4APQD

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
240
structure length
240
Chain Sequence
GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSGKGLRLIYYSYGAGSTEKGDLSEGYDASREKKSSFSLTVTSAQKNEMAVFLCASGSLLDVREVFFGKGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIGEN-PRESENTING GLYCOPROTEIN CD1D1
publication title Type-II Natural Killer T Cell Antigen Receptor Mediated Recognition of Cd1D-Sulfatide
rcsb
source organism Mus musculus
total genus 50
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2012-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4apqD02
2DS4A 3KXFD 3BRGC 1I85C 1EJOH 2XNAB 3SKMA 1LHZA 3ECBB 3ZSSA 4AIZA 4QRPE 3QZWB 1QHPA 4L4TE 3BJLA 3H42H 2Q86A 1CICD 2XZAH 5LBSL 4F7MB 3N1PC 1S9YB 1V8HA 1KCSL 5GRXG 2HRPL 2VDML 5AD0B 4AL8L 3BWAB 4QXTB 4NNXA 3LHPH 2BVTA 4F57L 3GSQB 1AGDA 2DLHA 3BHBA 3QDJB 1K8IA 3SQBA 5IJKA 1C5DA 1MPAL 4WW2B 5FYLH 1KEMH 2HWZL 4G8FB 3SE3A 1VEMA 4YXKH 4IRSA 4HGWA 1AO7B 4ZUTA 4OLVL 1PG7W 4OZIB 1JWSA 1F5WA 1MH5A 2MSPA 3PIQA 1NEZB 4YGVB 4I3SL 4HK0B 3OR6A 5F9WB 3CDGB 1S7XB 1N0LA 2P46B 2Q87A 3L3GA 1MRFL 1VCAA 3OJDA 4X6FA 1T1XA 1FSKC 4NZRH 4NQEB 5H37G 4NQUA 1QRKA 1YC7A 3FO0L 1IGCH 4MS8D 2Z31B 4EI5D 2NY3D 5SWQB 5D5MA 4U3CA 4KKBD 1QYGL 3VXMA 3FB6B 1I85A 2HVJB 3L7FA 5T1DL 1CIDA 3LVEA 5DMKA 1RPQA 4JFPB 1QLEL 3DURB 3HZKA 2FX7H 1IAII 2EDOA 3BI9X 4XI5D 4P5TC 2BNRE 3RQ3A 3FT3A 2ATKA 2ORBH 9CGTA 2EZ0C 4G6FB 3O9WB 3R0MA 3Q5OA 4I4WB 1GL4B 4WU5A 4BSVA 2C1OA 1OAYL 2VDKH 1YN6B 4YBHA 5D7IE 5C92A 3U0PA 3ARBB 12E8L 3HC0B 5F7MC 3D2UA 3BP7A 1F13A 2HJLB 1OTUD 4E41A 4HBCL 3PWNA 4HLZH 3WBDA 2A0LD 4Z6AT 1NUDA 1NFDB 2PYED 4LLWB 5F9OH 3Q6GL 2XN9E 3ULSA 3QIWC 4XVTH 5GRYA 4DTGH 3STLB 4FMKA 3PGCB 1FVDA 5EUOA 2ESVA 4RRPG 4NC1E 3WKNA 3GSWB 2R1YB 4NQSA 1HXMA 3THML 4ZOEA 4U0QB 4QY8A 5BZWB 3EOTL 1JGDB 5EH1A 4YLQT 5EIQA 1AXTH 3E1F1 1XEDA 2UWEE 5LCVH 3AB0C 4UILL 1S5HA 4LPTA 2CXKA 2XIDA 4L8SA 4U6XB 5GGSB 1UXWA 2HVKB 1MEXH 4K7PL 2EEAA 2R0WH 3PGFH 5GS0D 5K9KA 3INUL 1RURH 5I9QB 3B9DA 4NWUH 3FO1B 3MRNA 2BERA 2PXYC 4P5TA 4U1IA 3V2AR 4B7IA 3EAKA 2VL5B 1U8IB 5FCUH 1FCGA 3U6RA 4YDVB 5GGSY 4OJFL 3ZSTA 4ZODA 3HTLX 2UVEA 1MCIA 1NDMB 2NY1C 5IMLA 3LQAH 4Y4FD 4BFIA 3WXVL 3AU1A 5E9DE 3UTSA 1MLCA 4Y7MA 2DIAA 4Z7UE 2P24B 5D5MF 5AG8A 4TSAL 1T5WB 2BVUA 2J4WH 1KJVB 1MNUH 4X6DA 2EXWD 3EO0A 2EDNA 3LCYA 2OL3A 1UCBH 3V4UH 3QIWA 4AIXA 3V5DB 5FGCB 3U4EA 2P8LB 2APWA 5C6TH 4LCWA 4ERSH 3H9SB 1CDGA 2ZOLB 4PJGE 4EOWH 3HUJE 2BOCB 1H3UA 4M8VA 2HLFC 2QV2A 4M93C 4KKAD 4LLDB 2IMNA 4ODWB 1I3GH 1SJHB 3HKFA 1A7QH 1NC4D 2ED7A 4HH9B 3LPFA 4MNQE 2XQBH 5DI8A 1D5MB 2BHYA 4OZFA 2VDPH 4KUZH 1SYVB 5TE6H 3ABZA 2VRAA 1H8NA 3BVNA 3CZFA 3D39D 4O2CB 5EUOF 3NCFB 1OVZA 2PXYA 1YA5A 5T3ZH 1A6VH 1OPGH 2HTKD 4XTRD 2HFTA 4KKCD 2CIKA 1HKFA 4OF8A 32C2A 4QRRB 2MCPL 5TH2B 1WFUA 5I17B 3NCYS 3S35X 2HLAA 4ZXBC 1F4HA 2XY2A 5DQJB 1IVLA 2BXZA 2VERN 1UXSB 3BPLC 1HHKB 1FAKT 4QT5A 4OGYL 3MZGB 5KSAB 3QULA 1BQUA 4TUKL 3UTQB 5B38A 4JQIH 4Y4HC 4YDKL 6FABH 3JWDH 5CBAB 2GJ6E 1UCTA 1I75A 2YXMA 1T0MB 1ED3B 1FFRA 4GSDH 3VFUB 2VQ1B 4KZDH 2CMRL 2I5YL 2X4NB 4U1LA 4JY4B 1I7RA 3IFNH 1U8KB 1NSNL 1R3KA 4RQQA 1U91B 4X5WB 1DCLA 1I7TA 3HE7D 3RZCB 1FL3B 4P4RA 5FA3A 3TWCL 4JPWL 1M7IB 1TQBB 4OFDA 3VXRA 1DTUA 2NTSP 2HG5A 5MERA 1HH9A 3MOAH 4X6DF 5C9KA 4RGMB 4BUHA 1JNHA 3RPKA 2QQNH 3QCTL 1WBXA 3B83A 3KPQB 1KB5A 1VADB 1WWCA 3MGTB 4HGKC 5FYJL 3D9AL 1I1AB 4GG8B 1RUML 5EBWA 4GAJH 2R2EA 4P59L 3QXAB 4XC3H 3VRIA 1HDMB 2GY7B 3BP6B 1MHEA 1MSPA 3S97C 5D1XC 1S9VB 4ZXBA 2G2RA 4BH8B 5EN2A 1FFOB 1L0YA 2Q6WA 4P5MB 3WMSA 4ELKA 1QLRB 1P9MC 3I6LE 1EEQA 4NZUL 1R3JA 2CRZA 4EN3C 3V7MA 4FG6D 3CNKA 4Z7WE 2Z91B 4YR6A 5SWZB 2YPVL 1H3TA 4Y4HA 4A6YH 4XNZB 5EO9B 4TNVK 5CD5C 5DC9B 4G6MH 1KIQB 1MWAB 3G5VA 3GBMH 5E2VL 3CH1B 4YFLI 4IDJH 1NGPH 1KF9B 1A6TA 4JM2C 3K46A 4YHPB 1BLNB 3MNZB 5FYKE 3VG0H 4RCAA 4UQ3A 4OB5H 4WO4C 4O4YH 2X4SA 1CLZL 4LIQH 3T2NH 1JRHH 5IFJB 5ISZA 5IMKB 4RDQF 1YEGL 5CP7A 3GJFH 2QBWA 1QSFB 4O51A 2OJEB 1AY1H 3LRHA 4JRXA 3MRHB 5ICXB 4Y4KD 3L6FA 4QXGL 3BE1L 2VR9A 5HHOB 1VGEL 4WUUB 2EE9A 1CFNB 3JWOH 1ERNA 5FOBB 3O2VL 3BIKA 1Z5LA 1BQLH 3VI3E 1QG3A 1B88A 1TZHA 3ULUC 1EMTL 5EZOL 2DJUA 1W72L 2FSEA 5IESL 3R1GH 5D1XA 5HHMD 3R8QA 3QAZC 1MHHB 4PBWD 3RX7A 1FAIL 2D7PA 1P9MA 3IF1A 3V0VA 4EN3A 1D3CA 4HWEL 5TE4L 5L8JB 1J8HA 4PP2B 1F6LL 3GMRA 1MHPH 1A3RL 4P9HC 5I1GL 2XWBB 4CMMB 3I2CL 4OFYD 1T2QH 4LNRA 4X8XA 3TBVA 3KYKH 2YPKB 5CJQH 5ESVB 4KZEL 1WSST 2LU4A 3L1OH 4JM2A 1F00I 2AVGA 4N1EA 3WS6C 4DUWA 4KRPC 2R2BA 3OB8A 3LRGA 2OZ4A 1F11B 2C7UA 4WO4A 1CICC 4X6EB 5I30H 4P2QA 5JOPD 2WZPD 2ERJC 4J3WA 4U49A 1MIEL 5J9PB 5A16A 2QHRH 1DANT 4Z7QE 4BFBD 3MRKB 3EYSL 1IZJA 4FA8A 3MR9A 5C7XH 1KIRB 4GAYA 1UACH 4MDIB 3NMEA 5IW6B 1T89C 4RMQA 5HPMA 1U2HA 3I02B 5F1SA 4KJPD 1YDPA 5DSCB 2B39A 2NR6D 1J1XL 5D72L 2YEZA 2FJGB 3E2HB 2EYSB 3QDGB 1R24B 5CD3B 1YMHB 1TVBB 5C3TA 1YEEH 1OLZA 3U7AA 2VXTL 4K94H 1OAUH 1IAMA 4ONOA 4YDLC 4KV5F 4HG4J 4BQ9A 4OI8A 4OBRA 4HFUL 1PQZB 4YHIB 1SJXA 4NN6C 2O61A 1LEGB 3X13B 4EI5C 4KY1H 5HHQA 2NY3C 4KKBC 2FZ3A 2PUQT 2APVA 3KXFA 1R0AL 3X14B 1X3DA 5BS0B 4MHHG 1FL5A 1EHXA 1A1OB 4XI5C 2ZOKA 5I1HH 1CDJA 1H0DB 1RK1A 4X9HA 3S4SB 3T3ME 1CICA 2IPTH 2NX5D 2VZTA 4U7KA 2R1XB 2Q20A 5L0QB 1PKQB 1WCQA 2UZIL 3BISA 5FYKL 4WY7L 2FX8L 1MCPH 3OKLA 1ZGLP 5I16B 3VWJB 1YEIH 2W9EH 5KN5B 1T89A 5EU4A 4WJ5B 3ZYOA 1OTUC 1YPZB 4PTUA 4JM2F 3PDOB 4H88H 4M7LT 3U0TA 5FUCE 1VA9A 5IM7B 2JLLA 3VW3L 1A6AA 1M05B 1I8MB 2F58L 5D2LB 5HYQA 4N90E 2CDGB 1D9KD 1T20A 3C60D 3QB7C 2YK1L 2VXVH 3QJHB 5DS8A 1KTDB 3WD5L 2DIJA 1EO5A 3UYOD 2O5YL 3RY6C 5TQ2H 4RNRA 3CC5B 5F9JA 5JLZA 2O26U 5F3BB 4PY8I 1I3VA 2WIIA 3WDJA 1IGJB 2C5DC 4Z7VA 1T03L 4EI5A 1UB5B 4NKOA 4PRPD 3KJ6H 5GS0C 5GZOD 2VWEE 3LQZA 4HJJL 1N4XH 3ULUF 3DMMB 4MGXA 3FOLA 3RI5K 4FXLA 4KUCD 3MREB 3TPUA 2P5EE 2E6PA 2D9QB 1K2DB 5L88H 5E95B 4JDTL 2K1MA 4K3DL 3ARRA 4F7EB 1G7PA 1LO0H 1EZVX 1G9NH 4XAWL 2EC9U 1W0VA 3TIDA 4EDWL 1HHGA 2K3TA 1KJ2H 3UROR 2ZWLT 4Y4FC 1OL0A 4G5ZL 1NKOA 4HBQA 4KDVA 3GHEH 2B2XL 4ZOCA 3O3DB 1C7TA 4UBDD 5DWUH 1U8HB 5GGTL 3MCLH 2FJFB 3V5KB 1QZ1A 2AERT 4I18B 1FL6B 1HYSD 1KYOK 1AFVH 3IDIA 5EA0H 2PYEA 3NA9H 2A6KA 4LU5L 3WLBA 1RZFL 1F02I 1S8DA 2IANB 4MJ2A 3D39E 1IEAB 2VXSH 5CZVH 1DLFL 2PETA 2VDNH 4YHOL 3RY6A 4NN5B 2F5AL 2C1PA 3MX0A 4KKAC 2X1OA 3ZE2F 4K7PY 2FO4A 4NWTH 3GGWB 4LKXB 5EU7C 5E7BA 4PJCB 1BBDH 5LGHH 1JBJA 3PWPD 3GIVB 3CVIL 4OLZL 5ICZA 3IU4L 5EOCL 4AM0B 4EUPA 3HZMB 3WYRA 2HTKC 3RVTD 4XTRC 3BUYA 4KKCC 3WNKA 5JA8B 1U95B 4DGYH 3PL6B 1Z3GL 4WWKD 1ZEAL 5IMMA 4PGCB 4KTDL 4Z7VF 3VE0B 3OHXA 4JDVB 5T3XH 1MCBA 1AR1D 1TETH 2B0SL 1R3HA 5E6IB 4QCIA 3D5OF 4OV6F 5GISL 3HI6H 1X5JA 1ZA3A 5AWNH 3RWFB 1N6QH 1BJ8A 3ILPB 4OLYH 1QACA 2VITA 1LEKA 1J86A 1ZT1B 4IOFD 3IAPA 4P3WA 1E4XI 4WUKH 3MRIA 4FOMA 5IQ9B 3V4PL 3PWUB 4P3CL 5E6YA 4G3YH 4F33A 4QNPF 5DD0L 5JPNB 3HMXL 1JWMB 2B4CC 1QRNE 1XCQA 3MRPB 4XH2B 1ZLSH 4FQLL 3HE7C 1NC4A 2FJHB 4O9HH 4KK5D 5DVOA 5D70L 5E2UH 5C0RH 3UTTD 2JK5B 4LLUA 4P57A 4U2YA 4CADB 2FHCA 3LPWA 4GRWH 1CFBA 3HZYB 5JOFA 5F6IB 3QFJD 4C56A 1Q9KA 2FGWH 3IRZA 2X89D 2ATPA 2YUVA 3F8UB 3BP5A 4R0LB 1HHHA 3MV8B 2R2HA 4JPIA 1ORQA 3WUWA 1H15B 1BEYH 2Z92A 2X4QB 3R06A 1YNKL 3W9DA 1T1WB 4TTDC 5KVGH 2W0FA 1IAIL 3ZZ1A 3V0WH 1JNLL 4MCZB 4FG6C 3TEUA 1XH3B 3BFOA 4HIJA 3CFEA 4R8WH 4TTGA 1CGYA 3IVKB 5MEPA 4OF7A 4UMGA 4ETQB 3DROA 2W65A 3MLUL 4NQTA 1AGCA 5H94A 3OKEA 5I71B 4NFBA 1B2WH 4AEIL 2BNUA 1HQ4A 3MV7B 4BZ2H 3HE7A 3TBYB 2P8PB 3GMLA 4G9FB 3ZE1E 3DSFL 5DD6A 3UEZA 4FQIH 4TULH 4KDTA 4CVXB 3VXTA 1JHKL 2EDDA 4OQTH 3SDYL 5IHUL 3WS3A 3S36L 1FRGL 1JGVH 1FN4A 4UUJB 4Y4KC 5TQ0H 4I1NB 1K85A 3RWHB 1ZHNB 3PNWB 4PJIE 1FO0A 2IALA 3BQUC 3KS0H 4FFVD 3FN0L 5DLMH 1NCWL 3LKRA 2X4RA 3C6SA 3EYQC 5FB8A 3C2AH 1J0ZA 2BVPA 3K8KA 1GPOH 3QFDB 1HEZB 5C9JB 5KAQG 5IOPB 3SDCD 2P7TB 1WVZA 1FGVL 1CE1H 4GLRH 3NH7H 3I9GH 1F3RB 3K8LA 4M7LL 2FATH 3MCG1 2YN3A 1ZSDA 5IVXB 3BZEA 5I19H 5IVOA 2BY0A 3S8WA 4NSKA 1A7PH 1FZKA 1KJ3H 3W2DL 4PRDB 3QDMD 4YXLL 1INDH 3HNSL 1X7QB 4JHWH 1OGTB 1KULA 4YC2B 1VGKA 3WO4C 1QA9A 3VFSA 5EFIA 2B1HL 1YUHA 2BSSA 1RJZA 2DF3A 4D0DB 4G8GA 1IAKB 2XYCA 5GPRA 3PWJA 4K8RL 2DQDH 3P2TA 3O11A 2X09A 4Y4KA 3GI8L 2KZ1B 3F12A 1NCTA 3U1SL 3EDFA 3QXTA 2FD6L 4YHKH 5GRWA 1EEZA 3M17B 4QHMB 4LLMA 1MCOL 3BQUA 2DTML 5L9DL 2NR6C 5DD5L 2DQJH 3VCLA 4NDMB 1OY3B 1WT5C 3MXVH 2PCPA 3S37X 1PW3A 2VJXA 2A2QT 3O4LB 5BV7L 1FZOB 1U3YA 2BNQB 1OCWL 4XMPH 2ICEB 5EOQH 3VMOA 4I2XA 1XGQA 2NX5E 3S88H 5IEKA 2IADA 3W81A 1B4JH 3SDAD 3LMJL 4YDJB 3IETA 4PJ7A 1NC2D 2DN7A 5I73C 2H2SD 1PZUB 3BZDA 4OFYA 4YHNA 2NW3A 3ZKND 5INDA 3VFRB 5ADPH 1YN7A 1MJ8H 3BDBA 4GG6B 3FONA 3CLEH 3U9UA 3WHE0 1KCSH 1ZLWH 1C5CH 1NCDL 3GIZL 4P9ML 4Y1AD 3PE9A 4PJDA 2Z8VC 5JORB 4D0BB 4D94A 3FT4B 3KYMB 1XF2B 5HGHA 5CEZH 2HP4A 5IUSA 3CK0H 5EIIB 1HSAA 1GOFA 5E94A 4EQ3A 1TLKA 5MENB 2CSPA 3O3AA 4YH6A 3VG9B 4OLVH 3VGEA 3NGBC 3MROA 1MJ7L 1XR9B 4KQ4H 4G6KL 1G6VK 5ACLA 3BGFB 4PRPE 5CIPA 3L3DB 4NKMB 3CSBA 1MRFH 1D9KC 5GGVH 3VXOB 2KQMA 1ACYH 2XTJD 2VUOA 1AC6A 4M02A 3GKWL 4M7JH 2QSVA 1KELH 5KOVC 2X9YA 3FFCE 2DQIL 1YYLL 4Q74A 4C83B 3QXUA 3QUYB 4YEEA 1MCDA 5FHBH 4LQ1A 4H1LB 4MB4A 5IB1A 1Q9WB 2A6DB 4XP5L 1YYML 2A83A 3IYLW 5HYEA 1RZ8A 5GZOC 1RHHA 3TO2A 4HQQH 5T5FL 1BVZA 2Y36H 4L3EB 4JN2A 4QTHA 2VKWA 3TYFA 5GRJL 1F4YL 1KCUL 3KPSD 3HAEB 3MJ7A 4LRNL 4CGTA 4EI6A 2VABB 3O8XC 3MOQA 2IH1B 5C09D 3IDNB 5KSVA 2ADGB 1GYAA 3QO0B 3ZYIA 4LSQH 4X4MA 3RNQA 3P11L 2RAMA 5A2JH 5D96C 1D5IL 4PJ7F 3VJ6A 2Q8BH 3MO1A 5I1JL 4PGJA 4GO6B 4I0PA 1WIPA 4UT9H 4UBDC 4UIMA 1EVTC 3MNWB 1NPUA 4WHYG 2DWDB 1HYSC 4J3OC 1M6OA 4AYFA 2RJMA 1NGYB 3G5XB 43C9A 3DXAD 1IBGH 2AJSL 4PJDF 4J2XA 4DZBA 3BZ4B 3RL1B 4JN1L 3DBXB 4X4XA 2BFVL 1D9KA 3NFPA 2NY0D 4DAGH 2E7LC 5I66A 3NFSL 1H3PL 4Y5XC 3V8CA 1ZTXL 4R2GD 2EH8L 1AJ7L 3QPXL 1ADQL 1T3FB 4N0UB 4C54A 3GRWL 4PLKC 3KG5A 4ZTPL 3QQNA 4RAVB 2LU7A 1G6RH 3BZFB 4MD0A 3RUGB 1B3JA 1V5JA 2FH8A 3DX8B 3NN8B 1MRCL 1QR1A 3KHQA 4JRYB 3BKCH 3C09C 1LO3L 4OCSL 3T77A 5HVGB 1YEFH 3WFBH 1XF5A 3O8XA 1CGTA 3RVTC 3BW9B 5IB2B 2X44D 4OCXH 1B0RA 4IRJA 4WWKC 2VLJB 3U46A 3QT2A 1U92B 4I13B 1AR1C 4LHUB 5D93B 5I18H 4M5ZH 1NCBL 2D7NA 4KVCH 1T1ZA 4CN4A 2EDEA 2FLBT 2YZ8A 3KJ4C 4NRXB 4N8VA 3NTCH 4YXHH 1IGTA 5DUMH 4FQJH 1G7IB 3U0WH 4IOFC 3G6AB 2OJZL 1JMZA 1EH9A 1GGBH 4U6YB 4AT6B 5I75B 3UTTE 3N85H 2E8YA 4W6WB 2IPUK 1DUYA 4BKLA 1B4RA 1XIWB 4JFEB 1ZANL 3OKKA 1JYNA 4LSUL 2E7LA 3KPTA 2AV1A 1RU9H 4KROB 1JPFB 4Y5XA 3UBXB 2VTFA 2IQAA 4H26A 3GB7A 3KPMB 3NAAL 1CFQB 4KK5C 5IHZB 4ODXA 4Y16C 4RWYH 1YQVH 2EC9T 4ZDHB 2EYTB 1XFPA 3RVXD 2A74A 5L2KB 3DOSA 1CGSH 2OP4L 3PWPA 1LDPL 1BGXH 3L5XL 2ZG3A 3PHSA 3W11C 4GH7B 3S96A 4M48L 2JELL 2DQHH 1L6XA 3T4YA 5DVNA 2D03H 2E9BA 1IM9B 4HHAA 1O7VA 1TVHA 5DRXB 4M6AA 4FNLH 4GJTB 3MOBL 1KTRL 1RMFL 3HCVA 5I74B 3NIFE 4TYUA 4UT6L 5J0BA 2VMFA 4XP4L 3BEWB 1I4FA 4YDKH 5LQBL 3ARPA 1HKLL 1RIVH 3RIAK 3OB0K 5B39G 1BJMA 2CDEB 4JREC 1A1MB 1S3KL 1H5BB 3U36B 4O02H 5J11B 4R4BB 1PSKL 4MQSB 3E3QE 2DMCA 4K71C 2EICA 1CD8A 2P4AB 2XZQH 4NM4H 4U31A 3GMPB 2EYRB 3ARQA 3AROA 4UINL 5F1NB 4YHZH 4XNMB 4OZGE 5J3HD 4HW6A 4JKKA 3GMQB 3U30B 2XWTB 3LIZH 3GUTA 4HIXH 2KUTA 1F4WL 3LZFL 1RVFL 1IKNC 4WTXA 4UV7H 2D31A 3MYJB 4Y16A 3X3GH 1LO2H 4L29B 35C8H 3GBNL 5CCKL 2YOCA 3BPOC 2QL1A 4QHKI 2ZNXA 2WUCL 1FYTD 4WENB 4LQFH 4P59H 2H2PD 1ETZA 5IQ7L 4ESKA 3LY6A 4XPAL 3P40A 4GKSB 2X89A 2FX9L 4FFVC 3SDXB 1KJMB 2P5WD 5SWSB 3RVUD 1I1FA 4NRYB 1SY6A 5FCSH 3KHOA 3OAZK 4PJEB 4S1QL 1OM3H 1FFQA 2A1WL 4U4BA 3B6SA 3QDME 1U93B 4OLWH 3TP4A 2YPVH 3SDCC 4J6RH 1FNEB 4JFQA 4QGYA 3LN4B 1QEWB 1JHLH 4LARL 5SX5H 1I3UA 4JCMA 4POUB 2BRRH 1A6WH 2P47B 5CJ8A 1YJDH 2JJVA 4JZJC 4B7LA 1YMME 3LKNB 1T4KA 1E6OH 4HKZB 5ADOL 3R0NA 1NBZB 3ULVE 2AEIT 2IFFH 3S5LB 3DGGA 4NQVB 2OR8A 4RMWA 3W5MA 3WUZA 1HSBB 4ZTOL 1NEZA 4XWGH 1IKNA 2M8XA 3FO9B 2I07B 2ZUYA 2FECI 4YHMH 1HH6A 4YHYC 5HYSG 4JY5H 3NACL 4NO5B 5DJ2B 1CVRA 3WIFB 4V2BA 3SKOA 5CEYB 2YD6A 3QH3A 5EZOH 2PR4L 1QQDB 1W72H 1Y0LA 5T1KB 1NFIA 1P1ZA 3A6BL 1FNGA 4Z8FH 2FYYB 2V9RA 1XF1A 1ZS8B 5JA9A 2DQUL 5C0CD 5L7XL 4XVUC 5DA0B 3KGRA 1BVKB 5KSBA 2NY4B 4GMSL 1CBVH 1I7UA 4OTXH 4KRLB 2I9LA 4GS7C 1A1NA 3SDCA 1JGUH 1IGFL 2NY6B 4XBGA 1A3RH 1AIFB 4P49A 4TVSa 3RDTC 3CFKA 1DBML 2AJVH 5CLTA 1SQ2N 3VXRE 1OARL 4Z78B 2EDJA 4R4FL 3SDAC 5D1QD 4KZEH 1AI1H 1HHJA 4JZJA 4L3AA 2H2SC 3SE9H 1DBKH 5AZEH 3HC0A 3ZKNC 4LAQH 4NNYA 1XGUB 5T1LB 5FO7B 2DKUA 4X6CA 2PN5A 4GXVH 3TNNB 2FEDC 3JV0A 1MIEH 3O41B 4W6XB 3LD8B 4Z5RA 1BZ9A 4N0FB 2NXYB 1E4XL 4U1KA 3UX9B 1XAUA 3ARXA 2FBJL 3O45B 2G5BB 3MRGB 2JCCB 3Q3GB 2XTJE 5BV7B 3QSKB 2V5MA 4R26L 1IGML 3QWRD 5SV3A 2CLRB 3E8UL 3U9PL 4H5SA 5AZ2H 4U6VL 4NRZA 3VXUB 1WK0A 4I48B 5DYOB 4KMQA 1ONQB 3HC3L 3TO4B 1CDHA 4NJ9H 4B5EA 2VXTH 3MA9L 2NNAB 1AGEB 4A2MA 2OL3L 3ZE0F 5ECJE 4OSUH 3HFMH 2YHGA 4H8WC 5F3HB 1OP3K 1BOGA 4KVNL 5C09E 4QF1B 2R0KH 3RDTA 4MNGE 4XB8A 3WNLA 1NDMA 1P84J 3SDAA 1AE6H 5E8PB 5I1LB 2BHZA 1IE5A 1OAQL 1N0XH 4F7TA 4MA8H 4P46B 4KK6D 4HWZA 2EO9A 2P24A 5GGQL 4K55A 1T5WA 2BY2A 3OXSA 4MXWL 3CCHA 3QQ4A 4ONHB 3V79C 4KI5D 5D7KE 5KSBF 1T66D 4Y1AA 1AQDB 4U6HA 4ZG1A 4OD3L 5AUMB 4KFZC 4WY7H 3UJJL 3V5DA 2ARJB 4S0SD 4XNUL 4Q9QH 5FKPB 5ESQB 3IFPA 5CINH 5F7EL 3NCYP 5HDOA 4BQBA 2PTTB 2I25N 2FL5B 2VKXA 4MZ3A 4NCC1 1BQHB 1FYHB 4Y89A 2M26A 4PGDB 3EJZD 2VLRD 3H9ZA 5ELIA 4LF3B 2CO7B 4LDLB 4PJ9D 3AS2A 4OD1H 3BKMH 4X6CF 5J06A 5CZXD 1OT2A 3TCLB 4TVPD 4XP1H 4OCYL 1UM4L 3P4MB 4FQPA 4RGND 5ANMA 3U83A 3MFFB 3N1QC 5C8JB 2Y9RT 5HY9A 2NY0C 5FYLD 4X7DC 1IC1A 4AMKL 4JFHD 2FO1A 4I9WE 4K3HA 3CXHJ 1YNLL 4R2GC 1RIUH 1OP5H 1DQLH 3IDXL 4NUGH 3MSPA 3GHBH 4OD2A 1MI5B 2NY7H 4L4VB 1A5FL 1HHKA 3EYFA 1I8LC 3VXSE 5DHYB 1CD1B 4R4ND 2YMXL 4HUUB 3AXLB 4Q97A 4RRPA 2JIXD 4XAWH 2A9NH 2X4PB 5EC1A 4WRLA 4PJAE 4ZUSA 1F8TH 4CDGC 5F96L 1KB5L 1JFQH 1OLLA 4AEHL 4MJIB 4B0MM 1KLUA 1C16A 1T22B 4F80A 3TBWA 3T0XA 4I3RL 3EDJA 1EGJA 3RA7H 1KUMA 4U1JB 3KYNA 1FL3A 1K3ZA 1RZFH 1RIHH 3MRRB 3P9MB 1QFWI 3EO1A 5I8EB 3LRSB 2V7HA 5E4EB 1HXYB 1JI2A 4NKDB 1UWXH 3C6LD 3G04A 4D8PB 5CGYC 1W0WB 3JTTB 1JL8A 4YHOH 4CUCA 5CWSB 4QRUB 5D7JD 4JG1H 4Y5VC 5JMOC 5I2IB 5DJAB 4PRBB 3DX9B 4P4KC 2VXUL 4L9DA 3NCCB 4PB0L 3WFCL 3CUPB 3P73A 3U4BL 4MNHB 1Q38A 3MJ8A 1JZ5A 2KDGA 5EOCH 4PS4H 1I8LA 4ODTH 3DI3B 3ARYA 3HG1B 4NKIL 3O0RH 1KTLB 3A67L 5IFHH 1CVSC 1GGYA 5TDOB 2AV7A 5D71L 3V6ZB 1K4DA 1P7QB 2VE6B 8CGTA 2YSSB 3SN6N 1ODAA 2BOBA 4UU9A 3UJIH 4XAKD 2SEBA 1P4IL 3VFTA 5FEBA 4XP9H 2UYLA 2G9HB 4UDTB 4DQOH 4MDJB 4AK1A 3F58L 4OFPA 2OTWA 5GS3A 4MLSA 4DCQB 4Z7VE 1I8IA 2X70A 3U82B 5HDQL 4P3CH 4WI7A 4KTEL 4GKZA 5GJTL 5DFVC 2CK2A 1S7WB 1S7SA 4IBLT 1GIGH 4FQLH 1CFNA 1JP5A 1MFNA 4Y5VA 1QP1A 4P2RD 3BAEL 5DGQA 4JO3H 4N9OB 4L9LC 2MWCA 4P4KA 2Q8AH 3TT1H 1MJUH 3L95A 5E1AA 5D70H 2CLVB 1B0GA 2Q76A 2AJ3A 5K59F 3WSQH 1QPPA 2YUWA 2OZ4L 1IRAY 1FCCA 3MLWL 1FFPB 1KXTB 4WNQB 3VXPB 4GW4A 4H25B 4Y2DB 3D3VE 4OZHA 1BD2D 4MCYB 1A2YB 3MACL 4XC1L 2J12B 4KK8D 5FGRA 4NZTH 5DQ9B 2QHLA 4DWHA 4N5UA 2PO6B 3DTXB 2H2PC 3QUKB 5C6PB 2I24N 1DFBL 1U8PA 1X5AA 4HLJA 3WIIH 1MCLA 4UQ2B 4NQCD 4AENA 1P2CB 4HK3N 3RVUC 1KNOB 4P23C 1F58L 2JB5H 1S9WB 5MEQA 4YO0B 3K0WA 2WBJD 5IV2A 3SQOL 4JFFA 3ULUL 2CUMA 2DBLL 1EPFA 1A3LH 2VISA 3SKMB 4AIZB 3C8KA 2HT4D 1INQA 3SE4A 1CF8H 1P84K 1AR2A 2Q86B 1K6QL 1DBJL 3QI9C 1MJJA 1ZKAA 4JE4B 3BGAA 4UT7H 4AEIH 1W8NA 5JXAH 1N5YL 5C0ND 5JXED 1OGAE 1JGLL 4P9HL 4NNXB 2VIRA 3G5ZA 1AGDB 3BHBB 3TBSA 1K8IB 1YEJL 1C5DB 3S3JA 3ZTJG 4JGMA 4IRSB 2FLRT 5C0CE 2EYSA 4HH8A 4ZUTB 2FIKA 1I1YA 4Z77A 1BFOA 4NCC2 3EZJB 1JWSB 1MH5B 2DYPB 4OT1H 3PIQB 3GFUA 1FYTA 1GJIA 1NBYA 5EU5A 1VFUA 1I7ZA 1QFPA 1NCWH 1V7NL 4CVZA 3L3GB 3OJDB 3DX6A 1T1XB 1DQDL 3PP4L 1CWVA 1A21A 2P5WA 1JYXA 4LBEA 5F7LB 3IKKA 4P23A 3CFCH 1F90L 1PG7H 1QR4A 4ZUVA 5D5MB 3B9KC 3VXMB 4OZHF 2OYPA 5DMKB 3KPOA 2R1XA 4ELMA 1OSPL 1IQWH 1PKQA 3HZKB 4TNWF 3VFPA 1U8LA 2HKHL 4WEBL 3MBED 4F7CA 1NJ9A 5EUKA 2O5ZL 3JWNC 2ATKB 5D1QC 3QI9A 5I8CA 3JBG7 4NP4H 3QG6A 4XPBL 4YXLH 3HS0A 1PLGH 1M4KA 3QYCA 4WU5B 5DR5L 4BSVB 2C1OB 3GSXA 3QNXA 3FHQA 3DUHA 1QBML 3BDYL 3K2MC 2K7QA 3U0PB 2F54D 5IM7A 1WLHA 3D2UB 3NCBB 4E41B 3PWNB 1EAPA 1XGPA 3MJ9H 2WINA 2ZCKL 3OF6D 2QSTA 4QXUH 2WANA 2D7TH 5A43C 4ZFGL 4AY0A 1CGXA 1D6EB 2EEBA 3ULSB 2R0ZH 1XGTA 3BP4A 4FFWD 4UNTA 2D7OA 2GCYA 1BWMA 2KKQA 3QCVH 1FH5L 4X8JA 2FD6H 1FVDB 2P49B 5EUOB 2ESVB 4ONGL 4QOKD 4E5XA 4P2OD 4NQSB 5I15H 1GHFH 1HXMB 3L5WA 1MCSA 3MXWL 3RWCA 4QY8B 3WFHA 1FSKB 1NCUA 1N64L 3CFBA 1S5HB 1JYWA 4HPYH 1IC5H 1NLDH 4I77L 3M1BA 1UXWB 5JHLL 3B9KA 5K9KB 3CAFA 1DZBA 1K2DA 3X3FH 2XQYK 4MQXD 3MRNB 1IGIL 2HJFA 4P5TB 4W4OC 4Y8DC 4U1IB 3UYRH 1SYSA 3GSNH 3PQYD 1CS6A 5D1QA 1WQVT 4BSJA 1JZ8A 1TZIA 3D87B 5F7KC 3U6RB 1DR9A 3HPLB 3U4AA 5IMLB 2VLRE 5C08E 4BFIB 1W0YT 3LDBC 3AU1B 3UTSB 4HCRL 4KI5C 1MLCB 1T66C 1FGNH 5GS0L 3RX8A 5J7CC 3ESUF 1PGRB 4TVPE 4ELMF 3C8DA 5D7LD 3OXRA 4X6DB 5JDJA 3EO0B 3SGKA 3UTPE 4XXDA 1J10A 3QIWB 1X9QA 4PJBE 4ZO7A 4LOUC 5GGUA 4Q9RH 3U4EB 5HI5C 1G1CA 2X42A 4LCWB 4MQ7A 4G6KH 4JFHE 2XV6B 1I3RA 1JWUB 2A6IA 2DQEL 3QWRA 5FA4A 5F88A 4YX2L 1NL0L 4PJ9C 3G6JE 1UWGH 4V1DA 3K7UA 4Q6YA 5DFWH 4TRPH 5CZXC 1C1EH 4O5LH 3O2DH 5D1ZD 3V95A 3AB0B 3GKWH 4S1RH 3ZKXC 1OF2A 1WGOA 5BRZE 4R90L 4RGNC 5TF1L 3HZMA 3NPSC 5DI8B 3C2SA 5HI4D 4OZFB 2VDQL 2R9HD 3OJVC 3CZFB 2AQ3A 1PVHA 2PXYB 4PV8A 1CQKA 4LSSH 4ZS7H 2DM2A 3IDMA 4HAFA 2IAMD 4W4OA 4FQQB 3ZMRA 3O6ML 4Z7NE 5L8LB 4MSWB 4M1GL 4OM0L 4JG0L 32C2B 3QDJD 5GRJH 1HOCA 5AEAA 2P8MA 2HLAB 2NY1B 3KS0J 3ZT5A 3VGAC 1HQRA 1U8NA 4G6JL 1AO7D 4QT5B 3UZQA 2VLKE 4KJYA 4FTVE 5MP6H 3QULB 3P11H 4YBLC 4EDXA 2AJYL 4RAUB 5IHBA 4AG4H 4JVUA 3F7VA 1YY9D 5I1JH 1RHFA 1DN0B 2W92A 2RFXA 4XH2A 3VGHA 5INCA 4PRAA 4U1LB 4N1HB 4DGIL 1I7RB 3RVVD 4Z7OE 4GRMA 4PJ9A 1R3KB 4IDLA 4RQQB 2FJHA 1T2XA 1I7TB 4KU1A 1CL7I 1UZ8A 2FECL 4M93B 4ZAKD 2ZJSH 4FQ1H 4P4RB 5FA3B 1WZMA 3STZA 4CADA 3WO3B 1IARB 2HG5B 3IXAA 2R8SH 5MERB 1G7LA 4PGEA 1HH9B 3C6LC 2EDQA 3NFSH 2C9AA 4WDIA 1JNHB 1VFBA 4UV4L 2CD0A 1WBXB 4R0LA 3B3IA 1DSFH 3O9WD 2A77L 4MA1C 3MLSL 3U7YL 3OKOA 5K93A 5EBWB 2B4CL 2R2EB 2FRGP 4YFDB 1KCVH 1JNJA 3VRIB 1RUPL 3ARBD 4PJCF 5E2TL 3VGBA 4XAKE 1TMCB 2GITA 3VFGL 1MHEB 4IRZH 4L8CA 4ZXBB 2KPNA 2G2RB 5BMFL 5EN2B 2QQQA 2Q6WB 3BPLB 4PV9A 4ELKB 3MRMA 3KDMA 2R4SL 4XX1E 1QSEE 1R3JB 4K23L 4ETQA 4TOYH 2BY1A 2JKXA 4MJ4A 4YR6B 1ZVYA 1P7HL 4Y4HB 1A0QH 2IH3A 1NCBH 4ALAH 5KS9A 2AJUL 2NY5H 1FO0L 4DKFL 3G5VB 4YE4L 3CSGA 2GTZA 1A6TB 3BPCA 4XCCL 2B5IC 4Q58C 5J12C 1EZVY 1Z9LA 3ALXA 4UQ3B 5E99L 4KI5F 1X6NA 3ZDYF 3RY4A 1P4LA 5MHSD 2EIDA 3H2WA 1CE6A 3LQAC 1ZANH 5ISZB 4ZNCD 4GRLD 4OIIH 5CP7B 2X40A 3C6LA 2B8OT 4O51B 1TDQA 4UDUA 2ARWA 4JRXB 5I0DA 1MFAL 2APFA 3SE8L 2GK0A 3L6FB 4ZO8A 3ILQD 3QCUH 3BX7C 5HVWA 4GQPH 5JW4R 3BIKB 5HI3C 1FZJA 1Z5LB 4G43A 3L5XH 5C9JA 4PRHE 1TZHB 4JO4L 3QXWA 1MUJA 3VWKA 2FSEB 5D1XB 4DKDC 2MTPA 1T0PB 1HNGA 3OPZH 4KK8C 3QXVA 5K9OA 1V3MA 3VGFA 1EFXD 3WIHH 3IF1B 3V0VB 4EN3B 5J6HA 3D85D 1J8HB 1ZHBA 3LKOA 3H9SD 4Z95H 5GSRA 4XP4H 2AK4A 3GMRB 3QEQA 5LQBH 1HKLH 4M62H 3KPRD 4TSCL 4ZFFA 2ZCHL 4FZ8L 5IBTL 4LNRB 3TBVB 2WBJC 3MLXH 1EO8L 4JM2B 2CXGA 3DNKA 4PD4K 5GRUL 4X0KB 2R2BB 2HT4C 2YUXA 4LMQE 3S35H 1MFBL 3LN5A 5F7DA 3IJYA 2C7UB 4WO4B 4J1UB 1RULH 4P2QB 5FV2A 2BVOA 5DHVH 4K7PX 5LAXA 5A3ID 2D3VA 5T3XD 3FB7A 3VXNA 1IC7H 5A16B 5C0NC 3HMWH 4UZGA 1UA6H 3MR9B 5KS9F 3BKYL 4QTIL 4GAYB 4P2RA 1F4WH 1JTPA 2BXYA 3MV9E 1MCWW 2GY5A 1NCAH 5H35A 2CR6A 2FH6A 1S7VA 2IGFH 4DW2H 1E28A 2PTUA 5CCKH 1J0YA 3LS5L 4RFOL 1EUUA 5CJOH 4XNQA 5L8KB 2VSDA 1YDPB 4PG2C 2J8UB 5DRZA 1BD2A 2ICEA 2YEZB 4KMTL 1K5NB 4PRNA 4M6NH 4HJ0D 2DJSA 5BJTA 1ZGLB 3QAZB 1ZLVH 3OBAA 4X4YB 1P5VA 3KNBA 4YBQD 4DOHE 1S78D 4F58H 2A1WH 3D6GA 4NQCA 4YUEL 2O61B 1NUFA 2YD9A 1KFAH 5HHQB 3VFWA 4E9LA 4NOFA 1PY4A 2WBJA 3KXFB 5JORA 3RZCD 3C9NA 1G9MH 1QBLH 1FL5B 3HC4H 4KRPB 4GUPA 3MBEC 4CW1A 1FE8H 3ARTA 2ZOKB 4GQ9L 4PJFA 1RK1B 2G60L 3TIEA 1CICB 1BHGA 5HTSA 4LVNC 2ERJB 3KAAA 2LVCA 4PRIA 5HDBE 5IVXF 4WFFD 5EU6E 4QOKE 2Q1EA 4BFEA 5JW4Q 3OKLB 3FQXA 4XVJL 2WK2A 3ELAT 1QFWL 4JM4H 2R29H 5C6WH 4PTUB 3RKPA 2CGRH 3U0TB 3P9LA 1MY5A 3FQTB 1TJHL 2F53E 2AS5M 1VENA 1CXIA 4PG2A 4U0RC 1A6AB 4LSTL 3DRQA 4FFWC 5HYQB 43CAA 4M43L 1HINL 1T20B 4LPWA 4YAQA 4P2OC 3A6BH 5DS8B 4X80H 1OP9A 4LPUA 5DMGC 2X4OA 1FORL 3IJSA 2DQUH 3FQRA 3RHWK 4JFDD 4YDLB 2AI0L 1WIOA 3K74B 4YDIL 4RNRB 5F9JB 2BDNH 4DZ8A 5IB3A 2WIIB 4NN6B 4EI5B 4NQDD 4NKOB 2NY3B 5BCAA 1R5VA 3CXDL 7FABL 3LQZB 3JWOC 3FOLB 4MQXC 2PYFA 5FUZL 3TPUB 4LCIH 1Z9OA 3MBEA 5JHDD 1AGFA 3EO9L 1QSFD 5ITBH 5JW3H 5I1IL 2UUDK 1JPSH 5DJ6B 1G7PB 3U2SA 3TIDB 1W0VB 1HHGB 4U3XA 5HHOD 4CJ1A 4JO2H 1CQYA 3W0WE 5KVFH 2YPLD 3V8OA 5KTEL 3P3YA 1TVDA 2Y7QA 3VFNB 2F54A 4YNYA 4A6YA 4JR9L 3ARZA 5DT1H 4K3EL 3IDIB 3DBXA 2PYEB 4XPTH 4HEPG 1DQMH 2FHFA 1IGMH 4PJFF 4XPGH 3WLBB 2CK0L 3NZHL 1S8DB 4P2OA 1BPVA 1KSRA 4FQ2L 1U8OA 3K2UL 3MRJA 4JHAL 5IHLB 4NGHL 4Z18A 1T3FA 5EPMA 3HC3H 5C2UB 3ZDXF 2X2YA 3AS1A 4LEXH 3ZHKA 2XA8L 2C1PB 2OL3H 5F7NC 5KAQF 4HD9A 3PP3K 3QDJE 3GJFA 5D1ZC 3ZHDA 4PLNC 2FO4B 1UKSA 3OAUL 5HHXH 2Y07L 2OR9H 3MCKA 3MLVH 4R96B 4LCUA 1AO7E 1E27A 1ACZA 2R9HC 5IB2A 4PJ5A 4OZIE 4EUPB 4KAQL 3QG7L 2ZCLL 5JIKA 1CLYL 4JHBA 1JTTA 1SM3H 1G7JA 4LP4A 2IAMC 3EFDH 4UTBL 2BMKA 3BUYB 3T0EC 1D5ZA 5EBMA 2QQLL 5AYUH 1LE5A 4OD3H 5DK3A 5IMMB 4Y4FB 4NQEE 1ES0A 4U1MA 4XNUH 3OHXB 1CGVA 1X5KA 3MLRH 4K94C 4NO0D 4QWWD 5A2IH 1KN4L 1UGNA 1UM6L 1R3HB 1FDLH 3ZT7A 3ULVH 2V7NA 4QCIB 1BIIA 3FKUS 1ZA3B 2VITB 5D7LA 1LEKB 3CLFL 3QDGD 4IMLA 4WFHD 5J13C 1SEBB 1DEEA 3MRIB 3HHRB 1TNNA 3UBXA 4YQXL 5I1CL 3P0GB 3RVVC 4F33B 5BQ7A 1XCQB 5CEZD 1A8JH 1GOGA 4ZAKC 3QXDA 5D1ZA 1UYWH 3PUCA 1NC4B 5ACZA 1MCRA 3TJEL 1NFDE 3QQ9D 3MLYL 4Q6IC 3NIDE 4LLUB 5F97E 4P57B 1CK0H 3IDXH 3T2QA 1CXFA 5JOFB 1IM9A 3T65A 5DUPH 3TVMD 1QVOA 3RU8L 3C5SA 4C56B 4J12A 1BZ7A 1Q9KB 2IAMA 1Q0XH 2F5BH 2DLFH 4U3HA 5H37H 1PYWA 2ATPB 3T0EA 4M6ML 3VWJD 1HHHB 4S1SH 1UJ3C 1WAAE 3HLAA 2A6JA 2OK0H 2R2HB 4JPIB 2X5PA 1ORQB 1WBYA 3WUWB 4MHHI 4HULB 2Z92B 3IFLH 1T6WA 3QEHA 3R06B 3W9DB 1A1MA 4HKXA 5C86A 4RZCA 1YECH 3U36A 2W0FB 1KB5H 4JO1L 4MA7L 1WJ3A 5FO9A 1HIML 2ICWA 3FB5A 5MHSE 3QHZH 3QIBD 3I3EA 4GAGH 2R1WA 4HIJB 3CFEB 2V5TA 3RGHA 3N06B 2WLZA 5MEPB 4P2YA 2ICCA 1VACA 1PEZA 3DROB 2W65B 4NHUA 1DEDA 2W0KA 1AGCB 5H94B 1SY6L 5TE7H 2XTLA 4KQ3H 3GSVA 3K8MA 1HQ4B 3P0VH 1G9NC 5FHAH 1VERA 3HE7B 4M6OL 4BZYA 4ZAKA 3BD3A 5ENWA 1MCKA 5DD6B 1CT8A 3VRJA 4PJXA 3VXTB 4GRLC 2VXUH 3WS3B 5KW9H 4X6BA 4Q6IA 3WFCH 2DQTH 1UM5H 2Z8RA 1FN4B 3OAYH 3ILQC 4UI2A 3VXQA 5FGCE 2AEPL 2UZXB 4RISL 5BOZG 3H9SE 5MI0C 1U42A 4FP8L 1FO0B 2IALB 4S0TD 2LABA 3LEVL 5IK3A 1UJ3A 3B2VH 3WKMH 1FNEA 3LKRB 1LO5A 3C6SB 4ZSOA 1CZ8H 5FB8B 4CRPA 2BVPB 5D2NC 3WFDL 5E7FA 4EBQL 2W9LA 4HUWB 1EV2E 3BKJL 1FNSL 3GNML 25C8L 5HYJD 2E7MA 5GSVA 5DC4B 5GS1C 3LKNA 4LSRH 3K4AA 4TSBL 1HZHL 3BT2L 5C0AD 3TNMA 2Y1VA 5J89A 4HX1A 3CGTA 1T21A 2GT9B 5GHWL 3F58H 2A38A 1BQSA 1Q1JL 3BZEB 1WZ1L 3IDJA 4NSKB 4QRPD 4QRRE 1FZKB 1K9TA 5EZJA 1HSBA 2B1AH 1QLFA 5C0BA 3VH8A 1EHLL 1B6UA 3QUMH 4WVRA 4OUUA 5DZNA 4KTYA 4ORGA 1QA9B 3DVIA 5BOPA 5EFIB 4XBEL 2BSSB 1RJZB 1KJ2A 2EDRA 2R39A 4HIHA 5A3IC 5A1AA 5KSUA 4G8GB 1EVUA 3BD5A 1KCRL 3WJJC 1I8KA 3PWJB 3V7AE 4OV5A 4HPOH 5T1KA 1RZGB 2FWOA 4LPXA 4Y4KB 1OQXA 2HFFA 1RZ7L 2QSCH 3F12B 4R6UA 1V3JA 3PL6D 5B39A 1OTSD 4BJLA 4EEEA 4NBYB 1EEZB 4Y19A 4LLMB 3BQUB 3UC0L 1IC4H 4NO3A 3VCLB 5I1EL 4N0CD 1L7IL 3DETC 3DWTA 4HJ0C 4PJXF 1Y6KR 4ZUUA 3IDGA 5HHMB 5DJ0A 5D2NA 1UH2A 1A9BA 3LH2H 1EFXA 1GC1H 3TF7C 3GO1L 2MPAH 4YBQC 5JQ6L 4I2XB 5ALCL 1RUKL 5IEKB 2DM7A 2IADB 1NBVH 4WFFE 1XGUA 3IETB 4HK3J 4PJ7B 3T08A 1A14L 3NCMA 3KPRA 2NW3B 4Y2OA 4YHNB 3WJLC 5INDB 3KPNA 2ENYA 1YN7B 3FONB 4GMTL 4K3JL 2BNRD 1EJ6A 4PJDB 2HMID 4HFWA 2H26A 1T5XA 3WO4B 5I1KH 3SJVA 3MODH 2Y23A 3F7PC 5HGHB 4FQCH 1HSAB 1LK3L 1QKZH 3K1DA 3LEXA 4OGZA 3WJJA 5E94B 5SWZE 2DB8A 2IG2L 3O3AB 2HKFL 5I8OH 4ODSH 1CL7L 2L7UA 3MV8D 3F6LA 1NDGA 5DEZA 2ZPKH 3RAJL 2AEWA 4G7YL 3WFZA 1RUAL 5C0FB 5K9JL 3CVHH 3DX7A 3MROB 1OT1A 2XN9D 1AXSA 2YC1A 2GUOA 4L5FL 2V2TA 5CIPB 1DN2A 1F97A 3ES6A 2PF6A 5F93C 1V7NH 3FN9A 5JIHA 3Q1SL 3RIFF 3EDDA 1DQDH 1KB9J 3PP4H 1QSFE 3T0AA 1IKFH 1RSFA 1BAFL 4P5KA 5HHOE 1R5IA 4WUUE 1JJUA 4JZOA 1NCCL 4XNYL 5IB1B 1U6AH 5I73B 1AQKL 2HKHH 2A83B 1RZ8B 4HXAL 3WJLA 2E27L 1RHHB 3TO2B 4F15C 5HYSA 4YFEA 5BVJA 4G9FD 2W38A 4JN2B 2JJSC 4QHNA 4QTHB 1X5YA 5FKPA 3TYFB 3MJ7B 1NAKL 3SGDI 2PTTA 4H8WL 1NMBL 4AZ8A 5KSVB 3P9WB 3QHFL 5BO1L 4MAYC 2VUYA 3GK8H 1ITBB 5C0EA 2AGJL 4MD4A 4HS6A 4RMVA 3V6OE 3RNQB 1UEMA 2H6PB 3VFVA 3VJ6B 3MO1B 1NLBH 4I0PB 2P42B 4BQCA 3EFFA 4UIMB 4M03A 2NLJA 1QFHA 1TJIL 1WCBA 15C8H 3NGBB 1FBIH 3B8YA 2EEDA 5L2JB 1M6OB 3O6FC 43C9B 4PJHA 3RGVD 4DZBB 2IQ9L 3SEPA 5I8KH 3T0WA 1CLCA 4X4XB 1D9KB 3ZTNL 3NFPB 1RUQH 4U2ZA 5CSZA 1WZKA 2ADIA 3WNPA 2AK1L 1FLRL 1IT9L 2E7CA 1EGJL 5I66B 4JFDA 1S5IH 4L4VA 2E3VA 4KH2A 4XP6L 4OQTA 1MY7A 4MNQD 4W4NA 4GT7A 2XZCL 4NQDA 4FZEL 4HT1H 1Q8MA 3VI4E 5JR1L 4MD0B 2FB4L 4J8RA 2RIKA 1P4BL 1QR1B 2JJSA 2ZUUA 4DKEH 1PBYA 4L8BB 3T77B 1GZPA 1G9EA 1XF5B 3O8XB 5JHDA 2C3VA 2V2WA 1F42A 3UJTL 1RY7B 3QDGE 3S37H 5GXBB 4MAYA 4HCRH 3S36X 4DUVA 5J1SC 1M71A 1EBPA 1B0RB 3NABL 3U46B 2DQGL 2YPLA 5D96B 1QBAA 4J7RA 4WWID 4LSPL 4QWWC 1UWEH 4GRWF 3HI5L 5BVPL 3EJJX 3JVGC 5DJCA 1SHMA 2D7MA 4N8VB 2VXQL 3IXTA 1IGTB 5BS0E 2DKMA 3O6FA 5DRWA 2HH0H 4OLXL 1J18A 2BNQD 1KG0A 1DUYB 4BKLB 1CFTA 1PKQE 2CJUH 3EYUH 2ADJA 1QNZH 3OKKB 4Y5XB 5I1DA 2IQAB 1KC5H 4H26B 3MLZH 2R69L 3GB7B 4AQOA 3RNKA 1YPZE 4YPJA 4ODXB 3S34H 3FTGA 1IEHA 2G75A 2A74B 4PJHF 3QQ9C 3PWPB 2N7BA 5EBLA 3ZL4L 3C09B 3OKNA 2DMKA 5TDOA 3S96B 3TVMC 1E4WH 5D2LE 2VE6A 5DA4A 3T4YB 4BZ1H 4CU7A 1VPOH 3BO8A 5E56A 5MEND 4HHAB 2AABH 4HUMB 1TVHB 3NVQA 4WWKB 1J1PL 1J0IA 4NHCH 3ARFD 5FKAA 3HCVB 4KK9D 5LWYL 4NO0A 4NQXA 1WWBX 1I4FB 1CFVH 3QRGL 3JVGA 2WBWB 4W81A 3AVEA 5C07A 3KJ4B 3JXAA 3IAGC 3QIBC 1U8MA 3ISWA 1AKJA 1ZHLA 4HS8H 5J6GA 4DGIH 2W9DL 2VDOL 3O6LL 3DV6A 2Z93A 3BPNC 5EZIH 5FYKD 5GRZA 1EFQA 3J7HA 5IB5A 2IBZY 1OAKL 1FFPA 1RJLA 4PTTA 3GUTB 2RCSL 1A2YA 4UV4H 4WCYL 4X5XA 4L3ED 3P0YL 1MQ8A 4Y16B 1OSZA 2W60B 2A77H 2VZUA 3P4OA 2OTUA 4LVOC 1L7TL 4N0YL 3U7YH 5KVEL 2YD8A 2D0HA 3CDCA 1Q94A 4G7VL 4M5YL 1L4IA 3QFJB 4XNXL 4JPVL 3TVMA 4DGVL 3P30L 1ETZB 4ZNEE 1RUPH 2IANE 5IT2H 2HN7A 4KHTL 1OD7A 3EDEA 4J23A 4OZFG 5DVLA 1GGIL 2DD8L 3QISA 4YO0A 3BD4A 1II4E 3UBXI 1KN2L 1I1FB 2H1PL 3H3BC 4U1NA 3WN5C 4K23H 4M8QA 3B6SB 3Q2CA 2VH5H 3UMTA 3MRDA 4R7NA 4JFQB 4PJCE 4JREB 2QQKH 3KLAB 3PJSA 3QIBA 4TVPH 1TJGL 2R0LH 1NAMH 4XCCH 4K71B 1UZ6E 1HE7A 1T4KB 3S6CA 3TH4T 3BN9D 4X4ZA 5B38G 1P53A 3STBA 4J3UA 3SKJL 3DUUA 2J6EH 3DGGB 2GJJA 3PWVA 4RGOL 5EWIL 1JPTL 3GZKA 5F9AC 3SPVA 2ZSWA 4QKXB 2DYPA 1FJ1A 3SE8H 4BSWA 1HH6B 3BPOB 3N0PB 1CDCA 3EIFA 2DQFA 3SKOB 3QH3B 1Y0LB 2ZG1A 1NFIB 1P1ZB 1FNGB 1ORSA 2F8XC 2K9UA 3QA3A 3WN5A 1OOAA 5KSBB 4X7TA 1I7UB 3HNTH 4IMKC 2I9LB 1A1NB 3SDCB 4XBGB 2JJWA 4PUBH 3CFKB 5TPWL 2ZCHH 5DMIH 5EORL 2BK8A 5C0AA 1XIWD 1G6RA 1IL1A 1HHJB 2OS7A 4JZJB 4P48A 1Q0YH 4KROD 4UTAL 1AD0A 4NNYB 3MV8E 4QRPA 4MAUH 1A6UH 1I1RA 2VZ3A 3QNYA 4X6CB 3EOYG 4L4TA 4YZFF 2IPKA 1D6EA 2ADFH 4PPTA 2V5SA 1FIGH 5DD3H 4Z5RB 2CDFA 1BZ9B 3B5TA 5L2KD 2H32H 4OCWH 2CKBH 4U1KB 4HF5H 4YHYB 1CU4L 2E5EA 4OIAA 2C4XA 5EB9A 3BH8A 2FBOJ 4ODVL 4XMLL 2X1XR 2Y6SD 3ZYJA 1X5FA 2WW8A 4H5SB 2V9TA 4LSVL 3MJGX 5CJ5A 4NRZB 5FYJE 3MBXL 2WNGA 4N90D 4QYOA 3LQMA 4NO2B 4NC1C 3MV7E 2GTWA 4FS0A 4G9FE 4JFZL 5FM8A 4IMKA 2OQJA 4GS7B 3SDDC 1KBGL 2Y06H 3ARWA 1IM3A 1BOGB 4JQXC 5J56B 3RDTB 4X7FC 2R56H 3HPLA 2I9TA 1J05A 5E2WL 3SDAB 4UIKL 1JF1A 2WBKA 4XCYA 4F7TB 4HWZB 4KMLB 2X7LB 3OXSB 3UO1L 3QR2A 3CCHB 3QQ4B 2P5ED 1N59A 2BNRA 2Y5EA 4Y1AB 4U6HB 1A7RH 3SGJC 3LSOA 4EQ2A 3MUGA 4OBSA 2YBRA 3QJFA 3QO1A 3IFPB 3NIGE 1JWUA 3UAJD 5B3JF 3MNVA 3OX8A 5D7IA 5BXFA 4RMRA 5SWSD 4UB0L 3WXWL 5IVXE 2YA2A 5FM5M 2DQCH 1YJDC 2XN9A 3EJYC 3RGVC 5C0IA 1KEGL 3HE6D 3F65A 4DVRL 2VDRL 1FORH 5E08L 1M7DA 1BFVH 3OQ3B 4OKVA 5ANMB 5CMAA 4QHLA 5HY9B 3SDDA 1EJOL 4FQQA 4JQXA 4MSWA 3CX2A 3H42L 2UWEA 2XZAL 3MGAA 2GSIA 1MFDH 2X4TB 4OD2B 4U1HA 1YY8A 3EYFB 4LLQA 5CUSH 1SEQH 2CLZA 4NT6B 5ESAA 4TQEH 5B3NA 1INEH 5CLWA 4XT1C 5M94B 4RAUA 4MXQD 3KPSB 2XI9A 3SGJA 4N1CA 1T7ZA 4TUOA 1DN0A 5EC1B 1KEML 5FYLL 3U7WH 4ZUSB 3CX5K 4YXKL 3JV4A 3O4LE 4OLEA 1NMAH 2BNQE 5EOTB 1JNNL 2BJMH 2RR3A 1KLUB 3A6CH 1C16B 1KENH 5E9DA 3TBWB 4Z7UA 1JGEB 5CAYB 4D9RE 4D0CA 1J1OH 2ZUXA 3KYNB 4JKMA 4CMHC 5E8DL 1FZMA 2NY4D 5IIEB 4GG6E 4V2CB 3EO1B 4NZRL 1IGYA 3DXAB 2E8ZA 3RGVA 1KPVB 1IGCL 2V7HB 2NY6D 5F8RC 2F19H 3SOBH 5BZDB 2DTSA 3F6IA 4OLUL 5KZCD 1CG9B 1KLGA 3G04B 3MGOA 3DIFA 4PJGA 3WNNA 2NY0B 1AH1A 3HUJA 1QRND 4IM8A 4I8DA 2LTQC 2VDLL 4K8RD 5D7IF 1R3IH 2FX7L 5F6HJ 4OCMC 4M7KH 5MENE 2Q7YA 1FVEB 4HJGA 4R2GB 5GZNC 5JZ7D 1RZKH 4PRIE 3UPCA 3OKMA 4ZPTA 2ORBL 3P73B 2AJZA 3L9RA 5T1LD 3BWUC 4MNQA 3MJ8B 1TZGH 1V3LA 2AXGA 3EOAA 4M4PA 4KAQH 3TESA 1Q9OA 3WFEH 2IEPA 3RWEA 4JKPH 1TTGA 3O81A 3Q0HA 1B9ZA 3HPJB 2VDKL 1W72A 1UQSA 1TPXC 2EDWA 4X5LA 2AEQH 3FO2B 3FMGH 4HUNB 3TFKD 3V6FA 2AV7B 2AXJA 3ARGD 1K4DB 3T8XA 2UWEF 3I6KB 4XVTL 3ARFC 4ODHH 4JFXA 4DTGL 4RIRA 3EBAA 4UU9B 2BOBB 4M1CD 1MHCA 3WEXA 2SEBB 2YD2A 3VFMA 1HWHB 3VFTB 3DPBA 2UYLB 3BGFC 5FK9A 2OTWB 1J5OH 4LDOB 4L3EE 2R4RH 2GJ6A 1AXTL 1I8IB 1RZJH 2LQRA 2X70B 4YQXH 5I1CH 4GKZB 2OCFD 3VD5A 1S7SB 4IJ3C 2VQUA 2PW1A 1F4AA 3QIUC 1MEXL 2R0WL 4GBXD 4Y5VB 1G0DA 3SBWC 4NWUL 4Z7UF 4P4KB 4Y0GA 1E6JH 5E1AB 3L95B 1B0GB 2Q76B 2AJ3B 1XGRA 5L6YH 3G9AB 4OGXL 4GW4B 1LE9B 3LS4H 3C8HA 5FCUL 4OZHB 4GLRI 3LQAL 3BIBX 2BVQA 3EYVB 1I9RL 3ARUA 4I0KA 3WLWD 4DEPC 4PJGF 1MQKH 1U8PB 3HUJF 5CEXA 2J4WL 1MNUL 3X12A 4AENB 5T1MA 3L5HA 4EUPG 1UCBL 2DOCA 5IBUG 1HIMH 3V4UL 2BRQA 4H20L 1F4XH 3ARFA 4X0KA 5C6TL 5MEQB 4N0UE 3MZTA 5IV2B 4ERSL 4JFFB 1LILA 4J1UA 4Z7WA 2VISB 1B6DA 4EOWL 1D6VH 1BIHA 3C8KB 5LKNA 3RUGE 1INQB 1Z0MA 4JRYE 3FRPA 2V17H 3MMEA 1N6UA 1I3GL 1MJJB 4OCNC 1W8OA 1X5ZA 3L3KA 1A7QL 3M8OH 4RWHA 4HWUA 1GGUA 2NCMA 4JANA 5TF0A 4LGSB 5ICYA 1MF2H 3PXJA 2XQBL 3QIUA 1SVZA 1D5XA 3VRLF 4KUZL 2VIRB 4HAGA 3G5ZB 2VLJE 3TBSB 3SBWA 1N5AA 4L9LB 2R2CA 5ALBH 3REWA 2CPCA 4WHYH 2J8UA 5ETUA 5T3ZL 1A6VL 1OPGL 2OMBA 3CDYA 1K5NA 3VD9A 1ZGLA 4D9QE 1I9JH 5DDHA 2FIKB 1I1YB 4Z77B 1BFOB 4XHQA 4X4YA 4RISH 2GYSA 3HNVL 3LN9A 4S2SA 3A6OA 1FYTB 1NBYB 1NGQH 5EU5B 2YD4A 3NCJL 1I7ZB 2DAVA 4MS8C 4HWBH 4CVZB 3T0VA 1MIMH 3DX6B 4JFEE 1QSZA 4NM8H 5D8JH 2HT2D 4JQIL 2P5WB 4NZDA 6FABL 3JWDL 1L0QA 4LBEB 4YK4C 1NMCC 2FR4A 3GNMH 5GJSH 3WS6A 3IDYC 4P23B 4MMZC 3GJEA 4JY6A 4ZUVB 3GSUA 1V05A 4GSDL 3QNZA 1MFCH 4KZDL 3KPOB 3IFNL 4ELMB 3VFPB 5L2KE 1U8LB 4F7CB 1MREH 1NJ9B 5EO1B 1A47A 5EUKB 4E0RA 4KJQD 1K8DA 1KT2A 3QI9B 5I8CB 2G5RA 3QG6B 3HS0B 1ZWIA 1EHLH 3MOAL 2ZSVA 3GSXB 3QNXB 1ZK9A 2A0LC 2QQNL 4BH7A 3FQTA 3OL2A 4RMSA 5H8DA 1EAPB 1XGPB 3HRPA 2JF1A 5DEGA 4Z7WF 2CQVA 2WINB 1TCRA 4HC1H 4GAJL 4FQXD 3AGVA 4XC3L 1R5WA 1S7QA 3HG1D 3TZVD 1DL7H 1XGTB 3BP4B 2GCYB 4X8JB 1GGCH 1PDKA 4E5XB 4XWOD 3DUSA 5J8OA 4DVBA 2Y6SC 4OFVA 1G7MA 5FUCC 1P7QD 3L5WB 2R23A 3RWCB 4JKLA 3WFHB 1GAFH 4E42B 2J8UF 3CFBB 1H3XA 4A6YL 3V52H 2AXFA 5KJRH 4ZFOA 3GO1H 4G6ML 4LKCA 3GBML 3FZUD 3M1BB 1NGPL 5DK2A 3B9KB 4PIRF 5HBBA 3FFCD 5LVEA 3GMOA 5DJ6A 3VG0L 2GSGA 3MYZA 3SHSA 2HJFB 4O2FA 1J88A 1T7VA 4OB5L 4OI7A 2EDYA 1SYSB 5C2BH 5D1QB 4LIQL 3T2NL 1JRHL 3VI3F 5B21A 1TZIB 1MAMH 3PHOA 2VWEC 4EXPX 5KG9A 3VFNA 3PABA 3MLTA 5FV1L 3SDXE 5SWSE 3CFJA 4PJEE 2EXWC 4FQHA 2WP3O 2YR3A 1PJ9A 1LP9B 1MCNA 5DJXA 1RZIA 3OXRB 5DTFA 1BQLL 1L0XA 4XXDB 2PO6D 5GGUB 4PB9H 4JB9L 3QPQD 1MCJA 4MQ7B 3C08H 4Z0BH 1I3RB 2A6IB 5F88B 5FA4B 1G1YA 1IEBB 4V1DB 1K4CA 5IEHA 4OZ4A 4DN4H 4R96A 3NCEB 3HE6C 1MHPL 1X5GA 1R3LA 1OF2B 2A73A 1J7VR 5HHVH 2APTA 3I3DA 1T2QL 3OZ9H 1C5BH 3KYKL 4Z7QF 5CJQL 3L3JA 3LB6D 3M45A 2XG4A 4XCFH 3L1OL 1AQKH 2D7QA 2WQRA 3RRQA 4PV8B 3AAZA 4ZFZA 3IDMB 5DGRA 2E9JA 3DYOA 4Y4FA 1DJSA 2UY6A 5I30L 4ACPA 4H0GA 2DDQH 2F9BT 5CHNA 2GJZA 1HOCB 5F8QC 2P8MB 2QHRL 3P77B 1NMBH 2DWEA 5C7XL 3LDBB 2VAAA 4TPRH 2P5EA 1HQRB 1U8NB 3S7GA 4C4KT 1UACL 4PYHA 4K3GA 4KJYB 1L6ZA 1KIPA 1SEBA 1VKXA 4EDXB 3F7VB 4G8IA 3PHQA 1BREA 4GKNA 4BELD 1DBBH 4ONFH 1I9IL 3HN3A 2RFXB 3W39B 3DRTA 1PFCA 5INCB 3ZDZE 4PRAB 1WEJL 4GRMB 4PJ9B 1YEEL 1ZXQA 4K94L 5F72S 1OAUL 3UTZA 2CRYA 1UZ8B 3T3MF 2A9MH 1R6VA 3B5GA 3HE6A 3STZB 4F7PA 5CP3H 3IXAB 3ZKXB 4KY1L 1G7LB 3D39A 4PGEB 4RGNB 3NPSB 4WDIB 2NY2D 3KPPB 4XX1G 1VFBB 3EOBB 4ZD3H 5DJDA 2JCCE 3B3IB 5GQBA 5IFAH 5I1HL 2X1PA 5JR1H 3OKOB 2IPTL 4O58H 4QHUA 4OQ1A 4H0HB 3D2UD 1MFEH 4E41D 2GITB 1JMXA 1OAZH 3VXUE 3UJTH 4L8CB 4M00A 1MCPL 4F3FA 1MCCA 4HG4K 3TV3H 3VGAB 1YEIL 2DL9A 4N8CH 4NC0B 4XMKH 4PV9B 4LFHG 2KBGA 3MRMB 3RWJA 2W9EL 3KDMB 5C3LD 3NABH 4JDZB 4X9GA 4YBLB 4H88L 3ARDD 3MV01 3BYYA 2ESVD 1G0XA 2IH3B 2XPGA 3ARGC 3HI5H 4J3SA 4JVPA 5KS9B 1YEHH 1ZLUK 1XGYH 1Z6JT 1BM3H 1MVUA 4M1CC 5CILL 2GTZB 3OGOE 2VXVL 1SBSH 3BPCB 1FFNA 3B43A 2WUBH 3E6HA 3SCMD 2EH7H 3EW3B 4X7SL 3LKSA 1MWAH 3OR7A 5DURD 3MUY1 1P4LB 1CE6B 5E00A 5FUOL 1F6AA 4FFZL 3DV4A 3H6JA 3F7RA 4YIQA 3C6LB 3KJ6L 4UDUB 5FYKU 4KGJA 3H3PH 4GBXC 1N4XL 4WI6A 1QRNA 3MJ9A 2GK0B 4LVHC 3X11A 3BH9A 2W1NA 1DQJA 1CXHA 2P45B 4KPHH 4MA1B 1ZAGA 3OTTA 3O6KH 5EO0A 4NPYA 5L88L 3D69B 1FZJB 4G43B 1G9NL 4HUWA 3DHJA 1KJ2L 1MUJB 2XRAH 5AYQA 3VWKB 4KKLD 4YWGL 4OFIA 4EVNA 4UNVA 2ITDA 3GHEL 3WLWC 5K9OB 4D9LH 5DWUL 5IBLD 3C87A 3D18A 3MCLL 1C12B 2GT9A 2RHEA 4QRSA 1V7ML 5J6HB 1AFVL 5EA0L 4L3CA 2X6MA 1H3GA 4LCWD 1ZHBB 3LKOB 4LPCA 4PR5B 3NA9L 1CR9H 5GSRB 3SKUD 3ARGA 2AK4B 2EIEA 3QEQB 4P0DA 2RGSA 2P48B 4ZFFB 3F5WB 1MI5E 4RAHA 3VU2A 1QO3A 4L4VE 2B5IB 1P7KA 3GSNA 5J12B 5CZVL 2VDOH 2VDNL 3T3PE 1T1YA 3LN5B 5F7DB 3IJYB 3N9GH 2RQ8A 1YMMD 1QFWM 2C3GA 2BVOB 5HGDB 1ND0A 1RZGA 4YJZL 4NWTL 5LAXB 3KWWA 4OM1H 2O5XH 3FB7B 2UV3A 3VXNB 4Q2ZA 1BBDL 2PXYD 5LGHL 4WFGE 3ULVD 4GBXA 2RCSH 4WCYH 4MJIE 4P2RB 1A9EA 5A2KH 2PKDA 1CGWA 5H35B 4DN3H 4KJPC 1S7VB 3TA3D 1E28B 3CH8A 2NY1D 2QADB 2Z0BA 1N7MH 4LCYB 4XNQB 4HIEA 3OV6A 4DGYL 5DRZB 4DGVH 1BD2B 1WC7A 3L5IA 5KVDH 1T6VN 4PRNB 1CDYA 1IQDA 4PBVC 5BJTB 2LE9A 5T3XL 1TETL 1Y18A 1C8PA 3KNBB 3HI6L 3O2DA 5FIEA 1AD9A 3HZVA 2VC2L 5AWNL 3G9VA 1N6QL 4OLYL 1EHAA 2HT2C 2VLLA 4NQCB 5LBSH 3AS3A 2AJXL 5ID0A 4WUKL 3VFWB 3H3KA 1VFMA 2HRPH 1G7QA 2VDMH 2WBJB 1WV7T 4QLRA 5E03A 4AL8H 8FABA 3C9NB 3DO7A 5FDWA 4G3YL 2E9WA 3PGDA 3VXRD 4F57H 4GUPB 4CW1B 1FPTL 4PJ8D 3RL2A 4PJFB 1ZLSL 1MPAH 3TIEB 3OB0H 2HWZH 4K9EL 2WP3T 4APQD 5K33A 3HG1E 3IU3A 2E6JA 2YXFA 3L3HA 4RBPK 4BA8A 4O9HL 4PRIB 1KXVC 5IR1A 4RGOH 5E2UL 1JPTH 4M9PA 5C0RL 4MX7A 2CKNA 5C0FA 3FQXB 1S9KC 1FC1A 4NCDA 1NGXA 4I3SH 2LAGB 2FGWL 3P9LB 1WT5A 2NY5C 1VESA 3C60C 4FQXC 3IKCA 4OKDA 1NGWA 4JGUA 2ED9A 3TZVC 3FO0H 3DRQB 1PY9A 43CAB 3CFDA 4NC2B 5FM4A 5C07E 4ZYKB 4YAQB 5KVGL 1H9VA 1QYGH 4I0CC 2XXCB 2X4OB 3IJSB 5T1DH 3V0WL 2H45A 3FQRB 1QLEH 3SY0A 2EDBA 5IF0A 1A7OL 2FNBA 3MRLA 4R8WL 4DZ8B 5IB3B 4RFEA 3ETBF 2C3XA 2X1WL 3UZVB 1KGCD 4QXWA 5E8EA 1R5VB 3OAZH 1OAYH 2NX5A 5F7WC 1B2WL 4QO1A 5ISZD 2PYFB 3MBEB 3GKZA 12E8H 1AGFB 3QZWG 1EBAA 3C5ZD 4LPVA 4BZ2L 4HBCH 4JRXD 5F1KC 2H6PA 4FQIL 4TULL 4LVNB 3U2SB 5HGAA 3Q6GH 4OQTL 3RPIA 5D7KD 5LGJA 5FECA 2IMMA 2XKNA 4UAOC 1JGVL 5IG7A 5L2JA 5TQ0L 2Y7QB 2F54B 4YNYB 2XICA 4WHDA 5FDYA 4A6YB 3THMH 1DANU 3IGAB 4AH2A 1IAOA 3EOTH 3C60A 4FQXA 4ODVH 4U0RB 5DLML 3O3EA 3B4NA 3TZVA 3PV7A 4UILH 4EN3D 3QPQC 5DRNA 3C2AL 2GK2A 3ROOA 4C59B 1GPOL 2AW2A 4P2OB 1NEZG 4K7PH 1U8OB 3MRJB 1WWWX 3INUH 5EPMB 1FLTX 5ABDE 5CZKA 4L1HA 4S1DD 1FVCA 1UFUA 4BQ8A 4PRPA 1CE1L 3BMVA 3NH7L 3ALPA 3GJFB 1A02N 3I9GL 2L7JA 1XZ0A 3Q6FA 4JM2D 3EHBD 1Z9SA 3MCKB 4L8BA 4OJFH 4LCUB 4DFHA 1GZQA 5I19L 2C3HA 4WO4D 1E27B 1A7PL 2CIIA 1KJ3L 3IDUA 4I9WD 4P2QD 3WXVH 4PJ5B 4TNWK 5HVHC 1INDL 4JHWL 1LGVA 5IW3A 4UOW1 1G7JB 4TSAH 3GSRA 3ZT6A 3PQYB 2BMKB 1LK2A 3WHXB 3IRPX 3VXSD 4EZMA 1D5ZB 5EBMB 4LLAA 3OMZA 1LE5B 5IP4A 2UVFA 1T83C 4J3VA 3WIHA 2DQDL 1ES0B 4U1MB 4R97C 1AP2A 1BWWA 3IFOA 2V7NB 1BIIB 3JV6A 1Q72L 5D5ME 3ULUD 3VXME 4YHKL 5D7LB 3A0OA 1VEOA 2DIBA 4IMLB 4MB3A 1DEEB 2DQJL 1G9MC 1Y6NR 1JF6A 1MOEA 1L9NA 5EOQL 4XMPL 5BQ7B 3T1WA 3ZTJH 5DHVA 1T0NA 4JZNA 2LU3A 5DZOA 1B4JL 4IEFB 3E6FB 3QXDB 5D1ZB 4PGBA 4E41E 3R4DA 1RK0B 1J0JA 4KRPD 4MWFA 1WBZA 1RV6X 5ACZB 2MCPH 2NY2C 5ADPL 1PX3A 1MJ8L 4NBXB 3CLEL 5C0DB 3T65B 1C5CL 2OMNA 1JE6A 1QVOB 3C5SB 1OP3H 1BZ7B 4NKQB 5EUOE 2ESVE 4WWKA 3LEYL 2IAMB 4OGYH 1O0VA 1PYWB 3T0EB 1HHIA 2A6JB 3HLAB 4TUKH 1DUZA 5CEZL 1A4KA 1F3DH 1WBYB 3CK0L 1PAMA 1T83A 2J3SA 3QEGL 3QEHB 4HKXB 4RZCB 3FT2A 2Z4QA 2DBJA 4KUCF 2EXYD 4K7FB 5FO9B 1JNNH 2CMRH 2I5YH 2ICWB 2GIYA 3QBTB 3T0DA 1LDSA 3FB5B 1B0WA 3RBGA 4MLIA 4YEFA 1NSNH 3ARDC 4TN9A 2R1WB 4KQ4L 2NYYD 1SBBA 5IGXL 5J13B 1VACB 4NHUB 3TWCH 5E8DH 4JPWH 3KYOA 5GGVL 1ACYL 4MJ6A 3GM0A 3ZKMD 3SCMC 4M7JL 3QCTH 4W70A 1CN4A 3GSVB 1KELL 4OLUH 3E3QC 4L8SC 4CNIA 4MXVF 4LRIC 2W60A 5DJZA 3UTSE 4ZAKB 5ENWB 3UTTA 5FHBL 1CT8B 5FYJH 3VRJB 3D9AH 4PJXB 5B4MD 1RUMH 2VDLH 1AXIB 3RWIA 3QFJA 4X6BB 4JLRA 4Q6IB 4X6DE 1OWRM 3O3UN 4HQQL 1XF3B 2Y36L 3IJHA 3VXQB 3TN0D 1QD0A 3H0TB 3CPLB 4LCWE 2L0DA 4NZUH 3D3VD 4WU7A 5IK3B 1UJ3B 5DK0A 4LSQL 3TBTA 4RFNC 1KACB 3K3QA 4GXUM 1LO5B 3H7BB 2D0GA 4ZSOB 4KKLC 3GSOA 4B41A 1EK3A 3B2UD 1JV5B 3KLAA 2IFGA 2Q8BL 5E2VH 3GEWB 4F2MA 2MHAB 4UT9L 5IBLC 5GSVB 3ARDA 2QJDA 5ITFA 1Z0NA 1EEYA 3B9AA 3TNMB 1DDHA 1IBGL 1CLZH 3V7AG 1RQ5A 4HX1B 2IBGA 3Q48A 5E2JA 1T21B 1D5BA 5DZLA 5GIRB 4M4RA 5D6DC 1A6ZA 3CU1A 1YEGH 4CL7A 3RY5A 3IDJB 5EZJB 3L7EA 2OBGA 3GM8A 3SCMA 1QLFB 5C0BB 3VH8B 4DAGL 1X4ZA 2YA0A 4OUUB 4QXGH 3BE1H 5F44A 3FFDA 4LRIA 1VGEH 4ORGB 1BJ1H 4R9HA 3RTQD 1JCKA 1KJ2B 3O2VH 3RX5A 3NPZB 1O5DT 4HIHB 1OGAD 5KSUB 1NH6A 1LVEA 1G7HA 4GRLB 4Z0XA 1G6RL 1I8KB 3ULVC 1EMTH 1OB1A 1PEWA 4OV5B 1RFDL 2FWOB 5IESH 3BKCL 2ZP0T 4OZGA 2HFFB 1X4XA 4ZUWA 4OGXH 3TA3C 3BJ91 2D4FA 1YEFL 3WFBL 1FAIH 5B39B 4ZQKA 5MI0B 4G6AD 1CGUA 4Y19B 2Z9TA 1YNTA 5TE4H 1Q9LA 4HWEH 1I9RH 4OCXL 3G6DL 4ISVA 4NO3B 1MCFA 5I1GH 3CU7A 4ZUUB 3I2CH 3IDGB 5JOEA 5DJ0B 5D2NB 4Q0XL 5I18L 4M5ZL 4AQ1B 1A9BB 4KVCL 2V2XA 1EFXB 4HMDA 4H20H 5GS1B 1V3KA 3NTCL 3D85B 4YXHL 5DUML 3RKDD 3SGDH 4FQJL 3U0WL 4PG9A 1BVLB 3QDMA 1GGBL 2BVYA 1F2XK 1SJEA 3KPRB 5D6DA 3N85L 4KRMB 2VYRE 3WDIA 3KPNB 1MELA 1IFHL 3EGSA 3EYSH 5JUEL 3IAQA 1KTKE 4G8EA 4PJ8C 4HFWB 1RU9L 1ZT4A 2H26B 1T5XB 2W0LA 4LLYA 1QFOA 5IJVA 1YMMA 4APQC 3SJVB 3IS1X 1VEPA 4RWYL 1YQVL 5J57B 3LEXB 2N7AA 3PV6A 4C56D 2GKIA 5CS7A 3I6GA 2YS4A 1CGSL 1J1XH 1BGXL 2JB6A 3NIFF 5D72H 2H9GA 1NDGB 2DI9A 3TA3A 4P99A 2DQHL 4NO2A 3DX7B 2D03L 1AXSB 3VRLE 2YC1B 3HNVH 1G0YR 2GUOB 4XCNA 1FC2D 1IMHC 2XTJC 5DF0A 2V2TB 1KGCE 3NCJH 3OG6B 4HFUH 4FNLL 4HZLA 3O2WL 3ES6B 3MRCA 3QUXD 3WCYA 1VFAA 5ISZE 1R0AH 2WAHA 3TCXA 1WUNT 1RIVL 4HXBL 3WE6A 2VZVA 2J5LC 1HI6A 1NC2A 1KLFA 4JRXE 4OZGF 1EUTA 3DO3A 2MQ3A 2X7LA 4O02L 4KV5E 4NJAL 3S3PA 3ARED 4P5KB 3FAXA 1R5IB 3GI9L 4M61B 4JZOB 2HFGL 4U1SA 3FQUA 1EAJA 3VD4A 1D7FA 4GRWB 2UZIH 1KOAA 2XZQL 4NM4L 5FYKH 3HR5A 2FX8H 5HYSB 4I5BA 2AKRB 4H1LH 5BVJB 4QHNB 2IBZX 1A7BA 3GMNA 4YHZL 2ENSA 4PJ8A 3FRUA 3C5ZC 3HB3D 3LIZL 4HIXL 5HHNA 4APQA 3UDWC 3HAEH 5C0EB 4UV7L 4MD4B 5C08D 3X3GL 4HS6B 1VHPA 2IPUG 1LO2L 3O4OC 1M7XA 35C8L 3VW3H 1J8HE 2F58H 3LV3A 1QFUL 3VFVB 2DLGA 4LQFL 2YK1H 3EFFB 2NW2A 2NLJB 3WD5H 1HILA 4XGZB 5JW5A 1FG2A 4HV8A 5SX4I 1WCBB 1BOYA 1C08A 3UTPD 1T04A 2O5YH 4TTDD 4PJHB 3MFGB 3I85A 3CMOL 5D9SA 1OM3L 1T03H 4IOIA 4P2QE 4OLWL 2V9QA 3NFNA 1KYOJ 1RJYA 5CSZB 2ADIB 4J6RL 4HJJH 2UZYB 1U2CA 3ULVF 2X4TA 5HGBA 1JHLL 4JFDB 4S1DC 3ARVA 4JFYA 2BRRL 1A6WL 4NT6A 5BRZD 1YJDL 5EU3A 3EHBC 5ERWA 3ZHLA 2WMPA 4JDTH 4K3DH 4NQDB 3KPSA 4WTWA 1E6OL 2OR7A 4JJ5B 4EDWH 4J8RB 5C09A 4F15B 3SKNB 2J8UE 4G5ZH 3V4VL 3ULUE 4MNGA 3B9VA 2B2XH 5EOTA 2GFBB 1GZPB 2IFFL 4G8GD 1CLOL 2H41A 5JHDB 2C3VB 2V2WB 3C5ZA 5GGTH 2EECA 4JRWA 3S4SG 4MAYB 3UDWA 2MMXA 3QEUA 2ED8A 4OCRL 1JGEA 4XWGL 1M71B 3RWGA 4HKBA 5DJYA 4YHML 4LU5H 4FMFA 2QEJA 3SO3C 1U8JA 1GC1C 2YPLB 4JEGB 4JY5L 1DQQA 5IIEA 2VLKD 4FTVD 1A22B 3BQUD 3DXAA 2LV4A 1KPVA 3OG4B 5DJCB 5BZDA 3KXFE 4ORZC 3WL9A 3IXTB 3EYQD 4JB9H 1CG9A 1DLFH 5ACMA 2XXMB 3O6FB 5DRWB 4Z8FL 5HYIA 2F5AH 5DMJB 1VDGA 1I9EA 4IHOA 4WI4A 3H9HA 1J87A 4GFTB 1KG0B 2NTFA 1CBVL 4OTXL 3G5YA 1CFTB 3QUMA 1FVEA 2VQTA 1JGUL 2ZZUT 4FHBD 2ADJB 3CVIH 4OLZH 3UXFA 3IU4H 2AJVL 5I1DB 1ZVSA 4RX4D 5TDPA 2LFGA 3RVXC 3D0LA 3MUJA 1AI1L 3O3BA 1A7NL 3RNKB 3ZE2E 3BGMA 3HPJA 1QSVA 5KOMC 3SE9L 1DBKL 5AZEL 3FTGB 2G75B 1Z3GH 3FO2A 3L3IA 4GW5A 4LAQL 1ZEAH 5EBLB 1MCWM 4KTDH 5KANG 3OKNB 1XF4A 4GXVL 2B0SH 3HRZB 4HSQA 3I6KA 1JN6A 4X98A 1RAMA 5GISH 3BO8B 2ICWJ 3UPRA 3VXSA 1HCVA 1DBAL 2DL2A 5FKAB 3AFLA 4Q7DA 5HDLA 1RJCA 4NO0B 4NQXB 5FOJA 1QSED 3V4PH 1YEDA 2EXYC 4PJAA 5C07B 5E8OA 5AZ2L 2XOTA 1I9IH 5DD0H 3HMXH 1U8MB 1YZZA 1AKJB 1ZHLB 2NYYC 5J6GB 1U8QB 5F1IB 1WEJH 4NJ9L 4URTB 2YKLL 3DV6B 2J8HA 4LGPB 4L8DA 2Z93B 3E0GA 4MD5B 5J3HC 4OSUL 3HFML 2VB5A 5IB5B 3ZKMC 1U41A 3FQNA 1IILE 2R0KL 4LFHD 1RJLB 1LE9A 4QNPE 4FXGA 5D4QA 4PTTB 1EERB 1EHNA 3K80A 4X5XB 1FNLA 1AE6L 3EYVA 5B4MC 1N0XL 4MA8L 2COQA 1OSZB 3P4OB 2OTUB 2PYEE 5ID1A 2QLVB 3QUZD 1AHWC 1YNKH 1Q94B 3CVHA 1YC8A 2VR4A 1IAIH 2EO1A 3TN0C 3TVMB 2HN7B 4PRHD 1JNLH 4Q9QL 5CINL 4I0PD