1FGNL 2VDNL 1OSPH 4RAVB 4M43L 2MTPA 5JR1L 4X0KA 2X4TB 2VZUA 3LRSB 3L95B 1EK3A 4MD0A 4M6OH 2Q87A 1QRNE 3NIGF 5H35A 1ZLSL 4EIGB 4XAKE 5K9OA 3ECBA 5DD3L 2YUXA 4XNXH 3RZCA 3ULUH 3OKLB 2DM4A 1NAMH 2PTUA 1ADQA 1S7XA 2BDNL 3BYTA 2NXZB 4IS6B 2B4CC 4NN6C 1MI5E 2DL2A 4X98A 1J0ZA 3D39E 5CLTA 1IC7L 2J7LA 3FO0L 3OZ9L 1RIVL 2VLRE 3LN4A 1CT8A 2GSIB 4MJ4A 4MD5B 1REIA 5I76A 5C0BA 4ZSOA 1XGYL 4PB0H 1RURL 4I18C 3H9YA 1JN6B 4WV1B 1A5FL 2FDBP 4ALAH 4OFPA 3HG1E 1DBBL 1QKZL 4ZFOL 1NDMB 5E6IC 3HMWH 3QHZL 4U1MA 5GRJL 2R2EA 2XT1B 3H42H 4JG1H 3QXVA 4RGOH 3D3VE 3PL6A 5ESVB 3O6FA 5HVHC 3ULVE 3B9KC 5GRZA 3F12A 4D9RD 3O81A 4S1DC 3BEVA 5C8JA 1DSFH 3VXUD 3ARBA 1TETH 2EKJA 1BVZA 4DK3A 1H8SA 1HYSD 5HDQH 3CU1A 5KTEL 2BSTA 1IAIL 2YPLB 1MFBH 3GSXB 4C56E 1FL3B 4MJ5A 4HUWB 4EI6A 1CF8H 3G04A 1KPRB 4DN4H 1BVLB 5HHNB 1FZMB 1X6LA 4GRLB 5DJYB 1DBMH 1MY7A 1VKXA 5JORB 2X2YA 4HXBH 4DKEL 3UO1H 4X4YA 3QIWA 5LBSH 3MLWL 5IEKB 3P0VL 1C12A 4YHZH 4XVTL 2FHCA 5HYJD 1I8MA 3I6KB 3G6AA 3BRDA 2H6PB 3TNNB 3V7MA 1KIPA 4G9DB 3P4OB 2OL3A 1BGXH 1CXFA 3MJ9H 3LPWA 3HRPA 5IMLB 3DUUB 1MCEA 1IAMA 3UTSB 3IFPA 5I66B 2ZCKH 5JHDD 1DL7L 5I8OL 5L9DH 4XCEB 2CJUL 1UB6A 4JKMA 3VA2C 3WUWG 3QA3B 4KKNA 4JO1L 4IMKA 2QQNL 5AYUH 4Y4FD 1D5BA 5ITBL 1FQ9C 1QQDB 4WI9A 5KG9B 3ES6A 4XNUL 5JPMB 1IC4H 4JM4L 4UU9B 1JTTA 4P99A 3L5JA 3FQRB 1QP1A 2CKBB 3O2DL 3CGTA 1I7ZB 1U41A 1A6VL 3KPQA 1GGCL 4AEHL 1MELA 3T8XA 4M1DH 1MQKL 1P4LA 1F3DH 3F7YA 1UKTA 4YBQD 1MFEL 3QB7C 4FQIH 4PJEE 4BSVA 4GOSA 3SCMD 5KS9E 4GH7B 1U8LA 1TTGA 1M05A 3X11B 1RUQH 4F33A 4QOKD 5D93C 1J9CT 3ZDZE 4X9IA 5D7IF 2UWEA 4KDTC 3DETD 2NTSP 4OCWL 3B9DA 1BBDL 4KI5F 2GCYB 2OSLA 1LK2A 1WBZB 1A4KA 1KN4H 1QR1B 2ICEB 3GSWB 5DJ6A 4OF3A 3N1FC 1S9WB 1VGKB 2A77L 1EFXA 4Y5YC 4YAQB 4J3XA 3QWOA 1NGPL 2HRPL 4FFVD 2E7HA 4KMLB 5IV2B 1FG2A 5FA4B 3DMMD 4AY0A 2CDGA 5C6WH 4ZUVB 5FYKL 1G7MB 1S9YA 3M1BA 3RWIB 1FSKC 2P5WE 5C0CE 2GEEA 5I19L 2RHEA 3QEQA 5IT2L 3RUGA 2OMNA 1S78D 4GKZA 4ISVB 4WUKH 3GI8H 3FJTA 5ICYB 5AUMB 4Y1AD 3O4LB 1MH5A 4OGXL 5IJKA 1T0NB 3BFOA 4JRXA 4MCZB 3HRZB 3WKMH 4H1LA 2XWJB 1P4IL 4RIRA 4X4XA 2OM5A 3VXRA 2IBGA 1K2DB 3ULUF 3ARGA 3V95A 1U95B 2R9HC 3U7WH 3QNYB 2F9BT 3GHEL 4LIQE 3QBTB 5DFWH 4M7LL 2ERJB 2C7UB 3LS4L 2CUHA 3FN3A 2OTWB 4H8WH 5T1MA 3QUMH 4NM4H 5JQ6H 1N2RA 3BKJL 4WO4B 2BHYA 3DVFA 1LO5B 4ZPTA 4TVSa 5EZJA 4BH7B 4EN3A 1UA6H 3GSNL 4KI5C 1DQQA 2EDDA 5EULV 4HHAB 4BM7A 5C08A 3K7UA 2VQ1B 5KAQF 1MCLA 3FZUC 2P8PA 2NY7L 1F6FB 4QNPE 3TVMC 2VSDA 5IMKA 5HHQB 3HI6H 4R7NB 4JO4L 2FCBA 2ZG2A 1XT5A 2P8LB 4ORGB 2B0SH 1UXSB 5L2KB 2Z4QA 4DVBB 1K8DA 1WCBA 1KEGL 3OKKA 4N8CH 3MODH 3W0WB 3K81A 1S7VB 1GJIA 5GRXG 5HI3C 3D25A 1OTUD 3MRDA 1T2QH 1FV1A 1FYTD 4HS8L 3RNKA 3A67L 4IOFC 4D3CL 2CRZA 1WWCA 3SN6N 3H0TA 3S3SA 3VD3A 5B38A 1AO7E 3IRZA 2PW2A 4UINL 3TO4C 5D7KE 3KPSE 3I9GL 3ULUC 5BW7C 2HFEA 5DR5L 2ITCA 1N7MH 3MLYL 4CUCA 1FPTL 4X7DC 1T83A 2NYYC 3SJVE 5IVNA 1H15A 5E1AA 5L7XL 5C86A 4G7VH 5IGXL 2X7LA 1D9KC 2GUOA 1QLEL 3IYLW 2ARJB 4YHPB 2DL9A 1QSED 4ERSL 2C9AA 1AFVH 2Y6SC 2EDOA 3W9DA 5A43C 2BOCA 1CE1L 1Q1JH 1PAMA 1AGDA 3QDJA 1YEDB 4KRPC 4AEIH 4U31A 1FVCB 3ZYOA 2X4TA 1R3LB 4N0UA 3MMEA 3HI1B 4JM2F 4MVBC 5F1NB 5C7XL 1IT9L 3D9AL 4N0CD 4HAGA 3KLDA 2YD5A 3G5YB 5A1AA 4PG9B 4RA0C 2VDRH 4EOWH 3ROOB 4MQTB 4PJ5E 3VI3E 4XWGL 2VQUA 2FD6H 4TSAL 5GISL 1LDSA 3OKLA 4OKDA 2R0LL 1GAFL 3WFDH 3T0AA 4ONFH 1FRGL 4ZNEE 3SPVA 5IVXE 3EJZD 3LKQB 3HUJF 4BFBD 1YEGL 1U8IA 5GGVL 1F6AB 3VFVA 4RMTA 1I9IL 4L5FH 4L4TD 5ADPL 4TULL 1RZJL 1AKJB 3MRFB 5ANMB 3HPLA 4FNLH 1NL0L 4R90H 1VPOL 3DSFL 4YQXL 4WV1A 5JOPE 2AJ3B 1K8IA 2AP2A 3MLPA 3OB0K 3UPRA 2IQ9H 1OAKL 1DUZB 2R4RL 2ESVD 2VLJA 3CDYA 2HLAB 3U9UB 1NC2B 4Q97A 5HPMA 4GW5B 2AAVA 2BVUA 1HSAB 3NVQA 5CIPH 1KCUL 4PJ7E 4KTDH 2DI7A 3DSNA 1VGEL 2MQ0A 2AQ1A 4Q9BA 2PXYC 3O3AB 4ODXB 1KTKE 2VLKB 3S35L 3K3QA 4JM2C 3GSXA 1FNSL 2BFVL 4OI9A 3JTSB 3M8OH 3I6GA 4QYOB 1OGAE 1JCKA 1KPRA 4YFDB 3RP1A 1BVLA 5HHNA 5DJYA 4Q58C 1IC5H 2XWTA 3C5ZA 2O5XL 3G6JF 2Z8WC 4L8CB 1MJ7L 4Y16A 4LHUB 3G6JB 4JQVA 3EYQD 5JORA 1QSFB 4QGTA 3IXTA 3OB8A 3MJ6A 1F45A 5MENA 1DQDH 4PJGF 3QHTC 2VDOH 1TQBC 1XH3B 3G5ZB 4HJ0C 1DQMH 3BP6B 4MQXC 2H6PA 3TNNA 4PJGB 5D2LE 1G6VK 1AI1H 3BH9A 3Q5OA 4G9DA 4MAYD 4RWYL 3P4MB 3MPCA 1J8HD 4MWFA 4OCRH 3U82B 3B5HA 3WE6B 5IMLA 5LGHL 3TT3L 3CSPA 4AK1A 3QUMB 1KULA 5EORH 4LDOB 3VXTB 4F7PB 3QUKB 5E56A 4M4PA 1I9JL 3EOBB 3QCVH 2AGJL 3GO1H 3RZWA 1QQDA 1OCWH 2AEIT 2J88L 2N7AA 4UT6H 4JGMA 5KW9H 4Y2DB 1DJSA 3KYAA 3BP5A 32C2A 3T2OA 1Z2KA 4XCYB 1INQB 2JIXD 4HIEB 2OI9C 2CKBA 3RTQD 1MJUL 3WHXA 4K9EC 2BY3A 4OCSH 4X5LA 4OD1H 4U1NA 2J6EA 4NC2B 1G0DA 4CN6A 3CJJA 3QG7H 5A16B 3BDXA 3RVXD 4HF5L 3V6OE 3HFMH 3HMXH 2HFGL 2I9TB 3X11A 5EUOB 5EU6B 4PRPE 1JUFB 4I48B 1I3UA 4OZIB 3D85B 4Z78A 5BZDA 1IMHC 4MNGE 2HKHH 4DUVA 2DQHH 3HNTL 4RMSA 4I2XB 5FUZL 1UJ3C 1T7WA 1WBZA 5E7FA 1DVFB 2ICEA 1WZ1L 4W81A 4U1SA 1KTDB 1SEBB 2F53D 2ITDB 4LSUL 3IFNL 3QXDA 5CILH 4LPWA 3ZHDA 5SWQB 4YAQA 5IV2A 4BQ8A 3V52H 4FN0A 4P23D 5F7MC 3RRQA 1CFVL 4Z5RB 4YH6A 4ZUVA 4FP8H 4PV9B 1G7MA 2IAMD 1ZHNB 3RWIA 1JYWA 4WI7A 2YRLA 1A3LH 4P9HC 1T6WA 1J5OL 2RBLA 5D96B 5HDBF 3MV9E 1ETZA 5ICYA 5AUMA 3C2AH 3MCKA 3O4LA 4MQ7A 3IS1X 3MV7D 4G3YH 3CSGA 3V4UL 2DMBA 3JXAA 4QO1A 1DCLA 4U1LB 4Z7QE 1T80A 4HGWB 3KYKH 4D0CB 4LVOC 4LMQI 3VFGH 2VXUH 5DYOB 1CFSB 1A7NH 2PO6C 3QNYA 3K2UH 4S11A 4U6VH 2VMFA 4WDIA 2C7UA 4PUBH 5J0BA 2PF6A 3VMNA 2GQHA 5GGQL 5T3ZL 4YNYB 1PBYA 1RFDH 4RFOH 3GRWL 4U1HB 5EH1A 2E7BA 2XKNB 3I2CH 3ARYA 3DURA 3QDGA 4HHAA 4XNMB 1OT2A 2VL4A 4L3AA 2VQ1A 3BEWB 1L7IL 4QHMA 4HWBL 5IB1A 1KCKA 4Y88A 1CDGA 3VXUB 2IPKB 3CDGB 2HAZA 5TE4L 2YHGA 4FFZL 3QNXA 2E3VA 2DQEH 2P46B 4NZTL 4R4BB 5L2KA 2XN9D 4DVBA 4TVPD 4RMVA 5EBLB 4V2CB 1G9NC 1UVQB 2VDLH 1A6AA 1S7VA 1T0MB 5CIPB 4CJ1A 3FFCD 1MJJB 2HA1A 4NO0D 2XY1A 4KK9D 1G6RL 5HGAB 3WFBH 1I1AC 4S0TD 5GJTL 4NC0B 3CH8A 5HYJB 4PRDB 1NCDL 3HN3A 2VXQH 5JNYB 1OD9A 5GIRB 3PGFH 2Z93B 3Q0HA 1IEBB 4LRIC 4WCYH 4Z7VB 5JHDB 2ARJA 4L4VD 3QO0B 3MZTA 1UQSA 4KKAC 4PLJD 3TM6A 5KN5B 4YHPA 4BZYA 4FFYL 3CVHL 3AC0A 3JVGC 3BHBB 1OTTD 4M5ZL 3FCTB 3BPOB 2CO6B 3FT4B 3OKMB 4U6HA 4NJ9L 5D1QA 5I16A 5I15H 4Y4FB 3THML 2I27N 4I0KA 1A1MB 2UZYB 2EH7L 4DFHA 3SE9L 4XMKH 1U6AH 1FVCA 4NUGH 5CGTA 1HYSC 1YNLL 5F1NA 2IFGA 3HR5B 3TJHD 5IESH 2VXTL 1J1PL 2UZIH 1BP3B 3G5YA 5ICZA 3PQYD 4PG9A 1UEYA 3ROOA 3QWRA 1NCNA 1G7LB 4NUJA 2DQGH 1MIEL 1RZKL 2QR0B 2YZ1A 3NCJL 3SCMB 3LKQA 5EG6C 1CU4L 2ZWLT 5IB2B 4MA1B 4NQDE 2FB4L 4HJJH 1Q8MA 1HILB 4PFEA 1F6AA 4QOKB 4XB8A 1KG0B 4NKOB 4HH9A 2L7UA 2O61B 3EOAB 5A40E 3MUJA 4GXUM 1IAIM 5I1JH 2FX9L 3HA0A 1G9MH 1NFKA 1AKJA 3MRFA 5ANMA 3AFLA 1AE6L 1MRDH 3HNSL 4OCXL 5ALBH 2B4CL 4GRWH 5D6CA 5DJXB 5EBWB 3KG5A 2XG4A 4RGMC 5IHLB 1DUZA 1JWUA 4MZ2A 3VXPB 3DMMB 2HLAA 5B39B 5KVEL 1A7QH 3CAFA 3U9UA 2IPTH 4PJCE 1HXYA 4GW5A 1HSAA 1MHPH 1MOEA 3SDXF 5IVZB 5I18H 3AY4C 3OKEA 3EKCA 4W6XB 1OARL 4PJAF 4ODXA 5JLZB 2A9ML 3PNWB 2VLKA 5E08H 4PJAB 1G7IA 2PYEA 3JTSA 4QYOA 1EX0A 3WHE1 5L8KB 1MRCH 4GAJL 2FATL 5BVPL 4O2CB 4L8CA 5DO2D 1ORQB 4CGTA 1QBLL 1ZHKB 1TCRA 1IRAY 3MLUH 4YUEL 1P53A 4JDVA 4YBQC 3KPOB 1B88A 5C71A 4G9FE 4JKWA 5A2LH 3PWVB 4PP2A 5D1ZB 1PYWA 4NZRH 2W0FA 2VZOA 4U6YA 1Z9SA 3G5ZA 3OXRA 4GG6B 4HEPG 1GOFA 3BP6A 4UB0L 1NUFA 3DETC 4G80B 3F6LA 3DVGA 3OGCB 5J56B 4OLUL 2MKWA 4ELMB 2IH1B 3WE6A 2APTA 4F9PC 2MPAL 2CDFB 1MAKA 1JNHB 3GSQB 1BQUA 3I84A 4YFLF 5DS8B 5GS1C 4DTGH 1BZ7B 3VXTA 5E4EB 5EB9A 4F7PA 4FFVC 1QFPA 4X4ME 1R3JB 5L8LB 3WO3B 4PS4L 5DMGC 5C6TL 2W9DL 3B8SA 3D0VB 3CXHJ 1JYVA 1WUNT 1JHKL 3BAEL 1S78C 2ORBH 4X8XA 4HUUB 4Y2DA 3UTPE 2OZ4H 1BQHG 4ZUWB 2FHBA 3J7HA 1INQA 4HIEA 4JKPH 4PJXA 3V4PH 2M8XA 4IIQA 1DLFL 1BAFL 4UIMB 4C56D 2JB6B 2DQJH 3VFSA 4NN7B 2VIRB 5C09D 1FYTB 1GZPB 4LSVH 3NGBB 4HH8A 4J3WA 4YDVA 3GNML 1OTSC 3Q3GA 3GHBL 3CMOL 4M5YL 4P46D 1IM9D 1LK3L 3ARDC 5FDWB 1PLGH 3IJSB 4PP1D 4M6NH 1IGMH 1SJVA 3QRGL 1XGQA 4NP4L 1ZLVK 3ZL4H 5EUOA 4RX4A 3T0EC 5EU6A 4Q0XL 5BO1L 3NACL 2J3SA 2BX5A 3UZQA 4NO5A 5I1HL 4OZIA 4P2RA 3D85A 4DWHA 4EI5B 1DVFA 2VISB 1I8LC 3D0LB 3MGTB 2XWBB 3OBAA 2DM3A 3W5NA 1QSEB 1SEBA 2Y1VA 5D7LE 4R4ND 5SWQA 3SGJC 3PWNB 2ICES 4LQFL 1ND0B 3WFZA 2IANA 5E4EC 4UNUA 4YPGA 2OP4H 4Y7MA 3LB6D 4LNRB 2EKSB 1JWSA 5CEYB 1JZ5A 5BV7H 3HZVB 4Z5RA 1GC1L 3NCCB 3IJYB 5EN2B 1WEJH 4YDJB 1QYGH 1RZFH 4OGYH 5EOTA 5TF1H 1RJLB 3WD5H 3MZGB 5IBTL 4U0RB 4QHNB 3DGCR 4HFUH 2ZUWA 1OTUC 2N4IA 4X9HA 4FMFA 1T03H 5TE6L 4DOHE 3S9DB 4PJ8C 1X5YA 4FQ2L 3S3PA 2V2XA 2W65A 4IDLA 4NKMA 4D0CA 2B5IC 1LP9F 1MRFH 2B20A 4ODVH 5DYOA 1NCCH 4MJIB 2DBJA 3BSZH 2GW5A 1LDPH 2EDXA 1G7PB 4L4TB 1IGTB 4ZO7A 4EQ2A 1OP3H 2QSQA 4M93B 4W70A 2YUVA 1DBAL 3MYZA 2A0LD 4U1HA 1I85A 2ZCHH 3T3MF 2XKNA 5HGDB 2X70B 2ESVB 4S1RH 2KPNA 4XNMA 2F5BH 2X1XR 3BEWA 1SVZA 4MDIB 4GRWB 3V5KA 3BKCL 4NRXB 1A64A 1F4XL 3A6BL 1T7YA 3VXUA 2IPKA 3IETB 1NFDF 3RWCB 4UI2A 4U6TA 5FHAH 4O5LL 4BZ1H 2PN5A 4R4BA 3G08B 2PW1B 5EBLA 3RDTD 2G2RB 2FX8H 2EH8L 4PRIE 1UVQA 2VDKH 4MJ6B 1T0MA 5CIPA 3KJ6L 4EBQH 1MJJA 1AY1H 4LARL 3QCTH 1A6UL 1MVUB 1XR8B 3FO2A 3HAEG 2HH0H 5HGAA 5F3HB 3D2UD 1UADC 5A2FA 3EHBD 3FB5B 1OSPL 4MD4B 3ZYIA 3GI9H 4HK0B 2AEPH 4PRDA 5SV4A 3GMMB 3P11H 4G8GD 1T89C 5FHBH 2ZUYA 4ZS7H 3L6FB 5JNYA 2YD2A 3A6OA 3O8XD 4YXKH 4M93C 1J8HB 1IEBA 4PREB 5T3XE 1M7DB 1IAOB 1N3NB 5FYKE 4YR6B 5HHOA 3VWKD 2JK5A 3SQBA 4Z7VA 3QO0A 5KN5A 4MNQD 4JFEE 3OKYA 4XNXL 1IL1B 3N1PC 3ULUL 4QXUH 1ZK9A 1NAML 2RFXA 3HZMB 3OKMA 2ATPB 1NGZA 5F9AC 3S37X 1Q9LB 3QFJB 1LO0H 4HUMB 4Y4FA 1WV7T 1A1MA 1FC1A 2V7NB 2WBJC 5DMKA 4UT9H 3IU4H 4ESKA 1QA9B 3TWCH 2VDMH 1IGYA 4K3EH 3BE1H 2HJKB 3L3KB 1Y18B 4DGVH 1EEUA 2MKLC 2ILLA 2JIXB 3LKSB 4KKLD 4GMSH 4PJDA 5DA0B 2IGFH 3RTQB 4MXWH 4OUOA 5JDJA 4DUWA 4PB0L 2D4DA 2C3XA 3WFCH 1G7LA 1KT2B 4OIBA 4ALAL 4LEXH 3O45B 4F3FA 2JJTC 2I07B 3SBWC 5I1EH 3HMWL 5GS0D 2QR0A 4RGOL 3H42L 2NX5D 4MLSA 3CZFB 5IB2A 1RPQA 1U8MB 5HDOA 4ODHH 1HILA 4PG2C 5C2UB 3O6KL 1KG0A 4NKOA 1DSFL 1TETL 4M3KB 1RULH 2O61A 2IBZX 2DDQL 4H26B 1CFBA 5HDQL 4HLZH 4MAYC 1HQ4B 1MFBL 1KJ2H 1J8KA 1ZWIA 1JHLH 2F53B 1CF8L 1FL5B 2XRAH 4PLKD 5EBWA 3K4DA 4R9HA 4HC1H 4DN4L 3OJ2C 4JGUA 4WEMB 3VXPA 3F6IA 4XNZB 2BJMH 1DBML 4P23B 5B39A 2FECI 1G7QA 2IAMB 4HXBL 4LAJH 2J8UB 1JF1A 3UO1L 4P3DB 5LBSL 5EU3B 4XRCB 4YHZL 1BFOA 3ARSA 3F58H 3VI4F 4Z7UB 1ZVYA 1AHWB 2Z91B 5JLZA 5BV7B 2ICWB 1R24B 3QIBC 4RISH 3SE3A 1BGXL 3MJ9L 3MV7B 1N5YH 3MFFA 4X6FB 1KYOJ 1PDKA 2ZCKL 4AQ1B 3UDWA 1MCSA 2BOBB 5JW4M 5L9DL 4PJ5D 3REVB 1PQZB 3VXSD 1FDLH 1I4FB 3KPOA 5DK0B 2UVEA 1YJDH 1YEHH 4F8TA 4KVNH 1T7XA 5D1ZA 5AYUL 5ACMA 2VDPH 4C55A 4XCCH 5EU5B 3U0PB 2BSSB 2VZ3A 1C8PA 12E8H 3K8KA 3FQXA 1OAZH 1OAQH 3P30H 4GG6A 3V5DB 1FNGB 4EUPH 3OGCA 1MF2H 1S5IH 3QPQD 4V1DE 5CJQL 4NRZB 1GOGA 2E7MA 4GXVH 2NY5H 3HLAB 3MRQB 3KLSA 5DS8A 1LQSR 1VFAB 4PJIA 1BZ7A 4M1DL 1I9RH 3SDAB 5M94B 1BFVH 1R3JA 4YZFF 3MRJB 4FQIL 5GHWH 2IAMC 3WFHB 3D0VA 3E2HC 2XN9B 1RUQL 4QHKJ 1CGYA 4JRWA 4KK8C 5JMRA 3O0RH 1FVEB 1HE7A 3FFCB 4PY7A 1T5XB 4OZFG 2H1PH 2DYPD 3R0MA 4IRJD 4UIMA 1KN4L 1SJHB 4NO0B 2VIRA 5TDPB 5C07D 3QJHB 3SGKC 1FYTA 1GZPA 1Q9OB 3QCUH 5HTSA 5TDNB 3QDHA 3PWJA 2ZOKB 3E6FB 5IFAH 5CMAA 5FDWA 1VADB 1SYSA 3LQMA 5GRUH 5DSCB 3CFEB 1H5BB 4NZDA 3MV8B 1V3KA 5CD3A 5JTWA 3UEZA 5LXGL 2DQTH 4NFBA 4EI5A 4WUKL 3BQUD 3GI8L 1TPXB 1JNNH 5JW4Q 2XWBA 1DFBH 1QSEA 1UENA 2ZUTA 2AXJA 3WKML 5EOQH 4WFFE 3O4OC 2LU3A 1LHZA 1ND0A 5CUSH 1XEDA 2AVGA 4U05A 4LNRA 2EE6A 2EKSA 5F8RC 1W2KT 3CIQA 3HZVA 3FQUB 4JDZA 1XGUA 1M4KA 3U7WL 3LQAC 5LAXB 4U33A 1IGIL 1NFIA 2FECL 4JFFA 1SY6A 2PTVA 5H94B 3IRPX 3QUML 4NM4L 1RJLA 3PQYB 4PJHF 3OKOA 1F00I 2K9UA 5JQ6L 5LGKA 4QHNA 2BERA 1I7RB 1CE6B 3O9WD 4NWUL 1YYMH 2X9XA 1RHFA 1UA6L 2XA3A 2DI9A 4KK9C 1UT9A 4PGCB 2D7MA 1MCOH 4G7YH 4P9HL 2Q1EA 2WNGA 4MJIA 1P9MA 1P1ZB 5JOFB 3VFWB 3HI6L 4UAOB 3LDBB 2EYTA 4IOIB 2B0SL 2FGWH 3VDAA 3QG6A 4ETQB 2RAMA 4CDGC 2R56L 4N8CL 5FCSH 2HT3D 3IJHB 3MODL 3X14B 1BBJA 3C6SA 3WL9B 5C0BE 2XZAH 4ZSOE 1K5NB 5HGDA 4J3UA 1T2QL 4Q9CA 2NLJB 1AR1C 4JFZH 1QOKA 3FQNB 5E5RB 4WFHD 4MDIA 4NRXA 4Q9QH 4Q6IC 5F44A 3WO4B 2FJFB 3IETA 3RWCA 5B21A 4OBRA 2X42A 4H5SA 4ZFGH 3FL7A 4A6YB 1N7ML 4YXHH 4PGBB 2EC9T 5INCB 2G2RA 4LSRH 4G7VL 5DJ0A 4MJ6A 5LGJA 4LHJB 2JTDA 2H8PA 3MV9D 4XPGH 2XPGB 4WTZG 5C3TA 4KDVA 3QDAA 1MCFA 2WBKA 1KLUA 2V5SA 5EC2A 1Q1JL 1CICD 5MP6H 3NPZB 1DUYB 5CGYD 1KYOK 3FB5A 4MD4A 1JMZA 4PGDB 1IZJA 1Z0MA 1BLNB 3GMMA 5ADOH 1FAKT 3LIZH 3SDDD 3C5SA 4OLEA 3SO3C 3S4SB 3L6FA 5D2NC 3ZSSA 4GG8B 5JIPA 1H3XA 2PTTA 1MJ8H 1J8HA 1M7DA 1N3NA 2VDRL 4EOWL 1JGLH 4LCIH 4DK6A 1X5JA 4WHTA 3IKKA 4EUPB 4RAUA 2EXYC 2XNAB 2FD6L 3ULVF 3S36H 4NCC2 4LPTA 3WFDL 2ATPA 1AGBB 1Q9LA 3QFJA 4ONFL 2WQRA 2V6HA 2V7NA 2GT9B 5CINH 2NZ9C 5AG8A 1ZT4A 2ZUQC 3QIUD 3UX9B 2YK1H 1ZV5A 2HJKA 3L3KA 4L5FL 5LCVH 4ZD3H 5EUKB 1O5DT 4Z7WE 5GS0H 1WICA 1B0WA 3QI9D 5CD5C 4X4ZA 4YHIB 5C09B 3EO9L 3RY5A 3IDNB 1FN4B 4NNPH 4R90L 3MLSH 1I8KB 1KGCD 1KT2A 4BQ9A 5JO5B 3O45A 4P46B 2IQ9L 2GKIA 1IM9B 2I07A 5DK3A 1LEIA 1HKLH 3DVNB 5DXWA 3TA3A 4JHZA 4K94C 1W0YT 1U8MA 1ZLUK 5EA0H 3DYOA 5ELIA 3V0VB 2AXHA 5F1IB 1OSZB 4HUVA 1IGJB 4KTDL 4H26A 1YJDC 1AP2B 1BQLH 2A1WH 4S2SB 2YPKB 2GTWB 5DD0H 3U4EA 1HQ4A 2AJSH 3MRPB 4LLVB 3KR3H 4XXDB 2BVOA 3RHWK 2GAZB 2UWEE 3S5LA 4HK3J 3QWQB 5DQDH 5C0IB 2AQ3A 2F53A 3M8OL 1JBJA 1EMTH 1IC5L 4UQ2B 5J9PB 3KGRA 4XI5D 1MHCB 3WS6C 3CLEH 4AH2B 1A6PA 5J12C 1NKOA 3ZDXF 4OGAD 3ULVC 2H2SC 1I3VA 4LCUB 2J8UA 3DECA 2A6DA 2CK2A 4X9GA 2I60L 1KCVH 4P3DA 2IC2A 3RJDA 5DJ8B 2VC2H 2CK0H 1DQDL 3R0NA 2ED7A 2VDOL 4YFLI 4L8SB 4Z7UA 1AHWA 1DQML 2Z91A 1P7QD 3QEQE 1JP5A 1KNOB 1AI1L 1R24A 1XCQB 2DICA 4OCRL 4X6FA 3QP3A 2BOBA 1K4CA 3MXVH 3REVA 1Q38A 4RBPH 5EORL 4KDWA 4R8WH 4HCRH 3OQ3B 4JRXE 1I4FA 4P46C 3PGDB 5CJ8A 5KS9F 5DK0A 4GKSB 3UPCA 3VXRE 3QCVL 1T22B 2UY6A 3MLRL 5KS9B 3RX8A 5EU5A 3GO1L 4Z7NE 1F13A 1S7UB 1YEIL 2VITB 3ARUA 3ZDZF 4UUJB 4UT6L 3OTTA 3SO5A 5E9DD 5KW9L 4POZC 5IROA 2EDQA 3EIFA 2A6IB 2KZWA 2H9GB 3MCG1 4E0RB 3S5LG 3C87A 4TSCH 1N4XH 4R4NC 3HLAA 5MEQB 3D48R 4Q74A 4OCSL 4QWWC 4FQHB 5F6HJ 4OD1L 1XF3B 3SDAA 1WBYA 4X6BB 3QG7L 4X7EC 3SDYH 5AWNH 3HFML 2V5MA 3HMXL 5CEXA 3DROB 2XN9A 4OT1H 4AMKH 3RDTB 1TXKA 4L8SC 4NO3B 1FVEA 2HKHL 4G42A 3QDMD 4P2OC 2DQHL 5IHBA 1KBGH 3FN0H 4NO0A 5CEZD 4OF7A 4FTVE 4AZ8A 1V7MH 3NOIA 2NZIA 3D87B 3E6FA 4PRBB 4X6DA 3D2UB 4WFGE 1VADA 3V52L 2AABH 4FP8L 4XVSH 5ICXB 4DEPB 4G8GB 3CFEA 2BY2A 5C9JA 3MV8A 3QHFH 5DEGB 2D4FA 3KAAA 1A3LL 3O8XB 4BUHA 4XH2B 3VWKB 4LVHB 3MGAA 1EVUA 3O2VH 3C2AL 3R8QA 1IEHA 1S7WB 4MNQB 5H37G 5B3NA 3D69B 1RQ5A 5F7WC 4G3YL 4NRYB 3MX0A 4QNPF 1HXMA 3WN5B 1C1EH 2R69H 2YS4A 4YGAB 3KYKL 4LCCC 1BQSA 3VFGL 2VXUL 1A7NL 4DQOH 5LAXA 3QDJE 3K2UL 1G84A 4U6VL 1E4JA 3FMGL 3C2SA 4PUBL 5H94A 7FABH 2P7TB 1RFDL 1YY9C 1I7RA 1KB9K 5HVWA 3VXOB 5FYKU 4HXAH 4HWUA 2I25N 3I2CL 2H3NB 2KQNA 4PGCA 1F6LL 2C3WA 5HYSA 1ZT7B 2IWGA 3TZVD 9CGTA 2NX5B 2NY2D 1CD8A 1Z0NA 4GO6B 1YQVH 2XY2A 1JPFB 5JOFA 4XPAH 1EBPA 3VFWA 1HDMA 2DQEL 1UM4H 4IOIA 3O8XC 4ETQA 4AEEA 2QSVA 4IJ3B 5DRZA 4B7IA 2DIBA 3IJHA 5L88L 2VDLL 3RX7A 1EXUB 3FT2A 5F88A 1SM3H 4YK4C 3QUYB 3SHSA 4Y2OA 1K5NA 5I1AA 2WBWB 4JFOB 4ZAKA 1I7UB 3LVEA 1NUDA 1FHGA 3N1GC 5I1IH 1U91B 3WFBL 4XP9H 1YPZF 4OLXH 5F9WC 1X5XA 1MREH 3WIFB 2ZSWB 1YPZB 2FJFA 4A6YA 1WBXB 1UFUA 4PGBA 2VXQL 3S96A 2R29H 2OMBA 1TENA 5C9KA 3UTTA 2FJGB 3PGFL 4IBLT 4DVRH 1QEWB 1WVZA 2EYSB 3VI3F 1RZ7H 4G8EA 2R39A 3ZE0E 4WCYL 1T5WB 4PJ5B 3WEXA 4IRSC 3VXSB 4S0SD 1OM3H 5IVXF 3X17A 1TZIA 5GS0C 5M95B 3TJEH 3DGGA 1NLBH 5IVXB 1WQVT 5I15L 1ZLWH 5DJZA 3MOAH 1DUYA 4RMRA 3RVWD 3TVMA 4PGDA 4XMKL 1U6AL 2OXHA 4NUGL 4P4KB 4XGZA 3B5TA 4UV7H 3DX8B 3S4SA 4GG8A 3Q2CA 1PY4A 2P48B 3BIBX 5IESL 2UZIL 2NXYD 2WK2A 2J4WH 4XP1H 5BZWA 1NC4D 2QADC 4M8VA 3UTSE 5EPMA 5HI4C 2XNAA 3ROLA 5EBMA 2F8VA 2DQGL 5DC0A 3I85A 3CFCL 2GT9A 1AGFB 3GK8H 4HJJL 4JY5L 5HHVH 4P4RB 4NFDA 3TO4A 3D18B 4AIXA 2JJVA 4X5XB 1X6NA 4NO2B 15C8H 2FWOB 3KYMA 5EOCH 5I1JL 1G9ML 5EUKA 5GRWA 2QHLA 3BP7B 4TUJB 1B0GB 4IRJB 1CYGA 5JXED 4PRID 1BJ1H 4JFYB 1MRDL 5C07B 3TT1H 1FN4A 3ZT7A 1D9KA 3CCHB 1I8KA 3IF1B 3T4YB 5GRVL 3DYMA 3L7FB 4XC1H 3LEVL 5JO5A 2IJ0C 3TBYB 1R3HA 2ICWI 2PCPA 1FBIH 5L6YH 1A7QL 1ZEAH 2IPTL 3GSOB 1A6TA 4LLWA 1DZBA 2WWKT 5DZNA 2D31B 3V0VA 2APFA 1MHPL 1OSZA 5D2LF 5D71H 4AM0B 3FQWB 1I9EA 3HC0B 3BQUB 1HINH 2YPKA 4LPCA 5I2IA 1S9VB 5E2JA 3W9EA 4OAWB 3QPQC 3MRPA 4LLVA 5E08L 4XXDA 3W11D 3DJ9A 2NW3A 1SYVB 3KPRD 5BQ7B 1MRCL 4ODBD 3QEUB 4JFED 5E00B 4UQ2A 3GBNL 5C92A 3MLUL 4E41D 4AH2A 5IB4B 3TYGH 1NEZA 1S7SB 5SWSD 1WTGT 3KLHC 1P84J 4ZTOH 3VWJC 4NZRL 4HUKB 3L3DB 2VR4A 5FF6A 4MXVE 5DJ8A 3BJLA 4QRTB 4KJQC 1WFTA 3STZA 1CG9B 3ZHLA 3O9WB 3Q1SH 2FJHA 4YHYB 3P3YA 4J3TA 2P4AB 1ONQA 5C0JA 4JAMB 3O4LE 3PJSA 1IM3B 4DTGL 3MNZA 2AK4A 1BIIB 3TPKA 3LMJH 2EECA 2DMKA 1EPFA 2WINA 5C0AA 3WJJC 2VITA 1BFSA 5KAQG 4UUJA 5I8EB 1BM3H 4ZODA 4QRPD 2ORBL 2EDEA 4M02A 3Q6GH 2A6IA 2OZ4L 3S34H 1H3UA 2H9GA 5F21B 3NABH 4E0RA 1U3JA 3VXQB 4JM2A 4U7MA 4XPTH 2DQJL 4M6ML 2Q7YA 1U8HB 3RPIA 4HIHB 1JL8A 4F7EB 4HMDA 1F2XK 4LSVL 5I17A 1XF3A 4RNRB 2IEPA 4WI5A 1PLGL 2VLME 1IGML 1H0DB 5AAMA 4UILH 5JIIA 3WLBB 3DROA 5CEZH 4AT6B 4LASH 4NQTA 4LLUB 4PBWD 3RDTA 4NO3A 4HS3B 3SDCD 5L2KE 3L9RB 3JV4B 4TYUA 1EO5A 3TN0C 3W0WE 4OKVB 4XTRD 3EUUA 4CNIA 4MB3A 3QR2A 3RWFA 2B8OT 4Z7QF 1JGVH 5T1KA 1I3GH 4MDJB 2HP4A 1N8ZB 4PRBA 5CFHA 3V6OC 5BV7L 2CRIA 4NFCA 5ICXA 4G8GA 1CFNA 3GJEB 3PGCB 3SDDB 1WEJL 1NCBH 3BX7C 3SOBH 1KJMB 5C6PB 4K07A 2X6MA 1QYGL 1RZFL 1OW0A 2AXGB 4XH2A 2N7BA 1MWAA 3IT8D 5TF1L 3WD5L 2C1OB 3VWKA 1BZ9B 4HFUL 2HMIC 1S7WA 2GJJA 4Q6YA 1T03L 4KJYA 1SHMA 3DARA 1MCKA 3OF6A 1KCSH 3WN5A 4X8JB 1NBZA 2CMRH 4HZAA 1MRFL 3PE9A 4ODVL 1GGYA 1NCCL 2HFFB 5DJAB 3UJIH 3QIUB 3BSZL 5MHSD 1LEKB 2CPCA 4GBXC 5EIQA 3VG0H 1N64H 3AMLA 3L3HB 4ZO8A 2P7TA 3VE0B 2JCCB 3QI9B 3L3JB 4CW1B 2VKWA 4KH2A 2ZCHL 3GMPB 4NNXB 2CQVA 2BNRA 1JRHH 3UP1A 4ZQKB 4TNVK 2H3NA 2V9TA 3MUHL 4S1RL 4HWZB 5GGTH 1ZT7A 2F5BL 4NOBA 3WXWH 1CICC 1NCUA 3T4AB 3RQ3A 1HZHH 2YA2A 3AMKA 4P3WA 5E2VH 5I74B 5CGYC 5BVJB 5INDB 1JGEB 1JPFA 1YQ2A 3T65A 3SDDC 4OI7A 4MB4A 5FHAL 4BZ1L 1X5GA 4YHOH 1C7SA 4WWKC 1ZE3C 2FGZA 4JREB 2QBWA 2BSRB 2VDKL 3VFMB 5MERA 5ANME 2X10A 3QUYA 4EBQL 3QCTL 1VACA 2H41A 3IDJB 1IAKB 1NBVH 4HKXB 4JFOA 5EC1A 1RJZB 3VCLB 2OQJB 2HH0L 1U91A 1E6JH 4P5TD 4LHUG 5KANI 4FQXD 1J88A 2ZSWA 4B41A 3GKWH 1U36A 2Q76B 3GI9L 2PO6A 4CL7A 2IG2H 5I75B 2AEPL 3QNZB 3L7EA 3RWHB 3P11L 4HDIB 5FHBL 5F7FA 1P7QB 1WBXA 5DHXB 4ZS7L 1Z5LB 1KJVB 1B4RA 3BPNC 2FJGA 4LCWB 4YXKL 1QEWA 1P84K 2BNUB 2AV7B 3O3DB 2VLKE 4X99B 3RY6C 3VXSA 5FFLA 1F90H 5F3BB 4QRUB 4QXUL 3WLWD 1IKNC 5C0GB 3RZCD 1PZ5B 1LO0L 3G6JE 3C08H 3RAJH 1BJ1J 3Q6FB 4E42B 4UT9L 2P8MB 3T77B 3IU4L 1QSFE 4P4KA 5E9DB 3TWCL 3BIAX 5K9QG 4K3EL 3CVIL 3BE1L 3DX8A 3OAZK 4KPHH 5F89B 3MJ8A 5EO9B 5GGUA 3P9LB 4DGVL 1ZA6A 2I24N 4GMSL 1CD1B 2IGFL 4I13B 4PJGE 2Z35A 4MXWL 5ACLA 3LKPA 4NNYB 3C6LC 1RV6X 4ZS6D 3WFCL 4GS7B 1U2HA 5C0BD 4WNQB 2C3HA 4LEXL 3A6CH 1YZZA 4PJCF 1F3JB 5I1EL 3ZKSD 4LLQB 1FAIH 1MVFA 3PWUB 4TPRH 4UZGA 2FEDC 2ZP0T 3VMPA 3O6FD 1T7ZA 1D5ZB 3MOQA 4P4RA 3D18A 5IK3B 1RULL 1FVDA 4NO2A 2FWOA 1WAAA 4LQ1A 3ARBD 3QDMB 3BP7A 1EAPB 4TUJA 1B0GA 1O7VA 1MY5A 5F6IB 5SX5H 4JFYA 1KJ2L 1X4XA 2ZKHH 1T66D 4LRIA 1JHLL 4Y0GA 5FM8A 2XRAL 1D6VH 4OV5B 3T4YA 2CLRA 4HC1L 1S9XB 3RNQB 3VMOA 4J4PD 2X4PB 1INEH 3JVGA 5F7EH 1EERB 2BJML 4O58H 1AD0B 1TVHB 2AV1B 2CIKB 5GGSB 2D31A 2VNCA 5IWLC 2VR9A 3QIWD 4AM0A 3FQWA 5EUOE 3F58L 5EU6E 3HC0A 5ETUB 4DFIA 5FKPA 2XZCH 1FGVH 1PD6A 5FO7B 4OZIE 4RISL 1D5XB 2V7HB 5JW5A 3ARVA 4GFTB 5FM5O 4WIQA 1N5YL 3VXMB 2D0GA 4I2XE 4K94L 5DF0A 4EQ3A 4CVWA 1C08B 3QEUA 3RVVD 5E00A 4N5UA 1FDLL 5FYJD 3BPCB 5IB4A 3FOLA 1KPVB 1S7SA 1YJDL 4WFED 2IANE 2NW2B 3CC5B 3O41B 1F5WA 5I1LB 2VDPL 4XCCL 5DLMH 3GSRB 3WJLC 1WT5C 3L3DA 12E8L 2YRZA 1E28A 4X9BA 1OAZL 3VD7A 1BJ8A 1OAQL 3P30L 4U1GC 1DANU 4Z76A 1YUHA 2DTMH 1CG9A 1NEUA 1MF2L 1S5IL 1IGFH 4PJ9C 4J8RB 4GW4A 5D72H 4GXVL 4JAMA 3U6RB 1T3FB 2NY5L 5KSBB 1IM3A 3VFRB 4XPHH 1QPPA 2EDTA 5TDOB 3TZVB 2NY2B 4IMLB 5HYIA 1BIIA 1PKQB 1I9RL 1FIGH 1BFVL 2NY4D 2ARWA 1J1OH 1V5JA 2Q8BL 5GHWL 1U8PB 1GRWA 3RGVC 4AENA 1YY8A 1X5LA 1OGTB 2VUOA 1LNUB 4R97C 5I8EA 1HHGB 2E8ZA 4JZOB 1KSRA 3O0RL 1LEGB 1JZ6A 4TNWF 3VXQA 4GLRH 2H1PL 3DO7A 1MCDA 4PTUB 1U8HA 4P5KB 3N0PB 1QO3B 4XMLH 1KN2H 3H9ZA 4RNRA 3JWDC 3H9SB 4HPYH 5IFAL 5J7CC 1EFXD 1H3VA 3U0WH 2MSPA 3VW3H 3I6LD 4MNHA 1EEZB 1B90A 1QZ1A 3BN9C 4WEUD 5GRUL 4BKLB 1Q9KB 3VXUE 3KPNA 4M7JL 3UBXI 4LSDA 2BC4B 4LLUA 2X4UB 3KPPA 1TNMA 4OLZH 2DQTL 4WJ5B 3L9RA 1N6VA 3QEQD 4RWHA 3JV4A 3SGEH 1JNNL 2B1HH 4OKVA 1ZTXH 1DFBL 2C3VA 4F9PA 1FNHA 4DOHB 5F9JA 5EOQL 4A2MA 3KHQA 1N8ZA 2NY2C 5CUSL 4JRXD 1AH1A 4LSPH 3ARGD 3GJEA 3QEGH 3PGCA 3OXSB 2H45A 1KJMA 1CFQB 5HYJE 1MEXH 2AXGA 4N1EA 2YPVH 2NXYB 3MYJB 4JO3H 3PV7A 3TBWA 3SDXA 1BZ9A 4OLYH 1NC4B 4WRLA 2VQTA 1WC7B 5CCKH 3MRMB 1YYML 4Z7VE 1HHIB 3MA9H 5CBEB 4EN3D 4CJ0A 5K33A 1U8JA 2EO9A 3FRPG 2V2TA 1MCOL 5KSVB 4G7YL 2YXFA 4PJBB 5C08D 1G7HA 1HHKA 4XX1G 5DJAA 2UV3A 3BWAB 3HC4L 3QQ4B 3GUTB 3T0BA 5IMMB 2O93L 4F9LA 2FGWL 4EXPX 4Z8FH 2GITA 2JCCA 3BGFB 4HUNB 1M6OB 5KSUB 3MOBH 1LVEA 5EFIB 4CW1A 4G43A 2Z8RA 2ED8A 4KHTH 2KDGA 2XZAL 5IQ9A 2EDRA 2X89A 2HVJB 1OQOA 4JZJC 1AR2A 3EO0B 3MUZ1 4XWOD 4WFGD 4NZUH 3RVWC 5BVJA 1JJUA 4XX1E 2K7QA 1JGEA 2MMXA 3OWEA 1XZ0B 3WV0A 4QHUB 2HT4D 4ZFGL 4QOKE 4YXHL 2HT2D 2HVKB 4L3CB 1I8IB 4LHQB 3WNLA 3BZEB 3ABZA 4LSRL 2BSRA 1CIDA 3VFMA 3KPRB 5BRZA 2P5ED 2ZUUA 5DFVC 3W39B 2K1MA 3CSBA 2BY0A 1A6ZA 3IDJA 1IAKA 4HKXA 5FYLD 4E41B 1RJZA 1OY3B 2OQJA 3QFDB 5ID1B 1YC7A 5SWSB 1DN0B 3RL1B 2YWYA 1WWAX 5FUCE 3TYFB 3PABB 2VDQH 3QNZA 5ADOL 3LIZL 4NQVB 1ZT1A 2DKUA 1FFQA 2VO5A 2XTLA 4LCWA 3HS0A 3EYFB 4K7PY 1MJ8L 1J7VR 3DUHA 2AV7A 2AKRB 1ADQH 3O3DA 5D5MA 1FL6B 4X99A 4PJAE 1JGLL 2R15A 4LCIL 4ZO9A 4NQXB 3DRTA 4CU7A 2XACC 4QRUA 1XGTB 2L7JA 4PRHA 4JGJA 4Y4HC 3HCVA 2NXZD 5CINL 5JHLH 2HLFD 3WNOA 3Q6FA 4EKXA 3T77A 4QRPB 5E9DA 4Y19A 2WP3O 5F89A 4ZD3L 5LCVL 3P9LA 3BVNB 4GG6E 1CDCA 3W11C 5GS0L 4F7CB 1CD1A 2WSKA 3AB0B 4LCYB 4NNYA 4NNPL 2CDEA 4ELME 1MCNA 5B8CB 4WNQA 3RIFF 1B0RB 2VE6A 4UDUA 2XA8H 4R6UA 5SX4H 4LLQA 1HKLL 4UOW0 4KZEH 3PWUA 4ZUUB 2VLJD 3VDCA 5C0DB 4WI3A 4KWUA 5IOPB 1D5ZA 5IIEB 3MNVB 5IK3A 3FT3B 4KAQH 1NKRA 1BQLL 2A1WL 4MA3B 3QDMA 4H20H 3LAFA 1H3GA 1KIQB 1EAPA 5DD0L 4NDMB 5L2JB 2AJSL 2YWZA 3EFDH 4RFNB 3KR3L 4APQD 4NYLB 5E95B 3QPXH 2YD1A 3MNWB 2A2QT 4OV5A 3U0TB 1EMTL 3JTTB 1FYTE 2X4PA 3CLEL 4BFEA 2EC8A 3C5ZD 4UMGA 1AD0A 4CMMB 1TVHA 4Y16D 2HWZH 3MLTA 1U8QB 4ZPVB 1K3IA 3B2VH 2CIKA 3L3OB 3AU1B 5K9KA 1KCVL 2OL3H 3RWEB 2IFFH 2VC2L 2CK0L 3ZTNH 3H3PH 1RSFA 3FTGA 5ETUA 1L7TL 5MEND 1FZOB 5FYJH 3BW9B 5EU7E 2C1PB 5FO7A 3LRGA 2E6QA 1D5XA 2BVQB 3O11B 5DHYB 3D1MC 3VXMA 5ESAA 2Q3AA 1C08A 3QAZC 3MXVL 5L8JB 1ZAGA 1QSEE 3K1KC 4R8WL 4HCRL 3L3GB 3BPCA 2JJTA 3SBWA 3S88H 1OT1A 3O41A 5I1LA 1U92A 1AIFB 3CX5K 3HI5H 2BXYA 3T3PE 5FO8B 1MNUH 4JFFE 5F71A 3SDCC 1QFUH 1YNTA 1NCTA 4K3HA 4XMPH 5EZIH 4TSCL 3U6RA 5DTFA 1N4XL 5ECJE 3FB7B 4W6YB 5ACZB 5KSBA 4MX7B 1YC8A 4IMLA 1PKQA 3G5XA 1YDPB 3SKMA 2MNUA 4JZNB 3SDYL 2NY6D 4M62H 4HWEH 3WIHH 3WIIL 4I4WA 1KPUB 5I1KH 4MJIE 1LNUA 5D9SB 4C83A 4JQXA 4OT1L 4AMKL 4L4TE 1HCVA 4Y5VC 3RA7H 1LEGA 1XCTA 3TIEB 2XTJB 3QIBA 1MFNA 2H32B 1KBGL 2VAAB 3FN0L 8CGTA 1MLBB 2FH6A 1QO3A 3P0GB 1FORH 1V7ML 2CXGA 3NCBB 3IDYC 2ESVE 4P3CH 1J0HA 1JTPA 1LGVA 1OAXH 3H9SA 3NTCH 4LF3A 2LVCA 1PEZA 4FQXB 2W9EH 4P2QD